4HREE

Crystal structure of p11/annexin a2 heterotetramer in complex with smarca3 peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
b'PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Annexin A2
molecule tags Calcium-binding protein
source organism Mus musculus
publication title SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
pubmed doi rcsb
total genus 23
structure length 91
sequence length 91
chains with identical sequence F, I, J
ec nomenclature
pdb deposition date 2012-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4hreE00
1UUSA 1ZMZA 4N1GA 1M63B 1G4YR 2HETA 1B47A 1EH2A 2R2IA 1JBAA 1QIWA 1L2OB 3I5GC 1YRUB 3CR2A 3EVUA 1TRFA 1S5GZ 2WC8A 3ICBA 1XFYO 1CDNA 5IBWA 1NX1A 2NCOA 3D10A 1YRTB 4MLWA 1EXRA 3NSLA 5D7FA 2K7CA 2LCPA 3VRQA 1GJYA 4N1FA 4Q04A 4D1EA 1J7PA 3PATA 4U8DA 4YRUA 3LL8B 2LM5A 2M9GA 1XK4C 1CM4A 5AXIA 4PHMA 1MHOA 3GK1A 4ORAB 4N5XA 1QJTA 5AERA 2KYFA 2M3WA 5KSZA 3BUWB 2MA2A 2Y5IA 3D0YA 1Q80A 1KSOA 3TUYB 1KQMC 3I5FB 2KYCA 5DKRA 3DVEA 3E3RA 1OMRA 1KWOC 1KFUS 1S36A 1HQVA 2LMUA 3SG2A 1CTRA 1K2HA 1SCVA 2CNPA 2MJWB 4YBHB 1GGZA 1K95A 2M0RA 3KO0A 2K2AA 3I5HC 1QLKA 4AQIA 5AEQA 1DF0A 1DJZA 1SY9A 2BE4A 2PMYA 3BXKA 2NCPA 4OR9B 2ISDA 3VGOA 3EVRA 1OOJA 2Y4QA 3CR4X 3CLNA 2OTGC 1B8LA 4ZCVA 4C0KA 1B1GA 2IS9A 2KFHA 4YGEB 2CTNA 4YGBB 1K90D 3LK0A 1YVHA 1PVAA 1NX3A 3DF0A 1DJWA 2PALA 3SIBA 4ZCUA 1LA0A 4WQ2A 2MLEC 1RWYA 2MRDA 3VRRA 2WOSA 1KK8C 1XFWO 1B7TZ 4GBAA 2AMIA 2PSRA 1XFXO 3OB2B 3CZTX 4QJ4B 3CTNA 1BF5A 1NIWA 1A29A 1ZFSA 4OKHA 1J7RA 2KGBC 2NZ0A 4JPZB 5HKZA 4NQGA 1CNPA 3OB1B 3LK1A 3GK2A 3HCMA 4C0LA 1CB1A 1XFZO 1U5IA 1K9PA 1XA5A 1B8RA 2BCBA 4PHKA 1ZOTB 3QRXA 2CBLA 2HF5A 2KI4B 5I8NA 1CDPA 1XVJA 1KFXL 1BR4B 1PRWA 1FBVA 1NCYA 1WLZA 1GQMA 2BECA 2LE9B 2KAXA 1KCYA 2TN4A 1MWNA 2I18A 1MUXA 3FIAA 2KAYA 3SG7A 3VRNA 1NX0A 2LANA 4GGFA 1UWOA 1EL4A 1DF0B 2L98A 1C07A 2O5GA 3ZNIA 4NDDA 1X02A 2E6WA 3OX6A 1AJ4A 1M39A 1PULA 2EC6C 1BLQA 1MR8A 1LXFC 1TNXA 3DVKA 3PFVA 4IL1A 4PE4A 3DVJA 1NP8A 1JF0A 2EHBA 1SBJA 3BYAA 3KPXA 2ZKMX 5CPVA 3BUOB 1UHHA 1OSAA 1DVIA 1E8AA 4AQJA 3TDIA 1L7ZA 2JU0A 3M0WA 4MZJA 1KWOB 1UHNA 2WCFA 2OTGB 2BCAA 2F3YA 3EKJA 3GOFA 5I2LA 2JTZA 1YX7A 3PN7B 1CFDA 2LLTA 3O4YA 4GFTA 2F33A 3NSKA 2ZN8A 3KEVA 3WXAA 4ICBA 1CKKA 1PVBA 1LVCD 2BCXA 2JNXA 1EG4A 1OZOA 1NWDA 2P6BB 2LV7A 1S26D 2JQ6A 1RJVA 1Y6WA 2KFGA 4PALA 1JFKA 1SW8A 2LHIA 4CLNA 5KTYA 1DJIA 2OS8B 1SRAA 1K8UA 2JTTA 3EK4A 1GGWA 1SCMB 2K7DA 4YGDB 3NXAA 1VRKA 2LVVA 2ZNEA 1UHKA 4HREE 4CPVA 1FF1A 1A2XA 1WLMA 2V53A 1SL8A 3TS5B 2F2OA 1IGVA 1WRLA 4A4CA 2H2KA 3GK4X 1F70A 1TIZA 1YVLA 2KBMA 2RGIA 3OX5A 4GGNA 1B8CA 5DKNA 1JSAA 2KI4C 3PM8A 4TNCA 2L50A 4HRHA 1CLLA 3K21A 3O6BA 4DCKA 1S3PA 1KK7Y 4MVFA 1TNQA 5J3XA 2JT8A 3EK7A 4AOMA 1JWDA 1RROA 2JXCA 2K2FA 4GGFC 2NXQA 5D69A 2LHLA 3IQQA 4XJKA 3A4UB 1B9AA 1QASA 1F54A 4CIDA 2LUXA 4FQOA 1ALWA 1W7IB 1AVSA 1KSMA 1OMDA 1Y1UA 2NLNA 4R1EA 1FW4A 2Q4UA 2A4JA 2EC6B 1XO5A 2QPTA 1MXLC 1KQVA 4PDZA 1S5GY 1CLMA 4YGAA 5HLVA 1S1EA 3VROA 1SR6C 4GUKA 4MEWA 3SJSA 2FCEA 5GQQC 5G08A 1S6JA 2JT3A 2MLFC 2LVJA 1CMFA 4CFRA 1YUTA 2LLUA 1MF8B 4PE0A 3I5IB 1TCOB 5B8IB 5JJGA 1LINA 2I7AA 1D1OA 3PLFB 1YR5A 3KF9A 2ZN9A 4P5OE 3I5IC 2JXLA 1J55A 4MN0A 1OQPA 3BUXB 2CCMA 1OMVA 1PALA 2F2PA 2MAZA 3PALA 4WQ3A 1CDLA 2MHHA 2BL0C 1K9KA 3EKHA 1JUOA 1MQ1A 1IWQA 3JTDC 1QIVA 1IKUA 2LC5A 4PHJA 4UPGA 3AAKA 3TZ1A 2KNEA 4F0ZB 2COLB 1R2UA 1TNPA 3TS5C 2K7BA 1QLSA 4MZLA 4BY4A 1IRJA 2CT9A 1XFVO 1K96A 1UURA 3SG4A 3OHMB 1LA3A 1K94A 1DT7B 2VRGA 2EGDA 1K93D 3NSIA 2OS8C 4E68A 1TOPA 4M2PA 4MZKA 1CFPA 1SCMC 4MRYA 1QVIY 5I2OA 1CMGA 5DKQA 1IH0A 4GPLB 1NCZA 1N65A 1KFXS 4OV2A 4I5KA 2K8MB 5HKYA 3LCPC 2JOJA 1CFFA 1AHRA 1FI5A 1OZSA 1Y1AA 2OPOA 1F8HA 5F6TA 4DUQA 1SL7A 5CSJA 5I2QA 1NX2A 3CGAA 1H8BA 1SPYA 1AK8A 3PSRA 4A4BA 1V1FA 1J7QA 2B1UA 2JZIA 3O2PA 3SIAA 3D0YB 1S6IA 1QATA 4M2QA 4OCIA 2M8UA 5CSNA 3KHEA 2L4IA 1J7OA 1OE9B 1BT6A 2ZRSA 2LMVA 1V1GA 1ZACA 1BU3A 1MXEA 2JNFA 1UHIA 1SR6B 1ALVA 4PE1A 1PSBA 2M49B 2KOTA 4ORCB 3SG6A 2KI6C 1WY9A 3FWCA 3IQOA 5ER5A 4C0JA 2H61A 5AANA 2FOTA 1SMGA 1DJYA 4GAOA 1BODA 1XYDA 3DVMA 3A8RA 4M2OA 1YURA 1NCXA 1RFJA 3CS1A 2ZRTA 3OP0A 4YI9A 1BR1B 4ORBB 2LLSA 2M1KB 2JC2A 3FWBA 3WHUB 5CSIA 1WDCB 2ZFDA 2KBIA 1KFUL 3AKAA 4YI8A 3WHTB 2JRFA 3VRPA 2BL0B 1QV1A 1YUUA 3JTDB 1PSRA 2MBXA 4BY5A 5KU1A 4ETOA 1M31A 2L2EA 2M97A 3SG3A 1QS7A 1Y0VH 3C1VA 3CWGA 3BOWA 1BG1A 1G33A 1IG5A 1YTZC 2JWWA 2KFFA 3F45A 3LLEA 1IQ5A 2HQWA 5HYDA 1TCFA 1CM1A 4HRGA 4XYNA 3AAJA 2SCPA 1ODBA 1IJ5A 1KQMB 1PK0D 3I5FC 3TDZA 1A75A 3WNXB 4DIRA 1F4QA 1XK4A 1DTLA 1QXPA 2JPTA 4QJ5B 1B7TY 2WCEA 1YUSA 3JVTC 2GGZA 4MSPA 1XFUO 4USLA 1F71A 3BUNB 1QTXA 2BBMA 1DJGA 4I5LB 1QX7A 2KI6D 2PVBA 1N0YA 1F4OA 4MRXA 5K89A 2WNDA 1IJ6A 3EVVA 2LP3A 1FI6A 2AAOA 4PE7A 1HT9A 2Y1NA 2QACA 2I94A 5FYXA 1ZUZA 1G8IA 3BUMB 2JT0A 1SL9A 4XJKB 3SG5A 5BPJA 1JF2A 2GV5A 2JULA 2KDHA 2L5XB 4I5JA 5TNCA 1TNWA 1LKJA 1TTXA 2I2RE 1RK9A 5PALA 2D8NA 3AKBA 1H4BA 1DGUA 2AUCA 1C7WA 2CXJA 2KAVA 1QV0A 2KHNA 1NYAA 2M29A 2O60A 2KSPA 2ZNDA 1QX5B 4L9MA 2L4HA 2PRUA 1C7VA 3DD4A 1UHJA 3BQ3A 2LMTA 2FJUB 1CLBA 1SK6D 1M45A 3ZWHA 2E30A 4NDCA 1BJFA 1AP4A 2H61C 3CR5X 4MBEA 2Q91A 3DF0B 4CFQA 1L2OC 3I5GB 1N2DA 1J1EA 1EJ3A 1U5IB 1UP5A 3H4SE 3RM1A 3TDUA 4DS7A 1A03A 2BKHB 1A75B 1WRKA 1Y1XA 2LVKA 2K0JA 1WDCC 4DRWA 1CFCA 4OVNF 3TUYC 2WCBA 2LAPA 1RECA 4FTGA 4WRIA 1FPWA 2G2BA 3BOWB 1YX8A 5JOLA 2SASA 4P2YB 2KQ6A 2K61A 3NSOA 2L51A 3HX4A 2KGRA 2M1UA 3I5HB 1SKTA 5HLOA 1TN4A 3JVTB 4NDBA 3EK8A 4GNKB 1DGVA 2GGMA 1NSHA 5AFPA 1IQ3A 5CSFA 1AJ5A 1R6PA 1BOCA 2F3ZA 4PCWA 2LUCA 1DJXA 1AUIB 2KQYA 2PASA 4QJ3B 1B4CA 1DMOA 1J1DA 2WORA 1A4PA 3IF7A 3FS7A 2HQ8A 3PN7C 5HKWA 2DOQA 2F8PA 2Y1MA 1QX2A 2M7NA 2K7OA 1F55A 1KK7Z 4JQ0D 1BMOA 1RTP1 2G9BA 1EG3A 4JWQA 1QVIZ 2BBNA 3MSEB 1NUBA 3O78A 4PHNA 2LVIA 2BE6A 2LP2A 1W7JB 2BKIB 2HPSA 1CDMA 4YGCB 1SNLA 2FCDA 1KK8B 1K9UA 1NPQA 2M7LA 4HSZA 3RLZA 1JC2A 2LNKA 1WRZA 1M46A 4I5NB 5ER4X 1DJHA 1S6CA 1SYMA 1JFJA 2L0PA
chains in the Genus database with same CATH superfamily
1UUSA 1ZMZA 4N1GA 1M63B 5D3OA 3L47A 1G4YR 2HETA 1B47A 3S0DA 1EH2A 2R2IA 1JBAA 1QIWA 1L2OB 3I5GC 3R1VA 1YRUB 3CR2A 3EVUA 4KYNA 1TRFA 1S5GZ 2WC8A 3ICBA 1XFYO 1SSEB 5IBWA 1CDNA 1NX1A 2NCOA 3D10A 2QEBA 1YRTB 4MLWA 3Q8IA 1EXRA 3NSLA 5D7FA 2K7CA 2LCPA 3VRQA 1GJYA 3PM2A 4N1FA 4Q04A 4D1EA 1J7PA 2PYQA 3PATA 4U8DA 4YRUA 3LL8B 2LM5A 2M9GA 1XK4C 1CM4A 5AXIA 4PHMA 1MHOA 3GK1A 4ORAB 1Z4HA 3NGVA 4N5XA 1TUZA 1QJTA 3CZ1A 1OOIX 5AERA 2KYFA 2M3WA 5KSZA 3BUWB 2MA2A 2Y5IA 3D0YA 1Q80A 3FE8A 1KSOA 3TUYB 3SS4A 1KQMC 3I5FB 3EG5B 3FE6A 2KYCA 5DKRA 3DVEA 3E3RA 1OMRA 1KWOC 1KFUS 3D77A 1S36A 1HQVA 2KLEA 2LMUA 3SG2A 1CTRA 1K2HA 2WC5A 1SCVA 2CNPA 3DZTA 2MJWB 4YBHB 1C3ZA 1GGZA 1K95A 2M0RA 3KO0A 2K2AA 3I5HC 1QLKA 4AQIA 5FI2A 5AEQA 1DF0A 1DJZA 1SY9A 2BE4A 2PMYA 3BXKA 2NCPA 4OR9B 2ISDA 3VGOA 3EVRA 3B7AA 3CABA 1OOJA 2BAPA 2Y4QA 3CR4X 2YGUA 3CLNA 2OTGC 1B8LA 4ZCVA 4C0KA 1B1GA 2IS9A 2KFHA 4YGEB 3BFHA 2CTNA 2WCJA 1K90D 3LK0A 4YGBB 1YVHA 1PVAA 1NX3A 3DF0A 1DJWA 2PALA 3SIBA 4ZCUA 1LA0A 4WQ2A 2MLEC 1RWYA 2MRDA 3VRRA 2WOSA 1KK8C 1XFWO 1B7TZ 4GBAA 1OOFA 2AMIA 2PSRA 1XFXO 3OB2B 3CZTX 4QJ4B 3CTNA 1BF5A 1NIWA 1A29A 1ZFSA 3IVTA 4OKHA 1J7RA 2KGBC 1DELA 2NZ0A 4JPZB 5FI7A 5HKZA 3VB1A 4NQGA 1CNPA 3OB1B 3LK1A 3GK2A 3HCMA 4C0LA 1CB1A 1XFZO 1U5IA 1GM0A 1K9PA 1XA5A 4INWA 1B8RA 2BCBA 4PHKA 1TUJA 1ZOTB 3QRXA 2CBLA 2HF5A 2KI4B 5I8NA 1CDPA 1XVJA 1KFXL 1BR4B 5DICA 1PRWA 1FBVA 1NCYA 3SS5A 1WLZA 1GQMA 2BECA 3D75A 2WCMA 2LE9B 2KAXA 1KCYA 2TN4A 1MWNA 2I18A 2KLDA 3D78A 1MUXA 3FIAA 2KAYA 3SG7A 3VRNA 1LS8A 1NX0A 2LANA 4GGFA 1UWOA 1EL4A 1DF0B 2L98A 1OW4A 2PQLA 1C07A 2O5GA 3ZNIA 4NDDA 1X02A 4IJ7A 2E6WA 3OX6A 1AJ4A 1M39A 1P28A 1PULA 2EC6C 1BLQA 1MR8A 1LXFC 1TNXA 3DVKA 3PFVA 4IL1A 4PE4A 3DVJA 1NP8A 1JF0A 2EHBA 1SBJA 2JPOA 3BYAA 3KPXA 2ZKMX 5CPVA 3BUOB 1UHHA 1OSAA 1DVIA 3R1PA 1E8AA 4AQJA 3TDIA 1L7ZA 2JU0A 3M0WA 4MZJA 1KWOB 1XFRA 1UHNA 2WCFA 2OTGB 2BCAA 2F3YA 3EKJA 3GOFA 5I2LA 2JTZA 1YX7A 3PN7B 1CFDA 2LLTA 3O4YA 4GFTA 2F33A 3NSKA 2ZN8A 3KEVA 3WXAA 4ICBA 1CKKA 1PVBA 1LVCD 2BCXA 2JNXA 3D73A 3L4LA 1EG4A 1OZOA 1NWDA 2P6BB 2LV7A 1S26D 2JQ6A 1RJVA 1Y6WA 2KFGA 4PALA 1JFKA 1SW8A 2LHIA 4CLNA 5KTYA 1DJIA 2OS8B 1SRAA 1K8UA 2JTTA 3EK4A 1GGWA 1SCMB 2K7DA 4YGDB 3NXAA 1VRKA 2LVVA 2ZNEA 1UHKA 4HREE 4CPVA 1FF1A 1A2XA 1WLMA 2V53A 1SL8A 3TS5B 2F2OA 1IGVA 1WRLA 4PT1A 5EL2A 4A4CA 2H2KA 2WCHA 3GK4X 1F70A 1TIZA 1YVLA 2KBMA 2RGIA 3OX5A 4GGNA 1B8CA 5DKNA 1JSAA 2KI4C 3PM8A 4TNCA 2L50A 4HRHA 1CLLA 3K21A 3UNWA 3O6BA 4DCKA 1S3PA 1KK7Y 3NHIA 3FE9A 4MVFA 1TNQA 5J3XA 2JT8A 3DXLA 3EK7A 4AOMA 3DY9A 1JWDA 1RROA 2JXCA 2K2FA 4GGFC 2NXQA 5D69A 2LHLA 3IQQA 1DEKA 4XJKA 3A4UB 1B9AA 1QASA 1F54A 4CIDA 2LUXA 4FQOA 1ALWA 1W7IB 1AVSA 1KSMA 1OMDA 1Y1UA 2NLNA 4R1EA 1FW4A 2Q4UA 2A4JA 2EC6B 1XO5A 2QPTA 1MXLC 1KQVA 4PDZA 1S5GY 1CLMA 3CZ2A 4YGAA 1S1EA 5HLVA 3VROA 1SR6C 4GUKA 4MEWA 3SJSA 2FCEA 5GQQC 5G08A 1S6JA 2JT3A 2MLFC 2LVJA 3S0EA 1CMFA 4CFRA 1YUTA 2LLUA 1MF8B 1W9ZA 3DYEA 3I5IB 4PE0A 1TCOB 5B8IB 5JJGA 1LINA 2I7AA 1D1OA 2FJYA 3PLFB 1YR5A 3KF9A 2ZN9A 4P5OE 3I5IC 2JXLA 1J55A 4MN0A 1OQPA 3BUXB 2CCMA 1OMVA 1PALA 2F2PA 2MAZA 3PALA 4WQ3A 1CDLA 2MHHA 2BL0C 1K9KA 3EKHA 1JUOA 1MQ1A 2P71A 1IWQA 3JTDC 1QIVA 1IKUA 2LC5A 4PHJA 4UPGA 3O4XA 3AAKA 3TZ1A 2KNEA 4F0ZB 2COLB 1R2UA 4F7FA 1TNPA 3TS5C 2K7BA 1QLSA 4MZLA 4BY4A 1IRJA 2CT9A 1XFVO 1K96A 1UURA 3SG4A 3OHMB 1LA3A 3QMEA 1K94A 1DT7B 2VRGA 4JD9A 2EGDA 1K93D 3NSIA 3R1OA 2OS8C 4E68A 1JC2A 1TOPA 4M2PA 4MZKA 1CFPA 1SCMC 4MRYA 1QVIY 1QWVA 5I2OA 2ERBA 1CMGA 5DKQA 1IH0A 4GPLB 1NCZA 3B88A 1N65A 1KFXS 3PJIA 4OV2A 4I5KA 2K8MB 5HKYA 3LCPC 2JOJA 3NHTA 1CFFA 1AHRA 2QDIA 1FI5A 1OZSA 1Y1AA 2OPOA 1F8HA 5F6TA 4DUQA 1SL7A 5CSJA 5I2QA 1NX2A 3CGAA 1H8BA 1SPYA 1AK8A 3PSRA 4A4BA 1V1FA 1J7QA 2B1UA 2JZIA 3O2PA 3SIAA 3D0YB 2P70A 1S6IA 1QATA 4M2QA 1OOHA 4OCIA 2M8UA 5CSNA 3KHEA 2L4IA 1J7OA 1OE9B 1BT6A 2ZRSA 2LMVA 1V1GA 1ZACA 1BU3A 1MXEA 2JNFA 1UHIA 1SR6B 1ALVA 4PE1A 1PSBA 2M49B 2KOTA 4ORCB 3SG6A 2KI6C 1WY9A 3FWCA 3IQOA 4JKTA 5ER5A 4C0JA 2H61A 5AANA 2FOTA 1SMGA 2QEOA 3OBVA 1DJYA 4GAOA 2K60A 1BODA 1XYDA 3DVMA 3A8RA 4M2OA 1YURA 1NCXA 1RFJA 3CS1A 2ZRTA 3OP0A 4YI9A 1BR1B 4ORBB 2LLSA 2M1KB 2JC2A 3FWBA 3WHUB 5CSIA 1WDCB 2ZFDA 2KBIA 1KFUL 3AKAA 4YI8A 3WHTB 2JRFA 3UO9A 3VRPA 2WC6A 2BL0B 1QV1A 3BJHA 1YUUA 3JTDB 1PSRA 2MBXA 4BY5A 5KU1A 4ETOA 1M31A 2L2EA 2M97A 3SG3A 1QS7A 1Y0VH 3C1VA 2BNXA 3BOWA 3CWGA 1BG1A 1G33A 1IG5A 1YTZC 2JWWA 2KFFA 3F45A 3L4AA 3LLEA 1IQ5A 2HQWA 5HYDA 1TCFA 1CM1A 4HRGA 4XYNA 1ORGA 3AAJA 2SCPA 1ODBA 1IJ5A 1KQMB 1PK0D 3I5FC 3TDZA 1A75A 3WNXB 1DC1A 2QEVA 4DIRA 1F4QA 1XK4A 1DTLA 1QXPA 2JPTA 4QJ5B 1B7TY 2WCEA 3R72A 1YUSA 2WCKA 2GGZA 3JVTC 1XFUO 4MSPA 4USLA 1F71A 3BUNB 1QTXA 2BBMA 1DJGA 3BFAA 4I5LB 1QX7A 2KI6D 2PVBA 1N0YA 1F4OA 4MRXA 5K89A 3B87A 2WNDA 1IJ6A 3EVVA 3S0BA 2LP3A 1FI6A 2AAOA 4PE7A 1HT9A 2Y1NA 3N7HA 2QACA 2I94A 2KPHA 5I94A 5FYXA 3V2LA 1ZUZA 1G8IA 3BUMB 2JT0A 1SL9A 4XJKB 3SG5A 5BPJA 1JF2A 2GV5A 2JULA 2KDHA 2L5XB 4I5JA 5TNCA 5HL1A 1TNWA 1LKJA 1TTXA 2I2RE 1RK9A 2L2CA 2D8NA 3AKBA 5PALA 1DGUA 2AUCA 1C7WA 2CXJA 2KAVA 1QV0A 2KHNA 1H4BA 3CZ0A 1NYAA 2M29A 2O60A 2KSPA 2ZNDA 1QX5B 4L9MA 2L4HA 2PRUA 3SS3A 3DD4A 1C7VA 1UHJA 3BQ3A 2LMTA 3D74A 2FJUB 1T14A 1CLBA 1SK6D 1M45A 3B86A 3ZWHA 2E30A 4NDCA 1BJFA 1AP4A 2H61C 3CR5X 4MBEA 2Q91A 3DF0B 4CFQA 1L2OC 3BFBA 1N2DA 3I5GB 1J1EA 1EJ3A 3OGNA 1U5IB 1UP5A 3H4SE 3RM1A 3TDUA 4DS7A 1A03A 3S0AA 3D76A 2BKHB 1A75B 1WRKA 3B6XA 1Y1XA 1DQEA 2LVKA 2K0JA 1WDCC 4DRWA 1CFCA 4INXA 4OVNF 3TUYC 2WCBA 2LAPA 1RECA 4FTGA 4WRIA 1FPWA 2G2BA 3BOWB 1YX8A 5JOLA 2SASA 4P2YB 2KQ6A 2K61A 2H8VA 3NSOA 2L51A 3HX4A 2KGRA 2M1UA 3I5HB 1SKTA 5HLOA 1TN4A 3JVTB 4NDBA 3EK8A 1TWOA 4GNKB 1DGVA 2GGMA 1NSHA 3CDNA 5AFPA 1IQ3A 5CSFA 1AJ5A 1R6PA 1BOCA 3S0FA 4OZDA 2F3ZA 4PCWA 2LUCA 3RZSA 2L5YA 1DJXA 1OOGA 1AUIB 2KQYA 2PASA 3K1EA 4QJ3B 1B4CA 1DMOA 1J1DA 2WORA 1A4PA 3IF7A 2QEHA 2HQ8A 3FS7A 3PN7C 1IIOA 5HKWA 2DOQA 2F8PA 2Y1MA 1QX2A 2M7NA 2K7OA 3S0GA 1F55A 1KK7Z 4JQ0D 1BMOA 1RTP1 2G9BA 1EG3A 4JWQA 1QVIZ 2BBNA 3MSEB 1NUBA 2GTEA 3O78A 2LVIA 3CYZA 4FQTA 4PHNA 2BE6A 2LP2A 1W7JB 2BKIB 2HPSA 1CDMA 2WCLA 4YGCB 5FI6A 1SNLA 2FCDA 1KK8B 1K9UA 1NPQA 2M7LA 4HSZA 3RLZA 1C3YA 2LNKA 1WRZA 1Z2CB 1M46A 4I5NB 5ER4X 1DJHA 1S6CA 1SYMA 1JFJA 2L0PA
chains in the Genus database with same CATH topology
1UUSA 1ZMZA 4N1GA 1M63B 1G4YR 2HETA 1B47A 1EH2A 2R2IA 1JBAA 1QIWA 1L2OB 3I5GC 1YRUB 3CR2A 3EVUA 1TRFA 1S5GZ 2WC8A 3ICBA 1XFYO 1CDNA 5IBWA 1NX1A 2NCOA 3D10A 1YRTB 4MLWA 1EXRA 3NSLA 5D7FA 2K7CA 2LCPA 3VRQA 1GJYA 4N1FA 4Q04A 4D1EA 1J7PA 3PATA 4U8DA 4YRUA 3LL8B 2LM5A 2M9GA 1XK4C 1CM4A 5AXIA 4PHMA 1MHOA 3GK1A 4ORAB 4N5XA 1QJTA 5AERA 2KYFA 2M3WA 5KSZA 3BUWB 2MA2A 2Y5IA 3D0YA 1Q80A 1KSOA 3TUYB 1KQMC 3I5FB 2KYCA 5DKRA 3DVEA 3E3RA 1OMRA 1KWOC 1KFUS 1S36A 1HQVA 2LMUA 3SG2A 1CTRA 1K2HA 1SCVA 2CNPA 2MJWB 4YBHB 1GGZA 1K95A 2M0RA 3KO0A 2K2AA 3I5HC 1QLKA 4AQIA 5AEQA 1DF0A 1DJZA 1SY9A 2BE4A 2PMYA 3BXKA 2NCPA 4OR9B 2ISDA 3VGOA 3EVRA 1OOJA 2Y4QA 3CR4X 3CLNA 2OTGC 1B8LA 4ZCVA 4C0KA 1B1GA 2IS9A 2KFHA 4YGEB 2CTNA 4YGBB 1K90D 3LK0A 1YVHA 1PVAA 1NX3A 3DF0A 1DJWA 2PALA 3SIBA 4ZCUA 1LA0A 4WQ2A 2MLEC 1RWYA 2MRDA 3VRRA 2WOSA 1KK8C 1XFWO 1B7TZ 4GBAA 2AMIA 2PSRA 1XFXO 3OB2B 3CZTX 4QJ4B 3CTNA 1BF5A 1NIWA 1A29A 1ZFSA 4OKHA 1J7RA 2KGBC 2NZ0A 4JPZB 5HKZA 4NQGA 1CNPA 3OB1B 3LK1A 3GK2A 3HCMA 4C0LA 1CB1A 1XFZO 1U5IA 1K9PA 1XA5A 1B8RA 2BCBA 4PHKA 1ZOTB 3QRXA 2CBLA 2HF5A 2KI4B 5I8NA 1CDPA 1XVJA 1KFXL 1BR4B 1PRWA 1FBVA 1NCYA 1WLZA 1GQMA 2BECA 2LE9B 2KAXA 1KCYA 2TN4A 1MWNA 2I18A 1MUXA 3FIAA 2KAYA 3SG7A 3VRNA 1NX0A 2LANA 4GGFA 1UWOA 1EL4A 1DF0B 2L98A 1C07A 2O5GA 3ZNIA 4NDDA 1X02A 2E6WA 3OX6A 1AJ4A 1M39A 1PULA 2EC6C 1BLQA 1MR8A 1LXFC 1TNXA 3DVKA 3PFVA 4IL1A 4PE4A 3DVJA 1NP8A 1JF0A 2EHBA 1SBJA 3BYAA 3KPXA 2ZKMX 5CPVA 3BUOB 1UHHA 1OSAA 1DVIA 1E8AA 4AQJA 3TDIA 1L7ZA 2JU0A 3M0WA 4MZJA 1KWOB 1UHNA 2WCFA 2OTGB 2BCAA 2F3YA 3EKJA 3GOFA 5I2LA 2JTZA 1YX7A 3PN7B 1CFDA 2LLTA 3O4YA 4GFTA 2F33A 3NSKA 2ZN8A 3KEVA 3WXAA 4ICBA 1CKKA 1PVBA 1LVCD 2BCXA 2JNXA 1EG4A 1OZOA 1NWDA 2P6BB 2LV7A 1S26D 2JQ6A 1RJVA 1Y6WA 2KFGA 4PALA 1JFKA 1SW8A 2LHIA 4CLNA 5KTYA 1DJIA 2OS8B 1SRAA 1K8UA 2JTTA 3EK4A 1GGWA 1SCMB 2K7DA 4YGDB 3NXAA 1VRKA 2LVVA 2ZNEA 1UHKA 4HREE 4CPVA 1FF1A 1A2XA 1WLMA 2V53A 1SL8A 3TS5B 2F2OA 1IGVA 1WRLA 4A4CA 2H2KA 3GK4X 1F70A 1TIZA 1YVLA 2KBMA 2RGIA 3OX5A 4GGNA 1B8CA 5DKNA 1JSAA 2KI4C 3PM8A 4TNCA 2L50A 4HRHA 1CLLA 3K21A 3O6BA 4DCKA 1S3PA 1KK7Y 4MVFA 1TNQA 5J3XA 2JT8A 3EK7A 4AOMA 1JWDA 1RROA 2JXCA 2K2FA 4GGFC 2NXQA 5D69A 2LHLA 3IQQA 4XJKA 3A4UB 1B9AA 1QASA 1F54A 4CIDA 2LUXA 4FQOA 1ALWA 1W7IB 1AVSA 1KSMA 1OMDA 1Y1UA 2NLNA 4R1EA 1FW4A 2Q4UA 2A4JA 2EC6B 1XO5A 2QPTA 1MXLC 1KQVA 4PDZA 1S5GY 1CLMA 4YGAA 5HLVA 1S1EA 3VROA 1SR6C 4GUKA 4MEWA 3SJSA 2FCEA 5GQQC 5G08A 1S6JA 2JT3A 2MLFC 2LVJA 1CMFA 4CFRA 1YUTA 2LLUA 1MF8B 4PE0A 3I5IB 1TCOB 5B8IB 5JJGA 1LINA 2I7AA 1D1OA 3PLFB 1YR5A 3KF9A 2ZN9A 4P5OE 3I5IC 2JXLA 1J55A 4MN0A 1OQPA 3BUXB 2CCMA 1OMVA 1PALA 2F2PA 2MAZA 3PALA 4WQ3A 1CDLA 2MHHA 2BL0C 1K9KA 3EKHA 1JUOA 1MQ1A 1IWQA 3JTDC 1QIVA 1IKUA 2LC5A 4PHJA 4UPGA 3AAKA 3TZ1A 2KNEA 4F0ZB 2COLB 1R2UA 1TNPA 3TS5C 2K7BA 1QLSA 4MZLA 4BY4A 1IRJA 2CT9A 1XFVO 1K96A 1UURA 3SG4A 3OHMB 1LA3A 1K94A 1DT7B 2VRGA 2EGDA 1K93D 3NSIA 2OS8C 4E68A 1TOPA 4M2PA 4MZKA 1CFPA 1SCMC 4MRYA 1QVIY 5I2OA 1CMGA 5DKQA 1IH0A 4GPLB 1NCZA 1N65A 1KFXS 4OV2A 4I5KA 2K8MB 5HKYA 3LCPC 2JOJA 1CFFA 1AHRA 1FI5A 1OZSA 1Y1AA 2OPOA 1F8HA 5F6TA 4DUQA 1SL7A 5CSJA 5I2QA 1NX2A 3CGAA 1H8BA 1SPYA 1AK8A 3PSRA 4A4BA 1V1FA 1J7QA 2B1UA 2JZIA 3O2PA 3SIAA 3D0YB 1S6IA 1QATA 4M2QA 4OCIA 2M8UA 5CSNA 3KHEA 2L4IA 1J7OA 1OE9B 1BT6A 2ZRSA 2LMVA 1V1GA 1ZACA 1BU3A 1MXEA 2JNFA 1UHIA 1SR6B 1ALVA 4PE1A 1PSBA 2M49B 2KOTA 4ORCB 3SG6A 2KI6C 1WY9A 3FWCA 3IQOA 5ER5A 4C0JA 2H61A 5AANA 2FOTA 1SMGA 1DJYA 4GAOA 1BODA 1XYDA 3DVMA 3A8RA 4M2OA 1YURA 1NCXA 1RFJA 3CS1A 2ZRTA 3OP0A 4YI9A 1BR1B 4ORBB 2LLSA 2M1KB 2JC2A 3FWBA 3WHUB 5CSIA 1WDCB 2ZFDA 2KBIA 1KFUL 3AKAA 4YI8A 3WHTB 2JRFA 3VRPA 2BL0B 1QV1A 1YUUA 3JTDB 1PSRA 2MBXA 4BY5A 5KU1A 4ETOA 1M31A 2L2EA 2M97A 3SG3A 1QS7A 1Y0VH 3C1VA 3CWGA 3BOWA 1BG1A 1G33A 1IG5A 1YTZC 2JWWA 2KFFA 3F45A 3LLEA 1IQ5A 2HQWA 5HYDA 1TCFA 1CM1A 4HRGA 4XYNA 3AAJA 2SCPA 1ODBA 1IJ5A 1KQMB 1PK0D 3I5FC 3TDZA 1A75A 3WNXB 4DIRA 1F4QA 1XK4A 1DTLA 1QXPA 2JPTA 4QJ5B 1B7TY 2WCEA 1YUSA 3JVTC 2GGZA 4MSPA 1XFUO 4USLA 1F71A 3BUNB 1QTXA 2BBMA 1DJGA 4I5LB 1QX7A 2KI6D 2PVBA 1N0YA 1F4OA 4MRXA 5K89A 2WNDA 1IJ6A 3EVVA 2LP3A 1FI6A 2AAOA 4PE7A 1HT9A 2Y1NA 2QACA 2I94A 5FYXA 1ZUZA 1G8IA 3BUMB 2JT0A 1SL9A 4XJKB 3SG5A 5BPJA 1JF2A 2GV5A 2JULA 2KDHA 2L5XB 4I5JA 5TNCA 1TNWA 1LKJA 1TTXA 2I2RE 1RK9A 5PALA 2D8NA 3AKBA 1H4BA 1DGUA 2AUCA 1C7WA 2CXJA 2KAVA 1QV0A 2KHNA 1NYAA 2M29A 2O60A 2KSPA 2ZNDA 1QX5B 4L9MA 2L4HA 2PRUA 1C7VA 3DD4A 1UHJA 3BQ3A 2LMTA 2FJUB 1CLBA 1SK6D 1M45A 3ZWHA 2E30A 4NDCA 1BJFA 1AP4A 2H61C 3CR5X 4MBEA 2Q91A 3DF0B 4CFQA 1L2OC 3I5GB 1N2DA 1J1EA 1EJ3A 1U5IB 1UP5A 3H4SE 3RM1A 3TDUA 4DS7A 1A03A 2BKHB 1A75B 1WRKA 1Y1XA 2LVKA 2K0JA 1WDCC 4DRWA 1CFCA 4OVNF 3TUYC 2WCBA 2LAPA 1RECA 4FTGA 4WRIA 1FPWA 2G2BA 3BOWB 1YX8A 5JOLA 2SASA 4P2YB 2KQ6A 2K61A 3NSOA 2L51A 3HX4A 2KGRA 2M1UA 3I5HB 1SKTA 5HLOA 1TN4A 3JVTB 4NDBA 3EK8A 4GNKB 1DGVA 2GGMA 1NSHA 5AFPA 1IQ3A 5CSFA 1AJ5A 1R6PA 1BOCA 2F3ZA 4PCWA 2LUCA 1DJXA 1AUIB 2KQYA 2PASA 4QJ3B 1B4CA 1DMOA 1J1DA 2WORA 1A4PA 3IF7A 3FS7A 2HQ8A 3PN7C 5HKWA 2DOQA 2F8PA 2Y1MA 1QX2A 2M7NA 2K7OA 1F55A 1KK7Z 4JQ0D 1BMOA 1RTP1 2G9BA 1EG3A 4JWQA 1QVIZ 2BBNA 3MSEB 1NUBA 3O78A 4PHNA 2LVIA 2BE6A 2LP2A 1W7JB 2BKIB 2HPSA 1CDMA 4YGCB 1SNLA 2FCDA 1KK8B 1K9UA 1NPQA 2M7LA 4HSZA 3RLZA 1JC2A 2LNKA 1WRZA 1M46A 4I5NB 5ER4X 1DJHA 1S6CA 1SYMA 1JFJA 2L0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUS A;  1ZMZ A;  4N1G A;  1M63 B;  1G4Y R;  2HET A;  1B47 A;  1EH2 A;  2R2I A;  1JBA A;  1QIW A;  1L2O B;  3I5G C;  1YRU B;  3CR2 A;  3EVU A;  1TRF A;  1S5G Z;  2WC8 A;  3ICB A;  1XFY O;  1CDN A;  5IBW A;  1NX1 A;  2NCO A;  3D10 A;  1YRT B;  4MLW A;  1EXR A;  3NSL A;  5D7F A;  2K7C A;  2LCP A;  3VRQ A;  1GJY A;  4N1F A;  4Q04 A;  4D1E A;  1J7P A;  3PAT A;  4U8D A;  4YRU A;  3LL8 B;  2LM5 A;  2M9G A;  1XK4 C;  1CM4 A;  5AXI A;  4PHM A;  1MHO A;  3GK1 A;  4ORA B;  4N5X A;  1QJT A;  5AER A;  2KYF A;  2M3W A;  5KSZ A;  3BUW B;  2MA2 A;  2Y5I A;  3D0Y A;  1Q80 A;  1KSO A;  3TUY B;  1KQM C;  3I5F B;  2KYC A;  5DKR A;  3DVE A;  3E3R A;  1OMR A;  1KWO C;  1KFU S;  1S36 A;  1HQV A;  2LMU A;  3SG2 A;  1CTR A;  1K2H A;  1SCV A;  2CNP A;  2MJW B;  4YBH B;  1GGZ A;  1K95 A;  2M0R A;  3KO0 A;  2K2A A;  3I5H C;  1QLK A;  4AQI A;  5AEQ A;  1DF0 A;  1DJZ A;  1SY9 A;  2BE4 A;  2PMY A;  3BXK A;  2NCP A;  4OR9 B;  2ISD A;  3VGO A;  3EVR A;  1OOJ A;  2Y4Q A;  3CR4 X;  3CLN A;  2OTG C;  1B8L A;  4ZCV A;  4C0K A;  1B1G A;  2IS9 A;  2KFH A;  4YGE B;  2CTN A;  4YGB B;  1K90 D;  3LK0 A;  1YVH A;  1PVA A;  1NX3 A;  3DF0 A;  1DJW A;  2PAL A;  3SIB A;  4ZCU A;  1LA0 A;  4WQ2 A;  2MLE C;  1RWY A;  2MRD A;  3VRR A;  2WOS A;  1KK8 C;  1XFW O;  1B7T Z;  4GBA A;  2AMI A;  2PSR A;  1XFX O;  3OB2 B;  3CZT X;  4QJ4 B;  3CTN A;  1BF5 A;  1NIW A;  1A29 A;  1ZFS A;  4OKH A;  1J7R A;  2KGB C;  2NZ0 A;  4JPZ B;  5HKZ A;  4NQG A;  1CNP A;  3OB1 B;  3LK1 A;  3GK2 A;  3HCM A;  4C0L A;  1CB1 A;  1XFZ O;  1U5I A;  1K9P A;  1XA5 A;  1B8R A;  2BCB A;  4PHK A;  1ZOT B;  3QRX A;  2CBL A;  2HF5 A;  2KI4 B;  5I8N A;  1CDP A;  1XVJ A;  1KFX L;  1BR4 B;  1PRW A;  1FBV A;  1NCY A;  1WLZ A;  1GQM A;  2BEC A;  2LE9 B;  2KAX A;  1KCY A;  2TN4 A;  1MWN A;  2I18 A;  1MUX A;  3FIA A;  2KAY A;  3SG7 A;  3VRN A;  1NX0 A;  2LAN A;  4GGF A;  1UWO A;  1EL4 A;  1DF0 B;  2L98 A;  1C07 A;  2O5G A;  3ZNI A;  4NDD A;  1X02 A;  2E6W A;  3OX6 A;  1AJ4 A;  1M39 A;  1PUL A;  2EC6 C;  1BLQ A;  1MR8 A;  1LXF C;  1TNX A;  3DVK A;  3PFV A;  4IL1 A;  4PE4 A;  3DVJ A;  1NP8 A;  1JF0 A;  2EHB A;  1SBJ A;  3BYA A;  3KPX A;  2ZKM X;  5CPV A;  3BUO B;  1UHH A;  1OSA A;  1DVI A;  1E8A A;  4AQJ A;  3TDI A;  1L7Z A;  2JU0 A;  3M0W A;  4MZJ A;  1KWO B;  1UHN A;  2WCF A;  2OTG B;  2BCA A;  2F3Y A;  3EKJ A;  3GOF A;  5I2L A;  2JTZ A;  1YX7 A;  3PN7 B;  1CFD A;  2LLT A;  3O4Y A;  4GFT A;  2F33 A;  3NSK A;  2ZN8 A;  3KEV A;  3WXA A;  4ICB A;  1CKK A;  1PVB A;  1LVC D;  2BCX A;  2JNX A;  1EG4 A;  1OZO A;  1NWD A;  2P6B B;  2LV7 A;  1S26 D;  2JQ6 A;  1RJV A;  1Y6W A;  2KFG A;  4PAL A;  1JFK A;  1SW8 A;  2LHI A;  4CLN A;  5KTY A;  1DJI A;  2OS8 B;  1SRA A;  1K8U A;  2JTT A;  3EK4 A;  1GGW A;  1SCM B;  2K7D A;  4YGD B;  3NXA A;  1VRK A;  2LVV A;  2ZNE A;  1UHK A;  4HRE E;  4CPV A;  1FF1 A;  1A2X A;  1WLM A;  2V53 A;  1SL8 A;  3TS5 B;  2F2O A;  1IGV A;  1WRL A;  4A4C A;  2H2K A;  3GK4 X;  1F70 A;  1TIZ A;  1YVL A;  2KBM A;  2RGI A;  3OX5 A;  4GGN A;  1B8C A;  5DKN A;  1JSA A;  2KI4 C;  3PM8 A;  4TNC A;  2L50 A;  4HRH A;  1CLL A;  3K21 A;  3O6B A;  4DCK A;  1S3P A;  1KK7 Y;  4MVF A;  1TNQ A;  5J3X A;  2JT8 A;  3EK7 A;  4AOM A;  1JWD A;  1RRO A;  2JXC A;  2K2F A;  4GGF C;  2NXQ A;  5D69 A;  2LHL A;  3IQQ A;  4XJK A;  3A4U B;  1B9A A;  1QAS A;  1F54 A;  4CID A;  2LUX A;  4FQO A;  1ALW A;  1W7I B;  1AVS A;  1KSM A;  1OMD A;  1Y1U A;  2NLN A;  4R1E A;  1FW4 A;  2Q4U A;  2A4J A;  2EC6 B;  1XO5 A;  2QPT A;  1MXL C;  1KQV A;  4PDZ A;  1S5G Y;  1CLM A;  4YGA A;  5HLV A;  1S1E A;  3VRO A;  1SR6 C;  4GUK A;  4MEW A;  3SJS A;  2FCE A;  5GQQ C;  5G08 A;  1S6J A;  2JT3 A;  2MLF C;  2LVJ A;  1CMF A;  4CFR A;  1YUT A;  2LLU A;  1MF8 B;  4PE0 A;  3I5I B;  1TCO B;  5B8I B;  5JJG A;  1LIN A;  2I7A A;  1D1O A;  3PLF B;  1YR5 A;  3KF9 A;  2ZN9 A;  4P5O E;  3I5I C;  2JXL A;  1J55 A;  4MN0 A;  1OQP A;  3BUX B;  2CCM A;  1OMV A;  1PAL A;  2F2P A;  2MAZ A;  3PAL A;  4WQ3 A;  1CDL A;  2MHH A;  2BL0 C;  1K9K A;  3EKH A;  1JUO A;  1MQ1 A;  1IWQ A;  3JTD C;  1QIV A;  1IKU A;  2LC5 A;  4PHJ A;  4UPG A;  3AAK A;  3TZ1 A;  2KNE A;  4F0Z B;  2COL B;  1R2U A;  1TNP A;  3TS5 C;  2K7B A;  1QLS A;  4MZL A;  4BY4 A;  1IRJ A;  2CT9 A;  1XFV O;  1K96 A;  1UUR A;  3SG4 A;  3OHM B;  1LA3 A;  1K94 A;  1DT7 B;  2VRG A;  2EGD A;  1K93 D;  3NSI A;  2OS8 C;  4E68 A;  1TOP A;  4M2P A;  4MZK A;  1CFP A;  1SCM C;  4MRY A;  1QVI Y;  5I2O A;  1CMG A;  5DKQ A;  1IH0 A;  4GPL B;  1NCZ A;  1N65 A;  1KFX S;  4OV2 A;  4I5K A;  2K8M B;  5HKY A;  3LCP C;  2JOJ A;  1CFF A;  1AHR A;  1FI5 A;  1OZS A;  1Y1A A;  2OPO A;  1F8H A;  5F6T A;  4DUQ A;  1SL7 A;  5CSJ A;  5I2Q A;  1NX2 A;  3CGA A;  1H8B A;  1SPY A;  1AK8 A;  3PSR A;  4A4B A;  1V1F A;  1J7Q A;  2B1U A;  2JZI A;  3O2P A;  3SIA A;  3D0Y B;  1S6I A;  1QAT A;  4M2Q A;  4OCI A;  2M8U A;  5CSN A;  3KHE A;  2L4I A;  1J7O A;  1OE9 B;  1BT6 A;  2ZRS A;  2LMV A;  1V1G A;  1ZAC A;  1BU3 A;  1MXE A;  2JNF A;  1UHI A;  1SR6 B;  1ALV A;  4PE1 A;  1PSB A;  2M49 B;  2KOT A;  4ORC B;  3SG6 A;  2KI6 C;  1WY9 A;  3FWC A;  3IQO A;  5ER5 A;  4C0J A;  2H61 A;  5AAN A;  2FOT A;  1SMG A;  1DJY A;  4GAO A;  1BOD A;  1XYD A;  3DVM A;  3A8R A;  4M2O A;  1YUR A;  1NCX A;  1RFJ A;  3CS1 A;  2ZRT A;  3OP0 A;  4YI9 A;  1BR1 B;  4ORB B;  2LLS A;  2M1K B;  2JC2 A;  3FWB A;  3WHU B;  5CSI A;  1WDC B;  2ZFD A;  2KBI A;  1KFU L;  3AKA A;  4YI8 A;  3WHT B;  2JRF A;  3VRP A;  2BL0 B;  1QV1 A;  1YUU A;  3JTD B;  1PSR A;  2MBX A;  4BY5 A;  5KU1 A;  4ETO A;  1M31 A;  2L2E A;  2M97 A;  3SG3 A;  1QS7 A;  1Y0V H;  3C1V A;  3CWG A;  3BOW A;  1BG1 A;  1G33 A;  1IG5 A;  1YTZ C;  2JWW A;  2KFF A;  3F45 A;  3LLE A;  1IQ5 A;  2HQW A;  5HYD A;  1TCF A;  1CM1 A;  4HRG A;  4XYN A;  3AAJ A;  2SCP A;  1ODB A;  1IJ5 A;  1KQM B;  1PK0 D;  3I5F C;  3TDZ A;  1A75 A;  3WNX B;  4DIR A;  1F4Q A;  1XK4 A;  1DTL A;  1QXP A;  2JPT A;  4QJ5 B;  1B7T Y;  2WCE A;  1YUS A;  3JVT C;  2GGZ A;  4MSP A;  1XFU O;  4USL A;  1F71 A;  3BUN B;  1QTX A;  2BBM A;  1DJG A;  4I5L B;  1QX7 A;  2KI6 D;  2PVB A;  1N0Y A;  1F4O A;  4MRX A;  5K89 A;  2WND A;  1IJ6 A;  3EVV A;  2LP3 A;  1FI6 A;  2AAO A;  4PE7 A;  1HT9 A;  2Y1N A;  2QAC A;  2I94 A;  5FYX A;  1ZUZ A;  1G8I A;  3BUM B;  2JT0 A;  1SL9 A;  4XJK B;  3SG5 A;  5BPJ A;  1JF2 A;  2GV5 A;  2JUL A;  2KDH A;  2L5X B;  4I5J A;  5TNC A;  1TNW A;  1LKJ A;  1TTX A;  2I2R E;  1RK9 A;  5PAL A;  2D8N A;  3AKB A;  1H4B A;  1DGU A;  2AUC A;  1C7W A;  2CXJ A;  2KAV A;  1QV0 A;  2KHN A;  1NYA A;  2M29 A;  2O60 A;  2KSP A;  2ZND A;  1QX5 B;  4L9M A;  2L4H A;  2PRU A;  1C7V A;  3DD4 A;  1UHJ A;  3BQ3 A;  2LMT A;  2FJU B;  1CLB A;  1SK6 D;  1M45 A;  3ZWH A;  2E30 A;  4NDC A;  1BJF A;  1AP4 A;  2H61 C;  3CR5 X;  4MBE A;  2Q91 A;  3DF0 B;  4CFQ A;  1L2O C;  3I5G B;  1N2D A;  1J1E A;  1EJ3 A;  1U5I B;  1UP5 A;  3H4S E;  3RM1 A;  3TDU A;  4DS7 A;  1A03 A;  2BKH B;  1A75 B;  1WRK A;  1Y1X A;  2LVK A;  2K0J A;  1WDC C;  4DRW A;  1CFC A;  4OVN F;  3TUY C;  2WCB A;  2LAP A;  1REC A;  4FTG A;  4WRI A;  1FPW A;  2G2B A;  3BOW B;  1YX8 A;  5JOL A;  2SAS A;  4P2Y B;  2KQ6 A;  2K61 A;  3NSO A;  2L51 A;  3HX4 A;  2KGR A;  2M1U A;  3I5H B;  1SKT A;  5HLO A;  1TN4 A;  3JVT B;  4NDB A;  3EK8 A;  4GNK B;  1DGV A;  2GGM A;  1NSH A;  5AFP A;  1IQ3 A;  5CSF A;  1AJ5 A;  1R6P A;  1BOC A;  2F3Z A;  4PCW A;  2LUC A;  1DJX A;  1AUI B;  2KQY A;  2PAS A;  4QJ3 B;  1B4C A;  1DMO A;  1J1D A;  2WOR A;  1A4P A;  3IF7 A;  3FS7 A;  2HQ8 A;  3PN7 C;  5HKW A;  2DOQ A;  2F8P A;  2Y1M A;  1QX2 A;  2M7N A;  2K7O A;  1F55 A;  1KK7 Z;  4JQ0 D;  1BMO A;  1RTP 1;  2G9B A;  1EG3 A;  4JWQ A;  1QVI Z;  2BBN A;  3MSE B;  1NUB A;  3O78 A;  4PHN A;  2LVI A;  2BE6 A;  2LP2 A;  1W7J B;  2BKI B;  2HPS A;  1CDM A;  4YGC B;  1SNL A;  2FCD A;  1KK8 B;  1K9U A;  1NPQ A;  2M7L A;  4HSZ A;  3RLZ A;  1JC2 A;  2LNK A;  1WRZ A;  1M46 A;  4I5N B;  5ER4 X;  1DJH A;  1S6C A;  1SYM A;  1JFJ A;  2L0P A; 
#chains in the Genus database with same CATH topology
 1UUS A;  1ZMZ A;  4N1G A;  1M63 B;  5D3O A;  3L47 A;  1G4Y R;  2HET A;  1B47 A;  3S0D A;  1EH2 A;  2R2I A;  1JBA A;  1QIW A;  1L2O B;  3I5G C;  3R1V A;  1YRU B;  3CR2 A;  3EVU A;  4KYN A;  1TRF A;  1S5G Z;  2WC8 A;  3ICB A;  1XFY O;  1SSE B;  5IBW A;  1CDN A;  1NX1 A;  2NCO A;  3D10 A;  2QEB A;  1YRT B;  4MLW A;  3Q8I A;  1EXR A;  3NSL A;  5D7F A;  2K7C A;  2LCP A;  3VRQ A;  1GJY A;  3PM2 A;  4N1F A;  4Q04 A;  4D1E A;  1J7P A;  2PYQ A;  3PAT A;  4U8D A;  4YRU A;  3LL8 B;  2LM5 A;  2M9G A;  1XK4 C;  1CM4 A;  5AXI A;  4PHM A;  1MHO A;  3GK1 A;  4ORA B;  1Z4H A;  3NGV A;  4N5X A;  1TUZ A;  1QJT A;  3CZ1 A;  1OOI X;  5AER A;  2KYF A;  2M3W A;  5KSZ A;  3BUW B;  2MA2 A;  2Y5I A;  3D0Y A;  1Q80 A;  3FE8 A;  1KSO A;  3TUY B;  3SS4 A;  1KQM C;  3I5F B;  3EG5 B;  3FE6 A;  2KYC A;  5DKR A;  3DVE A;  3E3R A;  1OMR A;  1KWO C;  1KFU S;  3D77 A;  1S36 A;  1HQV A;  2KLE A;  2LMU A;  3SG2 A;  1CTR A;  1K2H A;  2WC5 A;  1SCV A;  2CNP A;  3DZT A;  2MJW B;  4YBH B;  1C3Z A;  1GGZ A;  1K95 A;  2M0R A;  3KO0 A;  2K2A A;  3I5H C;  1QLK A;  4AQI A;  5FI2 A;  5AEQ A;  1DF0 A;  1DJZ A;  1SY9 A;  2BE4 A;  2PMY A;  3BXK A;  2NCP A;  4OR9 B;  2ISD A;  3VGO A;  3EVR A;  3B7A A;  3CAB A;  1OOJ A;  2BAP A;  2Y4Q A;  3CR4 X;  2YGU A;  3CLN A;  2OTG C;  1B8L A;  4ZCV A;  4C0K A;  1B1G A;  2IS9 A;  2KFH A;  4YGE B;  3BFH A;  2CTN A;  2WCJ A;  1K90 D;  3LK0 A;  4YGB B;  1YVH A;  1PVA A;  1NX3 A;  3DF0 A;  1DJW A;  2PAL A;  3SIB A;  4ZCU A;  1LA0 A;  4WQ2 A;  2MLE C;  1RWY A;  2MRD A;  3VRR A;  2WOS A;  1KK8 C;  1XFW O;  1B7T Z;  4GBA A;  1OOF A;  2AMI A;  2PSR A;  1XFX O;  3OB2 B;  3CZT X;  4QJ4 B;  3CTN A;  1BF5 A;  1NIW A;  1A29 A;  1ZFS A;  3IVT A;  4OKH A;  1J7R A;  2KGB C;  1DEL A;  2NZ0 A;  4JPZ B;  5FI7 A;  5HKZ A;  3VB1 A;  4NQG A;  1CNP A;  3OB1 B;  3LK1 A;  3GK2 A;  3HCM A;  4C0L A;  1CB1 A;  1XFZ O;  1U5I A;  1GM0 A;  1K9P A;  1XA5 A;  4INW A;  1B8R A;  2BCB A;  4PHK A;  1TUJ A;  1ZOT B;  3QRX A;  2CBL A;  2HF5 A;  2KI4 B;  5I8N A;  1CDP A;  1XVJ A;  1KFX L;  1BR4 B;  5DIC A;  1PRW A;  1FBV A;  1NCY A;  3SS5 A;  1WLZ A;  1GQM A;  2BEC A;  3D75 A;  2WCM A;  2LE9 B;  2KAX A;  1KCY A;  2TN4 A;  1MWN A;  2I18 A;  2KLD A;  3D78 A;  1MUX A;  3FIA A;  2KAY A;  3SG7 A;  3VRN A;  1LS8 A;  1NX0 A;  2LAN A;  4GGF A;  1UWO A;  1EL4 A;  1DF0 B;  2L98 A;  1OW4 A;  2PQL A;  1C07 A;  2O5G A;  3ZNI A;  4NDD A;  1X02 A;  4IJ7 A;  2E6W A;  3OX6 A;  1AJ4 A;  1M39 A;  1P28 A;  1PUL A;  2EC6 C;  1BLQ A;  1MR8 A;  1LXF C;  1TNX A;  3DVK A;  3PFV A;  4IL1 A;  4PE4 A;  3DVJ A;  1NP8 A;  1JF0 A;  2EHB A;  1SBJ A;  2JPO A;  3BYA A;  3KPX A;  2ZKM X;  5CPV A;  3BUO B;  1UHH A;  1OSA A;  1DVI A;  3R1P A;  1E8A A;  4AQJ A;  3TDI A;  1L7Z A;  2JU0 A;  3M0W A;  4MZJ A;  1KWO B;  1XFR A;  1UHN A;  2WCF A;  2OTG B;  2BCA A;  2F3Y A;  3EKJ A;  3GOF A;  5I2L A;  2JTZ A;  1YX7 A;  3PN7 B;  1CFD A;  2LLT A;  3O4Y A;  4GFT A;  2F33 A;  3NSK A;  2ZN8 A;  3KEV A;  3WXA A;  4ICB A;  1CKK A;  1PVB A;  1LVC D;  2BCX A;  2JNX A;  3D73 A;  3L4L A;  1EG4 A;  1OZO A;  1NWD A;  2P6B B;  2LV7 A;  1S26 D;  2JQ6 A;  1RJV A;  1Y6W A;  2KFG A;  4PAL A;  1JFK A;  1SW8 A;  2LHI A;  4CLN A;  5KTY A;  1DJI A;  2OS8 B;  1SRA A;  1K8U A;  2JTT A;  3EK4 A;  1GGW A;  1SCM B;  2K7D A;  4YGD B;  3NXA A;  1VRK A;  2LVV A;  2ZNE A;  1UHK A;  4HRE E;  4CPV A;  1FF1 A;  1A2X A;  1WLM A;  2V53 A;  1SL8 A;  3TS5 B;  2F2O A;  1IGV A;  1WRL A;  4PT1 A;  5EL2 A;  4A4C A;  2H2K A;  2WCH A;  3GK4 X;  1F70 A;  1TIZ A;  1YVL A;  2KBM A;  2RGI A;  3OX5 A;  4GGN A;  1B8C A;  5DKN A;  1JSA A;  2KI4 C;  3PM8 A;  4TNC A;  2L50 A;  4HRH A;  1CLL A;  3K21 A;  3UNW A;  3O6B A;  4DCK A;  1S3P A;  1KK7 Y;  3NHI A;  3FE9 A;  4MVF A;  1TNQ A;  5J3X A;  2JT8 A;  3DXL A;  3EK7 A;  4AOM A;  3DY9 A;  1JWD A;  1RRO A;  2JXC A;  2K2F A;  4GGF C;  2NXQ A;  5D69 A;  2LHL A;  3IQQ A;  1DEK A;  4XJK A;  3A4U B;  1B9A A;  1QAS A;  1F54 A;  4CID A;  2LUX A;  4FQO A;  1ALW A;  1W7I B;  1AVS A;  1KSM A;  1OMD A;  1Y1U A;  2NLN A;  4R1E A;  1FW4 A;  2Q4U A;  2A4J A;  2EC6 B;  1XO5 A;  2QPT A;  1MXL C;  1KQV A;  4PDZ A;  1S5G Y;  1CLM A;  3CZ2 A;  4YGA A;  1S1E A;  5HLV A;  3VRO A;  1SR6 C;  4GUK A;  4MEW A;  3SJS A;  2FCE A;  5GQQ C;  5G08 A;  1S6J A;  2JT3 A;  2MLF C;  2LVJ A;  3S0E A;  1CMF A;  4CFR A;  1YUT A;  2LLU A;  1MF8 B;  1W9Z A;  3DYE A;  3I5I B;  4PE0 A;  1TCO B;  5B8I B;  5JJG A;  1LIN A;  2I7A A;  1D1O A;  2FJY A;  3PLF B;  1YR5 A;  3KF9 A;  2ZN9 A;  4P5O E;  3I5I C;  2JXL A;  1J55 A;  4MN0 A;  1OQP A;  3BUX B;  2CCM A;  1OMV A;  1PAL A;  2F2P A;  2MAZ A;  3PAL A;  4WQ3 A;  1CDL A;  2MHH A;  2BL0 C;  1K9K A;  3EKH A;  1JUO A;  1MQ1 A;  2P71 A;  1IWQ A;  3JTD C;  1QIV A;  1IKU A;  2LC5 A;  4PHJ A;  4UPG A;  3O4X A;  3AAK A;  3TZ1 A;  2KNE A;  4F0Z B;  2COL B;  1R2U A;  4F7F A;  1TNP A;  3TS5 C;  2K7B A;  1QLS A;  4MZL A;  4BY4 A;  1IRJ A;  2CT9 A;  1XFV O;  1K96 A;  1UUR A;  3SG4 A;  3OHM B;  1LA3 A;  3QME A;  1K94 A;  1DT7 B;  2VRG A;  4JD9 A;  2EGD A;  1K93 D;  3NSI A;  3R1O A;  2OS8 C;  4E68 A;  1JC2 A;  1TOP A;  4M2P A;  4MZK A;  1CFP A;  1SCM C;  4MRY A;  1QVI Y;  1QWV A;  5I2O A;  2ERB A;  1CMG A;  5DKQ A;  1IH0 A;  4GPL B;  1NCZ A;  3B88 A;  1N65 A;  1KFX S;  3PJI A;  4OV2 A;  4I5K A;  2K8M B;  5HKY A;  3LCP C;  2JOJ A;  3NHT A;  1CFF A;  1AHR A;  2QDI A;  1FI5 A;  1OZS A;  1Y1A A;  2OPO A;  1F8H A;  5F6T A;  4DUQ A;  1SL7 A;  5CSJ A;  5I2Q A;  1NX2 A;  3CGA A;  1H8B A;  1SPY A;  1AK8 A;  3PSR A;  4A4B A;  1V1F A;  1J7Q A;  2B1U A;  2JZI A;  3O2P A;  3SIA A;  3D0Y B;  2P70 A;  1S6I A;  1QAT A;  4M2Q A;  1OOH A;  4OCI A;  2M8U A;  5CSN A;  3KHE A;  2L4I A;  1J7O A;  1OE9 B;  1BT6 A;  2ZRS A;  2LMV A;  1V1G A;  1ZAC A;  1BU3 A;  1MXE A;  2JNF A;  1UHI A;  1SR6 B;  1ALV A;  4PE1 A;  1PSB A;  2M49 B;  2KOT A;  4ORC B;  3SG6 A;  2KI6 C;  1WY9 A;  3FWC A;  3IQO A;  4JKT A;  5ER5 A;  4C0J A;  2H61 A;  5AAN A;  2FOT A;  1SMG A;  2QEO A;  3OBV A;  1DJY A;  4GAO A;  2K60 A;  1BOD A;  1XYD A;  3DVM A;  3A8R A;  4M2O A;  1YUR A;  1NCX A;  1RFJ A;  3CS1 A;  2ZRT A;  3OP0 A;  4YI9 A;  1BR1 B;  4ORB B;  2LLS A;  2M1K B;  2JC2 A;  3FWB A;  3WHU B;  5CSI A;  1WDC B;  2ZFD A;  2KBI A;  1KFU L;  3AKA A;  4YI8 A;  3WHT B;  2JRF A;  3UO9 A;  3VRP A;  2WC6 A;  2BL0 B;  1QV1 A;  3BJH A;  1YUU A;  3JTD B;  1PSR A;  2MBX A;  4BY5 A;  5KU1 A;  4ETO A;  1M31 A;  2L2E A;  2M97 A;  3SG3 A;  1QS7 A;  1Y0V H;  3C1V A;  2BNX A;  3BOW A;  3CWG A;  1BG1 A;  1G33 A;  1IG5 A;  1YTZ C;  2JWW A;  2KFF A;  3F45 A;  3L4A A;  3LLE A;  1IQ5 A;  2HQW A;  5HYD A;  1TCF A;  1CM1 A;  4HRG A;  4XYN A;  1ORG A;  3AAJ A;  2SCP A;  1ODB A;  1IJ5 A;  1KQM B;  1PK0 D;  3I5F C;  3TDZ A;  1A75 A;  3WNX B;  1DC1 A;  2QEV A;  4DIR A;  1F4Q A;  1XK4 A;  1DTL A;  1QXP A;  2JPT A;  4QJ5 B;  1B7T Y;  2WCE A;  3R72 A;  1YUS A;  2WCK A;  2GGZ A;  3JVT C;  1XFU O;  4MSP A;  4USL A;  1F71 A;  3BUN B;  1QTX A;  2BBM A;  1DJG A;  3BFA A;  4I5L B;  1QX7 A;  2KI6 D;  2PVB A;  1N0Y A;  1F4O A;  4MRX A;  5K89 A;  3B87 A;  2WND A;  1IJ6 A;  3EVV A;  3S0B A;  2LP3 A;  1FI6 A;  2AAO A;  4PE7 A;  1HT9 A;  2Y1N A;  3N7H A;  2QAC A;  2I94 A;  2KPH A;  5I94 A;  5FYX A;  3V2L A;  1ZUZ A;  1G8I A;  3BUM B;  2JT0 A;  1SL9 A;  4XJK B;  3SG5 A;  5BPJ A;  1JF2 A;  2GV5 A;  2JUL A;  2KDH A;  2L5X B;  4I5J A;  5TNC A;  5HL1 A;  1TNW A;  1LKJ A;  1TTX A;  2I2R E;  1RK9 A;  2L2C A;  2D8N A;  3AKB A;  5PAL A;  1DGU A;  2AUC A;  1C7W A;  2CXJ A;  2KAV A;  1QV0 A;  2KHN A;  1H4B A;  3CZ0 A;  1NYA A;  2M29 A;  2O60 A;  2KSP A;  2ZND A;  1QX5 B;  4L9M A;  2L4H A;  2PRU A;  3SS3 A;  3DD4 A;  1C7V A;  1UHJ A;  3BQ3 A;  2LMT A;  3D74 A;  2FJU B;  1T14 A;  1CLB A;  1SK6 D;  1M45 A;  3B86 A;  3ZWH A;  2E30 A;  4NDC A;  1BJF A;  1AP4 A;  2H61 C;  3CR5 X;  4MBE A;  2Q91 A;  3DF0 B;  4CFQ A;  1L2O C;  3BFB A;  1N2D A;  3I5G B;  1J1E A;  1EJ3 A;  3OGN A;  1U5I B;  1UP5 A;  3H4S E;  3RM1 A;  3TDU A;  4DS7 A;  1A03 A;  3S0A A;  3D76 A;  2BKH B;  1A75 B;  1WRK A;  3B6X A;  1Y1X A;  1DQE A;  2LVK A;  2K0J A;  1WDC C;  4DRW A;  1CFC A;  4INX A;  4OVN F;  3TUY C;  2WCB A;  2LAP A;  1REC A;  4FTG A;  4WRI A;  1FPW A;  2G2B A;  3BOW B;  1YX8 A;  5JOL A;  2SAS A;  4P2Y B;  2KQ6 A;  2K61 A;  2H8V A;  3NSO A;  2L51 A;  3HX4 A;  2KGR A;  2M1U A;  3I5H B;  1SKT A;  5HLO A;  1TN4 A;  3JVT B;  4NDB A;  3EK8 A;  1TWO A;  4GNK B;  1DGV A;  2GGM A;  1NSH A;  3CDN A;  5AFP A;  1IQ3 A;  5CSF A;  1AJ5 A;  1R6P A;  1BOC A;  3S0F A;  4OZD A;  2F3Z A;  4PCW A;  2LUC A;  3RZS A;  2L5Y A;  1DJX A;  1OOG A;  1AUI B;  2KQY A;  2PAS A;  3K1E A;  4QJ3 B;  1B4C A;  1DMO A;  1J1D A;  2WOR A;  1A4P A;  3IF7 A;  2QEH A;  2HQ8 A;  3FS7 A;  3PN7 C;  1IIO A;  5HKW A;  2DOQ A;  2F8P A;  2Y1M A;  1QX2 A;  2M7N A;  2K7O A;  3S0G A;  1F55 A;  1KK7 Z;  4JQ0 D;  1BMO A;  1RTP 1;  2G9B A;  1EG3 A;  4JWQ A;  1QVI Z;  2BBN A;  3MSE B;  1NUB A;  2GTE A;  3O78 A;  2LVI A;  3CYZ A;  4FQT A;  4PHN A;  2BE6 A;  2LP2 A;  1W7J B;  2BKI B;  2HPS A;  1CDM A;  2WCL A;  4YGC B;  5FI6 A;  1SNL A;  2FCD A;  1KK8 B;  1K9U A;  1NPQ A;  2M7L A;  4HSZ A;  3RLZ A;  1C3Y A;  2LNK A;  1WRZ A;  1Z2C B;  1M46 A;  4I5N B;  5ER4 X;  1DJH A;  1S6C A;  1SYM A;  1JFJ A;  2L0P A; 
#chains in the Genus database with same CATH homology
 1UUS A;  1ZMZ A;  4N1G A;  1M63 B;  1G4Y R;  2HET A;  1B47 A;  1EH2 A;  2R2I A;  1JBA A;  1QIW A;  1L2O B;  3I5G C;  1YRU B;  3CR2 A;  3EVU A;  1TRF A;  1S5G Z;  2WC8 A;  3ICB A;  1XFY O;  1CDN A;  5IBW A;  1NX1 A;  2NCO A;  3D10 A;  1YRT B;  4MLW A;  1EXR A;  3NSL A;  5D7F A;  2K7C A;  2LCP A;  3VRQ A;  1GJY A;  4N1F A;  4Q04 A;  4D1E A;  1J7P A;  3PAT A;  4U8D A;  4YRU A;  3LL8 B;  2LM5 A;  2M9G A;  1XK4 C;  1CM4 A;  5AXI A;  4PHM A;  1MHO A;  3GK1 A;  4ORA B;  4N5X A;  1QJT A;  5AER A;  2KYF A;  2M3W A;  5KSZ A;  3BUW B;  2MA2 A;  2Y5I A;  3D0Y A;  1Q80 A;  1KSO A;  3TUY B;  1KQM C;  3I5F B;  2KYC A;  5DKR A;  3DVE A;  3E3R A;  1OMR A;  1KWO C;  1KFU S;  1S36 A;  1HQV A;  2LMU A;  3SG2 A;  1CTR A;  1K2H A;  1SCV A;  2CNP A;  2MJW B;  4YBH B;  1GGZ A;  1K95 A;  2M0R A;  3KO0 A;  2K2A A;  3I5H C;  1QLK A;  4AQI A;  5AEQ A;  1DF0 A;  1DJZ A;  1SY9 A;  2BE4 A;  2PMY A;  3BXK A;  2NCP A;  4OR9 B;  2ISD A;  3VGO A;  3EVR A;  1OOJ A;  2Y4Q A;  3CR4 X;  3CLN A;  2OTG C;  1B8L A;  4ZCV A;  4C0K A;  1B1G A;  2IS9 A;  2KFH A;  4YGE B;  2CTN A;  4YGB B;  1K90 D;  3LK0 A;  1YVH A;  1PVA A;  1NX3 A;  3DF0 A;  1DJW A;  2PAL A;  3SIB A;  4ZCU A;  1LA0 A;  4WQ2 A;  2MLE C;  1RWY A;  2MRD A;  3VRR A;  2WOS A;  1KK8 C;  1XFW O;  1B7T Z;  4GBA A;  2AMI A;  2PSR A;  1XFX O;  3OB2 B;  3CZT X;  4QJ4 B;  3CTN A;  1BF5 A;  1NIW A;  1A29 A;  1ZFS A;  4OKH A;  1J7R A;  2KGB C;  2NZ0 A;  4JPZ B;  5HKZ A;  4NQG A;  1CNP A;  3OB1 B;  3LK1 A;  3GK2 A;  3HCM A;  4C0L A;  1CB1 A;  1XFZ O;  1U5I A;  1K9P A;  1XA5 A;  1B8R A;  2BCB A;  4PHK A;  1ZOT B;  3QRX A;  2CBL A;  2HF5 A;  2KI4 B;  5I8N A;  1CDP A;  1XVJ A;  1KFX L;  1BR4 B;  1PRW A;  1FBV A;  1NCY A;  1WLZ A;  1GQM A;  2BEC A;  2LE9 B;  2KAX A;  1KCY A;  2TN4 A;  1MWN A;  2I18 A;  1MUX A;  3FIA A;  2KAY A;  3SG7 A;  3VRN A;  1NX0 A;  2LAN A;  4GGF A;  1UWO A;  1EL4 A;  1DF0 B;  2L98 A;  1C07 A;  2O5G A;  3ZNI A;  4NDD A;  1X02 A;  2E6W A;  3OX6 A;  1AJ4 A;  1M39 A;  1PUL A;  2EC6 C;  1BLQ A;  1MR8 A;  1LXF C;  1TNX A;  3DVK A;  3PFV A;  4IL1 A;  4PE4 A;  3DVJ A;  1NP8 A;  1JF0 A;  2EHB A;  1SBJ A;  3BYA A;  3KPX A;  2ZKM X;  5CPV A;  3BUO B;  1UHH A;  1OSA A;  1DVI A;  1E8A A;  4AQJ A;  3TDI A;  1L7Z A;  2JU0 A;  3M0W A;  4MZJ A;  1KWO B;  1UHN A;  2WCF A;  2OTG B;  2BCA A;  2F3Y A;  3EKJ A;  3GOF A;  5I2L A;  2JTZ A;  1YX7 A;  3PN7 B;  1CFD A;  2LLT A;  3O4Y A;  4GFT A;  2F33 A;  3NSK A;  2ZN8 A;  3KEV A;  3WXA A;  4ICB A;  1CKK A;  1PVB A;  1LVC D;  2BCX A;  2JNX A;  1EG4 A;  1OZO A;  1NWD A;  2P6B B;  2LV7 A;  1S26 D;  2JQ6 A;  1RJV A;  1Y6W A;  2KFG A;  4PAL A;  1JFK A;  1SW8 A;  2LHI A;  4CLN A;  5KTY A;  1DJI A;  2OS8 B;  1SRA A;  1K8U A;  2JTT A;  3EK4 A;  1GGW A;  1SCM B;  2K7D A;  4YGD B;  3NXA A;  1VRK A;  2LVV A;  2ZNE A;  1UHK A;  4HRE E;  4CPV A;  1FF1 A;  1A2X A;  1WLM A;  2V53 A;  1SL8 A;  3TS5 B;  2F2O A;  1IGV A;  1WRL A;  4A4C A;  2H2K A;  3GK4 X;  1F70 A;  1TIZ A;  1YVL A;  2KBM A;  2RGI A;  3OX5 A;  4GGN A;  1B8C A;  5DKN A;  1JSA A;  2KI4 C;  3PM8 A;  4TNC A;  2L50 A;  4HRH A;  1CLL A;  3K21 A;  3O6B A;  4DCK A;  1S3P A;  1KK7 Y;  4MVF A;  1TNQ A;  5J3X A;  2JT8 A;  3EK7 A;  4AOM A;  1JWD A;  1RRO A;  2JXC A;  2K2F A;  4GGF C;  2NXQ A;  5D69 A;  2LHL A;  3IQQ A;  4XJK A;  3A4U B;  1B9A A;  1QAS A;  1F54 A;  4CID A;  2LUX A;  4FQO A;  1ALW A;  1W7I B;  1AVS A;  1KSM A;  1OMD A;  1Y1U A;  2NLN A;  4R1E A;  1FW4 A;  2Q4U A;  2A4J A;  2EC6 B;  1XO5 A;  2QPT A;  1MXL C;  1KQV A;  4PDZ A;  1S5G Y;  1CLM A;  4YGA A;  5HLV A;  1S1E A;  3VRO A;  1SR6 C;  4GUK A;  4MEW A;  3SJS A;  2FCE A;  5GQQ C;  5G08 A;  1S6J A;  2JT3 A;  2MLF C;  2LVJ A;  1CMF A;  4CFR A;  1YUT A;  2LLU A;  1MF8 B;  4PE0 A;  3I5I B;  1TCO B;  5B8I B;  5JJG A;  1LIN A;  2I7A A;  1D1O A;  3PLF B;  1YR5 A;  3KF9 A;  2ZN9 A;  4P5O E;  3I5I C;  2JXL A;  1J55 A;  4MN0 A;  1OQP A;  3BUX B;  2CCM A;  1OMV A;  1PAL A;  2F2P A;  2MAZ A;  3PAL A;  4WQ3 A;  1CDL A;  2MHH A;  2BL0 C;  1K9K A;  3EKH A;  1JUO A;  1MQ1 A;  1IWQ A;  3JTD C;  1QIV A;  1IKU A;  2LC5 A;  4PHJ A;  4UPG A;  3AAK A;  3TZ1 A;  2KNE A;  4F0Z B;  2COL B;  1R2U A;  1TNP A;  3TS5 C;  2K7B A;  1QLS A;  4MZL A;  4BY4 A;  1IRJ A;  2CT9 A;  1XFV O;  1K96 A;  1UUR A;  3SG4 A;  3OHM B;  1LA3 A;  1K94 A;  1DT7 B;  2VRG A;  2EGD A;  1K93 D;  3NSI A;  2OS8 C;  4E68 A;  1TOP A;  4M2P A;  4MZK A;  1CFP A;  1SCM C;  4MRY A;  1QVI Y;  5I2O A;  1CMG A;  5DKQ A;  1IH0 A;  4GPL B;  1NCZ A;  1N65 A;  1KFX S;  4OV2 A;  4I5K A;  2K8M B;  5HKY A;  3LCP C;  2JOJ A;  1CFF A;  1AHR A;  1FI5 A;  1OZS A;  1Y1A A;  2OPO A;  1F8H A;  5F6T A;  4DUQ A;  1SL7 A;  5CSJ A;  5I2Q A;  1NX2 A;  3CGA A;  1H8B A;  1SPY A;  1AK8 A;  3PSR A;  4A4B A;  1V1F A;  1J7Q A;  2B1U A;  2JZI A;  3O2P A;  3SIA A;  3D0Y B;  1S6I A;  1QAT A;  4M2Q A;  4OCI A;  2M8U A;  5CSN A;  3KHE A;  2L4I A;  1J7O A;  1OE9 B;  1BT6 A;  2ZRS A;  2LMV A;  1V1G A;  1ZAC A;  1BU3 A;  1MXE A;  2JNF A;  1UHI A;  1SR6 B;  1ALV A;  4PE1 A;  1PSB A;  2M49 B;  2KOT A;  4ORC B;  3SG6 A;  2KI6 C;  1WY9 A;  3FWC A;  3IQO A;  5ER5 A;  4C0J A;  2H61 A;  5AAN A;  2FOT A;  1SMG A;  1DJY A;  4GAO A;  1BOD A;  1XYD A;  3DVM A;  3A8R A;  4M2O A;  1YUR A;  1NCX A;  1RFJ A;  3CS1 A;  2ZRT A;  3OP0 A;  4YI9 A;  1BR1 B;  4ORB B;  2LLS A;  2M1K B;  2JC2 A;  3FWB A;  3WHU B;  5CSI A;  1WDC B;  2ZFD A;  2KBI A;  1KFU L;  3AKA A;  4YI8 A;  3WHT B;  2JRF A;  3VRP A;  2BL0 B;  1QV1 A;  1YUU A;  3JTD B;  1PSR A;  2MBX A;  4BY5 A;  5KU1 A;  4ETO A;  1M31 A;  2L2E A;  2M97 A;  3SG3 A;  1QS7 A;  1Y0V H;  3C1V A;  3CWG A;  3BOW A;  1BG1 A;  1G33 A;  1IG5 A;  1YTZ C;  2JWW A;  2KFF A;  3F45 A;  3LLE A;  1IQ5 A;  2HQW A;  5HYD A;  1TCF A;  1CM1 A;  4HRG A;  4XYN A;  3AAJ A;  2SCP A;  1ODB A;  1IJ5 A;  1KQM B;  1PK0 D;  3I5F C;  3TDZ A;  1A75 A;  3WNX B;  4DIR A;  1F4Q A;  1XK4 A;  1DTL A;  1QXP A;  2JPT A;  4QJ5 B;  1B7T Y;  2WCE A;  1YUS A;  3JVT C;  2GGZ A;  4MSP A;  1XFU O;  4USL A;  1F71 A;  3BUN B;  1QTX A;  2BBM A;  1DJG A;  4I5L B;  1QX7 A;  2KI6 D;  2PVB A;  1N0Y A;  1F4O A;  4MRX A;  5K89 A;  2WND A;  1IJ6 A;  3EVV A;  2LP3 A;  1FI6 A;  2AAO A;  4PE7 A;  1HT9 A;  2Y1N A;  2QAC A;  2I94 A;  5FYX A;  1ZUZ A;  1G8I A;  3BUM B;  2JT0 A;  1SL9 A;  4XJK B;  3SG5 A;  5BPJ A;  1JF2 A;  2GV5 A;  2JUL A;  2KDH A;  2L5X B;  4I5J A;  5TNC A;  1TNW A;  1LKJ A;  1TTX A;  2I2R E;  1RK9 A;  5PAL A;  2D8N A;  3AKB A;  1H4B A;  1DGU A;  2AUC A;  1C7W A;  2CXJ A;  2KAV A;  1QV0 A;  2KHN A;  1NYA A;  2M29 A;  2O60 A;  2KSP A;  2ZND A;  1QX5 B;  4L9M A;  2L4H A;  2PRU A;  1C7V A;  3DD4 A;  1UHJ A;  3BQ3 A;  2LMT A;  2FJU B;  1CLB A;  1SK6 D;  1M45 A;  3ZWH A;  2E30 A;  4NDC A;  1BJF A;  1AP4 A;  2H61 C;  3CR5 X;  4MBE A;  2Q91 A;  3DF0 B;  4CFQ A;  1L2O C;  3I5G B;  1N2D A;  1J1E A;  1EJ3 A;  1U5I B;  1UP5 A;  3H4S E;  3RM1 A;  3TDU A;  4DS7 A;  1A03 A;  2BKH B;  1A75 B;  1WRK A;  1Y1X A;  2LVK A;  2K0J A;  1WDC C;  4DRW A;  1CFC A;  4OVN F;  3TUY C;  2WCB A;  2LAP A;  1REC A;  4FTG A;  4WRI A;  1FPW A;  2G2B A;  3BOW B;  1YX8 A;  5JOL A;  2SAS A;  4P2Y B;  2KQ6 A;  2K61 A;  3NSO A;  2L51 A;  3HX4 A;  2KGR A;  2M1U A;  3I5H B;  1SKT A;  5HLO A;  1TN4 A;  3JVT B;  4NDB A;  3EK8 A;  4GNK B;  1DGV A;  2GGM A;  1NSH A;  5AFP A;  1IQ3 A;  5CSF A;  1AJ5 A;  1R6P A;  1BOC A;  2F3Z A;  4PCW A;  2LUC A;  1DJX A;  1AUI B;  2KQY A;  2PAS A;  4QJ3 B;  1B4C A;  1DMO A;  1J1D A;  2WOR A;  1A4P A;  3IF7 A;  3FS7 A;  2HQ8 A;  3PN7 C;  5HKW A;  2DOQ A;  2F8P A;  2Y1M A;  1QX2 A;  2M7N A;  2K7O A;  1F55 A;  1KK7 Z;  4JQ0 D;  1BMO A;  1RTP 1;  2G9B A;  1EG3 A;  4JWQ A;  1QVI Z;  2BBN A;  3MSE B;  1NUB A;  3O78 A;  4PHN A;  2LVI A;  2BE6 A;  2LP2 A;  1W7J B;  2BKI B;  2HPS A;  1CDM A;  4YGC B;  1SNL A;  2FCD A;  1KK8 B;  1K9U A;  1NPQ A;  2M7L A;  4HSZ A;  3RLZ A;  1JC2 A;  2LNK A;  1WRZ A;  1M46 A;  4I5N B;  5ER4 X;  1DJH A;  1S6C A;  1SYM A;  1JFJ A;  2L0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...