2MA2A

Solution structure of rasgrp2 ef hands bound to calcium
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
KLDQALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Calcium-binding protein
molecule keywords RAS guanyl-releasing protein 2
publication title Structural analysis of autoinhibition in the Ras-specific exchange factor RasGRP1.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ma2A00
3DVKA 3KEVA 1EJ3A 1OOJA 1JBAA 4DIRA 1KFXL 4WQ3A 4PE1A 2JULA 1CM1A 1SKTA 2KI6C 1UHKA 1RROA 4CFQA 2LANA 1DMOA 4GGFC 4OR9B 1NCYA 1QS7A 1WRLA 3OX5A 1YRTB 3DVJA 4CIDA 5DKNA 4P2YB 3BYAA 2I18A 4WQ2A 2M1UA 1A75B 4PHNA 1H8BA 3I5GB 3I5HC 3BUOB 2JU0A 2KGRA 1YVHA 2ZRSA 2OS8C 2LVIA 1BG1A 3BUWB 4MZJA 1KCYA 1DJXA 2WC8A 2ISDA 3SG6A 5KU1A 1SBJA 1S5GY 2Q4UA 4GFTA 3D0YB 4GGNA 1AVSA 4L9MA 4YGEB 2BKIB 1MWNA 2M3WA 1L7ZA 1BF5A 1QX5B 1QV1A 2IS9A 2JNFA 2A4JA 3TZ1A 1XK4C 5HKWA 2AUCA 2BCBA 3VRRA 3CR2A 2WCBA 3SJSA 1TNXA 4ZCUA 1QX2A 1KWOC 2NZ0A 1BLQA 1OZSA 4PE7A 2GV5A 5HLOA 4OCIA 1IQ5A 4WRIA 1QX7A 1S36A 4OVNF 1WRZA 3C1VA 3O6BA 1MQ1A 4OKHA 1LINA 1SCMC 3EVRA 2K0JA 4MEWA 1EG3A 1K95A 1XA5A 5I8NA 4AQIA 1SNLA 2F3YA 1CMFA 3HX4A 1TN4A 4I5NB 2K2AA 4DUQA 2K7DA 3GOFA 1JC2A 3I5HB 2BCXA 4XJKB 1YX7A 3I5IC 4GBAA 3SIBA 1BR1B 2H2KA 2OS8B 5I2QA 4ZCVA 1A03A 5I2LA 3A4UB 2JRFA 3OX6A 1DJWA 4QJ4B 3TUYC 5ER5A 1CFPA 1KK7Z 2NCOA 2ZN8A 2LCPA 3WHTB 1XFWO 4D1EA 3VGOA 3CLNA 2JC2A 1D1OA 5D7FA 1R6PA 1W7IB 1WY9A 1ALWA 1XFUO 2PASA 3IQOA 4N1FA 1AK8A 4JWQA 1NIWA 2WCFA 4Q04A 2CNPA 1A4PA 2MJWB 1KWOB 4GAOA 2M29A 1GGZA 2JXCA 2JT3A 1MXEA 3CR4X 3IF7A 2DOQA 1CDLA 1TTXA 3EK7A 1J7QA 3LK1A 4MSPA 1W7JB 4BY4A 1CTRA 3O2PA 1SYMA 1A2XA 1BJFA 1X02A 1XFVO 1ZMZA 1AUIB 4NDDA 2LMUA 1CMGA 1FPWA 1B1GA 2PALA 2BE4A 1J55A 1UHJA 1JSAA 4GPLB 4TNCA 2AMIA 4M2PA 5ER4X 2H61A 1S6CA 2K7CA 2KI6D 1SR6C 1JF0A 2F2OA 1B4CA 2PVBA 3BQ3A 2LM5A 2JZIA 1DT7B 1XYDA 3I5IB 2ZNEA 4C0LA 2LUXA 1B7TY 1EXRA 2LC5A 3LLEA 3PALA 5TNCA 4IL1A 1VRKA 1JFKA 1C7WA 2JTZA 3KO0A 1UHHA 2FOTA 4ORCB 1SY9A 1IJ5A 3TUYB 1TCOB 3ZNIA 2CTNA 2KAXA 3DVMA 2E30A 2MLEC 1NWDA 2M49B 1HQVA 2KFFA 4A4BA 1GJYA 2SASA 4I5LB 1KFUL 3O78A 2Q91A 1Y0VH 1PK0D 1KFXS 2K8MB 1A75A 1SW8A 2BKHB 1IRJA 1DGVA 1U5IB 3E3RA 3BXKA 3SIAA 4CFRA 1CDPA 5KSZA 3TS5C 1LA3A 1C07A 5AEQA 2F8PA 2CXJA 3JVTB 2K61A 4AOMA 1QXPA 3LL8B 2EGDA 4I5JA 3AKAA 4GUKA 4MRYA 4PHKA 1DJIA 3D0YA 1M31A 2HPSA 2ZNDA 2LLUA 4C0KA 1DGUA 2LLSA 1LXFC 1PVAA 4BY5A 1J7PA 2K2FA 2KYCA 3BOWB 2I94A 1N2DA 1CFDA 4MRXA 5B8IB 1BR4B 2BL0C 5CSIA 2PRUA 4ORAB 2LAPA 3WHUB 5CSJA 1QVIY 1YURA 2NLNA 2NCPA 1B8RA 4GGFA 3OP0A 3PM8A 5F6TA 1DJHA 2KNEA 1V1FA 2VRGA 5G08A 4HREE 4JQ0D 2LNKA 2KBMA 4YI8A 1EH2A 2LP3A 2TN4A 2L50A 2GGZA 1G4YR 2JT8A 1K93D 1RK9A 2BCAA 5AANA 4QJ5B 2EC6C 2AAOA 1KSOA 2COLB 3SG7A 3TDZA 2PSRA 1M45A 1MF8B 2ZN9A 2ZKMX 1YX8A 1QLKA 1EG4A 1A29A 1YTZC 1TRFA 1FF1A 4XJKA 3TS5B 4CPVA 1G8IA 2BBMA 4AQJA 1BT6A 2LP2A 4GNKB 1BOCA 1LKJA 1XO5A 5I2OA 1ZUZA 2JT0A 2V53A 4JPZB 1K94A 2F33A 1F4OA 1PSBA 1UHIA 4YI9A 3ZWHA 2HQ8A 3K21A 1BMOA 3CWGA 3O4YA 1YR5A 2L2EA 1DJGA 1N65A 2MHHA 1HT9A 1F71A 4MVFA 1IH0A 2P6BB 1XK4A 3CR5X 3SG4A 3QRXA 2M9GA 2MLFC 2Y1MA 3GK1A 4DRWA 1S6JA 2I2RE 5AFPA 1Y1AA 5HLVA 2M97A 3PATA 4QJ3B 3VRQA 1TCFA 3NSIA 3DVEA 4FQOA 2JXLA 1XFZO 3VRNA 1QIWA 4HRHA 1L2OC 3WXAA 1M46A 2FCDA 4PHJA 4CLNA 4A4CA 1UWOA 2KFHA 2KHNA 1CNPA 5PALA 2EC6B 3AKBA 2HQWA 4YRUA 1TNQA 1PSRA 1NYAA 4FTGA 5GQQC 2BBNA 1JF2A 5HKZA 1NCXA 1QV0A 1DTLA 1PULA 2JNXA 3SG2A 1KK8C 2KGBC 2K7OA 1SMGA 1J7RA 1F54A 5FYXA 2JQ6A 4MBEA 1ZOTB 3FIAA 3LK0A 4YGCB 3SG5A 2ZRTA 1SCMB 3FWBA 1DF0B 1E8AA 1OMRA 1S5GZ 2M0RA 2KDHA 4N1GA 2M8UA 5D69A 4ORBB 1LVCD 1YUSA 1RECA 1NSHA 1IWQA 1IGVA 1DJYA 2O5GA 4YGAA 3HCMA 3DF0B 1U5IA 1ODBA 2BECA 1LA0A 1PRWA 4MZKA 4DS7A 1C7VA 1KQVA 2KQYA 2BE6A 1F4QA 3ICBA 1UHNA 3NSLA 1F55A 1K9PA 1UUSA 3I5FC 3WNXB 1G33A 3BUXB 3TDIA 1L2OB 1ALVA 4ICBA 1KQMC 3SG3A 4PCWA 5CSNA 4ETOA 1CB1A 1MXLC 1Q80A 2O60A 2Y4QA 1QTXA 4E68A 5BPJA 1FBVA 2L4IA 2L4HA 1WRKA 1NX2A 2L98A 4PHMA 1FI6A 3BOWA 2LV7A 1OE9B 1OMVA 5CPVA 1H4BA 1J1EA 2JOJA 3IQQA 1WDCC 3PN7C 2FCEA 1J1DA 4OV2A 1GQMA 1KK8B 3F45A 1F70A 3M0WA 4C0JA 1BU3A 1YVLA 1NUBA 1S1EA 2FJUB 1WLMA 1Y1XA 2CT9A 4M2OA 3NXAA 2F3ZA 3GK2A 4HSZA 1JFJA 1R2UA 4NDBA 4PE4A 2LMVA 3LCPC 2L5XB 1SR6B 1UURA 2PMYA 2WORA 3FS7A 1KK7Y 1QIVA 2OTGC 1GGWA 1MHOA 4DCKA 5HYDA 5JJGA 2G2BA 3AAJA 2KFGA 1J7OA 1WLZA 1CLMA 1TNWA 1B8CA 5J3XA 1V1GA 3DD4A 3PLFB 3I5FB 2RGIA 2GGMA 3AAKA 4MLWA 1K9UA 1K96A 2LE9B 5AERA 1KQMB 1B47A 1B9AA 1YRUB 2CBLA 2KSPA 2Y1NA 1UP5A 4NDCA 1N0YA 3VRPA 2G9BA 1QJTA 4NQGA 1CDMA 2LHLA 4YGBB 1SCVA 3KF9A 1YUTA 3EVUA 3PFVA 2KI4C 1K2HA 1SK6D 1B8LA 5DKRA 2M7LA 1NCZA 1WDCB 3PN7B 2LLTA 3KHEA 4R1EA 3NSOA 1B7TZ 2K7BA 3EKHA 3VROA 1TOPA 2Y5IA 5JOLA 1CM4A 3JTDC 2LVJA 1AP4A 1RFJA 3A8RA 4F0ZB 1FW4A 2BL0B 4HRGA 1OQPA 4PDZA 4M2QA 1PVBA 4U8DA 1CFCA 1DVIA 4YBHB 2OTGB 1OZOA 1NX1A 1QASA 4XYNA 1SL8A 5HKYA 2MAZA 1IQ3A 1NX3A 4YGDB 2R2IA 3OHMB 2KOTA 5KTYA 1EL4A 2L0PA 2SCPA 1AJ5A 2MBXA 1RTP1 3RLZA 1KSMA 1DF0A 1K90D 1QLSA 1SPYA 2JWWA 1NP8A 3PSRA 1SL9A 3NSKA 1TIZA 2M7NA 1AJ4A 4PE0A 1F8HA 2LVVA 2KYFA 1CLBA 2I7AA 1S26D 2KI4B 3DF0A 1IKUA 1CFFA 2NXQA 1OSAA 1ZFSA 4I5KA 1CKKA 1XVJA 1SL7A 1JWDA 4UPGA 1PALA 2KQ6A 2E6WA 1XFYO 2D8NA 1K8UA 3EVVA 1QVIZ 2LVKA 3JTDB 2H61C 1RJVA 2F2PA 2B1UA 1DJZA 2WCEA 3RM1A 3H4SE 4MZLA 3FWCA 2KAYA 3MSEB 1CLLA 3EK4A 2KAVA 1RWYA 2HF5A 1IJ6A 1Y6WA 3JVTC 2WNDA 1K9KA 1Y1UA 2CCMA 2WOSA 1QATA 1CDNA 1XFXO 5IBWA 3CZTX 4N5XA 2HETA 4PALA 1MR8A 2M1KB 1S3PA 2QPTA 2ZFDA 5AXIA 1KFUS 3OB1B 1NX0A 2JTTA 3CS1A 5CSFA 1NPQA 1FI5A 3I5GC 3EK8A 2LUCA 2EHBA 2QACA 2LMTA 2OPOA 1M63B 1OMDA 1S6IA 2KBIA 2MA2A 1BODA 3KPXA 1M39A 1MUXA 3CGAA 2MRDA 1AHRA 4P5OE 3EKJA 3TDUA 1ZACA 3BUNB 2LHIA 3BUMB 3OB2B 2JPTA 5K89A 4MN0A 3CTNA 1TNPA 2L51A 1SRAA 3GK4X 3D10A 1YUUA 4USLA 5DKQA 1IG5A 1JUOA
chains in the Genus database with same CATH superfamily
3DVKA 3KEVA 1EJ3A 1OOJA 1JBAA 4DIRA 1KFXL 4WQ3A 4PE1A 5HL1A 2JULA 1CM1A 1SKTA 2KI6C 1UHKA 3DXLA 1RROA 4CFQA 2LANA 5FI6A 2L5YA 1QWVA 1DMOA 4GGFC 4OR9B 3BFHA 1NCYA 1QS7A 1WRLA 3OX5A 1YRTB 2BAPA 1DEKA 3DVJA 4CIDA 5DKNA 4P2YB 1OW4A 3BYAA 3K1EA 2I18A 4WQ2A 2M1UA 1A75B 2BNXA 3S0DA 4PHNA 1H8BA 3S0BA 2QEOA 3I5GB 3I5HC 3BUOB 2JU0A 2KGRA 1YVHA 2ZRSA 2OS8C 2LVIA 1BG1A 3BUWB 3B87A 4MZJA 1KCYA 3QMEA 1DJXA 2WC8A 2ISDA 3SG6A 5KU1A 1SBJA 1S5GY 2Q4UA 4GFTA 3S0FA 3D0YB 4GGNA 1AVSA 2PQLA 4L9MA 2GTEA 4YGEB 2BKIB 1MWNA 2M3WA 1L7ZA 5EL2A 1QX5B 1BF5A 1QV1A 2JPOA 2IS9A 2JNFA 2A4JA 3TZ1A 1XK4C 5HKWA 2AUCA 2BCBA 3VRRA 3CR2A 2WCBA 3SJSA 1TNXA 4ZCUA 1QX2A 1KWOC 3Q8IA 2NZ0A 1BLQA 1OZSA 2KPHA 4PE7A 3D75A 2GV5A 5HLOA 3B7AA 4OCIA 1IQ5A 4IJ7A 4WRIA 1QX7A 1S36A 4OVNF 3S0AA 1WRZA 3C1VA 3O6BA 1MQ1A 4OKHA 1LINA 1SCMC 3EVRA 4INWA 2K0JA 4MEWA 1EG3A 1K95A 1XA5A 5I8NA 3NHTA 1SNLA 4AQIA 2F3YA 1CMFA 3HX4A 1TN4A 4I5NB 2K2AA 4DUQA 2K7DA 3GOFA 1JC2A 3I5HB 3B88A 3V2LA 2BCXA 4XJKB 1C3ZA 1YX7A 3I5IC 4GBAA 3SIBA 1BR1B 2H2KA 2OS8B 5I2QA 3D74A 4ZCVA 1A03A 1OOFA 5I2LA 5FI7A 3A4UB 2JRFA 3OX6A 1DJWA 4QJ4B 3TUYC 5ER5A 1CFPA 1GM0A 1KK7Z 2NCOA 2ZN8A 2LCPA 3WHTB 1XFWO 3CYZA 3VGOA 4D1EA 3CLNA 2JC2A 1D1OA 5D7FA 1R6PA 1W7IB 1WY9A 1ALWA 1XFUO 2PASA 3IQOA 4N1FA 1AK8A 2H8VA 4JWQA 1C3YA 1NIWA 2WCFA 4Q04A 2CNPA 1A4PA 2MJWB 3PM2A 1KWOB 3OGNA 4GAOA 2M29A 1GGZA 2JXCA 2JT3A 1MXEA 3CR4X 3IF7A 2P70A 2DOQA 3BFAA 1CDLA 1TTXA 3EK7A 1J7QA 3LK1A 4MSPA 1W7JB 4BY4A 1CTRA 3CZ0A 1SYMA 3O2PA 1A2XA 1BJFA 1X02A 1XFVO 1ZMZA 1AUIB 4NDDA 2LMUA 1CMGA 1FPWA 1B1GA 2PALA 2BE4A 1J55A 1UHJA 1JSAA 4GPLB 4TNCA 2AMIA 4M2PA 5ER4X 2H61A 1S6CA 2K7CA 2KI6D 1SR6C 1JF0A 2F2OA 1B4CA 2PVBA 1P28A 3BQ3A 2LM5A 2JZIA 1DT7B 1XYDA 3I5IB 2ZNEA 4C0LA 2LUXA 1B7TY 1EXRA 2LC5A 3LLEA 3PALA 5I94A 5TNCA 4IL1A 1VRKA 1DQEA 1JFKA 1C7WA 2JTZA 3KO0A 1UHHA 2FOTA 4ORCB 1SY9A 1IJ5A 3TUYB 1TCOB 3ZNIA 1DELA 2CTNA 2KAXA 3D78A 2E30A 3DVMA 2MLEC 1NWDA 2M49B 1HQVA 2KFFA 4A4BA 1GJYA 2SASA 4I5LB 1KFUL 3O78A 2Q91A 1Y0VH 1PK0D 1KFXS 2K8MB 1A75A 1SW8A 3L4LA 2BKHB 1IRJA 1DGVA 1U5IB 3E3RA 3SS3A 3BXKA 3SIAA 4CFRA 1CDPA 5KSZA 3D77A 3TS5C 1LA3A 1C07A 5AEQA 3L4AA 2F8PA 2CXJA 3JVTB 2K61A 1Z2CB 4AOMA 1QXPA 3LL8B 2EGDA 4I5JA 3AKAA 4GUKA 4MRYA 4PHKA 1DJIA 3D0YA 1M31A 2HPSA 2ZNDA 2LLUA 4C0KA 1DGUA 2LLSA 1LXFC 1PVAA 2QEBA 4BY5A 1J7PA 3NHIA 2K2FA 3O4XA 2KYCA 3BOWB 2I94A 1N2DA 1CFDA 4MRXA 5B8IB 1BR4B 2BL0C 5CSIA 2PRUA 4ORAB 1TUJA 2LAPA 3WHUB 5CSJA 1QVIY 1YURA 2NLNA 2NCPA 1B8RA 3EG5B 1IIOA 4GGFA 3OP0A 3PM8A 5F6TA 1DJHA 2KNEA 1V1FA 2VRGA 5G08A 4HREE 4JQ0D 1TWOA 2LNKA 2KBMA 4YI8A 1EH2A 2LP3A 2TN4A 2L50A 2GGZA 4OZDA 1G4YR 2JT8A 1K93D 1RK9A 2BCAA 2WCHA 3DY9A 5AANA 4QJ5B 2EC6C 2AAOA 1KSOA 2COLB 3SG7A 3TDZA 2PSRA 1M45A 1MF8B 2ZN9A 2ZKMX 1YX8A 1QLKA 1EG4A 1A29A 1YTZC 1TRFA 1FF1A 4XJKA 3TS5B 4CPVA 3BJHA 1G8IA 2BBMA 4AQJA 1BT6A 2LP2A 4GNKB 4USLA 1BOCA 1LKJA 1XO5A 5I2OA 2KLEA 1ZUZA 2JT0A 2V53A 4JPZB 1K94A 2F33A 1F4OA 1PSBA 1UHIA 4YI9A 3ZWHA 2HQ8A 2WCMA 3K21A 1BMOA 1LS8A 3CWGA 3O4YA 1OOIX 1YR5A 2L2EA 1DJGA 1N65A 3OBVA 2MHHA 1HT9A 2WCJA 1F71A 4MVFA 1IH0A 2P6BB 2WCLA 1XK4A 3CR5X 3SG4A 3QRXA 2M9GA 2MLFC 2Y1MA 3GK1A 4DRWA 1S6JA 2I2RE 5AFPA 1Y1AA 5HLVA 2M97A 3PATA 4QJ3B 3VRQA 1TCFA 3NSIA 3DVEA 4FQOA 2JXLA 1XFZO 3VRNA 1QIWA 4HRHA 1L2OC 3WXAA 1M46A 2FCDA 4PHJA 4CLNA 4A4CA 1UWOA 2KFHA 2KHNA 1CNPA 5PALA 2EC6B 3AKBA 2HQWA 4YRUA 1TNQA 1PSRA 3CABA 3B6XA 1NYAA 2PYQA 4FTGA 5GQQC 2BBNA 1JF2A 5HKZA 1NCXA 1QV0A 1DTLA 2QEVA 2WC5A 1PULA 2JNXA 3SG2A 1KK8C 1XFRA 2KGBC 2K7OA 3SS5A 1SMGA 1J7RA 1F54A 5FYXA 2JQ6A 3FE8A 4MBEA 1ZOTB 3FIAA 3LK0A 4YGCB 3SG5A 2ZRTA 1SCMB 3FWBA 1DF0B 1E8AA 1OMRA 1S5GZ 2M0RA 2KDHA 3B86A 2M8UA 2KLDA 3FE9A 4N1GA 5D69A 4ORBB 1LVCD 1YUSA 3R1VA 1RECA 1NSHA 1IWQA 1IGVA 3D76A 1DJYA 2O5GA 4YGAA 3HCMA 3DZTA 3DF0B 3S0EA 1U5IA 1ODBA 2BECA 1LA0A 1PRWA 3IVTA 4MZKA 4DS7A 4INXA 1T14A 1C7VA 1KQVA 2KQYA 2BE6A 1F4QA 3ICBA 1UHNA 4PT1A 3NSLA 1F55A 1K9PA 1UUSA 3I5FC 3WNXB 1G33A 3BUXB 3TDIA 1L2OB 1ALVA 4ICBA 1KQMC 3SG3A 4PCWA 5CSNA 3NGVA 4ETOA 1CB1A 1MXLC 1Q80A 2O60A 2Y4QA 1QTXA 4E68A 5BPJA 1FBVA 2L4IA 1SSEB 2L4HA 1WRKA 1NX2A 4JKTA 2L98A 4PHMA 1FI6A 3BOWA 2LV7A 1OE9B 1OMVA 5CPVA 1H4BA 1J1EA 2JOJA 3IQQA 1WDCC 4F7FA 3PN7C 2FCEA 1J1DA 4OV2A 3R1PA 1GQMA 1KK8B 2QEHA 3F45A 1F70A 3M0WA 4C0JA 3PJIA 1BU3A 1YVLA 3L47A 1NUBA 1S1EA 2FJUB 1WLMA 1Y1XA 2CT9A 4M2OA 3NXAA 3RZSA 2F3ZA 3GK2A 4HSZA 1JFJA 1R2UA 4NDBA 4PE4A 2LMVA 3LCPC 2L5XB 1SR6B 1UURA 2PMYA 2WORA 3FS7A 1KK7Y 1QIVA 2OTGC 1GGWA 1MHOA 4DCKA 5HYDA 5JJGA 2G2BA 3AAJA 2KFGA 1J7OA 3R1OA 1WLZA 1CLMA 1TNWA 1B8CA 5J3XA 1V1GA 3DD4A 3PLFB 3I5FB 5DICA 2RGIA 2GGMA 3AAKA 4MLWA 1K9UA 1K96A 2LE9B 5AERA 1KQMB 1B47A 1B9AA 1YRUB 2CBLA 2KSPA 2Y1NA 1UP5A 4NDCA 2L2CA 1N0YA 3VRPA 2G9BA 1QJTA 4NQGA 1CDMA 2LHLA 4YGBB 1SCVA 3KF9A 1YUTA 3EVUA 3PFVA 2KI4C 1K2HA 1SK6D 1B8LA 5DKRA 2M7LA 1NCZA 1WDCB 3PN7B 2LLTA 3KHEA 4R1EA 3NSOA 1B7TZ 2K7BA 3EKHA 3VROA 1TOPA 2Y5IA 1TUZA 5JOLA 1CM4A 3JTDC 2LVJA 1Z4HA 3N7HA 2QDIA 3CDNA 1AP4A 3UO9A 1RFJA 2YGUA 5FI2A 3A8RA 2ERBA 4F0ZB 1FW4A 2BL0B 4HRGA 1OQPA 4PDZA 4M2QA 1PVBA 1W9ZA 4U8DA 1DVIA 1OOGA 1CFCA 5D3OA 4YBHB 2OTGB 1OZOA 1NX1A 1QASA 2FJYA 4XYNA 1SL8A 5HKYA 3D73A 3R72A 2MAZA 1IQ3A 1NX3A 4YGDB 2R2IA 3OHMB 2KOTA 5KTYA 1EL4A 2L0PA 2SCPA 1AJ5A 2MBXA 1RTP1 3RLZA 1KSMA 3DYEA 1DF0A 1K90D 1QLSA 1SPYA 3UNWA 2JWWA 1NP8A 3PSRA 1SL9A 3NSKA 1TIZA 2M7NA 3S0GA 1AJ4A 4PE0A 1F8HA 2LVVA 2KYFA 1CLBA 2I7AA 1S26D 2KI4B 3DF0A 1IKUA 1CFFA 2NXQA 1OSAA 1ZFSA 4I5KA 1CKKA 1XVJA 1SL7A 1JWDA 1OOHA 4UPGA 1PALA 2KQ6A 4JD9A 2E6WA 1XFYO 2D8NA 3FE6A 1K8UA 3EVVA 1QVIZ 2LVKA 3JTDB 2H61C 1RJVA 2F2PA 2B1UA 1DJZA 2WCEA 3RM1A 3H4SE 4MZLA 3FWCA 2KAYA 3MSEB 1CLLA 3EK4A 2KAVA 3SS4A 1RWYA 2HF5A 1IJ6A 1Y6WA 3JVTC 2WNDA 1K9KA 1Y1UA 2CCMA 2WOSA 1QATA 1DC1A 1XFXO 1CDNA 5IBWA 3CZTX 4N5XA 2HETA 4PALA 1MR8A 2M1KB 3CZ2A 1S3PA 2QPTA 2ZFDA 5AXIA 2K60A 1KFUS 3BFBA 3OB1B 3CZ1A 1NX0A 2JTTA 3CS1A 5CSFA 1NPQA 1ORGA 1FI5A 3I5GC 3EK8A 2LUCA 2EHBA 2QACA 2LMTA 2OPOA 1M63B 1OMDA 1S6IA 2KBIA 2MA2A 1BODA 3KPXA 3VB1A 1M39A 1MUXA 3CGAA 2MRDA 1AHRA 4P5OE 3EKJA 3TDUA 4KYNA 1ZACA 3BUNB 2LHIA 3BUMB 3OB2B 2JPTA 5K89A 4MN0A 3CTNA 1TNPA 2P71A 2WCKA 4FQTA 2L51A 1SRAA 3GK4X 3D10A 1YUUA 2WC6A 5DKQA 1IG5A 1JUOA
chains in the Genus database with same CATH topology
3DVKA 3KEVA 1EJ3A 1OOJA 1JBAA 4DIRA 1KFXL 4WQ3A 4PE1A 2JULA 1CM1A 1SKTA 2KI6C 1UHKA 1RROA 4CFQA 2LANA 1DMOA 4GGFC 4OR9B 1NCYA 1QS7A 1WRLA 3OX5A 1YRTB 3DVJA 4CIDA 5DKNA 4P2YB 3BYAA 2I18A 4WQ2A 2M1UA 1A75B 4PHNA 1H8BA 3I5GB 3I5HC 3BUOB 2JU0A 2KGRA 1YVHA 2ZRSA 2OS8C 2LVIA 1BG1A 3BUWB 4MZJA 1KCYA 1DJXA 2WC8A 2ISDA 3SG6A 5KU1A 1SBJA 1S5GY 2Q4UA 4GFTA 3D0YB 4GGNA 1AVSA 4L9MA 4YGEB 2BKIB 1MWNA 2M3WA 1L7ZA 1BF5A 1QX5B 1QV1A 2IS9A 2JNFA 2A4JA 3TZ1A 1XK4C 5HKWA 2AUCA 2BCBA 3VRRA 3CR2A 2WCBA 3SJSA 1TNXA 4ZCUA 1QX2A 1KWOC 2NZ0A 1BLQA 1OZSA 4PE7A 2GV5A 5HLOA 4OCIA 1IQ5A 4WRIA 1QX7A 1S36A 4OVNF 1WRZA 3C1VA 3O6BA 1MQ1A 4OKHA 1LINA 1SCMC 3EVRA 2K0JA 4MEWA 1EG3A 1K95A 1XA5A 5I8NA 4AQIA 1SNLA 2F3YA 1CMFA 3HX4A 1TN4A 4I5NB 2K2AA 4DUQA 2K7DA 3GOFA 1JC2A 3I5HB 2BCXA 4XJKB 1YX7A 3I5IC 4GBAA 3SIBA 1BR1B 2H2KA 2OS8B 5I2QA 4ZCVA 1A03A 5I2LA 3A4UB 2JRFA 3OX6A 1DJWA 4QJ4B 3TUYC 5ER5A 1CFPA 1KK7Z 2NCOA 2ZN8A 2LCPA 3WHTB 1XFWO 4D1EA 3VGOA 3CLNA 2JC2A 1D1OA 5D7FA 1R6PA 1W7IB 1WY9A 1ALWA 1XFUO 2PASA 3IQOA 4N1FA 1AK8A 4JWQA 1NIWA 2WCFA 4Q04A 2CNPA 1A4PA 2MJWB 1KWOB 4GAOA 2M29A 1GGZA 2JXCA 2JT3A 1MXEA 3CR4X 3IF7A 2DOQA 1CDLA 1TTXA 3EK7A 1J7QA 3LK1A 4MSPA 1W7JB 4BY4A 1CTRA 3O2PA 1SYMA 1A2XA 1BJFA 1X02A 1XFVO 1ZMZA 1AUIB 4NDDA 2LMUA 1CMGA 1FPWA 1B1GA 2PALA 2BE4A 1J55A 1UHJA 1JSAA 4GPLB 4TNCA 2AMIA 4M2PA 5ER4X 2H61A 1S6CA 2K7CA 2KI6D 1SR6C 1JF0A 2F2OA 1B4CA 2PVBA 3BQ3A 2LM5A 2JZIA 1DT7B 1XYDA 3I5IB 2ZNEA 4C0LA 2LUXA 1B7TY 1EXRA 2LC5A 3LLEA 3PALA 5TNCA 4IL1A 1VRKA 1JFKA 1C7WA 2JTZA 3KO0A 1UHHA 2FOTA 4ORCB 1SY9A 1IJ5A 3TUYB 1TCOB 3ZNIA 2CTNA 2KAXA 3DVMA 2E30A 2MLEC 1NWDA 2M49B 1HQVA 2KFFA 4A4BA 1GJYA 2SASA 4I5LB 1KFUL 3O78A 2Q91A 1Y0VH 1PK0D 1KFXS 2K8MB 1A75A 1SW8A 2BKHB 1IRJA 1DGVA 1U5IB 3E3RA 3BXKA 3SIAA 4CFRA 1CDPA 5KSZA 3TS5C 1LA3A 1C07A 5AEQA 2F8PA 2CXJA 3JVTB 2K61A 4AOMA 1QXPA 3LL8B 2EGDA 4I5JA 3AKAA 4GUKA 4MRYA 4PHKA 1DJIA 3D0YA 1M31A 2HPSA 2ZNDA 2LLUA 4C0KA 1DGUA 2LLSA 1LXFC 1PVAA 4BY5A 1J7PA 2K2FA 2KYCA 3BOWB 2I94A 1N2DA 1CFDA 4MRXA 5B8IB 1BR4B 2BL0C 5CSIA 2PRUA 4ORAB 2LAPA 3WHUB 5CSJA 1QVIY 1YURA 2NLNA 2NCPA 1B8RA 4GGFA 3OP0A 3PM8A 5F6TA 1DJHA 2KNEA 1V1FA 2VRGA 5G08A 4HREE 4JQ0D 2LNKA 2KBMA 4YI8A 1EH2A 2LP3A 2TN4A 2L50A 2GGZA 1G4YR 2JT8A 1K93D 1RK9A 2BCAA 5AANA 4QJ5B 2EC6C 2AAOA 1KSOA 2COLB 3SG7A 3TDZA 2PSRA 1M45A 1MF8B 2ZN9A 2ZKMX 1YX8A 1QLKA 1EG4A 1A29A 1YTZC 1TRFA 1FF1A 4XJKA 3TS5B 4CPVA 1G8IA 2BBMA 4AQJA 1BT6A 2LP2A 4GNKB 1BOCA 1LKJA 1XO5A 5I2OA 1ZUZA 2JT0A 2V53A 4JPZB 1K94A 2F33A 1F4OA 1PSBA 1UHIA 4YI9A 3ZWHA 2HQ8A 3K21A 1BMOA 3CWGA 3O4YA 1YR5A 2L2EA 1DJGA 1N65A 2MHHA 1HT9A 1F71A 4MVFA 1IH0A 2P6BB 1XK4A 3CR5X 3SG4A 3QRXA 2M9GA 2MLFC 2Y1MA 3GK1A 4DRWA 1S6JA 2I2RE 5AFPA 1Y1AA 5HLVA 2M97A 3PATA 4QJ3B 3VRQA 1TCFA 3NSIA 3DVEA 4FQOA 2JXLA 1XFZO 3VRNA 1QIWA 4HRHA 1L2OC 3WXAA 1M46A 2FCDA 4PHJA 4CLNA 4A4CA 1UWOA 2KFHA 2KHNA 1CNPA 5PALA 2EC6B 3AKBA 2HQWA 4YRUA 1TNQA 1PSRA 1NYAA 4FTGA 5GQQC 2BBNA 1JF2A 5HKZA 1NCXA 1QV0A 1DTLA 1PULA 2JNXA 3SG2A 1KK8C 2KGBC 2K7OA 1SMGA 1J7RA 1F54A 5FYXA 2JQ6A 4MBEA 1ZOTB 3FIAA 3LK0A 4YGCB 3SG5A 2ZRTA 1SCMB 3FWBA 1DF0B 1E8AA 1OMRA 1S5GZ 2M0RA 2KDHA 4N1GA 2M8UA 5D69A 4ORBB 1LVCD 1YUSA 1RECA 1NSHA 1IWQA 1IGVA 1DJYA 2O5GA 4YGAA 3HCMA 3DF0B 1U5IA 1ODBA 2BECA 1LA0A 1PRWA 4MZKA 4DS7A 1C7VA 1KQVA 2KQYA 2BE6A 1F4QA 3ICBA 1UHNA 3NSLA 1F55A 1K9PA 1UUSA 3I5FC 3WNXB 1G33A 3BUXB 3TDIA 1L2OB 1ALVA 4ICBA 1KQMC 3SG3A 4PCWA 5CSNA 4ETOA 1CB1A 1MXLC 1Q80A 2O60A 2Y4QA 1QTXA 4E68A 5BPJA 1FBVA 2L4IA 2L4HA 1WRKA 1NX2A 2L98A 4PHMA 1FI6A 3BOWA 2LV7A 1OE9B 1OMVA 5CPVA 1H4BA 1J1EA 2JOJA 3IQQA 1WDCC 3PN7C 2FCEA 1J1DA 4OV2A 1GQMA 1KK8B 3F45A 1F70A 3M0WA 4C0JA 1BU3A 1YVLA 1NUBA 1S1EA 2FJUB 1WLMA 1Y1XA 2CT9A 4M2OA 3NXAA 2F3ZA 3GK2A 4HSZA 1JFJA 1R2UA 4NDBA 4PE4A 2LMVA 3LCPC 2L5XB 1SR6B 1UURA 2PMYA 2WORA 3FS7A 1KK7Y 1QIVA 2OTGC 1GGWA 1MHOA 4DCKA 5HYDA 5JJGA 2G2BA 3AAJA 2KFGA 1J7OA 1WLZA 1CLMA 1TNWA 1B8CA 5J3XA 1V1GA 3DD4A 3PLFB 3I5FB 2RGIA 2GGMA 3AAKA 4MLWA 1K9UA 1K96A 2LE9B 5AERA 1KQMB 1B47A 1B9AA 1YRUB 2CBLA 2KSPA 2Y1NA 1UP5A 4NDCA 1N0YA 3VRPA 2G9BA 1QJTA 4NQGA 1CDMA 2LHLA 4YGBB 1SCVA 3KF9A 1YUTA 3EVUA 3PFVA 2KI4C 1K2HA 1SK6D 1B8LA 5DKRA 2M7LA 1NCZA 1WDCB 3PN7B 2LLTA 3KHEA 4R1EA 3NSOA 1B7TZ 2K7BA 3EKHA 3VROA 1TOPA 2Y5IA 5JOLA 1CM4A 3JTDC 2LVJA 1AP4A 1RFJA 3A8RA 4F0ZB 1FW4A 2BL0B 4HRGA 1OQPA 4PDZA 4M2QA 1PVBA 4U8DA 1CFCA 1DVIA 4YBHB 2OTGB 1OZOA 1NX1A 1QASA 4XYNA 1SL8A 5HKYA 2MAZA 1IQ3A 1NX3A 4YGDB 2R2IA 3OHMB 2KOTA 5KTYA 1EL4A 2L0PA 2SCPA 1AJ5A 2MBXA 1RTP1 3RLZA 1KSMA 1DF0A 1K90D 1QLSA 1SPYA 2JWWA 1NP8A 3PSRA 1SL9A 3NSKA 1TIZA 2M7NA 1AJ4A 4PE0A 1F8HA 2LVVA 2KYFA 1CLBA 2I7AA 1S26D 2KI4B 3DF0A 1IKUA 1CFFA 2NXQA 1OSAA 1ZFSA 4I5KA 1CKKA 1XVJA 1SL7A 1JWDA 4UPGA 1PALA 2KQ6A 2E6WA 1XFYO 2D8NA 1K8UA 3EVVA 1QVIZ 2LVKA 3JTDB 2H61C 1RJVA 2F2PA 2B1UA 1DJZA 2WCEA 3RM1A 3H4SE 4MZLA 3FWCA 2KAYA 3MSEB 1CLLA 3EK4A 2KAVA 1RWYA 2HF5A 1IJ6A 1Y6WA 3JVTC 2WNDA 1K9KA 1Y1UA 2CCMA 2WOSA 1QATA 1CDNA 1XFXO 5IBWA 3CZTX 4N5XA 2HETA 4PALA 1MR8A 2M1KB 1S3PA 2QPTA 2ZFDA 5AXIA 1KFUS 3OB1B 1NX0A 2JTTA 3CS1A 5CSFA 1NPQA 1FI5A 3I5GC 3EK8A 2LUCA 2EHBA 2QACA 2LMTA 2OPOA 1M63B 1OMDA 1S6IA 2KBIA 2MA2A 1BODA 3KPXA 1M39A 1MUXA 3CGAA 2MRDA 1AHRA 4P5OE 3EKJA 3TDUA 1ZACA 3BUNB 2LHIA 3BUMB 3OB2B 2JPTA 5K89A 4MN0A 3CTNA 1TNPA 2L51A 1SRAA 3GK4X 3D10A 1YUUA 4USLA 5DKQA 1IG5A 1JUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVK A;  3KEV A;  1EJ3 A;  1OOJ A;  1JBA A;  4DIR A;  1KFX L;  4WQ3 A;  4PE1 A;  2JUL A;  1CM1 A;  1SKT A;  2KI6 C;  1UHK A;  1RRO A;  4CFQ A;  2LAN A;  1DMO A;  4GGF C;  4OR9 B;  1NCY A;  1QS7 A;  1WRL A;  3OX5 A;  1YRT B;  3DVJ A;  4CID A;  5DKN A;  4P2Y B;  3BYA A;  2I18 A;  4WQ2 A;  2M1U A;  1A75 B;  4PHN A;  1H8B A;  3I5G B;  3I5H C;  3BUO B;  2JU0 A;  2KGR A;  1YVH A;  2ZRS A;  2OS8 C;  2LVI A;  1BG1 A;  3BUW B;  4MZJ A;  1KCY A;  1DJX A;  2WC8 A;  2ISD A;  3SG6 A;  5KU1 A;  1SBJ A;  1S5G Y;  2Q4U A;  4GFT A;  3D0Y B;  4GGN A;  1AVS A;  4L9M A;  4YGE B;  2BKI B;  1MWN A;  2M3W A;  1L7Z A;  1BF5 A;  1QX5 B;  1QV1 A;  2IS9 A;  2JNF A;  2A4J A;  3TZ1 A;  1XK4 C;  5HKW A;  2AUC A;  2BCB A;  3VRR A;  3CR2 A;  2WCB A;  3SJS A;  1TNX A;  4ZCU A;  1QX2 A;  1KWO C;  2NZ0 A;  1BLQ A;  1OZS A;  4PE7 A;  2GV5 A;  5HLO A;  4OCI A;  1IQ5 A;  4WRI A;  1QX7 A;  1S36 A;  4OVN F;  1WRZ A;  3C1V A;  3O6B A;  1MQ1 A;  4OKH A;  1LIN A;  1SCM C;  3EVR A;  2K0J A;  4MEW A;  1EG3 A;  1K95 A;  1XA5 A;  5I8N A;  4AQI A;  1SNL A;  2F3Y A;  1CMF A;  3HX4 A;  1TN4 A;  4I5N B;  2K2A A;  4DUQ A;  2K7D A;  3GOF A;  1JC2 A;  3I5H B;  2BCX A;  4XJK B;  1YX7 A;  3I5I C;  4GBA A;  3SIB A;  1BR1 B;  2H2K A;  2OS8 B;  5I2Q A;  4ZCV A;  1A03 A;  5I2L A;  3A4U B;  2JRF A;  3OX6 A;  1DJW A;  4QJ4 B;  3TUY C;  5ER5 A;  1CFP A;  1KK7 Z;  2NCO A;  2ZN8 A;  2LCP A;  3WHT B;  1XFW O;  4D1E A;  3VGO A;  3CLN A;  2JC2 A;  1D1O A;  5D7F A;  1R6P A;  1W7I B;  1WY9 A;  1ALW A;  1XFU O;  2PAS A;  3IQO A;  4N1F A;  1AK8 A;  4JWQ A;  1NIW A;  2WCF A;  4Q04 A;  2CNP A;  1A4P A;  2MJW B;  1KWO B;  4GAO A;  2M29 A;  1GGZ A;  2JXC A;  2JT3 A;  1MXE A;  3CR4 X;  3IF7 A;  2DOQ A;  1CDL A;  1TTX A;  3EK7 A;  1J7Q A;  3LK1 A;  4MSP A;  1W7J B;  4BY4 A;  1CTR A;  3O2P A;  1SYM A;  1A2X A;  1BJF A;  1X02 A;  1XFV O;  1ZMZ A;  1AUI B;  4NDD A;  2LMU A;  1CMG A;  1FPW A;  1B1G A;  2PAL A;  2BE4 A;  1J55 A;  1UHJ A;  1JSA A;  4GPL B;  4TNC A;  2AMI A;  4M2P A;  5ER4 X;  2H61 A;  1S6C A;  2K7C A;  2KI6 D;  1SR6 C;  1JF0 A;  2F2O A;  1B4C A;  2PVB A;  3BQ3 A;  2LM5 A;  2JZI A;  1DT7 B;  1XYD A;  3I5I B;  2ZNE A;  4C0L A;  2LUX A;  1B7T Y;  1EXR A;  2LC5 A;  3LLE A;  3PAL A;  5TNC A;  4IL1 A;  1VRK A;  1JFK A;  1C7W A;  2JTZ A;  3KO0 A;  1UHH A;  2FOT A;  4ORC B;  1SY9 A;  1IJ5 A;  3TUY B;  1TCO B;  3ZNI A;  2CTN A;  2KAX A;  3DVM A;  2E30 A;  2MLE C;  1NWD A;  2M49 B;  1HQV A;  2KFF A;  4A4B A;  1GJY A;  2SAS A;  4I5L B;  1KFU L;  3O78 A;  2Q91 A;  1Y0V H;  1PK0 D;  1KFX S;  2K8M B;  1A75 A;  1SW8 A;  2BKH B;  1IRJ A;  1DGV A;  1U5I B;  3E3R A;  3BXK A;  3SIA A;  4CFR A;  1CDP A;  5KSZ A;  3TS5 C;  1LA3 A;  1C07 A;  5AEQ A;  2F8P A;  2CXJ A;  3JVT B;  2K61 A;  4AOM A;  1QXP A;  3LL8 B;  2EGD A;  4I5J A;  3AKA A;  4GUK A;  4MRY A;  4PHK A;  1DJI A;  3D0Y A;  1M31 A;  2HPS A;  2ZND A;  2LLU A;  4C0K A;  1DGU A;  2LLS A;  1LXF C;  1PVA A;  4BY5 A;  1J7P A;  2K2F A;  2KYC A;  3BOW B;  2I94 A;  1N2D A;  1CFD A;  4MRX A;  5B8I B;  1BR4 B;  2BL0 C;  5CSI A;  2PRU A;  4ORA B;  2LAP A;  3WHU B;  5CSJ A;  1QVI Y;  1YUR A;  2NLN A;  2NCP A;  1B8R A;  4GGF A;  3OP0 A;  3PM8 A;  5F6T A;  1DJH A;  2KNE A;  1V1F A;  2VRG A;  5G08 A;  4HRE E;  4JQ0 D;  2LNK A;  2KBM A;  4YI8 A;  1EH2 A;  2LP3 A;  2TN4 A;  2L50 A;  2GGZ A;  1G4Y R;  2JT8 A;  1K93 D;  1RK9 A;  2BCA A;  5AAN A;  4QJ5 B;  2EC6 C;  2AAO A;  1KSO A;  2COL B;  3SG7 A;  3TDZ A;  2PSR A;  1M45 A;  1MF8 B;  2ZN9 A;  2ZKM X;  1YX8 A;  1QLK A;  1EG4 A;  1A29 A;  1YTZ C;  1TRF A;  1FF1 A;  4XJK A;  3TS5 B;  4CPV A;  1G8I A;  2BBM A;  4AQJ A;  1BT6 A;  2LP2 A;  4GNK B;  1BOC A;  1LKJ A;  1XO5 A;  5I2O A;  1ZUZ A;  2JT0 A;  2V53 A;  4JPZ B;  1K94 A;  2F33 A;  1F4O A;  1PSB A;  1UHI A;  4YI9 A;  3ZWH A;  2HQ8 A;  3K21 A;  1BMO A;  3CWG A;  3O4Y A;  1YR5 A;  2L2E A;  1DJG A;  1N65 A;  2MHH A;  1HT9 A;  1F71 A;  4MVF A;  1IH0 A;  2P6B B;  1XK4 A;  3CR5 X;  3SG4 A;  3QRX A;  2M9G A;  2MLF C;  2Y1M A;  3GK1 A;  4DRW A;  1S6J A;  2I2R E;  5AFP A;  1Y1A A;  5HLV A;  2M97 A;  3PAT A;  4QJ3 B;  3VRQ A;  1TCF A;  3NSI A;  3DVE A;  4FQO A;  2JXL A;  1XFZ O;  3VRN A;  1QIW A;  4HRH A;  1L2O C;  3WXA A;  1M46 A;  2FCD A;  4PHJ A;  4CLN A;  4A4C A;  1UWO A;  2KFH A;  2KHN A;  1CNP A;  5PAL A;  2EC6 B;  3AKB A;  2HQW A;  4YRU A;  1TNQ A;  1PSR A;  1NYA A;  4FTG A;  5GQQ C;  2BBN A;  1JF2 A;  5HKZ A;  1NCX A;  1QV0 A;  1DTL A;  1PUL A;  2JNX A;  3SG2 A;  1KK8 C;  2KGB C;  2K7O A;  1SMG A;  1J7R A;  1F54 A;  5FYX A;  2JQ6 A;  4MBE A;  1ZOT B;  3FIA A;  3LK0 A;  4YGC B;  3SG5 A;  2ZRT A;  1SCM B;  3FWB A;  1DF0 B;  1E8A A;  1OMR A;  1S5G Z;  2M0R A;  2KDH A;  4N1G A;  2M8U A;  5D69 A;  4ORB B;  1LVC D;  1YUS A;  1REC A;  1NSH A;  1IWQ A;  1IGV A;  1DJY A;  2O5G A;  4YGA A;  3HCM A;  3DF0 B;  1U5I A;  1ODB A;  2BEC A;  1LA0 A;  1PRW A;  4MZK A;  4DS7 A;  1C7V A;  1KQV A;  2KQY A;  2BE6 A;  1F4Q A;  3ICB A;  1UHN A;  3NSL A;  1F55 A;  1K9P A;  1UUS A;  3I5F C;  3WNX B;  1G33 A;  3BUX B;  3TDI A;  1L2O B;  1ALV A;  4ICB A;  1KQM C;  3SG3 A;  4PCW A;  5CSN A;  4ETO A;  1CB1 A;  1MXL C;  1Q80 A;  2O60 A;  2Y4Q A;  1QTX A;  4E68 A;  5BPJ A;  1FBV A;  2L4I A;  2L4H A;  1WRK A;  1NX2 A;  2L98 A;  4PHM A;  1FI6 A;  3BOW A;  2LV7 A;  1OE9 B;  1OMV A;  5CPV A;  1H4B A;  1J1E A;  2JOJ A;  3IQQ A;  1WDC C;  3PN7 C;  2FCE A;  1J1D A;  4OV2 A;  1GQM A;  1KK8 B;  3F45 A;  1F70 A;  3M0W A;  4C0J A;  1BU3 A;  1YVL A;  1NUB A;  1S1E A;  2FJU B;  1WLM A;  1Y1X A;  2CT9 A;  4M2O A;  3NXA A;  2F3Z A;  3GK2 A;  4HSZ A;  1JFJ A;  1R2U A;  4NDB A;  4PE4 A;  2LMV A;  3LCP C;  2L5X B;  1SR6 B;  1UUR A;  2PMY A;  2WOR A;  3FS7 A;  1KK7 Y;  1QIV A;  2OTG C;  1GGW A;  1MHO A;  4DCK A;  5HYD A;  5JJG A;  2G2B A;  3AAJ A;  2KFG A;  1J7O A;  1WLZ A;  1CLM A;  1TNW A;  1B8C A;  5J3X A;  1V1G A;  3DD4 A;  3PLF B;  3I5F B;  2RGI A;  2GGM A;  3AAK A;  4MLW A;  1K9U A;  1K96 A;  2LE9 B;  5AER A;  1KQM B;  1B47 A;  1B9A A;  1YRU B;  2CBL A;  2KSP A;  2Y1N A;  1UP5 A;  4NDC A;  1N0Y A;  3VRP A;  2G9B A;  1QJT A;  4NQG A;  1CDM A;  2LHL A;  4YGB B;  1SCV A;  3KF9 A;  1YUT A;  3EVU A;  3PFV A;  2KI4 C;  1K2H A;  1SK6 D;  1B8L A;  5DKR A;  2M7L A;  1NCZ A;  1WDC B;  3PN7 B;  2LLT A;  3KHE A;  4R1E A;  3NSO A;  1B7T Z;  2K7B A;  3EKH A;  3VRO A;  1TOP A;  2Y5I A;  5JOL A;  1CM4 A;  3JTD C;  2LVJ A;  1AP4 A;  1RFJ A;  3A8R A;  4F0Z B;  1FW4 A;  2BL0 B;  4HRG A;  1OQP A;  4PDZ A;  4M2Q A;  1PVB A;  4U8D A;  1CFC A;  1DVI A;  4YBH B;  2OTG B;  1OZO A;  1NX1 A;  1QAS A;  4XYN A;  1SL8 A;  5HKY A;  2MAZ A;  1IQ3 A;  1NX3 A;  4YGD B;  2R2I A;  3OHM B;  2KOT A;  5KTY A;  1EL4 A;  2L0P A;  2SCP A;  1AJ5 A;  2MBX A;  1RTP 1;  3RLZ A;  1KSM A;  1DF0 A;  1K90 D;  1QLS A;  1SPY A;  2JWW A;  1NP8 A;  3PSR A;  1SL9 A;  3NSK A;  1TIZ A;  2M7N A;  1AJ4 A;  4PE0 A;  1F8H A;  2LVV A;  2KYF A;  1CLB A;  2I7A A;  1S26 D;  2KI4 B;  3DF0 A;  1IKU A;  1CFF A;  2NXQ A;  1OSA A;  1ZFS A;  4I5K A;  1CKK A;  1XVJ A;  1SL7 A;  1JWD A;  4UPG A;  1PAL A;  2KQ6 A;  2E6W A;  1XFY O;  2D8N A;  1K8U A;  3EVV A;  1QVI Z;  2LVK A;  3JTD B;  2H61 C;  1RJV A;  2F2P A;  2B1U A;  1DJZ A;  2WCE A;  3RM1 A;  3H4S E;  4MZL A;  3FWC A;  2KAY A;  3MSE B;  1CLL A;  3EK4 A;  2KAV A;  1RWY A;  2HF5 A;  1IJ6 A;  1Y6W A;  3JVT C;  2WND A;  1K9K A;  1Y1U A;  2CCM A;  2WOS A;  1QAT A;  1CDN A;  1XFX O;  5IBW A;  3CZT X;  4N5X A;  2HET A;  4PAL A;  1MR8 A;  2M1K B;  1S3P A;  2QPT A;  2ZFD A;  5AXI A;  1KFU S;  3OB1 B;  1NX0 A;  2JTT A;  3CS1 A;  5CSF A;  1NPQ A;  1FI5 A;  3I5G C;  3EK8 A;  2LUC A;  2EHB A;  2QAC A;  2LMT A;  2OPO A;  1M63 B;  1OMD A;  1S6I A;  2KBI A;  2MA2 A;  1BOD A;  3KPX A;  1M39 A;  1MUX A;  3CGA A;  2MRD A;  1AHR A;  4P5O E;  3EKJ A;  3TDU A;  1ZAC A;  3BUN B;  2LHI A;  3BUM B;  3OB2 B;  2JPT A;  5K89 A;  4MN0 A;  3CTN A;  1TNP A;  2L51 A;  1SRA A;  3GK4 X;  3D10 A;  1YUU A;  4USL A;  5DKQ A;  1IG5 A;  1JUO A; 
#chains in the Genus database with same CATH topology
 3DVK A;  3KEV A;  1EJ3 A;  1OOJ A;  1JBA A;  4DIR A;  1KFX L;  4WQ3 A;  4PE1 A;  5HL1 A;  2JUL A;  1CM1 A;  1SKT A;  2KI6 C;  1UHK A;  3DXL A;  1RRO A;  4CFQ A;  2LAN A;  5FI6 A;  2L5Y A;  1QWV A;  1DMO A;  4GGF C;  4OR9 B;  3BFH A;  1NCY A;  1QS7 A;  1WRL A;  3OX5 A;  1YRT B;  2BAP A;  1DEK A;  3DVJ A;  4CID A;  5DKN A;  4P2Y B;  1OW4 A;  3BYA A;  3K1E A;  2I18 A;  4WQ2 A;  2M1U A;  1A75 B;  2BNX A;  3S0D A;  4PHN A;  1H8B A;  3S0B A;  2QEO A;  3I5G B;  3I5H C;  3BUO B;  2JU0 A;  2KGR A;  1YVH A;  2ZRS A;  2OS8 C;  2LVI A;  1BG1 A;  3BUW B;  3B87 A;  4MZJ A;  1KCY A;  3QME A;  1DJX A;  2WC8 A;  2ISD A;  3SG6 A;  5KU1 A;  1SBJ A;  1S5G Y;  2Q4U A;  4GFT A;  3S0F A;  3D0Y B;  4GGN A;  1AVS A;  2PQL A;  4L9M A;  2GTE A;  4YGE B;  2BKI B;  1MWN A;  2M3W A;  1L7Z A;  5EL2 A;  1QX5 B;  1BF5 A;  1QV1 A;  2JPO A;  2IS9 A;  2JNF A;  2A4J A;  3TZ1 A;  1XK4 C;  5HKW A;  2AUC A;  2BCB A;  3VRR A;  3CR2 A;  2WCB A;  3SJS A;  1TNX A;  4ZCU A;  1QX2 A;  1KWO C;  3Q8I A;  2NZ0 A;  1BLQ A;  1OZS A;  2KPH A;  4PE7 A;  3D75 A;  2GV5 A;  5HLO A;  3B7A A;  4OCI A;  1IQ5 A;  4IJ7 A;  4WRI A;  1QX7 A;  1S36 A;  4OVN F;  3S0A A;  1WRZ A;  3C1V A;  3O6B A;  1MQ1 A;  4OKH A;  1LIN A;  1SCM C;  3EVR A;  4INW A;  2K0J A;  4MEW A;  1EG3 A;  1K95 A;  1XA5 A;  5I8N A;  3NHT A;  1SNL A;  4AQI A;  2F3Y A;  1CMF A;  3HX4 A;  1TN4 A;  4I5N B;  2K2A A;  4DUQ A;  2K7D A;  3GOF A;  1JC2 A;  3I5H B;  3B88 A;  3V2L A;  2BCX A;  4XJK B;  1C3Z A;  1YX7 A;  3I5I C;  4GBA A;  3SIB A;  1BR1 B;  2H2K A;  2OS8 B;  5I2Q A;  3D74 A;  4ZCV A;  1A03 A;  1OOF A;  5I2L A;  5FI7 A;  3A4U B;  2JRF A;  3OX6 A;  1DJW A;  4QJ4 B;  3TUY C;  5ER5 A;  1CFP A;  1GM0 A;  1KK7 Z;  2NCO A;  2ZN8 A;  2LCP A;  3WHT B;  1XFW O;  3CYZ A;  3VGO A;  4D1E A;  3CLN A;  2JC2 A;  1D1O A;  5D7F A;  1R6P A;  1W7I B;  1WY9 A;  1ALW A;  1XFU O;  2PAS A;  3IQO A;  4N1F A;  1AK8 A;  2H8V A;  4JWQ A;  1C3Y A;  1NIW A;  2WCF A;  4Q04 A;  2CNP A;  1A4P A;  2MJW B;  3PM2 A;  1KWO B;  3OGN A;  4GAO A;  2M29 A;  1GGZ A;  2JXC A;  2JT3 A;  1MXE A;  3CR4 X;  3IF7 A;  2P70 A;  2DOQ A;  3BFA A;  1CDL A;  1TTX A;  3EK7 A;  1J7Q A;  3LK1 A;  4MSP A;  1W7J B;  4BY4 A;  1CTR A;  3CZ0 A;  1SYM A;  3O2P A;  1A2X A;  1BJF A;  1X02 A;  1XFV O;  1ZMZ A;  1AUI B;  4NDD A;  2LMU A;  1CMG A;  1FPW A;  1B1G A;  2PAL A;  2BE4 A;  1J55 A;  1UHJ A;  1JSA A;  4GPL B;  4TNC A;  2AMI A;  4M2P A;  5ER4 X;  2H61 A;  1S6C A;  2K7C A;  2KI6 D;  1SR6 C;  1JF0 A;  2F2O A;  1B4C A;  2PVB A;  1P28 A;  3BQ3 A;  2LM5 A;  2JZI A;  1DT7 B;  1XYD A;  3I5I B;  2ZNE A;  4C0L A;  2LUX A;  1B7T Y;  1EXR A;  2LC5 A;  3LLE A;  3PAL A;  5I94 A;  5TNC A;  4IL1 A;  1VRK A;  1DQE A;  1JFK A;  1C7W A;  2JTZ A;  3KO0 A;  1UHH A;  2FOT A;  4ORC B;  1SY9 A;  1IJ5 A;  3TUY B;  1TCO B;  3ZNI A;  1DEL A;  2CTN A;  2KAX A;  3D78 A;  2E30 A;  3DVM A;  2MLE C;  1NWD A;  2M49 B;  1HQV A;  2KFF A;  4A4B A;  1GJY A;  2SAS A;  4I5L B;  1KFU L;  3O78 A;  2Q91 A;  1Y0V H;  1PK0 D;  1KFX S;  2K8M B;  1A75 A;  1SW8 A;  3L4L A;  2BKH B;  1IRJ A;  1DGV A;  1U5I B;  3E3R A;  3SS3 A;  3BXK A;  3SIA A;  4CFR A;  1CDP A;  5KSZ A;  3D77 A;  3TS5 C;  1LA3 A;  1C07 A;  5AEQ A;  3L4A A;  2F8P A;  2CXJ A;  3JVT B;  2K61 A;  1Z2C B;  4AOM A;  1QXP A;  3LL8 B;  2EGD A;  4I5J A;  3AKA A;  4GUK A;  4MRY A;  4PHK A;  1DJI A;  3D0Y A;  1M31 A;  2HPS A;  2ZND A;  2LLU A;  4C0K A;  1DGU A;  2LLS A;  1LXF C;  1PVA A;  2QEB A;  4BY5 A;  1J7P A;  3NHI A;  2K2F A;  3O4X A;  2KYC A;  3BOW B;  2I94 A;  1N2D A;  1CFD A;  4MRX A;  5B8I B;  1BR4 B;  2BL0 C;  5CSI A;  2PRU A;  4ORA B;  1TUJ A;  2LAP A;  3WHU B;  5CSJ A;  1QVI Y;  1YUR A;  2NLN A;  2NCP A;  1B8R A;  3EG5 B;  1IIO A;  4GGF A;  3OP0 A;  3PM8 A;  5F6T A;  1DJH A;  2KNE A;  1V1F A;  2VRG A;  5G08 A;  4HRE E;  4JQ0 D;  1TWO A;  2LNK A;  2KBM A;  4YI8 A;  1EH2 A;  2LP3 A;  2TN4 A;  2L50 A;  2GGZ A;  4OZD A;  1G4Y R;  2JT8 A;  1K93 D;  1RK9 A;  2BCA A;  2WCH A;  3DY9 A;  5AAN A;  4QJ5 B;  2EC6 C;  2AAO A;  1KSO A;  2COL B;  3SG7 A;  3TDZ A;  2PSR A;  1M45 A;  1MF8 B;  2ZN9 A;  2ZKM X;  1YX8 A;  1QLK A;  1EG4 A;  1A29 A;  1YTZ C;  1TRF A;  1FF1 A;  4XJK A;  3TS5 B;  4CPV A;  3BJH A;  1G8I A;  2BBM A;  4AQJ A;  1BT6 A;  2LP2 A;  4GNK B;  4USL A;  1BOC A;  1LKJ A;  1XO5 A;  5I2O A;  2KLE A;  1ZUZ A;  2JT0 A;  2V53 A;  4JPZ B;  1K94 A;  2F33 A;  1F4O A;  1PSB A;  1UHI A;  4YI9 A;  3ZWH A;  2HQ8 A;  2WCM A;  3K21 A;  1BMO A;  1LS8 A;  3CWG A;  3O4Y A;  1OOI X;  1YR5 A;  2L2E A;  1DJG A;  1N65 A;  3OBV A;  2MHH A;  1HT9 A;  2WCJ A;  1F71 A;  4MVF A;  1IH0 A;  2P6B B;  2WCL A;  1XK4 A;  3CR5 X;  3SG4 A;  3QRX A;  2M9G A;  2MLF C;  2Y1M A;  3GK1 A;  4DRW A;  1S6J A;  2I2R E;  5AFP A;  1Y1A A;  5HLV A;  2M97 A;  3PAT A;  4QJ3 B;  3VRQ A;  1TCF A;  3NSI A;  3DVE A;  4FQO A;  2JXL A;  1XFZ O;  3VRN A;  1QIW A;  4HRH A;  1L2O C;  3WXA A;  1M46 A;  2FCD A;  4PHJ A;  4CLN A;  4A4C A;  1UWO A;  2KFH A;  2KHN A;  1CNP A;  5PAL A;  2EC6 B;  3AKB A;  2HQW A;  4YRU A;  1TNQ A;  1PSR A;  3CAB A;  3B6X A;  1NYA A;  2PYQ A;  4FTG A;  5GQQ C;  2BBN A;  1JF2 A;  5HKZ A;  1NCX A;  1QV0 A;  1DTL A;  2QEV A;  2WC5 A;  1PUL A;  2JNX A;  3SG2 A;  1KK8 C;  1XFR A;  2KGB C;  2K7O A;  3SS5 A;  1SMG A;  1J7R A;  1F54 A;  5FYX A;  2JQ6 A;  3FE8 A;  4MBE A;  1ZOT B;  3FIA A;  3LK0 A;  4YGC B;  3SG5 A;  2ZRT A;  1SCM B;  3FWB A;  1DF0 B;  1E8A A;  1OMR A;  1S5G Z;  2M0R A;  2KDH A;  3B86 A;  2M8U A;  2KLD A;  3FE9 A;  4N1G A;  5D69 A;  4ORB B;  1LVC D;  1YUS A;  3R1V A;  1REC A;  1NSH A;  1IWQ A;  1IGV A;  3D76 A;  1DJY A;  2O5G A;  4YGA A;  3HCM A;  3DZT A;  3DF0 B;  3S0E A;  1U5I A;  1ODB A;  2BEC A;  1LA0 A;  1PRW A;  3IVT A;  4MZK A;  4DS7 A;  4INX A;  1T14 A;  1C7V A;  1KQV A;  2KQY A;  2BE6 A;  1F4Q A;  3ICB A;  1UHN A;  4PT1 A;  3NSL A;  1F55 A;  1K9P A;  1UUS A;  3I5F C;  3WNX B;  1G33 A;  3BUX B;  3TDI A;  1L2O B;  1ALV A;  4ICB A;  1KQM C;  3SG3 A;  4PCW A;  5CSN A;  3NGV A;  4ETO A;  1CB1 A;  1MXL C;  1Q80 A;  2O60 A;  2Y4Q A;  1QTX A;  4E68 A;  5BPJ A;  1FBV A;  2L4I A;  1SSE B;  2L4H A;  1WRK A;  1NX2 A;  4JKT A;  2L98 A;  4PHM A;  1FI6 A;  3BOW A;  2LV7 A;  1OE9 B;  1OMV A;  5CPV A;  1H4B A;  1J1E A;  2JOJ A;  3IQQ A;  1WDC C;  4F7F A;  3PN7 C;  2FCE A;  1J1D A;  4OV2 A;  3R1P A;  1GQM A;  1KK8 B;  2QEH A;  3F45 A;  1F70 A;  3M0W A;  4C0J A;  3PJI A;  1BU3 A;  1YVL A;  3L47 A;  1NUB A;  1S1E A;  2FJU B;  1WLM A;  1Y1X A;  2CT9 A;  4M2O A;  3NXA A;  3RZS A;  2F3Z A;  3GK2 A;  4HSZ A;  1JFJ A;  1R2U A;  4NDB A;  4PE4 A;  2LMV A;  3LCP C;  2L5X B;  1SR6 B;  1UUR A;  2PMY A;  2WOR A;  3FS7 A;  1KK7 Y;  1QIV A;  2OTG C;  1GGW A;  1MHO A;  4DCK A;  5HYD A;  5JJG A;  2G2B A;  3AAJ A;  2KFG A;  1J7O A;  3R1O A;  1WLZ A;  1CLM A;  1TNW A;  1B8C A;  5J3X A;  1V1G A;  3DD4 A;  3PLF B;  3I5F B;  5DIC A;  2RGI A;  2GGM A;  3AAK A;  4MLW A;  1K9U A;  1K96 A;  2LE9 B;  5AER A;  1KQM B;  1B47 A;  1B9A A;  1YRU B;  2CBL A;  2KSP A;  2Y1N A;  1UP5 A;  4NDC A;  2L2C A;  1N0Y A;  3VRP A;  2G9B A;  1QJT A;  4NQG A;  1CDM A;  2LHL A;  4YGB B;  1SCV A;  3KF9 A;  1YUT A;  3EVU A;  3PFV A;  2KI4 C;  1K2H A;  1SK6 D;  1B8L A;  5DKR A;  2M7L A;  1NCZ A;  1WDC B;  3PN7 B;  2LLT A;  3KHE A;  4R1E A;  3NSO A;  1B7T Z;  2K7B A;  3EKH A;  3VRO A;  1TOP A;  2Y5I A;  1TUZ A;  5JOL A;  1CM4 A;  3JTD C;  2LVJ A;  1Z4H A;  3N7H A;  2QDI A;  3CDN A;  1AP4 A;  3UO9 A;  1RFJ A;  2YGU A;  5FI2 A;  3A8R A;  2ERB A;  4F0Z B;  1FW4 A;  2BL0 B;  4HRG A;  1OQP A;  4PDZ A;  4M2Q A;  1PVB A;  1W9Z A;  4U8D A;  1DVI A;  1OOG A;  1CFC A;  5D3O A;  4YBH B;  2OTG B;  1OZO A;  1NX1 A;  1QAS A;  2FJY A;  4XYN A;  1SL8 A;  5HKY A;  3D73 A;  3R72 A;  2MAZ A;  1IQ3 A;  1NX3 A;  4YGD B;  2R2I A;  3OHM B;  2KOT A;  5KTY A;  1EL4 A;  2L0P A;  2SCP A;  1AJ5 A;  2MBX A;  1RTP 1;  3RLZ A;  1KSM A;  3DYE A;  1DF0 A;  1K90 D;  1QLS A;  1SPY A;  3UNW A;  2JWW A;  1NP8 A;  3PSR A;  1SL9 A;  3NSK A;  1TIZ A;  2M7N A;  3S0G A;  1AJ4 A;  4PE0 A;  1F8H A;  2LVV A;  2KYF A;  1CLB A;  2I7A A;  1S26 D;  2KI4 B;  3DF0 A;  1IKU A;  1CFF A;  2NXQ A;  1OSA A;  1ZFS A;  4I5K A;  1CKK A;  1XVJ A;  1SL7 A;  1JWD A;  1OOH A;  4UPG A;  1PAL A;  2KQ6 A;  4JD9 A;  2E6W A;  1XFY O;  2D8N A;  3FE6 A;  1K8U A;  3EVV A;  1QVI Z;  2LVK A;  3JTD B;  2H61 C;  1RJV A;  2F2P A;  2B1U A;  1DJZ A;  2WCE A;  3RM1 A;  3H4S E;  4MZL A;  3FWC A;  2KAY A;  3MSE B;  1CLL A;  3EK4 A;  2KAV A;  3SS4 A;  1RWY A;  2HF5 A;  1IJ6 A;  1Y6W A;  3JVT C;  2WND A;  1K9K A;  1Y1U A;  2CCM A;  2WOS A;  1QAT A;  1DC1 A;  1XFX O;  1CDN A;  5IBW A;  3CZT X;  4N5X A;  2HET A;  4PAL A;  1MR8 A;  2M1K B;  3CZ2 A;  1S3P A;  2QPT A;  2ZFD A;  5AXI A;  2K60 A;  1KFU S;  3BFB A;  3OB1 B;  3CZ1 A;  1NX0 A;  2JTT A;  3CS1 A;  5CSF A;  1NPQ A;  1ORG A;  1FI5 A;  3I5G C;  3EK8 A;  2LUC A;  2EHB A;  2QAC A;  2LMT A;  2OPO A;  1M63 B;  1OMD A;  1S6I A;  2KBI A;  2MA2 A;  1BOD A;  3KPX A;  3VB1 A;  1M39 A;  1MUX A;  3CGA A;  2MRD A;  1AHR A;  4P5O E;  3EKJ A;  3TDU A;  4KYN A;  1ZAC A;  3BUN B;  2LHI A;  3BUM B;  3OB2 B;  2JPT A;  5K89 A;  4MN0 A;  3CTN A;  1TNP A;  2P71 A;  2WCK A;  4FQT A;  2L51 A;  1SRA A;  3GK4 X;  3D10 A;  1YUU A;  2WC6 A;  5DKQ A;  1IG5 A;  1JUO A; 
#chains in the Genus database with same CATH homology
 3DVK A;  3KEV A;  1EJ3 A;  1OOJ A;  1JBA A;  4DIR A;  1KFX L;  4WQ3 A;  4PE1 A;  2JUL A;  1CM1 A;  1SKT A;  2KI6 C;  1UHK A;  1RRO A;  4CFQ A;  2LAN A;  1DMO A;  4GGF C;  4OR9 B;  1NCY A;  1QS7 A;  1WRL A;  3OX5 A;  1YRT B;  3DVJ A;  4CID A;  5DKN A;  4P2Y B;  3BYA A;  2I18 A;  4WQ2 A;  2M1U A;  1A75 B;  4PHN A;  1H8B A;  3I5G B;  3I5H C;  3BUO B;  2JU0 A;  2KGR A;  1YVH A;  2ZRS A;  2OS8 C;  2LVI A;  1BG1 A;  3BUW B;  4MZJ A;  1KCY A;  1DJX A;  2WC8 A;  2ISD A;  3SG6 A;  5KU1 A;  1SBJ A;  1S5G Y;  2Q4U A;  4GFT A;  3D0Y B;  4GGN A;  1AVS A;  4L9M A;  4YGE B;  2BKI B;  1MWN A;  2M3W A;  1L7Z A;  1BF5 A;  1QX5 B;  1QV1 A;  2IS9 A;  2JNF A;  2A4J A;  3TZ1 A;  1XK4 C;  5HKW A;  2AUC A;  2BCB A;  3VRR A;  3CR2 A;  2WCB A;  3SJS A;  1TNX A;  4ZCU A;  1QX2 A;  1KWO C;  2NZ0 A;  1BLQ A;  1OZS A;  4PE7 A;  2GV5 A;  5HLO A;  4OCI A;  1IQ5 A;  4WRI A;  1QX7 A;  1S36 A;  4OVN F;  1WRZ A;  3C1V A;  3O6B A;  1MQ1 A;  4OKH A;  1LIN A;  1SCM C;  3EVR A;  2K0J A;  4MEW A;  1EG3 A;  1K95 A;  1XA5 A;  5I8N A;  4AQI A;  1SNL A;  2F3Y A;  1CMF A;  3HX4 A;  1TN4 A;  4I5N B;  2K2A A;  4DUQ A;  2K7D A;  3GOF A;  1JC2 A;  3I5H B;  2BCX A;  4XJK B;  1YX7 A;  3I5I C;  4GBA A;  3SIB A;  1BR1 B;  2H2K A;  2OS8 B;  5I2Q A;  4ZCV A;  1A03 A;  5I2L A;  3A4U B;  2JRF A;  3OX6 A;  1DJW A;  4QJ4 B;  3TUY C;  5ER5 A;  1CFP A;  1KK7 Z;  2NCO A;  2ZN8 A;  2LCP A;  3WHT B;  1XFW O;  4D1E A;  3VGO A;  3CLN A;  2JC2 A;  1D1O A;  5D7F A;  1R6P A;  1W7I B;  1WY9 A;  1ALW A;  1XFU O;  2PAS A;  3IQO A;  4N1F A;  1AK8 A;  4JWQ A;  1NIW A;  2WCF A;  4Q04 A;  2CNP A;  1A4P A;  2MJW B;  1KWO B;  4GAO A;  2M29 A;  1GGZ A;  2JXC A;  2JT3 A;  1MXE A;  3CR4 X;  3IF7 A;  2DOQ A;  1CDL A;  1TTX A;  3EK7 A;  1J7Q A;  3LK1 A;  4MSP A;  1W7J B;  4BY4 A;  1CTR A;  3O2P A;  1SYM A;  1A2X A;  1BJF A;  1X02 A;  1XFV O;  1ZMZ A;  1AUI B;  4NDD A;  2LMU A;  1CMG A;  1FPW A;  1B1G A;  2PAL A;  2BE4 A;  1J55 A;  1UHJ A;  1JSA A;  4GPL B;  4TNC A;  2AMI A;  4M2P A;  5ER4 X;  2H61 A;  1S6C A;  2K7C A;  2KI6 D;  1SR6 C;  1JF0 A;  2F2O A;  1B4C A;  2PVB A;  3BQ3 A;  2LM5 A;  2JZI A;  1DT7 B;  1XYD A;  3I5I B;  2ZNE A;  4C0L A;  2LUX A;  1B7T Y;  1EXR A;  2LC5 A;  3LLE A;  3PAL A;  5TNC A;  4IL1 A;  1VRK A;  1JFK A;  1C7W A;  2JTZ A;  3KO0 A;  1UHH A;  2FOT A;  4ORC B;  1SY9 A;  1IJ5 A;  3TUY B;  1TCO B;  3ZNI A;  2CTN A;  2KAX A;  3DVM A;  2E30 A;  2MLE C;  1NWD A;  2M49 B;  1HQV A;  2KFF A;  4A4B A;  1GJY A;  2SAS A;  4I5L B;  1KFU L;  3O78 A;  2Q91 A;  1Y0V H;  1PK0 D;  1KFX S;  2K8M B;  1A75 A;  1SW8 A;  2BKH B;  1IRJ A;  1DGV A;  1U5I B;  3E3R A;  3BXK A;  3SIA A;  4CFR A;  1CDP A;  5KSZ A;  3TS5 C;  1LA3 A;  1C07 A;  5AEQ A;  2F8P A;  2CXJ A;  3JVT B;  2K61 A;  4AOM A;  1QXP A;  3LL8 B;  2EGD A;  4I5J A;  3AKA A;  4GUK A;  4MRY A;  4PHK A;  1DJI A;  3D0Y A;  1M31 A;  2HPS A;  2ZND A;  2LLU A;  4C0K A;  1DGU A;  2LLS A;  1LXF C;  1PVA A;  4BY5 A;  1J7P A;  2K2F A;  2KYC A;  3BOW B;  2I94 A;  1N2D A;  1CFD A;  4MRX A;  5B8I B;  1BR4 B;  2BL0 C;  5CSI A;  2PRU A;  4ORA B;  2LAP A;  3WHU B;  5CSJ A;  1QVI Y;  1YUR A;  2NLN A;  2NCP A;  1B8R A;  4GGF A;  3OP0 A;  3PM8 A;  5F6T A;  1DJH A;  2KNE A;  1V1F A;  2VRG A;  5G08 A;  4HRE E;  4JQ0 D;  2LNK A;  2KBM A;  4YI8 A;  1EH2 A;  2LP3 A;  2TN4 A;  2L50 A;  2GGZ A;  1G4Y R;  2JT8 A;  1K93 D;  1RK9 A;  2BCA A;  5AAN A;  4QJ5 B;  2EC6 C;  2AAO A;  1KSO A;  2COL B;  3SG7 A;  3TDZ A;  2PSR A;  1M45 A;  1MF8 B;  2ZN9 A;  2ZKM X;  1YX8 A;  1QLK A;  1EG4 A;  1A29 A;  1YTZ C;  1TRF A;  1FF1 A;  4XJK A;  3TS5 B;  4CPV A;  1G8I A;  2BBM A;  4AQJ A;  1BT6 A;  2LP2 A;  4GNK B;  1BOC A;  1LKJ A;  1XO5 A;  5I2O A;  1ZUZ A;  2JT0 A;  2V53 A;  4JPZ B;  1K94 A;  2F33 A;  1F4O A;  1PSB A;  1UHI A;  4YI9 A;  3ZWH A;  2HQ8 A;  3K21 A;  1BMO A;  3CWG A;  3O4Y A;  1YR5 A;  2L2E A;  1DJG A;  1N65 A;  2MHH A;  1HT9 A;  1F71 A;  4MVF A;  1IH0 A;  2P6B B;  1XK4 A;  3CR5 X;  3SG4 A;  3QRX A;  2M9G A;  2MLF C;  2Y1M A;  3GK1 A;  4DRW A;  1S6J A;  2I2R E;  5AFP A;  1Y1A A;  5HLV A;  2M97 A;  3PAT A;  4QJ3 B;  3VRQ A;  1TCF A;  3NSI A;  3DVE A;  4FQO A;  2JXL A;  1XFZ O;  3VRN A;  1QIW A;  4HRH A;  1L2O C;  3WXA A;  1M46 A;  2FCD A;  4PHJ A;  4CLN A;  4A4C A;  1UWO A;  2KFH A;  2KHN A;  1CNP A;  5PAL A;  2EC6 B;  3AKB A;  2HQW A;  4YRU A;  1TNQ A;  1PSR A;  1NYA A;  4FTG A;  5GQQ C;  2BBN A;  1JF2 A;  5HKZ A;  1NCX A;  1QV0 A;  1DTL A;  1PUL A;  2JNX A;  3SG2 A;  1KK8 C;  2KGB C;  2K7O A;  1SMG A;  1J7R A;  1F54 A;  5FYX A;  2JQ6 A;  4MBE A;  1ZOT B;  3FIA A;  3LK0 A;  4YGC B;  3SG5 A;  2ZRT A;  1SCM B;  3FWB A;  1DF0 B;  1E8A A;  1OMR A;  1S5G Z;  2M0R A;  2KDH A;  4N1G A;  2M8U A;  5D69 A;  4ORB B;  1LVC D;  1YUS A;  1REC A;  1NSH A;  1IWQ A;  1IGV A;  1DJY A;  2O5G A;  4YGA A;  3HCM A;  3DF0 B;  1U5I A;  1ODB A;  2BEC A;  1LA0 A;  1PRW A;  4MZK A;  4DS7 A;  1C7V A;  1KQV A;  2KQY A;  2BE6 A;  1F4Q A;  3ICB A;  1UHN A;  3NSL A;  1F55 A;  1K9P A;  1UUS A;  3I5F C;  3WNX B;  1G33 A;  3BUX B;  3TDI A;  1L2O B;  1ALV A;  4ICB A;  1KQM C;  3SG3 A;  4PCW A;  5CSN A;  4ETO A;  1CB1 A;  1MXL C;  1Q80 A;  2O60 A;  2Y4Q A;  1QTX A;  4E68 A;  5BPJ A;  1FBV A;  2L4I A;  2L4H A;  1WRK A;  1NX2 A;  2L98 A;  4PHM A;  1FI6 A;  3BOW A;  2LV7 A;  1OE9 B;  1OMV A;  5CPV A;  1H4B A;  1J1E A;  2JOJ A;  3IQQ A;  1WDC C;  3PN7 C;  2FCE A;  1J1D A;  4OV2 A;  1GQM A;  1KK8 B;  3F45 A;  1F70 A;  3M0W A;  4C0J A;  1BU3 A;  1YVL A;  1NUB A;  1S1E A;  2FJU B;  1WLM A;  1Y1X A;  2CT9 A;  4M2O A;  3NXA A;  2F3Z A;  3GK2 A;  4HSZ A;  1JFJ A;  1R2U A;  4NDB A;  4PE4 A;  2LMV A;  3LCP C;  2L5X B;  1SR6 B;  1UUR A;  2PMY A;  2WOR A;  3FS7 A;  1KK7 Y;  1QIV A;  2OTG C;  1GGW A;  1MHO A;  4DCK A;  5HYD A;  5JJG A;  2G2B A;  3AAJ A;  2KFG A;  1J7O A;  1WLZ A;  1CLM A;  1TNW A;  1B8C A;  5J3X A;  1V1G A;  3DD4 A;  3PLF B;  3I5F B;  2RGI A;  2GGM A;  3AAK A;  4MLW A;  1K9U A;  1K96 A;  2LE9 B;  5AER A;  1KQM B;  1B47 A;  1B9A A;  1YRU B;  2CBL A;  2KSP A;  2Y1N A;  1UP5 A;  4NDC A;  1N0Y A;  3VRP A;  2G9B A;  1QJT A;  4NQG A;  1CDM A;  2LHL A;  4YGB B;  1SCV A;  3KF9 A;  1YUT A;  3EVU A;  3PFV A;  2KI4 C;  1K2H A;  1SK6 D;  1B8L A;  5DKR A;  2M7L A;  1NCZ A;  1WDC B;  3PN7 B;  2LLT A;  3KHE A;  4R1E A;  3NSO A;  1B7T Z;  2K7B A;  3EKH A;  3VRO A;  1TOP A;  2Y5I A;  5JOL A;  1CM4 A;  3JTD C;  2LVJ A;  1AP4 A;  1RFJ A;  3A8R A;  4F0Z B;  1FW4 A;  2BL0 B;  4HRG A;  1OQP A;  4PDZ A;  4M2Q A;  1PVB A;  4U8D A;  1CFC A;  1DVI A;  4YBH B;  2OTG B;  1OZO A;  1NX1 A;  1QAS A;  4XYN A;  1SL8 A;  5HKY A;  2MAZ A;  1IQ3 A;  1NX3 A;  4YGD B;  2R2I A;  3OHM B;  2KOT A;  5KTY A;  1EL4 A;  2L0P A;  2SCP A;  1AJ5 A;  2MBX A;  1RTP 1;  3RLZ A;  1KSM A;  1DF0 A;  1K90 D;  1QLS A;  1SPY A;  2JWW A;  1NP8 A;  3PSR A;  1SL9 A;  3NSK A;  1TIZ A;  2M7N A;  1AJ4 A;  4PE0 A;  1F8H A;  2LVV A;  2KYF A;  1CLB A;  2I7A A;  1S26 D;  2KI4 B;  3DF0 A;  1IKU A;  1CFF A;  2NXQ A;  1OSA A;  1ZFS A;  4I5K A;  1CKK A;  1XVJ A;  1SL7 A;  1JWD A;  4UPG A;  1PAL A;  2KQ6 A;  2E6W A;  1XFY O;  2D8N A;  1K8U A;  3EVV A;  1QVI Z;  2LVK A;  3JTD B;  2H61 C;  1RJV A;  2F2P A;  2B1U A;  1DJZ A;  2WCE A;  3RM1 A;  3H4S E;  4MZL A;  3FWC A;  2KAY A;  3MSE B;  1CLL A;  3EK4 A;  2KAV A;  1RWY A;  2HF5 A;  1IJ6 A;  1Y6W A;  3JVT C;  2WND A;  1K9K A;  1Y1U A;  2CCM A;  2WOS A;  1QAT A;  1CDN A;  1XFX O;  5IBW A;  3CZT X;  4N5X A;  2HET A;  4PAL A;  1MR8 A;  2M1K B;  1S3P A;  2QPT A;  2ZFD A;  5AXI A;  1KFU S;  3OB1 B;  1NX0 A;  2JTT A;  3CS1 A;  5CSF A;  1NPQ A;  1FI5 A;  3I5G C;  3EK8 A;  2LUC A;  2EHB A;  2QAC A;  2LMT A;  2OPO A;  1M63 B;  1OMD A;  1S6I A;  2KBI A;  2MA2 A;  1BOD A;  3KPX A;  1M39 A;  1MUX A;  3CGA A;  2MRD A;  1AHR A;  4P5O E;  3EKJ A;  3TDU A;  1ZAC A;  3BUN B;  2LHI A;  3BUM B;  3OB2 B;  2JPT A;  5K89 A;  4MN0 A;  3CTN A;  1TNP A;  2L51 A;  1SRA A;  3GK4 X;  3D10 A;  1YUU A;  4USL A;  5DKQ A;  1IG5 A;  1JUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...