4HREE

Crystal structure of p11/annexin a2 heterotetramer in complex with smarca3 peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
91
structure length
91
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Annexin A2
publication title SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Calcium-binding protein
total genus 23
structure length 91
sequence length 91
chains with identical sequence F, I, J
ec nomenclature
pdb deposition date 2012-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4hreE00
1J7QA 2M1KB 3PFVA 4PHKA 1SCMC 1UHIA 4JWQA 1CLMA 3DD4A 2TN4A 3ZWHA 3C1VA 1W7IB 3MSEB 1TN4A 3KF9A 2ZRSA 4MVFA 2COLB 4C0LA 1AK8A 4DRWA 2PMYA 1LKJA 2KFGA 4CIDA 1RJVA 2LM5A 4YGAA 1ZACA 1DTLA 2M9GA 1CFDA 2HETA 2H61A 1OOJA 1SRAA 1CDLA 1IJ6A 2EC6C 2MBXA 1XK4A 2Q4UA 1NX2A 1Q80A 1QV0A 5HKYA 1XFYO 1C7WA 1WRZA 2KHNA 3O2PA 3HCMA 1WRLA 5AEQA 2JQ6A 1V1GA 5TNCA 3AKAA 1AUIB 2E6WA 1NX1A 4C0KA 2KYCA 3BUOB 1TNXA 1D1OA 1G33A 1LVCD 2LAPA 2F2OA 3OB1B 1K96A 1RROA 4I5KA 2LLSA 4WQ2A 1B7TZ 1SYMA 5AANA 1IQ3A 4CFRA 1UHNA 5CSJA 1XO5A 1QLKA 2JT0A 3NSIA 4PCWA 1B9AA 2D8NA 3EVUA 1QJTA 2JTTA 4MRXA 1TRFA 1UUSA 4M2OA 3WHTB 1F55A 1BU3A 3RLZA 3FS7A 5I2QA 4PHJA 1OMRA 2V53A 4AQIA 4QJ4B 1C7VA 1S5GZ 4XJKA 1KK7Z 1ODBA 3I5FC 1MXLC 1BLQA 3BUWB 3IF7A 1J1EA 1Y1UA 2K7OA 2KDHA 1M39A 1NX0A 3H4SE 1SPYA 4DCKA 4YI8A 1CLLA 1DVIA 4JPZB 2KI4C 1W7JB 1JSAA 3FIAA 2OS8C 4M2PA 4HSZA 3PM8A 1K9UA 2KBIA 2KQYA 2F33A 2L5XB 3M0WA 1KWOC 2ZNDA 5AERA 1E8AA 1CTRA 4N5XA 3LK1A 1J1DA 4ORBB 3GOFA 1KQMC 4CFQA 2JULA 2K7DA 4MSPA 1J7RA 4PDZA 3SG3A 1FW4A 4GAOA 1B8CA 2MA2A 1M63B 1OZSA 4OV2A 1YVHA 2MJWB 2LNKA 1S3PA 2LLUA 2GGMA 3BYAA 3VRPA 2ZN8A 1MQ1A 3BUXB 1S6CA 3NSKA 4NDBA 1DJGA 4GNKB 3D10A 2LCPA 2KSPA 1NIWA 1Y0VH 1TIZA 2HPSA 4P2YB 1TTXA 1L2OB 3SG2A 1JFKA 1TNWA 1SKTA 2KOTA 3RM1A 4GGFA 1NWDA 2F3YA 3DVMA 4PE7A 2LUXA 1S26D 1QIVA 1YUSA 1NYAA 2AUCA 2PVBA 2JNFA 3LLEA 1PULA 4MZLA 1DGVA 1NUBA 3SIBA 5D7FA 5KTYA 1J7PA 4A4CA 3O4YA 4JQ0D 1EXRA 1ZFSA 3VRRA 4DS7A 1UURA 2WCEA 4C0JA 1JF2A 4HREE 3PLFB 2NCPA 1K94A 1RTP1 2F2PA 2GV5A 1TCFA 4HRHA 1UHHA 2JXCA 4YRUA 2ZKMX 4L9MA 1PVAA 1DGUA 1WRKA 1QXPA 1CMFA 4CPVA 1CDPA 1WY9A 3LCPC 2L4HA 3SG5A 4FTGA 2MLEC 2CT9A 1XFUO 3TZ1A 1SK6D 2O5GA 3AAKA 3DVJA 2NZ0A 5AFPA 3OX6A 2Y1MA 3CR5X 4USLA 2LUCA 1BR1B 4OR9B 4I5NB 4Q04A 4NQGA 1K9PA 1DJYA 1OE9B 4N1GA 2JT3A 1B7TY 2FJUB 2LMUA 2PSRA 1NPQA 1BR4B 2E30A 4ETOA 5DKNA 3BOWA 1IRJA 4GPLB 2BL0B 4ICBA 1CDMA 1YUUA 4I5LB 1NSHA 2HF5A 3SG7A 1DJXA 4PE0A 2VRGA 2M8UA 1EJ3A 1QX2A 2PRUA 2WCFA 5B8IB 5HYDA 4MRYA 5CSIA 1SR6B 1S5GY 1F4QA 1RK9A 3TUYC 3GK4X 2LVJA 5HKWA 1KK7Y 3OP0A 1KFUL 2M49B 2DOQA 3IQQA 1QX5B 1BODA 1R6PA 1PALA 4MBEA 1ZOTB 2ZN9A 1FPWA 5KSZA 2LP2A 2LHIA 2KAXA 3D0YA 3KEVA 1PVBA 3CTNA 2MAZA 1WDCB 1H4BA 1BT6A 2M3WA 2CXJA 1N65A 1QTXA 2KYFA 1K95A 2ZRTA 2LC5A 4UPGA 2SCPA 2Y5IA 2BCXA 4XYNA 1PSBA 1M31A 1YRUB 1EG3A 2LMTA 1S6IA 1L2OC 1K9KA 4ZCUA 4D1EA 3VRQA 1YR5A 3CR4X 1MWNA 1QATA 1K2HA 2EGDA 3EVRA 4PE4A 4FQOA 1K8UA 3EVVA 2I2RE 4MEWA 1DT7B 2QACA 1M45A 1XFZO 2CNPA 3TDUA 3DVKA 3EK7A 1L7ZA 1YX8A 4AOMA 1A2XA 2K2FA 1OMDA 1X02A 1NCXA 1DJWA 4ORAB 2G9BA 4GUKA 2CCMA 4OKHA 2LE9B 3O78A 2I7AA 2JU0A 3DF0A 2PASA 3GK1A 3VROA 2KQ6A 1SCMB 1UHKA 2KFHA 1GGWA 2BBMA 2M1UA 2BBNA 2ZFDA 3JVTB 3OHMB 1QV1A 2AAOA 2AMIA 2G2BA 4YGDB 4YBHB 2QPTA 1F54A 1KSOA 3PATA 4F0ZB 2EHBA 1N2DA 2KAVA 1CFCA 2B1UA 1YURA 3CGAA 4QJ5B 2FCDA 2ZNEA 3SG6A 1OSAA 1IJ5A 2JZIA 1PRWA 2K61A 3SIAA 2BL0C 2NLNA 4MZJA 1Y1XA 1H8BA 3PN7B 2F3ZA 1A4PA 1F8HA 3LL8B 1YTZC 3OX5A 1NX3A 1SY9A 2K8MB 1G8IA 1QVIY 3VRNA 1VRKA 5CPVA 2BKIB 2L51A 1IKUA 1AVSA 3CZTX 3I5HB 4HRGA 2P6BB 1SBJA 1SR6C 1UP5A 4GFTA 2BKHB 2JC2A 1HT9A 4NDCA 1SW8A 5CSNA 2L4IA 4XJKB 3NXAA 1BG1A 1OZOA 2M7LA 3BUMB 1C07A 2LV7A 5AXIA 1SL7A 4N1FA 4DIRA 1CM4A 2O60A 4OVNF 1GQMA 1ZMZA 1B8LA 4YGCB 1KQVA 5KU1A 2KI6D 1CMGA 1UHJA 1WDCC 1SCVA 1XVJA 1NCYA 1N0YA 2KAYA 3EK8A 2KGRA 5JJGA 1YRTB 2I18A 2LMVA 2LHLA 1XFXO 4R1EA 1CFFA 2H2KA 1QVIZ 1KK8B 1IWQA 1PK0D 5HLVA 3KO0A 5ER5A 3GK2A 3I5IB 2MLFC 5J3XA 1MUXA 2KI4B 1XFVO 2M7NA 2ISDA 1ZUZA 1F4OA 1EL4A 5PALA 1GGZA 3OB2B 1LA3A 3BXKA 2WOSA 3O6BA 2WORA 2CBLA 1A75A 2FOTA 2BE4A 3LK0A 1A03A 1JC2A 1FBVA 2JTZA 2K2AA 1KWOB 4YGEB 1RECA 2JOJA 2PALA 2NCOA 2KNEA 3ICBA 1QX7A 1CDNA 2H61C 1KQMB 2MHHA 3K21A 3TS5B 1A29A 2L50A 2L0PA 5GQQC 1IQ5A 1WLMA 2WCBA 1XK4C 1YVLA 3JVTC 4E68A 4WRIA 1JFJA 1IGVA 1UWOA 2L98A 4BY4A 4QJ3B 1AHRA 3FWBA 1Y1AA 1KFXS 2MRDA 4OCIA 2BE6A 2JWWA 4ZCVA 4GBAA 4AQJA 1ALVA 1YX7A 2CTNA 3WHUB 2BECA 2M0RA 4DUQA 1JUOA 2A4JA 3I5GB 1DJHA 5G08A 1GJYA 2K0JA 1EH2A 3TDZA 2OTGB 1BF5A 4MLWA 1B4CA 3PN7C 1B47A 2M97A 1K93D 2NXQA 4M2QA 1EG4A 2HQWA 1CKKA 5IBWA 1QIWA 2IS9A 4MZKA 3JTDB 4BY5A 1Y6WA 4TNCA 3I5HC 4GGNA 2LVKA 5DKRA 1F70A 1MHOA 1XFWO 1S36A 5FYXA 4PHMA 1M46A 1S1EA 1YUTA 2LVVA 3BQ3A 5HLOA 2M29A 2Y1NA 3WNXB 1FI5A 1OQPA 1IH0A 1LINA 1TOPA 3AAJA 1NP8A 2RGIA 3BOWB 1LA0A 1XYDA 3CWGA 5DKQA 1K90D 1QASA 5I8NA 2WC8A 1KFXL 5ER4X 3E3RA 3SG4A 2K7BA 4A4BA 4CLNA 1FF1A 1A75B 4IL1A 2KI6C 2LP3A 1TNQA 1ALWA 1SMGA 1U5IA 1QS7A 2JXLA 1MF8B 1BMOA 2R2IA 3QRXA 1FI6A 5BPJA 1AJ5A 1KK8C 4YI9A 2Q91A 3FWCA 3NSLA 1JF0A 3I5IC 1PSRA 2OPOA 2JRFA 2KBMA 3EKJA 4U8DA 2KGBC 2K7CA 3SJSA 1BOCA 5CSFA 1DF0A 1RFJA 5F6TA 1B1GA 2EC6B 2SASA 3D0YB 1MXEA 3A4UB 2BCBA 5I2LA 3TUYB 3A8RA 1RWYA 2KFFA 4YGBB 3CLNA 1J55A 1V1FA 2FCEA 2LANA 1CFPA 3EK4A 1AP4A 1SL8A 3TS5C 1XA5A 2WNDA 4GGFC 1MR8A 1SL9A 1KCYA 2HQ8A 3AKBA 5I2OA 1JBAA 5HKZA 3NSOA 1KSMA 1NCZA 1AJ4A 3DVEA 3PALA 5JOLA 5D69A 1J7OA 1DMOA 3I5GC 3CR2A 1CLBA 1SNLA 2BCAA 2JNXA 2OTGC 4PE1A 1S6JA 4MN0A 1F71A 3DF0B 1CM1A 1OMVA 1WLZA 3I5FB 1CB1A 1CNPA 2F8PA 3JTDC 3BUNB 3TDIA 2JT8A 3WXAA 1U5IB 3F45A 3CS1A 2JPTA 1TNPA 1B8RA 4I5JA 2GGZA 4PALA 3IQOA 4PHNA 3EKHA 1HQVA 2LVIA 5K89A 3KHEA 4ORCB 1DJZA 3KPXA 1QLSA 4NDDA 1TCOB 2OS8B 1IG5A 4P5OE 3PSRA 4WQ3A 3VGOA 1LXFC 1KFUS 1G4YR 2L2EA 2I94A 1DF0B 2LLTA 1BJFA 3ZNIA 1R2UA 2Y4QA 3HX4A 1JWDA 1DJIA
chains in the Genus database with same CATH superfamily
3RZSA 1J7QA 2M1KB 3PFVA 4PHKA 1SCMC 1UHIA 4JWQA 1CLMA 3DD4A 2TN4A 3ZWHA 5DICA 3C1VA 3D77A 1W7IB 3CZ2A 3MSEB 1TN4A 3KF9A 1LS8A 2ERBA 2ZRSA 2COLB 4MVFA 4C0LA 1AK8A 4DRWA 5EL2A 2PMYA 1LKJA 2KFGA 2PQLA 4CIDA 1RJVA 2LM5A 4YGAA 1ZACA 1DTLA 2M9GA 1CFDA 2HETA 2H61A 2WCMA 1OOJA 1SRAA 1CDLA 1IJ6A 2EC6C 3DXLA 1XK4A 2MBXA 2Q4UA 1NX2A 1Q80A 1QV0A 5HKYA 1XFYO 1C7WA 1WRZA 2KHNA 3O2PA 1TWOA 3HCMA 1WRLA 5AEQA 2JQ6A 1V1GA 5TNCA 3AKAA 1AUIB 2E6WA 1NX1A 4C0KA 2KYCA 3BUOB 1TNXA 1D1OA 1G33A 1LVCD 2LAPA 2F2OA 3OB1B 1K96A 1RROA 4I5KA 2LLSA 3PJIA 4WQ2A 1B7TZ 1SYMA 5AANA 4OZDA 4CFRA 1IQ3A 1UHNA 5CSJA 1TUJA 1XO5A 1QLKA 2JT0A 3NSIA 3Q8IA 4PCWA 1B9AA 2D8NA 3EVUA 1QJTA 2JTTA 4MRXA 1TRFA 3D73A 1UUSA 4M2OA 3WHTB 3S0DA 1F55A 1BU3A 3RLZA 1DC1A 3L4AA 3BFHA 3FS7A 5I2QA 4PHJA 1OMRA 2V53A 3BFBA 4AQIA 4QJ4B 1C7VA 1S5GZ 4XJKA 3PM2A 1KK7Z 1ODBA 3I5FC 1MXLC 1BLQA 2H8VA 3BUWB 1J1EA 3IF7A 1Y1UA 2K7OA 2KDHA 1M39A 1NX0A 2QEVA 1SPYA 3H4SE 4DCKA 4YI8A 3QMEA 1CLLA 1DVIA 1C3ZA 2KI4C 4JPZB 1W7JB 1JSAA 3FIAA 2OS8C 1Z2CB 4M2PA 4HSZA 3PM8A 1K9UA 2KBIA 5D3OA 2KQYA 2F33A 2L5XB 3M0WA 1KWOC 2ZNDA 5AERA 1E8AA 1CTRA 4N5XA 3LK1A 1J1DA 4ORBB 3GOFA 1KQMC 4CFQA 2JULA 2K7DA 4MSPA 1J7RA 4PDZA 3SG3A 1FW4A 4GAOA 1B8CA 2MA2A 1M63B 1OZSA 4PT1A 4OV2A 1YVHA 2MJWB 2LNKA 1S3PA 2LLUA 2GGMA 1GM0A 3BYAA 3VRPA 2ZN8A 1MQ1A 3BUXB 1S6CA 3NSKA 4NDBA 1DJGA 4GNKB 3D10A 2LCPA 3S0AA 2KSPA 3K1EA 1NIWA 1Y0VH 1TIZA 2HPSA 4P2YB 1TTXA 1L2OB 3SG2A 1JFKA 1TNWA 1SKTA 4JKTA 2KOTA 3RM1A 4GGFA 1NWDA 2F3YA 3DVMA 4PE7A 2LUXA 1S26D 1QIVA 1YUSA 1NYAA 2AUCA 2PVBA 2JNFA 3LLEA 1PULA 3B88A 1DGVA 1NUBA 4MZLA 3SIBA 5D7FA 5KTYA 1J7PA 4A4CA 3O4YA 4JQ0D 1EXRA 1ZFSA 3VRRA 3UNWA 4DS7A 1UURA 2WCEA 4C0JA 1JF2A 4HREE 3PLFB 2NCPA 1K94A 1RTP1 3CYZA 2F2PA 2GV5A 1TCFA 4HRHA 1UHHA 2JXCA 4YRUA 2ZKMX 4L9MA 1PVAA 1DGUA 1WRKA 1IIOA 1QXPA 1CMFA 4CPVA 1CDPA 1WY9A 3LCPC 2L4HA 3SG5A 4FTGA 2MLEC 2CT9A 1XFUO 2P70A 3TZ1A 1SK6D 2O5GA 3AAKA 3DVJA 2NZ0A 5AFPA 1OOGA 2Y1MA 3CR5X 3OX6A 4USLA 2LUCA 1BR1B 4OR9B 4I5NB 4Q04A 4NQGA 1K9PA 3SS4A 1DJYA 1OE9B 4N1GA 2JT3A 3B87A 1B7TY 2KLDA 2FJUB 2LMUA 2PSRA 1NPQA 3R1VA 1BR4B 2E30A 4ETOA 5DKNA 1P28A 3BOWA 1IRJA 4GPLB 2BL0B 4ICBA 1CDMA 3IVTA 1YUUA 4I5LB 1NSHA 2HF5A 3SG7A 1DJXA 4PE0A 2VRGA 2M8UA 1EJ3A 1QX2A 2PRUA 2WCFA 5B8IB 5HYDA 4MRYA 5CSIA 3NGVA 1SR6B 1S5GY 1F4QA 1RK9A 3TUYC 3GK4X 3DYEA 3BFAA 2LVJA 5HKWA 1KK7Y 3OP0A 2QEOA 1KFUL 2M49B 2DOQA 3IQQA 2L2CA 1DEKA 1QX5B 1BODA 1Z4HA 1R6PA 1PALA 4MBEA 5I94A 1ZOTB 2ZN9A 1FPWA 1OOFA 5KSZA 4IJ7A 2LP2A 3D76A 2LHIA 2KAXA 3D0YA 3B7AA 3KEVA 1PVBA 3CZ0A 3CTNA 2MAZA 1WDCB 1H4BA 1BT6A 2M3WA 3S0EA 2CXJA 1N65A 1QTXA 2KYFA 1K95A 2ZRTA 2LC5A 4UPGA 2SCPA 2Y5IA 2BCXA 3O4XA 4XYNA 1PSBA 1M31A 1YRUB 1EG3A 2LMTA 1S6IA 1L2OC 1K9KA 2WCKA 4ZCUA 2KPHA 4D1EA 3N7HA 1YR5A 3B86A 3CR4X 3VRQA 1MWNA 1QATA 1K2HA 2EGDA 3FE8A 3R72A 3EVRA 4PE4A 3BJHA 4FQOA 1K8UA 3EVVA 2L5YA 2I2RE 4MEWA 1DT7B 2QACA 1M45A 1XFZO 2CNPA 3TDUA 3DVKA 3EK7A 1L7ZA 1YX8A 4AOMA 1A2XA 2K2FA 1OMDA 1QWVA 1NCXA 1X02A 1DJWA 4ORAB 2G9BA 4GUKA 2CCMA 4OKHA 2LE9B 3O78A 2I7AA 2JU0A 3DF0A 2PASA 3GK1A 3VROA 2KQ6A 1SCMB 1UHKA 2KFHA 3CDNA 3FE6A 4F7FA 1GGWA 2BBMA 2M1UA 2BBNA 2WC6A 2ZFDA 3JVTB 3B6XA 1QV1A 3OHMB 2AAOA 2AMIA 2G2BA 4YGDB 4YBHB 2QPTA 1F54A 1KSOA 3PATA 4F0ZB 2EHBA 1N2DA 1ORGA 2KAVA 1CFCA 2PYQA 2B1UA 1YURA 3CGAA 4QJ5B 2FCDA 1DELA 2ZNEA 3SG6A 1OW4A 1OSAA 1IJ5A 2QEBA 2JZIA 1PRWA 2K61A 3SIAA 2GTEA 2BL0C 2NLNA 4MZJA 1Y1XA 1H8BA 4JD9A 3PN7B 2F3ZA 1A4PA 1F8HA 3LL8B 1YTZC 3S0FA 3OX5A 1NX3A 1SY9A 2K8MB 1G8IA 1QVIY 3VRNA 1VRKA 5CPVA 2BKIB 2L51A 1IKUA 1AVSA 3CZTX 3I5HB 4HRGA 2P6BB 4KYNA 1SBJA 1SR6C 1DQEA 1UP5A 3VB1A 4GFTA 2BKHB 2JC2A 1HT9A 4NDCA 1SW8A 1XFRA 5CSNA 2L4IA 3CABA 4XJKB 3NXAA 1BG1A 1OZOA 2M7LA 3BUMB 1C07A 2LV7A 3D75A 5AXIA 1SL7A 4N1FA 4DIRA 1CM4A 2O60A 4OVNF 3OGNA 1GQMA 1ZMZA 1B8LA 4YGCB 1KQVA 5KU1A 2KI6D 1CMGA 1UHJA 1WDCC 1SCVA 1XVJA 1NCYA 1N0YA 3R1OA 2KAYA 3EK8A 1C3YA 2KGRA 5JJGA 1YRTB 2I18A 2LMVA 2LHLA 1XFXO 4R1EA 1CFFA 2H2KA 1QVIZ 1KK8B 1IWQA 1PK0D 5HLVA 3KO0A 5ER5A 3GK2A 3I5IB 2QDIA 2MLFC 5J3XA 1MUXA 2KI4B 1XFVO 2M7NA 2ISDA 1ZUZA 1F4OA 1EL4A 5PALA 1GGZA 3OB2B 3S0BA 1LA3A 3BXKA 2WOSA 3O6BA 2WORA 2CBLA 1A75A 2FOTA 2BE4A 3LK0A 3NHIA 1A03A 1JC2A 1FBVA 2JTZA 2K2AA 1KWOB 3D74A 4YGEB 1RECA 2JOJA 2PALA 2NCOA 2KNEA 3ICBA 1QX7A 1SSEB 1CDNA 2H61C 1KQMB 1TUZA 2MHHA 3K21A 2BNXA 3TS5B 1A29A 2L50A 2L0PA 5GQQC 1IQ5A 1WLMA 2WCBA 1XK4C 1YVLA 3JVTC 4E68A 4WRIA 1JFJA 1OOHA 1IGVA 1UWOA 2L98A 4BY4A 4QJ3B 1AHRA 3FWBA 1Y1AA 2WCLA 1KFXS 3FE9A 2MRDA 4OCIA 2BE6A 2FJYA 2JWWA 4GBAA 4ZCVA 4AQJA 1ALVA 1YX7A 2CTNA 3WHUB 2BECA 2M0RA 4DUQA 1JUOA 2A4JA 3I5GB 1DJHA 5G08A 1GJYA 2K0JA 1EH2A 3L47A 3TDZA 2OTGB 2WCJA 4MLWA 1BF5A 3PN7C 1B47A 2M97A 1K93D 2NXQA 4M2QA 1B4CA 1EG4A 2HQWA 1CKKA 5IBWA 1QIWA 2IS9A 4MZKA 3JTDB 4BY5A 3V2LA 1Y6WA 4TNCA 3I5HC 4GGNA 2LVKA 3EG5B 2QEHA 5DKRA 1F70A 1MHOA 1XFWO 1S36A 5FYXA 5HL1A 4PHMA 1M46A 1S1EA 1YUTA 2LVVA 3BQ3A 5FI6A 5HLOA 3UO9A 2M29A 2Y1NA 3WNXB 1FI5A 3SS5A 1OQPA 1IH0A 1LINA 1TOPA 3AAJA 1NP8A 2RGIA 3BOWB 1LA0A 1XYDA 4FQTA 3CWGA 5DKQA 1K90D 1QASA 5I8NA 2JPOA 1KFXL 2WC8A 3E3RA 5ER4X 2K7BA 3SG4A 4A4BA 4CLNA 1FF1A 1A75B 4IL1A 2KI6C 2LP3A 1TNQA 1ALWA 1SMGA 3D78A 3L4LA 1U5IA 3CZ1A 1QS7A 2JXLA 4INWA 1MF8B 1BMOA 2K60A 2R2IA 3QRXA 1FI6A 5BPJA 1AJ5A 1KK8C 4YI9A 2Q91A 3FWCA 3NSLA 4INXA 1JF0A 3OBVA 3I5IC 1PSRA 2OPOA 2JRFA 2KBMA 3EKJA 3S0GA 4U8DA 2KGBC 2K7CA 3SJSA 1BOCA 5CSFA 1DF0A 1RFJA 2WCHA 5F6TA 2EC6B 1B1GA 2SASA 3D0YB 1MXEA 3A4UB 2BCBA 5I2LA 3TUYB 3A8RA 1RWYA 2KFFA 4YGBB 5FI7A 3CLNA 1J55A 2WC5A 1V1FA 2FCEA 5FI2A 2LANA 1CFPA 2KLEA 3EK4A 1AP4A 1W9ZA 3SS3A 1SL8A 3TS5C 1XA5A 3NHTA 2WNDA 4GGFC 1MR8A 1SL9A 3DY9A 1KCYA 2HQ8A 3AKBA 5I2OA 1JBAA 5HKZA 3NSOA 1KSMA 1NCZA 1AJ4A 3DVEA 3PALA 5JOLA 5D69A 1J7OA 2P71A 1DMOA 3I5GC 3CR2A 1CLBA 1SNLA 2BCAA 2BAPA 2JNXA 2OTGC 4PE1A 1S6JA 4MN0A 1F71A 3DF0B 1CM1A 1OMVA 1WLZA 3I5FB 3R1PA 1CB1A 1CNPA 2F8PA 3JTDC 3BUNB 3TDIA 2JT8A 3WXAA 1U5IB 3F45A 3CS1A 2JPTA 1TNPA 1B8RA 4I5JA 2GGZA 4PALA 3IQOA 4PHNA 3EKHA 1HQVA 1T14A 2LVIA 1OOIX 3KHEA 4ORCB 5K89A 1DJZA 3KPXA 1QLSA 4NDDA 1TCOB 2OS8B 1IG5A 4P5OE 3PSRA 4WQ3A 3DZTA 3VGOA 1LXFC 1KFUS 1G4YR 2L2EA 2I94A 2YGUA 1DF0B 2LLTA 1BJFA 3ZNIA 1R2UA 2Y4QA 3HX4A 1JWDA 1DJIA
chains in the Genus database with same CATH topology
1J7QA 2M1KB 3PFVA 4PHKA 1SCMC 1UHIA 4JWQA 1CLMA 3DD4A 2TN4A 3ZWHA 3C1VA 1W7IB 3MSEB 1TN4A 3KF9A 2ZRSA 4MVFA 2COLB 4C0LA 1AK8A 4DRWA 2PMYA 1LKJA 2KFGA 4CIDA 1RJVA 2LM5A 4YGAA 1ZACA 1DTLA 2M9GA 1CFDA 2HETA 2H61A 1OOJA 1SRAA 1CDLA 1IJ6A 2EC6C 2MBXA 1XK4A 2Q4UA 1NX2A 1Q80A 1QV0A 5HKYA 1XFYO 1C7WA 1WRZA 2KHNA 3O2PA 3HCMA 1WRLA 5AEQA 2JQ6A 1V1GA 5TNCA 3AKAA 1AUIB 2E6WA 1NX1A 4C0KA 2KYCA 3BUOB 1TNXA 1D1OA 1G33A 1LVCD 2LAPA 2F2OA 3OB1B 1K96A 1RROA 4I5KA 2LLSA 4WQ2A 1B7TZ 1SYMA 5AANA 1IQ3A 4CFRA 1UHNA 5CSJA 1XO5A 1QLKA 2JT0A 3NSIA 4PCWA 1B9AA 2D8NA 3EVUA 1QJTA 2JTTA 4MRXA 1TRFA 1UUSA 4M2OA 3WHTB 1F55A 1BU3A 3RLZA 3FS7A 5I2QA 4PHJA 1OMRA 2V53A 4AQIA 4QJ4B 1C7VA 1S5GZ 4XJKA 1KK7Z 1ODBA 3I5FC 1MXLC 1BLQA 3BUWB 3IF7A 1J1EA 1Y1UA 2K7OA 2KDHA 1M39A 1NX0A 3H4SE 1SPYA 4DCKA 4YI8A 1CLLA 1DVIA 4JPZB 2KI4C 1W7JB 1JSAA 3FIAA 2OS8C 4M2PA 4HSZA 3PM8A 1K9UA 2KBIA 2KQYA 2F33A 2L5XB 3M0WA 1KWOC 2ZNDA 5AERA 1E8AA 1CTRA 4N5XA 3LK1A 1J1DA 4ORBB 3GOFA 1KQMC 4CFQA 2JULA 2K7DA 4MSPA 1J7RA 4PDZA 3SG3A 1FW4A 4GAOA 1B8CA 2MA2A 1M63B 1OZSA 4OV2A 1YVHA 2MJWB 2LNKA 1S3PA 2LLUA 2GGMA 3BYAA 3VRPA 2ZN8A 1MQ1A 3BUXB 1S6CA 3NSKA 4NDBA 1DJGA 4GNKB 3D10A 2LCPA 2KSPA 1NIWA 1Y0VH 1TIZA 2HPSA 4P2YB 1TTXA 1L2OB 3SG2A 1JFKA 1TNWA 1SKTA 2KOTA 3RM1A 4GGFA 1NWDA 2F3YA 3DVMA 4PE7A 2LUXA 1S26D 1QIVA 1YUSA 1NYAA 2AUCA 2PVBA 2JNFA 3LLEA 1PULA 4MZLA 1DGVA 1NUBA 3SIBA 5D7FA 5KTYA 1J7PA 4A4CA 3O4YA 4JQ0D 1EXRA 1ZFSA 3VRRA 4DS7A 1UURA 2WCEA 4C0JA 1JF2A 4HREE 3PLFB 2NCPA 1K94A 1RTP1 2F2PA 2GV5A 1TCFA 4HRHA 1UHHA 2JXCA 4YRUA 2ZKMX 4L9MA 1PVAA 1DGUA 1WRKA 1QXPA 1CMFA 4CPVA 1CDPA 1WY9A 3LCPC 2L4HA 3SG5A 4FTGA 2MLEC 2CT9A 1XFUO 3TZ1A 1SK6D 2O5GA 3AAKA 3DVJA 2NZ0A 5AFPA 3OX6A 2Y1MA 3CR5X 4USLA 2LUCA 1BR1B 4OR9B 4I5NB 4Q04A 4NQGA 1K9PA 1DJYA 1OE9B 4N1GA 2JT3A 1B7TY 2FJUB 2LMUA 2PSRA 1NPQA 1BR4B 2E30A 4ETOA 5DKNA 3BOWA 1IRJA 4GPLB 2BL0B 4ICBA 1CDMA 1YUUA 4I5LB 1NSHA 2HF5A 3SG7A 1DJXA 4PE0A 2VRGA 2M8UA 1EJ3A 1QX2A 2PRUA 2WCFA 5B8IB 5HYDA 4MRYA 5CSIA 1SR6B 1S5GY 1F4QA 1RK9A 3TUYC 3GK4X 2LVJA 5HKWA 1KK7Y 3OP0A 1KFUL 2M49B 2DOQA 3IQQA 1QX5B 1BODA 1R6PA 1PALA 4MBEA 1ZOTB 2ZN9A 1FPWA 5KSZA 2LP2A 2LHIA 2KAXA 3D0YA 3KEVA 1PVBA 3CTNA 2MAZA 1WDCB 1H4BA 1BT6A 2M3WA 2CXJA 1N65A 1QTXA 2KYFA 1K95A 2ZRTA 2LC5A 4UPGA 2SCPA 2Y5IA 2BCXA 4XYNA 1PSBA 1M31A 1YRUB 1EG3A 2LMTA 1S6IA 1L2OC 1K9KA 4ZCUA 4D1EA 3VRQA 1YR5A 3CR4X 1MWNA 1QATA 1K2HA 2EGDA 3EVRA 4PE4A 4FQOA 1K8UA 3EVVA 2I2RE 4MEWA 1DT7B 2QACA 1M45A 1XFZO 2CNPA 3TDUA 3DVKA 3EK7A 1L7ZA 1YX8A 4AOMA 1A2XA 2K2FA 1OMDA 1X02A 1NCXA 1DJWA 4ORAB 2G9BA 4GUKA 2CCMA 4OKHA 2LE9B 3O78A 2I7AA 2JU0A 3DF0A 2PASA 3GK1A 3VROA 2KQ6A 1SCMB 1UHKA 2KFHA 1GGWA 2BBMA 2M1UA 2BBNA 2ZFDA 3JVTB 3OHMB 1QV1A 2AAOA 2AMIA 2G2BA 4YGDB 4YBHB 2QPTA 1F54A 1KSOA 3PATA 4F0ZB 2EHBA 1N2DA 2KAVA 1CFCA 2B1UA 1YURA 3CGAA 4QJ5B 2FCDA 2ZNEA 3SG6A 1OSAA 1IJ5A 2JZIA 1PRWA 2K61A 3SIAA 2BL0C 2NLNA 4MZJA 1Y1XA 1H8BA 3PN7B 2F3ZA 1A4PA 1F8HA 3LL8B 1YTZC 3OX5A 1NX3A 1SY9A 2K8MB 1G8IA 1QVIY 3VRNA 1VRKA 5CPVA 2BKIB 2L51A 1IKUA 1AVSA 3CZTX 3I5HB 4HRGA 2P6BB 1SBJA 1SR6C 1UP5A 4GFTA 2BKHB 2JC2A 1HT9A 4NDCA 1SW8A 5CSNA 2L4IA 4XJKB 3NXAA 1BG1A 1OZOA 2M7LA 3BUMB 1C07A 2LV7A 5AXIA 1SL7A 4N1FA 4DIRA 1CM4A 2O60A 4OVNF 1GQMA 1ZMZA 1B8LA 4YGCB 1KQVA 5KU1A 2KI6D 1CMGA 1UHJA 1WDCC 1SCVA 1XVJA 1NCYA 1N0YA 2KAYA 3EK8A 2KGRA 5JJGA 1YRTB 2I18A 2LMVA 2LHLA 1XFXO 4R1EA 1CFFA 2H2KA 1QVIZ 1KK8B 1IWQA 1PK0D 5HLVA 3KO0A 5ER5A 3GK2A 3I5IB 2MLFC 5J3XA 1MUXA 2KI4B 1XFVO 2M7NA 2ISDA 1ZUZA 1F4OA 1EL4A 5PALA 1GGZA 3OB2B 1LA3A 3BXKA 2WOSA 3O6BA 2WORA 2CBLA 1A75A 2FOTA 2BE4A 3LK0A 1A03A 1JC2A 1FBVA 2JTZA 2K2AA 1KWOB 4YGEB 1RECA 2JOJA 2PALA 2NCOA 2KNEA 3ICBA 1QX7A 1CDNA 2H61C 1KQMB 2MHHA 3K21A 3TS5B 1A29A 2L50A 2L0PA 5GQQC 1IQ5A 1WLMA 2WCBA 1XK4C 1YVLA 3JVTC 4E68A 4WRIA 1JFJA 1IGVA 1UWOA 2L98A 4BY4A 4QJ3B 1AHRA 3FWBA 1Y1AA 1KFXS 2MRDA 4OCIA 2BE6A 2JWWA 4ZCVA 4GBAA 4AQJA 1ALVA 1YX7A 2CTNA 3WHUB 2BECA 2M0RA 4DUQA 1JUOA 2A4JA 3I5GB 1DJHA 5G08A 1GJYA 2K0JA 1EH2A 3TDZA 2OTGB 1BF5A 4MLWA 1B4CA 3PN7C 1B47A 2M97A 1K93D 2NXQA 4M2QA 1EG4A 2HQWA 1CKKA 5IBWA 1QIWA 2IS9A 4MZKA 3JTDB 4BY5A 1Y6WA 4TNCA 3I5HC 4GGNA 2LVKA 5DKRA 1F70A 1MHOA 1XFWO 1S36A 5FYXA 4PHMA 1M46A 1S1EA 1YUTA 2LVVA 3BQ3A 5HLOA 2M29A 2Y1NA 3WNXB 1FI5A 1OQPA 1IH0A 1LINA 1TOPA 3AAJA 1NP8A 2RGIA 3BOWB 1LA0A 1XYDA 3CWGA 5DKQA 1K90D 1QASA 5I8NA 2WC8A 1KFXL 5ER4X 3E3RA 3SG4A 2K7BA 4A4BA 4CLNA 1FF1A 1A75B 4IL1A 2KI6C 2LP3A 1TNQA 1ALWA 1SMGA 1U5IA 1QS7A 2JXLA 1MF8B 1BMOA 2R2IA 3QRXA 1FI6A 5BPJA 1AJ5A 1KK8C 4YI9A 2Q91A 3FWCA 3NSLA 1JF0A 3I5IC 1PSRA 2OPOA 2JRFA 2KBMA 3EKJA 4U8DA 2KGBC 2K7CA 3SJSA 1BOCA 5CSFA 1DF0A 1RFJA 5F6TA 1B1GA 2EC6B 2SASA 3D0YB 1MXEA 3A4UB 2BCBA 5I2LA 3TUYB 3A8RA 1RWYA 2KFFA 4YGBB 3CLNA 1J55A 1V1FA 2FCEA 2LANA 1CFPA 3EK4A 1AP4A 1SL8A 3TS5C 1XA5A 2WNDA 4GGFC 1MR8A 1SL9A 1KCYA 2HQ8A 3AKBA 5I2OA 1JBAA 5HKZA 3NSOA 1KSMA 1NCZA 1AJ4A 3DVEA 3PALA 5JOLA 5D69A 1J7OA 1DMOA 3I5GC 3CR2A 1CLBA 1SNLA 2BCAA 2JNXA 2OTGC 4PE1A 1S6JA 4MN0A 1F71A 3DF0B 1CM1A 1OMVA 1WLZA 3I5FB 1CB1A 1CNPA 2F8PA 3JTDC 3BUNB 3TDIA 2JT8A 3WXAA 1U5IB 3F45A 3CS1A 2JPTA 1TNPA 1B8RA 4I5JA 2GGZA 4PALA 3IQOA 4PHNA 3EKHA 1HQVA 2LVIA 5K89A 3KHEA 4ORCB 1DJZA 3KPXA 1QLSA 4NDDA 1TCOB 2OS8B 1IG5A 4P5OE 3PSRA 4WQ3A 3VGOA 1LXFC 1KFUS 1G4YR 2L2EA 2I94A 1DF0B 2LLTA 1BJFA 3ZNIA 1R2UA 2Y4QA 3HX4A 1JWDA 1DJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7Q A;  2M1K B;  3PFV A;  4PHK A;  1SCM C;  1UHI A;  4JWQ A;  1CLM A;  3DD4 A;  2TN4 A;  3ZWH A;  3C1V A;  1W7I B;  3MSE B;  1TN4 A;  3KF9 A;  2ZRS A;  4MVF A;  2COL B;  4C0L A;  1AK8 A;  4DRW A;  2PMY A;  1LKJ A;  2KFG A;  4CID A;  1RJV A;  2LM5 A;  4YGA A;  1ZAC A;  1DTL A;  2M9G A;  1CFD A;  2HET A;  2H61 A;  1OOJ A;  1SRA A;  1CDL A;  1IJ6 A;  2EC6 C;  2MBX A;  1XK4 A;  2Q4U A;  1NX2 A;  1Q80 A;  1QV0 A;  5HKY A;  1XFY O;  1C7W A;  1WRZ A;  2KHN A;  3O2P A;  3HCM A;  1WRL A;  5AEQ A;  2JQ6 A;  1V1G A;  5TNC A;  3AKA A;  1AUI B;  2E6W A;  1NX1 A;  4C0K A;  2KYC A;  3BUO B;  1TNX A;  1D1O A;  1G33 A;  1LVC D;  2LAP A;  2F2O A;  3OB1 B;  1K96 A;  1RRO A;  4I5K A;  2LLS A;  4WQ2 A;  1B7T Z;  1SYM A;  5AAN A;  1IQ3 A;  4CFR A;  1UHN A;  5CSJ A;  1XO5 A;  1QLK A;  2JT0 A;  3NSI A;  4PCW A;  1B9A A;  2D8N A;  3EVU A;  1QJT A;  2JTT A;  4MRX A;  1TRF A;  1UUS A;  4M2O A;  3WHT B;  1F55 A;  1BU3 A;  3RLZ A;  3FS7 A;  5I2Q A;  4PHJ A;  1OMR A;  2V53 A;  4AQI A;  4QJ4 B;  1C7V A;  1S5G Z;  4XJK A;  1KK7 Z;  1ODB A;  3I5F C;  1MXL C;  1BLQ A;  3BUW B;  3IF7 A;  1J1E A;  1Y1U A;  2K7O A;  2KDH A;  1M39 A;  1NX0 A;  3H4S E;  1SPY A;  4DCK A;  4YI8 A;  1CLL A;  1DVI A;  4JPZ B;  2KI4 C;  1W7J B;  1JSA A;  3FIA A;  2OS8 C;  4M2P A;  4HSZ A;  3PM8 A;  1K9U A;  2KBI A;  2KQY A;  2F33 A;  2L5X B;  3M0W A;  1KWO C;  2ZND A;  5AER A;  1E8A A;  1CTR A;  4N5X A;  3LK1 A;  1J1D A;  4ORB B;  3GOF A;  1KQM C;  4CFQ A;  2JUL A;  2K7D A;  4MSP A;  1J7R A;  4PDZ A;  3SG3 A;  1FW4 A;  4GAO A;  1B8C A;  2MA2 A;  1M63 B;  1OZS A;  4OV2 A;  1YVH A;  2MJW B;  2LNK A;  1S3P A;  2LLU A;  2GGM A;  3BYA A;  3VRP A;  2ZN8 A;  1MQ1 A;  3BUX B;  1S6C A;  3NSK A;  4NDB A;  1DJG A;  4GNK B;  3D10 A;  2LCP A;  2KSP A;  1NIW A;  1Y0V H;  1TIZ A;  2HPS A;  4P2Y B;  1TTX A;  1L2O B;  3SG2 A;  1JFK A;  1TNW A;  1SKT A;  2KOT A;  3RM1 A;  4GGF A;  1NWD A;  2F3Y A;  3DVM A;  4PE7 A;  2LUX A;  1S26 D;  1QIV A;  1YUS A;  1NYA A;  2AUC A;  2PVB A;  2JNF A;  3LLE A;  1PUL A;  4MZL A;  1DGV A;  1NUB A;  3SIB A;  5D7F A;  5KTY A;  1J7P A;  4A4C A;  3O4Y A;  4JQ0 D;  1EXR A;  1ZFS A;  3VRR A;  4DS7 A;  1UUR A;  2WCE A;  4C0J A;  1JF2 A;  4HRE E;  3PLF B;  2NCP A;  1K94 A;  1RTP 1;  2F2P A;  2GV5 A;  1TCF A;  4HRH A;  1UHH A;  2JXC A;  4YRU A;  2ZKM X;  4L9M A;  1PVA A;  1DGU A;  1WRK A;  1QXP A;  1CMF A;  4CPV A;  1CDP A;  1WY9 A;  3LCP C;  2L4H A;  3SG5 A;  4FTG A;  2MLE C;  2CT9 A;  1XFU O;  3TZ1 A;  1SK6 D;  2O5G A;  3AAK A;  3DVJ A;  2NZ0 A;  5AFP A;  3OX6 A;  2Y1M A;  3CR5 X;  4USL A;  2LUC A;  1BR1 B;  4OR9 B;  4I5N B;  4Q04 A;  4NQG A;  1K9P A;  1DJY A;  1OE9 B;  4N1G A;  2JT3 A;  1B7T Y;  2FJU B;  2LMU A;  2PSR A;  1NPQ A;  1BR4 B;  2E30 A;  4ETO A;  5DKN A;  3BOW A;  1IRJ A;  4GPL B;  2BL0 B;  4ICB A;  1CDM A;  1YUU A;  4I5L B;  1NSH A;  2HF5 A;  3SG7 A;  1DJX A;  4PE0 A;  2VRG A;  2M8U A;  1EJ3 A;  1QX2 A;  2PRU A;  2WCF A;  5B8I B;  5HYD A;  4MRY A;  5CSI A;  1SR6 B;  1S5G Y;  1F4Q A;  1RK9 A;  3TUY C;  3GK4 X;  2LVJ A;  5HKW A;  1KK7 Y;  3OP0 A;  1KFU L;  2M49 B;  2DOQ A;  3IQQ A;  1QX5 B;  1BOD A;  1R6P A;  1PAL A;  4MBE A;  1ZOT B;  2ZN9 A;  1FPW A;  5KSZ A;  2LP2 A;  2LHI A;  2KAX A;  3D0Y A;  3KEV A;  1PVB A;  3CTN A;  2MAZ A;  1WDC B;  1H4B A;  1BT6 A;  2M3W A;  2CXJ A;  1N65 A;  1QTX A;  2KYF A;  1K95 A;  2ZRT A;  2LC5 A;  4UPG A;  2SCP A;  2Y5I A;  2BCX A;  4XYN A;  1PSB A;  1M31 A;  1YRU B;  1EG3 A;  2LMT A;  1S6I A;  1L2O C;  1K9K A;  4ZCU A;  4D1E A;  3VRQ A;  1YR5 A;  3CR4 X;  1MWN A;  1QAT A;  1K2H A;  2EGD A;  3EVR A;  4PE4 A;  4FQO A;  1K8U A;  3EVV A;  2I2R E;  4MEW A;  1DT7 B;  2QAC A;  1M45 A;  1XFZ O;  2CNP A;  3TDU A;  3DVK A;  3EK7 A;  1L7Z A;  1YX8 A;  4AOM A;  1A2X A;  2K2F A;  1OMD A;  1X02 A;  1NCX A;  1DJW A;  4ORA B;  2G9B A;  4GUK A;  2CCM A;  4OKH A;  2LE9 B;  3O78 A;  2I7A A;  2JU0 A;  3DF0 A;  2PAS A;  3GK1 A;  3VRO A;  2KQ6 A;  1SCM B;  1UHK A;  2KFH A;  1GGW A;  2BBM A;  2M1U A;  2BBN A;  2ZFD A;  3JVT B;  3OHM B;  1QV1 A;  2AAO A;  2AMI A;  2G2B A;  4YGD B;  4YBH B;  2QPT A;  1F54 A;  1KSO A;  3PAT A;  4F0Z B;  2EHB A;  1N2D A;  2KAV A;  1CFC A;  2B1U A;  1YUR A;  3CGA A;  4QJ5 B;  2FCD A;  2ZNE A;  3SG6 A;  1OSA A;  1IJ5 A;  2JZI A;  1PRW A;  2K61 A;  3SIA A;  2BL0 C;  2NLN A;  4MZJ A;  1Y1X A;  1H8B A;  3PN7 B;  2F3Z A;  1A4P A;  1F8H A;  3LL8 B;  1YTZ C;  3OX5 A;  1NX3 A;  1SY9 A;  2K8M B;  1G8I A;  1QVI Y;  3VRN A;  1VRK A;  5CPV A;  2BKI B;  2L51 A;  1IKU A;  1AVS A;  3CZT X;  3I5H B;  4HRG A;  2P6B B;  1SBJ A;  1SR6 C;  1UP5 A;  4GFT A;  2BKH B;  2JC2 A;  1HT9 A;  4NDC A;  1SW8 A;  5CSN A;  2L4I A;  4XJK B;  3NXA A;  1BG1 A;  1OZO A;  2M7L A;  3BUM B;  1C07 A;  2LV7 A;  5AXI A;  1SL7 A;  4N1F A;  4DIR A;  1CM4 A;  2O60 A;  4OVN F;  1GQM A;  1ZMZ A;  1B8L A;  4YGC B;  1KQV A;  5KU1 A;  2KI6 D;  1CMG A;  1UHJ A;  1WDC C;  1SCV A;  1XVJ A;  1NCY A;  1N0Y A;  2KAY A;  3EK8 A;  2KGR A;  5JJG A;  1YRT B;  2I18 A;  2LMV A;  2LHL A;  1XFX O;  4R1E A;  1CFF A;  2H2K A;  1QVI Z;  1KK8 B;  1IWQ A;  1PK0 D;  5HLV A;  3KO0 A;  5ER5 A;  3GK2 A;  3I5I B;  2MLF C;  5J3X A;  1MUX A;  2KI4 B;  1XFV O;  2M7N A;  2ISD A;  1ZUZ A;  1F4O A;  1EL4 A;  5PAL A;  1GGZ A;  3OB2 B;  1LA3 A;  3BXK A;  2WOS A;  3O6B A;  2WOR A;  2CBL A;  1A75 A;  2FOT A;  2BE4 A;  3LK0 A;  1A03 A;  1JC2 A;  1FBV A;  2JTZ A;  2K2A A;  1KWO B;  4YGE B;  1REC A;  2JOJ A;  2PAL A;  2NCO A;  2KNE A;  3ICB A;  1QX7 A;  1CDN A;  2H61 C;  1KQM B;  2MHH A;  3K21 A;  3TS5 B;  1A29 A;  2L50 A;  2L0P A;  5GQQ C;  1IQ5 A;  1WLM A;  2WCB A;  1XK4 C;  1YVL A;  3JVT C;  4E68 A;  4WRI A;  1JFJ A;  1IGV A;  1UWO A;  2L98 A;  4BY4 A;  4QJ3 B;  1AHR A;  3FWB A;  1Y1A A;  1KFX S;  2MRD A;  4OCI A;  2BE6 A;  2JWW A;  4ZCV A;  4GBA A;  4AQJ A;  1ALV A;  1YX7 A;  2CTN A;  3WHU B;  2BEC A;  2M0R A;  4DUQ A;  1JUO A;  2A4J A;  3I5G B;  1DJH A;  5G08 A;  1GJY A;  2K0J A;  1EH2 A;  3TDZ A;  2OTG B;  1BF5 A;  4MLW A;  1B4C A;  3PN7 C;  1B47 A;  2M97 A;  1K93 D;  2NXQ A;  4M2Q A;  1EG4 A;  2HQW A;  1CKK A;  5IBW A;  1QIW A;  2IS9 A;  4MZK A;  3JTD B;  4BY5 A;  1Y6W A;  4TNC A;  3I5H C;  4GGN A;  2LVK A;  5DKR A;  1F70 A;  1MHO A;  1XFW O;  1S36 A;  5FYX A;  4PHM A;  1M46 A;  1S1E A;  1YUT A;  2LVV A;  3BQ3 A;  5HLO A;  2M29 A;  2Y1N A;  3WNX B;  1FI5 A;  1OQP A;  1IH0 A;  1LIN A;  1TOP A;  3AAJ A;  1NP8 A;  2RGI A;  3BOW B;  1LA0 A;  1XYD A;  3CWG A;  5DKQ A;  1K90 D;  1QAS A;  5I8N A;  2WC8 A;  1KFX L;  5ER4 X;  3E3R A;  3SG4 A;  2K7B A;  4A4B A;  4CLN A;  1FF1 A;  1A75 B;  4IL1 A;  2KI6 C;  2LP3 A;  1TNQ A;  1ALW A;  1SMG A;  1U5I A;  1QS7 A;  2JXL A;  1MF8 B;  1BMO A;  2R2I A;  3QRX A;  1FI6 A;  5BPJ A;  1AJ5 A;  1KK8 C;  4YI9 A;  2Q91 A;  3FWC A;  3NSL A;  1JF0 A;  3I5I C;  1PSR A;  2OPO A;  2JRF A;  2KBM A;  3EKJ A;  4U8D A;  2KGB C;  2K7C A;  3SJS A;  1BOC A;  5CSF A;  1DF0 A;  1RFJ A;  5F6T A;  1B1G A;  2EC6 B;  2SAS A;  3D0Y B;  1MXE A;  3A4U B;  2BCB A;  5I2L A;  3TUY B;  3A8R A;  1RWY A;  2KFF A;  4YGB B;  3CLN A;  1J55 A;  1V1F A;  2FCE A;  2LAN A;  1CFP A;  3EK4 A;  1AP4 A;  1SL8 A;  3TS5 C;  1XA5 A;  2WND A;  4GGF C;  1MR8 A;  1SL9 A;  1KCY A;  2HQ8 A;  3AKB A;  5I2O A;  1JBA A;  5HKZ A;  3NSO A;  1KSM A;  1NCZ A;  1AJ4 A;  3DVE A;  3PAL A;  5JOL A;  5D69 A;  1J7O A;  1DMO A;  3I5G C;  3CR2 A;  1CLB A;  1SNL A;  2BCA A;  2JNX A;  2OTG C;  4PE1 A;  1S6J A;  4MN0 A;  1F71 A;  3DF0 B;  1CM1 A;  1OMV A;  1WLZ A;  3I5F B;  1CB1 A;  1CNP A;  2F8P A;  3JTD C;  3BUN B;  3TDI A;  2JT8 A;  3WXA A;  1U5I B;  3F45 A;  3CS1 A;  2JPT A;  1TNP A;  1B8R A;  4I5J A;  2GGZ A;  4PAL A;  3IQO A;  4PHN A;  3EKH A;  1HQV A;  2LVI A;  5K89 A;  3KHE A;  4ORC B;  1DJZ A;  3KPX A;  1QLS A;  4NDD A;  1TCO B;  2OS8 B;  1IG5 A;  4P5O E;  3PSR A;  4WQ3 A;  3VGO A;  1LXF C;  1KFU S;  1G4Y R;  2L2E A;  2I94 A;  1DF0 B;  2LLT A;  1BJF A;  3ZNI A;  1R2U A;  2Y4Q A;  3HX4 A;  1JWD A;  1DJI A; 
#chains in the Genus database with same CATH topology
 3RZS A;  1J7Q A;  2M1K B;  3PFV A;  4PHK A;  1SCM C;  1UHI A;  4JWQ A;  1CLM A;  3DD4 A;  2TN4 A;  3ZWH A;  5DIC A;  3C1V A;  3D77 A;  1W7I B;  3CZ2 A;  3MSE B;  1TN4 A;  3KF9 A;  1LS8 A;  2ERB A;  2ZRS A;  2COL B;  4MVF A;  4C0L A;  1AK8 A;  4DRW A;  5EL2 A;  2PMY A;  1LKJ A;  2KFG A;  2PQL A;  4CID A;  1RJV A;  2LM5 A;  4YGA A;  1ZAC A;  1DTL A;  2M9G A;  1CFD A;  2HET A;  2H61 A;  2WCM A;  1OOJ A;  1SRA A;  1CDL A;  1IJ6 A;  2EC6 C;  3DXL A;  1XK4 A;  2MBX A;  2Q4U A;  1NX2 A;  1Q80 A;  1QV0 A;  5HKY A;  1XFY O;  1C7W A;  1WRZ A;  2KHN A;  3O2P A;  1TWO A;  3HCM A;  1WRL A;  5AEQ A;  2JQ6 A;  1V1G A;  5TNC A;  3AKA A;  1AUI B;  2E6W A;  1NX1 A;  4C0K A;  2KYC A;  3BUO B;  1TNX A;  1D1O A;  1G33 A;  1LVC D;  2LAP A;  2F2O A;  3OB1 B;  1K96 A;  1RRO A;  4I5K A;  2LLS A;  3PJI A;  4WQ2 A;  1B7T Z;  1SYM A;  5AAN A;  4OZD A;  4CFR A;  1IQ3 A;  1UHN A;  5CSJ A;  1TUJ A;  1XO5 A;  1QLK A;  2JT0 A;  3NSI A;  3Q8I A;  4PCW A;  1B9A A;  2D8N A;  3EVU A;  1QJT A;  2JTT A;  4MRX A;  1TRF A;  3D73 A;  1UUS A;  4M2O A;  3WHT B;  3S0D A;  1F55 A;  1BU3 A;  3RLZ A;  1DC1 A;  3L4A A;  3BFH A;  3FS7 A;  5I2Q A;  4PHJ A;  1OMR A;  2V53 A;  3BFB A;  4AQI A;  4QJ4 B;  1C7V A;  1S5G Z;  4XJK A;  3PM2 A;  1KK7 Z;  1ODB A;  3I5F C;  1MXL C;  1BLQ A;  2H8V A;  3BUW B;  1J1E A;  3IF7 A;  1Y1U A;  2K7O A;  2KDH A;  1M39 A;  1NX0 A;  2QEV A;  1SPY A;  3H4S E;  4DCK A;  4YI8 A;  3QME A;  1CLL A;  1DVI A;  1C3Z A;  2KI4 C;  4JPZ B;  1W7J B;  1JSA A;  3FIA A;  2OS8 C;  1Z2C B;  4M2P A;  4HSZ A;  3PM8 A;  1K9U A;  2KBI A;  5D3O A;  2KQY A;  2F33 A;  2L5X B;  3M0W A;  1KWO C;  2ZND A;  5AER A;  1E8A A;  1CTR A;  4N5X A;  3LK1 A;  1J1D A;  4ORB B;  3GOF A;  1KQM C;  4CFQ A;  2JUL A;  2K7D A;  4MSP A;  1J7R A;  4PDZ A;  3SG3 A;  1FW4 A;  4GAO A;  1B8C A;  2MA2 A;  1M63 B;  1OZS A;  4PT1 A;  4OV2 A;  1YVH A;  2MJW B;  2LNK A;  1S3P A;  2LLU A;  2GGM A;  1GM0 A;  3BYA A;  3VRP A;  2ZN8 A;  1MQ1 A;  3BUX B;  1S6C A;  3NSK A;  4NDB A;  1DJG A;  4GNK B;  3D10 A;  2LCP A;  3S0A A;  2KSP A;  3K1E A;  1NIW A;  1Y0V H;  1TIZ A;  2HPS A;  4P2Y B;  1TTX A;  1L2O B;  3SG2 A;  1JFK A;  1TNW A;  1SKT A;  4JKT A;  2KOT A;  3RM1 A;  4GGF A;  1NWD A;  2F3Y A;  3DVM A;  4PE7 A;  2LUX A;  1S26 D;  1QIV A;  1YUS A;  1NYA A;  2AUC A;  2PVB A;  2JNF A;  3LLE A;  1PUL A;  3B88 A;  1DGV A;  1NUB A;  4MZL A;  3SIB A;  5D7F A;  5KTY A;  1J7P A;  4A4C A;  3O4Y A;  4JQ0 D;  1EXR A;  1ZFS A;  3VRR A;  3UNW A;  4DS7 A;  1UUR A;  2WCE A;  4C0J A;  1JF2 A;  4HRE E;  3PLF B;  2NCP A;  1K94 A;  1RTP 1;  3CYZ A;  2F2P A;  2GV5 A;  1TCF A;  4HRH A;  1UHH A;  2JXC A;  4YRU A;  2ZKM X;  4L9M A;  1PVA A;  1DGU A;  1WRK A;  1IIO A;  1QXP A;  1CMF A;  4CPV A;  1CDP A;  1WY9 A;  3LCP C;  2L4H A;  3SG5 A;  4FTG A;  2MLE C;  2CT9 A;  1XFU O;  2P70 A;  3TZ1 A;  1SK6 D;  2O5G A;  3AAK A;  3DVJ A;  2NZ0 A;  5AFP A;  1OOG A;  2Y1M A;  3CR5 X;  3OX6 A;  4USL A;  2LUC A;  1BR1 B;  4OR9 B;  4I5N B;  4Q04 A;  4NQG A;  1K9P A;  3SS4 A;  1DJY A;  1OE9 B;  4N1G A;  2JT3 A;  3B87 A;  1B7T Y;  2KLD A;  2FJU B;  2LMU A;  2PSR A;  1NPQ A;  3R1V A;  1BR4 B;  2E30 A;  4ETO A;  5DKN A;  1P28 A;  3BOW A;  1IRJ A;  4GPL B;  2BL0 B;  4ICB A;  1CDM A;  3IVT A;  1YUU A;  4I5L B;  1NSH A;  2HF5 A;  3SG7 A;  1DJX A;  4PE0 A;  2VRG A;  2M8U A;  1EJ3 A;  1QX2 A;  2PRU A;  2WCF A;  5B8I B;  5HYD A;  4MRY A;  5CSI A;  3NGV A;  1SR6 B;  1S5G Y;  1F4Q A;  1RK9 A;  3TUY C;  3GK4 X;  3DYE A;  3BFA A;  2LVJ A;  5HKW A;  1KK7 Y;  3OP0 A;  2QEO A;  1KFU L;  2M49 B;  2DOQ A;  3IQQ A;  2L2C A;  1DEK A;  1QX5 B;  1BOD A;  1Z4H A;  1R6P A;  1PAL A;  4MBE A;  5I94 A;  1ZOT B;  2ZN9 A;  1FPW A;  1OOF A;  5KSZ A;  4IJ7 A;  2LP2 A;  3D76 A;  2LHI A;  2KAX A;  3D0Y A;  3B7A A;  3KEV A;  1PVB A;  3CZ0 A;  3CTN A;  2MAZ A;  1WDC B;  1H4B A;  1BT6 A;  2M3W A;  3S0E A;  2CXJ A;  1N65 A;  1QTX A;  2KYF A;  1K95 A;  2ZRT A;  2LC5 A;  4UPG A;  2SCP A;  2Y5I A;  2BCX A;  3O4X A;  4XYN A;  1PSB A;  1M31 A;  1YRU B;  1EG3 A;  2LMT A;  1S6I A;  1L2O C;  1K9K A;  2WCK A;  4ZCU A;  2KPH A;  4D1E A;  3N7H A;  1YR5 A;  3B86 A;  3CR4 X;  3VRQ A;  1MWN A;  1QAT A;  1K2H A;  2EGD A;  3FE8 A;  3R72 A;  3EVR A;  4PE4 A;  3BJH A;  4FQO A;  1K8U A;  3EVV A;  2L5Y A;  2I2R E;  4MEW A;  1DT7 B;  2QAC A;  1M45 A;  1XFZ O;  2CNP A;  3TDU A;  3DVK A;  3EK7 A;  1L7Z A;  1YX8 A;  4AOM A;  1A2X A;  2K2F A;  1OMD A;  1QWV A;  1NCX A;  1X02 A;  1DJW A;  4ORA B;  2G9B A;  4GUK A;  2CCM A;  4OKH A;  2LE9 B;  3O78 A;  2I7A A;  2JU0 A;  3DF0 A;  2PAS A;  3GK1 A;  3VRO A;  2KQ6 A;  1SCM B;  1UHK A;  2KFH A;  3CDN A;  3FE6 A;  4F7F A;  1GGW A;  2BBM A;  2M1U A;  2BBN A;  2WC6 A;  2ZFD A;  3JVT B;  3B6X A;  1QV1 A;  3OHM B;  2AAO A;  2AMI A;  2G2B A;  4YGD B;  4YBH B;  2QPT A;  1F54 A;  1KSO A;  3PAT A;  4F0Z B;  2EHB A;  1N2D A;  1ORG A;  2KAV A;  1CFC A;  2PYQ A;  2B1U A;  1YUR A;  3CGA A;  4QJ5 B;  2FCD A;  1DEL A;  2ZNE A;  3SG6 A;  1OW4 A;  1OSA A;  1IJ5 A;  2QEB A;  2JZI A;  1PRW A;  2K61 A;  3SIA A;  2GTE A;  2BL0 C;  2NLN A;  4MZJ A;  1Y1X A;  1H8B A;  4JD9 A;  3PN7 B;  2F3Z A;  1A4P A;  1F8H A;  3LL8 B;  1YTZ C;  3S0F A;  3OX5 A;  1NX3 A;  1SY9 A;  2K8M B;  1G8I A;  1QVI Y;  3VRN A;  1VRK A;  5CPV A;  2BKI B;  2L51 A;  1IKU A;  1AVS A;  3CZT X;  3I5H B;  4HRG A;  2P6B B;  4KYN A;  1SBJ A;  1SR6 C;  1DQE A;  1UP5 A;  3VB1 A;  4GFT A;  2BKH B;  2JC2 A;  1HT9 A;  4NDC A;  1SW8 A;  1XFR A;  5CSN A;  2L4I A;  3CAB A;  4XJK B;  3NXA A;  1BG1 A;  1OZO A;  2M7L A;  3BUM B;  1C07 A;  2LV7 A;  3D75 A;  5AXI A;  1SL7 A;  4N1F A;  4DIR A;  1CM4 A;  2O60 A;  4OVN F;  3OGN A;  1GQM A;  1ZMZ A;  1B8L A;  4YGC B;  1KQV A;  5KU1 A;  2KI6 D;  1CMG A;  1UHJ A;  1WDC C;  1SCV A;  1XVJ A;  1NCY A;  1N0Y A;  3R1O A;  2KAY A;  3EK8 A;  1C3Y A;  2KGR A;  5JJG A;  1YRT B;  2I18 A;  2LMV A;  2LHL A;  1XFX O;  4R1E A;  1CFF A;  2H2K A;  1QVI Z;  1KK8 B;  1IWQ A;  1PK0 D;  5HLV A;  3KO0 A;  5ER5 A;  3GK2 A;  3I5I B;  2QDI A;  2MLF C;  5J3X A;  1MUX A;  2KI4 B;  1XFV O;  2M7N A;  2ISD A;  1ZUZ A;  1F4O A;  1EL4 A;  5PAL A;  1GGZ A;  3OB2 B;  3S0B A;  1LA3 A;  3BXK A;  2WOS A;  3O6B A;  2WOR A;  2CBL A;  1A75 A;  2FOT A;  2BE4 A;  3LK0 A;  3NHI A;  1A03 A;  1JC2 A;  1FBV A;  2JTZ A;  2K2A A;  1KWO B;  3D74 A;  4YGE B;  1REC A;  2JOJ A;  2PAL A;  2NCO A;  2KNE A;  3ICB A;  1QX7 A;  1SSE B;  1CDN A;  2H61 C;  1KQM B;  1TUZ A;  2MHH A;  3K21 A;  2BNX A;  3TS5 B;  1A29 A;  2L50 A;  2L0P A;  5GQQ C;  1IQ5 A;  1WLM A;  2WCB A;  1XK4 C;  1YVL A;  3JVT C;  4E68 A;  4WRI A;  1JFJ A;  1OOH A;  1IGV A;  1UWO A;  2L98 A;  4BY4 A;  4QJ3 B;  1AHR A;  3FWB A;  1Y1A A;  2WCL A;  1KFX S;  3FE9 A;  2MRD A;  4OCI A;  2BE6 A;  2FJY A;  2JWW A;  4GBA A;  4ZCV A;  4AQJ A;  1ALV A;  1YX7 A;  2CTN A;  3WHU B;  2BEC A;  2M0R A;  4DUQ A;  1JUO A;  2A4J A;  3I5G B;  1DJH A;  5G08 A;  1GJY A;  2K0J A;  1EH2 A;  3L47 A;  3TDZ A;  2OTG B;  2WCJ A;  4MLW A;  1BF5 A;  3PN7 C;  1B47 A;  2M97 A;  1K93 D;  2NXQ A;  4M2Q A;  1B4C A;  1EG4 A;  2HQW A;  1CKK A;  5IBW A;  1QIW A;  2IS9 A;  4MZK A;  3JTD B;  4BY5 A;  3V2L A;  1Y6W A;  4TNC A;  3I5H C;  4GGN A;  2LVK A;  3EG5 B;  2QEH A;  5DKR A;  1F70 A;  1MHO A;  1XFW O;  1S36 A;  5FYX A;  5HL1 A;  4PHM A;  1M46 A;  1S1E A;  1YUT A;  2LVV A;  3BQ3 A;  5FI6 A;  5HLO A;  3UO9 A;  2M29 A;  2Y1N A;  3WNX B;  1FI5 A;  3SS5 A;  1OQP A;  1IH0 A;  1LIN A;  1TOP A;  3AAJ A;  1NP8 A;  2RGI A;  3BOW B;  1LA0 A;  1XYD A;  4FQT A;  3CWG A;  5DKQ A;  1K90 D;  1QAS A;  5I8N A;  2JPO A;  1KFX L;  2WC8 A;  3E3R A;  5ER4 X;  2K7B A;  3SG4 A;  4A4B A;  4CLN A;  1FF1 A;  1A75 B;  4IL1 A;  2KI6 C;  2LP3 A;  1TNQ A;  1ALW A;  1SMG A;  3D78 A;  3L4L A;  1U5I A;  3CZ1 A;  1QS7 A;  2JXL A;  4INW A;  1MF8 B;  1BMO A;  2K60 A;  2R2I A;  3QRX A;  1FI6 A;  5BPJ A;  1AJ5 A;  1KK8 C;  4YI9 A;  2Q91 A;  3FWC A;  3NSL A;  4INX A;  1JF0 A;  3OBV A;  3I5I C;  1PSR A;  2OPO A;  2JRF A;  2KBM A;  3EKJ A;  3S0G A;  4U8D A;  2KGB C;  2K7C A;  3SJS A;  1BOC A;  5CSF A;  1DF0 A;  1RFJ A;  2WCH A;  5F6T A;  2EC6 B;  1B1G A;  2SAS A;  3D0Y B;  1MXE A;  3A4U B;  2BCB A;  5I2L A;  3TUY B;  3A8R A;  1RWY A;  2KFF A;  4YGB B;  5FI7 A;  3CLN A;  1J55 A;  2WC5 A;  1V1F A;  2FCE A;  5FI2 A;  2LAN A;  1CFP A;  2KLE A;  3EK4 A;  1AP4 A;  1W9Z A;  3SS3 A;  1SL8 A;  3TS5 C;  1XA5 A;  3NHT A;  2WND A;  4GGF C;  1MR8 A;  1SL9 A;  3DY9 A;  1KCY A;  2HQ8 A;  3AKB A;  5I2O A;  1JBA A;  5HKZ A;  3NSO A;  1KSM A;  1NCZ A;  1AJ4 A;  3DVE A;  3PAL A;  5JOL A;  5D69 A;  1J7O A;  2P71 A;  1DMO A;  3I5G C;  3CR2 A;  1CLB A;  1SNL A;  2BCA A;  2BAP A;  2JNX A;  2OTG C;  4PE1 A;  1S6J A;  4MN0 A;  1F71 A;  3DF0 B;  1CM1 A;  1OMV A;  1WLZ A;  3I5F B;  3R1P A;  1CB1 A;  1CNP A;  2F8P A;  3JTD C;  3BUN B;  3TDI A;  2JT8 A;  3WXA A;  1U5I B;  3F45 A;  3CS1 A;  2JPT A;  1TNP A;  1B8R A;  4I5J A;  2GGZ A;  4PAL A;  3IQO A;  4PHN A;  3EKH A;  1HQV A;  1T14 A;  2LVI A;  1OOI X;  3KHE A;  4ORC B;  5K89 A;  1DJZ A;  3KPX A;  1QLS A;  4NDD A;  1TCO B;  2OS8 B;  1IG5 A;  4P5O E;  3PSR A;  4WQ3 A;  3DZT A;  3VGO A;  1LXF C;  1KFU S;  1G4Y R;  2L2E A;  2I94 A;  2YGU A;  1DF0 B;  2LLT A;  1BJF A;  3ZNI A;  1R2U A;  2Y4Q A;  3HX4 A;  1JWD A;  1DJI A; 
#chains in the Genus database with same CATH homology
 1J7Q A;  2M1K B;  3PFV A;  4PHK A;  1SCM C;  1UHI A;  4JWQ A;  1CLM A;  3DD4 A;  2TN4 A;  3ZWH A;  3C1V A;  1W7I B;  3MSE B;  1TN4 A;  3KF9 A;  2ZRS A;  4MVF A;  2COL B;  4C0L A;  1AK8 A;  4DRW A;  2PMY A;  1LKJ A;  2KFG A;  4CID A;  1RJV A;  2LM5 A;  4YGA A;  1ZAC A;  1DTL A;  2M9G A;  1CFD A;  2HET A;  2H61 A;  1OOJ A;  1SRA A;  1CDL A;  1IJ6 A;  2EC6 C;  2MBX A;  1XK4 A;  2Q4U A;  1NX2 A;  1Q80 A;  1QV0 A;  5HKY A;  1XFY O;  1C7W A;  1WRZ A;  2KHN A;  3O2P A;  3HCM A;  1WRL A;  5AEQ A;  2JQ6 A;  1V1G A;  5TNC A;  3AKA A;  1AUI B;  2E6W A;  1NX1 A;  4C0K A;  2KYC A;  3BUO B;  1TNX A;  1D1O A;  1G33 A;  1LVC D;  2LAP A;  2F2O A;  3OB1 B;  1K96 A;  1RRO A;  4I5K A;  2LLS A;  4WQ2 A;  1B7T Z;  1SYM A;  5AAN A;  1IQ3 A;  4CFR A;  1UHN A;  5CSJ A;  1XO5 A;  1QLK A;  2JT0 A;  3NSI A;  4PCW A;  1B9A A;  2D8N A;  3EVU A;  1QJT A;  2JTT A;  4MRX A;  1TRF A;  1UUS A;  4M2O A;  3WHT B;  1F55 A;  1BU3 A;  3RLZ A;  3FS7 A;  5I2Q A;  4PHJ A;  1OMR A;  2V53 A;  4AQI A;  4QJ4 B;  1C7V A;  1S5G Z;  4XJK A;  1KK7 Z;  1ODB A;  3I5F C;  1MXL C;  1BLQ A;  3BUW B;  3IF7 A;  1J1E A;  1Y1U A;  2K7O A;  2KDH A;  1M39 A;  1NX0 A;  3H4S E;  1SPY A;  4DCK A;  4YI8 A;  1CLL A;  1DVI A;  4JPZ B;  2KI4 C;  1W7J B;  1JSA A;  3FIA A;  2OS8 C;  4M2P A;  4HSZ A;  3PM8 A;  1K9U A;  2KBI A;  2KQY A;  2F33 A;  2L5X B;  3M0W A;  1KWO C;  2ZND A;  5AER A;  1E8A A;  1CTR A;  4N5X A;  3LK1 A;  1J1D A;  4ORB B;  3GOF A;  1KQM C;  4CFQ A;  2JUL A;  2K7D A;  4MSP A;  1J7R A;  4PDZ A;  3SG3 A;  1FW4 A;  4GAO A;  1B8C A;  2MA2 A;  1M63 B;  1OZS A;  4OV2 A;  1YVH A;  2MJW B;  2LNK A;  1S3P A;  2LLU A;  2GGM A;  3BYA A;  3VRP A;  2ZN8 A;  1MQ1 A;  3BUX B;  1S6C A;  3NSK A;  4NDB A;  1DJG A;  4GNK B;  3D10 A;  2LCP A;  2KSP A;  1NIW A;  1Y0V H;  1TIZ A;  2HPS A;  4P2Y B;  1TTX A;  1L2O B;  3SG2 A;  1JFK A;  1TNW A;  1SKT A;  2KOT A;  3RM1 A;  4GGF A;  1NWD A;  2F3Y A;  3DVM A;  4PE7 A;  2LUX A;  1S26 D;  1QIV A;  1YUS A;  1NYA A;  2AUC A;  2PVB A;  2JNF A;  3LLE A;  1PUL A;  4MZL A;  1DGV A;  1NUB A;  3SIB A;  5D7F A;  5KTY A;  1J7P A;  4A4C A;  3O4Y A;  4JQ0 D;  1EXR A;  1ZFS A;  3VRR A;  4DS7 A;  1UUR A;  2WCE A;  4C0J A;  1JF2 A;  4HRE E;  3PLF B;  2NCP A;  1K94 A;  1RTP 1;  2F2P A;  2GV5 A;  1TCF A;  4HRH A;  1UHH A;  2JXC A;  4YRU A;  2ZKM X;  4L9M A;  1PVA A;  1DGU A;  1WRK A;  1QXP A;  1CMF A;  4CPV A;  1CDP A;  1WY9 A;  3LCP C;  2L4H A;  3SG5 A;  4FTG A;  2MLE C;  2CT9 A;  1XFU O;  3TZ1 A;  1SK6 D;  2O5G A;  3AAK A;  3DVJ A;  2NZ0 A;  5AFP A;  3OX6 A;  2Y1M A;  3CR5 X;  4USL A;  2LUC A;  1BR1 B;  4OR9 B;  4I5N B;  4Q04 A;  4NQG A;  1K9P A;  1DJY A;  1OE9 B;  4N1G A;  2JT3 A;  1B7T Y;  2FJU B;  2LMU A;  2PSR A;  1NPQ A;  1BR4 B;  2E30 A;  4ETO A;  5DKN A;  3BOW A;  1IRJ A;  4GPL B;  2BL0 B;  4ICB A;  1CDM A;  1YUU A;  4I5L B;  1NSH A;  2HF5 A;  3SG7 A;  1DJX A;  4PE0 A;  2VRG A;  2M8U A;  1EJ3 A;  1QX2 A;  2PRU A;  2WCF A;  5B8I B;  5HYD A;  4MRY A;  5CSI A;  1SR6 B;  1S5G Y;  1F4Q A;  1RK9 A;  3TUY C;  3GK4 X;  2LVJ A;  5HKW A;  1KK7 Y;  3OP0 A;  1KFU L;  2M49 B;  2DOQ A;  3IQQ A;  1QX5 B;  1BOD A;  1R6P A;  1PAL A;  4MBE A;  1ZOT B;  2ZN9 A;  1FPW A;  5KSZ A;  2LP2 A;  2LHI A;  2KAX A;  3D0Y A;  3KEV A;  1PVB A;  3CTN A;  2MAZ A;  1WDC B;  1H4B A;  1BT6 A;  2M3W A;  2CXJ A;  1N65 A;  1QTX A;  2KYF A;  1K95 A;  2ZRT A;  2LC5 A;  4UPG A;  2SCP A;  2Y5I A;  2BCX A;  4XYN A;  1PSB A;  1M31 A;  1YRU B;  1EG3 A;  2LMT A;  1S6I A;  1L2O C;  1K9K A;  4ZCU A;  4D1E A;  3VRQ A;  1YR5 A;  3CR4 X;  1MWN A;  1QAT A;  1K2H A;  2EGD A;  3EVR A;  4PE4 A;  4FQO A;  1K8U A;  3EVV A;  2I2R E;  4MEW A;  1DT7 B;  2QAC A;  1M45 A;  1XFZ O;  2CNP A;  3TDU A;  3DVK A;  3EK7 A;  1L7Z A;  1YX8 A;  4AOM A;  1A2X A;  2K2F A;  1OMD A;  1X02 A;  1NCX A;  1DJW A;  4ORA B;  2G9B A;  4GUK A;  2CCM A;  4OKH A;  2LE9 B;  3O78 A;  2I7A A;  2JU0 A;  3DF0 A;  2PAS A;  3GK1 A;  3VRO A;  2KQ6 A;  1SCM B;  1UHK A;  2KFH A;  1GGW A;  2BBM A;  2M1U A;  2BBN A;  2ZFD A;  3JVT B;  3OHM B;  1QV1 A;  2AAO A;  2AMI A;  2G2B A;  4YGD B;  4YBH B;  2QPT A;  1F54 A;  1KSO A;  3PAT A;  4F0Z B;  2EHB A;  1N2D A;  2KAV A;  1CFC A;  2B1U A;  1YUR A;  3CGA A;  4QJ5 B;  2FCD A;  2ZNE A;  3SG6 A;  1OSA A;  1IJ5 A;  2JZI A;  1PRW A;  2K61 A;  3SIA A;  2BL0 C;  2NLN A;  4MZJ A;  1Y1X A;  1H8B A;  3PN7 B;  2F3Z A;  1A4P A;  1F8H A;  3LL8 B;  1YTZ C;  3OX5 A;  1NX3 A;  1SY9 A;  2K8M B;  1G8I A;  1QVI Y;  3VRN A;  1VRK A;  5CPV A;  2BKI B;  2L51 A;  1IKU A;  1AVS A;  3CZT X;  3I5H B;  4HRG A;  2P6B B;  1SBJ A;  1SR6 C;  1UP5 A;  4GFT A;  2BKH B;  2JC2 A;  1HT9 A;  4NDC A;  1SW8 A;  5CSN A;  2L4I A;  4XJK B;  3NXA A;  1BG1 A;  1OZO A;  2M7L A;  3BUM B;  1C07 A;  2LV7 A;  5AXI A;  1SL7 A;  4N1F A;  4DIR A;  1CM4 A;  2O60 A;  4OVN F;  1GQM A;  1ZMZ A;  1B8L A;  4YGC B;  1KQV A;  5KU1 A;  2KI6 D;  1CMG A;  1UHJ A;  1WDC C;  1SCV A;  1XVJ A;  1NCY A;  1N0Y A;  2KAY A;  3EK8 A;  2KGR A;  5JJG A;  1YRT B;  2I18 A;  2LMV A;  2LHL A;  1XFX O;  4R1E A;  1CFF A;  2H2K A;  1QVI Z;  1KK8 B;  1IWQ A;  1PK0 D;  5HLV A;  3KO0 A;  5ER5 A;  3GK2 A;  3I5I B;  2MLF C;  5J3X A;  1MUX A;  2KI4 B;  1XFV O;  2M7N A;  2ISD A;  1ZUZ A;  1F4O A;  1EL4 A;  5PAL A;  1GGZ A;  3OB2 B;  1LA3 A;  3BXK A;  2WOS A;  3O6B A;  2WOR A;  2CBL A;  1A75 A;  2FOT A;  2BE4 A;  3LK0 A;  1A03 A;  1JC2 A;  1FBV A;  2JTZ A;  2K2A A;  1KWO B;  4YGE B;  1REC A;  2JOJ A;  2PAL A;  2NCO A;  2KNE A;  3ICB A;  1QX7 A;  1CDN A;  2H61 C;  1KQM B;  2MHH A;  3K21 A;  3TS5 B;  1A29 A;  2L50 A;  2L0P A;  5GQQ C;  1IQ5 A;  1WLM A;  2WCB A;  1XK4 C;  1YVL A;  3JVT C;  4E68 A;  4WRI A;  1JFJ A;  1IGV A;  1UWO A;  2L98 A;  4BY4 A;  4QJ3 B;  1AHR A;  3FWB A;  1Y1A A;  1KFX S;  2MRD A;  4OCI A;  2BE6 A;  2JWW A;  4ZCV A;  4GBA A;  4AQJ A;  1ALV A;  1YX7 A;  2CTN A;  3WHU B;  2BEC A;  2M0R A;  4DUQ A;  1JUO A;  2A4J A;  3I5G B;  1DJH A;  5G08 A;  1GJY A;  2K0J A;  1EH2 A;  3TDZ A;  2OTG B;  1BF5 A;  4MLW A;  1B4C A;  3PN7 C;  1B47 A;  2M97 A;  1K93 D;  2NXQ A;  4M2Q A;  1EG4 A;  2HQW A;  1CKK A;  5IBW A;  1QIW A;  2IS9 A;  4MZK A;  3JTD B;  4BY5 A;  1Y6W A;  4TNC A;  3I5H C;  4GGN A;  2LVK A;  5DKR A;  1F70 A;  1MHO A;  1XFW O;  1S36 A;  5FYX A;  4PHM A;  1M46 A;  1S1E A;  1YUT A;  2LVV A;  3BQ3 A;  5HLO A;  2M29 A;  2Y1N A;  3WNX B;  1FI5 A;  1OQP A;  1IH0 A;  1LIN A;  1TOP A;  3AAJ A;  1NP8 A;  2RGI A;  3BOW B;  1LA0 A;  1XYD A;  3CWG A;  5DKQ A;  1K90 D;  1QAS A;  5I8N A;  2WC8 A;  1KFX L;  5ER4 X;  3E3R A;  3SG4 A;  2K7B A;  4A4B A;  4CLN A;  1FF1 A;  1A75 B;  4IL1 A;  2KI6 C;  2LP3 A;  1TNQ A;  1ALW A;  1SMG A;  1U5I A;  1QS7 A;  2JXL A;  1MF8 B;  1BMO A;  2R2I A;  3QRX A;  1FI6 A;  5BPJ A;  1AJ5 A;  1KK8 C;  4YI9 A;  2Q91 A;  3FWC A;  3NSL A;  1JF0 A;  3I5I C;  1PSR A;  2OPO A;  2JRF A;  2KBM A;  3EKJ A;  4U8D A;  2KGB C;  2K7C A;  3SJS A;  1BOC A;  5CSF A;  1DF0 A;  1RFJ A;  5F6T A;  1B1G A;  2EC6 B;  2SAS A;  3D0Y B;  1MXE A;  3A4U B;  2BCB A;  5I2L A;  3TUY B;  3A8R A;  1RWY A;  2KFF A;  4YGB B;  3CLN A;  1J55 A;  1V1F A;  2FCE A;  2LAN A;  1CFP A;  3EK4 A;  1AP4 A;  1SL8 A;  3TS5 C;  1XA5 A;  2WND A;  4GGF C;  1MR8 A;  1SL9 A;  1KCY A;  2HQ8 A;  3AKB A;  5I2O A;  1JBA A;  5HKZ A;  3NSO A;  1KSM A;  1NCZ A;  1AJ4 A;  3DVE A;  3PAL A;  5JOL A;  5D69 A;  1J7O A;  1DMO A;  3I5G C;  3CR2 A;  1CLB A;  1SNL A;  2BCA A;  2JNX A;  2OTG C;  4PE1 A;  1S6J A;  4MN0 A;  1F71 A;  3DF0 B;  1CM1 A;  1OMV A;  1WLZ A;  3I5F B;  1CB1 A;  1CNP A;  2F8P A;  3JTD C;  3BUN B;  3TDI A;  2JT8 A;  3WXA A;  1U5I B;  3F45 A;  3CS1 A;  2JPT A;  1TNP A;  1B8R A;  4I5J A;  2GGZ A;  4PAL A;  3IQO A;  4PHN A;  3EKH A;  1HQV A;  2LVI A;  5K89 A;  3KHE A;  4ORC B;  1DJZ A;  3KPX A;  1QLS A;  4NDD A;  1TCO B;  2OS8 B;  1IG5 A;  4P5O E;  3PSR A;  4WQ3 A;  3VGO A;  1LXF C;  1KFU S;  1G4Y R;  2L2E A;  2I94 A;  1DF0 B;  2LLT A;  1BJF A;  3ZNI A;  1R2U A;  2Y4Q A;  3HX4 A;  1JWD A;  1DJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...