2CXJA

3d solution structure of s100a13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 calcium-binding protein A13
publication title Three-Dimensional Solution Structure of S100A13
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 19
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2cxjA00
1SL7A 1DVIA 5AXIA 1WDCB 1CLBA 1V1GA 4JWQA 3KPXA 4CFQA 3K21A 3O6BA 1XK4C 1NX2A 2CTNA 1XFWO 2LMTA 2O60A 1TIZA 4NDDA 2QACA 2FCEA 3GOFA 1SCMC 1KK8C 1TCOB 2LMVA 1K8UA 3RM1A 1S3PA 2I94A 1EXRA 3HX4A 1CLMA 1PSBA 1KFUL 1VRKA 1JSAA 3LCPC 3JVTB 2LUCA 2WNDA 4ICBA 3I5IC 2MAZA 2BE6A 2ZN8A 2Y4QA 3CR2A 1HT9A 2M3WA 4MEWA 5HKWA 2JNXA 1DJIA 1PVAA 1GGWA 1BOCA 1IWQA 1PSRA 5CSNA 3F45A 2OTGB 1UURA 2ZRTA 1JFJA 4WQ2A 4MBEA 1XFVO 3BUXB 2OS8C 1M63B 1LA3A 1J1DA 3VRRA 1WDCC 1NCZA 2LVVA 3EVVA 5HYDA 5GQQC 1OOJA 1JFKA 2LLUA 1XYDA 1K95A 3CS1A 2EC6B 2PMYA 1J55A 2ZRSA 1A75B 1KFXS 1OZOA 1IQ3A 2H61A 5AERA 1NCYA 1SNLA 1NIWA 2TN4A 1OZSA 1Y1XA 3EKHA 3MSEB 4YI8A 2JXLA 3OP0A 2WCEA 1SR6B 5I2OA 3AKBA 4OR9B 4BY4A 3A4UB 1RTP1 2LHIA 3JVTC 4USLA 2L4IA 4GPLB 4C0JA 2LANA 5CPVA 2JZIA 4Q04A 5F6TA 2CBLA 1IRJA 2M9GA 2KYFA 2KI6D 1BU3A 3AKAA 1CTRA 1Y0VH 2OTGC 2JOJA 1W7JB 2JU0A 3SG5A 1CFCA 1F55A 3E3RA 1J7RA 1W7IB 4CIDA 1DTLA 1CNPA 1ZOTB 2BE4A 2JTZA 1YTZC 1A03A 1B9AA 1NSHA 2BKIB 5KSZA 1DT7B 4AQJA 2EC6C 2L98A 1ZUZA 1DJYA 1MXEA 1NUBA 4D1EA 1OSAA 4JPZB 2GV5A 3LK1A 3NSOA 1WRZA 2BCXA 2L2EA 2OPOA 1S1EA 2FJUB 2KSPA 2D8NA 1SR6C 1QATA 2GGMA 1YVLA 2NXQA 1SL9A 3TS5B 3TDZA 1SBJA 4PHKA 2BL0B 3VRQA 1LVCD 2CNPA 3BOWA 1J7PA 5PALA 2KI4B 4DCKA 3JTDB 4M2QA 2JQ6A 1DF0A 2KQ6A 3VRNA 1SKTA 2JXCA 4HSZA 1NX0A 1U5IB 1V1FA 2KBMA 2ZN9A 2LHLA 3WNXB 4CPVA 4N1GA 1YUUA 1SRAA 3GK4X 1BLQA 1H8BA 4JQ0D 1PULA 1KFUS 2K2AA 1NCXA 5CSJA 1CB1A 3C1VA 3M0WA 2AMIA 4XJKA 1SPYA 5FYXA 1OQPA 3DVKA 1DGUA 4YGBB 2KFHA 4FTGA 5KTYA 1AP4A 3NSLA 2L50A 2Q4UA 2JNFA 1RECA 3NSKA 1LINA 5IBWA 1BJFA 1B7TY 3SG6A 1CKKA 3DF0B 1IGVA 1NX1A 3ZWHA 1AK8A 1UUSA 2FCDA 3BUOB 3TS5C 2Y1MA 3PM8A 1R2UA 4A4CA 5I8NA 1DJWA 2KQYA 3LL8B 2BL0C 1QX2A 4PALA 1CLLA 2KI4C 1A4PA 4YGCB 4AQIA 2I7AA 1PK0D 2PASA 4PHMA 3DD4A 3JTDC 4NQGA 1QS7A 1NX3A 2LC5A 1ODBA 2KNEA 5J3XA 3AAJA 4WQ3A 2F3YA 1CFPA 1H4BA 4HRHA 2BECA 2CXJA 2K0JA 3OB1B 2ZNEA 1RROA 4GGFC 1SMGA 1JBAA 1ZMZA 4N5XA 1L2OC 5HKZA 1B7TZ 3FIAA 3PSRA 1JF2A 1MF8B 2WORA 2Y5IA 1DJGA 4DRWA 2VRGA 4M2OA 4BY5A 1BR1B 2IS9A 2AUCA 1KQVA 1OE9B 2ZKMX 2L5XB 1Y6WA 1LA0A 2Q91A 3FWCA 3BXKA 2F8PA 3I5HB 3PATA 1J1EA 2JT8A 3I5GB 1XK4A 2KFFA 3VROA 2DOQA 1QTXA 1QASA 4I5NB 2SCPA 1GGZA 5ER5A 3OX5A 4E68A 1TNPA 1XVJA 1FI5A 2JC2A 1UWOA 3WHUB 3CLNA 1YUSA 2LP3A 1B8LA 2F2PA 4R1EA 2QPTA 1Y1UA 4QJ5B 2F3ZA 2PALA 3CZTX 1YUTA 2L51A 1ZACA 1M45A 4GUKA 4YGEB 1YURA 3D0YA 3ZNIA 2NZ0A 3TUYB 2MLEC 1RJVA 5K89A 1AVSA 1S6JA 2KOTA 3KO0A 1KCYA 1S6CA 1TCFA 2LNKA 4ORAB 1SL8A 1UHIA 5AANA 1CM1A 1C07A 2CCMA 4MZKA 4ZCVA 4ORCB 3I5HC 2WC8A 2HETA 1A2XA 1XFXO 1MUXA 2LLSA 1F8HA 3I5GC 2KBIA 2HQWA 1NP8A 1G33A 4GGNA 2KAVA 2LVJA 4DS7A 4QJ3B 3OX6A 3HCMA 4PCWA 2LVKA 4PE0A 2F2OA 2MBXA 2JULA 4MLWA 4OVNF 2M97A 3SG3A 2GGZA 4GBAA 1IKUA 1CDNA 1JC2A 4PE4A 3CWGA 1TN4A 1WLZA 5CSIA 1XO5A 1K96A 2CT9A 1QLSA 2BBNA 3EVRA 4MRXA 1GJYA 3BYAA 4NDBA 1XFZO 2V53A 1F70A 1DMOA 1CFFA 3TUYC 2A4JA 2EGDA 1QJTA 2M8UA 1KFXL 3BUNB 3IQOA 1IJ5A 1B4CA 1N0YA 1MHOA 4HREE 1FI6A 1K9KA 4PHNA 3PN7B 4YBHB 3I5FB 2O5GA 4PE7A 1IH0A 2KYCA 4I5LB 3EK4A 1K93D 1PRWA 4P5OE 1A75A 1PVBA 2LE9B 1XFUO 2MRDA 3TZ1A 2PRUA 1UHNA 2COLB 2FOTA 1TNQA 3TDIA 1WRLA 4QJ4B 1YX8A 1K9PA 3KHEA 1S6IA 4TNCA 2KHNA 2HQ8A 3ICBA 1DGVA 3CGAA 1B1GA 4CLNA 1CMFA 2Y1NA 3SIAA 3BQ3A 2EHBA 1SCMB 2L0PA 3KF9A 1SYMA 1FBVA 2KGBC 2LCPA 1QIWA 2G9BA 3WHTB 1BT6A 3DVJA 3FS7A 1WRKA 2JWWA 1S26D 3DVEA 4M2PA 1BR4B 1OMVA 1QX5B 4C0LA 2M49B 3AAKA 1MXLC 1IG5A 3SIBA 2KI6C 1CDLA 1AJ5A 1MQ1A 1XA5A 2F33A 1TNXA 2KAXA 3EKJA 2B1UA 2L4HA 3FWBA 3GK1A 5I2LA 4CFRA 1WLMA 1J7OA 3PN7C 1B8RA 1MWNA 1NPQA 1C7WA 3I5FC 5G08A 1GQMA 1OMRA 2K7DA 2M1UA 4NDCA 2JTTA 2KDHA 1F4QA 2MLFC 2MJWB 2HPSA 3CR4X 2RGIA 2NLNA 1JUOA 2ZFDA 5CSFA 5AEQA 1IJ6A 5I2QA 5HKYA 2M7NA 3O2PA 1RFJA 1QVIY 2JT0A 4YGAA 1B47A 2JRFA 1UHHA 3PLFB 1ALWA 2H61C 2E6WA 4UPGA 4DUQA 5DKQA 2I18A 1N65A 2K8MB 4N1FA 1EG3A 1G4YR 1D1OA 2P6BB 4MRYA 2I2RE 4WRIA 3D10A 2LM5A 1CM4A 1KK7Y 2PSRA 3CTNA 2JPTA 1U5IA 2BCBA 1QV0A 1AHRA 2M29A 1WY9A 2LVIA 3EK8A 3BOWB 3SJSA 3PALA 4YRUA 1MR8A 3NXAA 1C7VA 4GGFA 1DF0B 1QLKA 3BUMB 1QVIZ 2G2BA 3BUWB 4DIRA 1K94A 1CDMA 2K61A 1F4OA 2BKHB 1XFYO 2KGRA 1K9UA 2WCFA 4C0KA 1NYAA 2K7OA 1UHKA 3DVMA 1K90D 1IQ5A 3GK2A 1TNWA 4ZCUA 2E30A 5D69A 1A29A 4FQOA 1QX7A 1BF5A 1RWYA 2MHHA 3DF0A 4XJKB 1KSMA 1TRFA 1KK7Z 1Y1AA 4ETOA 3VRPA 1FW4A 1X02A 1AUIB 3OHMB 1BMOA 1M31A 1R6PA 3WXAA 1SY9A 3EK7A 4MZJA 1QIVA 3CR5X 1M39A 4IL1A 1B8CA 1J7QA 1CDPA 2R2IA 1DJHA 1EJ3A 5AFPA 1LKJA 3SG2A 4HRGA 1HQVA 4U8DA 1YR5A 1NWDA 5JOLA 2M1KB 1TTXA 5HLVA 1LXFC 2K7BA 1UHJA 1DJZA 2MA2A 2LUXA 4MN0A 4OCIA 1ZFSA 1YRUB 2LP2A 1K2HA 1KWOB 1E8AA 1F54A 3O78A 3LLEA 4YGDB 1CFDA 4PHJA 1S5GY 5TNCA 1AJ4A 1KQMB 5BPJA 4OV2A 2LAPA 2KFGA 3NSIA 5KU1A 1SCVA 1YRTB 3RLZA 1FF1A 4PE1A 1SW8A 1YVHA 2AAOA 1UP5A 2PVBA 3H4SE 2HF5A 3OB2B 1JF0A 2ISDA 1YX7A 2M7LA 1QXPA 1EH2A 1M46A 3SG7A 3KEVA 4I5JA 1L7ZA 2WOSA 3EVUA 2NCOA 3VGOA 5HLOA 2M0RA 5B8IB 2BBMA 2H2KA 4MZLA 4XYNA 3SG4A 1N2DA 5DKRA 4A4BA 1F71A 2ZNDA 1EG4A 3PFVA 5D7FA 3IQQA 4AOMA 2LV7A 2K2FA 3IF7A 2LLTA 1KK8B 4GFTA 1S5GZ 1EL4A 1PALA 1G8IA 3O4YA 4GAOA 2NCPA 4I5KA 3TDUA 1KSOA 1SK6D 3QRXA 2SASA 4P2YB 4F0ZB 3LK0A 1BODA 1RK9A 2WCBA 1KWOC 1L2OB 2BCAA 2K7CA 3I5IB 4GNKB 4PDZA 2KAYA 1BG1A 1CMGA 5JJGA 2JT3A 4MSPA 1OMDA 4YI9A 4OKHA 3D0YB 1KQMC 5ER4X 2LMUA 1ALVA 1JWDA 1DJXA 1QV1A 1S36A 1TOPA 4L9MA 5DKNA 4MVFA 3A8RA 1Q80A 1FPWA 4ORBB 2OS8B
chains in the Genus database with same CATH superfamily
1SL7A 1DVIA 5AXIA 1WDCB 1CLBA 1V1GA 4JWQA 3OBVA 3KPXA 3DXLA 3K21A 4CFQA 1DQEA 3O6BA 1XK4C 1NX2A 2CTNA 3UNWA 1XFWO 2LMTA 4FQTA 2PYQA 2O60A 1TIZA 4NDDA 2QACA 2FCEA 3GOFA 1SCMC 1KK8C 1TCOB 2LMVA 1K8UA 3RM1A 1S3PA 2I94A 1EXRA 2BAPA 3HX4A 3FE9A 1CLMA 1PSBA 1KFUL 1VRKA 2QEVA 1JSAA 3LCPC 3JVTB 2LUCA 2WNDA 4ICBA 3I5IC 5EL2A 2MAZA 2BE6A 2ZN8A 2Y4QA 3CR2A 1HT9A 2M3WA 4JD9A 4MEWA 5HKWA 2JNXA 1DJIA 1PVAA 1GGWA 1BOCA 1IWQA 2KLEA 1PSRA 5CSNA 2QEOA 3F45A 2OTGB 1UURA 2ZRTA 1JFJA 4WQ2A 2BNXA 1XFVO 3BUXB 2OS8C 1M63B 1W9ZA 4MBEA 1LA3A 1J1DA 3VRRA 1SSEB 1WDCC 1NCZA 2LVVA 3EVVA 5DICA 5HYDA 5GQQC 1OOJA 1TWOA 1JFKA 3K1EA 2LLUA 1XYDA 1K95A 3CS1A 2EC6B 2PMYA 1J55A 2ZRSA 1A75B 1KFXS 3S0BA 1OZOA 1IQ3A 2H61A 3PM2A 5AERA 1NCYA 1SNLA 1NIWA 2TN4A 1OZSA 1Y1XA 3EKHA 3MSEB 4YI8A 2JXLA 3OP0A 2WCEA 1SR6B 5I2OA 3AKBA 4OR9B 4BY4A 3A4UB 1RTP1 2LHIA 3SS5A 3JVTC 2WCMA 4USLA 2L4IA 4GPLB 4C0JA 2LANA 5CPVA 2JZIA 4Q04A 5F6TA 2CBLA 1IRJA 2M9GA 2KYFA 2KI6D 1BU3A 3AKAA 1CTRA 3D74A 1Y0VH 2OTGC 2QEHA 2JOJA 1W7JB 2JU0A 3SG5A 1CFCA 1F55A 3E3RA 1J7RA 1W7IB 3B88A 1DTLA 4CIDA 1ZOTB 2BE4A 1CNPA 2JTZA 1YTZC 1A03A 1B9AA 3L47A 1NSHA 2BKIB 5KSZA 1DT7B 4AQJA 2EC6C 2L98A 1IIOA 1ZUZA 1DJYA 1MXEA 1NUBA 4D1EA 1OSAA 4JPZB 2GV5A 3LK1A 3NSOA 1WRZA 2BCXA 2L2EA 2OPOA 1S1EA 2FJUB 2KSPA 2D8NA 1SR6C 1QATA 2GGMA 4IJ7A 1YVLA 2NXQA 1SL9A 3TS5B 3TDZA 1SBJA 4PHKA 2BL0B 3VRQA 1LVCD 2CNPA 3BOWA 1J7PA 5PALA 2KI4B 4DCKA 3BFHA 3JTDB 4M2QA 2JQ6A 1DF0A 2KQ6A 3VRNA 1SKTA 2JXCA 3PJIA 4HSZA 1NX0A 1U5IB 1V1FA 1XFRA 2KBMA 2LHLA 2ZN9A 3SS3A 3WNXB 4CPVA 2GTEA 4N1GA 1YUUA 1SRAA 3D75A 3GK4X 1BLQA 4JQ0D 1H8BA 1PULA 1KFUS 2K2AA 1NCXA 5CSJA 1Z4HA 1CB1A 1DEKA 3C1VA 3S0EA 3M0WA 2AMIA 4XJKA 1SPYA 5FYXA 1OQPA 3DVKA 1DGUA 3CZ1A 3OGNA 4YGBB 2KFHA 4FTGA 5KTYA 1AP4A 3S0GA 3NSLA 2L50A 2Q4UA 2JNFA 1RECA 3NSKA 1LINA 2H8VA 5IBWA 1BJFA 1B7TY 3SG6A 1CKKA 3DF0B 1IGVA 1NX1A 3ZWHA 4KYNA 1AK8A 1UUSA 2WCJA 2FCDA 3B86A 3BUOB 3TS5C 2Y1MA 3PM8A 1R2UA 4A4CA 5I8NA 1DJWA 2KQYA 3LL8B 2BL0C 1QX2A 4INWA 4PALA 1CLLA 2KI4C 1A4PA 4YGCB 4AQIA 2I7AA 1PK0D 2PASA 4PHMA 3DD4A 3JTDC 4NQGA 1QS7A 1NX3A 2LC5A 1ODBA 2KNEA 3L4AA 5J3XA 3AAJA 4WQ3A 2F3YA 3D76A 1CFPA 1H4BA 4HRHA 2BECA 2CXJA 2FJYA 2K0JA 3OB1B 2ZNEA 1RROA 3NHIA 4GGFC 1SMGA 3D78A 1JBAA 1ZMZA 4N5XA 1L2OC 5HKZA 1B7TZ 2WCLA 3FIAA 1ORGA 3PSRA 5I94A 1JF2A 1MF8B 1T14A 2WORA 2Y5IA 3O4XA 1DJGA 4DRWA 2VRGA 4M2OA 4BY5A 1BR1B 3D77A 2IS9A 2AUCA 3FE8A 1KQVA 1OE9B 2ZKMX 2L5XB 1Y6WA 1LA0A 2Q91A 3FWCA 3BXKA 2F8PA 3I5HB 3PATA 1J1EA 2JT8A 3I5GB 1XK4A 2KFFA 3VROA 2DOQA 1QTXA 1QASA 4I5NB 3SS4A 2ERBA 2SCPA 1GGZA 5ER5A 3OX5A 4E68A 1TNPA 1XVJA 2KPHA 2JC2A 1FI5A 1UWOA 3WHUB 3CLNA 1YUSA 2LP3A 1B8LA 3DY9A 1OOGA 2F2PA 4R1EA 2QPTA 1Y1UA 4QJ5B 2F3ZA 2PALA 3CZTX 1YUTA 2L51A 1ZACA 1M45A 4GUKA 4YGEB 3BJHA 1YURA 3D0YA 3ZNIA 2NZ0A 3TUYB 2MLEC 2PQLA 3EG5B 1RJVA 5K89A 1AVSA 1S6JA 2KOTA 3KO0A 1KCYA 1S6CA 1TCFA 2LNKA 4ORAB 2WCHA 1SL8A 1UHIA 3CDNA 3NHTA 3BFAA 1CM1A 5AANA 1C07A 2CCMA 4MZKA 4ZCVA 4ORCB 3I5HC 4OZDA 2WC8A 2HETA 1A2XA 1XFXO 1MUXA 2LLSA 1C3YA 3I5GC 1F8HA 2KBIA 2HQWA 1NP8A 1G33A 4GGNA 2KAVA 2LVJA 4DS7A 4QJ3B 3OX6A 3HCMA 4PCWA 2LVKA 4PE0A 2L5YA 2F2OA 2MBXA 1P28A 2JULA 4MLWA 4OVNF 2M97A 5D3OA 2GGZA 3SG3A 4F7FA 4GBAA 1IKUA 1CDNA 1JC2A 4PE4A 3CWGA 1TN4A 1WLZA 5CSIA 1XO5A 1K96A 2CT9A 1QLSA 2BBNA 3EVRA 4MRXA 1GJYA 3VB1A 3BYAA 4NDBA 1XFZO 2V53A 1F70A 1DMOA 3QMEA 1CFFA 3TUYC 2A4JA 2EGDA 1QJTA 2M8UA 1KFXL 3NGVA 3BUNB 1OW4A 3IQOA 1IJ5A 1B4CA 1N0YA 1MHOA 4HREE 1FI6A 1K9KA 3R1OA 4PHNA 3PN7B 4YBHB 3I5FB 2O5GA 2QEBA 4PE7A 1IH0A 2KYCA 4I5LB 3EK4A 1K93D 1PRWA 2QDIA 4P5OE 1A75A 1PVBA 2LE9B 1XFUO 2MRDA 3TZ1A 2PRUA 1UHNA 2COLB 2FOTA 1TNQA 3TDIA 1WRLA 4QJ4B 3Q8IA 1YX8A 1K9PA 3KHEA 1S6IA 4TNCA 2KHNA 2WCKA 2HQ8A 3ICBA 1DGVA 3CGAA 4INXA 4CLNA 3D73A 1B1GA 1CMFA 2Y1NA 3SIAA 3BQ3A 2EHBA 1SCMB 2L0PA 3KF9A 1SYMA 1FBVA 2KGBC 1C3ZA 2LCPA 1QIWA 2G9BA 3WHTB 1BT6A 3DVJA 3FS7A 1WRKA 2JWWA 1S26D 3DVEA 4M2PA 1BR4B 1OMVA 1QX5B 4C0LA 5HL1A 2M49B 3AAKA 1MXLC 1IG5A 3SIBA 2KI6C 3CZ0A 1CDLA 1AJ5A 1MQ1A 1XA5A 2F33A 1TNXA 2KAXA 3EKJA 2B1UA 2L4HA 3FWBA 3GK1A 5I2LA 4CFRA 1LS8A 1WLMA 1J7OA 3PN7C 1B8RA 1MWNA 1NPQA 1C7WA 3I5FC 5G08A 1GQMA 1OMRA 2K7DA 3CZ2A 3L4LA 2M1UA 3B87A 4NDCA 2JTTA 2KDHA 1F4QA 2MLFC 2JPOA 2MJWB 2WC5A 2HPSA 3CR4X 2RGIA 2NLNA 1JUOA 2ZFDA 5CSFA 5AEQA 1IJ6A 5I2QA 5HKYA 2M7NA 3O2PA 1RFJA 1QVIY 2JT0A 4YGAA 1B47A 2JRFA 1UHHA 3PLFB 1ALWA 3R72A 3DYEA 2H61C 2WC6A 2E6WA 4UPGA 4DUQA 5DKQA 2I18A 1N65A 2K8MB 3N7HA 1EG3A 1G4YR 4N1FA 1D1OA 1GM0A 2P6BB 4MRYA 5FI2A 2I2RE 4WRIA 3D10A 2LM5A 1CM4A 1KK7Y 2PSRA 3BFBA 3CTNA 1TUZA 2JPTA 1U5IA 2BCBA 1DELA 1QV0A 1AHRA 2M29A 1WY9A 2LVIA 3EK8A 3BOWB 3SJSA 3PALA 4YRUA 1MR8A 3NXAA 1C7VA 4GGFA 5FI6A 1DF0B 1QLKA 3BUMB 1QVIZ 2G2BA 3BUWB 4DIRA 1K94A 1CDMA 2K61A 1F4OA 2BKHB 1XFYO 2KGRA 1K9UA 2WCFA 4C0KA 1NYAA 2K7OA 1UHKA 3DVMA 1K90D 1IQ5A 3GK2A 1TNWA 4ZCUA 3UO9A 2E30A 5D69A 1A29A 2P70A 3R1VA 4FQOA 1QX7A 1BF5A 1RWYA 2MHHA 3DF0A 4XJKB 1KSMA 1TRFA 1KK7Z 1Y1AA 4ETOA 3VRPA 1FW4A 1X02A 1AUIB 3OHMB 5FI7A 1BMOA 1M31A 2P71A 1R6PA 3WXAA 1SY9A 3EK7A 4MZJA 1QIVA 3CR5X 1M39A 4IL1A 3S0AA 1B8CA 1J7QA 2YGUA 1CDPA 2R2IA 1DJHA 1EJ3A 5AFPA 2KLDA 1LKJA 3SG2A 4HRGA 1HQVA 1QWVA 4U8DA 1YR5A 1NWDA 5JOLA 2M1KB 1TTXA 5HLVA 1LXFC 2K7BA 1UHJA 1DJZA 2MA2A 2LUXA 4MN0A 4OCIA 1ZFSA 1YRUB 2LP2A 1K2HA 1KWOB 1E8AA 1F54A 3O78A 3LLEA 4YGDB 1DC1A 1CFDA 4PHJA 1S5GY 5TNCA 1AJ4A 1FF1A 1KQMB 5BPJA 4OV2A 2LAPA 2KFGA 3NSIA 5KU1A 1SCVA 1Z2CB 1YRTB 4PT1A 3RLZA 1OOIX 4PE1A 1SW8A 1YVHA 2AAOA 1UP5A 2L2CA 2PVBA 2HF5A 3H4SE 1JF0A 3OB2B 1YX7A 1OOFA 2M7LA 2ISDA 1QXPA 1EH2A 1M46A 3SG7A 3R1PA 3KEVA 4I5JA 1L7ZA 2WOSA 3EVUA 2NCOA 3IVTA 3VGOA 5HLOA 2M0RA 5B8IB 2BBMA 2H2KA 4MZLA 4XYNA 3SG4A 1N2DA 5DKRA 4A4BA 1F71A 2ZNDA 1EG4A 3PFVA 3B7AA 5D7FA 3V2LA 3S0DA 3IQQA 4AOMA 2LV7A 1TUJA 2K2FA 3B6XA 3IF7A 2LLTA 1KK8B 4GFTA 3RZSA 3S0FA 1S5GZ 1EL4A 1PALA 1G8IA 3CABA 3O4YA 2NCPA 4GAOA 4I5KA 1KSOA 1SK6D 3TDUA 3QRXA 2SASA 4P2YB 4F0ZB 1OOHA 3LK0A 1BODA 1RK9A 2WCBA 1KWOC 1L2OB 2BCAA 2K7CA 3I5IB 2K60A 4GNKB 2KAYA 4PDZA 1BG1A 1CMGA 5JJGA 2JT3A 4JKTA 3DZTA 4MSPA 1OMDA 4YI9A 4OKHA 3D0YB 1KQMC 5ER4X 2LMUA 1ALVA 3CYZA 1JWDA 1DJXA 1QV1A 1S36A 1TOPA 4L9MA 5DKNA 4MVFA 3A8RA 1Q80A 1FPWA 4ORBB 3FE6A 2OS8B
chains in the Genus database with same CATH topology
1SL7A 1DVIA 5AXIA 1WDCB 1CLBA 1V1GA 4JWQA 3KPXA 4CFQA 3K21A 3O6BA 1XK4C 1NX2A 2CTNA 1XFWO 2LMTA 2O60A 1TIZA 4NDDA 2QACA 2FCEA 3GOFA 1SCMC 1KK8C 1TCOB 2LMVA 1K8UA 3RM1A 1S3PA 2I94A 1EXRA 3HX4A 1CLMA 1PSBA 1KFUL 1VRKA 1JSAA 3LCPC 3JVTB 2LUCA 2WNDA 4ICBA 3I5IC 2MAZA 2BE6A 2ZN8A 2Y4QA 3CR2A 1HT9A 2M3WA 4MEWA 5HKWA 2JNXA 1DJIA 1PVAA 1GGWA 1BOCA 1IWQA 1PSRA 5CSNA 3F45A 2OTGB 1UURA 2ZRTA 1JFJA 4WQ2A 4MBEA 1XFVO 3BUXB 2OS8C 1M63B 1LA3A 1J1DA 3VRRA 1WDCC 1NCZA 2LVVA 3EVVA 5HYDA 5GQQC 1OOJA 1JFKA 2LLUA 1XYDA 1K95A 3CS1A 2EC6B 2PMYA 1J55A 2ZRSA 1A75B 1KFXS 1OZOA 1IQ3A 2H61A 5AERA 1NCYA 1SNLA 1NIWA 2TN4A 1OZSA 1Y1XA 3EKHA 3MSEB 4YI8A 2JXLA 3OP0A 2WCEA 1SR6B 5I2OA 3AKBA 4OR9B 4BY4A 3A4UB 1RTP1 2LHIA 3JVTC 4USLA 2L4IA 4GPLB 4C0JA 2LANA 5CPVA 2JZIA 4Q04A 5F6TA 2CBLA 1IRJA 2M9GA 2KYFA 2KI6D 1BU3A 3AKAA 1CTRA 1Y0VH 2OTGC 2JOJA 1W7JB 2JU0A 3SG5A 1CFCA 1F55A 3E3RA 1J7RA 1W7IB 4CIDA 1DTLA 1CNPA 1ZOTB 2BE4A 2JTZA 1YTZC 1A03A 1B9AA 1NSHA 2BKIB 5KSZA 1DT7B 4AQJA 2EC6C 2L98A 1ZUZA 1DJYA 1MXEA 1NUBA 4D1EA 1OSAA 4JPZB 2GV5A 3LK1A 3NSOA 1WRZA 2BCXA 2L2EA 2OPOA 1S1EA 2FJUB 2KSPA 2D8NA 1SR6C 1QATA 2GGMA 1YVLA 2NXQA 1SL9A 3TS5B 3TDZA 1SBJA 4PHKA 2BL0B 3VRQA 1LVCD 2CNPA 3BOWA 1J7PA 5PALA 2KI4B 4DCKA 3JTDB 4M2QA 2JQ6A 1DF0A 2KQ6A 3VRNA 1SKTA 2JXCA 4HSZA 1NX0A 1U5IB 1V1FA 2KBMA 2ZN9A 2LHLA 3WNXB 4CPVA 4N1GA 1YUUA 1SRAA 3GK4X 1BLQA 1H8BA 4JQ0D 1PULA 1KFUS 2K2AA 1NCXA 5CSJA 1CB1A 3C1VA 3M0WA 2AMIA 4XJKA 1SPYA 5FYXA 1OQPA 3DVKA 1DGUA 4YGBB 2KFHA 4FTGA 5KTYA 1AP4A 3NSLA 2L50A 2Q4UA 2JNFA 1RECA 3NSKA 1LINA 5IBWA 1BJFA 1B7TY 3SG6A 1CKKA 3DF0B 1IGVA 1NX1A 3ZWHA 1AK8A 1UUSA 2FCDA 3BUOB 3TS5C 2Y1MA 3PM8A 1R2UA 4A4CA 5I8NA 1DJWA 2KQYA 3LL8B 2BL0C 1QX2A 4PALA 1CLLA 2KI4C 1A4PA 4YGCB 4AQIA 2I7AA 1PK0D 2PASA 4PHMA 3DD4A 3JTDC 4NQGA 1QS7A 1NX3A 2LC5A 1ODBA 2KNEA 5J3XA 3AAJA 4WQ3A 2F3YA 1CFPA 1H4BA 4HRHA 2BECA 2CXJA 2K0JA 3OB1B 2ZNEA 1RROA 4GGFC 1SMGA 1JBAA 1ZMZA 4N5XA 1L2OC 5HKZA 1B7TZ 3FIAA 3PSRA 1JF2A 1MF8B 2WORA 2Y5IA 1DJGA 4DRWA 2VRGA 4M2OA 4BY5A 1BR1B 2IS9A 2AUCA 1KQVA 1OE9B 2ZKMX 2L5XB 1Y6WA 1LA0A 2Q91A 3FWCA 3BXKA 2F8PA 3I5HB 3PATA 1J1EA 2JT8A 3I5GB 1XK4A 2KFFA 3VROA 2DOQA 1QTXA 1QASA 4I5NB 2SCPA 1GGZA 5ER5A 3OX5A 4E68A 1TNPA 1XVJA 1FI5A 2JC2A 1UWOA 3WHUB 3CLNA 1YUSA 2LP3A 1B8LA 2F2PA 4R1EA 2QPTA 1Y1UA 4QJ5B 2F3ZA 2PALA 3CZTX 1YUTA 2L51A 1ZACA 1M45A 4GUKA 4YGEB 1YURA 3D0YA 3ZNIA 2NZ0A 3TUYB 2MLEC 1RJVA 5K89A 1AVSA 1S6JA 2KOTA 3KO0A 1KCYA 1S6CA 1TCFA 2LNKA 4ORAB 1SL8A 1UHIA 5AANA 1CM1A 1C07A 2CCMA 4MZKA 4ZCVA 4ORCB 3I5HC 2WC8A 2HETA 1A2XA 1XFXO 1MUXA 2LLSA 1F8HA 3I5GC 2KBIA 2HQWA 1NP8A 1G33A 4GGNA 2KAVA 2LVJA 4DS7A 4QJ3B 3OX6A 3HCMA 4PCWA 2LVKA 4PE0A 2F2OA 2MBXA 2JULA 4MLWA 4OVNF 2M97A 3SG3A 2GGZA 4GBAA 1IKUA 1CDNA 1JC2A 4PE4A 3CWGA 1TN4A 1WLZA 5CSIA 1XO5A 1K96A 2CT9A 1QLSA 2BBNA 3EVRA 4MRXA 1GJYA 3BYAA 4NDBA 1XFZO 2V53A 1F70A 1DMOA 1CFFA 3TUYC 2A4JA 2EGDA 1QJTA 2M8UA 1KFXL 3BUNB 3IQOA 1IJ5A 1B4CA 1N0YA 1MHOA 4HREE 1FI6A 1K9KA 4PHNA 3PN7B 4YBHB 3I5FB 2O5GA 4PE7A 1IH0A 2KYCA 4I5LB 3EK4A 1K93D 1PRWA 4P5OE 1A75A 1PVBA 2LE9B 1XFUO 2MRDA 3TZ1A 2PRUA 1UHNA 2COLB 2FOTA 1TNQA 3TDIA 1WRLA 4QJ4B 1YX8A 1K9PA 3KHEA 1S6IA 4TNCA 2KHNA 2HQ8A 3ICBA 1DGVA 3CGAA 1B1GA 4CLNA 1CMFA 2Y1NA 3SIAA 3BQ3A 2EHBA 1SCMB 2L0PA 3KF9A 1SYMA 1FBVA 2KGBC 2LCPA 1QIWA 2G9BA 3WHTB 1BT6A 3DVJA 3FS7A 1WRKA 2JWWA 1S26D 3DVEA 4M2PA 1BR4B 1OMVA 1QX5B 4C0LA 2M49B 3AAKA 1MXLC 1IG5A 3SIBA 2KI6C 1CDLA 1AJ5A 1MQ1A 1XA5A 2F33A 1TNXA 2KAXA 3EKJA 2B1UA 2L4HA 3FWBA 3GK1A 5I2LA 4CFRA 1WLMA 1J7OA 3PN7C 1B8RA 1MWNA 1NPQA 1C7WA 3I5FC 5G08A 1GQMA 1OMRA 2K7DA 2M1UA 4NDCA 2JTTA 2KDHA 1F4QA 2MLFC 2MJWB 2HPSA 3CR4X 2RGIA 2NLNA 1JUOA 2ZFDA 5CSFA 5AEQA 1IJ6A 5I2QA 5HKYA 2M7NA 3O2PA 1RFJA 1QVIY 2JT0A 4YGAA 1B47A 2JRFA 1UHHA 3PLFB 1ALWA 2H61C 2E6WA 4UPGA 4DUQA 5DKQA 2I18A 1N65A 2K8MB 4N1FA 1EG3A 1G4YR 1D1OA 2P6BB 4MRYA 2I2RE 4WRIA 3D10A 2LM5A 1CM4A 1KK7Y 2PSRA 3CTNA 2JPTA 1U5IA 2BCBA 1QV0A 1AHRA 2M29A 1WY9A 2LVIA 3EK8A 3BOWB 3SJSA 3PALA 4YRUA 1MR8A 3NXAA 1C7VA 4GGFA 1DF0B 1QLKA 3BUMB 1QVIZ 2G2BA 3BUWB 4DIRA 1K94A 1CDMA 2K61A 1F4OA 2BKHB 1XFYO 2KGRA 1K9UA 2WCFA 4C0KA 1NYAA 2K7OA 1UHKA 3DVMA 1K90D 1IQ5A 3GK2A 1TNWA 4ZCUA 2E30A 5D69A 1A29A 4FQOA 1QX7A 1BF5A 1RWYA 2MHHA 3DF0A 4XJKB 1KSMA 1TRFA 1KK7Z 1Y1AA 4ETOA 3VRPA 1FW4A 1X02A 1AUIB 3OHMB 1BMOA 1M31A 1R6PA 3WXAA 1SY9A 3EK7A 4MZJA 1QIVA 3CR5X 1M39A 4IL1A 1B8CA 1J7QA 1CDPA 2R2IA 1DJHA 1EJ3A 5AFPA 1LKJA 3SG2A 4HRGA 1HQVA 4U8DA 1YR5A 1NWDA 5JOLA 2M1KB 1TTXA 5HLVA 1LXFC 2K7BA 1UHJA 1DJZA 2MA2A 2LUXA 4MN0A 4OCIA 1ZFSA 1YRUB 2LP2A 1K2HA 1KWOB 1E8AA 1F54A 3O78A 3LLEA 4YGDB 1CFDA 4PHJA 1S5GY 5TNCA 1AJ4A 1KQMB 5BPJA 4OV2A 2LAPA 2KFGA 3NSIA 5KU1A 1SCVA 1YRTB 3RLZA 1FF1A 4PE1A 1SW8A 1YVHA 2AAOA 1UP5A 2PVBA 3H4SE 2HF5A 3OB2B 1JF0A 2ISDA 1YX7A 2M7LA 1QXPA 1EH2A 1M46A 3SG7A 3KEVA 4I5JA 1L7ZA 2WOSA 3EVUA 2NCOA 3VGOA 5HLOA 2M0RA 5B8IB 2BBMA 2H2KA 4MZLA 4XYNA 3SG4A 1N2DA 5DKRA 4A4BA 1F71A 2ZNDA 1EG4A 3PFVA 5D7FA 3IQQA 4AOMA 2LV7A 2K2FA 3IF7A 2LLTA 1KK8B 4GFTA 1S5GZ 1EL4A 1PALA 1G8IA 3O4YA 4GAOA 2NCPA 4I5KA 3TDUA 1KSOA 1SK6D 3QRXA 2SASA 4P2YB 4F0ZB 3LK0A 1BODA 1RK9A 2WCBA 1KWOC 1L2OB 2BCAA 2K7CA 3I5IB 4GNKB 4PDZA 2KAYA 1BG1A 1CMGA 5JJGA 2JT3A 4MSPA 1OMDA 4YI9A 4OKHA 3D0YB 1KQMC 5ER4X 2LMUA 1ALVA 1JWDA 1DJXA 1QV1A 1S36A 1TOPA 4L9MA 5DKNA 4MVFA 3A8RA 1Q80A 1FPWA 4ORBB 2OS8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL7 A;  1DVI A;  5AXI A;  1WDC B;  1CLB A;  1V1G A;  4JWQ A;  3KPX A;  4CFQ A;  3K21 A;  3O6B A;  1XK4 C;  1NX2 A;  2CTN A;  1XFW O;  2LMT A;  2O60 A;  1TIZ A;  4NDD A;  2QAC A;  2FCE A;  3GOF A;  1SCM C;  1KK8 C;  1TCO B;  2LMV A;  1K8U A;  3RM1 A;  1S3P A;  2I94 A;  1EXR A;  3HX4 A;  1CLM A;  1PSB A;  1KFU L;  1VRK A;  1JSA A;  3LCP C;  3JVT B;  2LUC A;  2WND A;  4ICB A;  3I5I C;  2MAZ A;  2BE6 A;  2ZN8 A;  2Y4Q A;  3CR2 A;  1HT9 A;  2M3W A;  4MEW A;  5HKW A;  2JNX A;  1DJI A;  1PVA A;  1GGW A;  1BOC A;  1IWQ A;  1PSR A;  5CSN A;  3F45 A;  2OTG B;  1UUR A;  2ZRT A;  1JFJ A;  4WQ2 A;  4MBE A;  1XFV O;  3BUX B;  2OS8 C;  1M63 B;  1LA3 A;  1J1D A;  3VRR A;  1WDC C;  1NCZ A;  2LVV A;  3EVV A;  5HYD A;  5GQQ C;  1OOJ A;  1JFK A;  2LLU A;  1XYD A;  1K95 A;  3CS1 A;  2EC6 B;  2PMY A;  1J55 A;  2ZRS A;  1A75 B;  1KFX S;  1OZO A;  1IQ3 A;  2H61 A;  5AER A;  1NCY A;  1SNL A;  1NIW A;  2TN4 A;  1OZS A;  1Y1X A;  3EKH A;  3MSE B;  4YI8 A;  2JXL A;  3OP0 A;  2WCE A;  1SR6 B;  5I2O A;  3AKB A;  4OR9 B;  4BY4 A;  3A4U B;  1RTP 1;  2LHI A;  3JVT C;  4USL A;  2L4I A;  4GPL B;  4C0J A;  2LAN A;  5CPV A;  2JZI A;  4Q04 A;  5F6T A;  2CBL A;  1IRJ A;  2M9G A;  2KYF A;  2KI6 D;  1BU3 A;  3AKA A;  1CTR A;  1Y0V H;  2OTG C;  2JOJ A;  1W7J B;  2JU0 A;  3SG5 A;  1CFC A;  1F55 A;  3E3R A;  1J7R A;  1W7I B;  4CID A;  1DTL A;  1CNP A;  1ZOT B;  2BE4 A;  2JTZ A;  1YTZ C;  1A03 A;  1B9A A;  1NSH A;  2BKI B;  5KSZ A;  1DT7 B;  4AQJ A;  2EC6 C;  2L98 A;  1ZUZ A;  1DJY A;  1MXE A;  1NUB A;  4D1E A;  1OSA A;  4JPZ B;  2GV5 A;  3LK1 A;  3NSO A;  1WRZ A;  2BCX A;  2L2E A;  2OPO A;  1S1E A;  2FJU B;  2KSP A;  2D8N A;  1SR6 C;  1QAT A;  2GGM A;  1YVL A;  2NXQ A;  1SL9 A;  3TS5 B;  3TDZ A;  1SBJ A;  4PHK A;  2BL0 B;  3VRQ A;  1LVC D;  2CNP A;  3BOW A;  1J7P A;  5PAL A;  2KI4 B;  4DCK A;  3JTD B;  4M2Q A;  2JQ6 A;  1DF0 A;  2KQ6 A;  3VRN A;  1SKT A;  2JXC A;  4HSZ A;  1NX0 A;  1U5I B;  1V1F A;  2KBM A;  2ZN9 A;  2LHL A;  3WNX B;  4CPV A;  4N1G A;  1YUU A;  1SRA A;  3GK4 X;  1BLQ A;  1H8B A;  4JQ0 D;  1PUL A;  1KFU S;  2K2A A;  1NCX A;  5CSJ A;  1CB1 A;  3C1V A;  3M0W A;  2AMI A;  4XJK A;  1SPY A;  5FYX A;  1OQP A;  3DVK A;  1DGU A;  4YGB B;  2KFH A;  4FTG A;  5KTY A;  1AP4 A;  3NSL A;  2L50 A;  2Q4U A;  2JNF A;  1REC A;  3NSK A;  1LIN A;  5IBW A;  1BJF A;  1B7T Y;  3SG6 A;  1CKK A;  3DF0 B;  1IGV A;  1NX1 A;  3ZWH A;  1AK8 A;  1UUS A;  2FCD A;  3BUO B;  3TS5 C;  2Y1M A;  3PM8 A;  1R2U A;  4A4C A;  5I8N A;  1DJW A;  2KQY A;  3LL8 B;  2BL0 C;  1QX2 A;  4PAL A;  1CLL A;  2KI4 C;  1A4P A;  4YGC B;  4AQI A;  2I7A A;  1PK0 D;  2PAS A;  4PHM A;  3DD4 A;  3JTD C;  4NQG A;  1QS7 A;  1NX3 A;  2LC5 A;  1ODB A;  2KNE A;  5J3X A;  3AAJ A;  4WQ3 A;  2F3Y A;  1CFP A;  1H4B A;  4HRH A;  2BEC A;  2CXJ A;  2K0J A;  3OB1 B;  2ZNE A;  1RRO A;  4GGF C;  1SMG A;  1JBA A;  1ZMZ A;  4N5X A;  1L2O C;  5HKZ A;  1B7T Z;  3FIA A;  3PSR A;  1JF2 A;  1MF8 B;  2WOR A;  2Y5I A;  1DJG A;  4DRW A;  2VRG A;  4M2O A;  4BY5 A;  1BR1 B;  2IS9 A;  2AUC A;  1KQV A;  1OE9 B;  2ZKM X;  2L5X B;  1Y6W A;  1LA0 A;  2Q91 A;  3FWC A;  3BXK A;  2F8P A;  3I5H B;  3PAT A;  1J1E A;  2JT8 A;  3I5G B;  1XK4 A;  2KFF A;  3VRO A;  2DOQ A;  1QTX A;  1QAS A;  4I5N B;  2SCP A;  1GGZ A;  5ER5 A;  3OX5 A;  4E68 A;  1TNP A;  1XVJ A;  1FI5 A;  2JC2 A;  1UWO A;  3WHU B;  3CLN A;  1YUS A;  2LP3 A;  1B8L A;  2F2P A;  4R1E A;  2QPT A;  1Y1U A;  4QJ5 B;  2F3Z A;  2PAL A;  3CZT X;  1YUT A;  2L51 A;  1ZAC A;  1M45 A;  4GUK A;  4YGE B;  1YUR A;  3D0Y A;  3ZNI A;  2NZ0 A;  3TUY B;  2MLE C;  1RJV A;  5K89 A;  1AVS A;  1S6J A;  2KOT A;  3KO0 A;  1KCY A;  1S6C A;  1TCF A;  2LNK A;  4ORA B;  1SL8 A;  1UHI A;  5AAN A;  1CM1 A;  1C07 A;  2CCM A;  4MZK A;  4ZCV A;  4ORC B;  3I5H C;  2WC8 A;  2HET A;  1A2X A;  1XFX O;  1MUX A;  2LLS A;  1F8H A;  3I5G C;  2KBI A;  2HQW A;  1NP8 A;  1G33 A;  4GGN A;  2KAV A;  2LVJ A;  4DS7 A;  4QJ3 B;  3OX6 A;  3HCM A;  4PCW A;  2LVK A;  4PE0 A;  2F2O A;  2MBX A;  2JUL A;  4MLW A;  4OVN F;  2M97 A;  3SG3 A;  2GGZ A;  4GBA A;  1IKU A;  1CDN A;  1JC2 A;  4PE4 A;  3CWG A;  1TN4 A;  1WLZ A;  5CSI A;  1XO5 A;  1K96 A;  2CT9 A;  1QLS A;  2BBN A;  3EVR A;  4MRX A;  1GJY A;  3BYA A;  4NDB A;  1XFZ O;  2V53 A;  1F70 A;  1DMO A;  1CFF A;  3TUY C;  2A4J A;  2EGD A;  1QJT A;  2M8U A;  1KFX L;  3BUN B;  3IQO A;  1IJ5 A;  1B4C A;  1N0Y A;  1MHO A;  4HRE E;  1FI6 A;  1K9K A;  4PHN A;  3PN7 B;  4YBH B;  3I5F B;  2O5G A;  4PE7 A;  1IH0 A;  2KYC A;  4I5L B;  3EK4 A;  1K93 D;  1PRW A;  4P5O E;  1A75 A;  1PVB A;  2LE9 B;  1XFU O;  2MRD A;  3TZ1 A;  2PRU A;  1UHN A;  2COL B;  2FOT A;  1TNQ A;  3TDI A;  1WRL A;  4QJ4 B;  1YX8 A;  1K9P A;  3KHE A;  1S6I A;  4TNC A;  2KHN A;  2HQ8 A;  3ICB A;  1DGV A;  3CGA A;  1B1G A;  4CLN A;  1CMF A;  2Y1N A;  3SIA A;  3BQ3 A;  2EHB A;  1SCM B;  2L0P A;  3KF9 A;  1SYM A;  1FBV A;  2KGB C;  2LCP A;  1QIW A;  2G9B A;  3WHT B;  1BT6 A;  3DVJ A;  3FS7 A;  1WRK A;  2JWW A;  1S26 D;  3DVE A;  4M2P A;  1BR4 B;  1OMV A;  1QX5 B;  4C0L A;  2M49 B;  3AAK A;  1MXL C;  1IG5 A;  3SIB A;  2KI6 C;  1CDL A;  1AJ5 A;  1MQ1 A;  1XA5 A;  2F33 A;  1TNX A;  2KAX A;  3EKJ A;  2B1U A;  2L4H A;  3FWB A;  3GK1 A;  5I2L A;  4CFR A;  1WLM A;  1J7O A;  3PN7 C;  1B8R A;  1MWN A;  1NPQ A;  1C7W A;  3I5F C;  5G08 A;  1GQM A;  1OMR A;  2K7D A;  2M1U A;  4NDC A;  2JTT A;  2KDH A;  1F4Q A;  2MLF C;  2MJW B;  2HPS A;  3CR4 X;  2RGI A;  2NLN A;  1JUO A;  2ZFD A;  5CSF A;  5AEQ A;  1IJ6 A;  5I2Q A;  5HKY A;  2M7N A;  3O2P A;  1RFJ A;  1QVI Y;  2JT0 A;  4YGA A;  1B47 A;  2JRF A;  1UHH A;  3PLF B;  1ALW A;  2H61 C;  2E6W A;  4UPG A;  4DUQ A;  5DKQ A;  2I18 A;  1N65 A;  2K8M B;  4N1F A;  1EG3 A;  1G4Y R;  1D1O A;  2P6B B;  4MRY A;  2I2R E;  4WRI A;  3D10 A;  2LM5 A;  1CM4 A;  1KK7 Y;  2PSR A;  3CTN A;  2JPT A;  1U5I A;  2BCB A;  1QV0 A;  1AHR A;  2M29 A;  1WY9 A;  2LVI A;  3EK8 A;  3BOW B;  3SJS A;  3PAL A;  4YRU A;  1MR8 A;  3NXA A;  1C7V A;  4GGF A;  1DF0 B;  1QLK A;  3BUM B;  1QVI Z;  2G2B A;  3BUW B;  4DIR A;  1K94 A;  1CDM A;  2K61 A;  1F4O A;  2BKH B;  1XFY O;  2KGR A;  1K9U A;  2WCF A;  4C0K A;  1NYA A;  2K7O A;  1UHK A;  3DVM A;  1K90 D;  1IQ5 A;  3GK2 A;  1TNW A;  4ZCU A;  2E30 A;  5D69 A;  1A29 A;  4FQO A;  1QX7 A;  1BF5 A;  1RWY A;  2MHH A;  3DF0 A;  4XJK B;  1KSM A;  1TRF A;  1KK7 Z;  1Y1A A;  4ETO A;  3VRP A;  1FW4 A;  1X02 A;  1AUI B;  3OHM B;  1BMO A;  1M31 A;  1R6P A;  3WXA A;  1SY9 A;  3EK7 A;  4MZJ A;  1QIV A;  3CR5 X;  1M39 A;  4IL1 A;  1B8C A;  1J7Q A;  1CDP A;  2R2I A;  1DJH A;  1EJ3 A;  5AFP A;  1LKJ A;  3SG2 A;  4HRG A;  1HQV A;  4U8D A;  1YR5 A;  1NWD A;  5JOL A;  2M1K B;  1TTX A;  5HLV A;  1LXF C;  2K7B A;  1UHJ A;  1DJZ A;  2MA2 A;  2LUX A;  4MN0 A;  4OCI A;  1ZFS A;  1YRU B;  2LP2 A;  1K2H A;  1KWO B;  1E8A A;  1F54 A;  3O78 A;  3LLE A;  4YGD B;  1CFD A;  4PHJ A;  1S5G Y;  5TNC A;  1AJ4 A;  1KQM B;  5BPJ A;  4OV2 A;  2LAP A;  2KFG A;  3NSI A;  5KU1 A;  1SCV A;  1YRT B;  3RLZ A;  1FF1 A;  4PE1 A;  1SW8 A;  1YVH A;  2AAO A;  1UP5 A;  2PVB A;  3H4S E;  2HF5 A;  3OB2 B;  1JF0 A;  2ISD A;  1YX7 A;  2M7L A;  1QXP A;  1EH2 A;  1M46 A;  3SG7 A;  3KEV A;  4I5J A;  1L7Z A;  2WOS A;  3EVU A;  2NCO A;  3VGO A;  5HLO A;  2M0R A;  5B8I B;  2BBM A;  2H2K A;  4MZL A;  4XYN A;  3SG4 A;  1N2D A;  5DKR A;  4A4B A;  1F71 A;  2ZND A;  1EG4 A;  3PFV A;  5D7F A;  3IQQ A;  4AOM A;  2LV7 A;  2K2F A;  3IF7 A;  2LLT A;  1KK8 B;  4GFT A;  1S5G Z;  1EL4 A;  1PAL A;  1G8I A;  3O4Y A;  4GAO A;  2NCP A;  4I5K A;  3TDU A;  1KSO A;  1SK6 D;  3QRX A;  2SAS A;  4P2Y B;  4F0Z B;  3LK0 A;  1BOD A;  1RK9 A;  2WCB A;  1KWO C;  1L2O B;  2BCA A;  2K7C A;  3I5I B;  4GNK B;  4PDZ A;  2KAY A;  1BG1 A;  1CMG A;  5JJG A;  2JT3 A;  4MSP A;  1OMD A;  4YI9 A;  4OKH A;  3D0Y B;  1KQM C;  5ER4 X;  2LMU A;  1ALV A;  1JWD A;  1DJX A;  1QV1 A;  1S36 A;  1TOP A;  4L9M A;  5DKN A;  4MVF A;  3A8R A;  1Q80 A;  1FPW A;  4ORB B;  2OS8 B; 
#chains in the Genus database with same CATH topology
 1SL7 A;  1DVI A;  5AXI A;  1WDC B;  1CLB A;  1V1G A;  4JWQ A;  3OBV A;  3KPX A;  3DXL A;  3K21 A;  4CFQ A;  1DQE A;  3O6B A;  1XK4 C;  1NX2 A;  2CTN A;  3UNW A;  1XFW O;  2LMT A;  4FQT A;  2PYQ A;  2O60 A;  1TIZ A;  4NDD A;  2QAC A;  2FCE A;  3GOF A;  1SCM C;  1KK8 C;  1TCO B;  2LMV A;  1K8U A;  3RM1 A;  1S3P A;  2I94 A;  1EXR A;  2BAP A;  3HX4 A;  3FE9 A;  1CLM A;  1PSB A;  1KFU L;  1VRK A;  2QEV A;  1JSA A;  3LCP C;  3JVT B;  2LUC A;  2WND A;  4ICB A;  3I5I C;  5EL2 A;  2MAZ A;  2BE6 A;  2ZN8 A;  2Y4Q A;  3CR2 A;  1HT9 A;  2M3W A;  4JD9 A;  4MEW A;  5HKW A;  2JNX A;  1DJI A;  1PVA A;  1GGW A;  1BOC A;  1IWQ A;  2KLE A;  1PSR A;  5CSN A;  2QEO A;  3F45 A;  2OTG B;  1UUR A;  2ZRT A;  1JFJ A;  4WQ2 A;  2BNX A;  1XFV O;  3BUX B;  2OS8 C;  1M63 B;  1W9Z A;  4MBE A;  1LA3 A;  1J1D A;  3VRR A;  1SSE B;  1WDC C;  1NCZ A;  2LVV A;  3EVV A;  5DIC A;  5HYD A;  5GQQ C;  1OOJ A;  1TWO A;  1JFK A;  3K1E A;  2LLU A;  1XYD A;  1K95 A;  3CS1 A;  2EC6 B;  2PMY A;  1J55 A;  2ZRS A;  1A75 B;  1KFX S;  3S0B A;  1OZO A;  1IQ3 A;  2H61 A;  3PM2 A;  5AER A;  1NCY A;  1SNL A;  1NIW A;  2TN4 A;  1OZS A;  1Y1X A;  3EKH A;  3MSE B;  4YI8 A;  2JXL A;  3OP0 A;  2WCE A;  1SR6 B;  5I2O A;  3AKB A;  4OR9 B;  4BY4 A;  3A4U B;  1RTP 1;  2LHI A;  3SS5 A;  3JVT C;  2WCM A;  4USL A;  2L4I A;  4GPL B;  4C0J A;  2LAN A;  5CPV A;  2JZI A;  4Q04 A;  5F6T A;  2CBL A;  1IRJ A;  2M9G A;  2KYF A;  2KI6 D;  1BU3 A;  3AKA A;  1CTR A;  3D74 A;  1Y0V H;  2OTG C;  2QEH A;  2JOJ A;  1W7J B;  2JU0 A;  3SG5 A;  1CFC A;  1F55 A;  3E3R A;  1J7R A;  1W7I B;  3B88 A;  1DTL A;  4CID A;  1ZOT B;  2BE4 A;  1CNP A;  2JTZ A;  1YTZ C;  1A03 A;  1B9A A;  3L47 A;  1NSH A;  2BKI B;  5KSZ A;  1DT7 B;  4AQJ A;  2EC6 C;  2L98 A;  1IIO A;  1ZUZ A;  1DJY A;  1MXE A;  1NUB A;  4D1E A;  1OSA A;  4JPZ B;  2GV5 A;  3LK1 A;  3NSO A;  1WRZ A;  2BCX A;  2L2E A;  2OPO A;  1S1E A;  2FJU B;  2KSP A;  2D8N A;  1SR6 C;  1QAT A;  2GGM A;  4IJ7 A;  1YVL A;  2NXQ A;  1SL9 A;  3TS5 B;  3TDZ A;  1SBJ A;  4PHK A;  2BL0 B;  3VRQ A;  1LVC D;  2CNP A;  3BOW A;  1J7P A;  5PAL A;  2KI4 B;  4DCK A;  3BFH A;  3JTD B;  4M2Q A;  2JQ6 A;  1DF0 A;  2KQ6 A;  3VRN A;  1SKT A;  2JXC A;  3PJI A;  4HSZ A;  1NX0 A;  1U5I B;  1V1F A;  1XFR A;  2KBM A;  2LHL A;  2ZN9 A;  3SS3 A;  3WNX B;  4CPV A;  2GTE A;  4N1G A;  1YUU A;  1SRA A;  3D75 A;  3GK4 X;  1BLQ A;  4JQ0 D;  1H8B A;  1PUL A;  1KFU S;  2K2A A;  1NCX A;  5CSJ A;  1Z4H A;  1CB1 A;  1DEK A;  3C1V A;  3S0E A;  3M0W A;  2AMI A;  4XJK A;  1SPY A;  5FYX A;  1OQP A;  3DVK A;  1DGU A;  3CZ1 A;  3OGN A;  4YGB B;  2KFH A;  4FTG A;  5KTY A;  1AP4 A;  3S0G A;  3NSL A;  2L50 A;  2Q4U A;  2JNF A;  1REC A;  3NSK A;  1LIN A;  2H8V A;  5IBW A;  1BJF A;  1B7T Y;  3SG6 A;  1CKK A;  3DF0 B;  1IGV A;  1NX1 A;  3ZWH A;  4KYN A;  1AK8 A;  1UUS A;  2WCJ A;  2FCD A;  3B86 A;  3BUO B;  3TS5 C;  2Y1M A;  3PM8 A;  1R2U A;  4A4C A;  5I8N A;  1DJW A;  2KQY A;  3LL8 B;  2BL0 C;  1QX2 A;  4INW A;  4PAL A;  1CLL A;  2KI4 C;  1A4P A;  4YGC B;  4AQI A;  2I7A A;  1PK0 D;  2PAS A;  4PHM A;  3DD4 A;  3JTD C;  4NQG A;  1QS7 A;  1NX3 A;  2LC5 A;  1ODB A;  2KNE A;  3L4A A;  5J3X A;  3AAJ A;  4WQ3 A;  2F3Y A;  3D76 A;  1CFP A;  1H4B A;  4HRH A;  2BEC A;  2CXJ A;  2FJY A;  2K0J A;  3OB1 B;  2ZNE A;  1RRO A;  3NHI A;  4GGF C;  1SMG A;  3D78 A;  1JBA A;  1ZMZ A;  4N5X A;  1L2O C;  5HKZ A;  1B7T Z;  2WCL A;  3FIA A;  1ORG A;  3PSR A;  5I94 A;  1JF2 A;  1MF8 B;  1T14 A;  2WOR A;  2Y5I A;  3O4X A;  1DJG A;  4DRW A;  2VRG A;  4M2O A;  4BY5 A;  1BR1 B;  3D77 A;  2IS9 A;  2AUC A;  3FE8 A;  1KQV A;  1OE9 B;  2ZKM X;  2L5X B;  1Y6W A;  1LA0 A;  2Q91 A;  3FWC A;  3BXK A;  2F8P A;  3I5H B;  3PAT A;  1J1E A;  2JT8 A;  3I5G B;  1XK4 A;  2KFF A;  3VRO A;  2DOQ A;  1QTX A;  1QAS A;  4I5N B;  3SS4 A;  2ERB A;  2SCP A;  1GGZ A;  5ER5 A;  3OX5 A;  4E68 A;  1TNP A;  1XVJ A;  2KPH A;  2JC2 A;  1FI5 A;  1UWO A;  3WHU B;  3CLN A;  1YUS A;  2LP3 A;  1B8L A;  3DY9 A;  1OOG A;  2F2P A;  4R1E A;  2QPT A;  1Y1U A;  4QJ5 B;  2F3Z A;  2PAL A;  3CZT X;  1YUT A;  2L51 A;  1ZAC A;  1M45 A;  4GUK A;  4YGE B;  3BJH A;  1YUR A;  3D0Y A;  3ZNI A;  2NZ0 A;  3TUY B;  2MLE C;  2PQL A;  3EG5 B;  1RJV A;  5K89 A;  1AVS A;  1S6J A;  2KOT A;  3KO0 A;  1KCY A;  1S6C A;  1TCF A;  2LNK A;  4ORA B;  2WCH A;  1SL8 A;  1UHI A;  3CDN A;  3NHT A;  3BFA A;  1CM1 A;  5AAN A;  1C07 A;  2CCM A;  4MZK A;  4ZCV A;  4ORC B;  3I5H C;  4OZD A;  2WC8 A;  2HET A;  1A2X A;  1XFX O;  1MUX A;  2LLS A;  1C3Y A;  3I5G C;  1F8H A;  2KBI A;  2HQW A;  1NP8 A;  1G33 A;  4GGN A;  2KAV A;  2LVJ A;  4DS7 A;  4QJ3 B;  3OX6 A;  3HCM A;  4PCW A;  2LVK A;  4PE0 A;  2L5Y A;  2F2O A;  2MBX A;  1P28 A;  2JUL A;  4MLW A;  4OVN F;  2M97 A;  5D3O A;  2GGZ A;  3SG3 A;  4F7F A;  4GBA A;  1IKU A;  1CDN A;  1JC2 A;  4PE4 A;  3CWG A;  1TN4 A;  1WLZ A;  5CSI A;  1XO5 A;  1K96 A;  2CT9 A;  1QLS A;  2BBN A;  3EVR A;  4MRX A;  1GJY A;  3VB1 A;  3BYA A;  4NDB A;  1XFZ O;  2V53 A;  1F70 A;  1DMO A;  3QME A;  1CFF A;  3TUY C;  2A4J A;  2EGD A;  1QJT A;  2M8U A;  1KFX L;  3NGV A;  3BUN B;  1OW4 A;  3IQO A;  1IJ5 A;  1B4C A;  1N0Y A;  1MHO A;  4HRE E;  1FI6 A;  1K9K A;  3R1O A;  4PHN A;  3PN7 B;  4YBH B;  3I5F B;  2O5G A;  2QEB A;  4PE7 A;  1IH0 A;  2KYC A;  4I5L B;  3EK4 A;  1K93 D;  1PRW A;  2QDI A;  4P5O E;  1A75 A;  1PVB A;  2LE9 B;  1XFU O;  2MRD A;  3TZ1 A;  2PRU A;  1UHN A;  2COL B;  2FOT A;  1TNQ A;  3TDI A;  1WRL A;  4QJ4 B;  3Q8I A;  1YX8 A;  1K9P A;  3KHE A;  1S6I A;  4TNC A;  2KHN A;  2WCK A;  2HQ8 A;  3ICB A;  1DGV A;  3CGA A;  4INX A;  4CLN A;  3D73 A;  1B1G A;  1CMF A;  2Y1N A;  3SIA A;  3BQ3 A;  2EHB A;  1SCM B;  2L0P A;  3KF9 A;  1SYM A;  1FBV A;  2KGB C;  1C3Z A;  2LCP A;  1QIW A;  2G9B A;  3WHT B;  1BT6 A;  3DVJ A;  3FS7 A;  1WRK A;  2JWW A;  1S26 D;  3DVE A;  4M2P A;  1BR4 B;  1OMV A;  1QX5 B;  4C0L A;  5HL1 A;  2M49 B;  3AAK A;  1MXL C;  1IG5 A;  3SIB A;  2KI6 C;  3CZ0 A;  1CDL A;  1AJ5 A;  1MQ1 A;  1XA5 A;  2F33 A;  1TNX A;  2KAX A;  3EKJ A;  2B1U A;  2L4H A;  3FWB A;  3GK1 A;  5I2L A;  4CFR A;  1LS8 A;  1WLM A;  1J7O A;  3PN7 C;  1B8R A;  1MWN A;  1NPQ A;  1C7W A;  3I5F C;  5G08 A;  1GQM A;  1OMR A;  2K7D A;  3CZ2 A;  3L4L A;  2M1U A;  3B87 A;  4NDC A;  2JTT A;  2KDH A;  1F4Q A;  2MLF C;  2JPO A;  2MJW B;  2WC5 A;  2HPS A;  3CR4 X;  2RGI A;  2NLN A;  1JUO A;  2ZFD A;  5CSF A;  5AEQ A;  1IJ6 A;  5I2Q A;  5HKY A;  2M7N A;  3O2P A;  1RFJ A;  1QVI Y;  2JT0 A;  4YGA A;  1B47 A;  2JRF A;  1UHH A;  3PLF B;  1ALW A;  3R72 A;  3DYE A;  2H61 C;  2WC6 A;  2E6W A;  4UPG A;  4DUQ A;  5DKQ A;  2I18 A;  1N65 A;  2K8M B;  3N7H A;  1EG3 A;  1G4Y R;  4N1F A;  1D1O A;  1GM0 A;  2P6B B;  4MRY A;  5FI2 A;  2I2R E;  4WRI A;  3D10 A;  2LM5 A;  1CM4 A;  1KK7 Y;  2PSR A;  3BFB A;  3CTN A;  1TUZ A;  2JPT A;  1U5I A;  2BCB A;  1DEL A;  1QV0 A;  1AHR A;  2M29 A;  1WY9 A;  2LVI A;  3EK8 A;  3BOW B;  3SJS A;  3PAL A;  4YRU A;  1MR8 A;  3NXA A;  1C7V A;  4GGF A;  5FI6 A;  1DF0 B;  1QLK A;  3BUM B;  1QVI Z;  2G2B A;  3BUW B;  4DIR A;  1K94 A;  1CDM A;  2K61 A;  1F4O A;  2BKH B;  1XFY O;  2KGR A;  1K9U A;  2WCF A;  4C0K A;  1NYA A;  2K7O A;  1UHK A;  3DVM A;  1K90 D;  1IQ5 A;  3GK2 A;  1TNW A;  4ZCU A;  3UO9 A;  2E30 A;  5D69 A;  1A29 A;  2P70 A;  3R1V A;  4FQO A;  1QX7 A;  1BF5 A;  1RWY A;  2MHH A;  3DF0 A;  4XJK B;  1KSM A;  1TRF A;  1KK7 Z;  1Y1A A;  4ETO A;  3VRP A;  1FW4 A;  1X02 A;  1AUI B;  3OHM B;  5FI7 A;  1BMO A;  1M31 A;  2P71 A;  1R6P A;  3WXA A;  1SY9 A;  3EK7 A;  4MZJ A;  1QIV A;  3CR5 X;  1M39 A;  4IL1 A;  3S0A A;  1B8C A;  1J7Q A;  2YGU A;  1CDP A;  2R2I A;  1DJH A;  1EJ3 A;  5AFP A;  2KLD A;  1LKJ A;  3SG2 A;  4HRG A;  1HQV A;  1QWV A;  4U8D A;  1YR5 A;  1NWD A;  5JOL A;  2M1K B;  1TTX A;  5HLV A;  1LXF C;  2K7B A;  1UHJ A;  1DJZ A;  2MA2 A;  2LUX A;  4MN0 A;  4OCI A;  1ZFS A;  1YRU B;  2LP2 A;  1K2H A;  1KWO B;  1E8A A;  1F54 A;  3O78 A;  3LLE A;  4YGD B;  1DC1 A;  1CFD A;  4PHJ A;  1S5G Y;  5TNC A;  1AJ4 A;  1FF1 A;  1KQM B;  5BPJ A;  4OV2 A;  2LAP A;  2KFG A;  3NSI A;  5KU1 A;  1SCV A;  1Z2C B;  1YRT B;  4PT1 A;  3RLZ A;  1OOI X;  4PE1 A;  1SW8 A;  1YVH A;  2AAO A;  1UP5 A;  2L2C A;  2PVB A;  2HF5 A;  3H4S E;  1JF0 A;  3OB2 B;  1YX7 A;  1OOF A;  2M7L A;  2ISD A;  1QXP A;  1EH2 A;  1M46 A;  3SG7 A;  3R1P A;  3KEV A;  4I5J A;  1L7Z A;  2WOS A;  3EVU A;  2NCO A;  3IVT A;  3VGO A;  5HLO A;  2M0R A;  5B8I B;  2BBM A;  2H2K A;  4MZL A;  4XYN A;  3SG4 A;  1N2D A;  5DKR A;  4A4B A;  1F71 A;  2ZND A;  1EG4 A;  3PFV A;  3B7A A;  5D7F A;  3V2L A;  3S0D A;  3IQQ A;  4AOM A;  2LV7 A;  1TUJ A;  2K2F A;  3B6X A;  3IF7 A;  2LLT A;  1KK8 B;  4GFT A;  3RZS A;  3S0F A;  1S5G Z;  1EL4 A;  1PAL A;  1G8I A;  3CAB A;  3O4Y A;  2NCP A;  4GAO A;  4I5K A;  1KSO A;  1SK6 D;  3TDU A;  3QRX A;  2SAS A;  4P2Y B;  4F0Z B;  1OOH A;  3LK0 A;  1BOD A;  1RK9 A;  2WCB A;  1KWO C;  1L2O B;  2BCA A;  2K7C A;  3I5I B;  2K60 A;  4GNK B;  2KAY A;  4PDZ A;  1BG1 A;  1CMG A;  5JJG A;  2JT3 A;  4JKT A;  3DZT A;  4MSP A;  1OMD A;  4YI9 A;  4OKH A;  3D0Y B;  1KQM C;  5ER4 X;  2LMU A;  1ALV A;  3CYZ A;  1JWD A;  1DJX A;  1QV1 A;  1S36 A;  1TOP A;  4L9M A;  5DKN A;  4MVF A;  3A8R A;  1Q80 A;  1FPW A;  4ORB B;  3FE6 A;  2OS8 B; 
#chains in the Genus database with same CATH homology
 1SL7 A;  1DVI A;  5AXI A;  1WDC B;  1CLB A;  1V1G A;  4JWQ A;  3KPX A;  4CFQ A;  3K21 A;  3O6B A;  1XK4 C;  1NX2 A;  2CTN A;  1XFW O;  2LMT A;  2O60 A;  1TIZ A;  4NDD A;  2QAC A;  2FCE A;  3GOF A;  1SCM C;  1KK8 C;  1TCO B;  2LMV A;  1K8U A;  3RM1 A;  1S3P A;  2I94 A;  1EXR A;  3HX4 A;  1CLM A;  1PSB A;  1KFU L;  1VRK A;  1JSA A;  3LCP C;  3JVT B;  2LUC A;  2WND A;  4ICB A;  3I5I C;  2MAZ A;  2BE6 A;  2ZN8 A;  2Y4Q A;  3CR2 A;  1HT9 A;  2M3W A;  4MEW A;  5HKW A;  2JNX A;  1DJI A;  1PVA A;  1GGW A;  1BOC A;  1IWQ A;  1PSR A;  5CSN A;  3F45 A;  2OTG B;  1UUR A;  2ZRT A;  1JFJ A;  4WQ2 A;  4MBE A;  1XFV O;  3BUX B;  2OS8 C;  1M63 B;  1LA3 A;  1J1D A;  3VRR A;  1WDC C;  1NCZ A;  2LVV A;  3EVV A;  5HYD A;  5GQQ C;  1OOJ A;  1JFK A;  2LLU A;  1XYD A;  1K95 A;  3CS1 A;  2EC6 B;  2PMY A;  1J55 A;  2ZRS A;  1A75 B;  1KFX S;  1OZO A;  1IQ3 A;  2H61 A;  5AER A;  1NCY A;  1SNL A;  1NIW A;  2TN4 A;  1OZS A;  1Y1X A;  3EKH A;  3MSE B;  4YI8 A;  2JXL A;  3OP0 A;  2WCE A;  1SR6 B;  5I2O A;  3AKB A;  4OR9 B;  4BY4 A;  3A4U B;  1RTP 1;  2LHI A;  3JVT C;  4USL A;  2L4I A;  4GPL B;  4C0J A;  2LAN A;  5CPV A;  2JZI A;  4Q04 A;  5F6T A;  2CBL A;  1IRJ A;  2M9G A;  2KYF A;  2KI6 D;  1BU3 A;  3AKA A;  1CTR A;  1Y0V H;  2OTG C;  2JOJ A;  1W7J B;  2JU0 A;  3SG5 A;  1CFC A;  1F55 A;  3E3R A;  1J7R A;  1W7I B;  4CID A;  1DTL A;  1CNP A;  1ZOT B;  2BE4 A;  2JTZ A;  1YTZ C;  1A03 A;  1B9A A;  1NSH A;  2BKI B;  5KSZ A;  1DT7 B;  4AQJ A;  2EC6 C;  2L98 A;  1ZUZ A;  1DJY A;  1MXE A;  1NUB A;  4D1E A;  1OSA A;  4JPZ B;  2GV5 A;  3LK1 A;  3NSO A;  1WRZ A;  2BCX A;  2L2E A;  2OPO A;  1S1E A;  2FJU B;  2KSP A;  2D8N A;  1SR6 C;  1QAT A;  2GGM A;  1YVL A;  2NXQ A;  1SL9 A;  3TS5 B;  3TDZ A;  1SBJ A;  4PHK A;  2BL0 B;  3VRQ A;  1LVC D;  2CNP A;  3BOW A;  1J7P A;  5PAL A;  2KI4 B;  4DCK A;  3JTD B;  4M2Q A;  2JQ6 A;  1DF0 A;  2KQ6 A;  3VRN A;  1SKT A;  2JXC A;  4HSZ A;  1NX0 A;  1U5I B;  1V1F A;  2KBM A;  2ZN9 A;  2LHL A;  3WNX B;  4CPV A;  4N1G A;  1YUU A;  1SRA A;  3GK4 X;  1BLQ A;  1H8B A;  4JQ0 D;  1PUL A;  1KFU S;  2K2A A;  1NCX A;  5CSJ A;  1CB1 A;  3C1V A;  3M0W A;  2AMI A;  4XJK A;  1SPY A;  5FYX A;  1OQP A;  3DVK A;  1DGU A;  4YGB B;  2KFH A;  4FTG A;  5KTY A;  1AP4 A;  3NSL A;  2L50 A;  2Q4U A;  2JNF A;  1REC A;  3NSK A;  1LIN A;  5IBW A;  1BJF A;  1B7T Y;  3SG6 A;  1CKK A;  3DF0 B;  1IGV A;  1NX1 A;  3ZWH A;  1AK8 A;  1UUS A;  2FCD A;  3BUO B;  3TS5 C;  2Y1M A;  3PM8 A;  1R2U A;  4A4C A;  5I8N A;  1DJW A;  2KQY A;  3LL8 B;  2BL0 C;  1QX2 A;  4PAL A;  1CLL A;  2KI4 C;  1A4P A;  4YGC B;  4AQI A;  2I7A A;  1PK0 D;  2PAS A;  4PHM A;  3DD4 A;  3JTD C;  4NQG A;  1QS7 A;  1NX3 A;  2LC5 A;  1ODB A;  2KNE A;  5J3X A;  3AAJ A;  4WQ3 A;  2F3Y A;  1CFP A;  1H4B A;  4HRH A;  2BEC A;  2CXJ A;  2K0J A;  3OB1 B;  2ZNE A;  1RRO A;  4GGF C;  1SMG A;  1JBA A;  1ZMZ A;  4N5X A;  1L2O C;  5HKZ A;  1B7T Z;  3FIA A;  3PSR A;  1JF2 A;  1MF8 B;  2WOR A;  2Y5I A;  1DJG A;  4DRW A;  2VRG A;  4M2O A;  4BY5 A;  1BR1 B;  2IS9 A;  2AUC A;  1KQV A;  1OE9 B;  2ZKM X;  2L5X B;  1Y6W A;  1LA0 A;  2Q91 A;  3FWC A;  3BXK A;  2F8P A;  3I5H B;  3PAT A;  1J1E A;  2JT8 A;  3I5G B;  1XK4 A;  2KFF A;  3VRO A;  2DOQ A;  1QTX A;  1QAS A;  4I5N B;  2SCP A;  1GGZ A;  5ER5 A;  3OX5 A;  4E68 A;  1TNP A;  1XVJ A;  1FI5 A;  2JC2 A;  1UWO A;  3WHU B;  3CLN A;  1YUS A;  2LP3 A;  1B8L A;  2F2P A;  4R1E A;  2QPT A;  1Y1U A;  4QJ5 B;  2F3Z A;  2PAL A;  3CZT X;  1YUT A;  2L51 A;  1ZAC A;  1M45 A;  4GUK A;  4YGE B;  1YUR A;  3D0Y A;  3ZNI A;  2NZ0 A;  3TUY B;  2MLE C;  1RJV A;  5K89 A;  1AVS A;  1S6J A;  2KOT A;  3KO0 A;  1KCY A;  1S6C A;  1TCF A;  2LNK A;  4ORA B;  1SL8 A;  1UHI A;  5AAN A;  1CM1 A;  1C07 A;  2CCM A;  4MZK A;  4ZCV A;  4ORC B;  3I5H C;  2WC8 A;  2HET A;  1A2X A;  1XFX O;  1MUX A;  2LLS A;  1F8H A;  3I5G C;  2KBI A;  2HQW A;  1NP8 A;  1G33 A;  4GGN A;  2KAV A;  2LVJ A;  4DS7 A;  4QJ3 B;  3OX6 A;  3HCM A;  4PCW A;  2LVK A;  4PE0 A;  2F2O A;  2MBX A;  2JUL A;  4MLW A;  4OVN F;  2M97 A;  3SG3 A;  2GGZ A;  4GBA A;  1IKU A;  1CDN A;  1JC2 A;  4PE4 A;  3CWG A;  1TN4 A;  1WLZ A;  5CSI A;  1XO5 A;  1K96 A;  2CT9 A;  1QLS A;  2BBN A;  3EVR A;  4MRX A;  1GJY A;  3BYA A;  4NDB A;  1XFZ O;  2V53 A;  1F70 A;  1DMO A;  1CFF A;  3TUY C;  2A4J A;  2EGD A;  1QJT A;  2M8U A;  1KFX L;  3BUN B;  3IQO A;  1IJ5 A;  1B4C A;  1N0Y A;  1MHO A;  4HRE E;  1FI6 A;  1K9K A;  4PHN A;  3PN7 B;  4YBH B;  3I5F B;  2O5G A;  4PE7 A;  1IH0 A;  2KYC A;  4I5L B;  3EK4 A;  1K93 D;  1PRW A;  4P5O E;  1A75 A;  1PVB A;  2LE9 B;  1XFU O;  2MRD A;  3TZ1 A;  2PRU A;  1UHN A;  2COL B;  2FOT A;  1TNQ A;  3TDI A;  1WRL A;  4QJ4 B;  1YX8 A;  1K9P A;  3KHE A;  1S6I A;  4TNC A;  2KHN A;  2HQ8 A;  3ICB A;  1DGV A;  3CGA A;  1B1G A;  4CLN A;  1CMF A;  2Y1N A;  3SIA A;  3BQ3 A;  2EHB A;  1SCM B;  2L0P A;  3KF9 A;  1SYM A;  1FBV A;  2KGB C;  2LCP A;  1QIW A;  2G9B A;  3WHT B;  1BT6 A;  3DVJ A;  3FS7 A;  1WRK A;  2JWW A;  1S26 D;  3DVE A;  4M2P A;  1BR4 B;  1OMV A;  1QX5 B;  4C0L A;  2M49 B;  3AAK A;  1MXL C;  1IG5 A;  3SIB A;  2KI6 C;  1CDL A;  1AJ5 A;  1MQ1 A;  1XA5 A;  2F33 A;  1TNX A;  2KAX A;  3EKJ A;  2B1U A;  2L4H A;  3FWB A;  3GK1 A;  5I2L A;  4CFR A;  1WLM A;  1J7O A;  3PN7 C;  1B8R A;  1MWN A;  1NPQ A;  1C7W A;  3I5F C;  5G08 A;  1GQM A;  1OMR A;  2K7D A;  2M1U A;  4NDC A;  2JTT A;  2KDH A;  1F4Q A;  2MLF C;  2MJW B;  2HPS A;  3CR4 X;  2RGI A;  2NLN A;  1JUO A;  2ZFD A;  5CSF A;  5AEQ A;  1IJ6 A;  5I2Q A;  5HKY A;  2M7N A;  3O2P A;  1RFJ A;  1QVI Y;  2JT0 A;  4YGA A;  1B47 A;  2JRF A;  1UHH A;  3PLF B;  1ALW A;  2H61 C;  2E6W A;  4UPG A;  4DUQ A;  5DKQ A;  2I18 A;  1N65 A;  2K8M B;  4N1F A;  1EG3 A;  1G4Y R;  1D1O A;  2P6B B;  4MRY A;  2I2R E;  4WRI A;  3D10 A;  2LM5 A;  1CM4 A;  1KK7 Y;  2PSR A;  3CTN A;  2JPT A;  1U5I A;  2BCB A;  1QV0 A;  1AHR A;  2M29 A;  1WY9 A;  2LVI A;  3EK8 A;  3BOW B;  3SJS A;  3PAL A;  4YRU A;  1MR8 A;  3NXA A;  1C7V A;  4GGF A;  1DF0 B;  1QLK A;  3BUM B;  1QVI Z;  2G2B A;  3BUW B;  4DIR A;  1K94 A;  1CDM A;  2K61 A;  1F4O A;  2BKH B;  1XFY O;  2KGR A;  1K9U A;  2WCF A;  4C0K A;  1NYA A;  2K7O A;  1UHK A;  3DVM A;  1K90 D;  1IQ5 A;  3GK2 A;  1TNW A;  4ZCU A;  2E30 A;  5D69 A;  1A29 A;  4FQO A;  1QX7 A;  1BF5 A;  1RWY A;  2MHH A;  3DF0 A;  4XJK B;  1KSM A;  1TRF A;  1KK7 Z;  1Y1A A;  4ETO A;  3VRP A;  1FW4 A;  1X02 A;  1AUI B;  3OHM B;  1BMO A;  1M31 A;  1R6P A;  3WXA A;  1SY9 A;  3EK7 A;  4MZJ A;  1QIV A;  3CR5 X;  1M39 A;  4IL1 A;  1B8C A;  1J7Q A;  1CDP A;  2R2I A;  1DJH A;  1EJ3 A;  5AFP A;  1LKJ A;  3SG2 A;  4HRG A;  1HQV A;  4U8D A;  1YR5 A;  1NWD A;  5JOL A;  2M1K B;  1TTX A;  5HLV A;  1LXF C;  2K7B A;  1UHJ A;  1DJZ A;  2MA2 A;  2LUX A;  4MN0 A;  4OCI A;  1ZFS A;  1YRU B;  2LP2 A;  1K2H A;  1KWO B;  1E8A A;  1F54 A;  3O78 A;  3LLE A;  4YGD B;  1CFD A;  4PHJ A;  1S5G Y;  5TNC A;  1AJ4 A;  1KQM B;  5BPJ A;  4OV2 A;  2LAP A;  2KFG A;  3NSI A;  5KU1 A;  1SCV A;  1YRT B;  3RLZ A;  1FF1 A;  4PE1 A;  1SW8 A;  1YVH A;  2AAO A;  1UP5 A;  2PVB A;  3H4S E;  2HF5 A;  3OB2 B;  1JF0 A;  2ISD A;  1YX7 A;  2M7L A;  1QXP A;  1EH2 A;  1M46 A;  3SG7 A;  3KEV A;  4I5J A;  1L7Z A;  2WOS A;  3EVU A;  2NCO A;  3VGO A;  5HLO A;  2M0R A;  5B8I B;  2BBM A;  2H2K A;  4MZL A;  4XYN A;  3SG4 A;  1N2D A;  5DKR A;  4A4B A;  1F71 A;  2ZND A;  1EG4 A;  3PFV A;  5D7F A;  3IQQ A;  4AOM A;  2LV7 A;  2K2F A;  3IF7 A;  2LLT A;  1KK8 B;  4GFT A;  1S5G Z;  1EL4 A;  1PAL A;  1G8I A;  3O4Y A;  4GAO A;  2NCP A;  4I5K A;  3TDU A;  1KSO A;  1SK6 D;  3QRX A;  2SAS A;  4P2Y B;  4F0Z B;  3LK0 A;  1BOD A;  1RK9 A;  2WCB A;  1KWO C;  1L2O B;  2BCA A;  2K7C A;  3I5I B;  4GNK B;  4PDZ A;  2KAY A;  1BG1 A;  1CMG A;  5JJG A;  2JT3 A;  4MSP A;  1OMD A;  4YI9 A;  4OKH A;  3D0Y B;  1KQM C;  5ER4 X;  2LMU A;  1ALV A;  1JWD A;  1DJX A;  1QV1 A;  1S36 A;  1TOP A;  4L9M A;  5DKN A;  4MVF A;  3A8R A;  1Q80 A;  1FPW A;  4ORB B;  2OS8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...