3NHIA

Crystal structure of the anst-d7l1-leukotriene c4 complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
296
structure length
295
Chain Sequence
QPWKALDAEQALYVYKRCYEDHLPSGSDRKTYMTLWNAWRLEPNDAITHCYAKCVLTGLQIYDPQENAFKSDRIPVQYQAYKTITQSKQKEVTEYQKALAAANAKSGSCVDLYNAYLPVHNRFVNLSRQLYHGTVEGAAKIYAAMPEIKQKGESFHAYCEKRAWKGNKQSEWKNGRRYKLTGSPELKDAIDCIFRGLRYMDDTGLKVDEIVRDFNLINKSELEPEVRSVLASCKGSEAYDYYVCLVNSRLKQHFKNAFDFHELRSADYAYLLRKVYENPEKVKEEMKKLNTTVHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords D7 protein
publication title The function and three-dimensional structure of a thromboxane a(2)/cysteinyl leukotriene-binding protein from the saliva of a mosquito vector of the malaria parasite.
pubmed doi rcsb
source organism Anopheles stephensi
total genus 113
structure length 295
sequence length 296
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3nhiA02
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3nhiA01
2GTEA 3L4LA 3DXLA 1ORGA 3CABA 4PT1A 2JPOA 2QEOA 3S0DA 1OOIX 5DICA 3D73A 3FE9A 1XFRA 2PQLA 3D77A 3Q8IA 2P70A 4F7FA 2WCMA 1C3YA 3FE8A 3B88A 1OOGA 1QWVA 3CDNA 1OW4A 3PJIA 3CZ1A 3BFAA 3NHTA 3S0FA 3D75A 1OOFA 3S0BA 2WCLA 3S0EA 3VB1A 3QMEA 3K1EA 4OZDA 1C3ZA 2WC6A 1TUJA 3NHIA 1GM0A 3RZSA 3BJHA 2WCKA 3V2LA 3S0AA 2QEBA 3L47A 3B7AA 3D76A 3CZ0A 3R1PA 3R1VA 2QEHA 1TWOA 3L4AA 3DZTA 3BFHA 4INXA 2FJYA 5EL2A 1DQEA 3NGVA 2WCJA 3D74A 1OOHA 2QDIA 3DY9A 3D78A 3S0GA 3B6XA 3R1OA 2WCHA 3CYZA 4JD9A 3BFBA 3CZ2A 4FQTA 3OGNA 2QEVA 2H8VA 2ERBA 3FE6A 4INWA 3R72A 2KPHA 1T14A 1P28A 3B86A 3N7HA 3B87A 2P71A 2WC5A 3DYEA 1LS8A 2L2CA
chains in the Genus database with same CATH superfamily
1HT9A 2EHBA 2ZKMX 3QRXA 4CFRA 4JQ0D 4L9MA 3CABA 2LMVA 1TCFA 4PHKA 4XJKB 3I5GB 5FYXA 1F55A 2QEOA 3SS4A 1FPWA 3S0DA 2D8NA 3SS5A 4TNCA 5DICA 3I5FC 1ODBA 1DJHA 1PRWA 2KNEA 2WCEA 1J1EA 3IF7A 2JOJA 2PQLA 5F6TA 4GGFA 4CLNA 1OMDA 1IJ5A 2KI6C 2LVIA 2OS8B 4YGCB 1G4YR 2BE6A 2P70A 2WCMA 1J7PA 4QJ5B 3EK4A 1EG3A 1XYDA 1C3YA 1TNPA 2LAPA 2LVJA 1WLZA 1BT6A 4XJKA 1SL8A 1UP5A 1DEKA 2F2OA 3EKHA 1JC2A 3BFAA 2PALA 1IQ3A 2AAOA 3NHTA 1UUSA 1QVIY 1J7OA 2HPSA 1XK4C 3E3RA 1AVSA 1WY9A 2JXCA 2F3ZA 1TNQA 3S0BA 2L4HA 3WHUB 1IRJA 1SR6C 2L51A 2V53A 1Y0VH 4P2YB 3VRQA 2JTZA 2M0RA 5I8NA 2WCLA 2G9BA 2LLSA 3VRNA 3CS1A 1A4PA 4N5XA 1W9ZA 3TUYC 1Y1AA 4HRHA 3I5HB 1LVCD 3UNWA 1C3ZA 2M3WA 2WC6A 5KU1A 1J7QA 2VRGA 4MN0A 1CNPA 3SS3A 1J55A 3SIBA 3PM8A 4HREE 1TUJA 2M1UA 3NHIA 3VGOA 2QACA 3NSKA 4ORAB 1N65A 2JNXA 5AEQA 3RLZA 1N2DA 1J1DA 1OZSA 2K7OA 4N1GA 2ZNDA 4PHJA 3IQOA 2LVKA 1SY9A 3H4SE 3JTDB 3UO9A 1R6PA 3LK1A 1SRAA 4YBHB 2GV5A 2RGIA 5AXIA 1Y6WA 5HKWA 3LK0A 1M46A 3R1VA 5I2OA 4C0LA 2FCDA 1UWOA 1K95A 1XFZO 2ZRSA 2L50A 3KHEA 1S3PA 1CDLA 2BBMA 4PALA 3VRRA 1KCYA 1DC1A 1OSAA 3SG3A 1DQEA 4I5NB 5HL1A 2Q4UA 3I5IC 1JFKA 2HF5A 1J7RA 1IIOA 1S5GY 3D78A 3B6XA 1SR6B 3IQQA 3R1OA 1JF0A 1UHKA 2CTNA 1NX0A 1PK0D 1SCMC 2WNDA 1WRLA 3D0YA 1N0YA 4YI9A 3KPXA 2K61A 1F54A 1DJZA 2H8VA 4NDCA 2ERBA 1IKUA 2H61C 4INWA 3TUYB 2CT9A 5ER4X 3AKAA 2KGRA 3BUNB 1F4QA 2KAVA 3O78A 1YVLA 3GK1A 4OKHA 5AFPA 1K90D 1K94A 5PALA 1GJYA 1XK4A 2E6WA 2WC8A 1M45A 1DF0B 1Y1XA 3AAJA 1MXLC 4JWQA 1L2OC 1AUIB 1K96A 4FQOA 4Q04A 3B87A 2FJUB 5CPVA 1ZUZA 1QIVA 2P71A 1MUXA 1NP8A 2R2IA 5ER5A 1TIZA 1K93D 1QS7A 1LS8A 1CTRA 1KK8C 2GTEA 3L4LA 4NDBA 2BAPA 4GFTA 3PSRA 1ORGA 2M9GA 4PT1A 3JVTC 1QLSA 4I5LB 1G8IA 3VROA 4A4BA 2FOTA 4OVNF 4PHNA 1OOIX 5CSNA 1YX7A 3D73A 1DF0A 2L4IA 1C07A 1BF5A 2KI6D 1F70A 3PFVA 1Z4HA 1S6IA 2KFFA 1IH0A 1A75B 2G2BA 4UPGA 1K2HA 1G33A 2LV7A 2EC6B 3I5IB 2HETA 1HQVA 1RTP1 1M31A 3BUXB 3DVJA 3O4XA 1CFDA 2JWWA 1OW4A 1LKJA 5AERA 3OB2B 2LNKA 3CZ1A 5DKRA 1SCMB 2CNPA 1EG4A 2K7BA 1KK7Z 1GGWA 2DOQA 1QX7A 3KO0A 2ISDA 1BR1B 1SL9A 1DELA 3PATA 1A75A 2I94A 5I2LA 1RECA 4PHMA 2JZIA 2MJWB 1M63B 2BKIB 1OE9B 3VB1A 3TS5C 2JPTA 2HQWA 1PULA 1EXRA 3BQ3A 3JTDC 3ICBA 1YUTA 3BOWB 1L2OB 1SMGA 3K1EA 3QMEA 4MLWA 4ORBB 4OZDA 1NYAA 1S36A 4MSPA 2NXQA 4CIDA 2WORA 5JJGA 4E68A 3LCPC 1LA3A 1V1GA 3OBVA 1KK8B 1XVJA 2MRDA 1B7TZ 2H61A 2F8PA 3EKJA 1WRKA 1BOCA 3RZSA 3JVTB 5DKNA 1QXPA 1QV1A 1FW4A 3SG2A 3NSOA 1SPYA 3S0AA 1FF1A 2KDHA 4XYNA 2L5XB 1EL4A 3HCMA 2KAXA 4HSZA 1OOJA 1U5IB 1DGUA 2QEBA 1TUZA 3SG5A 3OB1B 5AANA 1A2XA 3BOWA 1NSHA 3TDZA 2BCBA 1IWQA 4M2QA 1QATA 5G08A 3O4YA 2KHNA 2JT3A 1Y1UA 3CZTX 1RJVA 2KYFA 3LLEA 1AJ5A 1KK7Y 3WHTB 1H4BA 4C0JA 2LANA 2OPOA 3DZTA 2PMYA 3CR5X 4PE0A 4YRUA 3BFHA 5KSZA 2K7DA 1NX3A 5CSIA 2MLFC 1SYMA 1U5IA 3TZ1A 1OOHA 2TN4A 2NLNA 2QDIA 1CMFA 2LP2A 2BL0C 4U8DA 1SSEB 2MAZA 4A4CA 1DJXA 2AMIA 1DTLA 1BODA 3FIAA 4ETOA 2WCHA 4JD9A 1YUUA 1CDPA 3TS5B 4GUKA 3BYAA 4M2PA 2QEVA 1PSRA 1EJ3A 2CXJA 2L2EA 1TRFA 1CM1A 1B9AA 2AUCA 3R72A 1NX2A 3DVMA 1F4OA 1SBJA 1B1GA 3VRPA 2NCPA 2F2PA 1B4CA 1SKTA 1K9KA 3B86A 1H8BA 1SK6D 1A03A 2L5YA 3IVTA 1S1EA 1KFXS 2EC6C 2JT8A 1RFJA 1KQMC 2L2CA 1XFWO 1LXFC 3FWBA 3CWGA 1AP4A 5DKQA 2BKHB 1DT7B 3F45A 1XFVO 2M7NA 2LLUA 3SJSA 5I2QA 1ZMZA 2BE4A 2ZNEA 1KFXL 3A4UB 1KSOA 2KLDA 2KI4C 4PE1A 3D77A 5FI6A 3Q8IA 1B47A 1DJIA 4F7FA 4FTGA 1BU3A 2M7LA 1DVIA 1L7ZA 5I94A 3CLNA 4JPZB 1PALA 2L98A 4YGEB 1DGVA 1SCVA 2NZ0A 2Y1NA 3B88A 1OOGA 2BL0B 4YI8A 1QWVA 3CDNA 4I5JA 1UHNA 4I5KA 2KLEA 3PJIA 1YUSA 3DD4A 3DVKA 2LUCA 3OHMB 2Y1MA 1CM4A 2LLTA 1R2UA 1KFUS 1LA0A 4P5OE 1GGZA 3O2PA 3D75A 1OOFA 2PASA 3SG6A 5CSFA 5HLOA 1IQ5A 1DMOA 4GNKB 1YTZC 5FI2A 1IGVA 1KFUL 5KTYA 4WQ2A 2O60A 2MLEC 3PALA 1OZOA 3OX5A 1QJTA 2LMTA 2KQYA 4PDZA 1RK9A 1TTXA 1TNXA 1B8LA 3O6BA 2SCPA 2KGBC 1NPQA 1CDMA 2M8UA 3EVRA 1DJWA 1KQMB 2JU0A 3EK8A 5TNCA 2IS9A 2JQ6A 5HKZA 1ALVA 2Y5IA 5BPJA 2H2KA 1NX1A 2ZN9A 1K8UA 1JF2A 3PN7C 1WRZA 4AQIA 4MBEA 1BLQA 1V1FA 3B7AA 2KI4B 2BECA 1BMOA 4KYNA 4MZKA 2F33A 1W7IB 4AQJA 4PE4A 4BY4A 5FI7A 3R1PA 3LL8B 1W7JB 2K60A 1RROA 1SNLA 2P6BB 3GOFA 1TNWA 1MR8A 1K9PA 1ALWA 1UURA 1TWOA 3MSEB 1YX8A 1CMGA 3L4AA 4C0KA 2KBIA 3GK2A 2HQ8A 2GGZA 2FJYA 5EL2A 2KYCA 1MWNA 3NGVA 2WCJA 3D74A 1CLBA 4DIRA 1B8CA 1YVHA 1UHJA 2A4JA 4QJ3B 4YGAA 4AOMA 1SL7A 1JBAA 3DY9A 2L0PA 2GGMA 2JNFA 4MRYA 4BY5A 4YGDB 2JTTA 3SG4A 3CYZA 4PE7A 1JSAA 2JT0A 2MHHA 1M39A 2CBLA 2I7AA 4FQTA 3AKBA 5D69A 1PVAA 2JULA 1JUOA 1WDCC 2CCMA 3RM1A 4OV2A 1XFYO 1NIWA 3CR2A 3SIAA 2QPTA 4R1EA 4YGBB 2Y4QA 2WCBA 2KOTA 1C7VA 1S6JA 1UHHA 4MVFA 4DUQA 2KPHA 1QASA 3C1VA 2LUXA 3CGAA 1XFXO 4M2OA 4NDDA 4ZCUA 5J3XA 2JC2A 5IBWA 2K2AA 3PN7B 1LINA 3WNXB 1NCZA 4MEWA 1A29A 3BXKA 2PVBA 5B8IB 1QX2A 3EK7A 1NCYA 3PLFB 4USLA 1FBVA 2OTGC 3DXLA 1YRTB 4IL1A 2K7CA 2MA2A 2COLB 2JPOA 1TCOB 1OMVA 1F71A 4N1FA 1KWOC 3OP0A 2LVVA 3AAKA 3HX4A 1NWDA 4MRXA 1B7TY 4HRGA 1MQ1A 3FE9A 1AK8A 1PVBA 3D10A 2I2RE 3EVVA 4ORCB 1XFRA 4DS7A 1CDNA 1PSBA 1OMRA 3NSLA 3A8RA 1S5GZ 2LHIA 3NSIA 5D3OA 1EH2A 1BR4B 4IJ7A 1BG1A 4GPLB 4MZLA 3CTNA 3FE8A 5JOLA 1JWDA 3M0WA 2LE9B 4OR9B 1ZFSA 3FWCA 3ZWHA 2YGUA 5HLVA 1JFJA 1Q80A 1B8RA 4QJ4B 3BUOB 1FI5A 3I5FB 2BCXA 2PRUA 1WDCB 3S0FA 2PSRA 1FI6A 1KQVA 3KF9A 4GAOA 1MHOA 3WXAA 4CPVA 2ZFDA 2KSPA 2LCPA 2NCOA 3TDUA 4CFQA 1XA5A 1K9UA 2M49B 1QX5B 3OX6A 2WOSA 1YURA 3S0EA 1VRKA 3D0YB 1TN4A 4NQGA 2KFHA 1QLKA 3PM2A 4OCIA 1X02A 2JXLA 2I18A 2K0JA 2M97A 1AHRA 3ZNIA 1RWYA 2KFGA 2ZRTA 3DF0B 3KEVA 1GQMA 1ZACA 2M29A 2OTGB 2ZN8A 1GM0A 3EVUA 1D1OA 1QIWA 1C7WA 1WLMA 2WCKA 3BJHA 2B1UA 1KWOB 4GGFC 4GGNA 3V2LA 4DRWA 1CFPA 3GK4X 1CKKA 2PYQA 3L47A 3BUMB 1IG5A 2LP3A 1ZOTB 3CR4X 4GBAA 3D76A 2KAYA 2LMUA 3CZ0A 2KBMA 1CFCA 3I5GC 3DVEA 2MBXA 3NXAA 3DF0A 2QEHA 1IJ6A 4ICBA 1AJ4A 3K21A 2KQ6A 4MZJA 4D1EA 4WQ3A 1NCXA 4INXA 2EGDA 3BUWB 2OS8C 2WCFA 4JKTA 4PCWA 1CFFA 2LHLA 5CSJA 1BJFA 3TDIA 1S26D 3S0GA 2M1KB 2E30A 2JRFA 3BFBA 3CZ2A 4DCKA 1CLLA 1OQPA 3EG5B 3OGNA 1QV0A 1E8AA 1DJYA 1SW8A 1CLMA 1DJGA 1KSMA 5HKYA 5D7FA 2SASA 3FE6A 1F8HA 1YRUB 1MXEA 1QTXA 1XFUO 1Z2CB 2BNXA 2O5GA 5HYDA 2FCEA 2K8MB 5K89A 5GQQC 4F0ZB 2K2FA 3SG7A 1NUBA 1T14A 2F3YA 3FS7A 4WRIA 1P28A 1QVIZ 1CB1A 1TOPA 1YR5A 3N7HA 1UHIA 2LM5A 2BBNA 3I5HC 4ZCVA 1MF8B 2BCAA 2WC5A 3DYEA 1S6CA 1XO5A 2Q91A 2LC5A
chains in the Genus database with same CATH topology
2GTEA 3L4LA 3DXLA 1ORGA 3CABA 4PT1A 2JPOA 2QEOA 3S0DA 1OOIX 5DICA 3D73A 3FE9A 1XFRA 2PQLA 3D77A 3Q8IA 2P70A 4F7FA 2WCMA 1C3YA 3FE8A 3B88A 1OOGA 1QWVA 3CDNA 1OW4A 3PJIA 3CZ1A 3BFAA 3NHTA 3S0FA 3D75A 1OOFA 3S0BA 2WCLA 3S0EA 3VB1A 3QMEA 3K1EA 4OZDA 1C3ZA 2WC6A 1TUJA 3NHIA 1GM0A 3RZSA 3BJHA 2WCKA 3V2LA 3S0AA 2QEBA 3L47A 3B7AA 3D76A 3CZ0A 3R1PA 3R1VA 2QEHA 1TWOA 3L4AA 3DZTA 3BFHA 4INXA 2FJYA 5EL2A 1DQEA 3NGVA 2WCJA 3D74A 1OOHA 2QDIA 3DY9A 3D78A 3S0GA 3B6XA 3R1OA 2WCHA 3CYZA 4JD9A 3BFBA 3CZ2A 4FQTA 3OGNA 2QEVA 2H8VA 2ERBA 3FE6A 4INWA 3R72A 2KPHA 1T14A 1P28A 3B86A 3N7HA 3B87A 2P71A 2WC5A 3DYEA 1LS8A 2L2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTE A;  3L4L A;  3DXL A;  1ORG A;  3CAB A;  4PT1 A;  2JPO A;  2QEO A;  3S0D A;  1OOI X;  5DIC A;  3D73 A;  3FE9 A;  1XFR A;  2PQL A;  3D77 A;  3Q8I A;  2P70 A;  4F7F A;  2WCM A;  1C3Y A;  3FE8 A;  3B88 A;  1OOG A;  1QWV A;  3CDN A;  1OW4 A;  3PJI A;  3CZ1 A;  3BFA A;  3NHT A;  3S0F A;  3D75 A;  1OOF A;  3S0B A;  2WCL A;  3S0E A;  3VB1 A;  3QME A;  3K1E A;  4OZD A;  1C3Z A;  2WC6 A;  1TUJ A;  3NHI A;  1GM0 A;  3RZS A;  3BJH A;  2WCK A;  3V2L A;  3S0A A;  2QEB A;  3L47 A;  3B7A A;  3D76 A;  3CZ0 A;  3R1P A;  3R1V A;  2QEH A;  1TWO A;  3L4A A;  3DZT A;  3BFH A;  4INX A;  2FJY A;  5EL2 A;  1DQE A;  3NGV A;  2WCJ A;  3D74 A;  1OOH A;  2QDI A;  3DY9 A;  3D78 A;  3S0G A;  3B6X A;  3R1O A;  2WCH A;  3CYZ A;  4JD9 A;  3BFB A;  3CZ2 A;  4FQT A;  3OGN A;  2QEV A;  2H8V A;  2ERB A;  3FE6 A;  4INW A;  3R72 A;  2KPH A;  1T14 A;  1P28 A;  3B86 A;  3N7H A;  3B87 A;  2P71 A;  2WC5 A;  3DYE A;  1LS8 A;  2L2C A; 
#chains in the Genus database with same CATH topology
 1HT9 A;  2EHB A;  2ZKM X;  3QRX A;  4CFR A;  4JQ0 D;  4L9M A;  3CAB A;  2LMV A;  1TCF A;  4PHK A;  4XJK B;  3I5G B;  5FYX A;  1F55 A;  2QEO A;  3SS4 A;  1FPW A;  3S0D A;  2D8N A;  3SS5 A;  4TNC A;  5DIC A;  3I5F C;  1ODB A;  1DJH A;  1PRW A;  2KNE A;  2WCE A;  1J1E A;  3IF7 A;  2JOJ A;  2PQL A;  5F6T A;  4GGF A;  4CLN A;  1OMD A;  1IJ5 A;  2KI6 C;  2LVI A;  2OS8 B;  4YGC B;  1G4Y R;  2BE6 A;  2P70 A;  2WCM A;  1J7P A;  4QJ5 B;  3EK4 A;  1EG3 A;  1XYD A;  1C3Y A;  1TNP A;  2LAP A;  2LVJ A;  1WLZ A;  1BT6 A;  4XJK A;  1SL8 A;  1UP5 A;  1DEK A;  2F2O A;  3EKH A;  1JC2 A;  3BFA A;  2PAL A;  1IQ3 A;  2AAO A;  3NHT A;  1UUS A;  1QVI Y;  1J7O A;  2HPS A;  1XK4 C;  3E3R A;  1AVS A;  1WY9 A;  2JXC A;  2F3Z A;  1TNQ A;  3S0B A;  2L4H A;  3WHU B;  1IRJ A;  1SR6 C;  2L51 A;  2V53 A;  1Y0V H;  4P2Y B;  3VRQ A;  2JTZ A;  2M0R A;  5I8N A;  2WCL A;  2G9B A;  2LLS A;  3VRN A;  3CS1 A;  1A4P A;  4N5X A;  1W9Z A;  3TUY C;  1Y1A A;  4HRH A;  3I5H B;  1LVC D;  3UNW A;  1C3Z A;  2M3W A;  2WC6 A;  5KU1 A;  1J7Q A;  2VRG A;  4MN0 A;  1CNP A;  3SS3 A;  1J55 A;  3SIB A;  3PM8 A;  4HRE E;  1TUJ A;  2M1U A;  3NHI A;  3VGO A;  2QAC A;  3NSK A;  4ORA B;  1N65 A;  2JNX A;  5AEQ A;  3RLZ A;  1N2D A;  1J1D A;  1OZS A;  2K7O A;  4N1G A;  2ZND A;  4PHJ A;  3IQO A;  2LVK A;  1SY9 A;  3H4S E;  3JTD B;  3UO9 A;  1R6P A;  3LK1 A;  1SRA A;  4YBH B;  2GV5 A;  2RGI A;  5AXI A;  1Y6W A;  5HKW A;  3LK0 A;  1M46 A;  3R1V A;  5I2O A;  4C0L A;  2FCD A;  1UWO A;  1K95 A;  1XFZ O;  2ZRS A;  2L50 A;  3KHE A;  1S3P A;  1CDL A;  2BBM A;  4PAL A;  3VRR A;  1KCY A;  1DC1 A;  1OSA A;  3SG3 A;  1DQE A;  4I5N B;  5HL1 A;  2Q4U A;  3I5I C;  1JFK A;  2HF5 A;  1J7R A;  1IIO A;  1S5G Y;  3D78 A;  3B6X A;  1SR6 B;  3IQQ A;  3R1O A;  1JF0 A;  1UHK A;  2CTN A;  1NX0 A;  1PK0 D;  1SCM C;  2WND A;  1WRL A;  3D0Y A;  1N0Y A;  4YI9 A;  3KPX A;  2K61 A;  1F54 A;  1DJZ A;  2H8V A;  4NDC A;  2ERB A;  1IKU A;  2H61 C;  4INW A;  3TUY B;  2CT9 A;  5ER4 X;  3AKA A;  2KGR A;  3BUN B;  1F4Q A;  2KAV A;  3O78 A;  1YVL A;  3GK1 A;  4OKH A;  5AFP A;  1K90 D;  1K94 A;  5PAL A;  1GJY A;  1XK4 A;  2E6W A;  2WC8 A;  1M45 A;  1DF0 B;  1Y1X A;  3AAJ A;  1MXL C;  4JWQ A;  1L2O C;  1AUI B;  1K96 A;  4FQO A;  4Q04 A;  3B87 A;  2FJU B;  5CPV A;  1ZUZ A;  1QIV A;  2P71 A;  1MUX A;  1NP8 A;  2R2I A;  5ER5 A;  1TIZ A;  1K93 D;  1QS7 A;  1LS8 A;  1CTR A;  1KK8 C;  2GTE A;  3L4L A;  4NDB A;  2BAP A;  4GFT A;  3PSR A;  1ORG A;  2M9G A;  4PT1 A;  3JVT C;  1QLS A;  4I5L B;  1G8I A;  3VRO A;  4A4B A;  2FOT A;  4OVN F;  4PHN A;  1OOI X;  5CSN A;  1YX7 A;  3D73 A;  1DF0 A;  2L4I A;  1C07 A;  1BF5 A;  2KI6 D;  1F70 A;  3PFV A;  1Z4H A;  1S6I A;  2KFF A;  1IH0 A;  1A75 B;  2G2B A;  4UPG A;  1K2H A;  1G33 A;  2LV7 A;  2EC6 B;  3I5I B;  2HET A;  1HQV A;  1RTP 1;  1M31 A;  3BUX B;  3DVJ A;  3O4X A;  1CFD A;  2JWW A;  1OW4 A;  1LKJ A;  5AER A;  3OB2 B;  2LNK A;  3CZ1 A;  5DKR A;  1SCM B;  2CNP A;  1EG4 A;  2K7B A;  1KK7 Z;  1GGW A;  2DOQ A;  1QX7 A;  3KO0 A;  2ISD A;  1BR1 B;  1SL9 A;  1DEL A;  3PAT A;  1A75 A;  2I94 A;  5I2L A;  1REC A;  4PHM A;  2JZI A;  2MJW B;  1M63 B;  2BKI B;  1OE9 B;  3VB1 A;  3TS5 C;  2JPT A;  2HQW A;  1PUL A;  1EXR A;  3BQ3 A;  3JTD C;  3ICB A;  1YUT A;  3BOW B;  1L2O B;  1SMG A;  3K1E A;  3QME A;  4MLW A;  4ORB B;  4OZD A;  1NYA A;  1S36 A;  4MSP A;  2NXQ A;  4CID A;  2WOR A;  5JJG A;  4E68 A;  3LCP C;  1LA3 A;  1V1G A;  3OBV A;  1KK8 B;  1XVJ A;  2MRD A;  1B7T Z;  2H61 A;  2F8P A;  3EKJ A;  1WRK A;  1BOC A;  3RZS A;  3JVT B;  5DKN A;  1QXP A;  1QV1 A;  1FW4 A;  3SG2 A;  3NSO A;  1SPY A;  3S0A A;  1FF1 A;  2KDH A;  4XYN A;  2L5X B;  1EL4 A;  3HCM A;  2KAX A;  4HSZ A;  1OOJ A;  1U5I B;  1DGU A;  2QEB A;  1TUZ A;  3SG5 A;  3OB1 B;  5AAN A;  1A2X A;  3BOW A;  1NSH A;  3TDZ A;  2BCB A;  1IWQ A;  4M2Q A;  1QAT A;  5G08 A;  3O4Y A;  2KHN A;  2JT3 A;  1Y1U A;  3CZT X;  1RJV A;  2KYF A;  3LLE A;  1AJ5 A;  1KK7 Y;  3WHT B;  1H4B A;  4C0J A;  2LAN A;  2OPO A;  3DZT A;  2PMY A;  3CR5 X;  4PE0 A;  4YRU A;  3BFH A;  5KSZ A;  2K7D A;  1NX3 A;  5CSI A;  2MLF C;  1SYM A;  1U5I A;  3TZ1 A;  1OOH A;  2TN4 A;  2NLN A;  2QDI A;  1CMF A;  2LP2 A;  2BL0 C;  4U8D A;  1SSE B;  2MAZ A;  4A4C A;  1DJX A;  2AMI A;  1DTL A;  1BOD A;  3FIA A;  4ETO A;  2WCH A;  4JD9 A;  1YUU A;  1CDP A;  3TS5 B;  4GUK A;  3BYA A;  4M2P A;  2QEV A;  1PSR A;  1EJ3 A;  2CXJ A;  2L2E A;  1TRF A;  1CM1 A;  1B9A A;  2AUC A;  3R72 A;  1NX2 A;  3DVM A;  1F4O A;  1SBJ A;  1B1G A;  3VRP A;  2NCP A;  2F2P A;  1B4C A;  1SKT A;  1K9K A;  3B86 A;  1H8B A;  1SK6 D;  1A03 A;  2L5Y A;  3IVT A;  1S1E A;  1KFX S;  2EC6 C;  2JT8 A;  1RFJ A;  1KQM C;  2L2C A;  1XFW O;  1LXF C;  3FWB A;  3CWG A;  1AP4 A;  5DKQ A;  2BKH B;  1DT7 B;  3F45 A;  1XFV O;  2M7N A;  2LLU A;  3SJS A;  5I2Q A;  1ZMZ A;  2BE4 A;  2ZNE A;  1KFX L;  3A4U B;  1KSO A;  2KLD A;  2KI4 C;  4PE1 A;  3D77 A;  5FI6 A;  3Q8I A;  1B47 A;  1DJI A;  4F7F A;  4FTG A;  1BU3 A;  2M7L A;  1DVI A;  1L7Z A;  5I94 A;  3CLN A;  4JPZ B;  1PAL A;  2L98 A;  4YGE B;  1DGV A;  1SCV A;  2NZ0 A;  2Y1N A;  3B88 A;  1OOG A;  2BL0 B;  4YI8 A;  1QWV A;  3CDN A;  4I5J A;  1UHN A;  4I5K A;  2KLE A;  3PJI A;  1YUS A;  3DD4 A;  3DVK A;  2LUC A;  3OHM B;  2Y1M A;  1CM4 A;  2LLT A;  1R2U A;  1KFU S;  1LA0 A;  4P5O E;  1GGZ A;  3O2P A;  3D75 A;  1OOF A;  2PAS A;  3SG6 A;  5CSF A;  5HLO A;  1IQ5 A;  1DMO A;  4GNK B;  1YTZ C;  5FI2 A;  1IGV A;  1KFU L;  5KTY A;  4WQ2 A;  2O60 A;  2MLE C;  3PAL A;  1OZO A;  3OX5 A;  1QJT A;  2LMT A;  2KQY A;  4PDZ A;  1RK9 A;  1TTX A;  1TNX A;  1B8L A;  3O6B A;  2SCP A;  2KGB C;  1NPQ A;  1CDM A;  2M8U A;  3EVR A;  1DJW A;  1KQM B;  2JU0 A;  3EK8 A;  5TNC A;  2IS9 A;  2JQ6 A;  5HKZ A;  1ALV A;  2Y5I A;  5BPJ A;  2H2K A;  1NX1 A;  2ZN9 A;  1K8U A;  1JF2 A;  3PN7 C;  1WRZ A;  4AQI A;  4MBE A;  1BLQ A;  1V1F A;  3B7A A;  2KI4 B;  2BEC A;  1BMO A;  4KYN A;  4MZK A;  2F33 A;  1W7I B;  4AQJ A;  4PE4 A;  4BY4 A;  5FI7 A;  3R1P A;  3LL8 B;  1W7J B;  2K60 A;  1RRO A;  1SNL A;  2P6B B;  3GOF A;  1TNW A;  1MR8 A;  1K9P A;  1ALW A;  1UUR A;  1TWO A;  3MSE B;  1YX8 A;  1CMG A;  3L4A A;  4C0K A;  2KBI A;  3GK2 A;  2HQ8 A;  2GGZ A;  2FJY A;  5EL2 A;  2KYC A;  1MWN A;  3NGV A;  2WCJ A;  3D74 A;  1CLB A;  4DIR A;  1B8C A;  1YVH A;  1UHJ A;  2A4J A;  4QJ3 B;  4YGA A;  4AOM A;  1SL7 A;  1JBA A;  3DY9 A;  2L0P A;  2GGM A;  2JNF A;  4MRY A;  4BY5 A;  4YGD B;  2JTT A;  3SG4 A;  3CYZ A;  4PE7 A;  1JSA A;  2JT0 A;  2MHH A;  1M39 A;  2CBL A;  2I7A A;  4FQT A;  3AKB A;  5D69 A;  1PVA A;  2JUL A;  1JUO A;  1WDC C;  2CCM A;  3RM1 A;  4OV2 A;  1XFY O;  1NIW A;  3CR2 A;  3SIA A;  2QPT A;  4R1E A;  4YGB B;  2Y4Q A;  2WCB A;  2KOT A;  1C7V A;  1S6J A;  1UHH A;  4MVF A;  4DUQ A;  2KPH A;  1QAS A;  3C1V A;  2LUX A;  3CGA A;  1XFX O;  4M2O A;  4NDD A;  4ZCU A;  5J3X A;  2JC2 A;  5IBW A;  2K2A A;  3PN7 B;  1LIN A;  3WNX B;  1NCZ A;  4MEW A;  1A29 A;  3BXK A;  2PVB A;  5B8I B;  1QX2 A;  3EK7 A;  1NCY A;  3PLF B;  4USL A;  1FBV A;  2OTG C;  3DXL A;  1YRT B;  4IL1 A;  2K7C A;  2MA2 A;  2COL B;  2JPO A;  1TCO B;  1OMV A;  1F71 A;  4N1F A;  1KWO C;  3OP0 A;  2LVV A;  3AAK A;  3HX4 A;  1NWD A;  4MRX A;  1B7T Y;  4HRG A;  1MQ1 A;  3FE9 A;  1AK8 A;  1PVB A;  3D10 A;  2I2R E;  3EVV A;  4ORC B;  1XFR A;  4DS7 A;  1CDN A;  1PSB A;  1OMR A;  3NSL A;  3A8R A;  1S5G Z;  2LHI A;  3NSI A;  5D3O A;  1EH2 A;  1BR4 B;  4IJ7 A;  1BG1 A;  4GPL B;  4MZL A;  3CTN A;  3FE8 A;  5JOL A;  1JWD A;  3M0W A;  2LE9 B;  4OR9 B;  1ZFS A;  3FWC A;  3ZWH A;  2YGU A;  5HLV A;  1JFJ A;  1Q80 A;  1B8R A;  4QJ4 B;  3BUO B;  1FI5 A;  3I5F B;  2BCX A;  2PRU A;  1WDC B;  3S0F A;  2PSR A;  1FI6 A;  1KQV A;  3KF9 A;  4GAO A;  1MHO A;  3WXA A;  4CPV A;  2ZFD A;  2KSP A;  2LCP A;  2NCO A;  3TDU A;  4CFQ A;  1XA5 A;  1K9U A;  2M49 B;  1QX5 B;  3OX6 A;  2WOS A;  1YUR A;  3S0E A;  1VRK A;  3D0Y B;  1TN4 A;  4NQG A;  2KFH A;  1QLK A;  3PM2 A;  4OCI A;  1X02 A;  2JXL A;  2I18 A;  2K0J A;  2M97 A;  1AHR A;  3ZNI A;  1RWY A;  2KFG A;  2ZRT A;  3DF0 B;  3KEV A;  1GQM A;  1ZAC A;  2M29 A;  2OTG B;  2ZN8 A;  1GM0 A;  3EVU A;  1D1O A;  1QIW A;  1C7W A;  1WLM A;  2WCK A;  3BJH A;  2B1U A;  1KWO B;  4GGF C;  4GGN A;  3V2L A;  4DRW A;  1CFP A;  3GK4 X;  1CKK A;  2PYQ A;  3L47 A;  3BUM B;  1IG5 A;  2LP3 A;  1ZOT B;  3CR4 X;  4GBA A;  3D76 A;  2KAY A;  2LMU A;  3CZ0 A;  2KBM A;  1CFC A;  3I5G C;  3DVE A;  2MBX A;  3NXA A;  3DF0 A;  2QEH A;  1IJ6 A;  4ICB A;  1AJ4 A;  3K21 A;  2KQ6 A;  4MZJ A;  4D1E A;  4WQ3 A;  1NCX A;  4INX A;  2EGD A;  3BUW B;  2OS8 C;  2WCF A;  4JKT A;  4PCW A;  1CFF A;  2LHL A;  5CSJ A;  1BJF A;  3TDI A;  1S26 D;  3S0G A;  2M1K B;  2E30 A;  2JRF A;  3BFB A;  3CZ2 A;  4DCK A;  1CLL A;  1OQP A;  3EG5 B;  3OGN A;  1QV0 A;  1E8A A;  1DJY A;  1SW8 A;  1CLM A;  1DJG A;  1KSM A;  5HKY A;  5D7F A;  2SAS A;  3FE6 A;  1F8H A;  1YRU B;  1MXE A;  1QTX A;  1XFU O;  1Z2C B;  2BNX A;  2O5G A;  5HYD A;  2FCE A;  2K8M B;  5K89 A;  5GQQ C;  4F0Z B;  2K2F A;  3SG7 A;  1NUB A;  1T14 A;  2F3Y A;  3FS7 A;  4WRI A;  1P28 A;  1QVI Z;  1CB1 A;  1TOP A;  1YR5 A;  3N7H A;  1UHI A;  2LM5 A;  2BBN A;  3I5H C;  4ZCV A;  1MF8 B;  2BCA A;  2WC5 A;  3DYE A;  1S6C A;  1XO5 A;  2Q91 A;  2LC5 A; 
#chains in the Genus database with same CATH homology
 2GTE A;  3L4L A;  3DXL A;  1ORG A;  3CAB A;  4PT1 A;  2JPO A;  2QEO A;  3S0D A;  1OOI X;  5DIC A;  3D73 A;  3FE9 A;  1XFR A;  2PQL A;  3D77 A;  3Q8I A;  2P70 A;  4F7F A;  2WCM A;  1C3Y A;  3FE8 A;  3B88 A;  1OOG A;  1QWV A;  3CDN A;  1OW4 A;  3PJI A;  3CZ1 A;  3BFA A;  3NHT A;  3S0F A;  3D75 A;  1OOF A;  3S0B A;  2WCL A;  3S0E A;  3VB1 A;  3QME A;  3K1E A;  4OZD A;  1C3Z A;  2WC6 A;  1TUJ A;  3NHI A;  1GM0 A;  3RZS A;  3BJH A;  2WCK A;  3V2L A;  3S0A A;  2QEB A;  3L47 A;  3B7A A;  3D76 A;  3CZ0 A;  3R1P A;  3R1V A;  2QEH A;  1TWO A;  3L4A A;  3DZT A;  3BFH A;  4INX A;  2FJY A;  5EL2 A;  1DQE A;  3NGV A;  2WCJ A;  3D74 A;  1OOH A;  2QDI A;  3DY9 A;  3D78 A;  3S0G A;  3B6X A;  3R1O A;  2WCH A;  3CYZ A;  4JD9 A;  3BFB A;  3CZ2 A;  4FQT A;  3OGN A;  2QEV A;  2H8V A;  2ERB A;  3FE6 A;  4INW A;  3R72 A;  2KPH A;  1T14 A;  1P28 A;  3B86 A;  3N7H A;  3B87 A;  2P71 A;  2WC5 A;  3DYE A;  1LS8 A;  2L2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...