1CTRA

Drug binding by calmodulin: crystal structure of a calmodulin-trifluoperazine complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
147
structure length
141
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALMODULIN
publication title Drug binding by calmodulin: crystal structure of a calmodulin-trifluoperazine complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 141
sequence length 147
ec nomenclature
pdb deposition date 1994-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ctrA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ctrA02
2FJUB 1EL4A 4MSPA 3BUNB 5KTYA 1SRAA 1DJWA 1CM1A 2M8UA 1B1GA 2SCPA 1OE9B 1S1EA 2LP2A 1B47A 3JTDC 1XK4C 1YVHA 3QRXA 4I5LB 1PVAA 2PRUA 3DD4A 3GK2A 2KQYA 1EJ3A 4NDDA 1IQ5A 1LA3A 1KSOA 2K7OA 2LNKA 2K2AA 3A8RA 1JFKA 1RROA 4HRGA 4PCWA 5DKRA 2V53A 1F4QA 1QTXA 1AJ5A 4NQGA 3D10A 2OTGC 2KFGA 1J1DA 1FI5A 1JSAA 4C0LA 1N2DA 4PE4A 3FIAA 1DJXA 4ZCUA 2KI6D 2LUXA 1F70A 1FPWA 3I5HB 4I5KA 1RJVA 4GGNA 2NCPA 1QLKA 2JNFA 2MAZA 5CPVA 4GBAA 5GQQC 1LVCD 1U5IA 4ORAB 3SJSA 4MVFA 4YGEB 4MN0A 5ER5A 3TDIA 3BUXB 5AERA 2JC2A 1NWDA 2KBMA 1BR1B 5KSZA 1TRFA 1QVIZ 2QPTA 3NSIA 1SNLA 1ZMZA 3GK4X 5IBWA 1JFJA 3EK7A 1BT6A 3BOWB 2JTZA 4GGFC 4MZJA 2BL0B 1Y1XA 1YVLA 1VRKA 2LE9B 3EK8A 1TTXA 2M49B 4OKHA 4HREE 1NX1A 2JQ6A 2MA2A 1MHOA 1N0YA 2JNXA 3TS5B 2WC8A 1WRZA 3O4YA 5JOLA 4CIDA 2LMVA 1TCFA 1CFPA 2Q91A 3WHUB 1J7QA 1K94A 1M63B 1V1FA 2KI4C 4PE7A 5I2LA 1RWYA 1YURA 2KAXA 1KWOB 5I2OA 2PSRA 2K8MB 2M1KB 1YRUB 1J7OA 2JXLA 3KF9A 1JF0A 3E3RA 1OQPA 1SKTA 1QIVA 2M1UA 2Y1MA 4M2PA 1FBVA 4P5OE 5HLOA 2PVBA 2BCXA 4PHKA 1BJFA 2G2BA 2M7NA 3WHTB 2OS8B 2JT3A 1AJ4A 2BE4A 1KCYA 1TNPA 1J1EA 1G8IA 3SG4A 5AANA 4CPVA 1IJ5A 2HETA 4UPGA 3TZ1A 1UHJA 2MLFC 1B8CA 2PMYA 2BL0C 2WORA 3VRNA 2I2RE 2EC6B 2IS9A 3SIAA 1KK8B 1SW8A 4A4BA 5AEQA 2GGMA 4YI8A 1FF1A 2FOTA 2KAVA 5ER4X 2B1UA 3EKJA 2A4JA 1CDPA 1CLMA 4GAOA 1WRKA 1RECA 3PLFB 1BR4B 1BF5A 1G4YR 1IG5A 2ZN8A 2ZNEA 1UHKA 1WLMA 1IGVA 2BBNA 4WRIA 2ZKMX 2JOJA 4N1FA 4N1GA 1SCVA 3CLNA 1MQ1A 1L2OB 2M9GA 2MHHA 1DJHA 1KWOC 2M97A 1SR6C 1YR5A 2MRDA 2Y1NA 4ORCB 3VRQA 1LINA 4C0KA 1IWQA 4P2YB 2FCEA 1PALA 1V1GA 3AKBA 2LHIA 3TDUA 2H2KA 1S6IA 1EXRA 1TNWA 3LK0A 1IRJA 4WQ3A 1QV0A 5FYXA 4OCIA 2OS8C 1UP5A 1LA0A 3KO0A 4FQOA 3NSLA 2TN4A 3CZTX 1F4OA 1UHHA 2JTTA 2KYCA 2KFHA 1A75A 3EKHA 2WNDA 4PE0A 4MRYA 2ZNDA 2HQ8A 4GPLB 2LCPA 2EC6C 2L5XB 1BOCA 5JJGA 1IH0A 2KBIA 1DT7B 1KK8C 3RM1A 4GNKB 2JPTA 2L50A 2LVKA 2R2IA 4MLWA 1S3PA 4XYNA 4JWQA 2KSPA 3DF0A 1XK4A 2K7DA 3CR5X 1KFXS 5DKQA 1M39A 3KEVA 2Y4QA 1QIWA 3BUWB 2M7LA 1SMGA 2EHBA 1DJZA 2LVVA 2K0JA 1NUBA 1A29A 1QX5B 2F8PA 5CSNA 1S26D 1ZUZA 2BBMA 1DGUA 3K21A 3AAJA 3ICBA 4ZCVA 3DVJA 3JVTB 2ZRTA 1SL7A 2CCMA 2OPOA 1XFWO 1CDMA 2H61C 2KOTA 4M2OA 2BCAA 1GGWA 3KHEA 4YBHB 1K2HA 3SG2A 3BXKA 2L98A 4PE1A 3SG3A 1PRWA 1WLZA 3I5IB 4DUQA 1R6PA 1CMGA 1YUSA 4XJKA 1KSMA 3H4SE 1B8LA 1GJYA 1S5GZ 1M46A 1J7PA 1QATA 1FW4A 1MWNA 1SY9A 4DRWA 1TNXA 3O6BA 3D0YA 1DF0A 4NDCA 3NSOA 2KYFA 1XFVO 1YUUA 1UHNA 1A03A 1SPYA 1ODBA 1RTP1 5HKYA 1C7WA 1PK0D 4GGFA 1BODA 2VRGA 3HX4A 2CT9A 3LL8B 1WDCB 4PHJA 5CSIA 1NX3A 1CKKA 2ZFDA 3PN7B 1TCOB 1E8AA 2M0RA 2BE6A 1WRLA 3LK1A 2BCBA 3BQ3A 3EVRA 3OX5A 4AQIA 3VRPA 3CGAA 1Q80A 1NCYA 4USLA 3BYAA 3ZNIA 1BLQA 2JWWA 4YGDB 1CFDA 1KFXL 2SASA 3I5HC 1TIZA 1CFCA 3JVTC 4DCKA 4AQJA 1DGVA 1KK7Z 4NDBA 4YRUA 1K90D 2MJWB 2LMUA 1JWDA 1B7TZ 1KQVA 5F6TA 1K8UA 2LHLA 2PALA 1Y1UA 2NZ0A 3GK1A 5D69A 1QVIY 3I5IC 2NLNA 4CFQA 5AXIA 3NXAA 1BG1A 4QJ3B 2WCBA 1S5GY 2K61A 2L2EA 4PDZA 2L4HA 1SL8A 2RGIA 1B4CA 4JQ0D 1YX8A 3M0WA 1H4BA 1CNPA 1B9AA 5BPJA 1YX7A 4PHNA 1YRTB 2L0PA 1NP8A 2L51A 5CSJA 3VRRA 2NXQA 3O78A 4C0JA 1C07A 1EH2A 1W7IB 4MZLA 1JBAA 3BOWA 3TS5C 1M31A 4OR9B 1SK6D 2D8NA 3EVUA 3PSRA 1WDCC 2MBXA 3CWGA 2HPSA 2LLUA 3FWBA 1DMOA 3PN7C 2F2OA 3SG5A 4TNCA 3FWCA 1K9UA 1QS7A 1OZOA 5TNCA 1H8BA 3IF7A 1Y0VH 3ZWHA 3EVVA 1AK8A 1U5IB 2ZN9A 3SG6A 1PSBA 1DJYA 2OTGB 2AUCA 1F55A 1B7TY 1S6CA 1UHIA 2LANA 1K95A 4YI9A 3KPXA 1BU3A 4F0ZB 1IKUA 5HKWA 1NX2A 1D1OA 3A4UB 2WOSA 2Y5IA 1CDNA 1XYDA 2NCOA 3BUMB 5J3XA 1IQ3A 4ORBB 1ZACA 1NCXA 1NYAA 2F3YA 1M45A 3OX6A 4YGAA 2KAYA 3IQOA 2MLEC 1DF0B 2LAPA 1ZOTB 2PASA 3PM8A 1CM4A 3HCMA 1PSRA 2BECA 1J7RA 1L7ZA 1A4PA 1C7VA 5HKZA 4YGCB 1EG3A 1RK9A 1CLLA 2E6WA 2KHNA 1Y6WA 1DTLA 1HT9A 3CTNA 1B8RA 3OP0A 3EK4A 1UWOA 2GV5A 1X02A 1R2UA 2DOQA 1K9KA 1N65A 2LLTA 4MZKA 1AHRA 5KU1A 2L4IA 1K96A 4M2QA 1PVBA 2E30A 4R1EA 1L2OC 1JUOA 2LVJA 1SCMB 1GGZA 4ETOA 3O2PA 2LVIA 1RFJA 3CS1A 3PATA 1F8HA 4ICBA 1YTZC 2ZRSA 3WXAA 4HRHA 2GGZA 1CB1A 1XFYO 3TDZA 4QJ4B 5HLVA 3AAKA 1KQMB 1QX2A 2KFFA 2KI4B 1ALWA 1NIWA 1FI6A 2Q4UA 1DJIA 3CR4X 1XA5A 2M3WA 3OB1B 4FTGA 3DVEA 4DS7A 1CDLA 1SBJA 2H61A 1EG4A 4L9MA 4CFRA 1MF8B 2HF5A 1QJTA 1QX7A 2K7BA 5B8IB 1XVJA 3I5GB 2BKHB 1GQMA 1MXEA 3NSKA 2KGRA 4IL1A 1TOPA 2P6BB 5HYDA 1A2XA 2KI6C 4E68A 1KFUS 3PFVA 1CFFA 1IJ6A 1XFZO 1JC2A 1Y1AA 1ZFSA 1TNQA 1AP4A 3TUYB 1XFUO 4YGBB 2I18A 3I5FB 4D1EA 2JT0A 2CBLA 2KGBC 2QACA 1S6JA 1UURA 2JU0A 1F54A 4HSZA 2EGDA 1F71A 2K7CA 4I5NB 3C1VA 1DVIA 1SCMC 1J55A 1MR8A 2HQWA 1MUXA 1DJGA 4U8DA 1NCZA 2O60A 1QXPA 3PALA 1QV1A 4GUKA 1WY9A 1AVSA 1QASA 2AMIA 5D7FA 4QJ5B 3DVKA 2M29A 2LUCA 4DIRA 1ALVA 1KQMC 3CR2A 1MXLC 2WCFA 3F45A 4MBEA 4N5XA 3LLEA 1SR6B 4GFTA 1AUIB 2G9BA 1K9PA 3OHMB 2JULA 3OB2B 1A75B 5G08A 1CTRA 1OMVA 1QLSA 2FCDA 3MSEB 2CNPA 1SL9A 4OVNF 1XO5A 3DVMA 2CTNA 4WQ2A 3I5GC 2JZIA 4MEWA 2AAOA 1OMDA 1OSAA 2COLB 3BUOB 4A4CA 1BMOA 4PHMA 2LC5A 5I2QA 1JF2A 1G33A 1PULA 2WCEA 3DF0B 2LP3A 2LMTA 3JTDB 2LV7A 3SIBA 3VGOA 1XFXO 2F33A 2F2PA 2I7AA 3FS7A 2ISDA 1OMRA 1CLBA 3TUYC 1K93D 5DKNA 1NSHA 1UUSA 3SG7A 3I5FC 4MRXA 1TN4A 2JRFA 5K89A 4JPZB 3GOFA 2BKIB 2I94A 4BY5A 1KFUL 1LXFC 1LKJA 2O5GA 1CMFA 1SYMA 3LCPC 1OZSA 1KK7Y 5PALA 4I5JA 3RLZA 4AOMA 2KDHA 4OV2A 3VROA 2LM5A 2JXCA 3IQQA 1YUTA 1W7JB 3WNXB 1S36A 4XJKB 5AFPA 2K2FA 4Q04A 1NX0A 2LLSA 4PALA 2CXJA 2F3ZA 2KQ6A 5CSFA 4BY4A 2JT8A 1HQVA 2KNEA 1OOJA 3D0YB 5I8NA 4CLNA 3AKAA 1NPQA
chains in the Genus database with same CATH superfamily
1OOHA 2FJUB 1OW4A 1EL4A 3L4AA 1T14A 4MSPA 3S0EA 2WCJA 3BUNB 5KTYA 1SRAA 1DJWA 1CM1A 2M8UA 1B1GA 2PYQA 2SCPA 1OE9B 1S1EA 2LP2A 2BAPA 1B47A 3JTDC 1XK4C 1YVHA 3QRXA 4I5LB 1PVAA 2PRUA 3DD4A 3GK2A 3PM2A 2KQYA 1EJ3A 2GTEA 4NDDA 1IQ5A 1LA3A 1KSOA 2K7OA 2LNKA 4JD9A 3R1OA 2K2AA 3A8RA 1JFKA 3QMEA 1RROA 4HRGA 4PCWA 5D3OA 5DKRA 2V53A 1F4QA 1QTXA 1DC1A 1AJ5A 3SS3A 4NQGA 3D10A 2OTGC 2KFGA 1J1DA 1FI5A 1JSAA 4PT1A 4C0LA 1N2DA 4PE4A 2ERBA 3FIAA 1DJXA 1TUJA 4ZCUA 2KI6D 2LUXA 1F70A 1FPWA 3I5HB 4I5KA 1RJVA 1Z2CB 2NCPA 4GGNA 1QLKA 2JNFA 2MAZA 5CPVA 4GBAA 5GQQC 1LVCD 1U5IA 4ORAB 3SJSA 4INWA 4MVFA 4YGEB 4MN0A 1OOFA 5ER5A 3TDIA 3BUXB 5AERA 2JC2A 1NWDA 2KBMA 1BR1B 5KSZA 1TRFA 1QVIZ 2QPTA 3IVTA 3NSIA 1SNLA 1ZMZA 3GK4X 5IBWA 1JFJA 3EK7A 1BT6A 3BOWB 2JTZA 4GGFC 4MZJA 2BL0B 1Y1XA 5EL2A 1YVLA 1VRKA 2LE9B 2JPOA 3EK8A 3PJIA 1TTXA 2M49B 4OKHA 4HREE 1NX1A 2JQ6A 2MA2A 1MHOA 1N0YA 2JNXA 3S0FA 3TS5B 2WC8A 1WRZA 3O4YA 5JOLA 2H8VA 4CIDA 2LMVA 1TCFA 1CFPA 2Q91A 3WHUB 1J7QA 3CABA 3FE9A 3OBVA 1K94A 1M63B 1V1FA 2KI4C 3B7AA 4PE7A 1RWYA 5I2LA 1YURA 2KAXA 1KWOB 5DICA 5I2OA 2PSRA 2K8MB 2M1KB 3OGNA 1YRUB 1J7OA 2JXLA 3KF9A 1JF0A 3E3RA 1OQPA 1SKTA 1QIVA 2M1UA 2Y1MA 4M2PA 1FBVA 4P5OE 5HLOA 3SS5A 3D75A 2PVBA 2BCXA 4PHKA 1BJFA 1GM0A 2G2BA 2M7NA 3WHTB 2OS8B 2JT3A 1AJ4A 2BE4A 1KCYA 1TNPA 1J1EA 1G8IA 3SG4A 5AANA 1IIOA 4CPVA 3CZ1A 1IJ5A 2HETA 1C3YA 4UPGA 3TZ1A 1UHJA 2MLFC 1B8CA 2PMYA 2BL0C 2WORA 2L5YA 2I2RE 3VRNA 2EC6B 2IS9A 3SIAA 3D78A 3R1VA 1KK8B 1SW8A 4A4BA 5AEQA 2GGMA 4YI8A 1FF1A 2FOTA 2KAVA 5ER4X 2B1UA 3EKJA 2A4JA 3L47A 1CDPA 1CLMA 4GAOA 1WRKA 1RECA 3PLFB 1BR4B 1BF5A 1G4YR 1IG5A 2ZN8A 2ZNEA 4FQTA 1UHKA 1WLMA 1IGVA 2BBNA 4WRIA 1P28A 2ZKMX 2JOJA 4N1FA 3R1PA 4N1GA 1SCVA 3CLNA 1MQ1A 1L2OB 1LS8A 2M9GA 2MHHA 4JKTA 2QEBA 1DJHA 1KWOC 2M97A 1SR6C 1YR5A 2MRDA 2Y1NA 4ORCB 3VRQA 1LINA 4INXA 4C0KA 1IWQA 4P2YB 2FCEA 1PALA 1V1GA 3AKBA 1C3ZA 2LHIA 3TDUA 2H2KA 3S0AA 1S6IA 1EXRA 1TNWA 3LK0A 1IRJA 4WQ3A 1QV0A 5FYXA 4OCIA 2OS8C 1UP5A 1LA0A 3KO0A 4FQOA 2WCHA 3NSLA 2TN4A 3CZTX 1F4OA 1UHHA 2JTTA 2KYCA 2KFHA 1A75A 3EKHA 2WNDA 4PE0A 4MRYA 2P70A 2ZNDA 2KPHA 2HQ8A 4GPLB 2LCPA 2EC6C 2L5XB 1BOCA 3CYZA 3CZ0A 2KBIA 5FI7A 5JJGA 1DT7B 1KK8C 3RM1A 3DY9A 4GNKB 2JPTA 2L50A 2LVKA 2R2IA 4MLWA 1IH0A 1S3PA 2QDIA 4XYNA 4JWQA 1DEKA 2KSPA 3DF0A 1XK4A 2K7DA 3CR5X 1KFXS 5DKQA 1M39A 3CDNA 3KEVA 2Y4QA 1QIWA 3BUWB 2M7LA 1SMGA 2EHBA 1DJZA 2LVVA 2K0JA 1NUBA 1A29A 1QX5B 2F8PA 5CSNA 1S26D 1ZUZA 2BBMA 1DGUA 3K21A 3AAJA 3ICBA 4ZCVA 3DVJA 3JVTB 1Z4HA 2ZRTA 1SL7A 2CCMA 2OPOA 1XFWO 3DXLA 1CDMA 2H61C 2KOTA 4M2OA 2BCAA 1GGWA 3KHEA 4YBHB 1K2HA 3SG2A 3BXKA 2L98A 4PE1A 3SG3A 1PRWA 1WLZA 2QEVA 3I5IB 4DUQA 1R6PA 1CMGA 1YUSA 4XJKA 1KSMA 2YGUA 3H4SE 3CZ2A 1B8LA 1GJYA 1S5GZ 1M46A 1J7PA 1QATA 1FW4A 1MWNA 1SY9A 4DRWA 2K60A 1TNXA 3O6BA 3D0YA 1DF0A 4NDCA 3NSOA 2KYFA 3SS4A 1XFVO 1YUUA 1UHNA 1A03A 1SPYA 1ODBA 1RTP1 5HKYA 1C7WA 1PK0D 2QEOA 4GGFA 1BODA 2VRGA 3HX4A 2CT9A 3LL8B 1WDCB 4PHJA 5CSIA 1TWOA 1NX3A 3BFBA 1CKKA 2ZFDA 3PN7B 1TCOB 1E8AA 2M0RA 1WRLA 2BE6A 3LK1A 2BCBA 3BQ3A 3EVRA 3OX5A 4AQIA 3VRPA 3CGAA 1Q80A 1NCYA 4USLA 3BYAA 3ZNIA 1BLQA 2JWWA 4YGDB 5FI2A 1CFDA 1KFXL 2SASA 3I5HC 1TIZA 3BJHA 1CFCA 3JVTC 4DCKA 4AQJA 1DGVA 1KK7Z 5I94A 4NDBA 4YRUA 1K90D 2MJWB 2LMUA 3FE8A 1JWDA 2FJYA 1B7TZ 1KQVA 5F6TA 1K8UA 2LHLA 2PALA 1Y1UA 2NZ0A 3GK1A 5D69A 1QVIY 3I5IC 2NLNA 4CFQA 5AXIA 3NXAA 1BG1A 4QJ3B 2WCBA 1S5GY 2K61A 2L2EA 4PDZA 2L4HA 3L4LA 1SL8A 2RGIA 1B4CA 4JQ0D 1YX8A 3M0WA 1H4BA 3D77A 1CNPA 1B9AA 1SSEB 2QEHA 5BPJA 1YX7A 4PHNA 1YRTB 2L0PA 1DQEA 5HL1A 1NP8A 3RZSA 2L51A 3S0DA 5CSJA 3VRRA 2NXQA 3O78A 4C0JA 1C07A 1EH2A 1W7IB 4MZLA 1JBAA 3BOWA 1XFRA 1M31A 4OR9B 1SK6D 2D8NA 3TS5C 3EVUA 3PSRA 1WDCC 2MBXA 3CWGA 2BNXA 2HPSA 2LLUA 3FWBA 1DMOA 3PN7C 1TUZA 3BFHA 3O4XA 2F2OA 3SG5A 1ORGA 4TNCA 3FWCA 1K9UA 1QS7A 1OZOA 5TNCA 1H8BA 1OOIX 3D74A 3IF7A 1Y0VH 3ZWHA 3EVVA 1AK8A 1U5IB 1QWVA 2ZN9A 1PSBA 1DJYA 2OTGB 2AUCA 3SG6A 1B7TY 1S6CA 3NHTA 1F55A 1UHIA 2LANA 1K95A 4YI9A 3KPXA 1BU3A 4F0ZB 3S0GA 3VB1A 1IKUA 5HKWA 1NX2A 1D1OA 3A4UB 2WOSA 2Y5IA 1CDNA 1XYDA 2NCOA 3BUMB 5J3XA 1IQ3A 4OZDA 4ORBB 1ZACA 1NCXA 1NYAA 2F3YA 1M45A 3OX6A 4YGAA 2KAYA 3IQOA 2MLEC 1DF0B 2LAPA 1ZOTB 2PASA 3PM8A 1CM4A 3HCMA 1PSRA 1J7RA 2BECA 1L7ZA 1A4PA 1C7VA 5HKZA 4YGCB 1EG3A 1RK9A 1CLLA 2E6WA 2KHNA 1Y6WA 1DTLA 1HT9A 3CTNA 1B8RA 3OP0A 3EK4A 1UWOA 2GV5A 2KLDA 5FI6A 1X02A 1R2UA 3UO9A 2DOQA 1K9KA 1N65A 2LLTA 4MZKA 1AHRA 2WC5A 5KU1A 2L4IA 1K96A 4M2QA 1PVBA 2E30A 4R1EA 1L2OC 1JUOA 2LVJA 3V2LA 1SCMB 1GGZA 4ETOA 3O2PA 2LVIA 1RFJA 3CS1A 3PATA 1F8HA 4ICBA 1YTZC 2ZRSA 3WXAA 4HRHA 2GGZA 1CB1A 1XFYO 3TDZA 4QJ4B 5HLVA 3AAKA 1KQMB 1QX2A 2KFFA 2KI4B 1ALWA 1NIWA 3K1EA 1FI6A 2Q4UA 1DJIA 3CR4X 1XA5A 2M3WA 3OB1B 4FTGA 3DVEA 4DS7A 1CDLA 1SBJA 2H61A 1EG4A 4L9MA 4CFRA 3N7HA 1MF8B 2HF5A 1QJTA 1QX7A 2K7BA 5B8IB 1XVJA 3I5GB 2BKHB 1GQMA 1MXEA 3NSKA 2KLEA 2KGRA 4IL1A 1TOPA 2P6BB 3EG5B 5HYDA 1A2XA 2KI6C 3NHIA 4E68A 1KFUS 3PFVA 1CFFA 1IJ6A 1XFZO 1JC2A 1Y1AA 1ZFSA 1TNQA 1AP4A 3TUYB 1DELA 1XFUO 4YGBB 2I18A 3I5FB 4D1EA 2JT0A 2CBLA 2P71A 2KGBC 3UNWA 2QACA 2WCMA 1S6JA 1UURA 2JU0A 3FE6A 4HSZA 2EGDA 1F54A 1F71A 2K7CA 4I5NB 3C1VA 1DVIA 1SCMC 1J55A 1MR8A 2HQWA 1MUXA 1DJGA 4U8DA 1NCZA 2O60A 1QXPA 3PALA 1QV1A 4GUKA 1WY9A 1AVSA 1QASA 2AMIA 3DZTA 5D7FA 3DVKA 4QJ5B 2M29A 2LUCA 4DIRA 1ALVA 1KQMC 1W9ZA 3CR2A 1MXLC 2WCFA 3F45A 3Q8IA 4MBEA 3D73A 4N5XA 3LLEA 1SR6B 4GFTA 4KYNA 1AUIB 2G9BA 1K9PA 3OHMB 2JULA 3OB2B 1A75B 3B88A 5G08A 1CTRA 1OMVA 1QLSA 2FCDA 3MSEB 2CNPA 1SL9A 4OVNF 1XO5A 3DVMA 2CTNA 4WQ2A 1OOGA 3I5GC 2JZIA 4MEWA 2AAOA 1OMDA 1OSAA 2COLB 2WCKA 3BUOB 4A4CA 1BMOA 4PHMA 2LC5A 4F7FA 5I2QA 1JF2A 1G33A 1PULA 2WCEA 3DF0B 2LP3A 2LMTA 3JTDB 2LV7A 3SIBA 3VGOA 1XFXO 2F33A 2F2PA 2I7AA 3DYEA 3BFAA 3B86A 3FS7A 2WC6A 2ISDA 1OMRA 2L2CA 1CLBA 3TUYC 1K93D 5DKNA 1NSHA 1UUSA 3SG7A 3I5FC 4MRXA 1TN4A 2JRFA 5K89A 4JPZB 3D76A 3GOFA 2BKIB 2I94A 4BY5A 1KFUL 1LXFC 1LKJA 2O5GA 2WCLA 1CMFA 1SYMA 3LCPC 1OZSA 1KK7Y 3B6XA 3B87A 5PALA 4I5JA 3RLZA 4AOMA 2KDHA 4OV2A 3VROA 2LM5A 2JXCA 3IQQA 1YUTA 1W7JB 3WNXB 1S36A 4IJ7A 4XJKB 5AFPA 2K2FA 4Q04A 1NX0A 3R72A 2LLSA 3NGVA 4PALA 2CXJA 2F3ZA 2KQ6A 5CSFA 3S0BA 2PQLA 4BY4A 2JT8A 1HQVA 2KNEA 1OOJA 3D0YB 5I8NA 4CLNA 3AKAA 1NPQA
chains in the Genus database with same CATH topology
2FJUB 1EL4A 4MSPA 3BUNB 5KTYA 1SRAA 1DJWA 1CM1A 2M8UA 1B1GA 2SCPA 1OE9B 1S1EA 2LP2A 1B47A 3JTDC 1XK4C 1YVHA 3QRXA 4I5LB 1PVAA 2PRUA 3DD4A 3GK2A 2KQYA 1EJ3A 4NDDA 1IQ5A 1LA3A 1KSOA 2K7OA 2LNKA 2K2AA 3A8RA 1JFKA 1RROA 4HRGA 4PCWA 5DKRA 2V53A 1F4QA 1QTXA 1AJ5A 4NQGA 3D10A 2OTGC 2KFGA 1J1DA 1FI5A 1JSAA 4C0LA 1N2DA 4PE4A 3FIAA 1DJXA 4ZCUA 2KI6D 2LUXA 1F70A 1FPWA 3I5HB 4I5KA 1RJVA 4GGNA 2NCPA 1QLKA 2JNFA 2MAZA 5CPVA 4GBAA 5GQQC 1LVCD 1U5IA 4ORAB 3SJSA 4MVFA 4YGEB 4MN0A 5ER5A 3TDIA 3BUXB 5AERA 2JC2A 1NWDA 2KBMA 1BR1B 5KSZA 1TRFA 1QVIZ 2QPTA 3NSIA 1SNLA 1ZMZA 3GK4X 5IBWA 1JFJA 3EK7A 1BT6A 3BOWB 2JTZA 4GGFC 4MZJA 2BL0B 1Y1XA 1YVLA 1VRKA 2LE9B 3EK8A 1TTXA 2M49B 4OKHA 4HREE 1NX1A 2JQ6A 2MA2A 1MHOA 1N0YA 2JNXA 3TS5B 2WC8A 1WRZA 3O4YA 5JOLA 4CIDA 2LMVA 1TCFA 1CFPA 2Q91A 3WHUB 1J7QA 1K94A 1M63B 1V1FA 2KI4C 4PE7A 5I2LA 1RWYA 1YURA 2KAXA 1KWOB 5I2OA 2PSRA 2K8MB 2M1KB 1YRUB 1J7OA 2JXLA 3KF9A 1JF0A 3E3RA 1OQPA 1SKTA 1QIVA 2M1UA 2Y1MA 4M2PA 1FBVA 4P5OE 5HLOA 2PVBA 2BCXA 4PHKA 1BJFA 2G2BA 2M7NA 3WHTB 2OS8B 2JT3A 1AJ4A 2BE4A 1KCYA 1TNPA 1J1EA 1G8IA 3SG4A 5AANA 4CPVA 1IJ5A 2HETA 4UPGA 3TZ1A 1UHJA 2MLFC 1B8CA 2PMYA 2BL0C 2WORA 3VRNA 2I2RE 2EC6B 2IS9A 3SIAA 1KK8B 1SW8A 4A4BA 5AEQA 2GGMA 4YI8A 1FF1A 2FOTA 2KAVA 5ER4X 2B1UA 3EKJA 2A4JA 1CDPA 1CLMA 4GAOA 1WRKA 1RECA 3PLFB 1BR4B 1BF5A 1G4YR 1IG5A 2ZN8A 2ZNEA 1UHKA 1WLMA 1IGVA 2BBNA 4WRIA 2ZKMX 2JOJA 4N1FA 4N1GA 1SCVA 3CLNA 1MQ1A 1L2OB 2M9GA 2MHHA 1DJHA 1KWOC 2M97A 1SR6C 1YR5A 2MRDA 2Y1NA 4ORCB 3VRQA 1LINA 4C0KA 1IWQA 4P2YB 2FCEA 1PALA 1V1GA 3AKBA 2LHIA 3TDUA 2H2KA 1S6IA 1EXRA 1TNWA 3LK0A 1IRJA 4WQ3A 1QV0A 5FYXA 4OCIA 2OS8C 1UP5A 1LA0A 3KO0A 4FQOA 3NSLA 2TN4A 3CZTX 1F4OA 1UHHA 2JTTA 2KYCA 2KFHA 1A75A 3EKHA 2WNDA 4PE0A 4MRYA 2ZNDA 2HQ8A 4GPLB 2LCPA 2EC6C 2L5XB 1BOCA 5JJGA 1IH0A 2KBIA 1DT7B 1KK8C 3RM1A 4GNKB 2JPTA 2L50A 2LVKA 2R2IA 4MLWA 1S3PA 4XYNA 4JWQA 2KSPA 3DF0A 1XK4A 2K7DA 3CR5X 1KFXS 5DKQA 1M39A 3KEVA 2Y4QA 1QIWA 3BUWB 2M7LA 1SMGA 2EHBA 1DJZA 2LVVA 2K0JA 1NUBA 1A29A 1QX5B 2F8PA 5CSNA 1S26D 1ZUZA 2BBMA 1DGUA 3K21A 3AAJA 3ICBA 4ZCVA 3DVJA 3JVTB 2ZRTA 1SL7A 2CCMA 2OPOA 1XFWO 1CDMA 2H61C 2KOTA 4M2OA 2BCAA 1GGWA 3KHEA 4YBHB 1K2HA 3SG2A 3BXKA 2L98A 4PE1A 3SG3A 1PRWA 1WLZA 3I5IB 4DUQA 1R6PA 1CMGA 1YUSA 4XJKA 1KSMA 3H4SE 1B8LA 1GJYA 1S5GZ 1M46A 1J7PA 1QATA 1FW4A 1MWNA 1SY9A 4DRWA 1TNXA 3O6BA 3D0YA 1DF0A 4NDCA 3NSOA 2KYFA 1XFVO 1YUUA 1UHNA 1A03A 1SPYA 1ODBA 1RTP1 5HKYA 1C7WA 1PK0D 4GGFA 1BODA 2VRGA 3HX4A 2CT9A 3LL8B 1WDCB 4PHJA 5CSIA 1NX3A 1CKKA 2ZFDA 3PN7B 1TCOB 1E8AA 2M0RA 2BE6A 1WRLA 3LK1A 2BCBA 3BQ3A 3EVRA 3OX5A 4AQIA 3VRPA 3CGAA 1Q80A 1NCYA 4USLA 3BYAA 3ZNIA 1BLQA 2JWWA 4YGDB 1CFDA 1KFXL 2SASA 3I5HC 1TIZA 1CFCA 3JVTC 4DCKA 4AQJA 1DGVA 1KK7Z 4NDBA 4YRUA 1K90D 2MJWB 2LMUA 1JWDA 1B7TZ 1KQVA 5F6TA 1K8UA 2LHLA 2PALA 1Y1UA 2NZ0A 3GK1A 5D69A 1QVIY 3I5IC 2NLNA 4CFQA 5AXIA 3NXAA 1BG1A 4QJ3B 2WCBA 1S5GY 2K61A 2L2EA 4PDZA 2L4HA 1SL8A 2RGIA 1B4CA 4JQ0D 1YX8A 3M0WA 1H4BA 1CNPA 1B9AA 5BPJA 1YX7A 4PHNA 1YRTB 2L0PA 1NP8A 2L51A 5CSJA 3VRRA 2NXQA 3O78A 4C0JA 1C07A 1EH2A 1W7IB 4MZLA 1JBAA 3BOWA 3TS5C 1M31A 4OR9B 1SK6D 2D8NA 3EVUA 3PSRA 1WDCC 2MBXA 3CWGA 2HPSA 2LLUA 3FWBA 1DMOA 3PN7C 2F2OA 3SG5A 4TNCA 3FWCA 1K9UA 1QS7A 1OZOA 5TNCA 1H8BA 3IF7A 1Y0VH 3ZWHA 3EVVA 1AK8A 1U5IB 2ZN9A 3SG6A 1PSBA 1DJYA 2OTGB 2AUCA 1F55A 1B7TY 1S6CA 1UHIA 2LANA 1K95A 4YI9A 3KPXA 1BU3A 4F0ZB 1IKUA 5HKWA 1NX2A 1D1OA 3A4UB 2WOSA 2Y5IA 1CDNA 1XYDA 2NCOA 3BUMB 5J3XA 1IQ3A 4ORBB 1ZACA 1NCXA 1NYAA 2F3YA 1M45A 3OX6A 4YGAA 2KAYA 3IQOA 2MLEC 1DF0B 2LAPA 1ZOTB 2PASA 3PM8A 1CM4A 3HCMA 1PSRA 2BECA 1J7RA 1L7ZA 1A4PA 1C7VA 5HKZA 4YGCB 1EG3A 1RK9A 1CLLA 2E6WA 2KHNA 1Y6WA 1DTLA 1HT9A 3CTNA 1B8RA 3OP0A 3EK4A 1UWOA 2GV5A 1X02A 1R2UA 2DOQA 1K9KA 1N65A 2LLTA 4MZKA 1AHRA 5KU1A 2L4IA 1K96A 4M2QA 1PVBA 2E30A 4R1EA 1L2OC 1JUOA 2LVJA 1SCMB 1GGZA 4ETOA 3O2PA 2LVIA 1RFJA 3CS1A 3PATA 1F8HA 4ICBA 1YTZC 2ZRSA 3WXAA 4HRHA 2GGZA 1CB1A 1XFYO 3TDZA 4QJ4B 5HLVA 3AAKA 1KQMB 1QX2A 2KFFA 2KI4B 1ALWA 1NIWA 1FI6A 2Q4UA 1DJIA 3CR4X 1XA5A 2M3WA 3OB1B 4FTGA 3DVEA 4DS7A 1CDLA 1SBJA 2H61A 1EG4A 4L9MA 4CFRA 1MF8B 2HF5A 1QJTA 1QX7A 2K7BA 5B8IB 1XVJA 3I5GB 2BKHB 1GQMA 1MXEA 3NSKA 2KGRA 4IL1A 1TOPA 2P6BB 5HYDA 1A2XA 2KI6C 4E68A 1KFUS 3PFVA 1CFFA 1IJ6A 1XFZO 1JC2A 1Y1AA 1ZFSA 1TNQA 1AP4A 3TUYB 1XFUO 4YGBB 2I18A 3I5FB 4D1EA 2JT0A 2CBLA 2KGBC 2QACA 1S6JA 1UURA 2JU0A 1F54A 4HSZA 2EGDA 1F71A 2K7CA 4I5NB 3C1VA 1DVIA 1SCMC 1J55A 1MR8A 2HQWA 1MUXA 1DJGA 4U8DA 1NCZA 2O60A 1QXPA 3PALA 1QV1A 4GUKA 1WY9A 1AVSA 1QASA 2AMIA 5D7FA 4QJ5B 3DVKA 2M29A 2LUCA 4DIRA 1ALVA 1KQMC 3CR2A 1MXLC 2WCFA 3F45A 4MBEA 4N5XA 3LLEA 1SR6B 4GFTA 1AUIB 2G9BA 1K9PA 3OHMB 2JULA 3OB2B 1A75B 5G08A 1CTRA 1OMVA 1QLSA 2FCDA 3MSEB 2CNPA 1SL9A 4OVNF 1XO5A 3DVMA 2CTNA 4WQ2A 3I5GC 2JZIA 4MEWA 2AAOA 1OMDA 1OSAA 2COLB 3BUOB 4A4CA 1BMOA 4PHMA 2LC5A 5I2QA 1JF2A 1G33A 1PULA 2WCEA 3DF0B 2LP3A 2LMTA 3JTDB 2LV7A 3SIBA 3VGOA 1XFXO 2F33A 2F2PA 2I7AA 3FS7A 2ISDA 1OMRA 1CLBA 3TUYC 1K93D 5DKNA 1NSHA 1UUSA 3SG7A 3I5FC 4MRXA 1TN4A 2JRFA 5K89A 4JPZB 3GOFA 2BKIB 2I94A 4BY5A 1KFUL 1LXFC 1LKJA 2O5GA 1CMFA 1SYMA 3LCPC 1OZSA 1KK7Y 5PALA 4I5JA 3RLZA 4AOMA 2KDHA 4OV2A 3VROA 2LM5A 2JXCA 3IQQA 1YUTA 1W7JB 3WNXB 1S36A 4XJKB 5AFPA 2K2FA 4Q04A 1NX0A 2LLSA 4PALA 2CXJA 2F3ZA 2KQ6A 5CSFA 4BY4A 2JT8A 1HQVA 2KNEA 1OOJA 3D0YB 5I8NA 4CLNA 3AKAA 1NPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJU B;  1EL4 A;  4MSP A;  3BUN B;  5KTY A;  1SRA A;  1DJW A;  1CM1 A;  2M8U A;  1B1G A;  2SCP A;  1OE9 B;  1S1E A;  2LP2 A;  1B47 A;  3JTD C;  1XK4 C;  1YVH A;  3QRX A;  4I5L B;  1PVA A;  2PRU A;  3DD4 A;  3GK2 A;  2KQY A;  1EJ3 A;  4NDD A;  1IQ5 A;  1LA3 A;  1KSO A;  2K7O A;  2LNK A;  2K2A A;  3A8R A;  1JFK A;  1RRO A;  4HRG A;  4PCW A;  5DKR A;  2V53 A;  1F4Q A;  1QTX A;  1AJ5 A;  4NQG A;  3D10 A;  2OTG C;  2KFG A;  1J1D A;  1FI5 A;  1JSA A;  4C0L A;  1N2D A;  4PE4 A;  3FIA A;  1DJX A;  4ZCU A;  2KI6 D;  2LUX A;  1F70 A;  1FPW A;  3I5H B;  4I5K A;  1RJV A;  4GGN A;  2NCP A;  1QLK A;  2JNF A;  2MAZ A;  5CPV A;  4GBA A;  5GQQ C;  1LVC D;  1U5I A;  4ORA B;  3SJS A;  4MVF A;  4YGE B;  4MN0 A;  5ER5 A;  3TDI A;  3BUX B;  5AER A;  2JC2 A;  1NWD A;  2KBM A;  1BR1 B;  5KSZ A;  1TRF A;  1QVI Z;  2QPT A;  3NSI A;  1SNL A;  1ZMZ A;  3GK4 X;  5IBW A;  1JFJ A;  3EK7 A;  1BT6 A;  3BOW B;  2JTZ A;  4GGF C;  4MZJ A;  2BL0 B;  1Y1X A;  1YVL A;  1VRK A;  2LE9 B;  3EK8 A;  1TTX A;  2M49 B;  4OKH A;  4HRE E;  1NX1 A;  2JQ6 A;  2MA2 A;  1MHO A;  1N0Y A;  2JNX A;  3TS5 B;  2WC8 A;  1WRZ A;  3O4Y A;  5JOL A;  4CID A;  2LMV A;  1TCF A;  1CFP A;  2Q91 A;  3WHU B;  1J7Q A;  1K94 A;  1M63 B;  1V1F A;  2KI4 C;  4PE7 A;  5I2L A;  1RWY A;  1YUR A;  2KAX A;  1KWO B;  5I2O A;  2PSR A;  2K8M B;  2M1K B;  1YRU B;  1J7O A;  2JXL A;  3KF9 A;  1JF0 A;  3E3R A;  1OQP A;  1SKT A;  1QIV A;  2M1U A;  2Y1M A;  4M2P A;  1FBV A;  4P5O E;  5HLO A;  2PVB A;  2BCX A;  4PHK A;  1BJF A;  2G2B A;  2M7N A;  3WHT B;  2OS8 B;  2JT3 A;  1AJ4 A;  2BE4 A;  1KCY A;  1TNP A;  1J1E A;  1G8I A;  3SG4 A;  5AAN A;  4CPV A;  1IJ5 A;  2HET A;  4UPG A;  3TZ1 A;  1UHJ A;  2MLF C;  1B8C A;  2PMY A;  2BL0 C;  2WOR A;  3VRN A;  2I2R E;  2EC6 B;  2IS9 A;  3SIA A;  1KK8 B;  1SW8 A;  4A4B A;  5AEQ A;  2GGM A;  4YI8 A;  1FF1 A;  2FOT A;  2KAV A;  5ER4 X;  2B1U A;  3EKJ A;  2A4J A;  1CDP A;  1CLM A;  4GAO A;  1WRK A;  1REC A;  3PLF B;  1BR4 B;  1BF5 A;  1G4Y R;  1IG5 A;  2ZN8 A;  2ZNE A;  1UHK A;  1WLM A;  1IGV A;  2BBN A;  4WRI A;  2ZKM X;  2JOJ A;  4N1F A;  4N1G A;  1SCV A;  3CLN A;  1MQ1 A;  1L2O B;  2M9G A;  2MHH A;  1DJH A;  1KWO C;  2M97 A;  1SR6 C;  1YR5 A;  2MRD A;  2Y1N A;  4ORC B;  3VRQ A;  1LIN A;  4C0K A;  1IWQ A;  4P2Y B;  2FCE A;  1PAL A;  1V1G A;  3AKB A;  2LHI A;  3TDU A;  2H2K A;  1S6I A;  1EXR A;  1TNW A;  3LK0 A;  1IRJ A;  4WQ3 A;  1QV0 A;  5FYX A;  4OCI A;  2OS8 C;  1UP5 A;  1LA0 A;  3KO0 A;  4FQO A;  3NSL A;  2TN4 A;  3CZT X;  1F4O A;  1UHH A;  2JTT A;  2KYC A;  2KFH A;  1A75 A;  3EKH A;  2WND A;  4PE0 A;  4MRY A;  2ZND A;  2HQ8 A;  4GPL B;  2LCP A;  2EC6 C;  2L5X B;  1BOC A;  5JJG A;  1IH0 A;  2KBI A;  1DT7 B;  1KK8 C;  3RM1 A;  4GNK B;  2JPT A;  2L50 A;  2LVK A;  2R2I A;  4MLW A;  1S3P A;  4XYN A;  4JWQ A;  2KSP A;  3DF0 A;  1XK4 A;  2K7D A;  3CR5 X;  1KFX S;  5DKQ A;  1M39 A;  3KEV A;  2Y4Q A;  1QIW A;  3BUW B;  2M7L A;  1SMG A;  2EHB A;  1DJZ A;  2LVV A;  2K0J A;  1NUB A;  1A29 A;  1QX5 B;  2F8P A;  5CSN A;  1S26 D;  1ZUZ A;  2BBM A;  1DGU A;  3K21 A;  3AAJ A;  3ICB A;  4ZCV A;  3DVJ A;  3JVT B;  2ZRT A;  1SL7 A;  2CCM A;  2OPO A;  1XFW O;  1CDM A;  2H61 C;  2KOT A;  4M2O A;  2BCA A;  1GGW A;  3KHE A;  4YBH B;  1K2H A;  3SG2 A;  3BXK A;  2L98 A;  4PE1 A;  3SG3 A;  1PRW A;  1WLZ A;  3I5I B;  4DUQ A;  1R6P A;  1CMG A;  1YUS A;  4XJK A;  1KSM A;  3H4S E;  1B8L A;  1GJY A;  1S5G Z;  1M46 A;  1J7P A;  1QAT A;  1FW4 A;  1MWN A;  1SY9 A;  4DRW A;  1TNX A;  3O6B A;  3D0Y A;  1DF0 A;  4NDC A;  3NSO A;  2KYF A;  1XFV O;  1YUU A;  1UHN A;  1A03 A;  1SPY A;  1ODB A;  1RTP 1;  5HKY A;  1C7W A;  1PK0 D;  4GGF A;  1BOD A;  2VRG A;  3HX4 A;  2CT9 A;  3LL8 B;  1WDC B;  4PHJ A;  5CSI A;  1NX3 A;  1CKK A;  2ZFD A;  3PN7 B;  1TCO B;  1E8A A;  2M0R A;  2BE6 A;  1WRL A;  3LK1 A;  2BCB A;  3BQ3 A;  3EVR A;  3OX5 A;  4AQI A;  3VRP A;  3CGA A;  1Q80 A;  1NCY A;  4USL A;  3BYA A;  3ZNI A;  1BLQ A;  2JWW A;  4YGD B;  1CFD A;  1KFX L;  2SAS A;  3I5H C;  1TIZ A;  1CFC A;  3JVT C;  4DCK A;  4AQJ A;  1DGV A;  1KK7 Z;  4NDB A;  4YRU A;  1K90 D;  2MJW B;  2LMU A;  1JWD A;  1B7T Z;  1KQV A;  5F6T A;  1K8U A;  2LHL A;  2PAL A;  1Y1U A;  2NZ0 A;  3GK1 A;  5D69 A;  1QVI Y;  3I5I C;  2NLN A;  4CFQ A;  5AXI A;  3NXA A;  1BG1 A;  4QJ3 B;  2WCB A;  1S5G Y;  2K61 A;  2L2E A;  4PDZ A;  2L4H A;  1SL8 A;  2RGI A;  1B4C A;  4JQ0 D;  1YX8 A;  3M0W A;  1H4B A;  1CNP A;  1B9A A;  5BPJ A;  1YX7 A;  4PHN A;  1YRT B;  2L0P A;  1NP8 A;  2L51 A;  5CSJ A;  3VRR A;  2NXQ A;  3O78 A;  4C0J A;  1C07 A;  1EH2 A;  1W7I B;  4MZL A;  1JBA A;  3BOW A;  3TS5 C;  1M31 A;  4OR9 B;  1SK6 D;  2D8N A;  3EVU A;  3PSR A;  1WDC C;  2MBX A;  3CWG A;  2HPS A;  2LLU A;  3FWB A;  1DMO A;  3PN7 C;  2F2O A;  3SG5 A;  4TNC A;  3FWC A;  1K9U A;  1QS7 A;  1OZO A;  5TNC A;  1H8B A;  3IF7 A;  1Y0V H;  3ZWH A;  3EVV A;  1AK8 A;  1U5I B;  2ZN9 A;  3SG6 A;  1PSB A;  1DJY A;  2OTG B;  2AUC A;  1F55 A;  1B7T Y;  1S6C A;  1UHI A;  2LAN A;  1K95 A;  4YI9 A;  3KPX A;  1BU3 A;  4F0Z B;  1IKU A;  5HKW A;  1NX2 A;  1D1O A;  3A4U B;  2WOS A;  2Y5I A;  1CDN A;  1XYD A;  2NCO A;  3BUM B;  5J3X A;  1IQ3 A;  4ORB B;  1ZAC A;  1NCX A;  1NYA A;  2F3Y A;  1M45 A;  3OX6 A;  4YGA A;  2KAY A;  3IQO A;  2MLE C;  1DF0 B;  2LAP A;  1ZOT B;  2PAS A;  3PM8 A;  1CM4 A;  3HCM A;  1PSR A;  2BEC A;  1J7R A;  1L7Z A;  1A4P A;  1C7V A;  5HKZ A;  4YGC B;  1EG3 A;  1RK9 A;  1CLL A;  2E6W A;  2KHN A;  1Y6W A;  1DTL A;  1HT9 A;  3CTN A;  1B8R A;  3OP0 A;  3EK4 A;  1UWO A;  2GV5 A;  1X02 A;  1R2U A;  2DOQ A;  1K9K A;  1N65 A;  2LLT A;  4MZK A;  1AHR A;  5KU1 A;  2L4I A;  1K96 A;  4M2Q A;  1PVB A;  2E30 A;  4R1E A;  1L2O C;  1JUO A;  2LVJ A;  1SCM B;  1GGZ A;  4ETO A;  3O2P A;  2LVI A;  1RFJ A;  3CS1 A;  3PAT A;  1F8H A;  4ICB A;  1YTZ C;  2ZRS A;  3WXA A;  4HRH A;  2GGZ A;  1CB1 A;  1XFY O;  3TDZ A;  4QJ4 B;  5HLV A;  3AAK A;  1KQM B;  1QX2 A;  2KFF A;  2KI4 B;  1ALW A;  1NIW A;  1FI6 A;  2Q4U A;  1DJI A;  3CR4 X;  1XA5 A;  2M3W A;  3OB1 B;  4FTG A;  3DVE A;  4DS7 A;  1CDL A;  1SBJ A;  2H61 A;  1EG4 A;  4L9M A;  4CFR A;  1MF8 B;  2HF5 A;  1QJT A;  1QX7 A;  2K7B A;  5B8I B;  1XVJ A;  3I5G B;  2BKH B;  1GQM A;  1MXE A;  3NSK A;  2KGR A;  4IL1 A;  1TOP A;  2P6B B;  5HYD A;  1A2X A;  2KI6 C;  4E68 A;  1KFU S;  3PFV A;  1CFF A;  1IJ6 A;  1XFZ O;  1JC2 A;  1Y1A A;  1ZFS A;  1TNQ A;  1AP4 A;  3TUY B;  1XFU O;  4YGB B;  2I18 A;  3I5F B;  4D1E A;  2JT0 A;  2CBL A;  2KGB C;  2QAC A;  1S6J A;  1UUR A;  2JU0 A;  1F54 A;  4HSZ A;  2EGD A;  1F71 A;  2K7C A;  4I5N B;  3C1V A;  1DVI A;  1SCM C;  1J55 A;  1MR8 A;  2HQW A;  1MUX A;  1DJG A;  4U8D A;  1NCZ A;  2O60 A;  1QXP A;  3PAL A;  1QV1 A;  4GUK A;  1WY9 A;  1AVS A;  1QAS A;  2AMI A;  5D7F A;  4QJ5 B;  3DVK A;  2M29 A;  2LUC A;  4DIR A;  1ALV A;  1KQM C;  3CR2 A;  1MXL C;  2WCF A;  3F45 A;  4MBE A;  4N5X A;  3LLE A;  1SR6 B;  4GFT A;  1AUI B;  2G9B A;  1K9P A;  3OHM B;  2JUL A;  3OB2 B;  1A75 B;  5G08 A;  1CTR A;  1OMV A;  1QLS A;  2FCD A;  3MSE B;  2CNP A;  1SL9 A;  4OVN F;  1XO5 A;  3DVM A;  2CTN A;  4WQ2 A;  3I5G C;  2JZI A;  4MEW A;  2AAO A;  1OMD A;  1OSA A;  2COL B;  3BUO B;  4A4C A;  1BMO A;  4PHM A;  2LC5 A;  5I2Q A;  1JF2 A;  1G33 A;  1PUL A;  2WCE A;  3DF0 B;  2LP3 A;  2LMT A;  3JTD B;  2LV7 A;  3SIB A;  3VGO A;  1XFX O;  2F33 A;  2F2P A;  2I7A A;  3FS7 A;  2ISD A;  1OMR A;  1CLB A;  3TUY C;  1K93 D;  5DKN A;  1NSH A;  1UUS A;  3SG7 A;  3I5F C;  4MRX A;  1TN4 A;  2JRF A;  5K89 A;  4JPZ B;  3GOF A;  2BKI B;  2I94 A;  4BY5 A;  1KFU L;  1LXF C;  1LKJ A;  2O5G A;  1CMF A;  1SYM A;  3LCP C;  1OZS A;  1KK7 Y;  5PAL A;  4I5J A;  3RLZ A;  4AOM A;  2KDH A;  4OV2 A;  3VRO A;  2LM5 A;  2JXC A;  3IQQ A;  1YUT A;  1W7J B;  3WNX B;  1S36 A;  4XJK B;  5AFP A;  2K2F A;  4Q04 A;  1NX0 A;  2LLS A;  4PAL A;  2CXJ A;  2F3Z A;  2KQ6 A;  5CSF A;  4BY4 A;  2JT8 A;  1HQV A;  2KNE A;  1OOJ A;  3D0Y B;  5I8N A;  4CLN A;  3AKA A;  1NPQ A; 
#chains in the Genus database with same CATH topology
 1OOH A;  2FJU B;  1OW4 A;  1EL4 A;  3L4A A;  1T14 A;  4MSP A;  3S0E A;  2WCJ A;  3BUN B;  5KTY A;  1SRA A;  1DJW A;  1CM1 A;  2M8U A;  1B1G A;  2PYQ A;  2SCP A;  1OE9 B;  1S1E A;  2LP2 A;  2BAP A;  1B47 A;  3JTD C;  1XK4 C;  1YVH A;  3QRX A;  4I5L B;  1PVA A;  2PRU A;  3DD4 A;  3GK2 A;  3PM2 A;  2KQY A;  1EJ3 A;  2GTE A;  4NDD A;  1IQ5 A;  1LA3 A;  1KSO A;  2K7O A;  2LNK A;  4JD9 A;  3R1O A;  2K2A A;  3A8R A;  1JFK A;  3QME A;  1RRO A;  4HRG A;  4PCW A;  5D3O A;  5DKR A;  2V53 A;  1F4Q A;  1QTX A;  1DC1 A;  1AJ5 A;  3SS3 A;  4NQG A;  3D10 A;  2OTG C;  2KFG A;  1J1D A;  1FI5 A;  1JSA A;  4PT1 A;  4C0L A;  1N2D A;  4PE4 A;  2ERB A;  3FIA A;  1DJX A;  1TUJ A;  4ZCU A;  2KI6 D;  2LUX A;  1F70 A;  1FPW A;  3I5H B;  4I5K A;  1RJV A;  1Z2C B;  2NCP A;  4GGN A;  1QLK A;  2JNF A;  2MAZ A;  5CPV A;  4GBA A;  5GQQ C;  1LVC D;  1U5I A;  4ORA B;  3SJS A;  4INW A;  4MVF A;  4YGE B;  4MN0 A;  1OOF A;  5ER5 A;  3TDI A;  3BUX B;  5AER A;  2JC2 A;  1NWD A;  2KBM A;  1BR1 B;  5KSZ A;  1TRF A;  1QVI Z;  2QPT A;  3IVT A;  3NSI A;  1SNL A;  1ZMZ A;  3GK4 X;  5IBW A;  1JFJ A;  3EK7 A;  1BT6 A;  3BOW B;  2JTZ A;  4GGF C;  4MZJ A;  2BL0 B;  1Y1X A;  5EL2 A;  1YVL A;  1VRK A;  2LE9 B;  2JPO A;  3EK8 A;  3PJI A;  1TTX A;  2M49 B;  4OKH A;  4HRE E;  1NX1 A;  2JQ6 A;  2MA2 A;  1MHO A;  1N0Y A;  2JNX A;  3S0F A;  3TS5 B;  2WC8 A;  1WRZ A;  3O4Y A;  5JOL A;  2H8V A;  4CID A;  2LMV A;  1TCF A;  1CFP A;  2Q91 A;  3WHU B;  1J7Q A;  3CAB A;  3FE9 A;  3OBV A;  1K94 A;  1M63 B;  1V1F A;  2KI4 C;  3B7A A;  4PE7 A;  1RWY A;  5I2L A;  1YUR A;  2KAX A;  1KWO B;  5DIC A;  5I2O A;  2PSR A;  2K8M B;  2M1K B;  3OGN A;  1YRU B;  1J7O A;  2JXL A;  3KF9 A;  1JF0 A;  3E3R A;  1OQP A;  1SKT A;  1QIV A;  2M1U A;  2Y1M A;  4M2P A;  1FBV A;  4P5O E;  5HLO A;  3SS5 A;  3D75 A;  2PVB A;  2BCX A;  4PHK A;  1BJF A;  1GM0 A;  2G2B A;  2M7N A;  3WHT B;  2OS8 B;  2JT3 A;  1AJ4 A;  2BE4 A;  1KCY A;  1TNP A;  1J1E A;  1G8I A;  3SG4 A;  5AAN A;  1IIO A;  4CPV A;  3CZ1 A;  1IJ5 A;  2HET A;  1C3Y A;  4UPG A;  3TZ1 A;  1UHJ A;  2MLF C;  1B8C A;  2PMY A;  2BL0 C;  2WOR A;  2L5Y A;  2I2R E;  3VRN A;  2EC6 B;  2IS9 A;  3SIA A;  3D78 A;  3R1V A;  1KK8 B;  1SW8 A;  4A4B A;  5AEQ A;  2GGM A;  4YI8 A;  1FF1 A;  2FOT A;  2KAV A;  5ER4 X;  2B1U A;  3EKJ A;  2A4J A;  3L47 A;  1CDP A;  1CLM A;  4GAO A;  1WRK A;  1REC A;  3PLF B;  1BR4 B;  1BF5 A;  1G4Y R;  1IG5 A;  2ZN8 A;  2ZNE A;  4FQT A;  1UHK A;  1WLM A;  1IGV A;  2BBN A;  4WRI A;  1P28 A;  2ZKM X;  2JOJ A;  4N1F A;  3R1P A;  4N1G A;  1SCV A;  3CLN A;  1MQ1 A;  1L2O B;  1LS8 A;  2M9G A;  2MHH A;  4JKT A;  2QEB A;  1DJH A;  1KWO C;  2M97 A;  1SR6 C;  1YR5 A;  2MRD A;  2Y1N A;  4ORC B;  3VRQ A;  1LIN A;  4INX A;  4C0K A;  1IWQ A;  4P2Y B;  2FCE A;  1PAL A;  1V1G A;  3AKB A;  1C3Z A;  2LHI A;  3TDU A;  2H2K A;  3S0A A;  1S6I A;  1EXR A;  1TNW A;  3LK0 A;  1IRJ A;  4WQ3 A;  1QV0 A;  5FYX A;  4OCI A;  2OS8 C;  1UP5 A;  1LA0 A;  3KO0 A;  4FQO A;  2WCH A;  3NSL A;  2TN4 A;  3CZT X;  1F4O A;  1UHH A;  2JTT A;  2KYC A;  2KFH A;  1A75 A;  3EKH A;  2WND A;  4PE0 A;  4MRY A;  2P70 A;  2ZND A;  2KPH A;  2HQ8 A;  4GPL B;  2LCP A;  2EC6 C;  2L5X B;  1BOC A;  3CYZ A;  3CZ0 A;  2KBI A;  5FI7 A;  5JJG A;  1DT7 B;  1KK8 C;  3RM1 A;  3DY9 A;  4GNK B;  2JPT A;  2L50 A;  2LVK A;  2R2I A;  4MLW A;  1IH0 A;  1S3P A;  2QDI A;  4XYN A;  4JWQ A;  1DEK A;  2KSP A;  3DF0 A;  1XK4 A;  2K7D A;  3CR5 X;  1KFX S;  5DKQ A;  1M39 A;  3CDN A;  3KEV A;  2Y4Q A;  1QIW A;  3BUW B;  2M7L A;  1SMG A;  2EHB A;  1DJZ A;  2LVV A;  2K0J A;  1NUB A;  1A29 A;  1QX5 B;  2F8P A;  5CSN A;  1S26 D;  1ZUZ A;  2BBM A;  1DGU A;  3K21 A;  3AAJ A;  3ICB A;  4ZCV A;  3DVJ A;  3JVT B;  1Z4H A;  2ZRT A;  1SL7 A;  2CCM A;  2OPO A;  1XFW O;  3DXL A;  1CDM A;  2H61 C;  2KOT A;  4M2O A;  2BCA A;  1GGW A;  3KHE A;  4YBH B;  1K2H A;  3SG2 A;  3BXK A;  2L98 A;  4PE1 A;  3SG3 A;  1PRW A;  1WLZ A;  2QEV A;  3I5I B;  4DUQ A;  1R6P A;  1CMG A;  1YUS A;  4XJK A;  1KSM A;  2YGU A;  3H4S E;  3CZ2 A;  1B8L A;  1GJY A;  1S5G Z;  1M46 A;  1J7P A;  1QAT A;  1FW4 A;  1MWN A;  1SY9 A;  4DRW A;  2K60 A;  1TNX A;  3O6B A;  3D0Y A;  1DF0 A;  4NDC A;  3NSO A;  2KYF A;  3SS4 A;  1XFV O;  1YUU A;  1UHN A;  1A03 A;  1SPY A;  1ODB A;  1RTP 1;  5HKY A;  1C7W A;  1PK0 D;  2QEO A;  4GGF A;  1BOD A;  2VRG A;  3HX4 A;  2CT9 A;  3LL8 B;  1WDC B;  4PHJ A;  5CSI A;  1TWO A;  1NX3 A;  3BFB A;  1CKK A;  2ZFD A;  3PN7 B;  1TCO B;  1E8A A;  2M0R A;  1WRL A;  2BE6 A;  3LK1 A;  2BCB A;  3BQ3 A;  3EVR A;  3OX5 A;  4AQI A;  3VRP A;  3CGA A;  1Q80 A;  1NCY A;  4USL A;  3BYA A;  3ZNI A;  1BLQ A;  2JWW A;  4YGD B;  5FI2 A;  1CFD A;  1KFX L;  2SAS A;  3I5H C;  1TIZ A;  3BJH A;  1CFC A;  3JVT C;  4DCK A;  4AQJ A;  1DGV A;  1KK7 Z;  5I94 A;  4NDB A;  4YRU A;  1K90 D;  2MJW B;  2LMU A;  3FE8 A;  1JWD A;  2FJY A;  1B7T Z;  1KQV A;  5F6T A;  1K8U A;  2LHL A;  2PAL A;  1Y1U A;  2NZ0 A;  3GK1 A;  5D69 A;  1QVI Y;  3I5I C;  2NLN A;  4CFQ A;  5AXI A;  3NXA A;  1BG1 A;  4QJ3 B;  2WCB A;  1S5G Y;  2K61 A;  2L2E A;  4PDZ A;  2L4H A;  3L4L A;  1SL8 A;  2RGI A;  1B4C A;  4JQ0 D;  1YX8 A;  3M0W A;  1H4B A;  3D77 A;  1CNP A;  1B9A A;  1SSE B;  2QEH A;  5BPJ A;  1YX7 A;  4PHN A;  1YRT B;  2L0P A;  1DQE A;  5HL1 A;  1NP8 A;  3RZS A;  2L51 A;  3S0D A;  5CSJ A;  3VRR A;  2NXQ A;  3O78 A;  4C0J A;  1C07 A;  1EH2 A;  1W7I B;  4MZL A;  1JBA A;  3BOW A;  1XFR A;  1M31 A;  4OR9 B;  1SK6 D;  2D8N A;  3TS5 C;  3EVU A;  3PSR A;  1WDC C;  2MBX A;  3CWG A;  2BNX A;  2HPS A;  2LLU A;  3FWB A;  1DMO A;  3PN7 C;  1TUZ A;  3BFH A;  3O4X A;  2F2O A;  3SG5 A;  1ORG A;  4TNC A;  3FWC A;  1K9U A;  1QS7 A;  1OZO A;  5TNC A;  1H8B A;  1OOI X;  3D74 A;  3IF7 A;  1Y0V H;  3ZWH A;  3EVV A;  1AK8 A;  1U5I B;  1QWV A;  2ZN9 A;  1PSB A;  1DJY A;  2OTG B;  2AUC A;  3SG6 A;  1B7T Y;  1S6C A;  3NHT A;  1F55 A;  1UHI A;  2LAN A;  1K95 A;  4YI9 A;  3KPX A;  1BU3 A;  4F0Z B;  3S0G A;  3VB1 A;  1IKU A;  5HKW A;  1NX2 A;  1D1O A;  3A4U B;  2WOS A;  2Y5I A;  1CDN A;  1XYD A;  2NCO A;  3BUM B;  5J3X A;  1IQ3 A;  4OZD A;  4ORB B;  1ZAC A;  1NCX A;  1NYA A;  2F3Y A;  1M45 A;  3OX6 A;  4YGA A;  2KAY A;  3IQO A;  2MLE C;  1DF0 B;  2LAP A;  1ZOT B;  2PAS A;  3PM8 A;  1CM4 A;  3HCM A;  1PSR A;  1J7R A;  2BEC A;  1L7Z A;  1A4P A;  1C7V A;  5HKZ A;  4YGC B;  1EG3 A;  1RK9 A;  1CLL A;  2E6W A;  2KHN A;  1Y6W A;  1DTL A;  1HT9 A;  3CTN A;  1B8R A;  3OP0 A;  3EK4 A;  1UWO A;  2GV5 A;  2KLD A;  5FI6 A;  1X02 A;  1R2U A;  3UO9 A;  2DOQ A;  1K9K A;  1N65 A;  2LLT A;  4MZK A;  1AHR A;  2WC5 A;  5KU1 A;  2L4I A;  1K96 A;  4M2Q A;  1PVB A;  2E30 A;  4R1E A;  1L2O C;  1JUO A;  2LVJ A;  3V2L A;  1SCM B;  1GGZ A;  4ETO A;  3O2P A;  2LVI A;  1RFJ A;  3CS1 A;  3PAT A;  1F8H A;  4ICB A;  1YTZ C;  2ZRS A;  3WXA A;  4HRH A;  2GGZ A;  1CB1 A;  1XFY O;  3TDZ A;  4QJ4 B;  5HLV A;  3AAK A;  1KQM B;  1QX2 A;  2KFF A;  2KI4 B;  1ALW A;  1NIW A;  3K1E A;  1FI6 A;  2Q4U A;  1DJI A;  3CR4 X;  1XA5 A;  2M3W A;  3OB1 B;  4FTG A;  3DVE A;  4DS7 A;  1CDL A;  1SBJ A;  2H61 A;  1EG4 A;  4L9M A;  4CFR A;  3N7H A;  1MF8 B;  2HF5 A;  1QJT A;  1QX7 A;  2K7B A;  5B8I B;  1XVJ A;  3I5G B;  2BKH B;  1GQM A;  1MXE A;  3NSK A;  2KLE A;  2KGR A;  4IL1 A;  1TOP A;  2P6B B;  3EG5 B;  5HYD A;  1A2X A;  2KI6 C;  3NHI A;  4E68 A;  1KFU S;  3PFV A;  1CFF A;  1IJ6 A;  1XFZ O;  1JC2 A;  1Y1A A;  1ZFS A;  1TNQ A;  1AP4 A;  3TUY B;  1DEL A;  1XFU O;  4YGB B;  2I18 A;  3I5F B;  4D1E A;  2JT0 A;  2CBL A;  2P71 A;  2KGB C;  3UNW A;  2QAC A;  2WCM A;  1S6J A;  1UUR A;  2JU0 A;  3FE6 A;  4HSZ A;  2EGD A;  1F54 A;  1F71 A;  2K7C A;  4I5N B;  3C1V A;  1DVI A;  1SCM C;  1J55 A;  1MR8 A;  2HQW A;  1MUX A;  1DJG A;  4U8D A;  1NCZ A;  2O60 A;  1QXP A;  3PAL A;  1QV1 A;  4GUK A;  1WY9 A;  1AVS A;  1QAS A;  2AMI A;  3DZT A;  5D7F A;  3DVK A;  4QJ5 B;  2M29 A;  2LUC A;  4DIR A;  1ALV A;  1KQM C;  1W9Z A;  3CR2 A;  1MXL C;  2WCF A;  3F45 A;  3Q8I A;  4MBE A;  3D73 A;  4N5X A;  3LLE A;  1SR6 B;  4GFT A;  4KYN A;  1AUI B;  2G9B A;  1K9P A;  3OHM B;  2JUL A;  3OB2 B;  1A75 B;  3B88 A;  5G08 A;  1CTR A;  1OMV A;  1QLS A;  2FCD A;  3MSE B;  2CNP A;  1SL9 A;  4OVN F;  1XO5 A;  3DVM A;  2CTN A;  4WQ2 A;  1OOG A;  3I5G C;  2JZI A;  4MEW A;  2AAO A;  1OMD A;  1OSA A;  2COL B;  2WCK A;  3BUO B;  4A4C A;  1BMO A;  4PHM A;  2LC5 A;  4F7F A;  5I2Q A;  1JF2 A;  1G33 A;  1PUL A;  2WCE A;  3DF0 B;  2LP3 A;  2LMT A;  3JTD B;  2LV7 A;  3SIB A;  3VGO A;  1XFX O;  2F33 A;  2F2P A;  2I7A A;  3DYE A;  3BFA A;  3B86 A;  3FS7 A;  2WC6 A;  2ISD A;  1OMR A;  2L2C A;  1CLB A;  3TUY C;  1K93 D;  5DKN A;  1NSH A;  1UUS A;  3SG7 A;  3I5F C;  4MRX A;  1TN4 A;  2JRF A;  5K89 A;  4JPZ B;  3D76 A;  3GOF A;  2BKI B;  2I94 A;  4BY5 A;  1KFU L;  1LXF C;  1LKJ A;  2O5G A;  2WCL A;  1CMF A;  1SYM A;  3LCP C;  1OZS A;  1KK7 Y;  3B6X A;  3B87 A;  5PAL A;  4I5J A;  3RLZ A;  4AOM A;  2KDH A;  4OV2 A;  3VRO A;  2LM5 A;  2JXC A;  3IQQ A;  1YUT A;  1W7J B;  3WNX B;  1S36 A;  4IJ7 A;  4XJK B;  5AFP A;  2K2F A;  4Q04 A;  1NX0 A;  3R72 A;  2LLS A;  3NGV A;  4PAL A;  2CXJ A;  2F3Z A;  2KQ6 A;  5CSF A;  3S0B A;  2PQL A;  4BY4 A;  2JT8 A;  1HQV A;  2KNE A;  1OOJ A;  3D0Y B;  5I8N A;  4CLN A;  3AKA A;  1NPQ A; 
#chains in the Genus database with same CATH homology
 2FJU B;  1EL4 A;  4MSP A;  3BUN B;  5KTY A;  1SRA A;  1DJW A;  1CM1 A;  2M8U A;  1B1G A;  2SCP A;  1OE9 B;  1S1E A;  2LP2 A;  1B47 A;  3JTD C;  1XK4 C;  1YVH A;  3QRX A;  4I5L B;  1PVA A;  2PRU A;  3DD4 A;  3GK2 A;  2KQY A;  1EJ3 A;  4NDD A;  1IQ5 A;  1LA3 A;  1KSO A;  2K7O A;  2LNK A;  2K2A A;  3A8R A;  1JFK A;  1RRO A;  4HRG A;  4PCW A;  5DKR A;  2V53 A;  1F4Q A;  1QTX A;  1AJ5 A;  4NQG A;  3D10 A;  2OTG C;  2KFG A;  1J1D A;  1FI5 A;  1JSA A;  4C0L A;  1N2D A;  4PE4 A;  3FIA A;  1DJX A;  4ZCU A;  2KI6 D;  2LUX A;  1F70 A;  1FPW A;  3I5H B;  4I5K A;  1RJV A;  4GGN A;  2NCP A;  1QLK A;  2JNF A;  2MAZ A;  5CPV A;  4GBA A;  5GQQ C;  1LVC D;  1U5I A;  4ORA B;  3SJS A;  4MVF A;  4YGE B;  4MN0 A;  5ER5 A;  3TDI A;  3BUX B;  5AER A;  2JC2 A;  1NWD A;  2KBM A;  1BR1 B;  5KSZ A;  1TRF A;  1QVI Z;  2QPT A;  3NSI A;  1SNL A;  1ZMZ A;  3GK4 X;  5IBW A;  1JFJ A;  3EK7 A;  1BT6 A;  3BOW B;  2JTZ A;  4GGF C;  4MZJ A;  2BL0 B;  1Y1X A;  1YVL A;  1VRK A;  2LE9 B;  3EK8 A;  1TTX A;  2M49 B;  4OKH A;  4HRE E;  1NX1 A;  2JQ6 A;  2MA2 A;  1MHO A;  1N0Y A;  2JNX A;  3TS5 B;  2WC8 A;  1WRZ A;  3O4Y A;  5JOL A;  4CID A;  2LMV A;  1TCF A;  1CFP A;  2Q91 A;  3WHU B;  1J7Q A;  1K94 A;  1M63 B;  1V1F A;  2KI4 C;  4PE7 A;  5I2L A;  1RWY A;  1YUR A;  2KAX A;  1KWO B;  5I2O A;  2PSR A;  2K8M B;  2M1K B;  1YRU B;  1J7O A;  2JXL A;  3KF9 A;  1JF0 A;  3E3R A;  1OQP A;  1SKT A;  1QIV A;  2M1U A;  2Y1M A;  4M2P A;  1FBV A;  4P5O E;  5HLO A;  2PVB A;  2BCX A;  4PHK A;  1BJF A;  2G2B A;  2M7N A;  3WHT B;  2OS8 B;  2JT3 A;  1AJ4 A;  2BE4 A;  1KCY A;  1TNP A;  1J1E A;  1G8I A;  3SG4 A;  5AAN A;  4CPV A;  1IJ5 A;  2HET A;  4UPG A;  3TZ1 A;  1UHJ A;  2MLF C;  1B8C A;  2PMY A;  2BL0 C;  2WOR A;  3VRN A;  2I2R E;  2EC6 B;  2IS9 A;  3SIA A;  1KK8 B;  1SW8 A;  4A4B A;  5AEQ A;  2GGM A;  4YI8 A;  1FF1 A;  2FOT A;  2KAV A;  5ER4 X;  2B1U A;  3EKJ A;  2A4J A;  1CDP A;  1CLM A;  4GAO A;  1WRK A;  1REC A;  3PLF B;  1BR4 B;  1BF5 A;  1G4Y R;  1IG5 A;  2ZN8 A;  2ZNE A;  1UHK A;  1WLM A;  1IGV A;  2BBN A;  4WRI A;  2ZKM X;  2JOJ A;  4N1F A;  4N1G A;  1SCV A;  3CLN A;  1MQ1 A;  1L2O B;  2M9G A;  2MHH A;  1DJH A;  1KWO C;  2M97 A;  1SR6 C;  1YR5 A;  2MRD A;  2Y1N A;  4ORC B;  3VRQ A;  1LIN A;  4C0K A;  1IWQ A;  4P2Y B;  2FCE A;  1PAL A;  1V1G A;  3AKB A;  2LHI A;  3TDU A;  2H2K A;  1S6I A;  1EXR A;  1TNW A;  3LK0 A;  1IRJ A;  4WQ3 A;  1QV0 A;  5FYX A;  4OCI A;  2OS8 C;  1UP5 A;  1LA0 A;  3KO0 A;  4FQO A;  3NSL A;  2TN4 A;  3CZT X;  1F4O A;  1UHH A;  2JTT A;  2KYC A;  2KFH A;  1A75 A;  3EKH A;  2WND A;  4PE0 A;  4MRY A;  2ZND A;  2HQ8 A;  4GPL B;  2LCP A;  2EC6 C;  2L5X B;  1BOC A;  5JJG A;  1IH0 A;  2KBI A;  1DT7 B;  1KK8 C;  3RM1 A;  4GNK B;  2JPT A;  2L50 A;  2LVK A;  2R2I A;  4MLW A;  1S3P A;  4XYN A;  4JWQ A;  2KSP A;  3DF0 A;  1XK4 A;  2K7D A;  3CR5 X;  1KFX S;  5DKQ A;  1M39 A;  3KEV A;  2Y4Q A;  1QIW A;  3BUW B;  2M7L A;  1SMG A;  2EHB A;  1DJZ A;  2LVV A;  2K0J A;  1NUB A;  1A29 A;  1QX5 B;  2F8P A;  5CSN A;  1S26 D;  1ZUZ A;  2BBM A;  1DGU A;  3K21 A;  3AAJ A;  3ICB A;  4ZCV A;  3DVJ A;  3JVT B;  2ZRT A;  1SL7 A;  2CCM A;  2OPO A;  1XFW O;  1CDM A;  2H61 C;  2KOT A;  4M2O A;  2BCA A;  1GGW A;  3KHE A;  4YBH B;  1K2H A;  3SG2 A;  3BXK A;  2L98 A;  4PE1 A;  3SG3 A;  1PRW A;  1WLZ A;  3I5I B;  4DUQ A;  1R6P A;  1CMG A;  1YUS A;  4XJK A;  1KSM A;  3H4S E;  1B8L A;  1GJY A;  1S5G Z;  1M46 A;  1J7P A;  1QAT A;  1FW4 A;  1MWN A;  1SY9 A;  4DRW A;  1TNX A;  3O6B A;  3D0Y A;  1DF0 A;  4NDC A;  3NSO A;  2KYF A;  1XFV O;  1YUU A;  1UHN A;  1A03 A;  1SPY A;  1ODB A;  1RTP 1;  5HKY A;  1C7W A;  1PK0 D;  4GGF A;  1BOD A;  2VRG A;  3HX4 A;  2CT9 A;  3LL8 B;  1WDC B;  4PHJ A;  5CSI A;  1NX3 A;  1CKK A;  2ZFD A;  3PN7 B;  1TCO B;  1E8A A;  2M0R A;  2BE6 A;  1WRL A;  3LK1 A;  2BCB A;  3BQ3 A;  3EVR A;  3OX5 A;  4AQI A;  3VRP A;  3CGA A;  1Q80 A;  1NCY A;  4USL A;  3BYA A;  3ZNI A;  1BLQ A;  2JWW A;  4YGD B;  1CFD A;  1KFX L;  2SAS A;  3I5H C;  1TIZ A;  1CFC A;  3JVT C;  4DCK A;  4AQJ A;  1DGV A;  1KK7 Z;  4NDB A;  4YRU A;  1K90 D;  2MJW B;  2LMU A;  1JWD A;  1B7T Z;  1KQV A;  5F6T A;  1K8U A;  2LHL A;  2PAL A;  1Y1U A;  2NZ0 A;  3GK1 A;  5D69 A;  1QVI Y;  3I5I C;  2NLN A;  4CFQ A;  5AXI A;  3NXA A;  1BG1 A;  4QJ3 B;  2WCB A;  1S5G Y;  2K61 A;  2L2E A;  4PDZ A;  2L4H A;  1SL8 A;  2RGI A;  1B4C A;  4JQ0 D;  1YX8 A;  3M0W A;  1H4B A;  1CNP A;  1B9A A;  5BPJ A;  1YX7 A;  4PHN A;  1YRT B;  2L0P A;  1NP8 A;  2L51 A;  5CSJ A;  3VRR A;  2NXQ A;  3O78 A;  4C0J A;  1C07 A;  1EH2 A;  1W7I B;  4MZL A;  1JBA A;  3BOW A;  3TS5 C;  1M31 A;  4OR9 B;  1SK6 D;  2D8N A;  3EVU A;  3PSR A;  1WDC C;  2MBX A;  3CWG A;  2HPS A;  2LLU A;  3FWB A;  1DMO A;  3PN7 C;  2F2O A;  3SG5 A;  4TNC A;  3FWC A;  1K9U A;  1QS7 A;  1OZO A;  5TNC A;  1H8B A;  3IF7 A;  1Y0V H;  3ZWH A;  3EVV A;  1AK8 A;  1U5I B;  2ZN9 A;  3SG6 A;  1PSB A;  1DJY A;  2OTG B;  2AUC A;  1F55 A;  1B7T Y;  1S6C A;  1UHI A;  2LAN A;  1K95 A;  4YI9 A;  3KPX A;  1BU3 A;  4F0Z B;  1IKU A;  5HKW A;  1NX2 A;  1D1O A;  3A4U B;  2WOS A;  2Y5I A;  1CDN A;  1XYD A;  2NCO A;  3BUM B;  5J3X A;  1IQ3 A;  4ORB B;  1ZAC A;  1NCX A;  1NYA A;  2F3Y A;  1M45 A;  3OX6 A;  4YGA A;  2KAY A;  3IQO A;  2MLE C;  1DF0 B;  2LAP A;  1ZOT B;  2PAS A;  3PM8 A;  1CM4 A;  3HCM A;  1PSR A;  2BEC A;  1J7R A;  1L7Z A;  1A4P A;  1C7V A;  5HKZ A;  4YGC B;  1EG3 A;  1RK9 A;  1CLL A;  2E6W A;  2KHN A;  1Y6W A;  1DTL A;  1HT9 A;  3CTN A;  1B8R A;  3OP0 A;  3EK4 A;  1UWO A;  2GV5 A;  1X02 A;  1R2U A;  2DOQ A;  1K9K A;  1N65 A;  2LLT A;  4MZK A;  1AHR A;  5KU1 A;  2L4I A;  1K96 A;  4M2Q A;  1PVB A;  2E30 A;  4R1E A;  1L2O C;  1JUO A;  2LVJ A;  1SCM B;  1GGZ A;  4ETO A;  3O2P A;  2LVI A;  1RFJ A;  3CS1 A;  3PAT A;  1F8H A;  4ICB A;  1YTZ C;  2ZRS A;  3WXA A;  4HRH A;  2GGZ A;  1CB1 A;  1XFY O;  3TDZ A;  4QJ4 B;  5HLV A;  3AAK A;  1KQM B;  1QX2 A;  2KFF A;  2KI4 B;  1ALW A;  1NIW A;  1FI6 A;  2Q4U A;  1DJI A;  3CR4 X;  1XA5 A;  2M3W A;  3OB1 B;  4FTG A;  3DVE A;  4DS7 A;  1CDL A;  1SBJ A;  2H61 A;  1EG4 A;  4L9M A;  4CFR A;  1MF8 B;  2HF5 A;  1QJT A;  1QX7 A;  2K7B A;  5B8I B;  1XVJ A;  3I5G B;  2BKH B;  1GQM A;  1MXE A;  3NSK A;  2KGR A;  4IL1 A;  1TOP A;  2P6B B;  5HYD A;  1A2X A;  2KI6 C;  4E68 A;  1KFU S;  3PFV A;  1CFF A;  1IJ6 A;  1XFZ O;  1JC2 A;  1Y1A A;  1ZFS A;  1TNQ A;  1AP4 A;  3TUY B;  1XFU O;  4YGB B;  2I18 A;  3I5F B;  4D1E A;  2JT0 A;  2CBL A;  2KGB C;  2QAC A;  1S6J A;  1UUR A;  2JU0 A;  1F54 A;  4HSZ A;  2EGD A;  1F71 A;  2K7C A;  4I5N B;  3C1V A;  1DVI A;  1SCM C;  1J55 A;  1MR8 A;  2HQW A;  1MUX A;  1DJG A;  4U8D A;  1NCZ A;  2O60 A;  1QXP A;  3PAL A;  1QV1 A;  4GUK A;  1WY9 A;  1AVS A;  1QAS A;  2AMI A;  5D7F A;  4QJ5 B;  3DVK A;  2M29 A;  2LUC A;  4DIR A;  1ALV A;  1KQM C;  3CR2 A;  1MXL C;  2WCF A;  3F45 A;  4MBE A;  4N5X A;  3LLE A;  1SR6 B;  4GFT A;  1AUI B;  2G9B A;  1K9P A;  3OHM B;  2JUL A;  3OB2 B;  1A75 B;  5G08 A;  1CTR A;  1OMV A;  1QLS A;  2FCD A;  3MSE B;  2CNP A;  1SL9 A;  4OVN F;  1XO5 A;  3DVM A;  2CTN A;  4WQ2 A;  3I5G C;  2JZI A;  4MEW A;  2AAO A;  1OMD A;  1OSA A;  2COL B;  3BUO B;  4A4C A;  1BMO A;  4PHM A;  2LC5 A;  5I2Q A;  1JF2 A;  1G33 A;  1PUL A;  2WCE A;  3DF0 B;  2LP3 A;  2LMT A;  3JTD B;  2LV7 A;  3SIB A;  3VGO A;  1XFX O;  2F33 A;  2F2P A;  2I7A A;  3FS7 A;  2ISD A;  1OMR A;  1CLB A;  3TUY C;  1K93 D;  5DKN A;  1NSH A;  1UUS A;  3SG7 A;  3I5F C;  4MRX A;  1TN4 A;  2JRF A;  5K89 A;  4JPZ B;  3GOF A;  2BKI B;  2I94 A;  4BY5 A;  1KFU L;  1LXF C;  1LKJ A;  2O5G A;  1CMF A;  1SYM A;  3LCP C;  1OZS A;  1KK7 Y;  5PAL A;  4I5J A;  3RLZ A;  4AOM A;  2KDH A;  4OV2 A;  3VRO A;  2LM5 A;  2JXC A;  3IQQ A;  1YUT A;  1W7J B;  3WNX B;  1S36 A;  4XJK B;  5AFP A;  2K2F A;  4Q04 A;  1NX0 A;  2LLS A;  4PAL A;  2CXJ A;  2F3Z A;  2KQ6 A;  5CSF A;  4BY4 A;  2JT8 A;  1HQV A;  2KNE A;  1OOJ A;  3D0Y B;  5I8N A;  4CLN A;  3AKA A;  1NPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...