1QV0A

Atomic resolution structure of obelin from obelia longissima
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
189
structure length
185
Chain Sequence
VKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNAGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Atomic resolution structure of obelin: soaking with calcium enhances electron density of the second oxygen atom substituted at the C2-position of coelenterazine.
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 77
structure length 185
sequence length 189
ec nomenclature ec 1.13.12.5: Renilla-type luciferase.
pdb deposition date 2003-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qv0A00
3DVMA 3WHUB 1CDLA 2K7DA 3AAKA 1OSAA 3EKHA 4MLWA 1Y1UA 4YGCB 2MBXA 4A4BA 3TUYC 1SL8A 1AP4A 1MHOA 1CFPA 2Y5IA 1W7IB 1E8AA 2LMVA 1K9KA 1F71A 2PVBA 2LNKA 2KFFA 3DVEA 1FW4A 1KK7Y 4Q04A 5ER4X 3TDZA 2OS8C 3TS5C 1DGUA 1CLLA 1NPQA 1PSRA 2M49B 1JF0A 4ORCB 4AQJA 2Y1MA 2FCDA 1NCYA 4MZKA 3JTDB 4USLA 3PLFB 1CFFA 5AXIA 2L50A 1A75B 5ER5A 1GQMA 4L9MA 2WORA 2B1UA 3TUYB 2Y4QA 5CSIA 2GGZA 3SG4A 2K8MB 3EKJA 4OCIA 5KTYA 1SL9A 3JVTC 1D1OA 3KF9A 2F8PA 5GQQC 2JNFA 3TS5B 2HPSA 2PRUA 4ETOA 1J7PA 2PALA 1SY9A 2Y1NA 1KSMA 3CR2A 1R6PA 1UWOA 2H61C 4WQ2A 2KDHA 1YVLA 3GK2A 2BL0C 3C1VA 1LXFC 4OKHA 4DUQA 1CM1A 2HQ8A 4C0KA 3O2PA 4NDCA 1SYMA 3BUOB 3PFVA 2BCBA 4OV2A 2JTTA 2L2EA 1NIWA 1UHIA 1VRKA 1YX7A 1M45A 1BU3A 3DF0A 2LVKA 1WDCC 1L2OC 1QLKA 1FF1A 4N1GA 4PE7A 3SG2A 2CBLA 4E68A 4CIDA 1RK9A 4GPLB 1XVJA 2BL0B 1UHKA 1S6IA 5AERA 2DOQA 2M7NA 1F8HA 1B1GA 1A4PA 3D0YA 3LL8B 3ZNIA 2SCPA 3BXKA 4OVNF 1RWYA 4YI9A 1CB1A 4C0JA 3MSEB 2K2FA 1YX8A 2JNXA 1JF2A 1WDCB 3QRXA 1L7ZA 2NLNA 4PALA 1JWDA 3RM1A 3BQ3A 1MWNA 1NYAA 2JPTA 3PATA 2LE9B 2M29A 1IRJA 1J55A 1IQ3A 2BECA 3EVUA 3TDUA 3OP0A 4M2OA 4AQIA 5I2OA 1XFZO 1TTXA 1IJ6A 3DVKA 1UHHA 1LA0A 3TZ1A 2MJWB 5AEQA 1M63B 1QX2A 2QPTA 1H4BA 1PALA 4GGFA 1DGVA 1OMVA 4P2YB 2CT9A 1TRFA 4UPGA 2LANA 1UUSA 2JTZA 1QJTA 3NSIA 1CDPA 4MEWA 2K2AA 4BY4A 1F70A 4MSPA 1K8UA 1K95A 3LK0A 2LVIA 3I5FB 2KYFA 2F2PA 1KFXS 3I5IC 3BOWA 5I8NA 2KSPA 2M9GA 4GAOA 5DKNA 1QXPA 1KFUS 1KCYA 1ZACA 2LUXA 2KI6C 1MXLC 2M0RA 2LC5A 3PM8A 1WLZA 4XYNA 3LK1A 2WOSA 4ORAB 2LP2A 1R2UA 1JSAA 2H2KA 1J1DA 2HETA 4MN0A 1JFKA 1FPWA 1CTRA 1SR6B 2GV5A 4QJ4B 3I5IB 1S6JA 1EH2A 1B47A 1M46A 3SG7A 1SPYA 1IJ5A 2ZNDA 4M2QA 1G4YR 3EK8A 1YRUB 2EC6B 1DJXA 1RECA 2WC8A 2EGDA 2JU0A 3BOWB 1NUBA 2OPOA 3CLNA 4JQ0D 3JTDC 1B7TZ 1KQMB 5D69A 1BOCA 1NCXA 1F54A 2KBMA 1DF0A 1K96A 1AK8A 4MZLA 1FBVA 4GGNA 1DT7B 3SG3A 1FI6A 1DJZA 1IWQA 1LKJA 4WQ3A 1K9UA 1XO5A 3VGOA 1QLSA 2I18A 5KU1A 2PMYA 1XFWO 2HQWA 4IL1A 1EG4A 1LA3A 1N65A 1S5GZ 2NXQA 2JZIA 2CTNA 1UHJA 1J7RA 3CZTX 2L98A 3TDIA 1OE9B 4MBEA 5FYXA 1CFDA 1CMGA 2KOTA 1U5IA 2LAPA 2MHHA 1YTZC 1BODA 1BF5A 1OZSA 2LMTA 1K9PA 4C0LA 1RROA 2LP3A 2D8NA 2M3WA 5CPVA 1RTP1 1BG1A 1CNPA 2TN4A 1IG5A 2M1KB 4CLNA 1B8LA 1J1EA 1EJ3A 3O4YA 4CFQA 1A03A 1EL4A 2AAOA 1JBAA 1PVAA 2LLSA 1QTXA 2ZNEA 1AVSA 3FWCA 3K21A 1UURA 1KQVA 2JWWA 1DMOA 1KK8B 1KK7Z 2JOJA 1TNWA 2CNPA 2EHBA 1U5IB 4P5OE 2FJUB 1V1GA 1MF8B 1YUSA 1DJHA 1S6CA 1WRKA 1LINA 1B8CA 1BR4B 2BE4A 3WHTB 1QX7A 3PALA 1XFUO 2BBMA 4HSZA 1NX0A 5IBWA 1BT6A 3VROA 1SCMC 3CGAA 2R2IA 3SIBA 5JJGA 3VRPA 1TNXA 1AJ5A 4WRIA 1CMFA 2LM5A 2MLFC 2LCPA 1GJYA 1ZUZA 1NSHA 2KGRA 1YR5A 2VRGA 1K2HA 3I5GB 2K7OA 5HLOA 4I5NB 2K0JA 1S26D 3I5FC 3DF0B 3FS7A 2BBNA 1OMDA 2F3ZA 2ISDA 3WXAA 1DVIA 1CLBA 1SCMB 1XK4A 1F4QA 3WNXB 1PULA 1DJIA 3AKBA 3NXAA 1XA5A 1B8RA 4FTGA 1S3PA 2BCAA 1CFCA 4ZCVA 4D1EA 1Y1AA 3D0YB 3AKAA 2G2BA 3A8RA 1WY9A 1XYDA 5HLVA 4ORBB 2WCFA 4GGFC 1SR6C 2L4HA 2OTGB 3PSRA 1BLQA 1GGWA 2K61A 2FOTA 1X02A 1DJYA 1KFXL 1B4CA 4GFTA 3PN7B 4I5JA 4QJ3B 1KFUL 3SG5A 5BPJA 1QIVA 2L5XB 4GBAA 2BE6A 2RGIA 2EC6C 1DJWA 1IH0A 1IQ5A 1XFVO 4DIRA 2ZRTA 2ZN8A 1HQVA 3EVRA 3M0WA 2KQYA 4AOMA 3F45A 1KQMC 2IS9A 2LMUA 2ZFDA 2KAVA 2KFGA 5HYDA 1EXRA 2AMIA 2QACA 5K89A 1K94A 3OB1B 4PHKA 3EVVA 3NSLA 3ZWHA 2AUCA 5PALA 1DTLA 1NCZA 1IKUA 1ALWA 1A2XA 1SMGA 1GGZA 1SKTA 2I94A 1K90D 2JQ6A 2ZN9A 1RFJA 1M31A 4CFRA 5AFPA 2F2OA 1MQ1A 5AANA 3I5HC 3VRQA 3DVJA 1KWOB 4I5KA 1MUXA 1A29A 1ZFSA 1WRZA 2O5GA 1ALVA 1TNQA 2LLTA 2V53A 2L51A 4PHJA 4PCWA 4CPVA 1SBJA 2NCPA 4NDBA 1QS7A 1TCOB 4ZCUA 3CWGA 1JUOA 2MAZA 2KI4C 4PE4A 3E3RA 1F4OA 5G08A 5J3XA 3FWBA 4ICBA 3I5HB 2KFHA 3CR5X 4PHNA 4YGEB 2JXLA 1QASA 2L4IA 3BYAA 3VRNA 1OQPA 1S36A 2WCBA 2KQ6A 1PVBA 2CCMA 1N0YA 2PASA 1SK6D 2A4JA 1BJFA 1XFYO 4A4CA 2NZ0A 2L0PA 3IQOA 1NP8A 1KK8C 1PK0D 2HF5A 2KI4B 1SCVA 1TIZA 1DF0B 1Y6WA 5DKQA 2LHIA 1G8IA 1AUIB 1OMRA 1YURA 4TNCA 5B8IB 3O6BA 1YUUA 1G33A 3OB2B 2Q4UA 4HREE 4JPZB 1NX3A 4BY5A 1TN4A 1KSOA 4N1FA 3HCMA 2H61A 2M97A 3SIAA 2SASA 2JRFA 3AAJA 1B9AA 1Q80A 3ICBA 4QJ5B 1QVIY 3GK4X 4PE1A 2E30A 1N2DA 2OS8B 3I5GC 2LHLA 1MXEA 2F3YA 2KYCA 1TCFA 1ZOTB 4MRYA 4U8DA 1OZOA 4HRHA 1AJ4A 1K93D 1RJVA 4F0ZB 2F33A 4M2PA 4GNKB 2PSRA 4MZJA 3FIAA 1SRAA 1WLMA 4MVFA 2MRDA 3OX6A 1Y1XA 1YVHA 4PDZA 5F6TA 2ZKMX 5CSNA 3KHEA 1BR1B 3H4SE 3JVTB 1CDNA 4GUKA 1QX5B 2GGMA 4YI8A 1H8BA 1WRLA 1M39A 3D10A 3KO0A 4NQGA 2K7CA 2MLEC 4YGDB 1LVCD 2OTGC 2G9BA 4PE0A 4YGAA 1ZMZA 4XJKA 3IQQA 4DS7A 3BUWB 3PN7C 3BUNB 2LUCA 2KAYA 2WCEA 1DJGA 3CTNA 3CS1A 1EG3A 1Y0VH 4MRXA 4YGBB 1CKKA 3O78A 3BUMB 2KNEA 1QVIZ 1L2OB 5DKRA 1XK4C 5HKZA 4DCKA 2M1UA 3IF7A 1SNLA 1BMOA 2JT8A 5CSFA 4YBHB 1HT9A 1SW8A 1IGVA 1FI5A 1V1FA 1W7JB 1CLMA 2NCOA 2JT0A 1J7QA 1QV1A 1F55A 2E6WA 2M8UA 4HRGA 1UHNA 5HKWA 3GK1A 4JWQA 3KPXA 1KWOC 5I2QA 2KHNA 1S1EA 4XJKB 3RLZA 3DD4A 2JT3A 3GOFA 2I2RE 3SJSA 5CSJA 3A4UB 1B7TY 2JXCA 2LLUA 3LCPC 4I5LB 5I2LA 1SL7A 2JC2A 3OHMB 5D7FA 3SG6A 5TNCA 2LV7A 4N5XA 2CXJA 5HKYA 2FCEA 3KEVA 1CM4A 1NWDA 1NX1A 5JOLA 2M7LA 1AHRA 2KGBC 2COLB 2I7AA 3OX5A 3CR4X 1YUTA 2JULA 2LVVA 3NSOA 4DRWA 2LVJA 4FQOA 1C7WA 1NX2A 1S5GY 4NDDA 1C07A 3HX4A 1TOPA 3EK7A 2BKHB 1QIWA 4OR9B 2WNDA 4R1EA 2KI6D 4PHMA 1ODBA 1OOJA 3NSKA 2K7BA 3VRRA 1QV0A 3BUXB 4YRUA 3LLEA 2KAXA 1MR8A 1TNPA 1C7VA 1PRWA 1PSBA 1YRTB 3EK4A 2BCXA 1A75A 2P6BB 2BKIB 1J7OA 1JFJA 1UP5A 2O60A 1XFXO 2Q91A 2KBIA 2ZRSA 1QATA 1JC2A 5KSZA 1CDMA 2MA2A
chains in the Genus database with same CATH superfamily
3DVMA 3WHUB 1CDLA 1DC1A 2K7DA 3AAKA 1OSAA 3EKHA 4MLWA 1Y1UA 4YGCB 2MBXA 4A4BA 3TUYC 1SL8A 1AP4A 1MHOA 1CFPA 2Y5IA 1W7IB 1E8AA 2LMVA 1K9KA 3D73A 2PVBA 2LNKA 2KFFA 3DVEA 1F71A 1FW4A 1KK7Y 4Q04A 5ER4X 3TDZA 2OS8C 3TS5C 1DGUA 3PM2A 1CLLA 1NPQA 1PSRA 2M49B 2PQLA 3O4XA 1JF0A 4ORCB 4AQJA 2Y1MA 2FCDA 1NCYA 4MZKA 3JTDB 4USLA 2WCKA 3PLFB 1CFFA 5AXIA 2L50A 1A75B 5ER5A 1GQMA 4L9MA 2WORA 2B1UA 3TUYB 2Y4QA 5CSIA 2GGZA 3SG4A 2K8MB 3EKJA 4OCIA 5KTYA 1SL9A 1T14A 3JVTC 1D1OA 3KF9A 2F8PA 5GQQC 2JNFA 3TS5B 2HPSA 2PRUA 4ETOA 1J7PA 2PALA 3S0BA 1SY9A 2Y1NA 3L47A 1KSMA 3B86A 3CR2A 1R6PA 1UWOA 2H61C 4WQ2A 2KDHA 1YVLA 3GK2A 2BL0C 3C1VA 1LXFC 4OKHA 4DUQA 1CM1A 2HQ8A 3DY9A 1ORGA 4C0KA 2P70A 3O2PA 4NDCA 1SYMA 3BUOB 5EL2A 3PFVA 2BCBA 4OV2A 2JTTA 2L2EA 1NIWA 1UHIA 1VRKA 1YX7A 1M45A 2QEOA 3D74A 2JPOA 1BU3A 3S0DA 3DF0A 2LVKA 1WDCC 1L2OC 1QLKA 1FF1A 4N1GA 4PE7A 3SG2A 2CBLA 4E68A 4CIDA 3NHTA 1OOIX 1RK9A 4GPLB 1XVJA 1XFRA 2BL0B 1UHKA 1S6IA 1P28A 5AERA 2DOQA 2M7NA 1F8HA 1B1GA 1TUZA 1A4PA 3D0YA 4FQTA 3LL8B 3ZNIA 2SCPA 3BXKA 1OOGA 4OVNF 1RWYA 4YI9A 3S0FA 1CB1A 4C0JA 3MSEB 2K2FA 3R72A 1YX8A 2JNXA 1JF2A 5FI6A 1WDCB 3QRXA 1L7ZA 2NLNA 4PALA 1JWDA 2L5YA 3RM1A 3BQ3A 1MWNA 1NYAA 2JPTA 3PATA 4OZDA 2LE9B 2M29A 1IRJA 1J55A 1IQ3A 2BECA 3EVUA 1OOHA 3OP0A 4M2OA 1DELA 3D77A 3TDUA 4AQIA 1XFZO 1TTXA 5I2OA 1IJ6A 3DVKA 1UHHA 1LA0A 3TZ1A 2MJWB 5AEQA 1M63B 1QX2A 2QPTA 1H4BA 1PALA 4GGFA 1DGVA 1OMVA 4P2YB 3S0EA 2CT9A 1TRFA 4UPGA 2LANA 1UUSA 2JTZA 1QJTA 3NSIA 3EG5B 1CDPA 4MEWA 2K2AA 4BY4A 1F70A 4MSPA 1K8UA 1K95A 2QEVA 3D76A 3LK0A 2LVIA 3I5FB 2KYFA 2F2PA 1KFXS 2QDIA 3B87A 3BOWA 3I5IC 3V2LA 2KSPA 2M9GA 4GAOA 5DKNA 1QXPA 1KFUS 5I8NA 1KCYA 3OBVA 1ZACA 2LUXA 3SS5A 2KI6C 1W9ZA 1MXLC 2M0RA 4F7FA 2LC5A 3PM8A 4INWA 1TWOA 1WLZA 3CABA 4XYNA 3LK1A 1SSEB 4PT1A 2YGUA 2WOSA 4ORAB 2LP2A 1R2UA 2QEBA 1JSAA 2H2KA 1J1DA 2HETA 4MN0A 1JFKA 1FPWA 1CTRA 1SR6B 2GV5A 4QJ4B 3CDNA 3I5IB 1S6JA 3FE8A 1LS8A 1EH2A 1B47A 1M46A 1OOFA 3SG7A 1SPYA 1IJ5A 2ZNDA 4M2QA 1G4YR 3CZ0A 3EK8A 3BFBA 2WCHA 1YRUB 2EC6B 1DJXA 1RECA 2WC8A 2EGDA 2JU0A 3BOWB 1NUBA 2OPOA 3CLNA 4JQ0D 3JTDC 1B7TZ 1KQMB 5D69A 1BOCA 1NCXA 1F54A 2KBMA 1DF0A 1K96A 1AK8A 3B6XA 4MZLA 1FBVA 4GGNA 1DT7B 3SG3A 4KYNA 1FI6A 1DJZA 1IWQA 1LKJA 4WQ3A 1K9UA 1XO5A 3VGOA 1QLSA 2I18A 5KU1A 2PMYA 1XFWO 2HQWA 4IL1A 1EG4A 1LA3A 1N65A 1S5GZ 2KLEA 2JZIA 2CTNA 2NXQA 3K1EA 1UHJA 1J7RA 3CZTX 2L98A 4JKTA 1OE9B 4MBEA 3TDIA 5FYXA 1CFDA 1CMGA 2KOTA 3R1PA 2GTEA 1U5IA 2LAPA 3SS4A 2MHHA 1YTZC 1BODA 1BF5A 1OZSA 2LMTA 3RZSA 1K9PA 4C0LA 1RROA 2LP3A 2D8NA 2M3WA 5CPVA 1RTP1 1BG1A 1CNPA 2TN4A 1IG5A 2M1KB 4CLNA 1B8LA 1J1EA 1EJ3A 3O4YA 4CFQA 1A03A 1EL4A 2AAOA 3FE6A 1JBAA 1C3YA 1PVAA 2L2CA 2LLSA 1QTXA 2ZNEA 3DYEA 1AVSA 2WCMA 3FWCA 3K21A 1UURA 1KQVA 2JWWA 1DMOA 1KK8B 1KK7Z 2JOJA 1TNWA 2CNPA 2EHBA 1U5IB 3B7AA 4P5OE 2FJUB 1V1GA 1MF8B 1YUSA 1DJHA 1S6CA 1WRKA 1LINA 1B8CA 1BR4B 2K60A 2BE4A 3WHTB 1QX7A 3PALA 4INXA 1XFUO 2BBMA 5I94A 4HSZA 1NX0A 5IBWA 1BT6A 3VROA 1SCMC 2QEHA 3CGAA 2R2IA 3SIBA 5JJGA 3VRPA 1TNXA 1AJ5A 4WRIA 1CMFA 2LM5A 2MLFC 3QMEA 2LCPA 1GJYA 1ZUZA 3SS3A 1NSHA 2KGRA 1YR5A 2VRGA 3NGVA 3I5GB 1K2HA 2K7OA 5HLOA 4I5NB 2K0JA 1S26D 2WC6A 3I5FC 3DF0B 3FS7A 2BBNA 3R1OA 1OMDA 2F3ZA 3DZTA 2ISDA 3WXAA 1DVIA 1CLBA 1SCMB 1XK4A 1F4QA 3WNXB 1PULA 1DJIA 3AKBA 3NXAA 1XA5A 1B8RA 4FTGA 1S3PA 2BCAA 2KLDA 1CFCA 4ZCVA 4JD9A 4D1EA 1Y1AA 3D0YB 3AKAA 2G2BA 3A8RA 1WY9A 1IIOA 1XYDA 5HLVA 4ORBB 3L4LA 1GM0A 2WCFA 4GGFC 1SR6C 2L4HA 2OTGB 3PSRA 1BLQA 1GGWA 2K61A 2FOTA 1X02A 1DJYA 1KFXL 1B4CA 4GFTA 3PN7B 4I5JA 4QJ3B 1KFUL 3SG5A 5BPJA 1QIVA 2L5XB 4GBAA 2BE6A 2RGIA 2EC6C 1DJWA 1IH0A 1IQ5A 1XFVO 4DIRA 2ZRTA 2ZN8A 1HQVA 3EVRA 3M0WA 2KQYA 4AOMA 3F45A 1KQMC 2IS9A 2LMUA 2ZFDA 2KAVA 2ERBA 2KFGA 5HYDA 1EXRA 2AMIA 2QACA 3NHIA 1K94A 5K89A 3OB1B 2P71A 4PHKA 3EVVA 3NSLA 3ZWHA 2AUCA 5PALA 1DTLA 1NCZA 1IKUA 1ALWA 1A2XA 1SMGA 1GGZA 1SKTA 2I94A 1K90D 2JQ6A 2ZN9A 1RFJA 1M31A 4CFRA 5AFPA 2F2OA 1MQ1A 5AANA 3I5HC 3VRQA 1OW4A 3DVJA 1KWOB 4I5KA 1MUXA 2KPHA 1A29A 1ZFSA 1WRZA 2O5GA 1ALVA 1TNQA 2LLTA 2V53A 2L51A 3BFAA 1DEKA 4PCWA 4PHJA 1SBJA 4CPVA 2NCPA 4NDBA 1QS7A 2WCJA 1TCOB 4ZCUA 3CWGA 1JUOA 2MAZA 2KI4C 4PE4A 3E3RA 1F4OA 5G08A 5J3XA 3FWBA 3FE9A 4ICBA 3CZ2A 2KFHA 3I5HB 3CR5X 4PHNA 4YGEB 2JXLA 1QASA 2L4IA 3BYAA 3VRNA 1OQPA 1S36A 2WCBA 3BFHA 2KQ6A 1PVBA 2CCMA 1N0YA 2PASA 1SK6D 2A4JA 1BJFA 1XFYO 3OGNA 2NZ0A 4A4CA 2L0PA 3IQOA 1NP8A 1KK8C 1PK0D 2HF5A 2KI4B 1SCVA 1TIZA 1DF0B 1QWVA 1Y6WA 5DKQA 2LHIA 1G8IA 1AUIB 1OMRA 1YURA 4TNCA 5B8IB 3O6BA 1YUUA 3DXLA 5FI7A 1G33A 3OB2B 2Q4UA 4HREE 1C3ZA 4JPZB 1NX3A 4BY5A 1TN4A 1KSOA 2WCLA 4N1FA 3HCMA 3CZ1A 2H61A 2M97A 3SIAA 2SASA 2JRFA 4IJ7A 3AAJA 1B9AA 1Q80A 3ICBA 4QJ5B 1QVIY 3GK4X 4PE1A 2E30A 1N2DA 2OS8B 3I5GC 2LHLA 1MXEA 2F3YA 2H8VA 2KYCA 1TCFA 1ZOTB 4MRYA 4U8DA 1OZOA 4HRHA 1AJ4A 1K93D 1RJVA 3S0GA 4F0ZB 2F33A 4M2PA 4GNKB 2PSRA 4MZJA 3VB1A 3FIAA 1SRAA 1WLMA 4MVFA 2MRDA 3OX6A 1Y1XA 1YVHA 4PDZA 5F6TA 2ZKMX 5CSNA 3KHEA 1BR1B 3H4SE 3JVTB 1CDNA 4GUKA 1QX5B 2GGMA 4YI8A 1H8BA 1WRLA 1M39A 3D10A 3KO0A 4NQGA 2K7CA 2MLEC 4YGDB 1LVCD 2OTGC 3IVTA 2G9BA 4PE0A 4YGAA 1ZMZA 4XJKA 3UO9A 3IQQA 4DS7A 3BUWB 3PN7C 3R1VA 2FJYA 2LUCA 2KAYA 2WCEA 3BUNB 1DJGA 3D75A 3L4AA 3CTNA 3CS1A 1EG3A 1Y0VH 4MRXA 4YGBB 3S0AA 5DICA 1CKKA 3O78A 1DQEA 3BUMB 2KNEA 1QVIZ 1L2OB 3Q8IA 5DKRA 1XK4C 5HKZA 4DCKA 2M1UA 3IF7A 1SNLA 1BMOA 2JT8A 5CSFA 4YBHB 1HT9A 1SW8A 1IGVA 1FI5A 1V1FA 1W7JB 1CLMA 2NCOA 2JT0A 1J7QA 1QV1A 1F55A 2E6WA 2M8UA 4HRGA 1UHNA 2WC5A 5HKWA 3UNWA 3GK1A 4JWQA 3KPXA 1KWOC 5I2QA 2KHNA 1S1EA 1Z4HA 4XJKB 3RLZA 3DD4A 2JT3A 3GOFA 2I2RE 3SJSA 5CSJA 3A4UB 1B7TY 2JXCA 2LLUA 3LCPC 1TUJA 4I5LB 3BJHA 5I2LA 1SL7A 2JC2A 3OHMB 5D7FA 3SG6A 5TNCA 2LV7A 4N5XA 2CXJA 5HKYA 2FCEA 3KEVA 1CM4A 1NWDA 1NX1A 5JOLA 2M7LA 1AHRA 2KGBC 2COLB 2I7AA 3OX5A 3CR4X 1YUTA 2JULA 2LVVA 3NSOA 4DRWA 2LVJA 3CYZA 4FQOA 1C7WA 1NX2A 1S5GY 4NDDA 1C07A 3HX4A 1TOPA 3EK7A 2BKHB 1QIWA 4OR9B 2WNDA 4R1EA 2KI6D 4PHMA 1ODBA 1OOJA 3NSKA 2K7BA 3VRRA 2BNXA 1QV0A 3D78A 3BUXB 2BAPA 5D3OA 4YRUA 3LLEA 5HL1A 1Z2CB 1MR8A 2KAXA 2PYQA 3PJIA 1TNPA 1C7VA 1PRWA 1PSBA 1YRTB 3B88A 3EK4A 2BCXA 1A75A 3N7HA 2P6BB 2BKIB 5FI2A 1J7OA 1JFJA 1UP5A 2O60A 1XFXO 2Q91A 2KBIA 2ZRSA 1QATA 1JC2A 5KSZA 1CDMA 2MA2A
chains in the Genus database with same CATH topology
3DVMA 3WHUB 1CDLA 2K7DA 3AAKA 1OSAA 3EKHA 4MLWA 1Y1UA 4YGCB 2MBXA 4A4BA 3TUYC 1SL8A 1AP4A 1MHOA 1CFPA 2Y5IA 1W7IB 1E8AA 2LMVA 1K9KA 1F71A 2PVBA 2LNKA 2KFFA 3DVEA 1FW4A 1KK7Y 4Q04A 5ER4X 3TDZA 2OS8C 3TS5C 1DGUA 1CLLA 1NPQA 1PSRA 2M49B 1JF0A 4ORCB 4AQJA 2Y1MA 2FCDA 1NCYA 4MZKA 3JTDB 4USLA 3PLFB 1CFFA 5AXIA 2L50A 1A75B 5ER5A 1GQMA 4L9MA 2WORA 2B1UA 3TUYB 2Y4QA 5CSIA 2GGZA 3SG4A 2K8MB 3EKJA 4OCIA 5KTYA 1SL9A 3JVTC 1D1OA 3KF9A 2F8PA 5GQQC 2JNFA 3TS5B 2HPSA 2PRUA 4ETOA 1J7PA 2PALA 1SY9A 2Y1NA 1KSMA 3CR2A 1R6PA 1UWOA 2H61C 4WQ2A 2KDHA 1YVLA 3GK2A 2BL0C 3C1VA 1LXFC 4OKHA 4DUQA 1CM1A 2HQ8A 4C0KA 3O2PA 4NDCA 1SYMA 3BUOB 3PFVA 2BCBA 4OV2A 2JTTA 2L2EA 1NIWA 1UHIA 1VRKA 1YX7A 1M45A 1BU3A 3DF0A 2LVKA 1WDCC 1L2OC 1QLKA 1FF1A 4N1GA 4PE7A 3SG2A 2CBLA 4E68A 4CIDA 1RK9A 4GPLB 1XVJA 2BL0B 1UHKA 1S6IA 5AERA 2DOQA 2M7NA 1F8HA 1B1GA 1A4PA 3D0YA 3LL8B 3ZNIA 2SCPA 3BXKA 4OVNF 1RWYA 4YI9A 1CB1A 4C0JA 3MSEB 2K2FA 1YX8A 2JNXA 1JF2A 1WDCB 3QRXA 1L7ZA 2NLNA 4PALA 1JWDA 3RM1A 3BQ3A 1MWNA 1NYAA 2JPTA 3PATA 2LE9B 2M29A 1IRJA 1J55A 1IQ3A 2BECA 3EVUA 3TDUA 3OP0A 4M2OA 4AQIA 5I2OA 1XFZO 1TTXA 1IJ6A 3DVKA 1UHHA 1LA0A 3TZ1A 2MJWB 5AEQA 1M63B 1QX2A 2QPTA 1H4BA 1PALA 4GGFA 1DGVA 1OMVA 4P2YB 2CT9A 1TRFA 4UPGA 2LANA 1UUSA 2JTZA 1QJTA 3NSIA 1CDPA 4MEWA 2K2AA 4BY4A 1F70A 4MSPA 1K8UA 1K95A 3LK0A 2LVIA 3I5FB 2KYFA 2F2PA 1KFXS 3I5IC 3BOWA 5I8NA 2KSPA 2M9GA 4GAOA 5DKNA 1QXPA 1KFUS 1KCYA 1ZACA 2LUXA 2KI6C 1MXLC 2M0RA 2LC5A 3PM8A 1WLZA 4XYNA 3LK1A 2WOSA 4ORAB 2LP2A 1R2UA 1JSAA 2H2KA 1J1DA 2HETA 4MN0A 1JFKA 1FPWA 1CTRA 1SR6B 2GV5A 4QJ4B 3I5IB 1S6JA 1EH2A 1B47A 1M46A 3SG7A 1SPYA 1IJ5A 2ZNDA 4M2QA 1G4YR 3EK8A 1YRUB 2EC6B 1DJXA 1RECA 2WC8A 2EGDA 2JU0A 3BOWB 1NUBA 2OPOA 3CLNA 4JQ0D 3JTDC 1B7TZ 1KQMB 5D69A 1BOCA 1NCXA 1F54A 2KBMA 1DF0A 1K96A 1AK8A 4MZLA 1FBVA 4GGNA 1DT7B 3SG3A 1FI6A 1DJZA 1IWQA 1LKJA 4WQ3A 1K9UA 1XO5A 3VGOA 1QLSA 2I18A 5KU1A 2PMYA 1XFWO 2HQWA 4IL1A 1EG4A 1LA3A 1N65A 1S5GZ 2NXQA 2JZIA 2CTNA 1UHJA 1J7RA 3CZTX 2L98A 3TDIA 1OE9B 4MBEA 5FYXA 1CFDA 1CMGA 2KOTA 1U5IA 2LAPA 2MHHA 1YTZC 1BODA 1BF5A 1OZSA 2LMTA 1K9PA 4C0LA 1RROA 2LP3A 2D8NA 2M3WA 5CPVA 1RTP1 1BG1A 1CNPA 2TN4A 1IG5A 2M1KB 4CLNA 1B8LA 1J1EA 1EJ3A 3O4YA 4CFQA 1A03A 1EL4A 2AAOA 1JBAA 1PVAA 2LLSA 1QTXA 2ZNEA 1AVSA 3FWCA 3K21A 1UURA 1KQVA 2JWWA 1DMOA 1KK8B 1KK7Z 2JOJA 1TNWA 2CNPA 2EHBA 1U5IB 4P5OE 2FJUB 1V1GA 1MF8B 1YUSA 1DJHA 1S6CA 1WRKA 1LINA 1B8CA 1BR4B 2BE4A 3WHTB 1QX7A 3PALA 1XFUO 2BBMA 4HSZA 1NX0A 5IBWA 1BT6A 3VROA 1SCMC 3CGAA 2R2IA 3SIBA 5JJGA 3VRPA 1TNXA 1AJ5A 4WRIA 1CMFA 2LM5A 2MLFC 2LCPA 1GJYA 1ZUZA 1NSHA 2KGRA 1YR5A 2VRGA 1K2HA 3I5GB 2K7OA 5HLOA 4I5NB 2K0JA 1S26D 3I5FC 3DF0B 3FS7A 2BBNA 1OMDA 2F3ZA 2ISDA 3WXAA 1DVIA 1CLBA 1SCMB 1XK4A 1F4QA 3WNXB 1PULA 1DJIA 3AKBA 3NXAA 1XA5A 1B8RA 4FTGA 1S3PA 2BCAA 1CFCA 4ZCVA 4D1EA 1Y1AA 3D0YB 3AKAA 2G2BA 3A8RA 1WY9A 1XYDA 5HLVA 4ORBB 2WCFA 4GGFC 1SR6C 2L4HA 2OTGB 3PSRA 1BLQA 1GGWA 2K61A 2FOTA 1X02A 1DJYA 1KFXL 1B4CA 4GFTA 3PN7B 4I5JA 4QJ3B 1KFUL 3SG5A 5BPJA 1QIVA 2L5XB 4GBAA 2BE6A 2RGIA 2EC6C 1DJWA 1IH0A 1IQ5A 1XFVO 4DIRA 2ZRTA 2ZN8A 1HQVA 3EVRA 3M0WA 2KQYA 4AOMA 3F45A 1KQMC 2IS9A 2LMUA 2ZFDA 2KAVA 2KFGA 5HYDA 1EXRA 2AMIA 2QACA 5K89A 1K94A 3OB1B 4PHKA 3EVVA 3NSLA 3ZWHA 2AUCA 5PALA 1DTLA 1NCZA 1IKUA 1ALWA 1A2XA 1SMGA 1GGZA 1SKTA 2I94A 1K90D 2JQ6A 2ZN9A 1RFJA 1M31A 4CFRA 5AFPA 2F2OA 1MQ1A 5AANA 3I5HC 3VRQA 3DVJA 1KWOB 4I5KA 1MUXA 1A29A 1ZFSA 1WRZA 2O5GA 1ALVA 1TNQA 2LLTA 2V53A 2L51A 4PHJA 4PCWA 4CPVA 1SBJA 2NCPA 4NDBA 1QS7A 1TCOB 4ZCUA 3CWGA 1JUOA 2MAZA 2KI4C 4PE4A 3E3RA 1F4OA 5G08A 5J3XA 3FWBA 4ICBA 3I5HB 2KFHA 3CR5X 4PHNA 4YGEB 2JXLA 1QASA 2L4IA 3BYAA 3VRNA 1OQPA 1S36A 2WCBA 2KQ6A 1PVBA 2CCMA 1N0YA 2PASA 1SK6D 2A4JA 1BJFA 1XFYO 4A4CA 2NZ0A 2L0PA 3IQOA 1NP8A 1KK8C 1PK0D 2HF5A 2KI4B 1SCVA 1TIZA 1DF0B 1Y6WA 5DKQA 2LHIA 1G8IA 1AUIB 1OMRA 1YURA 4TNCA 5B8IB 3O6BA 1YUUA 1G33A 3OB2B 2Q4UA 4HREE 4JPZB 1NX3A 4BY5A 1TN4A 1KSOA 4N1FA 3HCMA 2H61A 2M97A 3SIAA 2SASA 2JRFA 3AAJA 1B9AA 1Q80A 3ICBA 4QJ5B 1QVIY 3GK4X 4PE1A 2E30A 1N2DA 2OS8B 3I5GC 2LHLA 1MXEA 2F3YA 2KYCA 1TCFA 1ZOTB 4MRYA 4U8DA 1OZOA 4HRHA 1AJ4A 1K93D 1RJVA 4F0ZB 2F33A 4M2PA 4GNKB 2PSRA 4MZJA 3FIAA 1SRAA 1WLMA 4MVFA 2MRDA 3OX6A 1Y1XA 1YVHA 4PDZA 5F6TA 2ZKMX 5CSNA 3KHEA 1BR1B 3H4SE 3JVTB 1CDNA 4GUKA 1QX5B 2GGMA 4YI8A 1H8BA 1WRLA 1M39A 3D10A 3KO0A 4NQGA 2K7CA 2MLEC 4YGDB 1LVCD 2OTGC 2G9BA 4PE0A 4YGAA 1ZMZA 4XJKA 3IQQA 4DS7A 3BUWB 3PN7C 3BUNB 2LUCA 2KAYA 2WCEA 1DJGA 3CTNA 3CS1A 1EG3A 1Y0VH 4MRXA 4YGBB 1CKKA 3O78A 3BUMB 2KNEA 1QVIZ 1L2OB 5DKRA 1XK4C 5HKZA 4DCKA 2M1UA 3IF7A 1SNLA 1BMOA 2JT8A 5CSFA 4YBHB 1HT9A 1SW8A 1IGVA 1FI5A 1V1FA 1W7JB 1CLMA 2NCOA 2JT0A 1J7QA 1QV1A 1F55A 2E6WA 2M8UA 4HRGA 1UHNA 5HKWA 3GK1A 4JWQA 3KPXA 1KWOC 5I2QA 2KHNA 1S1EA 4XJKB 3RLZA 3DD4A 2JT3A 3GOFA 2I2RE 3SJSA 5CSJA 3A4UB 1B7TY 2JXCA 2LLUA 3LCPC 4I5LB 5I2LA 1SL7A 2JC2A 3OHMB 5D7FA 3SG6A 5TNCA 2LV7A 4N5XA 2CXJA 5HKYA 2FCEA 3KEVA 1CM4A 1NWDA 1NX1A 5JOLA 2M7LA 1AHRA 2KGBC 2COLB 2I7AA 3OX5A 3CR4X 1YUTA 2JULA 2LVVA 3NSOA 4DRWA 2LVJA 4FQOA 1C7WA 1NX2A 1S5GY 4NDDA 1C07A 3HX4A 1TOPA 3EK7A 2BKHB 1QIWA 4OR9B 2WNDA 4R1EA 2KI6D 4PHMA 1ODBA 1OOJA 3NSKA 2K7BA 3VRRA 1QV0A 3BUXB 4YRUA 3LLEA 2KAXA 1MR8A 1TNPA 1C7VA 1PRWA 1PSBA 1YRTB 3EK4A 2BCXA 1A75A 2P6BB 2BKIB 1J7OA 1JFJA 1UP5A 2O60A 1XFXO 2Q91A 2KBIA 2ZRSA 1QATA 1JC2A 5KSZA 1CDMA 2MA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVM A;  3WHU B;  1CDL A;  2K7D A;  3AAK A;  1OSA A;  3EKH A;  4MLW A;  1Y1U A;  4YGC B;  2MBX A;  4A4B A;  3TUY C;  1SL8 A;  1AP4 A;  1MHO A;  1CFP A;  2Y5I A;  1W7I B;  1E8A A;  2LMV A;  1K9K A;  1F71 A;  2PVB A;  2LNK A;  2KFF A;  3DVE A;  1FW4 A;  1KK7 Y;  4Q04 A;  5ER4 X;  3TDZ A;  2OS8 C;  3TS5 C;  1DGU A;  1CLL A;  1NPQ A;  1PSR A;  2M49 B;  1JF0 A;  4ORC B;  4AQJ A;  2Y1M A;  2FCD A;  1NCY A;  4MZK A;  3JTD B;  4USL A;  3PLF B;  1CFF A;  5AXI A;  2L50 A;  1A75 B;  5ER5 A;  1GQM A;  4L9M A;  2WOR A;  2B1U A;  3TUY B;  2Y4Q A;  5CSI A;  2GGZ A;  3SG4 A;  2K8M B;  3EKJ A;  4OCI A;  5KTY A;  1SL9 A;  3JVT C;  1D1O A;  3KF9 A;  2F8P A;  5GQQ C;  2JNF A;  3TS5 B;  2HPS A;  2PRU A;  4ETO A;  1J7P A;  2PAL A;  1SY9 A;  2Y1N A;  1KSM A;  3CR2 A;  1R6P A;  1UWO A;  2H61 C;  4WQ2 A;  2KDH A;  1YVL A;  3GK2 A;  2BL0 C;  3C1V A;  1LXF C;  4OKH A;  4DUQ A;  1CM1 A;  2HQ8 A;  4C0K A;  3O2P A;  4NDC A;  1SYM A;  3BUO B;  3PFV A;  2BCB A;  4OV2 A;  2JTT A;  2L2E A;  1NIW A;  1UHI A;  1VRK A;  1YX7 A;  1M45 A;  1BU3 A;  3DF0 A;  2LVK A;  1WDC C;  1L2O C;  1QLK A;  1FF1 A;  4N1G A;  4PE7 A;  3SG2 A;  2CBL A;  4E68 A;  4CID A;  1RK9 A;  4GPL B;  1XVJ A;  2BL0 B;  1UHK A;  1S6I A;  5AER A;  2DOQ A;  2M7N A;  1F8H A;  1B1G A;  1A4P A;  3D0Y A;  3LL8 B;  3ZNI A;  2SCP A;  3BXK A;  4OVN F;  1RWY A;  4YI9 A;  1CB1 A;  4C0J A;  3MSE B;  2K2F A;  1YX8 A;  2JNX A;  1JF2 A;  1WDC B;  3QRX A;  1L7Z A;  2NLN A;  4PAL A;  1JWD A;  3RM1 A;  3BQ3 A;  1MWN A;  1NYA A;  2JPT A;  3PAT A;  2LE9 B;  2M29 A;  1IRJ A;  1J55 A;  1IQ3 A;  2BEC A;  3EVU A;  3TDU A;  3OP0 A;  4M2O A;  4AQI A;  5I2O A;  1XFZ O;  1TTX A;  1IJ6 A;  3DVK A;  1UHH A;  1LA0 A;  3TZ1 A;  2MJW B;  5AEQ A;  1M63 B;  1QX2 A;  2QPT A;  1H4B A;  1PAL A;  4GGF A;  1DGV A;  1OMV A;  4P2Y B;  2CT9 A;  1TRF A;  4UPG A;  2LAN A;  1UUS A;  2JTZ A;  1QJT A;  3NSI A;  1CDP A;  4MEW A;  2K2A A;  4BY4 A;  1F70 A;  4MSP A;  1K8U A;  1K95 A;  3LK0 A;  2LVI A;  3I5F B;  2KYF A;  2F2P A;  1KFX S;  3I5I C;  3BOW A;  5I8N A;  2KSP A;  2M9G A;  4GAO A;  5DKN A;  1QXP A;  1KFU S;  1KCY A;  1ZAC A;  2LUX A;  2KI6 C;  1MXL C;  2M0R A;  2LC5 A;  3PM8 A;  1WLZ A;  4XYN A;  3LK1 A;  2WOS A;  4ORA B;  2LP2 A;  1R2U A;  1JSA A;  2H2K A;  1J1D A;  2HET A;  4MN0 A;  1JFK A;  1FPW A;  1CTR A;  1SR6 B;  2GV5 A;  4QJ4 B;  3I5I B;  1S6J A;  1EH2 A;  1B47 A;  1M46 A;  3SG7 A;  1SPY A;  1IJ5 A;  2ZND A;  4M2Q A;  1G4Y R;  3EK8 A;  1YRU B;  2EC6 B;  1DJX A;  1REC A;  2WC8 A;  2EGD A;  2JU0 A;  3BOW B;  1NUB A;  2OPO A;  3CLN A;  4JQ0 D;  3JTD C;  1B7T Z;  1KQM B;  5D69 A;  1BOC A;  1NCX A;  1F54 A;  2KBM A;  1DF0 A;  1K96 A;  1AK8 A;  4MZL A;  1FBV A;  4GGN A;  1DT7 B;  3SG3 A;  1FI6 A;  1DJZ A;  1IWQ A;  1LKJ A;  4WQ3 A;  1K9U A;  1XO5 A;  3VGO A;  1QLS A;  2I18 A;  5KU1 A;  2PMY A;  1XFW O;  2HQW A;  4IL1 A;  1EG4 A;  1LA3 A;  1N65 A;  1S5G Z;  2NXQ A;  2JZI A;  2CTN A;  1UHJ A;  1J7R A;  3CZT X;  2L98 A;  3TDI A;  1OE9 B;  4MBE A;  5FYX A;  1CFD A;  1CMG A;  2KOT A;  1U5I A;  2LAP A;  2MHH A;  1YTZ C;  1BOD A;  1BF5 A;  1OZS A;  2LMT A;  1K9P A;  4C0L A;  1RRO A;  2LP3 A;  2D8N A;  2M3W A;  5CPV A;  1RTP 1;  1BG1 A;  1CNP A;  2TN4 A;  1IG5 A;  2M1K B;  4CLN A;  1B8L A;  1J1E A;  1EJ3 A;  3O4Y A;  4CFQ A;  1A03 A;  1EL4 A;  2AAO A;  1JBA A;  1PVA A;  2LLS A;  1QTX A;  2ZNE A;  1AVS A;  3FWC A;  3K21 A;  1UUR A;  1KQV A;  2JWW A;  1DMO A;  1KK8 B;  1KK7 Z;  2JOJ A;  1TNW A;  2CNP A;  2EHB A;  1U5I B;  4P5O E;  2FJU B;  1V1G A;  1MF8 B;  1YUS A;  1DJH A;  1S6C A;  1WRK A;  1LIN A;  1B8C A;  1BR4 B;  2BE4 A;  3WHT B;  1QX7 A;  3PAL A;  1XFU O;  2BBM A;  4HSZ A;  1NX0 A;  5IBW A;  1BT6 A;  3VRO A;  1SCM C;  3CGA A;  2R2I A;  3SIB A;  5JJG A;  3VRP A;  1TNX A;  1AJ5 A;  4WRI A;  1CMF A;  2LM5 A;  2MLF C;  2LCP A;  1GJY A;  1ZUZ A;  1NSH A;  2KGR A;  1YR5 A;  2VRG A;  1K2H A;  3I5G B;  2K7O A;  5HLO A;  4I5N B;  2K0J A;  1S26 D;  3I5F C;  3DF0 B;  3FS7 A;  2BBN A;  1OMD A;  2F3Z A;  2ISD A;  3WXA A;  1DVI A;  1CLB A;  1SCM B;  1XK4 A;  1F4Q A;  3WNX B;  1PUL A;  1DJI A;  3AKB A;  3NXA A;  1XA5 A;  1B8R A;  4FTG A;  1S3P A;  2BCA A;  1CFC A;  4ZCV A;  4D1E A;  1Y1A A;  3D0Y B;  3AKA A;  2G2B A;  3A8R A;  1WY9 A;  1XYD A;  5HLV A;  4ORB B;  2WCF A;  4GGF C;  1SR6 C;  2L4H A;  2OTG B;  3PSR A;  1BLQ A;  1GGW A;  2K61 A;  2FOT A;  1X02 A;  1DJY A;  1KFX L;  1B4C A;  4GFT A;  3PN7 B;  4I5J A;  4QJ3 B;  1KFU L;  3SG5 A;  5BPJ A;  1QIV A;  2L5X B;  4GBA A;  2BE6 A;  2RGI A;  2EC6 C;  1DJW A;  1IH0 A;  1IQ5 A;  1XFV O;  4DIR A;  2ZRT A;  2ZN8 A;  1HQV A;  3EVR A;  3M0W A;  2KQY A;  4AOM A;  3F45 A;  1KQM C;  2IS9 A;  2LMU A;  2ZFD A;  2KAV A;  2KFG A;  5HYD A;  1EXR A;  2AMI A;  2QAC A;  5K89 A;  1K94 A;  3OB1 B;  4PHK A;  3EVV A;  3NSL A;  3ZWH A;  2AUC A;  5PAL A;  1DTL A;  1NCZ A;  1IKU A;  1ALW A;  1A2X A;  1SMG A;  1GGZ A;  1SKT A;  2I94 A;  1K90 D;  2JQ6 A;  2ZN9 A;  1RFJ A;  1M31 A;  4CFR A;  5AFP A;  2F2O A;  1MQ1 A;  5AAN A;  3I5H C;  3VRQ A;  3DVJ A;  1KWO B;  4I5K A;  1MUX A;  1A29 A;  1ZFS A;  1WRZ A;  2O5G A;  1ALV A;  1TNQ A;  2LLT A;  2V53 A;  2L51 A;  4PHJ A;  4PCW A;  4CPV A;  1SBJ A;  2NCP A;  4NDB A;  1QS7 A;  1TCO B;  4ZCU A;  3CWG A;  1JUO A;  2MAZ A;  2KI4 C;  4PE4 A;  3E3R A;  1F4O A;  5G08 A;  5J3X A;  3FWB A;  4ICB A;  3I5H B;  2KFH A;  3CR5 X;  4PHN A;  4YGE B;  2JXL A;  1QAS A;  2L4I A;  3BYA A;  3VRN A;  1OQP A;  1S36 A;  2WCB A;  2KQ6 A;  1PVB A;  2CCM A;  1N0Y A;  2PAS A;  1SK6 D;  2A4J A;  1BJF A;  1XFY O;  4A4C A;  2NZ0 A;  2L0P A;  3IQO A;  1NP8 A;  1KK8 C;  1PK0 D;  2HF5 A;  2KI4 B;  1SCV A;  1TIZ A;  1DF0 B;  1Y6W A;  5DKQ A;  2LHI A;  1G8I A;  1AUI B;  1OMR A;  1YUR A;  4TNC A;  5B8I B;  3O6B A;  1YUU A;  1G33 A;  3OB2 B;  2Q4U A;  4HRE E;  4JPZ B;  1NX3 A;  4BY5 A;  1TN4 A;  1KSO A;  4N1F A;  3HCM A;  2H61 A;  2M97 A;  3SIA A;  2SAS A;  2JRF A;  3AAJ A;  1B9A A;  1Q80 A;  3ICB A;  4QJ5 B;  1QVI Y;  3GK4 X;  4PE1 A;  2E30 A;  1N2D A;  2OS8 B;  3I5G C;  2LHL A;  1MXE A;  2F3Y A;  2KYC A;  1TCF A;  1ZOT B;  4MRY A;  4U8D A;  1OZO A;  4HRH A;  1AJ4 A;  1K93 D;  1RJV A;  4F0Z B;  2F33 A;  4M2P A;  4GNK B;  2PSR A;  4MZJ A;  3FIA A;  1SRA A;  1WLM A;  4MVF A;  2MRD A;  3OX6 A;  1Y1X A;  1YVH A;  4PDZ A;  5F6T A;  2ZKM X;  5CSN A;  3KHE A;  1BR1 B;  3H4S E;  3JVT B;  1CDN A;  4GUK A;  1QX5 B;  2GGM A;  4YI8 A;  1H8B A;  1WRL A;  1M39 A;  3D10 A;  3KO0 A;  4NQG A;  2K7C A;  2MLE C;  4YGD B;  1LVC D;  2OTG C;  2G9B A;  4PE0 A;  4YGA A;  1ZMZ A;  4XJK A;  3IQQ A;  4DS7 A;  3BUW B;  3PN7 C;  3BUN B;  2LUC A;  2KAY A;  2WCE A;  1DJG A;  3CTN A;  3CS1 A;  1EG3 A;  1Y0V H;  4MRX A;  4YGB B;  1CKK A;  3O78 A;  3BUM B;  2KNE A;  1QVI Z;  1L2O B;  5DKR A;  1XK4 C;  5HKZ A;  4DCK A;  2M1U A;  3IF7 A;  1SNL A;  1BMO A;  2JT8 A;  5CSF A;  4YBH B;  1HT9 A;  1SW8 A;  1IGV A;  1FI5 A;  1V1F A;  1W7J B;  1CLM A;  2NCO A;  2JT0 A;  1J7Q A;  1QV1 A;  1F55 A;  2E6W A;  2M8U A;  4HRG A;  1UHN A;  5HKW A;  3GK1 A;  4JWQ A;  3KPX A;  1KWO C;  5I2Q A;  2KHN A;  1S1E A;  4XJK B;  3RLZ A;  3DD4 A;  2JT3 A;  3GOF A;  2I2R E;  3SJS A;  5CSJ A;  3A4U B;  1B7T Y;  2JXC A;  2LLU A;  3LCP C;  4I5L B;  5I2L A;  1SL7 A;  2JC2 A;  3OHM B;  5D7F A;  3SG6 A;  5TNC A;  2LV7 A;  4N5X A;  2CXJ A;  5HKY A;  2FCE A;  3KEV A;  1CM4 A;  1NWD A;  1NX1 A;  5JOL A;  2M7L A;  1AHR A;  2KGB C;  2COL B;  2I7A A;  3OX5 A;  3CR4 X;  1YUT A;  2JUL A;  2LVV A;  3NSO A;  4DRW A;  2LVJ A;  4FQO A;  1C7W A;  1NX2 A;  1S5G Y;  4NDD A;  1C07 A;  3HX4 A;  1TOP A;  3EK7 A;  2BKH B;  1QIW A;  4OR9 B;  2WND A;  4R1E A;  2KI6 D;  4PHM A;  1ODB A;  1OOJ A;  3NSK A;  2K7B A;  3VRR A;  1QV0 A;  3BUX B;  4YRU A;  3LLE A;  2KAX A;  1MR8 A;  1TNP A;  1C7V A;  1PRW A;  1PSB A;  1YRT B;  3EK4 A;  2BCX A;  1A75 A;  2P6B B;  2BKI B;  1J7O A;  1JFJ A;  1UP5 A;  2O60 A;  1XFX O;  2Q91 A;  2KBI A;  2ZRS A;  1QAT A;  1JC2 A;  5KSZ A;  1CDM A;  2MA2 A; 
#chains in the Genus database with same CATH topology
 3DVM A;  3WHU B;  1CDL A;  1DC1 A;  2K7D A;  3AAK A;  1OSA A;  3EKH A;  4MLW A;  1Y1U A;  4YGC B;  2MBX A;  4A4B A;  3TUY C;  1SL8 A;  1AP4 A;  1MHO A;  1CFP A;  2Y5I A;  1W7I B;  1E8A A;  2LMV A;  1K9K A;  3D73 A;  2PVB A;  2LNK A;  2KFF A;  3DVE A;  1F71 A;  1FW4 A;  1KK7 Y;  4Q04 A;  5ER4 X;  3TDZ A;  2OS8 C;  3TS5 C;  1DGU A;  3PM2 A;  1CLL A;  1NPQ A;  1PSR A;  2M49 B;  2PQL A;  3O4X A;  1JF0 A;  4ORC B;  4AQJ A;  2Y1M A;  2FCD A;  1NCY A;  4MZK A;  3JTD B;  4USL A;  2WCK A;  3PLF B;  1CFF A;  5AXI A;  2L50 A;  1A75 B;  5ER5 A;  1GQM A;  4L9M A;  2WOR A;  2B1U A;  3TUY B;  2Y4Q A;  5CSI A;  2GGZ A;  3SG4 A;  2K8M B;  3EKJ A;  4OCI A;  5KTY A;  1SL9 A;  1T14 A;  3JVT C;  1D1O A;  3KF9 A;  2F8P A;  5GQQ C;  2JNF A;  3TS5 B;  2HPS A;  2PRU A;  4ETO A;  1J7P A;  2PAL A;  3S0B A;  1SY9 A;  2Y1N A;  3L47 A;  1KSM A;  3B86 A;  3CR2 A;  1R6P A;  1UWO A;  2H61 C;  4WQ2 A;  2KDH A;  1YVL A;  3GK2 A;  2BL0 C;  3C1V A;  1LXF C;  4OKH A;  4DUQ A;  1CM1 A;  2HQ8 A;  3DY9 A;  1ORG A;  4C0K A;  2P70 A;  3O2P A;  4NDC A;  1SYM A;  3BUO B;  5EL2 A;  3PFV A;  2BCB A;  4OV2 A;  2JTT A;  2L2E A;  1NIW A;  1UHI A;  1VRK A;  1YX7 A;  1M45 A;  2QEO A;  3D74 A;  2JPO A;  1BU3 A;  3S0D A;  3DF0 A;  2LVK A;  1WDC C;  1L2O C;  1QLK A;  1FF1 A;  4N1G A;  4PE7 A;  3SG2 A;  2CBL A;  4E68 A;  4CID A;  3NHT A;  1OOI X;  1RK9 A;  4GPL B;  1XVJ A;  1XFR A;  2BL0 B;  1UHK A;  1S6I A;  1P28 A;  5AER A;  2DOQ A;  2M7N A;  1F8H A;  1B1G A;  1TUZ A;  1A4P A;  3D0Y A;  4FQT A;  3LL8 B;  3ZNI A;  2SCP A;  3BXK A;  1OOG A;  4OVN F;  1RWY A;  4YI9 A;  3S0F A;  1CB1 A;  4C0J A;  3MSE B;  2K2F A;  3R72 A;  1YX8 A;  2JNX A;  1JF2 A;  5FI6 A;  1WDC B;  3QRX A;  1L7Z A;  2NLN A;  4PAL A;  1JWD A;  2L5Y A;  3RM1 A;  3BQ3 A;  1MWN A;  1NYA A;  2JPT A;  3PAT A;  4OZD A;  2LE9 B;  2M29 A;  1IRJ A;  1J55 A;  1IQ3 A;  2BEC A;  3EVU A;  1OOH A;  3OP0 A;  4M2O A;  1DEL A;  3D77 A;  3TDU A;  4AQI A;  1XFZ O;  1TTX A;  5I2O A;  1IJ6 A;  3DVK A;  1UHH A;  1LA0 A;  3TZ1 A;  2MJW B;  5AEQ A;  1M63 B;  1QX2 A;  2QPT A;  1H4B A;  1PAL A;  4GGF A;  1DGV A;  1OMV A;  4P2Y B;  3S0E A;  2CT9 A;  1TRF A;  4UPG A;  2LAN A;  1UUS A;  2JTZ A;  1QJT A;  3NSI A;  3EG5 B;  1CDP A;  4MEW A;  2K2A A;  4BY4 A;  1F70 A;  4MSP A;  1K8U A;  1K95 A;  2QEV A;  3D76 A;  3LK0 A;  2LVI A;  3I5F B;  2KYF A;  2F2P A;  1KFX S;  2QDI A;  3B87 A;  3BOW A;  3I5I C;  3V2L A;  2KSP A;  2M9G A;  4GAO A;  5DKN A;  1QXP A;  1KFU S;  5I8N A;  1KCY A;  3OBV A;  1ZAC A;  2LUX A;  3SS5 A;  2KI6 C;  1W9Z A;  1MXL C;  2M0R A;  4F7F A;  2LC5 A;  3PM8 A;  4INW A;  1TWO A;  1WLZ A;  3CAB A;  4XYN A;  3LK1 A;  1SSE B;  4PT1 A;  2YGU A;  2WOS A;  4ORA B;  2LP2 A;  1R2U A;  2QEB A;  1JSA A;  2H2K A;  1J1D A;  2HET A;  4MN0 A;  1JFK A;  1FPW A;  1CTR A;  1SR6 B;  2GV5 A;  4QJ4 B;  3CDN A;  3I5I B;  1S6J A;  3FE8 A;  1LS8 A;  1EH2 A;  1B47 A;  1M46 A;  1OOF A;  3SG7 A;  1SPY A;  1IJ5 A;  2ZND A;  4M2Q A;  1G4Y R;  3CZ0 A;  3EK8 A;  3BFB A;  2WCH A;  1YRU B;  2EC6 B;  1DJX A;  1REC A;  2WC8 A;  2EGD A;  2JU0 A;  3BOW B;  1NUB A;  2OPO A;  3CLN A;  4JQ0 D;  3JTD C;  1B7T Z;  1KQM B;  5D69 A;  1BOC A;  1NCX A;  1F54 A;  2KBM A;  1DF0 A;  1K96 A;  1AK8 A;  3B6X A;  4MZL A;  1FBV A;  4GGN A;  1DT7 B;  3SG3 A;  4KYN A;  1FI6 A;  1DJZ A;  1IWQ A;  1LKJ A;  4WQ3 A;  1K9U A;  1XO5 A;  3VGO A;  1QLS A;  2I18 A;  5KU1 A;  2PMY A;  1XFW O;  2HQW A;  4IL1 A;  1EG4 A;  1LA3 A;  1N65 A;  1S5G Z;  2KLE A;  2JZI A;  2CTN A;  2NXQ A;  3K1E A;  1UHJ A;  1J7R A;  3CZT X;  2L98 A;  4JKT A;  1OE9 B;  4MBE A;  3TDI A;  5FYX A;  1CFD A;  1CMG A;  2KOT A;  3R1P A;  2GTE A;  1U5I A;  2LAP A;  3SS4 A;  2MHH A;  1YTZ C;  1BOD A;  1BF5 A;  1OZS A;  2LMT A;  3RZS A;  1K9P A;  4C0L A;  1RRO A;  2LP3 A;  2D8N A;  2M3W A;  5CPV A;  1RTP 1;  1BG1 A;  1CNP A;  2TN4 A;  1IG5 A;  2M1K B;  4CLN A;  1B8L A;  1J1E A;  1EJ3 A;  3O4Y A;  4CFQ A;  1A03 A;  1EL4 A;  2AAO A;  3FE6 A;  1JBA A;  1C3Y A;  1PVA A;  2L2C A;  2LLS A;  1QTX A;  2ZNE A;  3DYE A;  1AVS A;  2WCM A;  3FWC A;  3K21 A;  1UUR A;  1KQV A;  2JWW A;  1DMO A;  1KK8 B;  1KK7 Z;  2JOJ A;  1TNW A;  2CNP A;  2EHB A;  1U5I B;  3B7A A;  4P5O E;  2FJU B;  1V1G A;  1MF8 B;  1YUS A;  1DJH A;  1S6C A;  1WRK A;  1LIN A;  1B8C A;  1BR4 B;  2K60 A;  2BE4 A;  3WHT B;  1QX7 A;  3PAL A;  4INX A;  1XFU O;  2BBM A;  5I94 A;  4HSZ A;  1NX0 A;  5IBW A;  1BT6 A;  3VRO A;  1SCM C;  2QEH A;  3CGA A;  2R2I A;  3SIB A;  5JJG A;  3VRP A;  1TNX A;  1AJ5 A;  4WRI A;  1CMF A;  2LM5 A;  2MLF C;  3QME A;  2LCP A;  1GJY A;  1ZUZ A;  3SS3 A;  1NSH A;  2KGR A;  1YR5 A;  2VRG A;  3NGV A;  3I5G B;  1K2H A;  2K7O A;  5HLO A;  4I5N B;  2K0J A;  1S26 D;  2WC6 A;  3I5F C;  3DF0 B;  3FS7 A;  2BBN A;  3R1O A;  1OMD A;  2F3Z A;  3DZT A;  2ISD A;  3WXA A;  1DVI A;  1CLB A;  1SCM B;  1XK4 A;  1F4Q A;  3WNX B;  1PUL A;  1DJI A;  3AKB A;  3NXA A;  1XA5 A;  1B8R A;  4FTG A;  1S3P A;  2BCA A;  2KLD A;  1CFC A;  4ZCV A;  4JD9 A;  4D1E A;  1Y1A A;  3D0Y B;  3AKA A;  2G2B A;  3A8R A;  1WY9 A;  1IIO A;  1XYD A;  5HLV A;  4ORB B;  3L4L A;  1GM0 A;  2WCF A;  4GGF C;  1SR6 C;  2L4H A;  2OTG B;  3PSR A;  1BLQ A;  1GGW A;  2K61 A;  2FOT A;  1X02 A;  1DJY A;  1KFX L;  1B4C A;  4GFT A;  3PN7 B;  4I5J A;  4QJ3 B;  1KFU L;  3SG5 A;  5BPJ A;  1QIV A;  2L5X B;  4GBA A;  2BE6 A;  2RGI A;  2EC6 C;  1DJW A;  1IH0 A;  1IQ5 A;  1XFV O;  4DIR A;  2ZRT A;  2ZN8 A;  1HQV A;  3EVR A;  3M0W A;  2KQY A;  4AOM A;  3F45 A;  1KQM C;  2IS9 A;  2LMU A;  2ZFD A;  2KAV A;  2ERB A;  2KFG A;  5HYD A;  1EXR A;  2AMI A;  2QAC A;  3NHI A;  1K94 A;  5K89 A;  3OB1 B;  2P71 A;  4PHK A;  3EVV A;  3NSL A;  3ZWH A;  2AUC A;  5PAL A;  1DTL A;  1NCZ A;  1IKU A;  1ALW A;  1A2X A;  1SMG A;  1GGZ A;  1SKT A;  2I94 A;  1K90 D;  2JQ6 A;  2ZN9 A;  1RFJ A;  1M31 A;  4CFR A;  5AFP A;  2F2O A;  1MQ1 A;  5AAN A;  3I5H C;  3VRQ A;  1OW4 A;  3DVJ A;  1KWO B;  4I5K A;  1MUX A;  2KPH A;  1A29 A;  1ZFS A;  1WRZ A;  2O5G A;  1ALV A;  1TNQ A;  2LLT A;  2V53 A;  2L51 A;  3BFA A;  1DEK A;  4PCW A;  4PHJ A;  1SBJ A;  4CPV A;  2NCP A;  4NDB A;  1QS7 A;  2WCJ A;  1TCO B;  4ZCU A;  3CWG A;  1JUO A;  2MAZ A;  2KI4 C;  4PE4 A;  3E3R A;  1F4O A;  5G08 A;  5J3X A;  3FWB A;  3FE9 A;  4ICB A;  3CZ2 A;  2KFH A;  3I5H B;  3CR5 X;  4PHN A;  4YGE B;  2JXL A;  1QAS A;  2L4I A;  3BYA A;  3VRN A;  1OQP A;  1S36 A;  2WCB A;  3BFH A;  2KQ6 A;  1PVB A;  2CCM A;  1N0Y A;  2PAS A;  1SK6 D;  2A4J A;  1BJF A;  1XFY O;  3OGN A;  2NZ0 A;  4A4C A;  2L0P A;  3IQO A;  1NP8 A;  1KK8 C;  1PK0 D;  2HF5 A;  2KI4 B;  1SCV A;  1TIZ A;  1DF0 B;  1QWV A;  1Y6W A;  5DKQ A;  2LHI A;  1G8I A;  1AUI B;  1OMR A;  1YUR A;  4TNC A;  5B8I B;  3O6B A;  1YUU A;  3DXL A;  5FI7 A;  1G33 A;  3OB2 B;  2Q4U A;  4HRE E;  1C3Z A;  4JPZ B;  1NX3 A;  4BY5 A;  1TN4 A;  1KSO A;  2WCL A;  4N1F A;  3HCM A;  3CZ1 A;  2H61 A;  2M97 A;  3SIA A;  2SAS A;  2JRF A;  4IJ7 A;  3AAJ A;  1B9A A;  1Q80 A;  3ICB A;  4QJ5 B;  1QVI Y;  3GK4 X;  4PE1 A;  2E30 A;  1N2D A;  2OS8 B;  3I5G C;  2LHL A;  1MXE A;  2F3Y A;  2H8V A;  2KYC A;  1TCF A;  1ZOT B;  4MRY A;  4U8D A;  1OZO A;  4HRH A;  1AJ4 A;  1K93 D;  1RJV A;  3S0G A;  4F0Z B;  2F33 A;  4M2P A;  4GNK B;  2PSR A;  4MZJ A;  3VB1 A;  3FIA A;  1SRA A;  1WLM A;  4MVF A;  2MRD A;  3OX6 A;  1Y1X A;  1YVH A;  4PDZ A;  5F6T A;  2ZKM X;  5CSN A;  3KHE A;  1BR1 B;  3H4S E;  3JVT B;  1CDN A;  4GUK A;  1QX5 B;  2GGM A;  4YI8 A;  1H8B A;  1WRL A;  1M39 A;  3D10 A;  3KO0 A;  4NQG A;  2K7C A;  2MLE C;  4YGD B;  1LVC D;  2OTG C;  3IVT A;  2G9B A;  4PE0 A;  4YGA A;  1ZMZ A;  4XJK A;  3UO9 A;  3IQQ A;  4DS7 A;  3BUW B;  3PN7 C;  3R1V A;  2FJY A;  2LUC A;  2KAY A;  2WCE A;  3BUN B;  1DJG A;  3D75 A;  3L4A A;  3CTN A;  3CS1 A;  1EG3 A;  1Y0V H;  4MRX A;  4YGB B;  3S0A A;  5DIC A;  1CKK A;  3O78 A;  1DQE A;  3BUM B;  2KNE A;  1QVI Z;  1L2O B;  3Q8I A;  5DKR A;  1XK4 C;  5HKZ A;  4DCK A;  2M1U A;  3IF7 A;  1SNL A;  1BMO A;  2JT8 A;  5CSF A;  4YBH B;  1HT9 A;  1SW8 A;  1IGV A;  1FI5 A;  1V1F A;  1W7J B;  1CLM A;  2NCO A;  2JT0 A;  1J7Q A;  1QV1 A;  1F55 A;  2E6W A;  2M8U A;  4HRG A;  1UHN A;  2WC5 A;  5HKW A;  3UNW A;  3GK1 A;  4JWQ A;  3KPX A;  1KWO C;  5I2Q A;  2KHN A;  1S1E A;  1Z4H A;  4XJK B;  3RLZ A;  3DD4 A;  2JT3 A;  3GOF A;  2I2R E;  3SJS A;  5CSJ A;  3A4U B;  1B7T Y;  2JXC A;  2LLU A;  3LCP C;  1TUJ A;  4I5L B;  3BJH A;  5I2L A;  1SL7 A;  2JC2 A;  3OHM B;  5D7F A;  3SG6 A;  5TNC A;  2LV7 A;  4N5X A;  2CXJ A;  5HKY A;  2FCE A;  3KEV A;  1CM4 A;  1NWD A;  1NX1 A;  5JOL A;  2M7L A;  1AHR A;  2KGB C;  2COL B;  2I7A A;  3OX5 A;  3CR4 X;  1YUT A;  2JUL A;  2LVV A;  3NSO A;  4DRW A;  2LVJ A;  3CYZ A;  4FQO A;  1C7W A;  1NX2 A;  1S5G Y;  4NDD A;  1C07 A;  3HX4 A;  1TOP A;  3EK7 A;  2BKH B;  1QIW A;  4OR9 B;  2WND A;  4R1E A;  2KI6 D;  4PHM A;  1ODB A;  1OOJ A;  3NSK A;  2K7B A;  3VRR A;  2BNX A;  1QV0 A;  3D78 A;  3BUX B;  2BAP A;  5D3O A;  4YRU A;  3LLE A;  5HL1 A;  1Z2C B;  1MR8 A;  2KAX A;  2PYQ A;  3PJI A;  1TNP A;  1C7V A;  1PRW A;  1PSB A;  1YRT B;  3B88 A;  3EK4 A;  2BCX A;  1A75 A;  3N7H A;  2P6B B;  2BKI B;  5FI2 A;  1J7O A;  1JFJ A;  1UP5 A;  2O60 A;  1XFX O;  2Q91 A;  2KBI A;  2ZRS A;  1QAT A;  1JC2 A;  5KSZ A;  1CDM A;  2MA2 A; 
#chains in the Genus database with same CATH homology
 3DVM A;  3WHU B;  1CDL A;  2K7D A;  3AAK A;  1OSA A;  3EKH A;  4MLW A;  1Y1U A;  4YGC B;  2MBX A;  4A4B A;  3TUY C;  1SL8 A;  1AP4 A;  1MHO A;  1CFP A;  2Y5I A;  1W7I B;  1E8A A;  2LMV A;  1K9K A;  1F71 A;  2PVB A;  2LNK A;  2KFF A;  3DVE A;  1FW4 A;  1KK7 Y;  4Q04 A;  5ER4 X;  3TDZ A;  2OS8 C;  3TS5 C;  1DGU A;  1CLL A;  1NPQ A;  1PSR A;  2M49 B;  1JF0 A;  4ORC B;  4AQJ A;  2Y1M A;  2FCD A;  1NCY A;  4MZK A;  3JTD B;  4USL A;  3PLF B;  1CFF A;  5AXI A;  2L50 A;  1A75 B;  5ER5 A;  1GQM A;  4L9M A;  2WOR A;  2B1U A;  3TUY B;  2Y4Q A;  5CSI A;  2GGZ A;  3SG4 A;  2K8M B;  3EKJ A;  4OCI A;  5KTY A;  1SL9 A;  3JVT C;  1D1O A;  3KF9 A;  2F8P A;  5GQQ C;  2JNF A;  3TS5 B;  2HPS A;  2PRU A;  4ETO A;  1J7P A;  2PAL A;  1SY9 A;  2Y1N A;  1KSM A;  3CR2 A;  1R6P A;  1UWO A;  2H61 C;  4WQ2 A;  2KDH A;  1YVL A;  3GK2 A;  2BL0 C;  3C1V A;  1LXF C;  4OKH A;  4DUQ A;  1CM1 A;  2HQ8 A;  4C0K A;  3O2P A;  4NDC A;  1SYM A;  3BUO B;  3PFV A;  2BCB A;  4OV2 A;  2JTT A;  2L2E A;  1NIW A;  1UHI A;  1VRK A;  1YX7 A;  1M45 A;  1BU3 A;  3DF0 A;  2LVK A;  1WDC C;  1L2O C;  1QLK A;  1FF1 A;  4N1G A;  4PE7 A;  3SG2 A;  2CBL A;  4E68 A;  4CID A;  1RK9 A;  4GPL B;  1XVJ A;  2BL0 B;  1UHK A;  1S6I A;  5AER A;  2DOQ A;  2M7N A;  1F8H A;  1B1G A;  1A4P A;  3D0Y A;  3LL8 B;  3ZNI A;  2SCP A;  3BXK A;  4OVN F;  1RWY A;  4YI9 A;  1CB1 A;  4C0J A;  3MSE B;  2K2F A;  1YX8 A;  2JNX A;  1JF2 A;  1WDC B;  3QRX A;  1L7Z A;  2NLN A;  4PAL A;  1JWD A;  3RM1 A;  3BQ3 A;  1MWN A;  1NYA A;  2JPT A;  3PAT A;  2LE9 B;  2M29 A;  1IRJ A;  1J55 A;  1IQ3 A;  2BEC A;  3EVU A;  3TDU A;  3OP0 A;  4M2O A;  4AQI A;  5I2O A;  1XFZ O;  1TTX A;  1IJ6 A;  3DVK A;  1UHH A;  1LA0 A;  3TZ1 A;  2MJW B;  5AEQ A;  1M63 B;  1QX2 A;  2QPT A;  1H4B A;  1PAL A;  4GGF A;  1DGV A;  1OMV A;  4P2Y B;  2CT9 A;  1TRF A;  4UPG A;  2LAN A;  1UUS A;  2JTZ A;  1QJT A;  3NSI A;  1CDP A;  4MEW A;  2K2A A;  4BY4 A;  1F70 A;  4MSP A;  1K8U A;  1K95 A;  3LK0 A;  2LVI A;  3I5F B;  2KYF A;  2F2P A;  1KFX S;  3I5I C;  3BOW A;  5I8N A;  2KSP A;  2M9G A;  4GAO A;  5DKN A;  1QXP A;  1KFU S;  1KCY A;  1ZAC A;  2LUX A;  2KI6 C;  1MXL C;  2M0R A;  2LC5 A;  3PM8 A;  1WLZ A;  4XYN A;  3LK1 A;  2WOS A;  4ORA B;  2LP2 A;  1R2U A;  1JSA A;  2H2K A;  1J1D A;  2HET A;  4MN0 A;  1JFK A;  1FPW A;  1CTR A;  1SR6 B;  2GV5 A;  4QJ4 B;  3I5I B;  1S6J A;  1EH2 A;  1B47 A;  1M46 A;  3SG7 A;  1SPY A;  1IJ5 A;  2ZND A;  4M2Q A;  1G4Y R;  3EK8 A;  1YRU B;  2EC6 B;  1DJX A;  1REC A;  2WC8 A;  2EGD A;  2JU0 A;  3BOW B;  1NUB A;  2OPO A;  3CLN A;  4JQ0 D;  3JTD C;  1B7T Z;  1KQM B;  5D69 A;  1BOC A;  1NCX A;  1F54 A;  2KBM A;  1DF0 A;  1K96 A;  1AK8 A;  4MZL A;  1FBV A;  4GGN A;  1DT7 B;  3SG3 A;  1FI6 A;  1DJZ A;  1IWQ A;  1LKJ A;  4WQ3 A;  1K9U A;  1XO5 A;  3VGO A;  1QLS A;  2I18 A;  5KU1 A;  2PMY A;  1XFW O;  2HQW A;  4IL1 A;  1EG4 A;  1LA3 A;  1N65 A;  1S5G Z;  2NXQ A;  2JZI A;  2CTN A;  1UHJ A;  1J7R A;  3CZT X;  2L98 A;  3TDI A;  1OE9 B;  4MBE A;  5FYX A;  1CFD A;  1CMG A;  2KOT A;  1U5I A;  2LAP A;  2MHH A;  1YTZ C;  1BOD A;  1BF5 A;  1OZS A;  2LMT A;  1K9P A;  4C0L A;  1RRO A;  2LP3 A;  2D8N A;  2M3W A;  5CPV A;  1RTP 1;  1BG1 A;  1CNP A;  2TN4 A;  1IG5 A;  2M1K B;  4CLN A;  1B8L A;  1J1E A;  1EJ3 A;  3O4Y A;  4CFQ A;  1A03 A;  1EL4 A;  2AAO A;  1JBA A;  1PVA A;  2LLS A;  1QTX A;  2ZNE A;  1AVS A;  3FWC A;  3K21 A;  1UUR A;  1KQV A;  2JWW A;  1DMO A;  1KK8 B;  1KK7 Z;  2JOJ A;  1TNW A;  2CNP A;  2EHB A;  1U5I B;  4P5O E;  2FJU B;  1V1G A;  1MF8 B;  1YUS A;  1DJH A;  1S6C A;  1WRK A;  1LIN A;  1B8C A;  1BR4 B;  2BE4 A;  3WHT B;  1QX7 A;  3PAL A;  1XFU O;  2BBM A;  4HSZ A;  1NX0 A;  5IBW A;  1BT6 A;  3VRO A;  1SCM C;  3CGA A;  2R2I A;  3SIB A;  5JJG A;  3VRP A;  1TNX A;  1AJ5 A;  4WRI A;  1CMF A;  2LM5 A;  2MLF C;  2LCP A;  1GJY A;  1ZUZ A;  1NSH A;  2KGR A;  1YR5 A;  2VRG A;  1K2H A;  3I5G B;  2K7O A;  5HLO A;  4I5N B;  2K0J A;  1S26 D;  3I5F C;  3DF0 B;  3FS7 A;  2BBN A;  1OMD A;  2F3Z A;  2ISD A;  3WXA A;  1DVI A;  1CLB A;  1SCM B;  1XK4 A;  1F4Q A;  3WNX B;  1PUL A;  1DJI A;  3AKB A;  3NXA A;  1XA5 A;  1B8R A;  4FTG A;  1S3P A;  2BCA A;  1CFC A;  4ZCV A;  4D1E A;  1Y1A A;  3D0Y B;  3AKA A;  2G2B A;  3A8R A;  1WY9 A;  1XYD A;  5HLV A;  4ORB B;  2WCF A;  4GGF C;  1SR6 C;  2L4H A;  2OTG B;  3PSR A;  1BLQ A;  1GGW A;  2K61 A;  2FOT A;  1X02 A;  1DJY A;  1KFX L;  1B4C A;  4GFT A;  3PN7 B;  4I5J A;  4QJ3 B;  1KFU L;  3SG5 A;  5BPJ A;  1QIV A;  2L5X B;  4GBA A;  2BE6 A;  2RGI A;  2EC6 C;  1DJW A;  1IH0 A;  1IQ5 A;  1XFV O;  4DIR A;  2ZRT A;  2ZN8 A;  1HQV A;  3EVR A;  3M0W A;  2KQY A;  4AOM A;  3F45 A;  1KQM C;  2IS9 A;  2LMU A;  2ZFD A;  2KAV A;  2KFG A;  5HYD A;  1EXR A;  2AMI A;  2QAC A;  5K89 A;  1K94 A;  3OB1 B;  4PHK A;  3EVV A;  3NSL A;  3ZWH A;  2AUC A;  5PAL A;  1DTL A;  1NCZ A;  1IKU A;  1ALW A;  1A2X A;  1SMG A;  1GGZ A;  1SKT A;  2I94 A;  1K90 D;  2JQ6 A;  2ZN9 A;  1RFJ A;  1M31 A;  4CFR A;  5AFP A;  2F2O A;  1MQ1 A;  5AAN A;  3I5H C;  3VRQ A;  3DVJ A;  1KWO B;  4I5K A;  1MUX A;  1A29 A;  1ZFS A;  1WRZ A;  2O5G A;  1ALV A;  1TNQ A;  2LLT A;  2V53 A;  2L51 A;  4PHJ A;  4PCW A;  4CPV A;  1SBJ A;  2NCP A;  4NDB A;  1QS7 A;  1TCO B;  4ZCU A;  3CWG A;  1JUO A;  2MAZ A;  2KI4 C;  4PE4 A;  3E3R A;  1F4O A;  5G08 A;  5J3X A;  3FWB A;  4ICB A;  3I5H B;  2KFH A;  3CR5 X;  4PHN A;  4YGE B;  2JXL A;  1QAS A;  2L4I A;  3BYA A;  3VRN A;  1OQP A;  1S36 A;  2WCB A;  2KQ6 A;  1PVB A;  2CCM A;  1N0Y A;  2PAS A;  1SK6 D;  2A4J A;  1BJF A;  1XFY O;  4A4C A;  2NZ0 A;  2L0P A;  3IQO A;  1NP8 A;  1KK8 C;  1PK0 D;  2HF5 A;  2KI4 B;  1SCV A;  1TIZ A;  1DF0 B;  1Y6W A;  5DKQ A;  2LHI A;  1G8I A;  1AUI B;  1OMR A;  1YUR A;  4TNC A;  5B8I B;  3O6B A;  1YUU A;  1G33 A;  3OB2 B;  2Q4U A;  4HRE E;  4JPZ B;  1NX3 A;  4BY5 A;  1TN4 A;  1KSO A;  4N1F A;  3HCM A;  2H61 A;  2M97 A;  3SIA A;  2SAS A;  2JRF A;  3AAJ A;  1B9A A;  1Q80 A;  3ICB A;  4QJ5 B;  1QVI Y;  3GK4 X;  4PE1 A;  2E30 A;  1N2D A;  2OS8 B;  3I5G C;  2LHL A;  1MXE A;  2F3Y A;  2KYC A;  1TCF A;  1ZOT B;  4MRY A;  4U8D A;  1OZO A;  4HRH A;  1AJ4 A;  1K93 D;  1RJV A;  4F0Z B;  2F33 A;  4M2P A;  4GNK B;  2PSR A;  4MZJ A;  3FIA A;  1SRA A;  1WLM A;  4MVF A;  2MRD A;  3OX6 A;  1Y1X A;  1YVH A;  4PDZ A;  5F6T A;  2ZKM X;  5CSN A;  3KHE A;  1BR1 B;  3H4S E;  3JVT B;  1CDN A;  4GUK A;  1QX5 B;  2GGM A;  4YI8 A;  1H8B A;  1WRL A;  1M39 A;  3D10 A;  3KO0 A;  4NQG A;  2K7C A;  2MLE C;  4YGD B;  1LVC D;  2OTG C;  2G9B A;  4PE0 A;  4YGA A;  1ZMZ A;  4XJK A;  3IQQ A;  4DS7 A;  3BUW B;  3PN7 C;  3BUN B;  2LUC A;  2KAY A;  2WCE A;  1DJG A;  3CTN A;  3CS1 A;  1EG3 A;  1Y0V H;  4MRX A;  4YGB B;  1CKK A;  3O78 A;  3BUM B;  2KNE A;  1QVI Z;  1L2O B;  5DKR A;  1XK4 C;  5HKZ A;  4DCK A;  2M1U A;  3IF7 A;  1SNL A;  1BMO A;  2JT8 A;  5CSF A;  4YBH B;  1HT9 A;  1SW8 A;  1IGV A;  1FI5 A;  1V1F A;  1W7J B;  1CLM A;  2NCO A;  2JT0 A;  1J7Q A;  1QV1 A;  1F55 A;  2E6W A;  2M8U A;  4HRG A;  1UHN A;  5HKW A;  3GK1 A;  4JWQ A;  3KPX A;  1KWO C;  5I2Q A;  2KHN A;  1S1E A;  4XJK B;  3RLZ A;  3DD4 A;  2JT3 A;  3GOF A;  2I2R E;  3SJS A;  5CSJ A;  3A4U B;  1B7T Y;  2JXC A;  2LLU A;  3LCP C;  4I5L B;  5I2L A;  1SL7 A;  2JC2 A;  3OHM B;  5D7F A;  3SG6 A;  5TNC A;  2LV7 A;  4N5X A;  2CXJ A;  5HKY A;  2FCE A;  3KEV A;  1CM4 A;  1NWD A;  1NX1 A;  5JOL A;  2M7L A;  1AHR A;  2KGB C;  2COL B;  2I7A A;  3OX5 A;  3CR4 X;  1YUT A;  2JUL A;  2LVV A;  3NSO A;  4DRW A;  2LVJ A;  4FQO A;  1C7W A;  1NX2 A;  1S5G Y;  4NDD A;  1C07 A;  3HX4 A;  1TOP A;  3EK7 A;  2BKH B;  1QIW A;  4OR9 B;  2WND A;  4R1E A;  2KI6 D;  4PHM A;  1ODB A;  1OOJ A;  3NSK A;  2K7B A;  3VRR A;  1QV0 A;  3BUX B;  4YRU A;  3LLE A;  2KAX A;  1MR8 A;  1TNP A;  1C7V A;  1PRW A;  1PSB A;  1YRT B;  3EK4 A;  2BCX A;  1A75 A;  2P6B B;  2BKI B;  1J7O A;  1JFJ A;  1UP5 A;  2O60 A;  1XFX O;  2Q91 A;  2KBI A;  2ZRS A;  1QAT A;  1JC2 A;  5KSZ A;  1CDM A;  2MA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...