2CXJA

3d solution structure of s100a13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
98
structure length
98
Chain Sequence
MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords S100 calcium-binding protein A13
publication title Three-Dimensional Solution Structure of S100A13
rcsb
source organism Mus musculus
total genus 19
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2cxjA00
3EK8A 3BYAA 3EKJA 2M3WA 5CPVA 2R2IA 1OZSA 2K7CA 1DJYA 4ETOA 1RK9A 1YR5A 1XFXO 3KF9A 1Y1XA 1F4OA 2LVVA 1CFFA 1JF2A 2FCEA 2CBLA 1JFJA 5AFPA 1A03A 1QV0A 2LE9B 1XK4C 1AK8A 1BODA 1S36A 2M49B 1YUUA 3VRQA 3VRPA 2NLNA 1TTXA 2LVJA 1Y1AA 1X02A 2PASA 4ZCVA 3FWBA 3TDZA 1QVIZ 4CIDA 2D8NA 2KFGA 3O78A 1EJ3A 1SR6C 1SCMC 1ZFSA 2K7BA 1F4QA 1KSOA 4JWQA 1IH0A 4IL1A 5K89A 5D7FA 4ZCUA 2KYCA 4YI9A 3A4UB 2K61A 2KYFA 2BBMA 1DF0B 1SRAA 1UWOA 3PSRA 4PE7A 2Y4QA 1SK6D 2M9GA 2AUCA 4MN0A 2LMUA 4C0KA 1SL7A 2E6WA 1DVIA 2JRFA 5G08A 1CLMA 3LCPC 4PE4A 4XJKB 2MA2A 1PVAA 1NX3A 1QX7A 1Y0VH 1SNLA 1MXLC 2L5XB 3CR4X 3ICBA 1MUXA 4I5KA 2TN4A 1XK4A 2M97A 3VROA 2CTNA 2Y1MA 2JXCA 2L50A 1BJFA 1NX2A 1YX7A 1S6IA 4HRGA 1DJHA 2BE6A 1KK8C 5ER5A 5I2QA 2VRGA 2F33A 3NSLA 2AMIA 3SG7A 4AQIA 1UP5A 3GK4X 1JUOA 5GQQC 2LMTA 2ZN9A 1QASA 3F45A 3JVTC 3CR2A 1QLKA 5JJGA 1KQMC 2LMVA 1AHRA 2KQ6A 2WC8A 1JWDA 2JXLA 2ZRSA 5F6TA 3A8RA 3CZTX 1XFVO 3EK4A 5I2OA 3I5HB 1J1DA 1FI5A 5HLOA 4QJ4B 1KK7Y 1Q80A 1ZACA 2K7DA 1DJIA 2LLUA 2OTGB 3PN7C 1TCFA 4HSZA 1C07A 1C7VA 4OV2A 1K96A 5AERA 1CFPA 1HQVA 3EK7A 2EC6C 3NSIA 2HQ8A 1BG1A 4GFTA 5HKWA 1KFXL 4PE1A 4GGNA 1NIWA 1B8CA 1LVCD 2KI4B 2L4HA 1YUTA 3EVUA 1B8LA 3NSKA 4GNKB 2NZ0A 2LLTA 1YURA 1RTP1 2K2FA 1RJVA 1W7IB 2WORA 2P6BB 1DJGA 2BE4A 1L7ZA 2L2EA 3PM8A 5HKZA 4YGDB 4YRUA 2NCOA 3BOWA 1YTZC 2L0PA 1CNPA 3AKAA 1WLMA 2KAXA 1VRKA 3DVKA 4DCKA 1XFWO 1IJ5A 2KFFA 2I2RE 2MBXA 1OE9B 3LK1A 2JWWA 4E68A 1UHJA 3D0YB 1QX2A 2PMYA 3AAKA 1CB1A 5KTYA 5FYXA 2K8MB 4GAOA 1RFJA 3IF7A 2JC2A 4GBAA 1OOJA 2LAPA 1EL4A 3I5GB 3IQQA 1FW4A 1F54A 3BXKA 1OSAA 2KOTA 1CDNA 2M1UA 2KI6D 1K2HA 2JZIA 5CSNA 1LXFC 2F3ZA 2BKIB 1WRLA 1ZUZA 2KGBC 1J55A 1QS7A 4FTGA 1S6JA 4YBHB 1K9KA 2LM5A 1N2DA 4CLNA 2FJUB 3KHEA 1SBJA 1SY9A 1WDCB 3O4YA 4M2QA 1EXRA 1XA5A 2Q4UA 3GK1A 1UHKA 1XVJA 2K0JA 2ZFDA 2Y5IA 2LHLA 2QACA 1TNXA 4FQOA 1DTLA 2L51A 3SG4A 1WY9A 1KSMA 1NX0A 4D1EA 1AJ4A 4BY5A 2ZRTA 3FS7A 1YVHA 1IWQA 5DKQA 3RLZA 1XFYO 2NXQA 1KWOB 1SW8A 2KNEA 4OR9B 4C0LA 1R6PA 2F3YA 4A4CA 1NYAA 3K21A 1CLLA 2LNKA 1M31A 1KFUS 1L2OB 2LP3A 2SASA 4HRHA 5DKRA 2M7NA 1K9PA 3JTDC 2WCBA 4MVFA 4MEWA 3EKHA 3WXAA 2KSPA 2PSRA 4CFRA 3BUWB 5B8IB 1ALWA 1A75A 1OMDA 1CM4A 2WNDA 3DD4A 2WCEA 4CPVA 1AP4A 4GGFC 3KEVA 2MJWB 1CKKA 1S5GZ 1AVSA 1CDLA 2LANA 1IJ6A 4MZJA 4PHJA 5PALA 1BF5A 2BL0C 3ZWHA 1EH2A 4XYNA 1N0YA 4N5XA 5AANA 1BLQA 1GGWA 1WRKA 3SIAA 2LUXA 4C0JA 2AAOA 1FBVA 1U5IA 2KBMA 1G4YR 1B9AA 2FCDA 2KAYA 2MLFC 1FF1A 1A2XA 1SCMB 2CCMA 3CS1A 1J7PA 1DJXA 2ZNDA 1R2UA 3KPXA 4PALA 4MRXA 2KGRA 2LVKA 2IS9A 5CSJA 2JTTA 1NWDA 2DOQA 1SMGA 1K93D 3PLFB 1B7TY 1K8UA 4A4BA 3CGAA 1F70A 3I5HC 1G8IA 4GGFA 4PHMA 5TNCA 1PULA 1LINA 1S3PA 1BMOA 1MQ1A 2CXJA 2JT0A 2KHNA 3IQOA 4XJKA 1MR8A 2WCFA 3BUOB 3I5IC 3HX4A 2M0RA 2ZNEA 2JNFA 1B4CA 4U8DA 1TOPA 1NSHA 1S1EA 2JPTA 1KK8B 1B47A 1HT9A 4CFQA 2GGZA 2K7OA 2F8PA 2PALA 2I18A 1UHIA 1DGVA 3PALA 1S26D 2NCPA 3HCMA 3OHMB 1WRZA 1LA3A 2FOTA 3BQ3A 3JVTB 3M0WA 1ZOTB 2JOJA 3TUYC 3BOWB 4YI8A 1KQMB 3I5FC 1IGVA 3VRNA 1YVLA 3C1VA 4MRYA 1AJ5A 2H2KA 5ER4X 2MAZA 1BOCA 2ZKMX 3H4SE 1G33A 3PN7B 1CFCA 1UHHA 3BUMB 2QPTA 2SCPA 3PFVA 2OS8C 1NCZA 4NDDA 5I2LA 3AAJA 1FI6A 2EC6B 3TS5C 1K90D 2M1KB 3EVVA 3SG2A 4AOMA 1K9UA 3RM1A 1EG4A 2JTZA 4WQ3A 1NCYA 2CT9A 2F2OA 3FIAA 4ORBB 3TZ1A 1F8HA 1NPQA 1W7JB 2H61C 1PVBA 2G9BA 2KDHA 3DF0A 4JQ0D 2BECA 1JFKA 1TRFA 4PDZA 1B1GA 2L98A 1KCYA 1CDMA 1UURA 2COLB 1QX5B 3VGOA 2B1UA 2MHHA 4R1EA 1QLSA 3OB2B 3OX6A 4M2PA 4MZLA 4P2YB 1F71A 2JT3A 3GK2A 3KO0A 3AKBA 3FWCA 4TNCA 4UPGA 4HREE 1QATA 1XYDA 1K94A 4QJ5B 1YX8A 1PSRA 2M29A 5I8NA 3LLEA 1ALVA 3MSEB 5AXIA 4DUQA 1IKUA 5IBWA 1SCVA 1YUSA 1LKJA 3OB1B 2GV5A 1OMVA 1QVIY 3O6BA 3SG5A 1M63B 1V1GA 2G2BA 2H61A 4DS7A 1BR4B 4I5JA 3BUXB 2EHBA 4OKHA 1SYMA 5CSIA 4OVNF 3GOFA 1UHNA 2WOSA 1IRJA 1JF0A 4P5OE 1IQ5A 3VRRA 1A75B 2L4IA 1S5GY 2HETA 1RECA 2O60A 1S6CA 4JPZB 1YRUB 2LHIA 1ODBA 2LLSA 4ORAB 2HQWA 4PHNA 3TDIA 2F2PA 1D1OA 5HLVA 1SL8A 1DJWA 4OCIA 2JNXA 1GJYA 4USLA 3SIBA 2LP2A 1NX1A 1PSBA 1KFXS 4AQJA 2CNPA 4GUKA 1V1FA 1NCXA 1U5IB 2KFHA 1BU3A 1C7WA 1TIZA 4YGEB 1BR1B 2HF5A 2Y1NA 1GQMA 3LK0A 3CWGA 4N1FA 3WNXB 2JULA 5CSFA 2EGDA 1MF8B 1YRTB 4N1GA 1K95A 1DT7B 3CLNA 1CFDA 2BKHB 1SL9A 1SR6B 3JTDB 1CDPA 4I5LB 1A4PA 3DVEA 1QIVA 1B8RA 1IG5A 1RROA 1MHOA 1QV1A 4PE0A 2LVIA 5DKNA 3O2PA 1DF0A 3WHTB 1LA0A 1MWNA 1J1EA 3E3RA 2JT8A 4F0ZB 2ZN8A 5AEQA 4NDCA 1RWYA 1Y6WA 2BL0B 1AUIB 1CMFA 1SKTA 1QIWA 2OTGC 5KSZA 4L9MA 2LCPA 3EVRA 1OQPA 1N65A 1CTRA 1PALA 1TNPA 3SG3A 2V53A 1TCOB 4WRIA 3ZNIA 2LC5A 1OZOA 5HYDA 1J7QA 4BY4A 1XO5A 1XFUO 1GGZA 2O5GA 3NXAA 1PRWA 2KI4C 1TN4A 3TDUA 1JSAA 4MLWA 1M39A 3DVJA 2I94A 1FPWA 1ZMZA 1NP8A 1KFUL 1UUSA 2LV7A 1A29A 4MZKA 4YGAA 3D10A 4NQGA 1B7TZ 4YGBB 4GPLB 1H4BA 4DIRA 3SG6A 3I5IB 1WLZA 5JOLA 2K2AA 2MRDA 1EG3A 3QRXA 1TNQA 1KK7Z 5J3XA 3DVMA 2KAVA 1IQ3A 1JC2A 1KQVA 1QJTA 1M46A 3CR5X 2JU0A 3I5GC 1DJZA 2PRUA 3DF0B 3PATA 3SJSA 4ICBA 2BCAA 2PVBA 5BPJA 2KQYA 2ISDA 3TUYB 4QJ3B 5D69A 2BBNA 3WHUB 3I5FB 4M2OA 4PCWA 3NSOA 2GGMA 2RGIA 3BUNB 2M8UA 4ORCB 5KU1A 2HPSA 1J7RA 1WDCC 2A4JA 1DMOA 2KI6C 1CMGA 3LL8B 5HKYA 2I7AA 2OS8B 3OP0A 3CTNA 4MBEA 4WQ2A 1OMRA 1QXPA 3TS5B 4YGCB 4I5NB 1CLBA 1XFZO 2BCXA 1H8BA 2JQ6A 3D0YA 1E8AA 3OX5A 2BCBA 2MLEC 2Q91A 1DGUA 2E30A 1KWOC 1F55A 2KBIA 1Y1UA 1PK0D 4PHKA 1QTXA 4MSPA 4Q04A 2M7LA 1SPYA 1BT6A 1L2OC 1CM1A 2OPOA 1M45A 4NDBA 1TNWA 4DRWA 1J7OA 2LUCA 1MXEA 1JBAA 1NUBA
chains in the Genus database with same CATH superfamily
3EK8A 3BYAA 3EKJA 2M3WA 3V2LA 5CPVA 2R2IA 1OZSA 2K7CA 1DJYA 4ETOA 1RK9A 1YR5A 1XFXO 3KF9A 1Y1XA 3SS5A 1F4OA 2LVVA 1CFFA 1JF2A 2FCEA 2CBLA 1JFJA 5AFPA 1A03A 1QV0A 2LE9B 1XK4C 1AK8A 1BODA 2ERBA 3SS3A 4IJ7A 1S36A 2M49B 1YUUA 3VRQA 3VRPA 2NLNA 1TTXA 2LVJA 1Y1AA 2KLDA 1X02A 2PASA 4OZDA 2P71A 4ZCVA 3FWBA 3S0FA 3TDZA 1QVIZ 4CIDA 2D8NA 2KFGA 3O78A 1EJ3A 1SR6C 1SCMC 1ZFSA 2K7BA 1F4QA 1KSOA 3NGVA 4JWQA 1IH0A 1OOGA 1DELA 4IL1A 5K89A 3L47A 5D7FA 4ZCUA 2KYCA 4YI9A 3A4UB 2K61A 2KYFA 2BBMA 1DF0B 1SRAA 1UWOA 2H8VA 3NHTA 2Y4QA 3PSRA 4PE7A 1SK6D 2M9GA 3RZSA 2AUCA 4MN0A 2LMUA 4C0KA 1SL7A 2E6WA 1DVIA 2JRFA 1DQEA 1CLMA 4KYNA 5G08A 3LCPC 4PE4A 4XJKB 2MA2A 1PVAA 1NX3A 1QX7A 1Y0VH 1SNLA 1MXLC 1LS8A 2L5XB 3CR4X 1MUXA 3ICBA 3UO9A 4I5KA 2TN4A 1XK4A 2M97A 3VROA 3OBVA 1F8HA 2CTNA 2Y1MA 2JXCA 2L50A 1BJFA 3QMEA 1NX2A 1OW4A 1YX7A 1S6IA 4HRGA 1DJHA 2BE6A 1KK8C 5ER5A 5I2QA 2VRGA 3TZ1A 2F33A 3D74A 3NSLA 2AMIA 2QEVA 3SG7A 4AQIA 1UP5A 3GK4X 1JUOA 2BNXA 5GQQC 1OOFA 2LMTA 2ZN9A 1QASA 3F45A 3JVTC 3CR2A 3OGNA 1QLKA 3R72A 3D73A 5JJGA 1KQMC 2LMVA 1AHRA 2KQ6A 2WC8A 1JWDA 2JXLA 2ZRSA 5F6TA 3A8RA 3CZTX 1XFVO 3EK4A 5I2OA 3I5HB 1J1DA 1FI5A 5HLOA 4QJ4B 1KK7Y 1Q80A 1ZACA 2K7DA 1DJIA 3D76A 2LLUA 2OTGB 3PN7C 3B87A 1TCFA 3D77A 4HSZA 1C07A 1C7VA 4OV2A 1K96A 5AERA 1CFPA 1HQVA 3EK7A 2EC6C 3NSIA 1QWVA 2HQ8A 3B7AA 1BG1A 4GFTA 5HKWA 1KFXL 4PE1A 4GGNA 1NIWA 1B8CA 1LVCD 3R1PA 2KI4B 1P28A 2L4HA 1YUTA 3EVUA 1B8LA 3NSKA 4GNKB 2NZ0A 2LLTA 1YURA 1W9ZA 1RTP1 2K2FA 1RJVA 2WC6A 1W7IB 2WORA 2P6BB 1DJGA 2BE4A 1L7ZA 2L2EA 3PM8A 5HKZA 4YGDB 4YRUA 2NCOA 3BOWA 1YTZC 2L0PA 1CNPA 3AKAA 1WLMA 2KAXA 1VRKA 3DVKA 4DCKA 2WCJA 3BJHA 1ORGA 1XFWO 5FI2A 3SS4A 3FE9A 1IJ5A 2KFFA 2I2RE 2MBXA 1OE9B 3LK1A 2JWWA 5FI6A 3UNWA 4E68A 1UHJA 3D0YB 1QX2A 2PMYA 3AAKA 1CB1A 5KTYA 5FYXA 2PQLA 2K8MB 4GAOA 1RFJA 3IF7A 2JC2A 4GBAA 1OOJA 2LAPA 1EL4A 3I5GB 3IQQA 3PM2A 1FW4A 1F54A 3BXKA 4F7FA 1OSAA 2KOTA 2QDIA 1CDNA 2M1UA 2KI6D 1K2HA 2JZIA 5CSNA 1LXFC 2F3ZA 2BKIB 1WRLA 1ZUZA 2KGBC 1J55A 1QS7A 4FTGA 1S6JA 4YBHB 1K9KA 2LM5A 1N2DA 4CLNA 2FJUB 3KHEA 1SBJA 1SY9A 1WDCB 3O4YA 4M2QA 1EXRA 1XA5A 2Q4UA 3GK1A 2L2CA 1UHKA 1XVJA 2K0JA 2ZFDA 2Y5IA 2LHLA 2QACA 1TNXA 4FQOA 1DTLA 2L51A 3SG4A 1WY9A 1KSMA 1NX0A 4D1EA 1AJ4A 4BY5A 2ZRTA 3FS7A 1YVHA 1IWQA 5DKQA 3RLZA 1XFYO 2NXQA 1KWOB 3CYZA 1SW8A 2KNEA 4OR9B 4C0LA 1R6PA 2F3YA 1Z2CB 4A4CA 1NYAA 3K21A 4JD9A 1CLLA 2LNKA 1M31A 1KFUS 1L2OB 2LP3A 2SASA 4HRHA 3BFAA 5DKRA 2M7NA 1K9PA 3JTDC 2WCBA 4MVFA 4MEWA 3EKHA 3WXAA 2KSPA 2PSRA 4CFRA 3BUWB 5B8IB 1ALWA 1A75A 1OMDA 1CM4A 2WNDA 3DD4A 2WCEA 4CPVA 1AP4A 4GGFC 3KEVA 2MJWB 1CKKA 1S5GZ 1AVSA 1CDLA 2LANA 1IJ6A 4MZJA 3FE6A 4PHJA 5PALA 2YGUA 1BF5A 2BL0C 3ZWHA 1EH2A 4XYNA 1N0YA 4JKTA 4N5XA 1TUZA 5AANA 1BLQA 1GGWA 1WRKA 3SIAA 2LUXA 4C0JA 2AAOA 1FBVA 1U5IA 5EL2A 2KBMA 1G4YR 1B9AA 2FCDA 2KAYA 2MLFC 1C3YA 1FF1A 1A2XA 1SCMB 2CCMA 3CS1A 1J7PA 1DJXA 2ZNDA 1R2UA 3KPXA 4PALA 2FJYA 4MRXA 2KGRA 2LVKA 2IS9A 5CSJA 2JTTA 1NWDA 2DOQA 1SMGA 1K93D 3PLFB 1B7TY 1K8UA 3CZ1A 4A4BA 3CGAA 1F70A 3I5HC 1G8IA 4GGFA 4PHMA 5TNCA 3N7HA 1PULA 1LINA 1S3PA 1BMOA 1MQ1A 2CXJA 2JT0A 2KHNA 3IQOA 4XJKA 1MR8A 2WCFA 3BUOB 3L4LA 3I5IC 3HX4A 2M0RA 2ZNEA 2JNFA 1B4CA 4U8DA 1TOPA 1NSHA 1S1EA 2JPTA 1KK8B 1TWOA 1IIOA 1B47A 1HT9A 4CFQA 2GGZA 2K7OA 2F8PA 1TUJA 2PALA 2I18A 1UHIA 1DGVA 3PALA 1S26D 2NCPA 3HCMA 3OHMB 1DC1A 1WRZA 1LA3A 2FOTA 3BQ3A 3JVTB 3M0WA 1ZOTB 2JOJA 3TUYC 3BOWB 1OOHA 4INWA 4YI8A 1KQMB 3I5FC 1IGVA 3VRNA 1YVLA 3C1VA 4MRYA 3S0EA 2WCKA 1AJ5A 2H2KA 5ER4X 2MAZA 3BFBA 3IVTA 2ZKMX 3H4SE 1G33A 3Q8IA 3PN7B 1BOCA 3DY9A 1CFCA 1GM0A 1UHHA 3BUMB 2QPTA 2SCPA 3PFVA 3R1OA 2OS8C 1NCZA 4NDDA 5I2LA 3AAJA 1FI6A 2EC6B 3TS5C 1K90D 2M1KB 3EVVA 3SG2A 4AOMA 1K9UA 3RM1A 3DZTA 1EG4A 2JTZA 2WC5A 1NCYA 2CT9A 2F2OA 3FIAA 4ORBB 4WQ3A 3R1VA 1NPQA 1W7JB 2H61C 1PVBA 2G9BA 2KDHA 3DF0A 4JQ0D 2BECA 5HL1A 1JFKA 1TRFA 4PDZA 1B1GA 2L98A 1KCYA 1CDMA 1UURA 2COLB 1QX5B 3VGOA 2B1UA 2MHHA 4R1EA 1QLSA 3OB2B 3OX6A 4M2PA 4MZLA 4P2YB 1F71A 2JT3A 3GK2A 3KO0A 3AKBA 3FWCA 4TNCA 4UPGA 4HREE 1QATA 1SSEB 1XYDA 1K94A 4QJ5B 1YX8A 1PSRA 2M29A 5I8NA 2QEHA 3LLEA 1ALVA 3MSEB 5AXIA 3CZ0A 2KPHA 4DUQA 1IKUA 5IBWA 1SCVA 1YUSA 1LKJA 3OB1B 2GV5A 1OMVA 1QVIY 3O6BA 3SG5A 5I94A 1M63B 1V1GA 2G2BA 2H61A 2JPOA 4DS7A 1BR4B 4I5JA 3BUXB 2EHBA 4OKHA 5DICA 1SYMA 5CSIA 4OVNF 3GOFA 1UHNA 2WOSA 1IRJA 1JF0A 4P5OE 1IQ5A 3VRRA 3NHIA 1A75B 2L4IA 1S5GY 1Z4HA 2HETA 2PYQA 1RECA 1C3ZA 1S6CA 2O60A 1YRUB 4JPZB 2KLEA 2LHIA 1ODBA 2LLSA 4ORAB 3DYEA 2HQWA 3B6XA 4PHNA 3TDIA 2F2PA 1D1OA 5HLVA 1SL8A 1DJWA 4OCIA 2JNXA 1GJYA 4USLA 2L5YA 3SIBA 2LP2A 3EG5B 2QEOA 1NX1A 1PSBA 2WCMA 1KFXS 4AQJA 2CNPA 4GUKA 1V1FA 1NCXA 1U5IB 2KFHA 1BU3A 1C7WA 1TIZA 4YGEB 1BR1B 3BFHA 2HF5A 2Y1NA 1GQMA 3O4XA 3LK0A 3CWGA 4N1FA 3WNXB 2JULA 5CSFA 2EGDA 1MF8B 1YRTB 4N1GA 1K95A 1DT7B 3CLNA 5D3OA 1CFDA 2BKHB 1SL9A 1SR6B 3JTDB 1CDPA 4I5LB 1A4PA 3DVEA 1QIVA 1B8RA 1IG5A 1RROA 1MHOA 1QV1A 3L4AA 4PE0A 2LVIA 5DKNA 3O2PA 1DF0A 3WHTB 1LA0A 2K60A 1MWNA 1J1EA 3E3RA 2JT8A 3VB1A 2ZN8A 5AEQA 4NDCA 1RWYA 4F0ZB 1Y6WA 3CABA 2BL0B 1AUIB 1CMFA 1SKTA 1QIWA 2OTGC 5KSZA 4INXA 4L9MA 2LCPA 3EVRA 1OQPA 1N65A 1CTRA 1PALA 1TNPA 3SG3A 2V53A 1TCOB 4WRIA 3ZNIA 2LC5A 1OZOA 5HYDA 1J7QA 4BY4A 1XO5A 1XFRA 1XFUO 3CDNA 3PJIA 1GGZA 2O5GA 3D75A 3NXAA 1PRWA 2KI4C 1TN4A 2WCHA 3CZ2A 4FQTA 3S0GA 3TDUA 1DEKA 1JSAA 4MLWA 1M39A 3DVJA 2I94A 1FPWA 1ZMZA 1NP8A 1KFUL 1UUSA 2LV7A 1A29A 3D78A 4MZKA 4YGAA 3D10A 4NQGA 1B7TZ 4YGBB 4GPLB 1H4BA 4DIRA 3SG6A 3I5IB 1OOIX 1WLZA 2K2AA 2MRDA 2P70A 3B88A 5JOLA 1EG3A 3QRXA 1TNQA 1KK7Z 2BAPA 5J3XA 3DVMA 2KAVA 1IQ3A 1JC2A 1KQVA 1QJTA 2WCLA 1M46A 3CR5X 2JU0A 3I5GC 1DJZA 2PRUA 3DF0B 3PATA 3SJSA 4ICBA 2BCAA 2PVBA 5BPJA 2KQYA 2ISDA 3TUYB 4QJ3B 5D69A 2BBNA 3WHUB 3I5FB 4M2OA 4PCWA 3S0BA 3NSOA 3B86A 2GGMA 2RGIA 3BUNB 2M8UA 3DXLA 4ORCB 5KU1A 2HPSA 1J7RA 1WDCC 2A4JA 1DMOA 2KI6C 3K1EA 4PT1A 1CMGA 3LL8B 5HKYA 2I7AA 2OS8B 3OP0A 3CTNA 4MBEA 4WQ2A 1OMRA 1QXPA 3TS5B 4YGCB 4I5NB 1CLBA 1XFZO 2BCXA 1H8BA 2JQ6A 3D0YA 1E8AA 1T14A 5FI7A 3OX5A 2BCBA 3FE8A 2MLEC 2Q91A 1DGUA 2E30A 1KWOC 1F55A 2KBIA 1Y1UA 1PK0D 3S0AA 4PHKA 1QTXA 4MSPA 4Q04A 2M7LA 2QEBA 1SPYA 2GTEA 1BT6A 1L2OC 1CM1A 2OPOA 1M45A 3S0DA 4NDBA 1TNWA 4DRWA 1J7OA 2LUCA 1MXEA 1JBAA 1NUBA
chains in the Genus database with same CATH topology
3EK8A 3BYAA 3EKJA 2M3WA 5CPVA 2R2IA 1OZSA 2K7CA 1DJYA 4ETOA 1RK9A 1YR5A 1XFXO 3KF9A 1Y1XA 1F4OA 2LVVA 1CFFA 1JF2A 2FCEA 2CBLA 1JFJA 5AFPA 1A03A 1QV0A 2LE9B 1XK4C 1AK8A 1BODA 1S36A 2M49B 1YUUA 3VRQA 3VRPA 2NLNA 1TTXA 2LVJA 1Y1AA 1X02A 2PASA 4ZCVA 3FWBA 3TDZA 1QVIZ 4CIDA 2D8NA 2KFGA 3O78A 1EJ3A 1SR6C 1SCMC 1ZFSA 2K7BA 1F4QA 1KSOA 4JWQA 1IH0A 4IL1A 5K89A 5D7FA 4ZCUA 2KYCA 4YI9A 3A4UB 2K61A 2KYFA 2BBMA 1DF0B 1SRAA 1UWOA 3PSRA 4PE7A 2Y4QA 1SK6D 2M9GA 2AUCA 4MN0A 2LMUA 4C0KA 1SL7A 2E6WA 1DVIA 2JRFA 5G08A 1CLMA 3LCPC 4PE4A 4XJKB 2MA2A 1PVAA 1NX3A 1QX7A 1Y0VH 1SNLA 1MXLC 2L5XB 3CR4X 3ICBA 1MUXA 4I5KA 2TN4A 1XK4A 2M97A 3VROA 2CTNA 2Y1MA 2JXCA 2L50A 1BJFA 1NX2A 1YX7A 1S6IA 4HRGA 1DJHA 2BE6A 1KK8C 5ER5A 5I2QA 2VRGA 2F33A 3NSLA 2AMIA 3SG7A 4AQIA 1UP5A 3GK4X 1JUOA 5GQQC 2LMTA 2ZN9A 1QASA 3F45A 3JVTC 3CR2A 1QLKA 5JJGA 1KQMC 2LMVA 1AHRA 2KQ6A 2WC8A 1JWDA 2JXLA 2ZRSA 5F6TA 3A8RA 3CZTX 1XFVO 3EK4A 5I2OA 3I5HB 1J1DA 1FI5A 5HLOA 4QJ4B 1KK7Y 1Q80A 1ZACA 2K7DA 1DJIA 2LLUA 2OTGB 3PN7C 1TCFA 4HSZA 1C07A 1C7VA 4OV2A 1K96A 5AERA 1CFPA 1HQVA 3EK7A 2EC6C 3NSIA 2HQ8A 1BG1A 4GFTA 5HKWA 1KFXL 4PE1A 4GGNA 1NIWA 1B8CA 1LVCD 2KI4B 2L4HA 1YUTA 3EVUA 1B8LA 3NSKA 4GNKB 2NZ0A 2LLTA 1YURA 1RTP1 2K2FA 1RJVA 1W7IB 2WORA 2P6BB 1DJGA 2BE4A 1L7ZA 2L2EA 3PM8A 5HKZA 4YGDB 4YRUA 2NCOA 3BOWA 1YTZC 2L0PA 1CNPA 3AKAA 1WLMA 2KAXA 1VRKA 3DVKA 4DCKA 1XFWO 1IJ5A 2KFFA 2I2RE 2MBXA 1OE9B 3LK1A 2JWWA 4E68A 1UHJA 3D0YB 1QX2A 2PMYA 3AAKA 1CB1A 5KTYA 5FYXA 2K8MB 4GAOA 1RFJA 3IF7A 2JC2A 4GBAA 1OOJA 2LAPA 1EL4A 3I5GB 3IQQA 1FW4A 1F54A 3BXKA 1OSAA 2KOTA 1CDNA 2M1UA 2KI6D 1K2HA 2JZIA 5CSNA 1LXFC 2F3ZA 2BKIB 1WRLA 1ZUZA 2KGBC 1J55A 1QS7A 4FTGA 1S6JA 4YBHB 1K9KA 2LM5A 1N2DA 4CLNA 2FJUB 3KHEA 1SBJA 1SY9A 1WDCB 3O4YA 4M2QA 1EXRA 1XA5A 2Q4UA 3GK1A 1UHKA 1XVJA 2K0JA 2ZFDA 2Y5IA 2LHLA 2QACA 1TNXA 4FQOA 1DTLA 2L51A 3SG4A 1WY9A 1KSMA 1NX0A 4D1EA 1AJ4A 4BY5A 2ZRTA 3FS7A 1YVHA 1IWQA 5DKQA 3RLZA 1XFYO 2NXQA 1KWOB 1SW8A 2KNEA 4OR9B 4C0LA 1R6PA 2F3YA 4A4CA 1NYAA 3K21A 1CLLA 2LNKA 1M31A 1KFUS 1L2OB 2LP3A 2SASA 4HRHA 5DKRA 2M7NA 1K9PA 3JTDC 2WCBA 4MVFA 4MEWA 3EKHA 3WXAA 2KSPA 2PSRA 4CFRA 3BUWB 5B8IB 1ALWA 1A75A 1OMDA 1CM4A 2WNDA 3DD4A 2WCEA 4CPVA 1AP4A 4GGFC 3KEVA 2MJWB 1CKKA 1S5GZ 1AVSA 1CDLA 2LANA 1IJ6A 4MZJA 4PHJA 5PALA 1BF5A 2BL0C 3ZWHA 1EH2A 4XYNA 1N0YA 4N5XA 5AANA 1BLQA 1GGWA 1WRKA 3SIAA 2LUXA 4C0JA 2AAOA 1FBVA 1U5IA 2KBMA 1G4YR 1B9AA 2FCDA 2KAYA 2MLFC 1FF1A 1A2XA 1SCMB 2CCMA 3CS1A 1J7PA 1DJXA 2ZNDA 1R2UA 3KPXA 4PALA 4MRXA 2KGRA 2LVKA 2IS9A 5CSJA 2JTTA 1NWDA 2DOQA 1SMGA 1K93D 3PLFB 1B7TY 1K8UA 4A4BA 3CGAA 1F70A 3I5HC 1G8IA 4GGFA 4PHMA 5TNCA 1PULA 1LINA 1S3PA 1BMOA 1MQ1A 2CXJA 2JT0A 2KHNA 3IQOA 4XJKA 1MR8A 2WCFA 3BUOB 3I5IC 3HX4A 2M0RA 2ZNEA 2JNFA 1B4CA 4U8DA 1TOPA 1NSHA 1S1EA 2JPTA 1KK8B 1B47A 1HT9A 4CFQA 2GGZA 2K7OA 2F8PA 2PALA 2I18A 1UHIA 1DGVA 3PALA 1S26D 2NCPA 3HCMA 3OHMB 1WRZA 1LA3A 2FOTA 3BQ3A 3JVTB 3M0WA 1ZOTB 2JOJA 3TUYC 3BOWB 4YI8A 1KQMB 3I5FC 1IGVA 3VRNA 1YVLA 3C1VA 4MRYA 1AJ5A 2H2KA 5ER4X 2MAZA 1BOCA 2ZKMX 3H4SE 1G33A 3PN7B 1CFCA 1UHHA 3BUMB 2QPTA 2SCPA 3PFVA 2OS8C 1NCZA 4NDDA 5I2LA 3AAJA 1FI6A 2EC6B 3TS5C 1K90D 2M1KB 3EVVA 3SG2A 4AOMA 1K9UA 3RM1A 1EG4A 2JTZA 4WQ3A 1NCYA 2CT9A 2F2OA 3FIAA 4ORBB 3TZ1A 1F8HA 1NPQA 1W7JB 2H61C 1PVBA 2G9BA 2KDHA 3DF0A 4JQ0D 2BECA 1JFKA 1TRFA 4PDZA 1B1GA 2L98A 1KCYA 1CDMA 1UURA 2COLB 1QX5B 3VGOA 2B1UA 2MHHA 4R1EA 1QLSA 3OB2B 3OX6A 4M2PA 4MZLA 4P2YB 1F71A 2JT3A 3GK2A 3KO0A 3AKBA 3FWCA 4TNCA 4UPGA 4HREE 1QATA 1XYDA 1K94A 4QJ5B 1YX8A 1PSRA 2M29A 5I8NA 3LLEA 1ALVA 3MSEB 5AXIA 4DUQA 1IKUA 5IBWA 1SCVA 1YUSA 1LKJA 3OB1B 2GV5A 1OMVA 1QVIY 3O6BA 3SG5A 1M63B 1V1GA 2G2BA 2H61A 4DS7A 1BR4B 4I5JA 3BUXB 2EHBA 4OKHA 1SYMA 5CSIA 4OVNF 3GOFA 1UHNA 2WOSA 1IRJA 1JF0A 4P5OE 1IQ5A 3VRRA 1A75B 2L4IA 1S5GY 2HETA 1RECA 2O60A 1S6CA 4JPZB 1YRUB 2LHIA 1ODBA 2LLSA 4ORAB 2HQWA 4PHNA 3TDIA 2F2PA 1D1OA 5HLVA 1SL8A 1DJWA 4OCIA 2JNXA 1GJYA 4USLA 3SIBA 2LP2A 1NX1A 1PSBA 1KFXS 4AQJA 2CNPA 4GUKA 1V1FA 1NCXA 1U5IB 2KFHA 1BU3A 1C7WA 1TIZA 4YGEB 1BR1B 2HF5A 2Y1NA 1GQMA 3LK0A 3CWGA 4N1FA 3WNXB 2JULA 5CSFA 2EGDA 1MF8B 1YRTB 4N1GA 1K95A 1DT7B 3CLNA 1CFDA 2BKHB 1SL9A 1SR6B 3JTDB 1CDPA 4I5LB 1A4PA 3DVEA 1QIVA 1B8RA 1IG5A 1RROA 1MHOA 1QV1A 4PE0A 2LVIA 5DKNA 3O2PA 1DF0A 3WHTB 1LA0A 1MWNA 1J1EA 3E3RA 2JT8A 4F0ZB 2ZN8A 5AEQA 4NDCA 1RWYA 1Y6WA 2BL0B 1AUIB 1CMFA 1SKTA 1QIWA 2OTGC 5KSZA 4L9MA 2LCPA 3EVRA 1OQPA 1N65A 1CTRA 1PALA 1TNPA 3SG3A 2V53A 1TCOB 4WRIA 3ZNIA 2LC5A 1OZOA 5HYDA 1J7QA 4BY4A 1XO5A 1XFUO 1GGZA 2O5GA 3NXAA 1PRWA 2KI4C 1TN4A 3TDUA 1JSAA 4MLWA 1M39A 3DVJA 2I94A 1FPWA 1ZMZA 1NP8A 1KFUL 1UUSA 2LV7A 1A29A 4MZKA 4YGAA 3D10A 4NQGA 1B7TZ 4YGBB 4GPLB 1H4BA 4DIRA 3SG6A 3I5IB 1WLZA 5JOLA 2K2AA 2MRDA 1EG3A 3QRXA 1TNQA 1KK7Z 5J3XA 3DVMA 2KAVA 1IQ3A 1JC2A 1KQVA 1QJTA 1M46A 3CR5X 2JU0A 3I5GC 1DJZA 2PRUA 3DF0B 3PATA 3SJSA 4ICBA 2BCAA 2PVBA 5BPJA 2KQYA 2ISDA 3TUYB 4QJ3B 5D69A 2BBNA 3WHUB 3I5FB 4M2OA 4PCWA 3NSOA 2GGMA 2RGIA 3BUNB 2M8UA 4ORCB 5KU1A 2HPSA 1J7RA 1WDCC 2A4JA 1DMOA 2KI6C 1CMGA 3LL8B 5HKYA 2I7AA 2OS8B 3OP0A 3CTNA 4MBEA 4WQ2A 1OMRA 1QXPA 3TS5B 4YGCB 4I5NB 1CLBA 1XFZO 2BCXA 1H8BA 2JQ6A 3D0YA 1E8AA 3OX5A 2BCBA 2MLEC 2Q91A 1DGUA 2E30A 1KWOC 1F55A 2KBIA 1Y1UA 1PK0D 4PHKA 1QTXA 4MSPA 4Q04A 2M7LA 1SPYA 1BT6A 1L2OC 1CM1A 2OPOA 1M45A 4NDBA 1TNWA 4DRWA 1J7OA 2LUCA 1MXEA 1JBAA 1NUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EK8 A;  3BYA A;  3EKJ A;  2M3W A;  5CPV A;  2R2I A;  1OZS A;  2K7C A;  1DJY A;  4ETO A;  1RK9 A;  1YR5 A;  1XFX O;  3KF9 A;  1Y1X A;  1F4O A;  2LVV A;  1CFF A;  1JF2 A;  2FCE A;  2CBL A;  1JFJ A;  5AFP A;  1A03 A;  1QV0 A;  2LE9 B;  1XK4 C;  1AK8 A;  1BOD A;  1S36 A;  2M49 B;  1YUU A;  3VRQ A;  3VRP A;  2NLN A;  1TTX A;  2LVJ A;  1Y1A A;  1X02 A;  2PAS A;  4ZCV A;  3FWB A;  3TDZ A;  1QVI Z;  4CID A;  2D8N A;  2KFG A;  3O78 A;  1EJ3 A;  1SR6 C;  1SCM C;  1ZFS A;  2K7B A;  1F4Q A;  1KSO A;  4JWQ A;  1IH0 A;  4IL1 A;  5K89 A;  5D7F A;  4ZCU A;  2KYC A;  4YI9 A;  3A4U B;  2K61 A;  2KYF A;  2BBM A;  1DF0 B;  1SRA A;  1UWO A;  3PSR A;  4PE7 A;  2Y4Q A;  1SK6 D;  2M9G A;  2AUC A;  4MN0 A;  2LMU A;  4C0K A;  1SL7 A;  2E6W A;  1DVI A;  2JRF A;  5G08 A;  1CLM A;  3LCP C;  4PE4 A;  4XJK B;  2MA2 A;  1PVA A;  1NX3 A;  1QX7 A;  1Y0V H;  1SNL A;  1MXL C;  2L5X B;  3CR4 X;  3ICB A;  1MUX A;  4I5K A;  2TN4 A;  1XK4 A;  2M97 A;  3VRO A;  2CTN A;  2Y1M A;  2JXC A;  2L50 A;  1BJF A;  1NX2 A;  1YX7 A;  1S6I A;  4HRG A;  1DJH A;  2BE6 A;  1KK8 C;  5ER5 A;  5I2Q A;  2VRG A;  2F33 A;  3NSL A;  2AMI A;  3SG7 A;  4AQI A;  1UP5 A;  3GK4 X;  1JUO A;  5GQQ C;  2LMT A;  2ZN9 A;  1QAS A;  3F45 A;  3JVT C;  3CR2 A;  1QLK A;  5JJG A;  1KQM C;  2LMV A;  1AHR A;  2KQ6 A;  2WC8 A;  1JWD A;  2JXL A;  2ZRS A;  5F6T A;  3A8R A;  3CZT X;  1XFV O;  3EK4 A;  5I2O A;  3I5H B;  1J1D A;  1FI5 A;  5HLO A;  4QJ4 B;  1KK7 Y;  1Q80 A;  1ZAC A;  2K7D A;  1DJI A;  2LLU A;  2OTG B;  3PN7 C;  1TCF A;  4HSZ A;  1C07 A;  1C7V A;  4OV2 A;  1K96 A;  5AER A;  1CFP A;  1HQV A;  3EK7 A;  2EC6 C;  3NSI A;  2HQ8 A;  1BG1 A;  4GFT A;  5HKW A;  1KFX L;  4PE1 A;  4GGN A;  1NIW A;  1B8C A;  1LVC D;  2KI4 B;  2L4H A;  1YUT A;  3EVU A;  1B8L A;  3NSK A;  4GNK B;  2NZ0 A;  2LLT A;  1YUR A;  1RTP 1;  2K2F A;  1RJV A;  1W7I B;  2WOR A;  2P6B B;  1DJG A;  2BE4 A;  1L7Z A;  2L2E A;  3PM8 A;  5HKZ A;  4YGD B;  4YRU A;  2NCO A;  3BOW A;  1YTZ C;  2L0P A;  1CNP A;  3AKA A;  1WLM A;  2KAX A;  1VRK A;  3DVK A;  4DCK A;  1XFW O;  1IJ5 A;  2KFF A;  2I2R E;  2MBX A;  1OE9 B;  3LK1 A;  2JWW A;  4E68 A;  1UHJ A;  3D0Y B;  1QX2 A;  2PMY A;  3AAK A;  1CB1 A;  5KTY A;  5FYX A;  2K8M B;  4GAO A;  1RFJ A;  3IF7 A;  2JC2 A;  4GBA A;  1OOJ A;  2LAP A;  1EL4 A;  3I5G B;  3IQQ A;  1FW4 A;  1F54 A;  3BXK A;  1OSA A;  2KOT A;  1CDN A;  2M1U A;  2KI6 D;  1K2H A;  2JZI A;  5CSN A;  1LXF C;  2F3Z A;  2BKI B;  1WRL A;  1ZUZ A;  2KGB C;  1J55 A;  1QS7 A;  4FTG A;  1S6J A;  4YBH B;  1K9K A;  2LM5 A;  1N2D A;  4CLN A;  2FJU B;  3KHE A;  1SBJ A;  1SY9 A;  1WDC B;  3O4Y A;  4M2Q A;  1EXR A;  1XA5 A;  2Q4U A;  3GK1 A;  1UHK A;  1XVJ A;  2K0J A;  2ZFD A;  2Y5I A;  2LHL A;  2QAC A;  1TNX A;  4FQO A;  1DTL A;  2L51 A;  3SG4 A;  1WY9 A;  1KSM A;  1NX0 A;  4D1E A;  1AJ4 A;  4BY5 A;  2ZRT A;  3FS7 A;  1YVH A;  1IWQ A;  5DKQ A;  3RLZ A;  1XFY O;  2NXQ A;  1KWO B;  1SW8 A;  2KNE A;  4OR9 B;  4C0L A;  1R6P A;  2F3Y A;  4A4C A;  1NYA A;  3K21 A;  1CLL A;  2LNK A;  1M31 A;  1KFU S;  1L2O B;  2LP3 A;  2SAS A;  4HRH A;  5DKR A;  2M7N A;  1K9P A;  3JTD C;  2WCB A;  4MVF A;  4MEW A;  3EKH A;  3WXA A;  2KSP A;  2PSR A;  4CFR A;  3BUW B;  5B8I B;  1ALW A;  1A75 A;  1OMD A;  1CM4 A;  2WND A;  3DD4 A;  2WCE A;  4CPV A;  1AP4 A;  4GGF C;  3KEV A;  2MJW B;  1CKK A;  1S5G Z;  1AVS A;  1CDL A;  2LAN A;  1IJ6 A;  4MZJ A;  4PHJ A;  5PAL A;  1BF5 A;  2BL0 C;  3ZWH A;  1EH2 A;  4XYN A;  1N0Y A;  4N5X A;  5AAN A;  1BLQ A;  1GGW A;  1WRK A;  3SIA A;  2LUX A;  4C0J A;  2AAO A;  1FBV A;  1U5I A;  2KBM A;  1G4Y R;  1B9A A;  2FCD A;  2KAY A;  2MLF C;  1FF1 A;  1A2X A;  1SCM B;  2CCM A;  3CS1 A;  1J7P A;  1DJX A;  2ZND A;  1R2U A;  3KPX A;  4PAL A;  4MRX A;  2KGR A;  2LVK A;  2IS9 A;  5CSJ A;  2JTT A;  1NWD A;  2DOQ A;  1SMG A;  1K93 D;  3PLF B;  1B7T Y;  1K8U A;  4A4B A;  3CGA A;  1F70 A;  3I5H C;  1G8I A;  4GGF A;  4PHM A;  5TNC A;  1PUL A;  1LIN A;  1S3P A;  1BMO A;  1MQ1 A;  2CXJ A;  2JT0 A;  2KHN A;  3IQO A;  4XJK A;  1MR8 A;  2WCF A;  3BUO B;  3I5I C;  3HX4 A;  2M0R A;  2ZNE A;  2JNF A;  1B4C A;  4U8D A;  1TOP A;  1NSH A;  1S1E A;  2JPT A;  1KK8 B;  1B47 A;  1HT9 A;  4CFQ A;  2GGZ A;  2K7O A;  2F8P A;  2PAL A;  2I18 A;  1UHI A;  1DGV A;  3PAL A;  1S26 D;  2NCP A;  3HCM A;  3OHM B;  1WRZ A;  1LA3 A;  2FOT A;  3BQ3 A;  3JVT B;  3M0W A;  1ZOT B;  2JOJ A;  3TUY C;  3BOW B;  4YI8 A;  1KQM B;  3I5F C;  1IGV A;  3VRN A;  1YVL A;  3C1V A;  4MRY A;  1AJ5 A;  2H2K A;  5ER4 X;  2MAZ A;  1BOC A;  2ZKM X;  3H4S E;  1G33 A;  3PN7 B;  1CFC A;  1UHH A;  3BUM B;  2QPT A;  2SCP A;  3PFV A;  2OS8 C;  1NCZ A;  4NDD A;  5I2L A;  3AAJ A;  1FI6 A;  2EC6 B;  3TS5 C;  1K90 D;  2M1K B;  3EVV A;  3SG2 A;  4AOM A;  1K9U A;  3RM1 A;  1EG4 A;  2JTZ A;  4WQ3 A;  1NCY A;  2CT9 A;  2F2O A;  3FIA A;  4ORB B;  3TZ1 A;  1F8H A;  1NPQ A;  1W7J B;  2H61 C;  1PVB A;  2G9B A;  2KDH A;  3DF0 A;  4JQ0 D;  2BEC A;  1JFK A;  1TRF A;  4PDZ A;  1B1G A;  2L98 A;  1KCY A;  1CDM A;  1UUR A;  2COL B;  1QX5 B;  3VGO A;  2B1U A;  2MHH A;  4R1E A;  1QLS A;  3OB2 B;  3OX6 A;  4M2P A;  4MZL A;  4P2Y B;  1F71 A;  2JT3 A;  3GK2 A;  3KO0 A;  3AKB A;  3FWC A;  4TNC A;  4UPG A;  4HRE E;  1QAT A;  1XYD A;  1K94 A;  4QJ5 B;  1YX8 A;  1PSR A;  2M29 A;  5I8N A;  3LLE A;  1ALV A;  3MSE B;  5AXI A;  4DUQ A;  1IKU A;  5IBW A;  1SCV A;  1YUS A;  1LKJ A;  3OB1 B;  2GV5 A;  1OMV A;  1QVI Y;  3O6B A;  3SG5 A;  1M63 B;  1V1G A;  2G2B A;  2H61 A;  4DS7 A;  1BR4 B;  4I5J A;  3BUX B;  2EHB A;  4OKH A;  1SYM A;  5CSI A;  4OVN F;  3GOF A;  1UHN A;  2WOS A;  1IRJ A;  1JF0 A;  4P5O E;  1IQ5 A;  3VRR A;  1A75 B;  2L4I A;  1S5G Y;  2HET A;  1REC A;  2O60 A;  1S6C A;  4JPZ B;  1YRU B;  2LHI A;  1ODB A;  2LLS A;  4ORA B;  2HQW A;  4PHN A;  3TDI A;  2F2P A;  1D1O A;  5HLV A;  1SL8 A;  1DJW A;  4OCI A;  2JNX A;  1GJY A;  4USL A;  3SIB A;  2LP2 A;  1NX1 A;  1PSB A;  1KFX S;  4AQJ A;  2CNP A;  4GUK A;  1V1F A;  1NCX A;  1U5I B;  2KFH A;  1BU3 A;  1C7W A;  1TIZ A;  4YGE B;  1BR1 B;  2HF5 A;  2Y1N A;  1GQM A;  3LK0 A;  3CWG A;  4N1F A;  3WNX B;  2JUL A;  5CSF A;  2EGD A;  1MF8 B;  1YRT B;  4N1G A;  1K95 A;  1DT7 B;  3CLN A;  1CFD A;  2BKH B;  1SL9 A;  1SR6 B;  3JTD B;  1CDP A;  4I5L B;  1A4P A;  3DVE A;  1QIV A;  1B8R A;  1IG5 A;  1RRO A;  1MHO A;  1QV1 A;  4PE0 A;  2LVI A;  5DKN A;  3O2P A;  1DF0 A;  3WHT B;  1LA0 A;  1MWN A;  1J1E A;  3E3R A;  2JT8 A;  4F0Z B;  2ZN8 A;  5AEQ A;  4NDC A;  1RWY A;  1Y6W A;  2BL0 B;  1AUI B;  1CMF A;  1SKT A;  1QIW A;  2OTG C;  5KSZ A;  4L9M A;  2LCP A;  3EVR A;  1OQP A;  1N65 A;  1CTR A;  1PAL A;  1TNP A;  3SG3 A;  2V53 A;  1TCO B;  4WRI A;  3ZNI A;  2LC5 A;  1OZO A;  5HYD A;  1J7Q A;  4BY4 A;  1XO5 A;  1XFU O;  1GGZ A;  2O5G A;  3NXA A;  1PRW A;  2KI4 C;  1TN4 A;  3TDU A;  1JSA A;  4MLW A;  1M39 A;  3DVJ A;  2I94 A;  1FPW A;  1ZMZ A;  1NP8 A;  1KFU L;  1UUS A;  2LV7 A;  1A29 A;  4MZK A;  4YGA A;  3D10 A;  4NQG A;  1B7T Z;  4YGB B;  4GPL B;  1H4B A;  4DIR A;  3SG6 A;  3I5I B;  1WLZ A;  5JOL A;  2K2A A;  2MRD A;  1EG3 A;  3QRX A;  1TNQ A;  1KK7 Z;  5J3X A;  3DVM A;  2KAV A;  1IQ3 A;  1JC2 A;  1KQV A;  1QJT A;  1M46 A;  3CR5 X;  2JU0 A;  3I5G C;  1DJZ A;  2PRU A;  3DF0 B;  3PAT A;  3SJS A;  4ICB A;  2BCA A;  2PVB A;  5BPJ A;  2KQY A;  2ISD A;  3TUY B;  4QJ3 B;  5D69 A;  2BBN A;  3WHU B;  3I5F B;  4M2O A;  4PCW A;  3NSO A;  2GGM A;  2RGI A;  3BUN B;  2M8U A;  4ORC B;  5KU1 A;  2HPS A;  1J7R A;  1WDC C;  2A4J A;  1DMO A;  2KI6 C;  1CMG A;  3LL8 B;  5HKY A;  2I7A A;  2OS8 B;  3OP0 A;  3CTN A;  4MBE A;  4WQ2 A;  1OMR A;  1QXP A;  3TS5 B;  4YGC B;  4I5N B;  1CLB A;  1XFZ O;  2BCX A;  1H8B A;  2JQ6 A;  3D0Y A;  1E8A A;  3OX5 A;  2BCB A;  2MLE C;  2Q91 A;  1DGU A;  2E30 A;  1KWO C;  1F55 A;  2KBI A;  1Y1U A;  1PK0 D;  4PHK A;  1QTX A;  4MSP A;  4Q04 A;  2M7L A;  1SPY A;  1BT6 A;  1L2O C;  1CM1 A;  2OPO A;  1M45 A;  4NDB A;  1TNW A;  4DRW A;  1J7O A;  2LUC A;  1MXE A;  1JBA A;  1NUB A; 
#chains in the Genus database with same CATH topology
 3EK8 A;  3BYA A;  3EKJ A;  2M3W A;  3V2L A;  5CPV A;  2R2I A;  1OZS A;  2K7C A;  1DJY A;  4ETO A;  1RK9 A;  1YR5 A;  1XFX O;  3KF9 A;  1Y1X A;  3SS5 A;  1F4O A;  2LVV A;  1CFF A;  1JF2 A;  2FCE A;  2CBL A;  1JFJ A;  5AFP A;  1A03 A;  1QV0 A;  2LE9 B;  1XK4 C;  1AK8 A;  1BOD A;  2ERB A;  3SS3 A;  4IJ7 A;  1S36 A;  2M49 B;  1YUU A;  3VRQ A;  3VRP A;  2NLN A;  1TTX A;  2LVJ A;  1Y1A A;  2KLD A;  1X02 A;  2PAS A;  4OZD A;  2P71 A;  4ZCV A;  3FWB A;  3S0F A;  3TDZ A;  1QVI Z;  4CID A;  2D8N A;  2KFG A;  3O78 A;  1EJ3 A;  1SR6 C;  1SCM C;  1ZFS A;  2K7B A;  1F4Q A;  1KSO A;  3NGV A;  4JWQ A;  1IH0 A;  1OOG A;  1DEL A;  4IL1 A;  5K89 A;  3L47 A;  5D7F A;  4ZCU A;  2KYC A;  4YI9 A;  3A4U B;  2K61 A;  2KYF A;  2BBM A;  1DF0 B;  1SRA A;  1UWO A;  2H8V A;  3NHT A;  2Y4Q A;  3PSR A;  4PE7 A;  1SK6 D;  2M9G A;  3RZS A;  2AUC A;  4MN0 A;  2LMU A;  4C0K A;  1SL7 A;  2E6W A;  1DVI A;  2JRF A;  1DQE A;  1CLM A;  4KYN A;  5G08 A;  3LCP C;  4PE4 A;  4XJK B;  2MA2 A;  1PVA A;  1NX3 A;  1QX7 A;  1Y0V H;  1SNL A;  1MXL C;  1LS8 A;  2L5X B;  3CR4 X;  1MUX A;  3ICB A;  3UO9 A;  4I5K A;  2TN4 A;  1XK4 A;  2M97 A;  3VRO A;  3OBV A;  1F8H A;  2CTN A;  2Y1M A;  2JXC A;  2L50 A;  1BJF A;  3QME A;  1NX2 A;  1OW4 A;  1YX7 A;  1S6I A;  4HRG A;  1DJH A;  2BE6 A;  1KK8 C;  5ER5 A;  5I2Q A;  2VRG A;  3TZ1 A;  2F33 A;  3D74 A;  3NSL A;  2AMI A;  2QEV A;  3SG7 A;  4AQI A;  1UP5 A;  3GK4 X;  1JUO A;  2BNX A;  5GQQ C;  1OOF A;  2LMT A;  2ZN9 A;  1QAS A;  3F45 A;  3JVT C;  3CR2 A;  3OGN A;  1QLK A;  3R72 A;  3D73 A;  5JJG A;  1KQM C;  2LMV A;  1AHR A;  2KQ6 A;  2WC8 A;  1JWD A;  2JXL A;  2ZRS A;  5F6T A;  3A8R A;  3CZT X;  1XFV O;  3EK4 A;  5I2O A;  3I5H B;  1J1D A;  1FI5 A;  5HLO A;  4QJ4 B;  1KK7 Y;  1Q80 A;  1ZAC A;  2K7D A;  1DJI A;  3D76 A;  2LLU A;  2OTG B;  3PN7 C;  3B87 A;  1TCF A;  3D77 A;  4HSZ A;  1C07 A;  1C7V A;  4OV2 A;  1K96 A;  5AER A;  1CFP A;  1HQV A;  3EK7 A;  2EC6 C;  3NSI A;  1QWV A;  2HQ8 A;  3B7A A;  1BG1 A;  4GFT A;  5HKW A;  1KFX L;  4PE1 A;  4GGN A;  1NIW A;  1B8C A;  1LVC D;  3R1P A;  2KI4 B;  1P28 A;  2L4H A;  1YUT A;  3EVU A;  1B8L A;  3NSK A;  4GNK B;  2NZ0 A;  2LLT A;  1YUR A;  1W9Z A;  1RTP 1;  2K2F A;  1RJV A;  2WC6 A;  1W7I B;  2WOR A;  2P6B B;  1DJG A;  2BE4 A;  1L7Z A;  2L2E A;  3PM8 A;  5HKZ A;  4YGD B;  4YRU A;  2NCO A;  3BOW A;  1YTZ C;  2L0P A;  1CNP A;  3AKA A;  1WLM A;  2KAX A;  1VRK A;  3DVK A;  4DCK A;  2WCJ A;  3BJH A;  1ORG A;  1XFW O;  5FI2 A;  3SS4 A;  3FE9 A;  1IJ5 A;  2KFF A;  2I2R E;  2MBX A;  1OE9 B;  3LK1 A;  2JWW A;  5FI6 A;  3UNW A;  4E68 A;  1UHJ A;  3D0Y B;  1QX2 A;  2PMY A;  3AAK A;  1CB1 A;  5KTY A;  5FYX A;  2PQL A;  2K8M B;  4GAO A;  1RFJ A;  3IF7 A;  2JC2 A;  4GBA A;  1OOJ A;  2LAP A;  1EL4 A;  3I5G B;  3IQQ A;  3PM2 A;  1FW4 A;  1F54 A;  3BXK A;  4F7F A;  1OSA A;  2KOT A;  2QDI A;  1CDN A;  2M1U A;  2KI6 D;  1K2H A;  2JZI A;  5CSN A;  1LXF C;  2F3Z A;  2BKI B;  1WRL A;  1ZUZ A;  2KGB C;  1J55 A;  1QS7 A;  4FTG A;  1S6J A;  4YBH B;  1K9K A;  2LM5 A;  1N2D A;  4CLN A;  2FJU B;  3KHE A;  1SBJ A;  1SY9 A;  1WDC B;  3O4Y A;  4M2Q A;  1EXR A;  1XA5 A;  2Q4U A;  3GK1 A;  2L2C A;  1UHK A;  1XVJ A;  2K0J A;  2ZFD A;  2Y5I A;  2LHL A;  2QAC A;  1TNX A;  4FQO A;  1DTL A;  2L51 A;  3SG4 A;  1WY9 A;  1KSM A;  1NX0 A;  4D1E A;  1AJ4 A;  4BY5 A;  2ZRT A;  3FS7 A;  1YVH A;  1IWQ A;  5DKQ A;  3RLZ A;  1XFY O;  2NXQ A;  1KWO B;  3CYZ A;  1SW8 A;  2KNE A;  4OR9 B;  4C0L A;  1R6P A;  2F3Y A;  1Z2C B;  4A4C A;  1NYA A;  3K21 A;  4JD9 A;  1CLL A;  2LNK A;  1M31 A;  1KFU S;  1L2O B;  2LP3 A;  2SAS A;  4HRH A;  3BFA A;  5DKR A;  2M7N A;  1K9P A;  3JTD C;  2WCB A;  4MVF A;  4MEW A;  3EKH A;  3WXA A;  2KSP A;  2PSR A;  4CFR A;  3BUW B;  5B8I B;  1ALW A;  1A75 A;  1OMD A;  1CM4 A;  2WND A;  3DD4 A;  2WCE A;  4CPV A;  1AP4 A;  4GGF C;  3KEV A;  2MJW B;  1CKK A;  1S5G Z;  1AVS A;  1CDL A;  2LAN A;  1IJ6 A;  4MZJ A;  3FE6 A;  4PHJ A;  5PAL A;  2YGU A;  1BF5 A;  2BL0 C;  3ZWH A;  1EH2 A;  4XYN A;  1N0Y A;  4JKT A;  4N5X A;  1TUZ A;  5AAN A;  1BLQ A;  1GGW A;  1WRK A;  3SIA A;  2LUX A;  4C0J A;  2AAO A;  1FBV A;  1U5I A;  5EL2 A;  2KBM A;  1G4Y R;  1B9A A;  2FCD A;  2KAY A;  2MLF C;  1C3Y A;  1FF1 A;  1A2X A;  1SCM B;  2CCM A;  3CS1 A;  1J7P A;  1DJX A;  2ZND A;  1R2U A;  3KPX A;  4PAL A;  2FJY A;  4MRX A;  2KGR A;  2LVK A;  2IS9 A;  5CSJ A;  2JTT A;  1NWD A;  2DOQ A;  1SMG A;  1K93 D;  3PLF B;  1B7T Y;  1K8U A;  3CZ1 A;  4A4B A;  3CGA A;  1F70 A;  3I5H C;  1G8I A;  4GGF A;  4PHM A;  5TNC A;  3N7H A;  1PUL A;  1LIN A;  1S3P A;  1BMO A;  1MQ1 A;  2CXJ A;  2JT0 A;  2KHN A;  3IQO A;  4XJK A;  1MR8 A;  2WCF A;  3BUO B;  3L4L A;  3I5I C;  3HX4 A;  2M0R A;  2ZNE A;  2JNF A;  1B4C A;  4U8D A;  1TOP A;  1NSH A;  1S1E A;  2JPT A;  1KK8 B;  1TWO A;  1IIO A;  1B47 A;  1HT9 A;  4CFQ A;  2GGZ A;  2K7O A;  2F8P A;  1TUJ A;  2PAL A;  2I18 A;  1UHI A;  1DGV A;  3PAL A;  1S26 D;  2NCP A;  3HCM A;  3OHM B;  1DC1 A;  1WRZ A;  1LA3 A;  2FOT A;  3BQ3 A;  3JVT B;  3M0W A;  1ZOT B;  2JOJ A;  3TUY C;  3BOW B;  1OOH A;  4INW A;  4YI8 A;  1KQM B;  3I5F C;  1IGV A;  3VRN A;  1YVL A;  3C1V A;  4MRY A;  3S0E A;  2WCK A;  1AJ5 A;  2H2K A;  5ER4 X;  2MAZ A;  3BFB A;  3IVT A;  2ZKM X;  3H4S E;  1G33 A;  3Q8I A;  3PN7 B;  1BOC A;  3DY9 A;  1CFC A;  1GM0 A;  1UHH A;  3BUM B;  2QPT A;  2SCP A;  3PFV A;  3R1O A;  2OS8 C;  1NCZ A;  4NDD A;  5I2L A;  3AAJ A;  1FI6 A;  2EC6 B;  3TS5 C;  1K90 D;  2M1K B;  3EVV A;  3SG2 A;  4AOM A;  1K9U A;  3RM1 A;  3DZT A;  1EG4 A;  2JTZ A;  2WC5 A;  1NCY A;  2CT9 A;  2F2O A;  3FIA A;  4ORB B;  4WQ3 A;  3R1V A;  1NPQ A;  1W7J B;  2H61 C;  1PVB A;  2G9B A;  2KDH A;  3DF0 A;  4JQ0 D;  2BEC A;  5HL1 A;  1JFK A;  1TRF A;  4PDZ A;  1B1G A;  2L98 A;  1KCY A;  1CDM A;  1UUR A;  2COL B;  1QX5 B;  3VGO A;  2B1U A;  2MHH A;  4R1E A;  1QLS A;  3OB2 B;  3OX6 A;  4M2P A;  4MZL A;  4P2Y B;  1F71 A;  2JT3 A;  3GK2 A;  3KO0 A;  3AKB A;  3FWC A;  4TNC A;  4UPG A;  4HRE E;  1QAT A;  1SSE B;  1XYD A;  1K94 A;  4QJ5 B;  1YX8 A;  1PSR A;  2M29 A;  5I8N A;  2QEH A;  3LLE A;  1ALV A;  3MSE B;  5AXI A;  3CZ0 A;  2KPH A;  4DUQ A;  1IKU A;  5IBW A;  1SCV A;  1YUS A;  1LKJ A;  3OB1 B;  2GV5 A;  1OMV A;  1QVI Y;  3O6B A;  3SG5 A;  5I94 A;  1M63 B;  1V1G A;  2G2B A;  2H61 A;  2JPO A;  4DS7 A;  1BR4 B;  4I5J A;  3BUX B;  2EHB A;  4OKH A;  5DIC A;  1SYM A;  5CSI A;  4OVN F;  3GOF A;  1UHN A;  2WOS A;  1IRJ A;  1JF0 A;  4P5O E;  1IQ5 A;  3VRR A;  3NHI A;  1A75 B;  2L4I A;  1S5G Y;  1Z4H A;  2HET A;  2PYQ A;  1REC A;  1C3Z A;  1S6C A;  2O60 A;  1YRU B;  4JPZ B;  2KLE A;  2LHI A;  1ODB A;  2LLS A;  4ORA B;  3DYE A;  2HQW A;  3B6X A;  4PHN A;  3TDI A;  2F2P A;  1D1O A;  5HLV A;  1SL8 A;  1DJW A;  4OCI A;  2JNX A;  1GJY A;  4USL A;  2L5Y A;  3SIB A;  2LP2 A;  3EG5 B;  2QEO A;  1NX1 A;  1PSB A;  2WCM A;  1KFX S;  4AQJ A;  2CNP A;  4GUK A;  1V1F A;  1NCX A;  1U5I B;  2KFH A;  1BU3 A;  1C7W A;  1TIZ A;  4YGE B;  1BR1 B;  3BFH A;  2HF5 A;  2Y1N A;  1GQM A;  3O4X A;  3LK0 A;  3CWG A;  4N1F A;  3WNX B;  2JUL A;  5CSF A;  2EGD A;  1MF8 B;  1YRT B;  4N1G A;  1K95 A;  1DT7 B;  3CLN A;  5D3O A;  1CFD A;  2BKH B;  1SL9 A;  1SR6 B;  3JTD B;  1CDP A;  4I5L B;  1A4P A;  3DVE A;  1QIV A;  1B8R A;  1IG5 A;  1RRO A;  1MHO A;  1QV1 A;  3L4A A;  4PE0 A;  2LVI A;  5DKN A;  3O2P A;  1DF0 A;  3WHT B;  1LA0 A;  2K60 A;  1MWN A;  1J1E A;  3E3R A;  2JT8 A;  3VB1 A;  2ZN8 A;  5AEQ A;  4NDC A;  1RWY A;  4F0Z B;  1Y6W A;  3CAB A;  2BL0 B;  1AUI B;  1CMF A;  1SKT A;  1QIW A;  2OTG C;  5KSZ A;  4INX A;  4L9M A;  2LCP A;  3EVR A;  1OQP A;  1N65 A;  1CTR A;  1PAL A;  1TNP A;  3SG3 A;  2V53 A;  1TCO B;  4WRI A;  3ZNI A;  2LC5 A;  1OZO A;  5HYD A;  1J7Q A;  4BY4 A;  1XO5 A;  1XFR A;  1XFU O;  3CDN A;  3PJI A;  1GGZ A;  2O5G A;  3D75 A;  3NXA A;  1PRW A;  2KI4 C;  1TN4 A;  2WCH A;  3CZ2 A;  4FQT A;  3S0G A;  3TDU A;  1DEK A;  1JSA A;  4MLW A;  1M39 A;  3DVJ A;  2I94 A;  1FPW A;  1ZMZ A;  1NP8 A;  1KFU L;  1UUS A;  2LV7 A;  1A29 A;  3D78 A;  4MZK A;  4YGA A;  3D10 A;  4NQG A;  1B7T Z;  4YGB B;  4GPL B;  1H4B A;  4DIR A;  3SG6 A;  3I5I B;  1OOI X;  1WLZ A;  2K2A A;  2MRD A;  2P70 A;  3B88 A;  5JOL A;  1EG3 A;  3QRX A;  1TNQ A;  1KK7 Z;  2BAP A;  5J3X A;  3DVM A;  2KAV A;  1IQ3 A;  1JC2 A;  1KQV A;  1QJT A;  2WCL A;  1M46 A;  3CR5 X;  2JU0 A;  3I5G C;  1DJZ A;  2PRU A;  3DF0 B;  3PAT A;  3SJS A;  4ICB A;  2BCA A;  2PVB A;  5BPJ A;  2KQY A;  2ISD A;  3TUY B;  4QJ3 B;  5D69 A;  2BBN A;  3WHU B;  3I5F B;  4M2O A;  4PCW A;  3S0B A;  3NSO A;  3B86 A;  2GGM A;  2RGI A;  3BUN B;  2M8U A;  3DXL A;  4ORC B;  5KU1 A;  2HPS A;  1J7R A;  1WDC C;  2A4J A;  1DMO A;  2KI6 C;  3K1E A;  4PT1 A;  1CMG A;  3LL8 B;  5HKY A;  2I7A A;  2OS8 B;  3OP0 A;  3CTN A;  4MBE A;  4WQ2 A;  1OMR A;  1QXP A;  3TS5 B;  4YGC B;  4I5N B;  1CLB A;  1XFZ O;  2BCX A;  1H8B A;  2JQ6 A;  3D0Y A;  1E8A A;  1T14 A;  5FI7 A;  3OX5 A;  2BCB A;  3FE8 A;  2MLE C;  2Q91 A;  1DGU A;  2E30 A;  1KWO C;  1F55 A;  2KBI A;  1Y1U A;  1PK0 D;  3S0A A;  4PHK A;  1QTX A;  4MSP A;  4Q04 A;  2M7L A;  2QEB A;  1SPY A;  2GTE A;  1BT6 A;  1L2O C;  1CM1 A;  2OPO A;  1M45 A;  3S0D A;  4NDB A;  1TNW A;  4DRW A;  1J7O A;  2LUC A;  1MXE A;  1JBA A;  1NUB A; 
#chains in the Genus database with same CATH homology
 3EK8 A;  3BYA A;  3EKJ A;  2M3W A;  5CPV A;  2R2I A;  1OZS A;  2K7C A;  1DJY A;  4ETO A;  1RK9 A;  1YR5 A;  1XFX O;  3KF9 A;  1Y1X A;  1F4O A;  2LVV A;  1CFF A;  1JF2 A;  2FCE A;  2CBL A;  1JFJ A;  5AFP A;  1A03 A;  1QV0 A;  2LE9 B;  1XK4 C;  1AK8 A;  1BOD A;  1S36 A;  2M49 B;  1YUU A;  3VRQ A;  3VRP A;  2NLN A;  1TTX A;  2LVJ A;  1Y1A A;  1X02 A;  2PAS A;  4ZCV A;  3FWB A;  3TDZ A;  1QVI Z;  4CID A;  2D8N A;  2KFG A;  3O78 A;  1EJ3 A;  1SR6 C;  1SCM C;  1ZFS A;  2K7B A;  1F4Q A;  1KSO A;  4JWQ A;  1IH0 A;  4IL1 A;  5K89 A;  5D7F A;  4ZCU A;  2KYC A;  4YI9 A;  3A4U B;  2K61 A;  2KYF A;  2BBM A;  1DF0 B;  1SRA A;  1UWO A;  3PSR A;  4PE7 A;  2Y4Q A;  1SK6 D;  2M9G A;  2AUC A;  4MN0 A;  2LMU A;  4C0K A;  1SL7 A;  2E6W A;  1DVI A;  2JRF A;  5G08 A;  1CLM A;  3LCP C;  4PE4 A;  4XJK B;  2MA2 A;  1PVA A;  1NX3 A;  1QX7 A;  1Y0V H;  1SNL A;  1MXL C;  2L5X B;  3CR4 X;  3ICB A;  1MUX A;  4I5K A;  2TN4 A;  1XK4 A;  2M97 A;  3VRO A;  2CTN A;  2Y1M A;  2JXC A;  2L50 A;  1BJF A;  1NX2 A;  1YX7 A;  1S6I A;  4HRG A;  1DJH A;  2BE6 A;  1KK8 C;  5ER5 A;  5I2Q A;  2VRG A;  2F33 A;  3NSL A;  2AMI A;  3SG7 A;  4AQI A;  1UP5 A;  3GK4 X;  1JUO A;  5GQQ C;  2LMT A;  2ZN9 A;  1QAS A;  3F45 A;  3JVT C;  3CR2 A;  1QLK A;  5JJG A;  1KQM C;  2LMV A;  1AHR A;  2KQ6 A;  2WC8 A;  1JWD A;  2JXL A;  2ZRS A;  5F6T A;  3A8R A;  3CZT X;  1XFV O;  3EK4 A;  5I2O A;  3I5H B;  1J1D A;  1FI5 A;  5HLO A;  4QJ4 B;  1KK7 Y;  1Q80 A;  1ZAC A;  2K7D A;  1DJI A;  2LLU A;  2OTG B;  3PN7 C;  1TCF A;  4HSZ A;  1C07 A;  1C7V A;  4OV2 A;  1K96 A;  5AER A;  1CFP A;  1HQV A;  3EK7 A;  2EC6 C;  3NSI A;  2HQ8 A;  1BG1 A;  4GFT A;  5HKW A;  1KFX L;  4PE1 A;  4GGN A;  1NIW A;  1B8C A;  1LVC D;  2KI4 B;  2L4H A;  1YUT A;  3EVU A;  1B8L A;  3NSK A;  4GNK B;  2NZ0 A;  2LLT A;  1YUR A;  1RTP 1;  2K2F A;  1RJV A;  1W7I B;  2WOR A;  2P6B B;  1DJG A;  2BE4 A;  1L7Z A;  2L2E A;  3PM8 A;  5HKZ A;  4YGD B;  4YRU A;  2NCO A;  3BOW A;  1YTZ C;  2L0P A;  1CNP A;  3AKA A;  1WLM A;  2KAX A;  1VRK A;  3DVK A;  4DCK A;  1XFW O;  1IJ5 A;  2KFF A;  2I2R E;  2MBX A;  1OE9 B;  3LK1 A;  2JWW A;  4E68 A;  1UHJ A;  3D0Y B;  1QX2 A;  2PMY A;  3AAK A;  1CB1 A;  5KTY A;  5FYX A;  2K8M B;  4GAO A;  1RFJ A;  3IF7 A;  2JC2 A;  4GBA A;  1OOJ A;  2LAP A;  1EL4 A;  3I5G B;  3IQQ A;  1FW4 A;  1F54 A;  3BXK A;  1OSA A;  2KOT A;  1CDN A;  2M1U A;  2KI6 D;  1K2H A;  2JZI A;  5CSN A;  1LXF C;  2F3Z A;  2BKI B;  1WRL A;  1ZUZ A;  2KGB C;  1J55 A;  1QS7 A;  4FTG A;  1S6J A;  4YBH B;  1K9K A;  2LM5 A;  1N2D A;  4CLN A;  2FJU B;  3KHE A;  1SBJ A;  1SY9 A;  1WDC B;  3O4Y A;  4M2Q A;  1EXR A;  1XA5 A;  2Q4U A;  3GK1 A;  1UHK A;  1XVJ A;  2K0J A;  2ZFD A;  2Y5I A;  2LHL A;  2QAC A;  1TNX A;  4FQO A;  1DTL A;  2L51 A;  3SG4 A;  1WY9 A;  1KSM A;  1NX0 A;  4D1E A;  1AJ4 A;  4BY5 A;  2ZRT A;  3FS7 A;  1YVH A;  1IWQ A;  5DKQ A;  3RLZ A;  1XFY O;  2NXQ A;  1KWO B;  1SW8 A;  2KNE A;  4OR9 B;  4C0L A;  1R6P A;  2F3Y A;  4A4C A;  1NYA A;  3K21 A;  1CLL A;  2LNK A;  1M31 A;  1KFU S;  1L2O B;  2LP3 A;  2SAS A;  4HRH A;  5DKR A;  2M7N A;  1K9P A;  3JTD C;  2WCB A;  4MVF A;  4MEW A;  3EKH A;  3WXA A;  2KSP A;  2PSR A;  4CFR A;  3BUW B;  5B8I B;  1ALW A;  1A75 A;  1OMD A;  1CM4 A;  2WND A;  3DD4 A;  2WCE A;  4CPV A;  1AP4 A;  4GGF C;  3KEV A;  2MJW B;  1CKK A;  1S5G Z;  1AVS A;  1CDL A;  2LAN A;  1IJ6 A;  4MZJ A;  4PHJ A;  5PAL A;  1BF5 A;  2BL0 C;  3ZWH A;  1EH2 A;  4XYN A;  1N0Y A;  4N5X A;  5AAN A;  1BLQ A;  1GGW A;  1WRK A;  3SIA A;  2LUX A;  4C0J A;  2AAO A;  1FBV A;  1U5I A;  2KBM A;  1G4Y R;  1B9A A;  2FCD A;  2KAY A;  2MLF C;  1FF1 A;  1A2X A;  1SCM B;  2CCM A;  3CS1 A;  1J7P A;  1DJX A;  2ZND A;  1R2U A;  3KPX A;  4PAL A;  4MRX A;  2KGR A;  2LVK A;  2IS9 A;  5CSJ A;  2JTT A;  1NWD A;  2DOQ A;  1SMG A;  1K93 D;  3PLF B;  1B7T Y;  1K8U A;  4A4B A;  3CGA A;  1F70 A;  3I5H C;  1G8I A;  4GGF A;  4PHM A;  5TNC A;  1PUL A;  1LIN A;  1S3P A;  1BMO A;  1MQ1 A;  2CXJ A;  2JT0 A;  2KHN A;  3IQO A;  4XJK A;  1MR8 A;  2WCF A;  3BUO B;  3I5I C;  3HX4 A;  2M0R A;  2ZNE A;  2JNF A;  1B4C A;  4U8D A;  1TOP A;  1NSH A;  1S1E A;  2JPT A;  1KK8 B;  1B47 A;  1HT9 A;  4CFQ A;  2GGZ A;  2K7O A;  2F8P A;  2PAL A;  2I18 A;  1UHI A;  1DGV A;  3PAL A;  1S26 D;  2NCP A;  3HCM A;  3OHM B;  1WRZ A;  1LA3 A;  2FOT A;  3BQ3 A;  3JVT B;  3M0W A;  1ZOT B;  2JOJ A;  3TUY C;  3BOW B;  4YI8 A;  1KQM B;  3I5F C;  1IGV A;  3VRN A;  1YVL A;  3C1V A;  4MRY A;  1AJ5 A;  2H2K A;  5ER4 X;  2MAZ A;  1BOC A;  2ZKM X;  3H4S E;  1G33 A;  3PN7 B;  1CFC A;  1UHH A;  3BUM B;  2QPT A;  2SCP A;  3PFV A;  2OS8 C;  1NCZ A;  4NDD A;  5I2L A;  3AAJ A;  1FI6 A;  2EC6 B;  3TS5 C;  1K90 D;  2M1K B;  3EVV A;  3SG2 A;  4AOM A;  1K9U A;  3RM1 A;  1EG4 A;  2JTZ A;  4WQ3 A;  1NCY A;  2CT9 A;  2F2O A;  3FIA A;  4ORB B;  3TZ1 A;  1F8H A;  1NPQ A;  1W7J B;  2H61 C;  1PVB A;  2G9B A;  2KDH A;  3DF0 A;  4JQ0 D;  2BEC A;  1JFK A;  1TRF A;  4PDZ A;  1B1G A;  2L98 A;  1KCY A;  1CDM A;  1UUR A;  2COL B;  1QX5 B;  3VGO A;  2B1U A;  2MHH A;  4R1E A;  1QLS A;  3OB2 B;  3OX6 A;  4M2P A;  4MZL A;  4P2Y B;  1F71 A;  2JT3 A;  3GK2 A;  3KO0 A;  3AKB A;  3FWC A;  4TNC A;  4UPG A;  4HRE E;  1QAT A;  1XYD A;  1K94 A;  4QJ5 B;  1YX8 A;  1PSR A;  2M29 A;  5I8N A;  3LLE A;  1ALV A;  3MSE B;  5AXI A;  4DUQ A;  1IKU A;  5IBW A;  1SCV A;  1YUS A;  1LKJ A;  3OB1 B;  2GV5 A;  1OMV A;  1QVI Y;  3O6B A;  3SG5 A;  1M63 B;  1V1G A;  2G2B A;  2H61 A;  4DS7 A;  1BR4 B;  4I5J A;  3BUX B;  2EHB A;  4OKH A;  1SYM A;  5CSI A;  4OVN F;  3GOF A;  1UHN A;  2WOS A;  1IRJ A;  1JF0 A;  4P5O E;  1IQ5 A;  3VRR A;  1A75 B;  2L4I A;  1S5G Y;  2HET A;  1REC A;  2O60 A;  1S6C A;  4JPZ B;  1YRU B;  2LHI A;  1ODB A;  2LLS A;  4ORA B;  2HQW A;  4PHN A;  3TDI A;  2F2P A;  1D1O A;  5HLV A;  1SL8 A;  1DJW A;  4OCI A;  2JNX A;  1GJY A;  4USL A;  3SIB A;  2LP2 A;  1NX1 A;  1PSB A;  1KFX S;  4AQJ A;  2CNP A;  4GUK A;  1V1F A;  1NCX A;  1U5I B;  2KFH A;  1BU3 A;  1C7W A;  1TIZ A;  4YGE B;  1BR1 B;  2HF5 A;  2Y1N A;  1GQM A;  3LK0 A;  3CWG A;  4N1F A;  3WNX B;  2JUL A;  5CSF A;  2EGD A;  1MF8 B;  1YRT B;  4N1G A;  1K95 A;  1DT7 B;  3CLN A;  1CFD A;  2BKH B;  1SL9 A;  1SR6 B;  3JTD B;  1CDP A;  4I5L B;  1A4P A;  3DVE A;  1QIV A;  1B8R A;  1IG5 A;  1RRO A;  1MHO A;  1QV1 A;  4PE0 A;  2LVI A;  5DKN A;  3O2P A;  1DF0 A;  3WHT B;  1LA0 A;  1MWN A;  1J1E A;  3E3R A;  2JT8 A;  4F0Z B;  2ZN8 A;  5AEQ A;  4NDC A;  1RWY A;  1Y6W A;  2BL0 B;  1AUI B;  1CMF A;  1SKT A;  1QIW A;  2OTG C;  5KSZ A;  4L9M A;  2LCP A;  3EVR A;  1OQP A;  1N65 A;  1CTR A;  1PAL A;  1TNP A;  3SG3 A;  2V53 A;  1TCO B;  4WRI A;  3ZNI A;  2LC5 A;  1OZO A;  5HYD A;  1J7Q A;  4BY4 A;  1XO5 A;  1XFU O;  1GGZ A;  2O5G A;  3NXA A;  1PRW A;  2KI4 C;  1TN4 A;  3TDU A;  1JSA A;  4MLW A;  1M39 A;  3DVJ A;  2I94 A;  1FPW A;  1ZMZ A;  1NP8 A;  1KFU L;  1UUS A;  2LV7 A;  1A29 A;  4MZK A;  4YGA A;  3D10 A;  4NQG A;  1B7T Z;  4YGB B;  4GPL B;  1H4B A;  4DIR A;  3SG6 A;  3I5I B;  1WLZ A;  5JOL A;  2K2A A;  2MRD A;  1EG3 A;  3QRX A;  1TNQ A;  1KK7 Z;  5J3X A;  3DVM A;  2KAV A;  1IQ3 A;  1JC2 A;  1KQV A;  1QJT A;  1M46 A;  3CR5 X;  2JU0 A;  3I5G C;  1DJZ A;  2PRU A;  3DF0 B;  3PAT A;  3SJS A;  4ICB A;  2BCA A;  2PVB A;  5BPJ A;  2KQY A;  2ISD A;  3TUY B;  4QJ3 B;  5D69 A;  2BBN A;  3WHU B;  3I5F B;  4M2O A;  4PCW A;  3NSO A;  2GGM A;  2RGI A;  3BUN B;  2M8U A;  4ORC B;  5KU1 A;  2HPS A;  1J7R A;  1WDC C;  2A4J A;  1DMO A;  2KI6 C;  1CMG A;  3LL8 B;  5HKY A;  2I7A A;  2OS8 B;  3OP0 A;  3CTN A;  4MBE A;  4WQ2 A;  1OMR A;  1QXP A;  3TS5 B;  4YGC B;  4I5N B;  1CLB A;  1XFZ O;  2BCX A;  1H8B A;  2JQ6 A;  3D0Y A;  1E8A A;  3OX5 A;  2BCB A;  2MLE C;  2Q91 A;  1DGU A;  2E30 A;  1KWO C;  1F55 A;  2KBI A;  1Y1U A;  1PK0 D;  4PHK A;  1QTX A;  4MSP A;  4Q04 A;  2M7L A;  1SPY A;  1BT6 A;  1L2O C;  1CM1 A;  2OPO A;  1M45 A;  4NDB A;  1TNW A;  4DRW A;  1J7O A;  2LUC A;  1MXE A;  1JBA A;  1NUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...