2CXJA

3d solution structure of s100a13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 calcium-binding protein A13
publication title Three-Dimensional Solution Structure of S100A13
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 19
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2cxjA00
3OP0A 1LXFC 2IS9A 1S5GY 1A03A 1KK8C 2L98A 3VRNA 1RROA 2ZN8A 2ZNEA 2K0JA 5AXIA 1IKUA 3HX4A 2KSPA 1K95A 4DUQA 1L2OC 5CSFA 2M9GA 1J55A 2CCMA 2WORA 2L4HA 4OV2A 1MUXA 2VRGA 1OMVA 2OS8C 1WLMA 3BUNB 1V1FA 5GQQC 1F71A 4P2YB 2BCBA 4WRIA 1C7VA 2KQ6A 3PALA 1QASA 4C0KA 2GGZA 2ZNDA 2WCFA 3DD4A 1JC2A 1J1DA 4FTGA 1BLQA 4YBHB 3JTDB 3RM1A 1S6CA 4XJKB 1UP5A 2I7AA 1SY9A 1UHIA 1NX0A 2K8MB 2KYCA 1TIZA 2G9BA 2KI4B 4NDDA 3BUMB 4CIDA 1DJHA 2M1KB 1CLMA 2I18A 3FWBA 3OHMB 4BY4A 5ER5A 4MZKA 3JVTB 1HQVA 3I5FB 1ZACA 2Y4QA 1QV0A 2LANA 1EH2A 3A4UB 1NWDA 3NSOA 1U5IB 2JNFA 2Y1NA 3CS1A 1KFXL 3LK0A 5F6TA 2M7LA 3OB1B 5JJGA 1DT7B 1QIWA 3SG4A 1YUUA 1IJ5A 1RK9A 1KK8B 4L9MA 4YI8A 2LP3A 1EJ3A 3HCMA 2B1UA 1YRTB 2P6BB 1WRKA 1A29A 3EKJA 1CDMA 4BY5A 1CLBA 2Q4UA 3NXAA 2AAOA 2K2AA 3PATA 1YRUB 2HETA 2KI6C 2KFFA 1WY9A 1H4BA 4ZCVA 4F0ZB 2PVBA 3BYAA 1UHHA 1K8UA 5HLOA 5DKNA 1OMRA 1CM1A 3KEVA 3LL8B 3PN7C 3PSRA 1KQVA 2PSRA 2JOJA 3FIAA 4C0LA 3EK4A 1FBVA 1WLZA 1WDCC 2LC5A 2WNDA 3MSEB 3BQ3A 1SL7A 1AJ5A 2WOSA 4CPVA 4YGBB 3VGOA 3KO0A 1S6IA 1LINA 1XFYO 2BKHB 2D8NA 1TRFA 2Q91A 4ORAB 3CGAA 3DVMA 4A4BA 2H61C 4CFQA 3IF7A 3AAJA 1MR8A 4IL1A 4HREE 2NCPA 1FI6A 1JUOA 1B47A 1MF8B 3WXAA 3BOWB 2Y5IA 2LUCA 1NSHA 2ZFDA 5B8IB 5CPVA 1DJZA 3SIBA 1XO5A 1ALWA 1TTXA 3GK2A 2E30A 1B9AA 2LLSA 1XFUO 3TZ1A 2KQYA 3D10A 2G2BA 3RLZA 2OTGB 2KYFA 1KFUS 1DJYA 1K9PA 1W7JB 5I2LA 1M31A 4DS7A 1B8RA 1J7QA 2JT8A 1BU3A 1SRAA 1DVIA 1N65A 1X02A 4N1FA 5KSZA 1K96A 2KDHA 4OR9B 2FCEA 2MLEC 3NSLA 1IGVA 1CMFA 3TUYC 1M46A 1PULA 4FQOA 1IRJA 2KBIA 3NSKA 5G08A 2A4JA 3TS5B 1F55A 2JTTA 2COLB 4GGNA 1CKKA 3SG2A 1YTZC 4OCIA 1PK0D 4DIRA 1QVIY 1JF2A 2F8PA 3VRPA 2EC6B 2CT9A 1CB1A 1B8CA 1F4OA 3CZTX 2F2OA 2KOTA 4A4CA 3PM8A 5KU1A 1M39A 4XJKA 2CTNA 1BR4B 2OPOA 1SCMC 3AAKA 1DJXA 2L51A 3OB2B 2M8UA 1FF1A 1KFUL 2PALA 1LA0A 2PASA 1K94A 3BUXB 4USLA 2TN4A 1PALA 4PE7A 2LUXA 3FWCA 1BT6A 1SCVA 5J3XA 1JBAA 4I5LB 1WRZA 1K90D 1XK4A 4MLWA 1ODBA 2AUCA 3VROA 2K7CA 3O2PA 1JFKA 3DVKA 1Y1UA 4E68A 3TDUA 2M3WA 4NDBA 5I2OA 1K93D 1TCOB 1YVLA 3BXKA 1XFWO 1KWOB 4NDCA 1NCYA 3E3RA 3ZNIA 2K7BA 2WCEA 1TNQA 1CFPA 1OSAA 3EVRA 1DJGA 4AQIA 2LHLA 1DF0B 1SPYA 1VRKA 2SASA 3KHEA 1W7IB 2JULA 4C0JA 1SK6D 1MHOA 5AERA 1IH0A 1G4YR 1K2HA 1FI5A 5K89A 2CNPA 4WQ3A 3GK1A 1SKTA 2MAZA 2LVKA 1JFJA 1QS7A 1GGZA 4PE0A 1G33A 2JU0A 3VRQA 1RFJA 4I5KA 4PHKA 2LNKA 5IBWA 5KTYA 1NX3A 1GJYA 1A75B 4GNKB 1FW4A 2KAVA 2ZKMX 1QX2A 2CBLA 3CTNA 5CSJA 1Y0VH 1L2OB 1A4PA 2BL0C 2FCDA 1SBJA 2KHNA 2LE9B 2LMUA 1NP8A 4NQGA 1SCMB 5TNCA 4XYNA 1PSBA 1KK7Z 2OS8B 1XA5A 3DF0B 4GBAA 3CR2A 1R2UA 1QV1A 3SJSA 2M49B 1HT9A 1CDNA 1MQ1A 1AP4A 4GFTA 1OZSA 1QJTA 3WHUB 2EHBA 2LVIA 2NCOA 1CMGA 2M0RA 2PMYA 1DJWA 1JSAA 1BOCA 1J1EA 4M2OA 2KBMA 3C1VA 4JWQA 1YX7A 2ISDA 4DCKA 2BBMA 1AVSA 1S6JA 1UURA 1C07A 4P5OE 2AMIA 1QTXA 1UHNA 5JOLA 2O5GA 4HRGA 4GPLB 5HKWA 1S3PA 1RECA 2BE6A 3GOFA 2MRDA 1BJFA 1BR1B 1Q80A 1SW8A 3I5GC 4GGFA 4HRHA 4PE4A 2K61A 1YR5A 4ETOA 2KNEA 2L2EA 4ORBB 1IQ5A 1KQMC 3CR5X 1XFVO 2L4IA 4WQ2A 1YURA 1YUSA 2F33A 4JQ0D 1TN4A 4YGDB 3M0WA 2K7DA 3GK4X 3EK8A 1LVCD 4PCWA 3O6BA 1S5GZ 1K9UA 3IQQA 3OX6A 5I2QA 3SG7A 2HF5A 2M97A 2BL0B 3CR4X 4PHJA 1V1GA 1ALVA 3WNXB 1RWYA 4N5XA 4M2PA 1M45A 2JZIA 4QJ3B 4YGAA 1B4CA 1PVBA 1UWOA 1CM4A 3PFVA 2H61A 2KFHA 1XFXO 4U8DA 1J7OA 1NYAA 1KK7Y 1TNWA 2V53A 2LAPA 2ZRSA 1Y1AA 3PN7B 2WCBA 2E6WA 3SIAA 4YI9A 1CTRA 3KPXA 1ZFSA 2F3YA 1Y6WA 4TNCA 4MSPA 4MBEA 2KGBC 1WDCB 1SL8A 2KFGA 2K2FA 5AANA 4PHNA 2KAXA 3QRXA 1DJIA 1IG5A 4ZCUA 1OE9B 3JTDC 1CNPA 1DMOA 2RGIA 3I5GB 2LMTA 1TCFA 3AKAA 1AHRA 1CFDA 2LLUA 2BE4A 1AJ4A 1KQMB 1QLSA 3BUWB 3D0YB 2CXJA 2R2IA 1QLKA 5I8NA 2LVJA 1GQMA 3F45A 1SL9A 1B7TZ 1DF0A 1JWDA 3JVTC 2HQWA 3O78A 4MRXA 2I94A 1NUBA 2ZRTA 5BPJA 3I5FC 4ICBA 1NCXA 3OX5A 2LP2A 1XK4C 2EGDA 1QX7A 2LMVA 2ZN9A 1JF0A 2Y1MA 2M1UA 3BUOB 2MHHA 4QJ5B 1U5IA 1F4QA 1XFZO 2LCPA 2LLTA 1PRWA 1EG4A 2DOQA 2JXLA 3SG5A 1A75A 3PLFB 4OKHA 3EKHA 2GV5A 1YX8A 4UPGA 1Y1XA 1IQ3A 1F8HA 1KFXS 1S1EA 1RTP1 1TNPA 1KSOA 2MJWB 4M2QA 4QJ4B 3TUYB 2F3ZA 3DF0A 3IQOA 2NZ0A 4PALA 2SCPA 1MXLC 1SYMA 1BG1A 2M7NA 1D1OA 4GAOA 4MRYA 2K7OA 4MZLA 3LK1A 2H2KA 2JRFA 1OQPA 1CFCA 4PHMA 3KF9A 2JT3A 4AOMA 1H8BA 1MWNA 2WC8A 4OVNF 2BCAA 4JPZB 4N1GA 1CFFA 4I5NB 1EG3A 5D69A 1QIVA 2BKIB 2MA2A 3CLNA 3ZWHA 1QATA 1BF5A 3DVJA 3AKBA 1UHJA 2F2PA 1F70A 2KI6D 1QX5B 2JC2A 3EK7A 4I5JA 2FJUB 1A2XA 1B7TY 2JXCA 2O60A 1ZMZA 2JQ6A 2JWWA 3CWGA 3FS7A 3BOWA 1DTLA 3I5IC 1M63B 1YVHA 3VRRA 2HQ8A 1FPWA 2JNXA 2L50A 3A8RA 3TDZA 1SMGA 1RJVA 1C7WA 1MXEA 1CLLA 1NX1A 2FOTA 4PE1A 1OMDA 1NX2A 4CFRA 2OTGC 3LLEA 1XYDA 4PDZA 4GGFC 5FYXA 1WRLA 1CDPA 4MN0A 1SR6C 2KGRA 3SG6A 3SG3A 1SNLA 2BCXA 3I5HC 1UUSA 4MZJA 2HPSA 4CLNA 1IWQA 1IJ6A 2QPTA 5AFPA 4MEWA 3DVEA 5HKZA 5PALA 1AK8A 3H4SE 1QVIZ 1G8IA 3O4YA 3TS5C 1LA3A 2KAYA 1DGVA 1TOPA 3TDIA 2M29A 4ORCB 1KCYA 1J7RA 2BBNA 3EVVA 2LHIA 3EVUA 2JTZA 1L7ZA 1OOJA 2PRUA 2LVVA 1B8LA 1EL4A 1LKJA 3NSIA 2EC6C 1N0YA 5AEQA 1DGUA 4DRWA 4YGEB 4Q04A 2MLFC 1R6PA 1B1GA 1PVAA 1NPQA 5CSNA 3D0YA 5DKRA 1TNXA 1F54A 1CDLA 1NCZA 3WHTB 4HSZA 3I5IB 2NLNA 2BECA 5ER4X 1OZOA 1XVJA 1YUTA 4YGCB 2JT0A 2L0PA 2NXQA 2GGMA 1NIWA 4YRUA 1N2DA 1K9KA 1GGWA 1KSMA 4GUKA 2I2RE 1SR6B 5HLVA 5HKYA 5HYDA 1KWOC 2LM5A 1AUIB 5D7FA 1J7PA 3I5HB 4D1EA 5DKQA 3LCPC 2KI4C 3ICBA 1S26D 2QACA 1E8AA 3K21A 1BODA 4R1EA 1ZOTB 2L5XB 4MVFA 1BMOA 1UHKA 1S36A 2LV7A 1QXPA 1PSRA 4AQJA 5CSIA 2JPTA 1EXRA 1ZUZA 2MBXA
chains in the Genus database with same CATH superfamily
3OP0A 1LXFC 2IS9A 1S5GY 3NHTA 1A03A 1KK8C 2L98A 3VRNA 1RROA 2ZN8A 2ZNEA 2K0JA 5AXIA 1IKUA 3HX4A 2KSPA 1K95A 4DUQA 1L2OC 5CSFA 2M9GA 1J55A 2CCMA 2WORA 2L4HA 5FI2A 4OV2A 1MUXA 2VRGA 1OMVA 2OS8C 1T14A 1WLMA 3BUNB 3SS3A 1V1FA 5GQQC 1F71A 4P2YB 2BCBA 4WRIA 1C7VA 2KQ6A 3PALA 1QASA 4C0KA 2GGZA 2ZNDA 2WCFA 3DD4A 3N7HA 1JC2A 1J1DA 4FTGA 2KLEA 1BLQA 4YBHB 3JTDB 3BJHA 3RM1A 1S6CA 4XJKB 1UP5A 2I7AA 3R72A 2FJYA 1SY9A 1UHIA 1NX0A 2K8MB 2KYCA 2WCMA 1TIZA 2G9BA 2KI4B 4NDDA 3BUMB 4CIDA 1DJHA 2M1KB 1CLMA 2I18A 3FWBA 3OHMB 4BY4A 5ER5A 2WC5A 4MZKA 3JVTB 1HQVA 3I5FB 1ZACA 2Y4QA 1QV0A 2LANA 1EH2A 3A4UB 1NWDA 3NSOA 3R1VA 3V2LA 1U5IB 2JNFA 2Y1NA 3CS1A 1KFXL 3LK0A 5F6TA 2M7LA 3OB1B 5JJGA 1DT7B 1QIWA 1TWOA 3SG4A 1YUUA 3UNWA 1IJ5A 1RK9A 1KK8B 4L9MA 4YI8A 3D77A 2LP3A 3BFBA 1EJ3A 3HCMA 2B1UA 1YRTB 5DICA 2P6BB 1W9ZA 1A29A 1WRKA 1CDMA 3EKJA 4BY5A 1CLBA 2Q4UA 3NXAA 2AAOA 2K2AA 3PATA 1OOFA 1YRUB 2HETA 2KI6C 2JPOA 2KFFA 1WY9A 2BNXA 2GTEA 2WC6A 1H4BA 3S0GA 4ZCVA 5D3OA 2PVBA 4F0ZB 3BYAA 1UHHA 2P71A 1K8UA 5HLOA 5DKNA 1OMRA 1CM1A 3KEVA 3B87A 3LL8B 3PN7C 3PSRA 1KQVA 2PSRA 3CABA 2JOJA 3FIAA 3B88A 4C0LA 3EK4A 3K1EA 1FBVA 3CZ1A 1WLZA 1WDCC 2LC5A 2WNDA 3MSEB 1Z2CB 3BQ3A 3S0FA 1SL7A 1AJ5A 2WOSA 4CPVA 4YGBB 3VGOA 3KO0A 1S6IA 1LINA 1XFYO 2BKHB 2D8NA 1TRFA 2ERBA 2Q91A 3CGAA 3DVMA 4ORAB 2H61C 4PT1A 3UO9A 3IF7A 3AAJA 1MR8A 4IL1A 4HREE 2NCPA 1FI6A 3CDNA 1JUOA 1B47A 4INWA 1MF8B 3WXAA 3BOWB 1C3ZA 2Y5IA 2LUCA 1OW4A 1NSHA 2ZFDA 5B8IB 5CPVA 1DJZA 3SIBA 1XO5A 1ALWA 1TTXA 3GK2A 3R1PA 5FI6A 2E30A 1B9AA 3O4XA 1ORGA 2LLSA 1XFUO 3TZ1A 3CZ0A 2KQYA 3D10A 2G2BA 3RLZA 2OTGB 2KYFA 1KFUS 1DJYA 1K9PA 1W7JB 5I2LA 1M31A 4DS7A 1B8RA 1J7QA 2JT8A 1BU3A 1SRAA 1DVIA 1N65A 1X02A 4N1FA 5KSZA 3B6XA 1K96A 2KDHA 3BFHA 4OR9B 2FCEA 3D78A 3S0EA 4JKTA 2MLEC 3NSLA 1IGVA 1CMFA 3TUYC 1M46A 1PULA 4FQOA 1IRJA 2KBIA 3NSKA 5G08A 2A4JA 3TS5B 1F55A 2JTTA 2COLB 4GGNA 1CKKA 3SG2A 1YTZC 4OCIA 1PK0D 4DIRA 1QVIY 1JF2A 2F8PA 3VRPA 2EC6B 2CT9A 1CB1A 1B8CA 1F4OA 3CZTX 2F2OA 2KOTA 4A4CA 3PM8A 5KU1A 1M39A 4XJKA 2CTNA 1BR4B 2OPOA 1SCMC 3AAKA 1DJXA 2L51A 3OB2B 2M8UA 1FF1A 3DXLA 1KFUL 2QEBA 2PALA 1LA0A 2PASA 1K94A 1OOIX 3BUXB 2L2CA 4USLA 2TN4A 1PALA 4PE7A 2LUXA 3FWCA 1BT6A 1SCVA 5J3XA 3S0AA 1JBAA 4I5LB 1WRZA 1K90D 1XK4A 4MLWA 2KPHA 1ODBA 2AUCA 3VROA 2K7CA 3O2PA 1XFRA 1JFKA 3DVKA 1Y1UA 4E68A 3TDUA 2M3WA 4NDBA 5I2OA 3Q8IA 1K93D 1TCOB 1YVLA 3BXKA 1XFWO 1KWOB 4NDCA 1NCYA 3E3RA 3L4LA 2K7BA 2WCEA 3ZNIA 1TNQA 1CFPA 1OSAA 3EVRA 1DJGA 4AQIA 2LHLA 1DF0B 1SPYA 1VRKA 2SASA 3KHEA 1W7IB 2JULA 4C0JA 1SK6D 3CYZA 1MHOA 5AERA 1IH0A 1G4YR 2KLDA 2PYQA 1K2HA 1FI5A 1DEKA 1SSEB 3DYEA 3OBVA 5K89A 2CNPA 4WQ3A 3GK1A 3L47A 1SKTA 2MAZA 2LVKA 1JFJA 1QS7A 1GGZA 4PE0A 1G33A 2JU0A 3VRQA 1RFJA 4I5KA 4PHKA 2LNKA 2WCKA 5IBWA 3NGVA 5KTYA 1NX3A 1GJYA 1A75B 4GNKB 1FW4A 2KAVA 2ZKMX 1QX2A 2CBLA 3CTNA 5CSJA 1Y0VH 1L2OB 1A4PA 2BL0C 2FCDA 1SBJA 2KHNA 2LE9B 2LMUA 1NP8A 4NQGA 1SCMB 5TNCA 4XYNA 1PSBA 1KK7Z 2OS8B 1XA5A 3DF0B 4GBAA 3CR2A 1R2UA 1QV1A 3SJSA 2M49B 1HT9A 1CDNA 1MQ1A 1AP4A 4GFTA 1OZSA 1QJTA 1LS8A 3WHUB 2EHBA 2LVIA 2NCOA 1CMGA 4JD9A 2M0RA 2PMYA 1DJWA 1JSAA 1BOCA 1J1EA 4M2OA 2KBMA 3C1VA 4JWQA 1YX7A 2ISDA 4DCKA 2BBMA 1AVSA 1S6JA 3IVTA 1UURA 1C07A 4P5OE 3D74A 2AMIA 1QTXA 1UHNA 5JOLA 2QEHA 2O5GA 2QEOA 4HRGA 4GPLB 5HKWA 1DC1A 1S3PA 1RECA 2BE6A 3GOFA 2MRDA 1BJFA 1BR1B 1Q80A 1SW8A 3I5GC 4GGFA 4HRHA 4PE4A 2K61A 1YR5A 4ETOA 2KNEA 2L2EA 4ORBB 1IQ5A 1KQMC 3CR5X 1XFVO 2L4IA 4WQ2A 1YURA 1YUSA 2F33A 4JQ0D 1TN4A 4YGDB 3M0WA 3PM2A 3RZSA 2K7DA 3GK4X 5HL1A 3EK8A 1LVCD 4PCWA 3O6BA 1S5GZ 2K60A 3FE9A 1K9UA 3IQQA 3OX6A 5I2QA 3SG7A 2HF5A 2M97A 2BL0B 2WCHA 3CR4X 3B86A 1V1GA 4OZDA 1ALVA 4PHJA 3WNXB 1RWYA 4N5XA 4M2PA 1M45A 2JZIA 3L4AA 4QJ3B 4YGAA 3CZ2A 1B4CA 1PVBA 3FE6A 1UWOA 1CM4A 3PFVA 2H61A 4A4BA 2KFHA 1XFXO 3S0DA 4U8DA 1J7OA 1NYAA 1KK7Y 1TNWA 2V53A 2LAPA 2ZRSA 3B7AA 1Y1AA 3PN7B 2WCBA 2E6WA 3SIAA 4YI9A 1CTRA 3KPXA 1ZFSA 2F3YA 1Y6WA 4TNCA 4MSPA 4MBEA 2KGBC 3OGNA 1WDCB 1SL8A 2KFGA 2K2FA 5AANA 4PHNA 2KAXA 3QRXA 1DJIA 1IG5A 4ZCUA 1OE9B 3SS5A 3JTDC 1CNPA 1DMOA 2RGIA 3I5GB 2LMTA 1TCFA 2L5YA 3AKAA 1AHRA 1CFDA 2LLUA 2BE4A 1AJ4A 1KQMB 1QLSA 3BUWB 3D0YB 2CXJA 2R2IA 1QLKA 3DY9A 4CFQA 5I8NA 4F7FA 2LVJA 1GQMA 3F45A 1SL9A 1B7TZ 1DF0A 1JWDA 3JVTC 2HQWA 3O78A 4MRXA 2I94A 1NUBA 2ZRTA 5BPJA 3I5FC 4ICBA 1NCXA 3OX5A 1C3YA 2LP2A 1XK4C 2EGDA 1QX7A 2LMVA 2ZN9A 1JF0A 2Y1MA 2M1UA 3BUOB 2MHHA 3S0BA 4QJ5B 1U5IA 3SS4A 3DZTA 1F4QA 1XFZO 2LCPA 2LLTA 1PRWA 1EG4A 2DOQA 2JXLA 3SG5A 2QEVA 2WCJA 1A75A 3PLFB 4OKHA 3EKHA 2GV5A 1YX8A 4UPGA 1Y1XA 1IQ3A 1F8HA 1KFXS 1S1EA 1RTP1 1TNPA 1KSOA 2MJWB 4M2QA 4QJ4B 3TUYB 2F3ZA 3NHIA 3DF0A 3IQOA 2NZ0A 4PALA 2SCPA 1MXLC 4IJ7A 1SYMA 1BG1A 2M7NA 2WCLA 1D1OA 4GAOA 3EG5B 4MRYA 2K7OA 4MZLA 3LK1A 2H2KA 2JRFA 1OQPA 1CFCA 4PHMA 3KF9A 2JT3A 4AOMA 1H8BA 1QWVA 3PJIA 1MWNA 2WC8A 4OVNF 2BCAA 4JPZB 4N1GA 1CFFA 4I5NB 1EG3A 5D69A 1QIVA 2BKIB 2MA2A 3CLNA 3ZWHA 1DELA 3D75A 1QATA 1BF5A 3DVJA 3AKBA 1UHJA 2F2PA 1F70A 2KI6D 1QX5B 2JC2A 2YGUA 3EK7A 4I5JA 2FJUB 5FI7A 1TUZA 1A2XA 1B7TY 2JXCA 2O60A 1ZMZA 2JQ6A 2JWWA 3CWGA 3FS7A 2PQLA 3BOWA 1DTLA 4FQTA 3I5IC 1M63B 1YVHA 3VRRA 2HQ8A 1FPWA 2JNXA 2L50A 3A8RA 3TDZA 5I94A 1SMGA 1RJVA 1C7WA 1MXEA 1CLLA 1NX1A 2FOTA 4PE1A 1OMDA 1NX2A 4CFRA 2P70A 2OTGC 3LLEA 1XYDA 4PDZA 4GGFC 5FYXA 1WRLA 3VB1A 1CDPA 4MN0A 4KYNA 1SR6C 2KGRA 3SG6A 1IIOA 3SG3A 1SNLA 2BCXA 3I5HC 1UUSA 4MZJA 2HPSA 4CLNA 1IWQA 1GM0A 1IJ6A 2QPTA 5AFPA 3D76A 3DVEA 4MEWA 5HKZA 5PALA 1AK8A 3H4SE 2QDIA 1QVIZ 1G8IA 5EL2A 3O4YA 3TS5C 1LA3A 2KAYA 1DGVA 1TOPA 3R1OA 2M29A 3TDIA 4ORCB 3QMEA 1KCYA 1J7RA 2BBNA 3EVVA 2LHIA 3EVUA 2JTZA 1L7ZA 1OOJA 1P28A 2PRUA 2LVVA 1B8LA 1EL4A 1LKJA 3NSIA 2EC6C 1OOHA 1N0YA 5AEQA 1DGUA 4DRWA 4YGEB 4Q04A 1Z4HA 2MLFC 1R6PA 1B1GA 1PVAA 1NPQA 5CSNA 3D0YA 5DKRA 1TNXA 1F54A 1OOGA 1CDLA 1NCZA 3WHTB 1DQEA 4HSZA 2BAPA 3D73A 3I5IB 2NLNA 2BECA 4INXA 5ER4X 1OZOA 1XVJA 1YUTA 4YGCB 2JT0A 2L0PA 2NXQA 3BFAA 2GGMA 1NIWA 4YRUA 1N2DA 1K9KA 1GGWA 1KSMA 4GUKA 2I2RE 1SR6B 5HLVA 5HKYA 5HYDA 1KWOC 2LM5A 1AUIB 5D7FA 1J7PA 3I5HB 4D1EA 5DKQA 2H8VA 3LCPC 2KI4C 3ICBA 1S26D 2QACA 1E8AA 3K21A 1BODA 3FE8A 4R1EA 1ZOTB 2L5XB 4MVFA 1BMOA 1UHKA 1S36A 2LV7A 1QXPA 1PSRA 4AQJA 5CSIA 1TUJA 2JPTA 1EXRA 1ZUZA 2MBXA
chains in the Genus database with same CATH topology
3OP0A 1LXFC 2IS9A 1S5GY 1A03A 1KK8C 2L98A 3VRNA 1RROA 2ZN8A 2ZNEA 2K0JA 5AXIA 1IKUA 3HX4A 2KSPA 1K95A 4DUQA 1L2OC 5CSFA 2M9GA 1J55A 2CCMA 2WORA 2L4HA 4OV2A 1MUXA 2VRGA 1OMVA 2OS8C 1WLMA 3BUNB 1V1FA 5GQQC 1F71A 4P2YB 2BCBA 4WRIA 1C7VA 2KQ6A 3PALA 1QASA 4C0KA 2GGZA 2ZNDA 2WCFA 3DD4A 1JC2A 1J1DA 4FTGA 1BLQA 4YBHB 3JTDB 3RM1A 1S6CA 4XJKB 1UP5A 2I7AA 1SY9A 1UHIA 1NX0A 2K8MB 2KYCA 1TIZA 2G9BA 2KI4B 4NDDA 3BUMB 4CIDA 1DJHA 2M1KB 1CLMA 2I18A 3FWBA 3OHMB 4BY4A 5ER5A 4MZKA 3JVTB 1HQVA 3I5FB 1ZACA 2Y4QA 1QV0A 2LANA 1EH2A 3A4UB 1NWDA 3NSOA 1U5IB 2JNFA 2Y1NA 3CS1A 1KFXL 3LK0A 5F6TA 2M7LA 3OB1B 5JJGA 1DT7B 1QIWA 3SG4A 1YUUA 1IJ5A 1RK9A 1KK8B 4L9MA 4YI8A 2LP3A 1EJ3A 3HCMA 2B1UA 1YRTB 2P6BB 1WRKA 1A29A 3EKJA 1CDMA 4BY5A 1CLBA 2Q4UA 3NXAA 2AAOA 2K2AA 3PATA 1YRUB 2HETA 2KI6C 2KFFA 1WY9A 1H4BA 4ZCVA 4F0ZB 2PVBA 3BYAA 1UHHA 1K8UA 5HLOA 5DKNA 1OMRA 1CM1A 3KEVA 3LL8B 3PN7C 3PSRA 1KQVA 2PSRA 2JOJA 3FIAA 4C0LA 3EK4A 1FBVA 1WLZA 1WDCC 2LC5A 2WNDA 3MSEB 3BQ3A 1SL7A 1AJ5A 2WOSA 4CPVA 4YGBB 3VGOA 3KO0A 1S6IA 1LINA 1XFYO 2BKHB 2D8NA 1TRFA 2Q91A 4ORAB 3CGAA 3DVMA 4A4BA 2H61C 4CFQA 3IF7A 3AAJA 1MR8A 4IL1A 4HREE 2NCPA 1FI6A 1JUOA 1B47A 1MF8B 3WXAA 3BOWB 2Y5IA 2LUCA 1NSHA 2ZFDA 5B8IB 5CPVA 1DJZA 3SIBA 1XO5A 1ALWA 1TTXA 3GK2A 2E30A 1B9AA 2LLSA 1XFUO 3TZ1A 2KQYA 3D10A 2G2BA 3RLZA 2OTGB 2KYFA 1KFUS 1DJYA 1K9PA 1W7JB 5I2LA 1M31A 4DS7A 1B8RA 1J7QA 2JT8A 1BU3A 1SRAA 1DVIA 1N65A 1X02A 4N1FA 5KSZA 1K96A 2KDHA 4OR9B 2FCEA 2MLEC 3NSLA 1IGVA 1CMFA 3TUYC 1M46A 1PULA 4FQOA 1IRJA 2KBIA 3NSKA 5G08A 2A4JA 3TS5B 1F55A 2JTTA 2COLB 4GGNA 1CKKA 3SG2A 1YTZC 4OCIA 1PK0D 4DIRA 1QVIY 1JF2A 2F8PA 3VRPA 2EC6B 2CT9A 1CB1A 1B8CA 1F4OA 3CZTX 2F2OA 2KOTA 4A4CA 3PM8A 5KU1A 1M39A 4XJKA 2CTNA 1BR4B 2OPOA 1SCMC 3AAKA 1DJXA 2L51A 3OB2B 2M8UA 1FF1A 1KFUL 2PALA 1LA0A 2PASA 1K94A 3BUXB 4USLA 2TN4A 1PALA 4PE7A 2LUXA 3FWCA 1BT6A 1SCVA 5J3XA 1JBAA 4I5LB 1WRZA 1K90D 1XK4A 4MLWA 1ODBA 2AUCA 3VROA 2K7CA 3O2PA 1JFKA 3DVKA 1Y1UA 4E68A 3TDUA 2M3WA 4NDBA 5I2OA 1K93D 1TCOB 1YVLA 3BXKA 1XFWO 1KWOB 4NDCA 1NCYA 3E3RA 3ZNIA 2K7BA 2WCEA 1TNQA 1CFPA 1OSAA 3EVRA 1DJGA 4AQIA 2LHLA 1DF0B 1SPYA 1VRKA 2SASA 3KHEA 1W7IB 2JULA 4C0JA 1SK6D 1MHOA 5AERA 1IH0A 1G4YR 1K2HA 1FI5A 5K89A 2CNPA 4WQ3A 3GK1A 1SKTA 2MAZA 2LVKA 1JFJA 1QS7A 1GGZA 4PE0A 1G33A 2JU0A 3VRQA 1RFJA 4I5KA 4PHKA 2LNKA 5IBWA 5KTYA 1NX3A 1GJYA 1A75B 4GNKB 1FW4A 2KAVA 2ZKMX 1QX2A 2CBLA 3CTNA 5CSJA 1Y0VH 1L2OB 1A4PA 2BL0C 2FCDA 1SBJA 2KHNA 2LE9B 2LMUA 1NP8A 4NQGA 1SCMB 5TNCA 4XYNA 1PSBA 1KK7Z 2OS8B 1XA5A 3DF0B 4GBAA 3CR2A 1R2UA 1QV1A 3SJSA 2M49B 1HT9A 1CDNA 1MQ1A 1AP4A 4GFTA 1OZSA 1QJTA 3WHUB 2EHBA 2LVIA 2NCOA 1CMGA 2M0RA 2PMYA 1DJWA 1JSAA 1BOCA 1J1EA 4M2OA 2KBMA 3C1VA 4JWQA 1YX7A 2ISDA 4DCKA 2BBMA 1AVSA 1S6JA 1UURA 1C07A 4P5OE 2AMIA 1QTXA 1UHNA 5JOLA 2O5GA 4HRGA 4GPLB 5HKWA 1S3PA 1RECA 2BE6A 3GOFA 2MRDA 1BJFA 1BR1B 1Q80A 1SW8A 3I5GC 4GGFA 4HRHA 4PE4A 2K61A 1YR5A 4ETOA 2KNEA 2L2EA 4ORBB 1IQ5A 1KQMC 3CR5X 1XFVO 2L4IA 4WQ2A 1YURA 1YUSA 2F33A 4JQ0D 1TN4A 4YGDB 3M0WA 2K7DA 3GK4X 3EK8A 1LVCD 4PCWA 3O6BA 1S5GZ 1K9UA 3IQQA 3OX6A 5I2QA 3SG7A 2HF5A 2M97A 2BL0B 3CR4X 4PHJA 1V1GA 1ALVA 3WNXB 1RWYA 4N5XA 4M2PA 1M45A 2JZIA 4QJ3B 4YGAA 1B4CA 1PVBA 1UWOA 1CM4A 3PFVA 2H61A 2KFHA 1XFXO 4U8DA 1J7OA 1NYAA 1KK7Y 1TNWA 2V53A 2LAPA 2ZRSA 1Y1AA 3PN7B 2WCBA 2E6WA 3SIAA 4YI9A 1CTRA 3KPXA 1ZFSA 2F3YA 1Y6WA 4TNCA 4MSPA 4MBEA 2KGBC 1WDCB 1SL8A 2KFGA 2K2FA 5AANA 4PHNA 2KAXA 3QRXA 1DJIA 1IG5A 4ZCUA 1OE9B 3JTDC 1CNPA 1DMOA 2RGIA 3I5GB 2LMTA 1TCFA 3AKAA 1AHRA 1CFDA 2LLUA 2BE4A 1AJ4A 1KQMB 1QLSA 3BUWB 3D0YB 2CXJA 2R2IA 1QLKA 5I8NA 2LVJA 1GQMA 3F45A 1SL9A 1B7TZ 1DF0A 1JWDA 3JVTC 2HQWA 3O78A 4MRXA 2I94A 1NUBA 2ZRTA 5BPJA 3I5FC 4ICBA 1NCXA 3OX5A 2LP2A 1XK4C 2EGDA 1QX7A 2LMVA 2ZN9A 1JF0A 2Y1MA 2M1UA 3BUOB 2MHHA 4QJ5B 1U5IA 1F4QA 1XFZO 2LCPA 2LLTA 1PRWA 1EG4A 2DOQA 2JXLA 3SG5A 1A75A 3PLFB 4OKHA 3EKHA 2GV5A 1YX8A 4UPGA 1Y1XA 1IQ3A 1F8HA 1KFXS 1S1EA 1RTP1 1TNPA 1KSOA 2MJWB 4M2QA 4QJ4B 3TUYB 2F3ZA 3DF0A 3IQOA 2NZ0A 4PALA 2SCPA 1MXLC 1SYMA 1BG1A 2M7NA 1D1OA 4GAOA 4MRYA 2K7OA 4MZLA 3LK1A 2H2KA 2JRFA 1OQPA 1CFCA 4PHMA 3KF9A 2JT3A 4AOMA 1H8BA 1MWNA 2WC8A 4OVNF 2BCAA 4JPZB 4N1GA 1CFFA 4I5NB 1EG3A 5D69A 1QIVA 2BKIB 2MA2A 3CLNA 3ZWHA 1QATA 1BF5A 3DVJA 3AKBA 1UHJA 2F2PA 1F70A 2KI6D 1QX5B 2JC2A 3EK7A 4I5JA 2FJUB 1A2XA 1B7TY 2JXCA 2O60A 1ZMZA 2JQ6A 2JWWA 3CWGA 3FS7A 3BOWA 1DTLA 3I5IC 1M63B 1YVHA 3VRRA 2HQ8A 1FPWA 2JNXA 2L50A 3A8RA 3TDZA 1SMGA 1RJVA 1C7WA 1MXEA 1CLLA 1NX1A 2FOTA 4PE1A 1OMDA 1NX2A 4CFRA 2OTGC 3LLEA 1XYDA 4PDZA 4GGFC 5FYXA 1WRLA 1CDPA 4MN0A 1SR6C 2KGRA 3SG6A 3SG3A 1SNLA 2BCXA 3I5HC 1UUSA 4MZJA 2HPSA 4CLNA 1IWQA 1IJ6A 2QPTA 5AFPA 4MEWA 3DVEA 5HKZA 5PALA 1AK8A 3H4SE 1QVIZ 1G8IA 3O4YA 3TS5C 1LA3A 2KAYA 1DGVA 1TOPA 3TDIA 2M29A 4ORCB 1KCYA 1J7RA 2BBNA 3EVVA 2LHIA 3EVUA 2JTZA 1L7ZA 1OOJA 2PRUA 2LVVA 1B8LA 1EL4A 1LKJA 3NSIA 2EC6C 1N0YA 5AEQA 1DGUA 4DRWA 4YGEB 4Q04A 2MLFC 1R6PA 1B1GA 1PVAA 1NPQA 5CSNA 3D0YA 5DKRA 1TNXA 1F54A 1CDLA 1NCZA 3WHTB 4HSZA 3I5IB 2NLNA 2BECA 5ER4X 1OZOA 1XVJA 1YUTA 4YGCB 2JT0A 2L0PA 2NXQA 2GGMA 1NIWA 4YRUA 1N2DA 1K9KA 1GGWA 1KSMA 4GUKA 2I2RE 1SR6B 5HLVA 5HKYA 5HYDA 1KWOC 2LM5A 1AUIB 5D7FA 1J7PA 3I5HB 4D1EA 5DKQA 3LCPC 2KI4C 3ICBA 1S26D 2QACA 1E8AA 3K21A 1BODA 4R1EA 1ZOTB 2L5XB 4MVFA 1BMOA 1UHKA 1S36A 2LV7A 1QXPA 1PSRA 4AQJA 5CSIA 2JPTA 1EXRA 1ZUZA 2MBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OP0 A;  1LXF C;  2IS9 A;  1S5G Y;  1A03 A;  1KK8 C;  2L98 A;  3VRN A;  1RRO A;  2ZN8 A;  2ZNE A;  2K0J A;  5AXI A;  1IKU A;  3HX4 A;  2KSP A;  1K95 A;  4DUQ A;  1L2O C;  5CSF A;  2M9G A;  1J55 A;  2CCM A;  2WOR A;  2L4H A;  4OV2 A;  1MUX A;  2VRG A;  1OMV A;  2OS8 C;  1WLM A;  3BUN B;  1V1F A;  5GQQ C;  1F71 A;  4P2Y B;  2BCB A;  4WRI A;  1C7V A;  2KQ6 A;  3PAL A;  1QAS A;  4C0K A;  2GGZ A;  2ZND A;  2WCF A;  3DD4 A;  1JC2 A;  1J1D A;  4FTG A;  1BLQ A;  4YBH B;  3JTD B;  3RM1 A;  1S6C A;  4XJK B;  1UP5 A;  2I7A A;  1SY9 A;  1UHI A;  1NX0 A;  2K8M B;  2KYC A;  1TIZ A;  2G9B A;  2KI4 B;  4NDD A;  3BUM B;  4CID A;  1DJH A;  2M1K B;  1CLM A;  2I18 A;  3FWB A;  3OHM B;  4BY4 A;  5ER5 A;  4MZK A;  3JVT B;  1HQV A;  3I5F B;  1ZAC A;  2Y4Q A;  1QV0 A;  2LAN A;  1EH2 A;  3A4U B;  1NWD A;  3NSO A;  1U5I B;  2JNF A;  2Y1N A;  3CS1 A;  1KFX L;  3LK0 A;  5F6T A;  2M7L A;  3OB1 B;  5JJG A;  1DT7 B;  1QIW A;  3SG4 A;  1YUU A;  1IJ5 A;  1RK9 A;  1KK8 B;  4L9M A;  4YI8 A;  2LP3 A;  1EJ3 A;  3HCM A;  2B1U A;  1YRT B;  2P6B B;  1WRK A;  1A29 A;  3EKJ A;  1CDM A;  4BY5 A;  1CLB A;  2Q4U A;  3NXA A;  2AAO A;  2K2A A;  3PAT A;  1YRU B;  2HET A;  2KI6 C;  2KFF A;  1WY9 A;  1H4B A;  4ZCV A;  4F0Z B;  2PVB A;  3BYA A;  1UHH A;  1K8U A;  5HLO A;  5DKN A;  1OMR A;  1CM1 A;  3KEV A;  3LL8 B;  3PN7 C;  3PSR A;  1KQV A;  2PSR A;  2JOJ A;  3FIA A;  4C0L A;  3EK4 A;  1FBV A;  1WLZ A;  1WDC C;  2LC5 A;  2WND A;  3MSE B;  3BQ3 A;  1SL7 A;  1AJ5 A;  2WOS A;  4CPV A;  4YGB B;  3VGO A;  3KO0 A;  1S6I A;  1LIN A;  1XFY O;  2BKH B;  2D8N A;  1TRF A;  2Q91 A;  4ORA B;  3CGA A;  3DVM A;  4A4B A;  2H61 C;  4CFQ A;  3IF7 A;  3AAJ A;  1MR8 A;  4IL1 A;  4HRE E;  2NCP A;  1FI6 A;  1JUO A;  1B47 A;  1MF8 B;  3WXA A;  3BOW B;  2Y5I A;  2LUC A;  1NSH A;  2ZFD A;  5B8I B;  5CPV A;  1DJZ A;  3SIB A;  1XO5 A;  1ALW A;  1TTX A;  3GK2 A;  2E30 A;  1B9A A;  2LLS A;  1XFU O;  3TZ1 A;  2KQY A;  3D10 A;  2G2B A;  3RLZ A;  2OTG B;  2KYF A;  1KFU S;  1DJY A;  1K9P A;  1W7J B;  5I2L A;  1M31 A;  4DS7 A;  1B8R A;  1J7Q A;  2JT8 A;  1BU3 A;  1SRA A;  1DVI A;  1N65 A;  1X02 A;  4N1F A;  5KSZ A;  1K96 A;  2KDH A;  4OR9 B;  2FCE A;  2MLE C;  3NSL A;  1IGV A;  1CMF A;  3TUY C;  1M46 A;  1PUL A;  4FQO A;  1IRJ A;  2KBI A;  3NSK A;  5G08 A;  2A4J A;  3TS5 B;  1F55 A;  2JTT A;  2COL B;  4GGN A;  1CKK A;  3SG2 A;  1YTZ C;  4OCI A;  1PK0 D;  4DIR A;  1QVI Y;  1JF2 A;  2F8P A;  3VRP A;  2EC6 B;  2CT9 A;  1CB1 A;  1B8C A;  1F4O A;  3CZT X;  2F2O A;  2KOT A;  4A4C A;  3PM8 A;  5KU1 A;  1M39 A;  4XJK A;  2CTN A;  1BR4 B;  2OPO A;  1SCM C;  3AAK A;  1DJX A;  2L51 A;  3OB2 B;  2M8U A;  1FF1 A;  1KFU L;  2PAL A;  1LA0 A;  2PAS A;  1K94 A;  3BUX B;  4USL A;  2TN4 A;  1PAL A;  4PE7 A;  2LUX A;  3FWC A;  1BT6 A;  1SCV A;  5J3X A;  1JBA A;  4I5L B;  1WRZ A;  1K90 D;  1XK4 A;  4MLW A;  1ODB A;  2AUC A;  3VRO A;  2K7C A;  3O2P A;  1JFK A;  3DVK A;  1Y1U A;  4E68 A;  3TDU A;  2M3W A;  4NDB A;  5I2O A;  1K93 D;  1TCO B;  1YVL A;  3BXK A;  1XFW O;  1KWO B;  4NDC A;  1NCY A;  3E3R A;  3ZNI A;  2K7B A;  2WCE A;  1TNQ A;  1CFP A;  1OSA A;  3EVR A;  1DJG A;  4AQI A;  2LHL A;  1DF0 B;  1SPY A;  1VRK A;  2SAS A;  3KHE A;  1W7I B;  2JUL A;  4C0J A;  1SK6 D;  1MHO A;  5AER A;  1IH0 A;  1G4Y R;  1K2H A;  1FI5 A;  5K89 A;  2CNP A;  4WQ3 A;  3GK1 A;  1SKT A;  2MAZ A;  2LVK A;  1JFJ A;  1QS7 A;  1GGZ A;  4PE0 A;  1G33 A;  2JU0 A;  3VRQ A;  1RFJ A;  4I5K A;  4PHK A;  2LNK A;  5IBW A;  5KTY A;  1NX3 A;  1GJY A;  1A75 B;  4GNK B;  1FW4 A;  2KAV A;  2ZKM X;  1QX2 A;  2CBL A;  3CTN A;  5CSJ A;  1Y0V H;  1L2O B;  1A4P A;  2BL0 C;  2FCD A;  1SBJ A;  2KHN A;  2LE9 B;  2LMU A;  1NP8 A;  4NQG A;  1SCM B;  5TNC A;  4XYN A;  1PSB A;  1KK7 Z;  2OS8 B;  1XA5 A;  3DF0 B;  4GBA A;  3CR2 A;  1R2U A;  1QV1 A;  3SJS A;  2M49 B;  1HT9 A;  1CDN A;  1MQ1 A;  1AP4 A;  4GFT A;  1OZS A;  1QJT A;  3WHU B;  2EHB A;  2LVI A;  2NCO A;  1CMG A;  2M0R A;  2PMY A;  1DJW A;  1JSA A;  1BOC A;  1J1E A;  4M2O A;  2KBM A;  3C1V A;  4JWQ A;  1YX7 A;  2ISD A;  4DCK A;  2BBM A;  1AVS A;  1S6J A;  1UUR A;  1C07 A;  4P5O E;  2AMI A;  1QTX A;  1UHN A;  5JOL A;  2O5G A;  4HRG A;  4GPL B;  5HKW A;  1S3P A;  1REC A;  2BE6 A;  3GOF A;  2MRD A;  1BJF A;  1BR1 B;  1Q80 A;  1SW8 A;  3I5G C;  4GGF A;  4HRH A;  4PE4 A;  2K61 A;  1YR5 A;  4ETO A;  2KNE A;  2L2E A;  4ORB B;  1IQ5 A;  1KQM C;  3CR5 X;  1XFV O;  2L4I A;  4WQ2 A;  1YUR A;  1YUS A;  2F33 A;  4JQ0 D;  1TN4 A;  4YGD B;  3M0W A;  2K7D A;  3GK4 X;  3EK8 A;  1LVC D;  4PCW A;  3O6B A;  1S5G Z;  1K9U A;  3IQQ A;  3OX6 A;  5I2Q A;  3SG7 A;  2HF5 A;  2M97 A;  2BL0 B;  3CR4 X;  4PHJ A;  1V1G A;  1ALV A;  3WNX B;  1RWY A;  4N5X A;  4M2P A;  1M45 A;  2JZI A;  4QJ3 B;  4YGA A;  1B4C A;  1PVB A;  1UWO A;  1CM4 A;  3PFV A;  2H61 A;  2KFH A;  1XFX O;  4U8D A;  1J7O A;  1NYA A;  1KK7 Y;  1TNW A;  2V53 A;  2LAP A;  2ZRS A;  1Y1A A;  3PN7 B;  2WCB A;  2E6W A;  3SIA A;  4YI9 A;  1CTR A;  3KPX A;  1ZFS A;  2F3Y A;  1Y6W A;  4TNC A;  4MSP A;  4MBE A;  2KGB C;  1WDC B;  1SL8 A;  2KFG A;  2K2F A;  5AAN A;  4PHN A;  2KAX A;  3QRX A;  1DJI A;  1IG5 A;  4ZCU A;  1OE9 B;  3JTD C;  1CNP A;  1DMO A;  2RGI A;  3I5G B;  2LMT A;  1TCF A;  3AKA A;  1AHR A;  1CFD A;  2LLU A;  2BE4 A;  1AJ4 A;  1KQM B;  1QLS A;  3BUW B;  3D0Y B;  2CXJ A;  2R2I A;  1QLK A;  5I8N A;  2LVJ A;  1GQM A;  3F45 A;  1SL9 A;  1B7T Z;  1DF0 A;  1JWD A;  3JVT C;  2HQW A;  3O78 A;  4MRX A;  2I94 A;  1NUB A;  2ZRT A;  5BPJ A;  3I5F C;  4ICB A;  1NCX A;  3OX5 A;  2LP2 A;  1XK4 C;  2EGD A;  1QX7 A;  2LMV A;  2ZN9 A;  1JF0 A;  2Y1M A;  2M1U A;  3BUO B;  2MHH A;  4QJ5 B;  1U5I A;  1F4Q A;  1XFZ O;  2LCP A;  2LLT A;  1PRW A;  1EG4 A;  2DOQ A;  2JXL A;  3SG5 A;  1A75 A;  3PLF B;  4OKH A;  3EKH A;  2GV5 A;  1YX8 A;  4UPG A;  1Y1X A;  1IQ3 A;  1F8H A;  1KFX S;  1S1E A;  1RTP 1;  1TNP A;  1KSO A;  2MJW B;  4M2Q A;  4QJ4 B;  3TUY B;  2F3Z A;  3DF0 A;  3IQO A;  2NZ0 A;  4PAL A;  2SCP A;  1MXL C;  1SYM A;  1BG1 A;  2M7N A;  1D1O A;  4GAO A;  4MRY A;  2K7O A;  4MZL A;  3LK1 A;  2H2K A;  2JRF A;  1OQP A;  1CFC A;  4PHM A;  3KF9 A;  2JT3 A;  4AOM A;  1H8B A;  1MWN A;  2WC8 A;  4OVN F;  2BCA A;  4JPZ B;  4N1G A;  1CFF A;  4I5N B;  1EG3 A;  5D69 A;  1QIV A;  2BKI B;  2MA2 A;  3CLN A;  3ZWH A;  1QAT A;  1BF5 A;  3DVJ A;  3AKB A;  1UHJ A;  2F2P A;  1F70 A;  2KI6 D;  1QX5 B;  2JC2 A;  3EK7 A;  4I5J A;  2FJU B;  1A2X A;  1B7T Y;  2JXC A;  2O60 A;  1ZMZ A;  2JQ6 A;  2JWW A;  3CWG A;  3FS7 A;  3BOW A;  1DTL A;  3I5I C;  1M63 B;  1YVH A;  3VRR A;  2HQ8 A;  1FPW A;  2JNX A;  2L50 A;  3A8R A;  3TDZ A;  1SMG A;  1RJV A;  1C7W A;  1MXE A;  1CLL A;  1NX1 A;  2FOT A;  4PE1 A;  1OMD A;  1NX2 A;  4CFR A;  2OTG C;  3LLE A;  1XYD A;  4PDZ A;  4GGF C;  5FYX A;  1WRL A;  1CDP A;  4MN0 A;  1SR6 C;  2KGR A;  3SG6 A;  3SG3 A;  1SNL A;  2BCX A;  3I5H C;  1UUS A;  4MZJ A;  2HPS A;  4CLN A;  1IWQ A;  1IJ6 A;  2QPT A;  5AFP A;  4MEW A;  3DVE A;  5HKZ A;  5PAL A;  1AK8 A;  3H4S E;  1QVI Z;  1G8I A;  3O4Y A;  3TS5 C;  1LA3 A;  2KAY A;  1DGV A;  1TOP A;  3TDI A;  2M29 A;  4ORC B;  1KCY A;  1J7R A;  2BBN A;  3EVV A;  2LHI A;  3EVU A;  2JTZ A;  1L7Z A;  1OOJ A;  2PRU A;  2LVV A;  1B8L A;  1EL4 A;  1LKJ A;  3NSI A;  2EC6 C;  1N0Y A;  5AEQ A;  1DGU A;  4DRW A;  4YGE B;  4Q04 A;  2MLF C;  1R6P A;  1B1G A;  1PVA A;  1NPQ A;  5CSN A;  3D0Y A;  5DKR A;  1TNX A;  1F54 A;  1CDL A;  1NCZ A;  3WHT B;  4HSZ A;  3I5I B;  2NLN A;  2BEC A;  5ER4 X;  1OZO A;  1XVJ A;  1YUT A;  4YGC B;  2JT0 A;  2L0P A;  2NXQ A;  2GGM A;  1NIW A;  4YRU A;  1N2D A;  1K9K A;  1GGW A;  1KSM A;  4GUK A;  2I2R E;  1SR6 B;  5HLV A;  5HKY A;  5HYD A;  1KWO C;  2LM5 A;  1AUI B;  5D7F A;  1J7P A;  3I5H B;  4D1E A;  5DKQ A;  3LCP C;  2KI4 C;  3ICB A;  1S26 D;  2QAC A;  1E8A A;  3K21 A;  1BOD A;  4R1E A;  1ZOT B;  2L5X B;  4MVF A;  1BMO A;  1UHK A;  1S36 A;  2LV7 A;  1QXP A;  1PSR A;  4AQJ A;  5CSI A;  2JPT A;  1EXR A;  1ZUZ A;  2MBX A; 
#chains in the Genus database with same CATH topology
 3OP0 A;  1LXF C;  2IS9 A;  1S5G Y;  3NHT A;  1A03 A;  1KK8 C;  2L98 A;  3VRN A;  1RRO A;  2ZN8 A;  2ZNE A;  2K0J A;  5AXI A;  1IKU A;  3HX4 A;  2KSP A;  1K95 A;  4DUQ A;  1L2O C;  5CSF A;  2M9G A;  1J55 A;  2CCM A;  2WOR A;  2L4H A;  5FI2 A;  4OV2 A;  1MUX A;  2VRG A;  1OMV A;  2OS8 C;  1T14 A;  1WLM A;  3BUN B;  3SS3 A;  1V1F A;  5GQQ C;  1F71 A;  4P2Y B;  2BCB A;  4WRI A;  1C7V A;  2KQ6 A;  3PAL A;  1QAS A;  4C0K A;  2GGZ A;  2ZND A;  2WCF A;  3DD4 A;  3N7H A;  1JC2 A;  1J1D A;  4FTG A;  2KLE A;  1BLQ A;  4YBH B;  3JTD B;  3BJH A;  3RM1 A;  1S6C A;  4XJK B;  1UP5 A;  2I7A A;  3R72 A;  2FJY A;  1SY9 A;  1UHI A;  1NX0 A;  2K8M B;  2KYC A;  2WCM A;  1TIZ A;  2G9B A;  2KI4 B;  4NDD A;  3BUM B;  4CID A;  1DJH A;  2M1K B;  1CLM A;  2I18 A;  3FWB A;  3OHM B;  4BY4 A;  5ER5 A;  2WC5 A;  4MZK A;  3JVT B;  1HQV A;  3I5F B;  1ZAC A;  2Y4Q A;  1QV0 A;  2LAN A;  1EH2 A;  3A4U B;  1NWD A;  3NSO A;  3R1V A;  3V2L A;  1U5I B;  2JNF A;  2Y1N A;  3CS1 A;  1KFX L;  3LK0 A;  5F6T A;  2M7L A;  3OB1 B;  5JJG A;  1DT7 B;  1QIW A;  1TWO A;  3SG4 A;  1YUU A;  3UNW A;  1IJ5 A;  1RK9 A;  1KK8 B;  4L9M A;  4YI8 A;  3D77 A;  2LP3 A;  3BFB A;  1EJ3 A;  3HCM A;  2B1U A;  1YRT B;  5DIC A;  2P6B B;  1W9Z A;  1A29 A;  1WRK A;  1CDM A;  3EKJ A;  4BY5 A;  1CLB A;  2Q4U A;  3NXA A;  2AAO A;  2K2A A;  3PAT A;  1OOF A;  1YRU B;  2HET A;  2KI6 C;  2JPO A;  2KFF A;  1WY9 A;  2BNX A;  2GTE A;  2WC6 A;  1H4B A;  3S0G A;  4ZCV A;  5D3O A;  2PVB A;  4F0Z B;  3BYA A;  1UHH A;  2P71 A;  1K8U A;  5HLO A;  5DKN A;  1OMR A;  1CM1 A;  3KEV A;  3B87 A;  3LL8 B;  3PN7 C;  3PSR A;  1KQV A;  2PSR A;  3CAB A;  2JOJ A;  3FIA A;  3B88 A;  4C0L A;  3EK4 A;  3K1E A;  1FBV A;  3CZ1 A;  1WLZ A;  1WDC C;  2LC5 A;  2WND A;  3MSE B;  1Z2C B;  3BQ3 A;  3S0F A;  1SL7 A;  1AJ5 A;  2WOS A;  4CPV A;  4YGB B;  3VGO A;  3KO0 A;  1S6I A;  1LIN A;  1XFY O;  2BKH B;  2D8N A;  1TRF A;  2ERB A;  2Q91 A;  3CGA A;  3DVM A;  4ORA B;  2H61 C;  4PT1 A;  3UO9 A;  3IF7 A;  3AAJ A;  1MR8 A;  4IL1 A;  4HRE E;  2NCP A;  1FI6 A;  3CDN A;  1JUO A;  1B47 A;  4INW A;  1MF8 B;  3WXA A;  3BOW B;  1C3Z A;  2Y5I A;  2LUC A;  1OW4 A;  1NSH A;  2ZFD A;  5B8I B;  5CPV A;  1DJZ A;  3SIB A;  1XO5 A;  1ALW A;  1TTX A;  3GK2 A;  3R1P A;  5FI6 A;  2E30 A;  1B9A A;  3O4X A;  1ORG A;  2LLS A;  1XFU O;  3TZ1 A;  3CZ0 A;  2KQY A;  3D10 A;  2G2B A;  3RLZ A;  2OTG B;  2KYF A;  1KFU S;  1DJY A;  1K9P A;  1W7J B;  5I2L A;  1M31 A;  4DS7 A;  1B8R A;  1J7Q A;  2JT8 A;  1BU3 A;  1SRA A;  1DVI A;  1N65 A;  1X02 A;  4N1F A;  5KSZ A;  3B6X A;  1K96 A;  2KDH A;  3BFH A;  4OR9 B;  2FCE A;  3D78 A;  3S0E A;  4JKT A;  2MLE C;  3NSL A;  1IGV A;  1CMF A;  3TUY C;  1M46 A;  1PUL A;  4FQO A;  1IRJ A;  2KBI A;  3NSK A;  5G08 A;  2A4J A;  3TS5 B;  1F55 A;  2JTT A;  2COL B;  4GGN A;  1CKK A;  3SG2 A;  1YTZ C;  4OCI A;  1PK0 D;  4DIR A;  1QVI Y;  1JF2 A;  2F8P A;  3VRP A;  2EC6 B;  2CT9 A;  1CB1 A;  1B8C A;  1F4O A;  3CZT X;  2F2O A;  2KOT A;  4A4C A;  3PM8 A;  5KU1 A;  1M39 A;  4XJK A;  2CTN A;  1BR4 B;  2OPO A;  1SCM C;  3AAK A;  1DJX A;  2L51 A;  3OB2 B;  2M8U A;  1FF1 A;  3DXL A;  1KFU L;  2QEB A;  2PAL A;  1LA0 A;  2PAS A;  1K94 A;  1OOI X;  3BUX B;  2L2C A;  4USL A;  2TN4 A;  1PAL A;  4PE7 A;  2LUX A;  3FWC A;  1BT6 A;  1SCV A;  5J3X A;  3S0A A;  1JBA A;  4I5L B;  1WRZ A;  1K90 D;  1XK4 A;  4MLW A;  2KPH A;  1ODB A;  2AUC A;  3VRO A;  2K7C A;  3O2P A;  1XFR A;  1JFK A;  3DVK A;  1Y1U A;  4E68 A;  3TDU A;  2M3W A;  4NDB A;  5I2O A;  3Q8I A;  1K93 D;  1TCO B;  1YVL A;  3BXK A;  1XFW O;  1KWO B;  4NDC A;  1NCY A;  3E3R A;  3L4L A;  2K7B A;  2WCE A;  3ZNI A;  1TNQ A;  1CFP A;  1OSA A;  3EVR A;  1DJG A;  4AQI A;  2LHL A;  1DF0 B;  1SPY A;  1VRK A;  2SAS A;  3KHE A;  1W7I B;  2JUL A;  4C0J A;  1SK6 D;  3CYZ A;  1MHO A;  5AER A;  1IH0 A;  1G4Y R;  2KLD A;  2PYQ A;  1K2H A;  1FI5 A;  1DEK A;  1SSE B;  3DYE A;  3OBV A;  5K89 A;  2CNP A;  4WQ3 A;  3GK1 A;  3L47 A;  1SKT A;  2MAZ A;  2LVK A;  1JFJ A;  1QS7 A;  1GGZ A;  4PE0 A;  1G33 A;  2JU0 A;  3VRQ A;  1RFJ A;  4I5K A;  4PHK A;  2LNK A;  2WCK A;  5IBW A;  3NGV A;  5KTY A;  1NX3 A;  1GJY A;  1A75 B;  4GNK B;  1FW4 A;  2KAV A;  2ZKM X;  1QX2 A;  2CBL A;  3CTN A;  5CSJ A;  1Y0V H;  1L2O B;  1A4P A;  2BL0 C;  2FCD A;  1SBJ A;  2KHN A;  2LE9 B;  2LMU A;  1NP8 A;  4NQG A;  1SCM B;  5TNC A;  4XYN A;  1PSB A;  1KK7 Z;  2OS8 B;  1XA5 A;  3DF0 B;  4GBA A;  3CR2 A;  1R2U A;  1QV1 A;  3SJS A;  2M49 B;  1HT9 A;  1CDN A;  1MQ1 A;  1AP4 A;  4GFT A;  1OZS A;  1QJT A;  1LS8 A;  3WHU B;  2EHB A;  2LVI A;  2NCO A;  1CMG A;  4JD9 A;  2M0R A;  2PMY A;  1DJW A;  1JSA A;  1BOC A;  1J1E A;  4M2O A;  2KBM A;  3C1V A;  4JWQ A;  1YX7 A;  2ISD A;  4DCK A;  2BBM A;  1AVS A;  1S6J A;  3IVT A;  1UUR A;  1C07 A;  4P5O E;  3D74 A;  2AMI A;  1QTX A;  1UHN A;  5JOL A;  2QEH A;  2O5G A;  2QEO A;  4HRG A;  4GPL B;  5HKW A;  1DC1 A;  1S3P A;  1REC A;  2BE6 A;  3GOF A;  2MRD A;  1BJF A;  1BR1 B;  1Q80 A;  1SW8 A;  3I5G C;  4GGF A;  4HRH A;  4PE4 A;  2K61 A;  1YR5 A;  4ETO A;  2KNE A;  2L2E A;  4ORB B;  1IQ5 A;  1KQM C;  3CR5 X;  1XFV O;  2L4I A;  4WQ2 A;  1YUR A;  1YUS A;  2F33 A;  4JQ0 D;  1TN4 A;  4YGD B;  3M0W A;  3PM2 A;  3RZS A;  2K7D A;  3GK4 X;  5HL1 A;  3EK8 A;  1LVC D;  4PCW A;  3O6B A;  1S5G Z;  2K60 A;  3FE9 A;  1K9U A;  3IQQ A;  3OX6 A;  5I2Q A;  3SG7 A;  2HF5 A;  2M97 A;  2BL0 B;  2WCH A;  3CR4 X;  3B86 A;  1V1G A;  4OZD A;  1ALV A;  4PHJ A;  3WNX B;  1RWY A;  4N5X A;  4M2P A;  1M45 A;  2JZI A;  3L4A A;  4QJ3 B;  4YGA A;  3CZ2 A;  1B4C A;  1PVB A;  3FE6 A;  1UWO A;  1CM4 A;  3PFV A;  2H61 A;  4A4B A;  2KFH A;  1XFX O;  3S0D A;  4U8D A;  1J7O A;  1NYA A;  1KK7 Y;  1TNW A;  2V53 A;  2LAP A;  2ZRS A;  3B7A A;  1Y1A A;  3PN7 B;  2WCB A;  2E6W A;  3SIA A;  4YI9 A;  1CTR A;  3KPX A;  1ZFS A;  2F3Y A;  1Y6W A;  4TNC A;  4MSP A;  4MBE A;  2KGB C;  3OGN A;  1WDC B;  1SL8 A;  2KFG A;  2K2F A;  5AAN A;  4PHN A;  2KAX A;  3QRX A;  1DJI A;  1IG5 A;  4ZCU A;  1OE9 B;  3SS5 A;  3JTD C;  1CNP A;  1DMO A;  2RGI A;  3I5G B;  2LMT A;  1TCF A;  2L5Y A;  3AKA A;  1AHR A;  1CFD A;  2LLU A;  2BE4 A;  1AJ4 A;  1KQM B;  1QLS A;  3BUW B;  3D0Y B;  2CXJ A;  2R2I A;  1QLK A;  3DY9 A;  4CFQ A;  5I8N A;  4F7F A;  2LVJ A;  1GQM A;  3F45 A;  1SL9 A;  1B7T Z;  1DF0 A;  1JWD A;  3JVT C;  2HQW A;  3O78 A;  4MRX A;  2I94 A;  1NUB A;  2ZRT A;  5BPJ A;  3I5F C;  4ICB A;  1NCX A;  3OX5 A;  1C3Y A;  2LP2 A;  1XK4 C;  2EGD A;  1QX7 A;  2LMV A;  2ZN9 A;  1JF0 A;  2Y1M A;  2M1U A;  3BUO B;  2MHH A;  3S0B A;  4QJ5 B;  1U5I A;  3SS4 A;  3DZT A;  1F4Q A;  1XFZ O;  2LCP A;  2LLT A;  1PRW A;  1EG4 A;  2DOQ A;  2JXL A;  3SG5 A;  2QEV A;  2WCJ A;  1A75 A;  3PLF B;  4OKH A;  3EKH A;  2GV5 A;  1YX8 A;  4UPG A;  1Y1X A;  1IQ3 A;  1F8H A;  1KFX S;  1S1E A;  1RTP 1;  1TNP A;  1KSO A;  2MJW B;  4M2Q A;  4QJ4 B;  3TUY B;  2F3Z A;  3NHI A;  3DF0 A;  3IQO A;  2NZ0 A;  4PAL A;  2SCP A;  1MXL C;  4IJ7 A;  1SYM A;  1BG1 A;  2M7N A;  2WCL A;  1D1O A;  4GAO A;  3EG5 B;  4MRY A;  2K7O A;  4MZL A;  3LK1 A;  2H2K A;  2JRF A;  1OQP A;  1CFC A;  4PHM A;  3KF9 A;  2JT3 A;  4AOM A;  1H8B A;  1QWV A;  3PJI A;  1MWN A;  2WC8 A;  4OVN F;  2BCA A;  4JPZ B;  4N1G A;  1CFF A;  4I5N B;  1EG3 A;  5D69 A;  1QIV A;  2BKI B;  2MA2 A;  3CLN A;  3ZWH A;  1DEL A;  3D75 A;  1QAT A;  1BF5 A;  3DVJ A;  3AKB A;  1UHJ A;  2F2P A;  1F70 A;  2KI6 D;  1QX5 B;  2JC2 A;  2YGU A;  3EK7 A;  4I5J A;  2FJU B;  5FI7 A;  1TUZ A;  1A2X A;  1B7T Y;  2JXC A;  2O60 A;  1ZMZ A;  2JQ6 A;  2JWW A;  3CWG A;  3FS7 A;  2PQL A;  3BOW A;  1DTL A;  4FQT A;  3I5I C;  1M63 B;  1YVH A;  3VRR A;  2HQ8 A;  1FPW A;  2JNX A;  2L50 A;  3A8R A;  3TDZ A;  5I94 A;  1SMG A;  1RJV A;  1C7W A;  1MXE A;  1CLL A;  1NX1 A;  2FOT A;  4PE1 A;  1OMD A;  1NX2 A;  4CFR A;  2P70 A;  2OTG C;  3LLE A;  1XYD A;  4PDZ A;  4GGF C;  5FYX A;  1WRL A;  3VB1 A;  1CDP A;  4MN0 A;  4KYN A;  1SR6 C;  2KGR A;  3SG6 A;  1IIO A;  3SG3 A;  1SNL A;  2BCX A;  3I5H C;  1UUS A;  4MZJ A;  2HPS A;  4CLN A;  1IWQ A;  1GM0 A;  1IJ6 A;  2QPT A;  5AFP A;  3D76 A;  3DVE A;  4MEW A;  5HKZ A;  5PAL A;  1AK8 A;  3H4S E;  2QDI A;  1QVI Z;  1G8I A;  5EL2 A;  3O4Y A;  3TS5 C;  1LA3 A;  2KAY A;  1DGV A;  1TOP A;  3R1O A;  2M29 A;  3TDI A;  4ORC B;  3QME A;  1KCY A;  1J7R A;  2BBN A;  3EVV A;  2LHI A;  3EVU A;  2JTZ A;  1L7Z A;  1OOJ A;  1P28 A;  2PRU A;  2LVV A;  1B8L A;  1EL4 A;  1LKJ A;  3NSI A;  2EC6 C;  1OOH A;  1N0Y A;  5AEQ A;  1DGU A;  4DRW A;  4YGE B;  4Q04 A;  1Z4H A;  2MLF C;  1R6P A;  1B1G A;  1PVA A;  1NPQ A;  5CSN A;  3D0Y A;  5DKR A;  1TNX A;  1F54 A;  1OOG A;  1CDL A;  1NCZ A;  3WHT B;  1DQE A;  4HSZ A;  2BAP A;  3D73 A;  3I5I B;  2NLN A;  2BEC A;  4INX A;  5ER4 X;  1OZO A;  1XVJ A;  1YUT A;  4YGC B;  2JT0 A;  2L0P A;  2NXQ A;  3BFA A;  2GGM A;  1NIW A;  4YRU A;  1N2D A;  1K9K A;  1GGW A;  1KSM A;  4GUK A;  2I2R E;  1SR6 B;  5HLV A;  5HKY A;  5HYD A;  1KWO C;  2LM5 A;  1AUI B;  5D7F A;  1J7P A;  3I5H B;  4D1E A;  5DKQ A;  2H8V A;  3LCP C;  2KI4 C;  3ICB A;  1S26 D;  2QAC A;  1E8A A;  3K21 A;  1BOD A;  3FE8 A;  4R1E A;  1ZOT B;  2L5X B;  4MVF A;  1BMO A;  1UHK A;  1S36 A;  2LV7 A;  1QXP A;  1PSR A;  4AQJ A;  5CSI A;  1TUJ A;  2JPT A;  1EXR A;  1ZUZ A;  2MBX A; 
#chains in the Genus database with same CATH homology
 3OP0 A;  1LXF C;  2IS9 A;  1S5G Y;  1A03 A;  1KK8 C;  2L98 A;  3VRN A;  1RRO A;  2ZN8 A;  2ZNE A;  2K0J A;  5AXI A;  1IKU A;  3HX4 A;  2KSP A;  1K95 A;  4DUQ A;  1L2O C;  5CSF A;  2M9G A;  1J55 A;  2CCM A;  2WOR A;  2L4H A;  4OV2 A;  1MUX A;  2VRG A;  1OMV A;  2OS8 C;  1WLM A;  3BUN B;  1V1F A;  5GQQ C;  1F71 A;  4P2Y B;  2BCB A;  4WRI A;  1C7V A;  2KQ6 A;  3PAL A;  1QAS A;  4C0K A;  2GGZ A;  2ZND A;  2WCF A;  3DD4 A;  1JC2 A;  1J1D A;  4FTG A;  1BLQ A;  4YBH B;  3JTD B;  3RM1 A;  1S6C A;  4XJK B;  1UP5 A;  2I7A A;  1SY9 A;  1UHI A;  1NX0 A;  2K8M B;  2KYC A;  1TIZ A;  2G9B A;  2KI4 B;  4NDD A;  3BUM B;  4CID A;  1DJH A;  2M1K B;  1CLM A;  2I18 A;  3FWB A;  3OHM B;  4BY4 A;  5ER5 A;  4MZK A;  3JVT B;  1HQV A;  3I5F B;  1ZAC A;  2Y4Q A;  1QV0 A;  2LAN A;  1EH2 A;  3A4U B;  1NWD A;  3NSO A;  1U5I B;  2JNF A;  2Y1N A;  3CS1 A;  1KFX L;  3LK0 A;  5F6T A;  2M7L A;  3OB1 B;  5JJG A;  1DT7 B;  1QIW A;  3SG4 A;  1YUU A;  1IJ5 A;  1RK9 A;  1KK8 B;  4L9M A;  4YI8 A;  2LP3 A;  1EJ3 A;  3HCM A;  2B1U A;  1YRT B;  2P6B B;  1WRK A;  1A29 A;  3EKJ A;  1CDM A;  4BY5 A;  1CLB A;  2Q4U A;  3NXA A;  2AAO A;  2K2A A;  3PAT A;  1YRU B;  2HET A;  2KI6 C;  2KFF A;  1WY9 A;  1H4B A;  4ZCV A;  4F0Z B;  2PVB A;  3BYA A;  1UHH A;  1K8U A;  5HLO A;  5DKN A;  1OMR A;  1CM1 A;  3KEV A;  3LL8 B;  3PN7 C;  3PSR A;  1KQV A;  2PSR A;  2JOJ A;  3FIA A;  4C0L A;  3EK4 A;  1FBV A;  1WLZ A;  1WDC C;  2LC5 A;  2WND A;  3MSE B;  3BQ3 A;  1SL7 A;  1AJ5 A;  2WOS A;  4CPV A;  4YGB B;  3VGO A;  3KO0 A;  1S6I A;  1LIN A;  1XFY O;  2BKH B;  2D8N A;  1TRF A;  2Q91 A;  4ORA B;  3CGA A;  3DVM A;  4A4B A;  2H61 C;  4CFQ A;  3IF7 A;  3AAJ A;  1MR8 A;  4IL1 A;  4HRE E;  2NCP A;  1FI6 A;  1JUO A;  1B47 A;  1MF8 B;  3WXA A;  3BOW B;  2Y5I A;  2LUC A;  1NSH A;  2ZFD A;  5B8I B;  5CPV A;  1DJZ A;  3SIB A;  1XO5 A;  1ALW A;  1TTX A;  3GK2 A;  2E30 A;  1B9A A;  2LLS A;  1XFU O;  3TZ1 A;  2KQY A;  3D10 A;  2G2B A;  3RLZ A;  2OTG B;  2KYF A;  1KFU S;  1DJY A;  1K9P A;  1W7J B;  5I2L A;  1M31 A;  4DS7 A;  1B8R A;  1J7Q A;  2JT8 A;  1BU3 A;  1SRA A;  1DVI A;  1N65 A;  1X02 A;  4N1F A;  5KSZ A;  1K96 A;  2KDH A;  4OR9 B;  2FCE A;  2MLE C;  3NSL A;  1IGV A;  1CMF A;  3TUY C;  1M46 A;  1PUL A;  4FQO A;  1IRJ A;  2KBI A;  3NSK A;  5G08 A;  2A4J A;  3TS5 B;  1F55 A;  2JTT A;  2COL B;  4GGN A;  1CKK A;  3SG2 A;  1YTZ C;  4OCI A;  1PK0 D;  4DIR A;  1QVI Y;  1JF2 A;  2F8P A;  3VRP A;  2EC6 B;  2CT9 A;  1CB1 A;  1B8C A;  1F4O A;  3CZT X;  2F2O A;  2KOT A;  4A4C A;  3PM8 A;  5KU1 A;  1M39 A;  4XJK A;  2CTN A;  1BR4 B;  2OPO A;  1SCM C;  3AAK A;  1DJX A;  2L51 A;  3OB2 B;  2M8U A;  1FF1 A;  1KFU L;  2PAL A;  1LA0 A;  2PAS A;  1K94 A;  3BUX B;  4USL A;  2TN4 A;  1PAL A;  4PE7 A;  2LUX A;  3FWC A;  1BT6 A;  1SCV A;  5J3X A;  1JBA A;  4I5L B;  1WRZ A;  1K90 D;  1XK4 A;  4MLW A;  1ODB A;  2AUC A;  3VRO A;  2K7C A;  3O2P A;  1JFK A;  3DVK A;  1Y1U A;  4E68 A;  3TDU A;  2M3W A;  4NDB A;  5I2O A;  1K93 D;  1TCO B;  1YVL A;  3BXK A;  1XFW O;  1KWO B;  4NDC A;  1NCY A;  3E3R A;  3ZNI A;  2K7B A;  2WCE A;  1TNQ A;  1CFP A;  1OSA A;  3EVR A;  1DJG A;  4AQI A;  2LHL A;  1DF0 B;  1SPY A;  1VRK A;  2SAS A;  3KHE A;  1W7I B;  2JUL A;  4C0J A;  1SK6 D;  1MHO A;  5AER A;  1IH0 A;  1G4Y R;  1K2H A;  1FI5 A;  5K89 A;  2CNP A;  4WQ3 A;  3GK1 A;  1SKT A;  2MAZ A;  2LVK A;  1JFJ A;  1QS7 A;  1GGZ A;  4PE0 A;  1G33 A;  2JU0 A;  3VRQ A;  1RFJ A;  4I5K A;  4PHK A;  2LNK A;  5IBW A;  5KTY A;  1NX3 A;  1GJY A;  1A75 B;  4GNK B;  1FW4 A;  2KAV A;  2ZKM X;  1QX2 A;  2CBL A;  3CTN A;  5CSJ A;  1Y0V H;  1L2O B;  1A4P A;  2BL0 C;  2FCD A;  1SBJ A;  2KHN A;  2LE9 B;  2LMU A;  1NP8 A;  4NQG A;  1SCM B;  5TNC A;  4XYN A;  1PSB A;  1KK7 Z;  2OS8 B;  1XA5 A;  3DF0 B;  4GBA A;  3CR2 A;  1R2U A;  1QV1 A;  3SJS A;  2M49 B;  1HT9 A;  1CDN A;  1MQ1 A;  1AP4 A;  4GFT A;  1OZS A;  1QJT A;  3WHU B;  2EHB A;  2LVI A;  2NCO A;  1CMG A;  2M0R A;  2PMY A;  1DJW A;  1JSA A;  1BOC A;  1J1E A;  4M2O A;  2KBM A;  3C1V A;  4JWQ A;  1YX7 A;  2ISD A;  4DCK A;  2BBM A;  1AVS A;  1S6J A;  1UUR A;  1C07 A;  4P5O E;  2AMI A;  1QTX A;  1UHN A;  5JOL A;  2O5G A;  4HRG A;  4GPL B;  5HKW A;  1S3P A;  1REC A;  2BE6 A;  3GOF A;  2MRD A;  1BJF A;  1BR1 B;  1Q80 A;  1SW8 A;  3I5G C;  4GGF A;  4HRH A;  4PE4 A;  2K61 A;  1YR5 A;  4ETO A;  2KNE A;  2L2E A;  4ORB B;  1IQ5 A;  1KQM C;  3CR5 X;  1XFV O;  2L4I A;  4WQ2 A;  1YUR A;  1YUS A;  2F33 A;  4JQ0 D;  1TN4 A;  4YGD B;  3M0W A;  2K7D A;  3GK4 X;  3EK8 A;  1LVC D;  4PCW A;  3O6B A;  1S5G Z;  1K9U A;  3IQQ A;  3OX6 A;  5I2Q A;  3SG7 A;  2HF5 A;  2M97 A;  2BL0 B;  3CR4 X;  4PHJ A;  1V1G A;  1ALV A;  3WNX B;  1RWY A;  4N5X A;  4M2P A;  1M45 A;  2JZI A;  4QJ3 B;  4YGA A;  1B4C A;  1PVB A;  1UWO A;  1CM4 A;  3PFV A;  2H61 A;  2KFH A;  1XFX O;  4U8D A;  1J7O A;  1NYA A;  1KK7 Y;  1TNW A;  2V53 A;  2LAP A;  2ZRS A;  1Y1A A;  3PN7 B;  2WCB A;  2E6W A;  3SIA A;  4YI9 A;  1CTR A;  3KPX A;  1ZFS A;  2F3Y A;  1Y6W A;  4TNC A;  4MSP A;  4MBE A;  2KGB C;  1WDC B;  1SL8 A;  2KFG A;  2K2F A;  5AAN A;  4PHN A;  2KAX A;  3QRX A;  1DJI A;  1IG5 A;  4ZCU A;  1OE9 B;  3JTD C;  1CNP A;  1DMO A;  2RGI A;  3I5G B;  2LMT A;  1TCF A;  3AKA A;  1AHR A;  1CFD A;  2LLU A;  2BE4 A;  1AJ4 A;  1KQM B;  1QLS A;  3BUW B;  3D0Y B;  2CXJ A;  2R2I A;  1QLK A;  5I8N A;  2LVJ A;  1GQM A;  3F45 A;  1SL9 A;  1B7T Z;  1DF0 A;  1JWD A;  3JVT C;  2HQW A;  3O78 A;  4MRX A;  2I94 A;  1NUB A;  2ZRT A;  5BPJ A;  3I5F C;  4ICB A;  1NCX A;  3OX5 A;  2LP2 A;  1XK4 C;  2EGD A;  1QX7 A;  2LMV A;  2ZN9 A;  1JF0 A;  2Y1M A;  2M1U A;  3BUO B;  2MHH A;  4QJ5 B;  1U5I A;  1F4Q A;  1XFZ O;  2LCP A;  2LLT A;  1PRW A;  1EG4 A;  2DOQ A;  2JXL A;  3SG5 A;  1A75 A;  3PLF B;  4OKH A;  3EKH A;  2GV5 A;  1YX8 A;  4UPG A;  1Y1X A;  1IQ3 A;  1F8H A;  1KFX S;  1S1E A;  1RTP 1;  1TNP A;  1KSO A;  2MJW B;  4M2Q A;  4QJ4 B;  3TUY B;  2F3Z A;  3DF0 A;  3IQO A;  2NZ0 A;  4PAL A;  2SCP A;  1MXL C;  1SYM A;  1BG1 A;  2M7N A;  1D1O A;  4GAO A;  4MRY A;  2K7O A;  4MZL A;  3LK1 A;  2H2K A;  2JRF A;  1OQP A;  1CFC A;  4PHM A;  3KF9 A;  2JT3 A;  4AOM A;  1H8B A;  1MWN A;  2WC8 A;  4OVN F;  2BCA A;  4JPZ B;  4N1G A;  1CFF A;  4I5N B;  1EG3 A;  5D69 A;  1QIV A;  2BKI B;  2MA2 A;  3CLN A;  3ZWH A;  1QAT A;  1BF5 A;  3DVJ A;  3AKB A;  1UHJ A;  2F2P A;  1F70 A;  2KI6 D;  1QX5 B;  2JC2 A;  3EK7 A;  4I5J A;  2FJU B;  1A2X A;  1B7T Y;  2JXC A;  2O60 A;  1ZMZ A;  2JQ6 A;  2JWW A;  3CWG A;  3FS7 A;  3BOW A;  1DTL A;  3I5I C;  1M63 B;  1YVH A;  3VRR A;  2HQ8 A;  1FPW A;  2JNX A;  2L50 A;  3A8R A;  3TDZ A;  1SMG A;  1RJV A;  1C7W A;  1MXE A;  1CLL A;  1NX1 A;  2FOT A;  4PE1 A;  1OMD A;  1NX2 A;  4CFR A;  2OTG C;  3LLE A;  1XYD A;  4PDZ A;  4GGF C;  5FYX A;  1WRL A;  1CDP A;  4MN0 A;  1SR6 C;  2KGR A;  3SG6 A;  3SG3 A;  1SNL A;  2BCX A;  3I5H C;  1UUS A;  4MZJ A;  2HPS A;  4CLN A;  1IWQ A;  1IJ6 A;  2QPT A;  5AFP A;  4MEW A;  3DVE A;  5HKZ A;  5PAL A;  1AK8 A;  3H4S E;  1QVI Z;  1G8I A;  3O4Y A;  3TS5 C;  1LA3 A;  2KAY A;  1DGV A;  1TOP A;  3TDI A;  2M29 A;  4ORC B;  1KCY A;  1J7R A;  2BBN A;  3EVV A;  2LHI A;  3EVU A;  2JTZ A;  1L7Z A;  1OOJ A;  2PRU A;  2LVV A;  1B8L A;  1EL4 A;  1LKJ A;  3NSI A;  2EC6 C;  1N0Y A;  5AEQ A;  1DGU A;  4DRW A;  4YGE B;  4Q04 A;  2MLF C;  1R6P A;  1B1G A;  1PVA A;  1NPQ A;  5CSN A;  3D0Y A;  5DKR A;  1TNX A;  1F54 A;  1CDL A;  1NCZ A;  3WHT B;  4HSZ A;  3I5I B;  2NLN A;  2BEC A;  5ER4 X;  1OZO A;  1XVJ A;  1YUT A;  4YGC B;  2JT0 A;  2L0P A;  2NXQ A;  2GGM A;  1NIW A;  4YRU A;  1N2D A;  1K9K A;  1GGW A;  1KSM A;  4GUK A;  2I2R E;  1SR6 B;  5HLV A;  5HKY A;  5HYD A;  1KWO C;  2LM5 A;  1AUI B;  5D7F A;  1J7P A;  3I5H B;  4D1E A;  5DKQ A;  3LCP C;  2KI4 C;  3ICB A;  1S26 D;  2QAC A;  1E8A A;  3K21 A;  1BOD A;  4R1E A;  1ZOT B;  2L5X B;  4MVF A;  1BMO A;  1UHK A;  1S36 A;  2LV7 A;  1QXP A;  1PSR A;  4AQJ A;  5CSI A;  2JPT A;  1EXR A;  1ZUZ A;  2MBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...