2CXJA

3d solution structure of s100a13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
b'MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 calcium-binding protein A13
publication title Three-Dimensional Solution Structure of S100A13
rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 19
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2cxjA00
1QVIZ 1S6IA 5CSFA 3D0YB 3D10A 2PALA 3BUOB 2K2AA 3DVEA 2E30A 1YVLA 4N5XA 1CM1A 4I5JA 5I2QA 1N2DA 2LUXA 2LANA 1K2HA 1IWQA 4GPLB 1BODA 3TS5B 2Y5IA 4BY4A 5HKWA 3KF9A 4NDCA 4MRXA 2JTTA 1SNLA 2I94A 1TIZA 1DJWA 5DKQA 1B8RA 1SY9A 4PHJA 4MN0A 4A4CA 2GGZA 3I5FC 4GAOA 4MVFA 4P5OE 4PCWA 4PHKA 2K2FA 4PDZA 3SIBA 3QRXA 4YRUA 2CT9A 1CFPA 1DF0B 3BXKA 4TNCA 2KQYA 1DGUA 1OMDA 2KOTA 4OV2A 1QLSA 1SR6B 1CDMA 2AMIA 3I5IC 2KAVA 3OHMB 4GGFA 1SL9A 3DF0B 3TUYB 3TDIA 2JQ6A 3EK7A 1GJYA 1SK6D 1ODBA 3GK4X 1JUOA 3OB1B 4OKHA 1DJXA 2MJWB 2JNXA 5TNCA 2LLTA 1BU3A 3OP0A 4GFTA 1S6JA 2FJUB 4PHNA 1QX5B 2Q91A 4MZLA 3EKJA 5KTYA 1UUSA 2VRGA 1TN4A 4PE7A 1NCXA 1U5IA 1CDLA 2WCFA 2Y4QA 5F6TA 4BY5A 3LL8B 4GBAA 4ORCB 1A03A 1IH0A 4AQJA 4C0LA 1OOJA 3F45A 2LC5A 2MA2A 1CNPA 1YX7A 3I5GC 2DOQA 2JRFA 1NX2A 1WDCB 1PVBA 4YGDB 1AVSA 2EHBA 1IGVA 1S3PA 1F4QA 2LNKA 2FCEA 2MLEC 1K90D 4MRYA 2JXLA 3PFVA 1XK4C 1SPYA 5AERA 2F3YA 1EH2A 2LV7A 2LAPA 3CS1A 2KBIA 4PE0A 2BECA 4NDDA 4I5KA 1XFVO 2K7DA 4NQGA 1K8UA 2KI6D 1H4BA 3CTNA 1A2XA 1ZMZA 1MWNA 4JWQA 2M7LA 1MF8B 1NYAA 2JWWA 1GGWA 1WLZA 1WRKA 4CLNA 1A75B 4I5NB 4PE1A 1TNXA 3I5FB 3MSEB 2V53A 5AANA 1AUIB 2KGBC 2KI4C 5BPJA 1XFXO 5IBWA 1ZACA 3GK1A 1XFYO 1XA5A 4I5LB 1PSBA 2KYCA 5HKYA 1B4CA 1KK8C 2IS9A 3ZWHA 2LP3A 3NSLA 1RWYA 3I5HC 2NZ0A 3EK4A 3BUXB 1BR1B 1L2OC 2WCEA 3KEVA 1F4OA 4MEWA 5AEQA 2KFGA 1NCYA 3HX4A 2BCXA 2MHHA 1NX1A 1QIWA 1H8BA 1G33A 1QVIY 1GGZA 5CPVA 4CFRA 2KHNA 3IF7A 2OPOA 4M2QA 5G08A 1J7RA 1BJFA 1NSHA 2M29A 1OMRA 3OX5A 1DJZA 4FQOA 1MXLC 2G9BA 1SL7A 1AJ5A 1BLQA 3D0YA 2L0PA 3BUWB 2G2BA 2KFFA 4PALA 2AUCA 1JWDA 1W7IB 1F54A 1N0YA 1IQ3A 2FOTA 2WCBA 3A4UB 3I5GB 3FS7A 4D1EA 4ETOA 4YGAA 1LINA 2M8UA 2PMYA 2BCAA 2KNEA 2WC8A 2MLFC 4JQ0D 1B1GA 1OMVA 2BBMA 3BUMB 1DTLA 3WHTB 1QS7A 3FWBA 1F55A 5AXIA 1S5GZ 4DS7A 1D1OA 1UP5A 3CR2A 3JVTC 1SL8A 2M0RA 2RGIA 3NSKA 5KSZA 1TNQA 2M1UA 1KFUS 2OTGC 2P6BB 1DF0A 4GGNA 2HQWA 2SCPA 1ZOTB 2LCPA 1YUUA 3CZTX 4AQIA 2CTNA 1CDPA 1DJGA 2LMTA 3VRNA 5J3XA 1X02A 1DGVA 1M63B 2FCDA 1R6PA 2KI4B 2JPTA 1DJYA 1WRZA 1J1EA 3WXAA 5I8NA 1SCMC 3DF0A 1EXRA 4MZKA 1ZFSA 2CCMA 3VROA 1S26D 1S1EA 1KK8B 2HF5A 2L4HA 1KQMC 2MBXA 3O2PA 2EC6C 3I5HB 1SMGA 2LVVA 1WY9A 2JNFA 2LLSA 5I2OA 1BT6A 1YVHA 1NP8A 3RLZA 2PASA 2KYFA 3O6BA 1F8HA 2M1KB 3KO0A 1CB1A 1IJ5A 1KWOC 1MUXA 3C1VA 2BKHB 1TRFA 1V1GA 3SG5A 2LVJA 1KK7Y 4XYNA 2L51A 1F71A 3LK1A 2Y1MA 4Q04A 1W7JB 3TDZA 3PN7C 3WHUB 4MSPA 1LXFC 1YUTA 3CR4X 2H2KA 2OS8C 3HCMA 1B47A 1ALVA 3DVMA 1A4PA 2COLB 2NXQA 2I18A 1WLMA 1JBAA 3KHEA 3EVRA 2F33A 4OR9B 3OX6A 4QJ3B 1QIVA 1CMFA 2LP2A 2HQ8A 1A75A 4L9MA 3BUNB 3A8RA 4U8DA 1OSAA 5I2LA 4XJKB 2R2IA 1QLKA 1PSRA 2Y1NA 3JVTB 2NLNA 2LVKA 3NSOA 2KBMA 1N65A 4M2PA 1IKUA 1CDNA 2D8NA 2LMVA 1Q80A 2H61C 3IQOA 1IJ6A 1YUSA 1ZUZA 3M0WA 5PALA 2O5GA 3AAKA 1M39A 1BR4B 1UHKA 1XVJA 2CNPA 2M49B 1KFUL 4M2OA 1Y1XA 1BG1A 4YI9A 4DIRA 1CLLA 1HQVA 1SCMB 1RK9A 2K8MB 2ZN9A 5CSJA 2PRUA 1DJHA 2MAZA 4AOMA 3KPXA 1CLBA 2MRDA 1XYDA 1KQMB 1DJIA 2EGDA 3LK0A 1UURA 2EC6B 5D69A 1FF1A 3BOWB 1SW8A 2KSPA 1NUBA 1QJTA 1MHOA 1K96A 3I5IB 1EL4A 3SG4A 4HRGA 5AFPA 1EG4A 1KSMA 2GV5A 1CM4A 1G8IA 1LA0A 2NCOA 4DRWA 1CFFA 1IQ5A 2ZNEA 4N1GA 1UHJA 1EJ3A 2WNDA 3ZNIA 4E68A 1B8CA 1S6CA 1PRWA 1R2UA 4HRHA 4ZCUA 1B7TZ 1WRLA 2I2RE 2JU0A 1CMGA 1M31A 1Y1UA 1KWOB 2F3ZA 1ALWA 1YTZC 2K7OA 1NCZA 1S5GY 2LE9B 2TN4A 4OVNF 3JTDC 2ZRTA 1JSAA 2JXCA 3DD4A 2KFHA 3PN7B 1UHNA 2LLUA 2E6WA 1LA3A 1XK4A 1RJVA 4DCKA 1JF0A 2OS8B 1TOPA 1AK8A 2M3WA 1LKJA 4GNKB 1DVIA 3H4SE 4GGFC 2BKIB 4CPVA 3LLEA 3PALA 1YURA 1HT9A 2L50A 4QJ4B 1OZSA 1J55A 1C07A 4WRIA 4C0KA 4ICBA 1JC2A 4IL1A 1K9KA 1A29A 1XFZO 1TNWA 2JOJA 1CTRA 1CKKA 2BBNA 3IQQA 4HREE 1PULA 1K95A 1SBJA 3BQ3A 2K7BA 4A4BA 1YRTB 1SYMA 2JC2A 2KDHA 3AKAA 1C7VA 4P2YB 5KU1A 1S36A 2KQ6A 1BF5A 3FIAA 1FPWA 1IG5A 4CFQA 2JZIA 1C7WA 1QTXA 1L2OB 2BCBA 2BE6A 2K7CA 4MZJA 2WOSA 3NXAA 5D7FA 4F0ZB 1GQMA 2K0JA 1Y0VH 3PM8A 1IRJA 1PK0D 1NPQA 1BOCA 1Y6WA 1RECA 3LCPC 2JT3A 4N1FA 1KFXS 2QPTA 1MXEA 1SKTA 1BMOA 1MR8A 3CR5X 1YR5A 5FYXA 1XFWO 2LHIA 1NIWA 1E8AA 1TCOB 2GGMA 4YI8A 3PLFB 4ORAB 5JJGA 1K9UA 2BL0C 1QX7A 3JTDB 3K21A 1K9PA 1TNPA 3SG7A 3AKBA 2BE4A 5CSIA 2PVBA 2CXJA 1J7OA 1KSOA 4C0JA 3CWGA 1JFKA 1M46A 1V1FA 2LHLA 4WQ2A 2JT8A 2L98A 1UWOA 2NCPA 2SASA 2ZKMX 3EVVA 4XJKA 1NWDA 2ISDA 1B9AA 3BYAA 2LUCA 1FBVA 3CLNA 3EK8A 1Y1AA 2O60A 3O78A 1B8LA 3E3RA 1K94A 3PATA 2PSRA 2L2EA 4MLWA 4CIDA 1NX0A 2ZNDA 2M9GA 3DVKA 1G4YR 3TZ1A 2ZFDA 1RFJA 2JTZA 3VRPA 2OTGB 5ER5A 4YBHB 4YGBB 3CGAA 1PVAA 2JT0A 1UHIA 4YGCB 2F8PA 1QV0A 2ZN8A 1U5IB 2M97A 1B7TY 2KGRA 1J1DA 3BOWA 5HKZA 1QXPA 4NDBA 1LVCD 4USLA 2A4JA 4FTGA 2CBLA 1XO5A 5DKRA 3SG6A 1KK7Z 3AAJA 2KI6C 1RROA 3EVUA 2F2PA 3TS5C 4YGEB 5K89A 4DUQA 3WNXB 2WORA 2LVIA 2I7AA 5GQQC 5CSNA 1KQVA 1VRKA 3VGOA 3VRQA 2AAOA 4ORBB 1MQ1A 3RM1A 2JULA 1J7QA 2M7NA 3SG2A 3VRRA 1XFUO 2F2OA 1OZOA 2LM5A 3O4YA 4QJ5B 4HSZA 3SG3A 2B1UA 2HPSA 1OQPA 4WQ3A 3SIAA 1NX3A 1SR6C 1KFXL 2BL0B 2K61A 1SCVA 3GOFA 2Q4UA 4PHMA 3GK2A 4PE4A 5HLOA 2HETA 2LMUA 3TUYC 1L7ZA 1J7PA 1FI6A 1SRAA 1QATA 3FWCA 3NSIA 1JFJA 1FI5A 1YX8A 2L5XB 5B8IB 2KAXA 5ER4X 1OE9B 3DVJA 3EKHA 3TDUA 1DMOA 1DT7B 1YRUB 4R1EA 2L4IA 4ZCVA 1AP4A 1CFDA 4GUKA 1JF2A 1TCFA 4MBEA 1TTXA 1EG3A 3OB2B 4JPZB 2H61A 3PSRA 1M45A 2ZRSA 4OCIA 5HYDA 3SJSA 3ICBA 1RTP1 2KAYA 5JOLA 2QACA 1F70A 1AHRA 1FW4A 1K93D 1PALA 5DKNA 1QV1A 5HLVA 1QX2A 4UPGA 1KCYA 1UHHA 1WDCC 1CFCA 1CLMA 1AJ4A 1QASA
chains in the Genus database with same CATH superfamily
1QVIZ 1S6IA 5CSFA 1TWOA 2WCHA 3D10A 3D0YB 2PALA 3BUOB 2K2AA 3DVEA 4F7FA 2KLEA 2E30A 1YVLA 4N5XA 1CM1A 1QWVA 4I5JA 3CZ0A 5I2QA 1N2DA 2LUXA 1C3ZA 2LANA 1K2HA 1IWQA 4GPLB 1BODA 3TS5B 2Y5IA 4BY4A 5HKWA 3KF9A 3FE9A 4MRXA 4NDCA 2JTTA 1SNLA 1LS8A 2I94A 1TIZA 1DJWA 5EL2A 5DKQA 1B8RA 1SY9A 3B7AA 4PHJA 3PM2A 4MN0A 2P71A 3SS5A 2GGZA 4A4CA 3I5FC 4GAOA 4MVFA 4P5OE 4PCWA 4PHKA 2K2FA 4PDZA 3SIBA 3QRXA 4YRUA 2CT9A 1CFPA 1DF0B 2QEHA 3BXKA 4TNCA 2KQYA 1DGUA 1OMDA 1ORGA 2KOTA 4OV2A 1QLSA 1SR6B 1CDMA 2AMIA 5FI7A 3I5IC 2KAVA 3OHMB 4GGFA 1SL9A 3DF0B 3TUYB 3TDIA 2JQ6A 3B86A 3EK7A 1GJYA 1SK6D 1ODBA 3GK4X 1JUOA 3OB1B 4OKHA 3S0DA 1DJXA 2MJWB 2JNXA 5TNCA 2LLTA 1BU3A 3FE6A 3OP0A 4GFTA 1S6JA 2FJUB 4PHNA 4OZDA 1QX5B 2Q91A 4MZLA 3EKJA 5KTYA 1UUSA 2VRGA 1TN4A 4PE7A 1NCXA 1U5IA 1CDLA 2WCFA 2Y4QA 5F6TA 4BY5A 3LL8B 4GBAA 4ORCB 1A03A 1IH0A 4AQJA 4C0LA 1OOJA 3F45A 2LC5A 2MA2A 1CNPA 1YX7A 3I5GC 2DOQA 2JRFA 3S0FA 1NX2A 1WDCB 1PVBA 2H8VA 4YGDB 1P28A 1AVSA 2EHBA 1IGVA 1S3PA 1F4QA 2LNKA 2FCEA 2MLEC 1K90D 4MRYA 2JXLA 3PFVA 1TUJA 1XK4C 3R72A 1SPYA 4PT1A 5AERA 2F3YA 1EH2A 2LV7A 2LAPA 3CS1A 2KBIA 4PE0A 2BECA 4NDDA 4I5KA 1XFVO 2K7DA 4NQGA 1K8UA 2KI6D 1H4BA 3CTNA 3UNWA 1A2XA 1ZMZA 1MWNA 4JWQA 2M7LA 1MF8B 1NYAA 2JWWA 3S0BA 1GGWA 1WLZA 1WRKA 4CLNA 1A75B 4I5NB 4PE1A 1TNXA 3L4AA 3I5FB 3MSEB 2V53A 5AANA 1AUIB 2KGBC 2KI4C 5BPJA 1XFXO 5IBWA 1ZACA 3GK1A 1XFYO 5HL1A 1OW4A 1XA5A 3D76A 4I5LB 1PSBA 2KYCA 4JKTA 5HKYA 2FJYA 3VB1A 1B4CA 1SSEB 1KK8C 2IS9A 3ZWHA 2LP3A 3NSLA 1RWYA 3I5HC 3IVTA 2NZ0A 3EK4A 3BUXB 1BR1B 1L2OC 2WCEA 3KEVA 1F4OA 4MEWA 5AEQA 2KFGA 1NCYA 3B88A 3HX4A 2BCXA 2MHHA 1NX1A 2WCJA 1QIWA 3D74A 1H8BA 2K60A 3SS3A 1G33A 3CDNA 1QVIY 1GGZA 5CPVA 4CFRA 2KHNA 3IF7A 2OPOA 4M2QA 5G08A 2WC6A 1J7RA 1BJFA 1NSHA 2M29A 2QDIA 1OMRA 3OX5A 1DJZA 4FQOA 1MXLC 3OGNA 2G9BA 3B87A 1SL7A 1AJ5A 1BLQA 3D0YA 5FI6A 2L0PA 3BUWB 2G2BA 2KFFA 4PALA 2AUCA 1JWDA 1W7IB 1F54A 1N0YA 1IQ3A 2FOTA 2WCBA 3A4UB 3I5GB 3FS7A 4D1EA 4ETOA 4YGAA 1LINA 2M8UA 2PMYA 3O4XA 2BCAA 2KNEA 1DEKA 2WC8A 2MLFC 4JQ0D 1B1GA 1OMVA 3NHTA 2BBMA 3DZTA 3BUMB 1DTLA 3WHTB 1QS7A 3FWBA 1F55A 5AXIA 1S5GZ 4DS7A 1D1OA 1UP5A 3CR2A 3FE8A 3OBVA 3JVTC 2QEOA 1SL8A 1T14A 2M0RA 2RGIA 3NSKA 1TNQA 5KSZA 2M1UA 1KFUS 2OTGC 2P6BB 1DF0A 4GGNA 2HQWA 2SCPA 1ZOTB 2LCPA 1YUUA 3CZTX 4AQIA 2CTNA 1CDPA 1DJGA 2LMTA 3VRNA 5J3XA 1X02A 3CZ1A 1DGVA 1M63B 2FCDA 1R6PA 2KI4B 2JPTA 1DJYA 1WRZA 1J1EA 3WXAA 5I8NA 1SCMC 3DF0A 1EXRA 4MZKA 1ZFSA 2CCMA 3VROA 1S26D 1OOGA 1S1EA 1KK8B 2HF5A 3PJIA 4INXA 2L4HA 1KQMC 2MBXA 3O2PA 2EC6C 3BFAA 1SMGA 3I5HB 2LVVA 1WY9A 2JNFA 2LLSA 5I2OA 1BT6A 1YVHA 1NP8A 1IIOA 3RLZA 2KPHA 2PASA 3BJHA 2KYFA 3O6BA 1F8HA 2QEBA 2M1KB 3KO0A 3B6XA 1IJ5A 1CB1A 1KWOC 1MUXA 3C1VA 2BKHB 1TRFA 1V1GA 3SG5A 1OOIX 2LVJA 1KK7Y 4XYNA 2L51A 1F71A 3BFHA 3LK1A 2Y1MA 4Q04A 1W7JB 3TDZA 3PN7C 3WHUB 4MSPA 1LXFC 1YUTA 3CR4X 2H2KA 2OS8C 3HCMA 1Z2CB 1B47A 1ALVA 3DVMA 1A4PA 2COLB 2NXQA 2I18A 1WLMA 3NGVA 1JBAA 3KHEA 3EVRA 2F33A 4OR9B 3OX6A 3D75A 4QJ3B 1QIVA 1CMFA 2LP2A 2HQ8A 1A75A 4L9MA 3S0EA 3BUNB 3A8RA 4U8DA 1OSAA 5I2LA 4XJKB 2R2IA 1QLKA 1PSRA 2Y1NA 3JVTB 2NLNA 2LVKA 3NSOA 2KBMA 1N65A 4M2PA 1IKUA 1CDNA 2D8NA 4INWA 2LMVA 1Q80A 2H61C 3IQOA 1IJ6A 1YUSA 1ZUZA 3M0WA 3N7HA 5PALA 3CYZA 2O5GA 3AAKA 1M39A 1BR4B 1UHKA 1XVJA 2CNPA 2M49B 1KFUL 4M2OA 1Y1XA 1BG1A 4YI9A 4DIRA 1CLLA 1HQVA 1SCMB 1RK9A 2K8MB 2ZN9A 5CSJA 2PRUA 1DJHA 2MAZA 4AOMA 3KPXA 1CLBA 2MRDA 2QEVA 1XYDA 1KQMB 1DJIA 2EGDA 3LK0A 1UURA 2EC6B 5D69A 1FF1A 3BOWB 1SW8A 2KSPA 1NUBA 1QJTA 1MHOA 1K96A 3I5IB 1EL4A 3SG4A 4HRGA 5AFPA 1EG4A 1KSMA 2GV5A 1CM4A 1G8IA 1LA0A 2NCOA 4DRWA 1CFFA 1IQ5A 2ZNEA 1XFRA 1UHJA 4N1GA 1EJ3A 2WNDA 3ZNIA 4E68A 1B8CA 1S6CA 1PRWA 1R2UA 4HRHA 4ZCUA 1B7TZ 1WRLA 2I2RE 2JU0A 1CMGA 1M31A 2BNXA 1Y1UA 1KWOB 2F3ZA 1ALWA 1YTZC 2K7OA 1NCZA 1S5GY 2LE9B 2TN4A 5I94A 4OVNF 3S0AA 3JTDC 2ZRTA 1JSAA 2JXCA 3DD4A 1DELA 2KFHA 3PN7B 1UHNA 2LLUA 2E6WA 1LA3A 1XK4A 1RJVA 4DCKA 1JF0A 2OS8B 1TOPA 2ERBA 1AK8A 2M3WA 1LKJA 4GNKB 1DVIA 1TUZA 3H4SE 3CZ2A 2BKIB 4GGFC 3LLEA 3PALA 4CPVA 1YURA 1HT9A 2L50A 4QJ4B 1OZSA 1J55A 1C07A 4WRIA 3S0GA 4FQTA 4C0KA 1DQEA 4ICBA 1JC2A 4IL1A 1K9KA 3R1OA 3L4LA 1A29A 3V2LA 1XFZO 2BAPA 3D73A 1TNWA 2L2CA 2JOJA 1CTRA 1CKKA 1OOHA 2BBNA 3IQQA 4HREE 1PULA 1K95A 1SBJA 3BQ3A 3DYEA 3QMEA 2K7BA 4A4BA 3D77A 1YRTB 1SYMA 2JC2A 2KDHA 3AKAA 1C7VA 4P2YB 5KU1A 1S36A 2KQ6A 1BF5A 1OOFA 3FIAA 5D3OA 1IG5A 4CFQA 1FPWA 2JZIA 1C7WA 1QTXA 1L2OB 2BCBA 2BE6A 2K7CA 4MZJA 2WOSA 2GTEA 3NXAA 1GM0A 4IJ7A 5D7FA 4F0ZB 1GQMA 2K0JA 1Y0VH 3PM8A 1IRJA 1PK0D 1NPQA 1BOCA 1Y6WA 1RECA 3LCPC 2JT3A 4N1FA 1KFXS 2QPTA 1MXEA 1SKTA 1BMOA 1MR8A 3CR5X 1YR5A 5FYXA 1XFWO 2LHIA 1NIWA 1E8AA 1TCOB 2GGMA 2KLDA 4YI8A 3PLFB 4ORAB 5JJGA 1K9UA 2BL0C 1QX7A 3JTDB 3K21A 3K1EA 1K9PA 1TNPA 3SG7A 3AKBA 2BE4A 5CSIA 2PVBA 2CXJA 1J7OA 2L5YA 1KSOA 4C0JA 3CWGA 1JFKA 1M46A 2P70A 1V1FA 2LHLA 2WCKA 4WQ2A 2JT8A 2L98A 1UWOA 2NCPA 2SASA 2ZKMX 3EVVA 4XJKA 4KYNA 1NWDA 3CABA 2ISDA 1B9AA 3BYAA 2LUCA 1FBVA 3CLNA 3EK8A 3UO9A 1Y1AA 2O60A 3O78A 1B8LA 3E3RA 3R1PA 1K94A 3PATA 2PSRA 2L2EA 4MLWA 2PYQA 4CIDA 1NX0A 2ZNDA 2JPOA 2M9GA 3DVKA 1G4YR 3TZ1A 2ZFDA 2PQLA 1RFJA 2JTZA 3VRPA 2OTGB 5ER5A 4YBHB 4YGBB 3CGAA 1PVAA 3RZSA 2JT0A 1UHIA 4YGCB 2F8PA 1QV0A 2WCLA 2ZN8A 1U5IB 2M97A 1B7TY 2KGRA 1J1DA 3BOWA 5HKZA 1QXPA 4NDBA 1LVCD 4USLA 2A4JA 4FTGA 2CBLA 3BFBA 1XO5A 5DKRA 3SG6A 1KK7Z 3AAJA 5DICA 2KI6C 1RROA 3EVUA 2F2PA 3TS5C 1C3YA 4YGEB 3EG5B 5K89A 4DUQA 3WNXB 2WORA 2LVIA 2I7AA 5GQQC 5CSNA 1KQVA 1VRKA 2YGUA 3VGOA 3VRQA 2AAOA 4ORBB 1MQ1A 3RM1A 2JULA 1J7QA 2M7NA 3SG2A 3VRRA 3R1VA 1XFUO 2F2OA 1OZOA 2LM5A 3O4YA 4QJ5B 4HSZA 3SG3A 2B1UA 2HPSA 1OQPA 4WQ3A 3SIAA 1NX3A 1SR6C 1KFXL 2BL0B 2K61A 1SCVA 3GOFA 2Q4UA 5FI2A 4PHMA 3GK2A 2WC5A 4PE4A 5HLOA 2HETA 2LMUA 3TUYC 1L7ZA 3Q8IA 1J7PA 1FI6A 1SRAA 1QATA 3FWCA 3NSIA 1JFJA 1FI5A 1YX8A 2L5XB 5B8IB 3DY9A 2KAXA 5ER4X 1OE9B 3DVJA 3EKHA 3TDUA 1DMOA 1DT7B 1YRUB 3L47A 4R1EA 2L4IA 4ZCVA 1AP4A 1CFDA 4GUKA 2WCMA 1JF2A 1TCFA 3D78A 4MBEA 1TTXA 1EG3A 3OB2B 4JPZB 2H61A 3PSRA 1M45A 2ZRSA 4OCIA 5HYDA 1Z4HA 3SJSA 3ICBA 1RTP1 2KAYA 3SS4A 5JOLA 2QACA 1DC1A 1F70A 4JD9A 1AHRA 1FW4A 1K93D 1PALA 5DKNA 1QV1A 5HLVA 1QX2A 4UPGA 3DXLA 1UHHA 1KCYA 1WDCC 3NHIA 1W9ZA 1CFCA 1CLMA 1AJ4A 1QASA
chains in the Genus database with same CATH topology
1QVIZ 1S6IA 5CSFA 3D0YB 3D10A 2PALA 3BUOB 2K2AA 3DVEA 2E30A 1YVLA 4N5XA 1CM1A 4I5JA 5I2QA 1N2DA 2LUXA 2LANA 1K2HA 1IWQA 4GPLB 1BODA 3TS5B 2Y5IA 4BY4A 5HKWA 3KF9A 4NDCA 4MRXA 2JTTA 1SNLA 2I94A 1TIZA 1DJWA 5DKQA 1B8RA 1SY9A 4PHJA 4MN0A 4A4CA 2GGZA 3I5FC 4GAOA 4MVFA 4P5OE 4PCWA 4PHKA 2K2FA 4PDZA 3SIBA 3QRXA 4YRUA 2CT9A 1CFPA 1DF0B 3BXKA 4TNCA 2KQYA 1DGUA 1OMDA 2KOTA 4OV2A 1QLSA 1SR6B 1CDMA 2AMIA 3I5IC 2KAVA 3OHMB 4GGFA 1SL9A 3DF0B 3TUYB 3TDIA 2JQ6A 3EK7A 1GJYA 1SK6D 1ODBA 3GK4X 1JUOA 3OB1B 4OKHA 1DJXA 2MJWB 2JNXA 5TNCA 2LLTA 1BU3A 3OP0A 4GFTA 1S6JA 2FJUB 4PHNA 1QX5B 2Q91A 4MZLA 3EKJA 5KTYA 1UUSA 2VRGA 1TN4A 4PE7A 1NCXA 1U5IA 1CDLA 2WCFA 2Y4QA 5F6TA 4BY5A 3LL8B 4GBAA 4ORCB 1A03A 1IH0A 4AQJA 4C0LA 1OOJA 3F45A 2LC5A 2MA2A 1CNPA 1YX7A 3I5GC 2DOQA 2JRFA 1NX2A 1WDCB 1PVBA 4YGDB 1AVSA 2EHBA 1IGVA 1S3PA 1F4QA 2LNKA 2FCEA 2MLEC 1K90D 4MRYA 2JXLA 3PFVA 1XK4C 1SPYA 5AERA 2F3YA 1EH2A 2LV7A 2LAPA 3CS1A 2KBIA 4PE0A 2BECA 4NDDA 4I5KA 1XFVO 2K7DA 4NQGA 1K8UA 2KI6D 1H4BA 3CTNA 1A2XA 1ZMZA 1MWNA 4JWQA 2M7LA 1MF8B 1NYAA 2JWWA 1GGWA 1WLZA 1WRKA 4CLNA 1A75B 4I5NB 4PE1A 1TNXA 3I5FB 3MSEB 2V53A 5AANA 1AUIB 2KGBC 2KI4C 5BPJA 1XFXO 5IBWA 1ZACA 3GK1A 1XFYO 1XA5A 4I5LB 1PSBA 2KYCA 5HKYA 1B4CA 1KK8C 2IS9A 3ZWHA 2LP3A 3NSLA 1RWYA 3I5HC 2NZ0A 3EK4A 3BUXB 1BR1B 1L2OC 2WCEA 3KEVA 1F4OA 4MEWA 5AEQA 2KFGA 1NCYA 3HX4A 2BCXA 2MHHA 1NX1A 1QIWA 1H8BA 1G33A 1QVIY 1GGZA 5CPVA 4CFRA 2KHNA 3IF7A 2OPOA 4M2QA 5G08A 1J7RA 1BJFA 1NSHA 2M29A 1OMRA 3OX5A 1DJZA 4FQOA 1MXLC 2G9BA 1SL7A 1AJ5A 1BLQA 3D0YA 2L0PA 3BUWB 2G2BA 2KFFA 4PALA 2AUCA 1JWDA 1W7IB 1F54A 1N0YA 1IQ3A 2FOTA 2WCBA 3A4UB 3I5GB 3FS7A 4D1EA 4ETOA 4YGAA 1LINA 2M8UA 2PMYA 2BCAA 2KNEA 2WC8A 2MLFC 4JQ0D 1B1GA 1OMVA 2BBMA 3BUMB 1DTLA 3WHTB 1QS7A 3FWBA 1F55A 5AXIA 1S5GZ 4DS7A 1D1OA 1UP5A 3CR2A 3JVTC 1SL8A 2M0RA 2RGIA 3NSKA 5KSZA 1TNQA 2M1UA 1KFUS 2OTGC 2P6BB 1DF0A 4GGNA 2HQWA 2SCPA 1ZOTB 2LCPA 1YUUA 3CZTX 4AQIA 2CTNA 1CDPA 1DJGA 2LMTA 3VRNA 5J3XA 1X02A 1DGVA 1M63B 2FCDA 1R6PA 2KI4B 2JPTA 1DJYA 1WRZA 1J1EA 3WXAA 5I8NA 1SCMC 3DF0A 1EXRA 4MZKA 1ZFSA 2CCMA 3VROA 1S26D 1S1EA 1KK8B 2HF5A 2L4HA 1KQMC 2MBXA 3O2PA 2EC6C 3I5HB 1SMGA 2LVVA 1WY9A 2JNFA 2LLSA 5I2OA 1BT6A 1YVHA 1NP8A 3RLZA 2PASA 2KYFA 3O6BA 1F8HA 2M1KB 3KO0A 1CB1A 1IJ5A 1KWOC 1MUXA 3C1VA 2BKHB 1TRFA 1V1GA 3SG5A 2LVJA 1KK7Y 4XYNA 2L51A 1F71A 3LK1A 2Y1MA 4Q04A 1W7JB 3TDZA 3PN7C 3WHUB 4MSPA 1LXFC 1YUTA 3CR4X 2H2KA 2OS8C 3HCMA 1B47A 1ALVA 3DVMA 1A4PA 2COLB 2NXQA 2I18A 1WLMA 1JBAA 3KHEA 3EVRA 2F33A 4OR9B 3OX6A 4QJ3B 1QIVA 1CMFA 2LP2A 2HQ8A 1A75A 4L9MA 3BUNB 3A8RA 4U8DA 1OSAA 5I2LA 4XJKB 2R2IA 1QLKA 1PSRA 2Y1NA 3JVTB 2NLNA 2LVKA 3NSOA 2KBMA 1N65A 4M2PA 1IKUA 1CDNA 2D8NA 2LMVA 1Q80A 2H61C 3IQOA 1IJ6A 1YUSA 1ZUZA 3M0WA 5PALA 2O5GA 3AAKA 1M39A 1BR4B 1UHKA 1XVJA 2CNPA 2M49B 1KFUL 4M2OA 1Y1XA 1BG1A 4YI9A 4DIRA 1CLLA 1HQVA 1SCMB 1RK9A 2K8MB 2ZN9A 5CSJA 2PRUA 1DJHA 2MAZA 4AOMA 3KPXA 1CLBA 2MRDA 1XYDA 1KQMB 1DJIA 2EGDA 3LK0A 1UURA 2EC6B 5D69A 1FF1A 3BOWB 1SW8A 2KSPA 1NUBA 1QJTA 1MHOA 1K96A 3I5IB 1EL4A 3SG4A 4HRGA 5AFPA 1EG4A 1KSMA 2GV5A 1CM4A 1G8IA 1LA0A 2NCOA 4DRWA 1CFFA 1IQ5A 2ZNEA 4N1GA 1UHJA 1EJ3A 2WNDA 3ZNIA 4E68A 1B8CA 1S6CA 1PRWA 1R2UA 4HRHA 4ZCUA 1B7TZ 1WRLA 2I2RE 2JU0A 1CMGA 1M31A 1Y1UA 1KWOB 2F3ZA 1ALWA 1YTZC 2K7OA 1NCZA 1S5GY 2LE9B 2TN4A 4OVNF 3JTDC 2ZRTA 1JSAA 2JXCA 3DD4A 2KFHA 3PN7B 1UHNA 2LLUA 2E6WA 1LA3A 1XK4A 1RJVA 4DCKA 1JF0A 2OS8B 1TOPA 1AK8A 2M3WA 1LKJA 4GNKB 1DVIA 3H4SE 4GGFC 2BKIB 4CPVA 3LLEA 3PALA 1YURA 1HT9A 2L50A 4QJ4B 1OZSA 1J55A 1C07A 4WRIA 4C0KA 4ICBA 1JC2A 4IL1A 1K9KA 1A29A 1XFZO 1TNWA 2JOJA 1CTRA 1CKKA 2BBNA 3IQQA 4HREE 1PULA 1K95A 1SBJA 3BQ3A 2K7BA 4A4BA 1YRTB 1SYMA 2JC2A 2KDHA 3AKAA 1C7VA 4P2YB 5KU1A 1S36A 2KQ6A 1BF5A 3FIAA 1FPWA 1IG5A 4CFQA 2JZIA 1C7WA 1QTXA 1L2OB 2BCBA 2BE6A 2K7CA 4MZJA 2WOSA 3NXAA 5D7FA 4F0ZB 1GQMA 2K0JA 1Y0VH 3PM8A 1IRJA 1PK0D 1NPQA 1BOCA 1Y6WA 1RECA 3LCPC 2JT3A 4N1FA 1KFXS 2QPTA 1MXEA 1SKTA 1BMOA 1MR8A 3CR5X 1YR5A 5FYXA 1XFWO 2LHIA 1NIWA 1E8AA 1TCOB 2GGMA 4YI8A 3PLFB 4ORAB 5JJGA 1K9UA 2BL0C 1QX7A 3JTDB 3K21A 1K9PA 1TNPA 3SG7A 3AKBA 2BE4A 5CSIA 2PVBA 2CXJA 1J7OA 1KSOA 4C0JA 3CWGA 1JFKA 1M46A 1V1FA 2LHLA 4WQ2A 2JT8A 2L98A 1UWOA 2NCPA 2SASA 2ZKMX 3EVVA 4XJKA 1NWDA 2ISDA 1B9AA 3BYAA 2LUCA 1FBVA 3CLNA 3EK8A 1Y1AA 2O60A 3O78A 1B8LA 3E3RA 1K94A 3PATA 2PSRA 2L2EA 4MLWA 4CIDA 1NX0A 2ZNDA 2M9GA 3DVKA 1G4YR 3TZ1A 2ZFDA 1RFJA 2JTZA 3VRPA 2OTGB 5ER5A 4YBHB 4YGBB 3CGAA 1PVAA 2JT0A 1UHIA 4YGCB 2F8PA 1QV0A 2ZN8A 1U5IB 2M97A 1B7TY 2KGRA 1J1DA 3BOWA 5HKZA 1QXPA 4NDBA 1LVCD 4USLA 2A4JA 4FTGA 2CBLA 1XO5A 5DKRA 3SG6A 1KK7Z 3AAJA 2KI6C 1RROA 3EVUA 2F2PA 3TS5C 4YGEB 5K89A 4DUQA 3WNXB 2WORA 2LVIA 2I7AA 5GQQC 5CSNA 1KQVA 1VRKA 3VGOA 3VRQA 2AAOA 4ORBB 1MQ1A 3RM1A 2JULA 1J7QA 2M7NA 3SG2A 3VRRA 1XFUO 2F2OA 1OZOA 2LM5A 3O4YA 4QJ5B 4HSZA 3SG3A 2B1UA 2HPSA 1OQPA 4WQ3A 3SIAA 1NX3A 1SR6C 1KFXL 2BL0B 2K61A 1SCVA 3GOFA 2Q4UA 4PHMA 3GK2A 4PE4A 5HLOA 2HETA 2LMUA 3TUYC 1L7ZA 1J7PA 1FI6A 1SRAA 1QATA 3FWCA 3NSIA 1JFJA 1FI5A 1YX8A 2L5XB 5B8IB 2KAXA 5ER4X 1OE9B 3DVJA 3EKHA 3TDUA 1DMOA 1DT7B 1YRUB 4R1EA 2L4IA 4ZCVA 1AP4A 1CFDA 4GUKA 1JF2A 1TCFA 4MBEA 1TTXA 1EG3A 3OB2B 4JPZB 2H61A 3PSRA 1M45A 2ZRSA 4OCIA 5HYDA 3SJSA 3ICBA 1RTP1 2KAYA 5JOLA 2QACA 1F70A 1AHRA 1FW4A 1K93D 1PALA 5DKNA 1QV1A 5HLVA 1QX2A 4UPGA 1KCYA 1UHHA 1WDCC 1CFCA 1CLMA 1AJ4A 1QASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVI Z;  1S6I A;  5CSF A;  3D0Y B;  3D10 A;  2PAL A;  3BUO B;  2K2A A;  3DVE A;  2E30 A;  1YVL A;  4N5X A;  1CM1 A;  4I5J A;  5I2Q A;  1N2D A;  2LUX A;  2LAN A;  1K2H A;  1IWQ A;  4GPL B;  1BOD A;  3TS5 B;  2Y5I A;  4BY4 A;  5HKW A;  3KF9 A;  4NDC A;  4MRX A;  2JTT A;  1SNL A;  2I94 A;  1TIZ A;  1DJW A;  5DKQ A;  1B8R A;  1SY9 A;  4PHJ A;  4MN0 A;  4A4C A;  2GGZ A;  3I5F C;  4GAO A;  4MVF A;  4P5O E;  4PCW A;  4PHK A;  2K2F A;  4PDZ A;  3SIB A;  3QRX A;  4YRU A;  2CT9 A;  1CFP A;  1DF0 B;  3BXK A;  4TNC A;  2KQY A;  1DGU A;  1OMD A;  2KOT A;  4OV2 A;  1QLS A;  1SR6 B;  1CDM A;  2AMI A;  3I5I C;  2KAV A;  3OHM B;  4GGF A;  1SL9 A;  3DF0 B;  3TUY B;  3TDI A;  2JQ6 A;  3EK7 A;  1GJY A;  1SK6 D;  1ODB A;  3GK4 X;  1JUO A;  3OB1 B;  4OKH A;  1DJX A;  2MJW B;  2JNX A;  5TNC A;  2LLT A;  1BU3 A;  3OP0 A;  4GFT A;  1S6J A;  2FJU B;  4PHN A;  1QX5 B;  2Q91 A;  4MZL A;  3EKJ A;  5KTY A;  1UUS A;  2VRG A;  1TN4 A;  4PE7 A;  1NCX A;  1U5I A;  1CDL A;  2WCF A;  2Y4Q A;  5F6T A;  4BY5 A;  3LL8 B;  4GBA A;  4ORC B;  1A03 A;  1IH0 A;  4AQJ A;  4C0L A;  1OOJ A;  3F45 A;  2LC5 A;  2MA2 A;  1CNP A;  1YX7 A;  3I5G C;  2DOQ A;  2JRF A;  1NX2 A;  1WDC B;  1PVB A;  4YGD B;  1AVS A;  2EHB A;  1IGV A;  1S3P A;  1F4Q A;  2LNK A;  2FCE A;  2MLE C;  1K90 D;  4MRY A;  2JXL A;  3PFV A;  1XK4 C;  1SPY A;  5AER A;  2F3Y A;  1EH2 A;  2LV7 A;  2LAP A;  3CS1 A;  2KBI A;  4PE0 A;  2BEC A;  4NDD A;  4I5K A;  1XFV O;  2K7D A;  4NQG A;  1K8U A;  2KI6 D;  1H4B A;  3CTN A;  1A2X A;  1ZMZ A;  1MWN A;  4JWQ A;  2M7L A;  1MF8 B;  1NYA A;  2JWW A;  1GGW A;  1WLZ A;  1WRK A;  4CLN A;  1A75 B;  4I5N B;  4PE1 A;  1TNX A;  3I5F B;  3MSE B;  2V53 A;  5AAN A;  1AUI B;  2KGB C;  2KI4 C;  5BPJ A;  1XFX O;  5IBW A;  1ZAC A;  3GK1 A;  1XFY O;  1XA5 A;  4I5L B;  1PSB A;  2KYC A;  5HKY A;  1B4C A;  1KK8 C;  2IS9 A;  3ZWH A;  2LP3 A;  3NSL A;  1RWY A;  3I5H C;  2NZ0 A;  3EK4 A;  3BUX B;  1BR1 B;  1L2O C;  2WCE A;  3KEV A;  1F4O A;  4MEW A;  5AEQ A;  2KFG A;  1NCY A;  3HX4 A;  2BCX A;  2MHH A;  1NX1 A;  1QIW A;  1H8B A;  1G33 A;  1QVI Y;  1GGZ A;  5CPV A;  4CFR A;  2KHN A;  3IF7 A;  2OPO A;  4M2Q A;  5G08 A;  1J7R A;  1BJF A;  1NSH A;  2M29 A;  1OMR A;  3OX5 A;  1DJZ A;  4FQO A;  1MXL C;  2G9B A;  1SL7 A;  1AJ5 A;  1BLQ A;  3D0Y A;  2L0P A;  3BUW B;  2G2B A;  2KFF A;  4PAL A;  2AUC A;  1JWD A;  1W7I B;  1F54 A;  1N0Y A;  1IQ3 A;  2FOT A;  2WCB A;  3A4U B;  3I5G B;  3FS7 A;  4D1E A;  4ETO A;  4YGA A;  1LIN A;  2M8U A;  2PMY A;  2BCA A;  2KNE A;  2WC8 A;  2MLF C;  4JQ0 D;  1B1G A;  1OMV A;  2BBM A;  3BUM B;  1DTL A;  3WHT B;  1QS7 A;  3FWB A;  1F55 A;  5AXI A;  1S5G Z;  4DS7 A;  1D1O A;  1UP5 A;  3CR2 A;  3JVT C;  1SL8 A;  2M0R A;  2RGI A;  3NSK A;  5KSZ A;  1TNQ A;  2M1U A;  1KFU S;  2OTG C;  2P6B B;  1DF0 A;  4GGN A;  2HQW A;  2SCP A;  1ZOT B;  2LCP A;  1YUU A;  3CZT X;  4AQI A;  2CTN A;  1CDP A;  1DJG A;  2LMT A;  3VRN A;  5J3X A;  1X02 A;  1DGV A;  1M63 B;  2FCD A;  1R6P A;  2KI4 B;  2JPT A;  1DJY A;  1WRZ A;  1J1E A;  3WXA A;  5I8N A;  1SCM C;  3DF0 A;  1EXR A;  4MZK A;  1ZFS A;  2CCM A;  3VRO A;  1S26 D;  1S1E A;  1KK8 B;  2HF5 A;  2L4H A;  1KQM C;  2MBX A;  3O2P A;  2EC6 C;  3I5H B;  1SMG A;  2LVV A;  1WY9 A;  2JNF A;  2LLS A;  5I2O A;  1BT6 A;  1YVH A;  1NP8 A;  3RLZ A;  2PAS A;  2KYF A;  3O6B A;  1F8H A;  2M1K B;  3KO0 A;  1CB1 A;  1IJ5 A;  1KWO C;  1MUX A;  3C1V A;  2BKH B;  1TRF A;  1V1G A;  3SG5 A;  2LVJ A;  1KK7 Y;  4XYN A;  2L51 A;  1F71 A;  3LK1 A;  2Y1M A;  4Q04 A;  1W7J B;  3TDZ A;  3PN7 C;  3WHU B;  4MSP A;  1LXF C;  1YUT A;  3CR4 X;  2H2K A;  2OS8 C;  3HCM A;  1B47 A;  1ALV A;  3DVM A;  1A4P A;  2COL B;  2NXQ A;  2I18 A;  1WLM A;  1JBA A;  3KHE A;  3EVR A;  2F33 A;  4OR9 B;  3OX6 A;  4QJ3 B;  1QIV A;  1CMF A;  2LP2 A;  2HQ8 A;  1A75 A;  4L9M A;  3BUN B;  3A8R A;  4U8D A;  1OSA A;  5I2L A;  4XJK B;  2R2I A;  1QLK A;  1PSR A;  2Y1N A;  3JVT B;  2NLN A;  2LVK A;  3NSO A;  2KBM A;  1N65 A;  4M2P A;  1IKU A;  1CDN A;  2D8N A;  2LMV A;  1Q80 A;  2H61 C;  3IQO A;  1IJ6 A;  1YUS A;  1ZUZ A;  3M0W A;  5PAL A;  2O5G A;  3AAK A;  1M39 A;  1BR4 B;  1UHK A;  1XVJ A;  2CNP A;  2M49 B;  1KFU L;  4M2O A;  1Y1X A;  1BG1 A;  4YI9 A;  4DIR A;  1CLL A;  1HQV A;  1SCM B;  1RK9 A;  2K8M B;  2ZN9 A;  5CSJ A;  2PRU A;  1DJH A;  2MAZ A;  4AOM A;  3KPX A;  1CLB A;  2MRD A;  1XYD A;  1KQM B;  1DJI A;  2EGD A;  3LK0 A;  1UUR A;  2EC6 B;  5D69 A;  1FF1 A;  3BOW B;  1SW8 A;  2KSP A;  1NUB A;  1QJT A;  1MHO A;  1K96 A;  3I5I B;  1EL4 A;  3SG4 A;  4HRG A;  5AFP A;  1EG4 A;  1KSM A;  2GV5 A;  1CM4 A;  1G8I A;  1LA0 A;  2NCO A;  4DRW A;  1CFF A;  1IQ5 A;  2ZNE A;  4N1G A;  1UHJ A;  1EJ3 A;  2WND A;  3ZNI A;  4E68 A;  1B8C A;  1S6C A;  1PRW A;  1R2U A;  4HRH A;  4ZCU A;  1B7T Z;  1WRL A;  2I2R E;  2JU0 A;  1CMG A;  1M31 A;  1Y1U A;  1KWO B;  2F3Z A;  1ALW A;  1YTZ C;  2K7O A;  1NCZ A;  1S5G Y;  2LE9 B;  2TN4 A;  4OVN F;  3JTD C;  2ZRT A;  1JSA A;  2JXC A;  3DD4 A;  2KFH A;  3PN7 B;  1UHN A;  2LLU A;  2E6W A;  1LA3 A;  1XK4 A;  1RJV A;  4DCK A;  1JF0 A;  2OS8 B;  1TOP A;  1AK8 A;  2M3W A;  1LKJ A;  4GNK B;  1DVI A;  3H4S E;  4GGF C;  2BKI B;  4CPV A;  3LLE A;  3PAL A;  1YUR A;  1HT9 A;  2L50 A;  4QJ4 B;  1OZS A;  1J55 A;  1C07 A;  4WRI A;  4C0K A;  4ICB A;  1JC2 A;  4IL1 A;  1K9K A;  1A29 A;  1XFZ O;  1TNW A;  2JOJ A;  1CTR A;  1CKK A;  2BBN A;  3IQQ A;  4HRE E;  1PUL A;  1K95 A;  1SBJ A;  3BQ3 A;  2K7B A;  4A4B A;  1YRT B;  1SYM A;  2JC2 A;  2KDH A;  3AKA A;  1C7V A;  4P2Y B;  5KU1 A;  1S36 A;  2KQ6 A;  1BF5 A;  3FIA A;  1FPW A;  1IG5 A;  4CFQ A;  2JZI A;  1C7W A;  1QTX A;  1L2O B;  2BCB A;  2BE6 A;  2K7C A;  4MZJ A;  2WOS A;  3NXA A;  5D7F A;  4F0Z B;  1GQM A;  2K0J A;  1Y0V H;  3PM8 A;  1IRJ A;  1PK0 D;  1NPQ A;  1BOC A;  1Y6W A;  1REC A;  3LCP C;  2JT3 A;  4N1F A;  1KFX S;  2QPT A;  1MXE A;  1SKT A;  1BMO A;  1MR8 A;  3CR5 X;  1YR5 A;  5FYX A;  1XFW O;  2LHI A;  1NIW A;  1E8A A;  1TCO B;  2GGM A;  4YI8 A;  3PLF B;  4ORA B;  5JJG A;  1K9U A;  2BL0 C;  1QX7 A;  3JTD B;  3K21 A;  1K9P A;  1TNP A;  3SG7 A;  3AKB A;  2BE4 A;  5CSI A;  2PVB A;  2CXJ A;  1J7O A;  1KSO A;  4C0J A;  3CWG A;  1JFK A;  1M46 A;  1V1F A;  2LHL A;  4WQ2 A;  2JT8 A;  2L98 A;  1UWO A;  2NCP A;  2SAS A;  2ZKM X;  3EVV A;  4XJK A;  1NWD A;  2ISD A;  1B9A A;  3BYA A;  2LUC A;  1FBV A;  3CLN A;  3EK8 A;  1Y1A A;  2O60 A;  3O78 A;  1B8L A;  3E3R A;  1K94 A;  3PAT A;  2PSR A;  2L2E A;  4MLW A;  4CID A;  1NX0 A;  2ZND A;  2M9G A;  3DVK A;  1G4Y R;  3TZ1 A;  2ZFD A;  1RFJ A;  2JTZ A;  3VRP A;  2OTG B;  5ER5 A;  4YBH B;  4YGB B;  3CGA A;  1PVA A;  2JT0 A;  1UHI A;  4YGC B;  2F8P A;  1QV0 A;  2ZN8 A;  1U5I B;  2M97 A;  1B7T Y;  2KGR A;  1J1D A;  3BOW A;  5HKZ A;  1QXP A;  4NDB A;  1LVC D;  4USL A;  2A4J A;  4FTG A;  2CBL A;  1XO5 A;  5DKR A;  3SG6 A;  1KK7 Z;  3AAJ A;  2KI6 C;  1RRO A;  3EVU A;  2F2P A;  3TS5 C;  4YGE B;  5K89 A;  4DUQ A;  3WNX B;  2WOR A;  2LVI A;  2I7A A;  5GQQ C;  5CSN A;  1KQV A;  1VRK A;  3VGO A;  3VRQ A;  2AAO A;  4ORB B;  1MQ1 A;  3RM1 A;  2JUL A;  1J7Q A;  2M7N A;  3SG2 A;  3VRR A;  1XFU O;  2F2O A;  1OZO A;  2LM5 A;  3O4Y A;  4QJ5 B;  4HSZ A;  3SG3 A;  2B1U A;  2HPS A;  1OQP A;  4WQ3 A;  3SIA A;  1NX3 A;  1SR6 C;  1KFX L;  2BL0 B;  2K61 A;  1SCV A;  3GOF A;  2Q4U A;  4PHM A;  3GK2 A;  4PE4 A;  5HLO A;  2HET A;  2LMU A;  3TUY C;  1L7Z A;  1J7P A;  1FI6 A;  1SRA A;  1QAT A;  3FWC A;  3NSI A;  1JFJ A;  1FI5 A;  1YX8 A;  2L5X B;  5B8I B;  2KAX A;  5ER4 X;  1OE9 B;  3DVJ A;  3EKH A;  3TDU A;  1DMO A;  1DT7 B;  1YRU B;  4R1E A;  2L4I A;  4ZCV A;  1AP4 A;  1CFD A;  4GUK A;  1JF2 A;  1TCF A;  4MBE A;  1TTX A;  1EG3 A;  3OB2 B;  4JPZ B;  2H61 A;  3PSR A;  1M45 A;  2ZRS A;  4OCI A;  5HYD A;  3SJS A;  3ICB A;  1RTP 1;  2KAY A;  5JOL A;  2QAC A;  1F70 A;  1AHR A;  1FW4 A;  1K93 D;  1PAL A;  5DKN A;  1QV1 A;  5HLV A;  1QX2 A;  4UPG A;  1KCY A;  1UHH A;  1WDC C;  1CFC A;  1CLM A;  1AJ4 A;  1QAS A; 
#chains in the Genus database with same CATH topology
 1QVI Z;  1S6I A;  5CSF A;  1TWO A;  2WCH A;  3D10 A;  3D0Y B;  2PAL A;  3BUO B;  2K2A A;  3DVE A;  4F7F A;  2KLE A;  2E30 A;  1YVL A;  4N5X A;  1CM1 A;  1QWV A;  4I5J A;  3CZ0 A;  5I2Q A;  1N2D A;  2LUX A;  1C3Z A;  2LAN A;  1K2H A;  1IWQ A;  4GPL B;  1BOD A;  3TS5 B;  2Y5I A;  4BY4 A;  5HKW A;  3KF9 A;  3FE9 A;  4MRX A;  4NDC A;  2JTT A;  1SNL A;  1LS8 A;  2I94 A;  1TIZ A;  1DJW A;  5EL2 A;  5DKQ A;  1B8R A;  1SY9 A;  3B7A A;  4PHJ A;  3PM2 A;  4MN0 A;  2P71 A;  3SS5 A;  2GGZ A;  4A4C A;  3I5F C;  4GAO A;  4MVF A;  4P5O E;  4PCW A;  4PHK A;  2K2F A;  4PDZ A;  3SIB A;  3QRX A;  4YRU A;  2CT9 A;  1CFP A;  1DF0 B;  2QEH A;  3BXK A;  4TNC A;  2KQY A;  1DGU A;  1OMD A;  1ORG A;  2KOT A;  4OV2 A;  1QLS A;  1SR6 B;  1CDM A;  2AMI A;  5FI7 A;  3I5I C;  2KAV A;  3OHM B;  4GGF A;  1SL9 A;  3DF0 B;  3TUY B;  3TDI A;  2JQ6 A;  3B86 A;  3EK7 A;  1GJY A;  1SK6 D;  1ODB A;  3GK4 X;  1JUO A;  3OB1 B;  4OKH A;  3S0D A;  1DJX A;  2MJW B;  2JNX A;  5TNC A;  2LLT A;  1BU3 A;  3FE6 A;  3OP0 A;  4GFT A;  1S6J A;  2FJU B;  4PHN A;  4OZD A;  1QX5 B;  2Q91 A;  4MZL A;  3EKJ A;  5KTY A;  1UUS A;  2VRG A;  1TN4 A;  4PE7 A;  1NCX A;  1U5I A;  1CDL A;  2WCF A;  2Y4Q A;  5F6T A;  4BY5 A;  3LL8 B;  4GBA A;  4ORC B;  1A03 A;  1IH0 A;  4AQJ A;  4C0L A;  1OOJ A;  3F45 A;  2LC5 A;  2MA2 A;  1CNP A;  1YX7 A;  3I5G C;  2DOQ A;  2JRF A;  3S0F A;  1NX2 A;  1WDC B;  1PVB A;  2H8V A;  4YGD B;  1P28 A;  1AVS A;  2EHB A;  1IGV A;  1S3P A;  1F4Q A;  2LNK A;  2FCE A;  2MLE C;  1K90 D;  4MRY A;  2JXL A;  3PFV A;  1TUJ A;  1XK4 C;  3R72 A;  1SPY A;  4PT1 A;  5AER A;  2F3Y A;  1EH2 A;  2LV7 A;  2LAP A;  3CS1 A;  2KBI A;  4PE0 A;  2BEC A;  4NDD A;  4I5K A;  1XFV O;  2K7D A;  4NQG A;  1K8U A;  2KI6 D;  1H4B A;  3CTN A;  3UNW A;  1A2X A;  1ZMZ A;  1MWN A;  4JWQ A;  2M7L A;  1MF8 B;  1NYA A;  2JWW A;  3S0B A;  1GGW A;  1WLZ A;  1WRK A;  4CLN A;  1A75 B;  4I5N B;  4PE1 A;  1TNX A;  3L4A A;  3I5F B;  3MSE B;  2V53 A;  5AAN A;  1AUI B;  2KGB C;  2KI4 C;  5BPJ A;  1XFX O;  5IBW A;  1ZAC A;  3GK1 A;  1XFY O;  5HL1 A;  1OW4 A;  1XA5 A;  3D76 A;  4I5L B;  1PSB A;  2KYC A;  4JKT A;  5HKY A;  2FJY A;  3VB1 A;  1B4C A;  1SSE B;  1KK8 C;  2IS9 A;  3ZWH A;  2LP3 A;  3NSL A;  1RWY A;  3I5H C;  3IVT A;  2NZ0 A;  3EK4 A;  3BUX B;  1BR1 B;  1L2O C;  2WCE A;  3KEV A;  1F4O A;  4MEW A;  5AEQ A;  2KFG A;  1NCY A;  3B88 A;  3HX4 A;  2BCX A;  2MHH A;  1NX1 A;  2WCJ A;  1QIW A;  3D74 A;  1H8B A;  2K60 A;  3SS3 A;  1G33 A;  3CDN A;  1QVI Y;  1GGZ A;  5CPV A;  4CFR A;  2KHN A;  3IF7 A;  2OPO A;  4M2Q A;  5G08 A;  2WC6 A;  1J7R A;  1BJF A;  1NSH A;  2M29 A;  2QDI A;  1OMR A;  3OX5 A;  1DJZ A;  4FQO A;  1MXL C;  3OGN A;  2G9B A;  3B87 A;  1SL7 A;  1AJ5 A;  1BLQ A;  3D0Y A;  5FI6 A;  2L0P A;  3BUW B;  2G2B A;  2KFF A;  4PAL A;  2AUC A;  1JWD A;  1W7I B;  1F54 A;  1N0Y A;  1IQ3 A;  2FOT A;  2WCB A;  3A4U B;  3I5G B;  3FS7 A;  4D1E A;  4ETO A;  4YGA A;  1LIN A;  2M8U A;  2PMY A;  3O4X A;  2BCA A;  2KNE A;  1DEK A;  2WC8 A;  2MLF C;  4JQ0 D;  1B1G A;  1OMV A;  3NHT A;  2BBM A;  3DZT A;  3BUM B;  1DTL A;  3WHT B;  1QS7 A;  3FWB A;  1F55 A;  5AXI A;  1S5G Z;  4DS7 A;  1D1O A;  1UP5 A;  3CR2 A;  3FE8 A;  3OBV A;  3JVT C;  2QEO A;  1SL8 A;  1T14 A;  2M0R A;  2RGI A;  3NSK A;  1TNQ A;  5KSZ A;  2M1U A;  1KFU S;  2OTG C;  2P6B B;  1DF0 A;  4GGN A;  2HQW A;  2SCP A;  1ZOT B;  2LCP A;  1YUU A;  3CZT X;  4AQI A;  2CTN A;  1CDP A;  1DJG A;  2LMT A;  3VRN A;  5J3X A;  1X02 A;  3CZ1 A;  1DGV A;  1M63 B;  2FCD A;  1R6P A;  2KI4 B;  2JPT A;  1DJY A;  1WRZ A;  1J1E A;  3WXA A;  5I8N A;  1SCM C;  3DF0 A;  1EXR A;  4MZK A;  1ZFS A;  2CCM A;  3VRO A;  1S26 D;  1OOG A;  1S1E A;  1KK8 B;  2HF5 A;  3PJI A;  4INX A;  2L4H A;  1KQM C;  2MBX A;  3O2P A;  2EC6 C;  3BFA A;  1SMG A;  3I5H B;  2LVV A;  1WY9 A;  2JNF A;  2LLS A;  5I2O A;  1BT6 A;  1YVH A;  1NP8 A;  1IIO A;  3RLZ A;  2KPH A;  2PAS A;  3BJH A;  2KYF A;  3O6B A;  1F8H A;  2QEB A;  2M1K B;  3KO0 A;  3B6X A;  1IJ5 A;  1CB1 A;  1KWO C;  1MUX A;  3C1V A;  2BKH B;  1TRF A;  1V1G A;  3SG5 A;  1OOI X;  2LVJ A;  1KK7 Y;  4XYN A;  2L51 A;  1F71 A;  3BFH A;  3LK1 A;  2Y1M A;  4Q04 A;  1W7J B;  3TDZ A;  3PN7 C;  3WHU B;  4MSP A;  1LXF C;  1YUT A;  3CR4 X;  2H2K A;  2OS8 C;  3HCM A;  1Z2C B;  1B47 A;  1ALV A;  3DVM A;  1A4P A;  2COL B;  2NXQ A;  2I18 A;  1WLM A;  3NGV A;  1JBA A;  3KHE A;  3EVR A;  2F33 A;  4OR9 B;  3OX6 A;  3D75 A;  4QJ3 B;  1QIV A;  1CMF A;  2LP2 A;  2HQ8 A;  1A75 A;  4L9M A;  3S0E A;  3BUN B;  3A8R A;  4U8D A;  1OSA A;  5I2L A;  4XJK B;  2R2I A;  1QLK A;  1PSR A;  2Y1N A;  3JVT B;  2NLN A;  2LVK A;  3NSO A;  2KBM A;  1N65 A;  4M2P A;  1IKU A;  1CDN A;  2D8N A;  4INW A;  2LMV A;  1Q80 A;  2H61 C;  3IQO A;  1IJ6 A;  1YUS A;  1ZUZ A;  3M0W A;  3N7H A;  5PAL A;  3CYZ A;  2O5G A;  3AAK A;  1M39 A;  1BR4 B;  1UHK A;  1XVJ A;  2CNP A;  2M49 B;  1KFU L;  4M2O A;  1Y1X A;  1BG1 A;  4YI9 A;  4DIR A;  1CLL A;  1HQV A;  1SCM B;  1RK9 A;  2K8M B;  2ZN9 A;  5CSJ A;  2PRU A;  1DJH A;  2MAZ A;  4AOM A;  3KPX A;  1CLB A;  2MRD A;  2QEV A;  1XYD A;  1KQM B;  1DJI A;  2EGD A;  3LK0 A;  1UUR A;  2EC6 B;  5D69 A;  1FF1 A;  3BOW B;  1SW8 A;  2KSP A;  1NUB A;  1QJT A;  1MHO A;  1K96 A;  3I5I B;  1EL4 A;  3SG4 A;  4HRG A;  5AFP A;  1EG4 A;  1KSM A;  2GV5 A;  1CM4 A;  1G8I A;  1LA0 A;  2NCO A;  4DRW A;  1CFF A;  1IQ5 A;  2ZNE A;  1XFR A;  1UHJ A;  4N1G A;  1EJ3 A;  2WND A;  3ZNI A;  4E68 A;  1B8C A;  1S6C A;  1PRW A;  1R2U A;  4HRH A;  4ZCU A;  1B7T Z;  1WRL A;  2I2R E;  2JU0 A;  1CMG A;  1M31 A;  2BNX A;  1Y1U A;  1KWO B;  2F3Z A;  1ALW A;  1YTZ C;  2K7O A;  1NCZ A;  1S5G Y;  2LE9 B;  2TN4 A;  5I94 A;  4OVN F;  3S0A A;  3JTD C;  2ZRT A;  1JSA A;  2JXC A;  3DD4 A;  1DEL A;  2KFH A;  3PN7 B;  1UHN A;  2LLU A;  2E6W A;  1LA3 A;  1XK4 A;  1RJV A;  4DCK A;  1JF0 A;  2OS8 B;  1TOP A;  2ERB A;  1AK8 A;  2M3W A;  1LKJ A;  4GNK B;  1DVI A;  1TUZ A;  3H4S E;  3CZ2 A;  2BKI B;  4GGF C;  3LLE A;  3PAL A;  4CPV A;  1YUR A;  1HT9 A;  2L50 A;  4QJ4 B;  1OZS A;  1J55 A;  1C07 A;  4WRI A;  3S0G A;  4FQT A;  4C0K A;  1DQE A;  4ICB A;  1JC2 A;  4IL1 A;  1K9K A;  3R1O A;  3L4L A;  1A29 A;  3V2L A;  1XFZ O;  2BAP A;  3D73 A;  1TNW A;  2L2C A;  2JOJ A;  1CTR A;  1CKK A;  1OOH A;  2BBN A;  3IQQ A;  4HRE E;  1PUL A;  1K95 A;  1SBJ A;  3BQ3 A;  3DYE A;  3QME A;  2K7B A;  4A4B A;  3D77 A;  1YRT B;  1SYM A;  2JC2 A;  2KDH A;  3AKA A;  1C7V A;  4P2Y B;  5KU1 A;  1S36 A;  2KQ6 A;  1BF5 A;  1OOF A;  3FIA A;  5D3O A;  1IG5 A;  4CFQ A;  1FPW A;  2JZI A;  1C7W A;  1QTX A;  1L2O B;  2BCB A;  2BE6 A;  2K7C A;  4MZJ A;  2WOS A;  2GTE A;  3NXA A;  1GM0 A;  4IJ7 A;  5D7F A;  4F0Z B;  1GQM A;  2K0J A;  1Y0V H;  3PM8 A;  1IRJ A;  1PK0 D;  1NPQ A;  1BOC A;  1Y6W A;  1REC A;  3LCP C;  2JT3 A;  4N1F A;  1KFX S;  2QPT A;  1MXE A;  1SKT A;  1BMO A;  1MR8 A;  3CR5 X;  1YR5 A;  5FYX A;  1XFW O;  2LHI A;  1NIW A;  1E8A A;  1TCO B;  2GGM A;  2KLD A;  4YI8 A;  3PLF B;  4ORA B;  5JJG A;  1K9U A;  2BL0 C;  1QX7 A;  3JTD B;  3K21 A;  3K1E A;  1K9P A;  1TNP A;  3SG7 A;  3AKB A;  2BE4 A;  5CSI A;  2PVB A;  2CXJ A;  1J7O A;  2L5Y A;  1KSO A;  4C0J A;  3CWG A;  1JFK A;  1M46 A;  2P70 A;  1V1F A;  2LHL A;  2WCK A;  4WQ2 A;  2JT8 A;  2L98 A;  1UWO A;  2NCP A;  2SAS A;  2ZKM X;  3EVV A;  4XJK A;  4KYN A;  1NWD A;  3CAB A;  2ISD A;  1B9A A;  3BYA A;  2LUC A;  1FBV A;  3CLN A;  3EK8 A;  3UO9 A;  1Y1A A;  2O60 A;  3O78 A;  1B8L A;  3E3R A;  3R1P A;  1K94 A;  3PAT A;  2PSR A;  2L2E A;  4MLW A;  2PYQ A;  4CID A;  1NX0 A;  2ZND A;  2JPO A;  2M9G A;  3DVK A;  1G4Y R;  3TZ1 A;  2ZFD A;  2PQL A;  1RFJ A;  2JTZ A;  3VRP A;  2OTG B;  5ER5 A;  4YBH B;  4YGB B;  3CGA A;  1PVA A;  3RZS A;  2JT0 A;  1UHI A;  4YGC B;  2F8P A;  1QV0 A;  2WCL A;  2ZN8 A;  1U5I B;  2M97 A;  1B7T Y;  2KGR A;  1J1D A;  3BOW A;  5HKZ A;  1QXP A;  4NDB A;  1LVC D;  4USL A;  2A4J A;  4FTG A;  2CBL A;  3BFB A;  1XO5 A;  5DKR A;  3SG6 A;  1KK7 Z;  3AAJ A;  5DIC A;  2KI6 C;  1RRO A;  3EVU A;  2F2P A;  3TS5 C;  1C3Y A;  4YGE B;  3EG5 B;  5K89 A;  4DUQ A;  3WNX B;  2WOR A;  2LVI A;  2I7A A;  5GQQ C;  5CSN A;  1KQV A;  1VRK A;  2YGU A;  3VGO A;  3VRQ A;  2AAO A;  4ORB B;  1MQ1 A;  3RM1 A;  2JUL A;  1J7Q A;  2M7N A;  3SG2 A;  3VRR A;  3R1V A;  1XFU O;  2F2O A;  1OZO A;  2LM5 A;  3O4Y A;  4QJ5 B;  4HSZ A;  3SG3 A;  2B1U A;  2HPS A;  1OQP A;  4WQ3 A;  3SIA A;  1NX3 A;  1SR6 C;  1KFX L;  2BL0 B;  2K61 A;  1SCV A;  3GOF A;  2Q4U A;  5FI2 A;  4PHM A;  3GK2 A;  2WC5 A;  4PE4 A;  5HLO A;  2HET A;  2LMU A;  3TUY C;  1L7Z A;  3Q8I A;  1J7P A;  1FI6 A;  1SRA A;  1QAT A;  3FWC A;  3NSI A;  1JFJ A;  1FI5 A;  1YX8 A;  2L5X B;  5B8I B;  3DY9 A;  2KAX A;  5ER4 X;  1OE9 B;  3DVJ A;  3EKH A;  3TDU A;  1DMO A;  1DT7 B;  1YRU B;  3L47 A;  4R1E A;  2L4I A;  4ZCV A;  1AP4 A;  1CFD A;  4GUK A;  2WCM A;  1JF2 A;  1TCF A;  3D78 A;  4MBE A;  1TTX A;  1EG3 A;  3OB2 B;  4JPZ B;  2H61 A;  3PSR A;  1M45 A;  2ZRS A;  4OCI A;  5HYD A;  1Z4H A;  3SJS A;  3ICB A;  1RTP 1;  2KAY A;  3SS4 A;  5JOL A;  2QAC A;  1DC1 A;  1F70 A;  4JD9 A;  1AHR A;  1FW4 A;  1K93 D;  1PAL A;  5DKN A;  1QV1 A;  5HLV A;  1QX2 A;  4UPG A;  3DXL A;  1UHH A;  1KCY A;  1WDC C;  3NHI A;  1W9Z A;  1CFC A;  1CLM A;  1AJ4 A;  1QAS A; 
#chains in the Genus database with same CATH homology
 1QVI Z;  1S6I A;  5CSF A;  3D0Y B;  3D10 A;  2PAL A;  3BUO B;  2K2A A;  3DVE A;  2E30 A;  1YVL A;  4N5X A;  1CM1 A;  4I5J A;  5I2Q A;  1N2D A;  2LUX A;  2LAN A;  1K2H A;  1IWQ A;  4GPL B;  1BOD A;  3TS5 B;  2Y5I A;  4BY4 A;  5HKW A;  3KF9 A;  4NDC A;  4MRX A;  2JTT A;  1SNL A;  2I94 A;  1TIZ A;  1DJW A;  5DKQ A;  1B8R A;  1SY9 A;  4PHJ A;  4MN0 A;  4A4C A;  2GGZ A;  3I5F C;  4GAO A;  4MVF A;  4P5O E;  4PCW A;  4PHK A;  2K2F A;  4PDZ A;  3SIB A;  3QRX A;  4YRU A;  2CT9 A;  1CFP A;  1DF0 B;  3BXK A;  4TNC A;  2KQY A;  1DGU A;  1OMD A;  2KOT A;  4OV2 A;  1QLS A;  1SR6 B;  1CDM A;  2AMI A;  3I5I C;  2KAV A;  3OHM B;  4GGF A;  1SL9 A;  3DF0 B;  3TUY B;  3TDI A;  2JQ6 A;  3EK7 A;  1GJY A;  1SK6 D;  1ODB A;  3GK4 X;  1JUO A;  3OB1 B;  4OKH A;  1DJX A;  2MJW B;  2JNX A;  5TNC A;  2LLT A;  1BU3 A;  3OP0 A;  4GFT A;  1S6J A;  2FJU B;  4PHN A;  1QX5 B;  2Q91 A;  4MZL A;  3EKJ A;  5KTY A;  1UUS A;  2VRG A;  1TN4 A;  4PE7 A;  1NCX A;  1U5I A;  1CDL A;  2WCF A;  2Y4Q A;  5F6T A;  4BY5 A;  3LL8 B;  4GBA A;  4ORC B;  1A03 A;  1IH0 A;  4AQJ A;  4C0L A;  1OOJ A;  3F45 A;  2LC5 A;  2MA2 A;  1CNP A;  1YX7 A;  3I5G C;  2DOQ A;  2JRF A;  1NX2 A;  1WDC B;  1PVB A;  4YGD B;  1AVS A;  2EHB A;  1IGV A;  1S3P A;  1F4Q A;  2LNK A;  2FCE A;  2MLE C;  1K90 D;  4MRY A;  2JXL A;  3PFV A;  1XK4 C;  1SPY A;  5AER A;  2F3Y A;  1EH2 A;  2LV7 A;  2LAP A;  3CS1 A;  2KBI A;  4PE0 A;  2BEC A;  4NDD A;  4I5K A;  1XFV O;  2K7D A;  4NQG A;  1K8U A;  2KI6 D;  1H4B A;  3CTN A;  1A2X A;  1ZMZ A;  1MWN A;  4JWQ A;  2M7L A;  1MF8 B;  1NYA A;  2JWW A;  1GGW A;  1WLZ A;  1WRK A;  4CLN A;  1A75 B;  4I5N B;  4PE1 A;  1TNX A;  3I5F B;  3MSE B;  2V53 A;  5AAN A;  1AUI B;  2KGB C;  2KI4 C;  5BPJ A;  1XFX O;  5IBW A;  1ZAC A;  3GK1 A;  1XFY O;  1XA5 A;  4I5L B;  1PSB A;  2KYC A;  5HKY A;  1B4C A;  1KK8 C;  2IS9 A;  3ZWH A;  2LP3 A;  3NSL A;  1RWY A;  3I5H C;  2NZ0 A;  3EK4 A;  3BUX B;  1BR1 B;  1L2O C;  2WCE A;  3KEV A;  1F4O A;  4MEW A;  5AEQ A;  2KFG A;  1NCY A;  3HX4 A;  2BCX A;  2MHH A;  1NX1 A;  1QIW A;  1H8B A;  1G33 A;  1QVI Y;  1GGZ A;  5CPV A;  4CFR A;  2KHN A;  3IF7 A;  2OPO A;  4M2Q A;  5G08 A;  1J7R A;  1BJF A;  1NSH A;  2M29 A;  1OMR A;  3OX5 A;  1DJZ A;  4FQO A;  1MXL C;  2G9B A;  1SL7 A;  1AJ5 A;  1BLQ A;  3D0Y A;  2L0P A;  3BUW B;  2G2B A;  2KFF A;  4PAL A;  2AUC A;  1JWD A;  1W7I B;  1F54 A;  1N0Y A;  1IQ3 A;  2FOT A;  2WCB A;  3A4U B;  3I5G B;  3FS7 A;  4D1E A;  4ETO A;  4YGA A;  1LIN A;  2M8U A;  2PMY A;  2BCA A;  2KNE A;  2WC8 A;  2MLF C;  4JQ0 D;  1B1G A;  1OMV A;  2BBM A;  3BUM B;  1DTL A;  3WHT B;  1QS7 A;  3FWB A;  1F55 A;  5AXI A;  1S5G Z;  4DS7 A;  1D1O A;  1UP5 A;  3CR2 A;  3JVT C;  1SL8 A;  2M0R A;  2RGI A;  3NSK A;  5KSZ A;  1TNQ A;  2M1U A;  1KFU S;  2OTG C;  2P6B B;  1DF0 A;  4GGN A;  2HQW A;  2SCP A;  1ZOT B;  2LCP A;  1YUU A;  3CZT X;  4AQI A;  2CTN A;  1CDP A;  1DJG A;  2LMT A;  3VRN A;  5J3X A;  1X02 A;  1DGV A;  1M63 B;  2FCD A;  1R6P A;  2KI4 B;  2JPT A;  1DJY A;  1WRZ A;  1J1E A;  3WXA A;  5I8N A;  1SCM C;  3DF0 A;  1EXR A;  4MZK A;  1ZFS A;  2CCM A;  3VRO A;  1S26 D;  1S1E A;  1KK8 B;  2HF5 A;  2L4H A;  1KQM C;  2MBX A;  3O2P A;  2EC6 C;  3I5H B;  1SMG A;  2LVV A;  1WY9 A;  2JNF A;  2LLS A;  5I2O A;  1BT6 A;  1YVH A;  1NP8 A;  3RLZ A;  2PAS A;  2KYF A;  3O6B A;  1F8H A;  2M1K B;  3KO0 A;  1CB1 A;  1IJ5 A;  1KWO C;  1MUX A;  3C1V A;  2BKH B;  1TRF A;  1V1G A;  3SG5 A;  2LVJ A;  1KK7 Y;  4XYN A;  2L51 A;  1F71 A;  3LK1 A;  2Y1M A;  4Q04 A;  1W7J B;  3TDZ A;  3PN7 C;  3WHU B;  4MSP A;  1LXF C;  1YUT A;  3CR4 X;  2H2K A;  2OS8 C;  3HCM A;  1B47 A;  1ALV A;  3DVM A;  1A4P A;  2COL B;  2NXQ A;  2I18 A;  1WLM A;  1JBA A;  3KHE A;  3EVR A;  2F33 A;  4OR9 B;  3OX6 A;  4QJ3 B;  1QIV A;  1CMF A;  2LP2 A;  2HQ8 A;  1A75 A;  4L9M A;  3BUN B;  3A8R A;  4U8D A;  1OSA A;  5I2L A;  4XJK B;  2R2I A;  1QLK A;  1PSR A;  2Y1N A;  3JVT B;  2NLN A;  2LVK A;  3NSO A;  2KBM A;  1N65 A;  4M2P A;  1IKU A;  1CDN A;  2D8N A;  2LMV A;  1Q80 A;  2H61 C;  3IQO A;  1IJ6 A;  1YUS A;  1ZUZ A;  3M0W A;  5PAL A;  2O5G A;  3AAK A;  1M39 A;  1BR4 B;  1UHK A;  1XVJ A;  2CNP A;  2M49 B;  1KFU L;  4M2O A;  1Y1X A;  1BG1 A;  4YI9 A;  4DIR A;  1CLL A;  1HQV A;  1SCM B;  1RK9 A;  2K8M B;  2ZN9 A;  5CSJ A;  2PRU A;  1DJH A;  2MAZ A;  4AOM A;  3KPX A;  1CLB A;  2MRD A;  1XYD A;  1KQM B;  1DJI A;  2EGD A;  3LK0 A;  1UUR A;  2EC6 B;  5D69 A;  1FF1 A;  3BOW B;  1SW8 A;  2KSP A;  1NUB A;  1QJT A;  1MHO A;  1K96 A;  3I5I B;  1EL4 A;  3SG4 A;  4HRG A;  5AFP A;  1EG4 A;  1KSM A;  2GV5 A;  1CM4 A;  1G8I A;  1LA0 A;  2NCO A;  4DRW A;  1CFF A;  1IQ5 A;  2ZNE A;  4N1G A;  1UHJ A;  1EJ3 A;  2WND A;  3ZNI A;  4E68 A;  1B8C A;  1S6C A;  1PRW A;  1R2U A;  4HRH A;  4ZCU A;  1B7T Z;  1WRL A;  2I2R E;  2JU0 A;  1CMG A;  1M31 A;  1Y1U A;  1KWO B;  2F3Z A;  1ALW A;  1YTZ C;  2K7O A;  1NCZ A;  1S5G Y;  2LE9 B;  2TN4 A;  4OVN F;  3JTD C;  2ZRT A;  1JSA A;  2JXC A;  3DD4 A;  2KFH A;  3PN7 B;  1UHN A;  2LLU A;  2E6W A;  1LA3 A;  1XK4 A;  1RJV A;  4DCK A;  1JF0 A;  2OS8 B;  1TOP A;  1AK8 A;  2M3W A;  1LKJ A;  4GNK B;  1DVI A;  3H4S E;  4GGF C;  2BKI B;  4CPV A;  3LLE A;  3PAL A;  1YUR A;  1HT9 A;  2L50 A;  4QJ4 B;  1OZS A;  1J55 A;  1C07 A;  4WRI A;  4C0K A;  4ICB A;  1JC2 A;  4IL1 A;  1K9K A;  1A29 A;  1XFZ O;  1TNW A;  2JOJ A;  1CTR A;  1CKK A;  2BBN A;  3IQQ A;  4HRE E;  1PUL A;  1K95 A;  1SBJ A;  3BQ3 A;  2K7B A;  4A4B A;  1YRT B;  1SYM A;  2JC2 A;  2KDH A;  3AKA A;  1C7V A;  4P2Y B;  5KU1 A;  1S36 A;  2KQ6 A;  1BF5 A;  3FIA A;  1FPW A;  1IG5 A;  4CFQ A;  2JZI A;  1C7W A;  1QTX A;  1L2O B;  2BCB A;  2BE6 A;  2K7C A;  4MZJ A;  2WOS A;  3NXA A;  5D7F A;  4F0Z B;  1GQM A;  2K0J A;  1Y0V H;  3PM8 A;  1IRJ A;  1PK0 D;  1NPQ A;  1BOC A;  1Y6W A;  1REC A;  3LCP C;  2JT3 A;  4N1F A;  1KFX S;  2QPT A;  1MXE A;  1SKT A;  1BMO A;  1MR8 A;  3CR5 X;  1YR5 A;  5FYX A;  1XFW O;  2LHI A;  1NIW A;  1E8A A;  1TCO B;  2GGM A;  4YI8 A;  3PLF B;  4ORA B;  5JJG A;  1K9U A;  2BL0 C;  1QX7 A;  3JTD B;  3K21 A;  1K9P A;  1TNP A;  3SG7 A;  3AKB A;  2BE4 A;  5CSI A;  2PVB A;  2CXJ A;  1J7O A;  1KSO A;  4C0J A;  3CWG A;  1JFK A;  1M46 A;  1V1F A;  2LHL A;  4WQ2 A;  2JT8 A;  2L98 A;  1UWO A;  2NCP A;  2SAS A;  2ZKM X;  3EVV A;  4XJK A;  1NWD A;  2ISD A;  1B9A A;  3BYA A;  2LUC A;  1FBV A;  3CLN A;  3EK8 A;  1Y1A A;  2O60 A;  3O78 A;  1B8L A;  3E3R A;  1K94 A;  3PAT A;  2PSR A;  2L2E A;  4MLW A;  4CID A;  1NX0 A;  2ZND A;  2M9G A;  3DVK A;  1G4Y R;  3TZ1 A;  2ZFD A;  1RFJ A;  2JTZ A;  3VRP A;  2OTG B;  5ER5 A;  4YBH B;  4YGB B;  3CGA A;  1PVA A;  2JT0 A;  1UHI A;  4YGC B;  2F8P A;  1QV0 A;  2ZN8 A;  1U5I B;  2M97 A;  1B7T Y;  2KGR A;  1J1D A;  3BOW A;  5HKZ A;  1QXP A;  4NDB A;  1LVC D;  4USL A;  2A4J A;  4FTG A;  2CBL A;  1XO5 A;  5DKR A;  3SG6 A;  1KK7 Z;  3AAJ A;  2KI6 C;  1RRO A;  3EVU A;  2F2P A;  3TS5 C;  4YGE B;  5K89 A;  4DUQ A;  3WNX B;  2WOR A;  2LVI A;  2I7A A;  5GQQ C;  5CSN A;  1KQV A;  1VRK A;  3VGO A;  3VRQ A;  2AAO A;  4ORB B;  1MQ1 A;  3RM1 A;  2JUL A;  1J7Q A;  2M7N A;  3SG2 A;  3VRR A;  1XFU O;  2F2O A;  1OZO A;  2LM5 A;  3O4Y A;  4QJ5 B;  4HSZ A;  3SG3 A;  2B1U A;  2HPS A;  1OQP A;  4WQ3 A;  3SIA A;  1NX3 A;  1SR6 C;  1KFX L;  2BL0 B;  2K61 A;  1SCV A;  3GOF A;  2Q4U A;  4PHM A;  3GK2 A;  4PE4 A;  5HLO A;  2HET A;  2LMU A;  3TUY C;  1L7Z A;  1J7P A;  1FI6 A;  1SRA A;  1QAT A;  3FWC A;  3NSI A;  1JFJ A;  1FI5 A;  1YX8 A;  2L5X B;  5B8I B;  2KAX A;  5ER4 X;  1OE9 B;  3DVJ A;  3EKH A;  3TDU A;  1DMO A;  1DT7 B;  1YRU B;  4R1E A;  2L4I A;  4ZCV A;  1AP4 A;  1CFD A;  4GUK A;  1JF2 A;  1TCF A;  4MBE A;  1TTX A;  1EG3 A;  3OB2 B;  4JPZ B;  2H61 A;  3PSR A;  1M45 A;  2ZRS A;  4OCI A;  5HYD A;  3SJS A;  3ICB A;  1RTP 1;  2KAY A;  5JOL A;  2QAC A;  1F70 A;  1AHR A;  1FW4 A;  1K93 D;  1PAL A;  5DKN A;  1QV1 A;  5HLV A;  1QX2 A;  4UPG A;  1KCY A;  1UHH A;  1WDC C;  1CFC A;  1CLM A;  1AJ4 A;  1QAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...