1QV0A

Atomic resolution structure of obelin from obelia longissima
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
189
structure length
185
Chain Sequence
b'VKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNAGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Atomic resolution structure of obelin: soaking with calcium enhances electron density of the second oxygen atom substituted at the C2-position of coelenterazine.
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 77
structure length 185
sequence length 189
ec nomenclature ec 1.13.12.5: Renilla-type luciferase.
pdb deposition date 2003-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qv0A00
4FQOA 2LAPA 4ETOA 3HCMA 2CT9A 2K7DA 5I2OA 1GGZA 5HYDA 3NSOA 1YRUB 1AP4A 2NXQA 3CS1A 1R6PA 4I5JA 1WRZA 2KAVA 2KDHA 2QPTA 5JOLA 4D1EA 1K95A 1F4OA 3JVTB 1EG4A 1DJWA 1BR4B 4L9MA 2ZNEA 2H2KA 2ZKMX 2TN4A 4ZCUA 4CPVA 2E30A 1QIVA 4YGAA 2LLSA 3WNXB 3FIAA 1DJIA 1B47A 1Q80A 2PASA 5KSZA 2BL0C 4NDDA 4C0JA 5HKYA 2LANA 3CZTX 5BPJA 1M63B 1BU3A 1UP5A 4CFRA 3EVUA 1J7PA 5DKRA 1IG5A 2DOQA 2P6BB 1MF8B 2BE6A 2I2RE 1LXFC 2Y1MA 1CMGA 1F54A 1LVCD 4PHMA 2K8MB 1A4PA 4M2PA 2PALA 5ER4X 3NXAA 3O4YA 1KK7Z 1GQMA 2H61C 1ZACA 2LM5A 1F8HA 4TNCA 4HRHA 4NQGA 1B9AA 4N5XA 1QLKA 3PATA 1ALWA 5GQQC 1KQMB 1N0YA 1AJ5A 2CNPA 2KI6D 2KFFA 5D7FA 4ZCVA 1YUUA 1RWYA 1XFYO 1K9KA 1GJYA 4DCKA 4OCIA 3CTNA 2M97A 3LL8B 1S5GZ 1CLLA 1OMRA 2KQYA 4GPLB 4AQIA 5CPVA 5J3XA 1K93D 1QV1A 2JNFA 1CLMA 2HF5A 1FW4A 1NIWA 3DF0A 1FBVA 1K9UA 3AKBA 2WNDA 2I94A 4HREE 1BG1A 4QJ5B 4MSPA 2AUCA 3TUYB 4F0ZB 2QACA 1CFPA 1NCXA 3C1VA 1XFWO 5KTYA 1MWNA 3A8RA 5DKNA 1SPYA 1TRFA 2M9GA 1AK8A 1HT9A 1SKTA 3TDIA 4AOMA 1TNXA 1YR5A 1OE9B 1TN4A 1MR8A 3AAKA 2K2FA 2L0PA 1S6JA 2F3ZA 5I8NA 1B8CA 2JULA 4A4CA 1EG3A 2L50A 1MXLC 1OMVA 1OQPA 3I5IB 4DRWA 4PE1A 1AUIB 1KCYA 1XFXO 2EC6B 1DF0A 1NP8A 3JVTC 4P2YB 1XVJA 2LCPA 1IWQA 1B7TY 1SR6B 3BXKA 1BLQA 3BUOB 1A03A 1BF5A 1EL4A 1SCMB 2SASA 1JF0A 2KHNA 1PK0D 2R2IA 1G8IA 1QS7A 1J7QA 3CR2A 1YURA 5PALA 1H4BA 4YGBB 1F4QA 1AJ4A 2NLNA 2M7LA 2F8PA 2JU0A 3CR4X 5CSIA 3VRNA 2MLFC 1RK9A 4JPZB 1QVIY 3PLFB 2EHBA 4MZLA 1XYDA 1M46A 3DVJA 1UHJA 1LA3A 3FWBA 3BUNB 3IQQA 3EVRA 2CXJA 2LC5A 1CDPA 2BCAA 3RM1A 1DF0B 1IJ6A 1DJZA 3DD4A 3PSRA 2LMUA 1FPWA 1CDLA 4GBAA 3IQOA 4GAOA 1DGUA 2M49B 3EVVA 1TNQA 1Y0VH 1UHHA 2E6WA 3TS5B 1DTLA 1KQMC 3JTDB 3DVMA 2KQ6A 1TCFA 4A4BA 3DVKA 5AEQA 3ZWHA 2PMYA 3BUWB 1L7ZA 1B8RA 1MXEA 3E3RA 1TOPA 1K96A 1KWOC 1E8AA 2V53A 2KAXA 2LLUA 2LHIA 1PRWA 1K8UA 4OVNF 4YI8A 4MRXA 4QJ3B 3TUYC 1QATA 4IL1A 1W7JB 2B1UA 4PE4A 3SIBA 2LP3A 4GGFA 1JFKA 3VRQA 4FTGA 1J1DA 4MEWA 3SG3A 5AFPA 1CFDA 2VRGA 1QX2A 2KYCA 3F45A 3I5IC 1TIZA 4AQJA 2ZRTA 2L4HA 2LVVA 1H8BA 2NCPA 1GGWA 1G4YR 3SJSA 1QXPA 3WHUB 2EC6C 3CLNA 4PDZA 4XJKA 1JWDA 1PSBA 1IGVA 2JT0A 1XK4A 1SR6C 1J7OA 4ICBA 3K21A 5IBWA 1SCMC 1PALA 1OSAA 1OMDA 2LMVA 4DUQA 5JJGA 1NCYA 2F33A 4PCWA 2NZ0A 1C7VA 1ZUZA 4Q04A 1JC2A 2G2BA 2L51A 2F2PA 1YUSA 2O5GA 1B8LA 1WDCB 2Y4QA 3PM8A 4ORBB 1JF2A 3NSLA 2BKHB 1F70A 2JT3A 1TTXA 3PALA 2KSPA 4P5OE 1SCVA 3GOFA 1IH0A 3EK7A 2O60A 3EK4A 4JQ0D 2K2AA 4XJKB 1AVSA 1WLMA 2OS8B 2L5XB 2ZNDA 1D1OA 4OV2A 2JPTA 1KWOB 3CGAA 3CR5X 2MHHA 4M2QA 4MZKA 2BBMA 2KOTA 2KFGA 4GGNA 1BOCA 1ALVA 1YUTA 2NCOA 2PRUA 5DKQA 3TS5C 2ZN8A 3JTDC 3RLZA 3KHEA 1SYMA 2L4IA 1XFVO 2WCBA 4USLA 1FI5A 2KI4B 4UPGA 1A2XA 1DJXA 1M45A 2RGIA 2M0RA 1ZFSA 2COLB 4E68A 3PN7B 1RTP1 4YGDB 3QRXA 1ODBA 2LP2A 2SCPA 3HX4A 4YGCB 4BY5A 1LKJA 1S6IA 1CFCA 2ZN9A 1W7IB 3BOWA 2HQ8A 1OZOA 1EXRA 5KU1A 3O78A 1C07A 2LMTA 3DF0B 4HRGA 1RFJA 4U8DA 1CM4A 1VRKA 1K2HA 3BUXB 1KFXS 4MZJA 2LLTA 3GK1A 3BQ3A 1PULA 5D69A 3LCPC 1L2OB 3KO0A 4GUKA 3VRPA 1WY9A 3I5HB 3TZ1A 4N1GA 1LINA 1UHKA 2MJWB 3SG7A 3NSIA 4XYNA 2KYFA 1JSAA 1EJ3A 3EKJA 2EGDA 1NX3A 5I2QA 1B7TZ 2JNXA 2LVIA 2BECA 3VROA 3FWCA 4DS7A 3OB2B 3BOWB 1UUSA 1U5IA 3SG2A 2KBMA 3I5FB 4I5KA 1C7WA 3ZNIA 2BBNA 1V1GA 2HETA 5K89A 1KFUS 2JWWA 2AMIA 2JTTA 5ER5A 2KNEA 4GGFC 1NUBA 1YRTB 1WDCC 2Y5IA 2KBIA 1QX7A 1QVIZ 1S36A 1SL8A 2ISDA 1SRAA 3EK8A 3LLEA 5HLVA 1TNPA 5FYXA 1NX0A 1DJYA 1YVLA 2LUCA 5HKWA 4BY4A 2BCBA 2OS8C 1J7RA 2JRFA 2MAZA 1M31A 2MBXA 1XK4C 1A75A 4I5NB 3DVEA 4JWQA 1RJVA 4YRUA 5B8IB 1CLBA 2LVKA 5AANA 1LA0A 2L98A 3ICBA 2CCMA 2LNKA 4MN0A 1Y1XA 2JXLA 1UHNA 2LUXA 4CFQA 4NDCA 1IKUA 2KI4C 3VGOA 2JTZA 1OZSA 3I5GB 3IF7A 3KEVA 1B1GA 3GK4X 4PHJA 3PN7C 1MQ1A 1JBAA 1Y1AA 1V1FA 2I18A 3OHMB 4YI9A 3GK2A 4MLWA 1CB1A 1QLSA 1DJGA 3D0YA 1K9PA 3KPXA 1QIWA 1TCOB 1A75B 1CNPA 1CTRA 1KK8B 1NX1A 2CBLA 2ZFDA 4WQ2A 1YVHA 5HKZA 1CKKA 3D10A 2FCDA 5CSJA 1UWOA 4C0KA 1F71A 2FJUB 3O6BA 5CSFA 1L2OC 4MBEA 1J1EA 1YTZC 2JT8A 1KK7Y 3I5HC 4PE0A 1TNWA 1A29A 1ZOTB 2L2EA 1BJFA 3A4UB 3FS7A 1SBJA 1SW8A 3LK1A 1SL9A 1QX5B 1KSOA 1XA5A 2WOSA 2OPOA 2Y1NA 3AAJA 2F3YA 3OX5A 5AERA 3WXAA 1G33A 1N65A 1S26D 1DGVA 1R2UA 5F6TA 3SG4A 2M8UA 1S5GY 3D0YB 3I5FC 1KQVA 1DVIA 1NX2A 1QV0A 2KAYA 2OTGB 2LE9B 3OP0A 1CDMA 4GFTA 2Q91A 1J55A 1PSRA 2LVJA 5I2LA 1ZMZA 1QTXA 4PHNA 4QJ4B 1UURA 1KFXL 4WRIA 4DIRA 1SL7A 1S1EA 4GNKB 1NPQA 1SNLA 1HQVA 2IS9A 4OKHA 4MRYA 1RROA 3SIAA 4MVFA 3O2PA 2WC8A 1DMOA 1NWDA 1SMGA 3CWGA 1CFFA 2AAOA 4M2OA 3TDZA 1JFJA 2HQWA 1BR1B 2G9BA 2M3WA 1QASA 1BMOA 1N2DA 3LK0A 2GGMA 2K7CA 1K94A 1NSHA 1FF1A 3VRRA 3SG5A 2GGZA 1IRJA 1KFUL 1WRKA 1B4CA 5CSNA 2H61A 1EH2A 1XFZO 1NYAA 2KFHA 1IJ5A 2I7AA 3I5GC 2A4JA 2K0JA 5TNCA 1IQ5A 2M1UA 1WLZA 2BL0B 1CM1A 2FOTA 2M7NA 3EKHA 4R1EA 1Y1UA 2KGRA 2MLEC 4ORCB 3AKAA 2FCEA 2WORA 1Y6WA 2JZIA 4WQ3A 1S3PA 1RECA 1YX8A 1XO5A 2F2OA 1XFUO 4OR9B 1KSMA 1KK8C 4C0LA 2BE4A 1FI6A 2PSRA 1OOJA 2WCFA 1DT7B 1F55A 2BKIB 1NCZA 2CTNA 1BT6A 2K7BA 2M29A 4PALA 4CLNA 1CMFA 2JOJA 2M1KB 2MRDA 1AHRA 3SG6A 3WHTB 1QJTA 2K61A 2BCXA 2LV7A 4I5LB 1DJHA 1SY9A 2HPSA 4PE7A 3MSEB 4NDBA 1PVBA 1JUOA 4YBHB 2ZRSA 2WCEA 3BYAA 2LHLA 3M0WA 1K90D 5AXIA 1WRLA 1M39A 3PFVA 3TDUA 4CIDA 2K7OA 2GV5A 2PVBA 2Q4UA 3H4SE 1UHIA 4ORAB 2OTGC 1BODA 2JC2A 1MHOA 1SK6D 2JQ6A 2KI6C 1YX7A 2MA2A 4HSZA 5G08A 1U5IB 4PHKA 1IQ3A 3BUMB 1PVAA 1CDNA 3NSKA 1S6CA 5HLOA 1X02A 2D8NA 2KGBC 4N1FA 4YGEB 1MUXA 3KF9A 3OX6A 3OB1B 2JXCA
chains in the Genus database with same CATH superfamily
4FQOA 2LAPA 4ETOA 3HCMA 2CT9A 2K7DA 5I2OA 2WC5A 1GGZA 5HYDA 3NSOA 1DQEA 1YRUB 5FI7A 1AP4A 2NXQA 1SSEB 3CS1A 1R6PA 4I5JA 5EL2A 1WRZA 2KAVA 2KDHA 2QPTA 5JOLA 4D1EA 1K95A 1F4OA 3JVTB 1EG4A 1DJWA 1BR4B 4L9MA 2ZNEA 2H2KA 2ZKMX 2TN4A 3D78A 4ZCUA 4CPVA 2E30A 1QIVA 4YGAA 2LLSA 3WNXB 3FIAA 3OBVA 1DJIA 1B47A 1ORGA 1Q80A 2PASA 2QEVA 2BL0C 5KSZA 3SS5A 2PYQA 4NDDA 4C0JA 5HKYA 2LANA 3D77A 5D3OA 3CZTX 5BPJA 1M63B 1BU3A 1UP5A 4CFRA 3D74A 3EVUA 1J7PA 4FQTA 5FI2A 5DKRA 1IG5A 2DOQA 2P6BB 3D75A 1MF8B 2BE6A 2I2RE 1LXFC 2Y1MA 1CMGA 1F54A 1LVCD 4PHMA 2K8MB 1OW4A 3S0DA 1A4PA 4M2PA 2PALA 5ER4X 3PM2A 3CZ2A 3NXAA 3O4YA 1KK7Z 1GQMA 2H61C 1TUJA 1ZACA 1TUZA 2LM5A 1F8HA 4TNCA 4HRHA 4NQGA 1B9AA 4N5XA 1QLKA 3PATA 1ALWA 5GQQC 1KQMB 1N0YA 1AJ5A 2CNPA 2KI6D 2KFFA 5D7FA 4ZCVA 1YUUA 1RWYA 1XFYO 1K9KA 1GJYA 4DCKA 4OCIA 3CTNA 2M97A 3LL8B 1S5GZ 1CLLA 1OMRA 2KQYA 4GPLB 2PQLA 4AQIA 5CPVA 5J3XA 1K93D 1QV1A 2JNFA 1CLMA 2HF5A 4JD9A 1FW4A 1NIWA 3DF0A 1FBVA 1K9UA 3AKBA 2WNDA 2I94A 4HREE 1BG1A 4JKTA 4QJ5B 4MSPA 2AUCA 3TUYB 4F0ZB 2QACA 1CFPA 1NCXA 3C1VA 1Z2CB 1XFWO 3DXLA 1MWNA 2L5YA 3A8RA 5DKNA 5KTYA 1SPYA 1TRFA 2M9GA 5DICA 1AK8A 1HT9A 1SKTA 3TDIA 4AOMA 1TNXA 3BFHA 1YR5A 1OE9B 1TN4A 1MR8A 3AAKA 4IJ7A 2K2FA 2L0PA 1S6JA 2F3ZA 2P71A 5I8NA 1B8CA 3CDNA 2BAPA 2JULA 4A4CA 1EG3A 2L50A 1MXLC 1OMVA 3B88A 1OQPA 3I5IB 4DRWA 4PE1A 1AUIB 3B7AA 1KCYA 1XFXO 1XFRA 2EC6B 3R72A 4INWA 1DF0A 1NP8A 3JVTC 4P2YB 1XVJA 2LCPA 1IWQA 1B7TY 1SR6B 3BXKA 1BLQA 3BUOB 1A03A 1BF5A 1EL4A 1SCMB 2SASA 1JF0A 2ERBA 2KHNA 1PK0D 2R2IA 1G8IA 1QS7A 1J7QA 3CR2A 1YURA 5PALA 1H4BA 4YGBB 1F4QA 2KLEA 1AJ4A 3FE6A 2NLNA 2M7LA 2F8PA 2JU0A 2KPHA 3CR4X 4INXA 5CSIA 3VRNA 2MLFC 1RK9A 4JPZB 1QVIY 3PLFB 2EHBA 4MZLA 1XYDA 1DELA 1M46A 2BNXA 3DVJA 1UHJA 1LA3A 3FWBA 3BUNB 3IQQA 3EVRA 2CXJA 2LC5A 1CDPA 2BCAA 3RM1A 1DF0B 1IJ6A 3SS4A 1DJZA 2WCJA 3DD4A 3PSRA 2LMUA 1FPWA 1CDLA 4GBAA 3IQOA 4GAOA 1DGUA 2M49B 3EVVA 1TNQA 1Y0VH 1UHHA 2E6WA 3TS5B 1DTLA 1KQMC 3JTDB 3DVMA 3O4XA 2KQ6A 1TCFA 2QEHA 4A4BA 3DVKA 3DZTA 5AEQA 3ZWHA 2PMYA 3BUWB 1L7ZA 1B8RA 1MXEA 3E3RA 2L2CA 1TOPA 5G08A 1K96A 1KWOC 1E8AA 2V53A 2KAXA 2LLUA 3VB1A 2LHIA 1PRWA 1K8UA 4OVNF 4YI8A 4MRXA 4QJ3B 3TUYC 2QDIA 1QATA 4IL1A 1W7JB 1GM0A 2B1UA 4PE4A 3SIBA 1C3ZA 2LP3A 4GGFA 1JFKA 3VRQA 4FTGA 1J1DA 3PJIA 4MEWA 3SG3A 5AFPA 1CFDA 2VRGA 1QX2A 2KYCA 3R1VA 3F45A 3I5IC 1TIZA 4AQJA 2ZRTA 2L4HA 2LVVA 1H8BA 2NCPA 1GGWA 1G4YR 3SJSA 1QXPA 3WHUB 2EC6C 3CLNA 4PDZA 4XJKA 5HL1A 1JWDA 1PSBA 3L4AA 2WCMA 1IGVA 2JT0A 1XK4A 1SR6C 1J7OA 4ICBA 3K21A 5IBWA 1SCMC 1PALA 1OSAA 1OMDA 2LMVA 4DUQA 5JJGA 1NCYA 2F33A 4PCWA 2NZ0A 1C7VA 1ZUZA 4Q04A 1JC2A 2G2BA 2L51A 3D73A 2F2PA 1YUSA 3OGNA 3FE8A 2O5GA 1B8LA 1WDCB 2Y4QA 3PM8A 4ORBB 1JF2A 3NSLA 2BKHB 1F70A 2JT3A 1TTXA 3PALA 2KSPA 4P5OE 1DC1A 2K60A 1SCVA 3GOFA 1IH0A 3EK7A 2O60A 3EK4A 4JQ0D 2KLDA 2K2AA 4XJKB 1AVSA 1WLMA 2OS8B 2L5XB 2ZNDA 1D1OA 4OV2A 2JPTA 3BJHA 1KWOB 3CGAA 3CR5X 2MHHA 4M2QA 4MZKA 2BBMA 2KOTA 2KFGA 4GGNA 1BOCA 1ALVA 1YUTA 2NCOA 2PRUA 5DKQA 3TS5C 2ZN8A 3JTDC 3RLZA 3KHEA 1SYMA 1T14A 2L4IA 1XFVO 2WCBA 4USLA 1FI5A 1W9ZA 2KI4B 4UPGA 1A2XA 1DJXA 1M45A 2RGIA 2M0RA 1ZFSA 2COLB 4E68A 2QEBA 3PN7B 1RTP1 4YGDB 3QRXA 1ODBA 2LP2A 2SCPA 3HX4A 4YGCB 4BY5A 1LKJA 1S6IA 1CFCA 2ZN9A 1W7IB 3BOWA 2HQ8A 1OZOA 1EXRA 5FI6A 5KU1A 3O78A 1C07A 3S0GA 2LMTA 3DF0B 4HRGA 1C3YA 1RFJA 4U8DA 4F7FA 1CM4A 1VRKA 1K2HA 3BUXB 1KFXS 4MZJA 2LLTA 3GK1A 3BQ3A 1PULA 5D69A 3B6XA 3LCPC 1L2OB 3KO0A 4GUKA 3VRPA 1WY9A 3I5HB 3TZ1A 4N1GA 1LINA 1UHKA 2MJWB 3D76A 3NSIA 4XYNA 3SG7A 2KYFA 1JSAA 3CZ1A 1EJ3A 3EKJA 2EGDA 1NX3A 3R1OA 3IVTA 5I2QA 1QWVA 1B7TZ 2JNXA 2LVIA 2BECA 3VROA 3FWCA 4DS7A 3OB2B 3BOWB 1UUSA 1U5IA 3SG2A 2KBMA 3I5FB 4I5KA 1C7WA 3ZNIA 2BBNA 1V1GA 2HETA 5K89A 1KFUS 2JWWA 2JPOA 2AMIA 2JTTA 5ER5A 2KNEA 4GGFC 1NUBA 1YRTB 2GTEA 1WDCC 2P70A 2Y5IA 2KBIA 1QX7A 3CABA 3Q8IA 1QVIZ 1S36A 3NHTA 1SL8A 2ISDA 1SRAA 3EK8A 3LLEA 5HLVA 1TNPA 5FYXA 1NX0A 3L4LA 1DJYA 1YVLA 3QMEA 2LUCA 5HKWA 4BY4A 2BCBA 2OS8C 1J7RA 2JRFA 2MAZA 1M31A 2WCHA 1XK4C 2MBXA 1A75A 1OOHA 4I5NB 3DVEA 4JWQA 1RJVA 1TWOA 4YRUA 5B8IB 1CLBA 2LVKA 3EG5B 5AANA 1LA0A 2L98A 3ICBA 2CCMA 2H8VA 2LNKA 1Y1XA 4MN0A 2JXLA 1UHNA 2LUXA 4CFQA 4NDCA 1IKUA 2KI4C 3VGOA 2JTZA 1OZSA 3I5GB 2YGUA 3UO9A 3IF7A 3KEVA 1B1GA 3GK4X 4PHJA 3PN7C 1MQ1A 1JBAA 1Y1AA 1V1FA 2I18A 3OHMB 4YI9A 3GK2A 4MLWA 1CB1A 1QLSA 1DJGA 3D0YA 1K9PA 3KPXA 1QIWA 1TCOB 1A75B 1CNPA 1CTRA 1KK8B 1NX1A 2CBLA 2ZFDA 4WQ2A 1YVHA 3R1PA 5HKZA 1CKKA 3D10A 2FCDA 5CSJA 1UWOA 4C0KA 1F71A 2FJUB 3O6BA 5CSFA 1L2OC 4MBEA 1J1EA 2WCKA 1YTZC 2JT8A 1KK7Y 3I5HC 4PE0A 1TNWA 1A29A 1ZOTB 2L2EA 1BJFA 3A4UB 3FS7A 1IIOA 1SBJA 1P28A 1SW8A 3LK1A 1SL9A 1QX5B 1KSOA 1XA5A 2WOSA 2OPOA 2Y1NA 3AAJA 2F3YA 3OX5A 5AERA 3WXAA 1G33A 1N65A 1S26D 1DGVA 1R2UA 5F6TA 3SG4A 2M8UA 1S5GY 3D0YB 3DY9A 3I5FC 1KQVA 1DVIA 1NX2A 1QV0A 2KAYA 2OTGB 2LE9B 3OP0A 1CDMA 4GFTA 3B87A 2Q91A 1J55A 1PSRA 2LVJA 5I2LA 1OOIX 1ZMZA 1QTXA 3B86A 4PHNA 1UURA 1KFXL 4WRIA 4DIRA 4QJ4B 3CZ0A 1SL7A 1S1EA 4GNKB 1NPQA 1SNLA 5I94A 1HQVA 2IS9A 4OKHA 4MRYA 1RROA 3SIAA 4MVFA 3O2PA 2WC8A 1DMOA 1NWDA 1SMGA 3CWGA 3S0FA 1CFFA 2AAOA 4M2OA 3NHIA 3TDZA 1JFJA 2HQWA 1BR1B 2G9BA 2M3WA 1QASA 1BMOA 1N2DA 3LK0A 2GGMA 2K7CA 1Z4HA 1K94A 1NSHA 3NGVA 1FF1A 3VRRA 1LS8A 3SG5A 2GGZA 2QEOA 1IRJA 1KFUL 1WRKA 1B4CA 5CSNA 2H61A 1EH2A 1XFZO 1NYAA 2KFHA 1IJ5A 2I7AA 3I5GC 2A4JA 2K0JA 5TNCA 1IQ5A 2M1UA 1WLZA 2BL0B 1CM1A 2FOTA 2M7NA 3EKHA 4R1EA 1Y1UA 2KGRA 2MLEC 4ORCB 3BFBA 3AKAA 2FCEA 2WORA 1Y6WA 2JZIA 4WQ3A 1S3PA 1RECA 3RZSA 1YX8A 1XO5A 2F2OA 1XFUO 4OR9B 1KSMA 1KK8C 4OZDA 4C0LA 2BE4A 1FI6A 2PSRA 1OOJA 1OOGA 2WCFA 1DT7B 2BKIB 1NCZA 2CTNA 1BT6A 2K7BA 1F55A 2M29A 4PALA 3BFAA 4CLNA 1CMFA 3SS3A 2JOJA 2WCLA 2M1KB 3L47A 2MRDA 1AHRA 3UNWA 3SG6A 2WC6A 3FE9A 3WHTB 1QJTA 2K61A 2BCXA 2LV7A 4I5LB 1DJHA 1SY9A 2HPSA 4PE7A 3MSEB 3N7HA 4NDBA 1PVBA 1JUOA 4YBHB 3S0BA 2ZRSA 2WCEA 3BYAA 2LHLA 3M0WA 1K90D 5AXIA 1WRLA 1M39A 3PFVA 3TDUA 3V2LA 4CIDA 1DEKA 2K7OA 2FJYA 3S0AA 2GV5A 2PVBA 2Q4UA 3H4SE 3S0EA 1UHIA 4ORAB 2OTGC 1BODA 2JC2A 3DYEA 1MHOA 1SK6D 2JQ6A 2KI6C 1YX7A 2MA2A 3K1EA 4HSZA 1U5IB 4PHKA 1IQ3A 3BUMB 1PVAA 4KYNA 1CDNA 3NSKA 1S6CA 5HLOA 1X02A 2D8NA 2KGBC 3CYZA 4N1FA 4YGEB 1MUXA 3KF9A 4PT1A 3OX6A 1OOFA 3OB1B 2JXCA
chains in the Genus database with same CATH topology
4FQOA 2LAPA 4ETOA 3HCMA 2CT9A 2K7DA 5I2OA 1GGZA 5HYDA 3NSOA 1YRUB 1AP4A 2NXQA 3CS1A 1R6PA 4I5JA 1WRZA 2KAVA 2KDHA 2QPTA 5JOLA 4D1EA 1K95A 1F4OA 3JVTB 1EG4A 1DJWA 1BR4B 4L9MA 2ZNEA 2H2KA 2ZKMX 2TN4A 4ZCUA 4CPVA 2E30A 1QIVA 4YGAA 2LLSA 3WNXB 3FIAA 1DJIA 1B47A 1Q80A 2PASA 5KSZA 2BL0C 4NDDA 4C0JA 5HKYA 2LANA 3CZTX 5BPJA 1M63B 1BU3A 1UP5A 4CFRA 3EVUA 1J7PA 5DKRA 1IG5A 2DOQA 2P6BB 1MF8B 2BE6A 2I2RE 1LXFC 2Y1MA 1CMGA 1F54A 1LVCD 4PHMA 2K8MB 1A4PA 4M2PA 2PALA 5ER4X 3NXAA 3O4YA 1KK7Z 1GQMA 2H61C 1ZACA 2LM5A 1F8HA 4TNCA 4HRHA 4NQGA 1B9AA 4N5XA 1QLKA 3PATA 1ALWA 5GQQC 1KQMB 1N0YA 1AJ5A 2CNPA 2KI6D 2KFFA 5D7FA 4ZCVA 1YUUA 1RWYA 1XFYO 1K9KA 1GJYA 4DCKA 4OCIA 3CTNA 2M97A 3LL8B 1S5GZ 1CLLA 1OMRA 2KQYA 4GPLB 4AQIA 5CPVA 5J3XA 1K93D 1QV1A 2JNFA 1CLMA 2HF5A 1FW4A 1NIWA 3DF0A 1FBVA 1K9UA 3AKBA 2WNDA 2I94A 4HREE 1BG1A 4QJ5B 4MSPA 2AUCA 3TUYB 4F0ZB 2QACA 1CFPA 1NCXA 3C1VA 1XFWO 5KTYA 1MWNA 3A8RA 5DKNA 1SPYA 1TRFA 2M9GA 1AK8A 1HT9A 1SKTA 3TDIA 4AOMA 1TNXA 1YR5A 1OE9B 1TN4A 1MR8A 3AAKA 2K2FA 2L0PA 1S6JA 2F3ZA 5I8NA 1B8CA 2JULA 4A4CA 1EG3A 2L50A 1MXLC 1OMVA 1OQPA 3I5IB 4DRWA 4PE1A 1AUIB 1KCYA 1XFXO 2EC6B 1DF0A 1NP8A 3JVTC 4P2YB 1XVJA 2LCPA 1IWQA 1B7TY 1SR6B 3BXKA 1BLQA 3BUOB 1A03A 1BF5A 1EL4A 1SCMB 2SASA 1JF0A 2KHNA 1PK0D 2R2IA 1G8IA 1QS7A 1J7QA 3CR2A 1YURA 5PALA 1H4BA 4YGBB 1F4QA 1AJ4A 2NLNA 2M7LA 2F8PA 2JU0A 3CR4X 5CSIA 3VRNA 2MLFC 1RK9A 4JPZB 1QVIY 3PLFB 2EHBA 4MZLA 1XYDA 1M46A 3DVJA 1UHJA 1LA3A 3FWBA 3BUNB 3IQQA 3EVRA 2CXJA 2LC5A 1CDPA 2BCAA 3RM1A 1DF0B 1IJ6A 1DJZA 3DD4A 3PSRA 2LMUA 1FPWA 1CDLA 4GBAA 3IQOA 4GAOA 1DGUA 2M49B 3EVVA 1TNQA 1Y0VH 1UHHA 2E6WA 3TS5B 1DTLA 1KQMC 3JTDB 3DVMA 2KQ6A 1TCFA 4A4BA 3DVKA 5AEQA 3ZWHA 2PMYA 3BUWB 1L7ZA 1B8RA 1MXEA 3E3RA 1TOPA 1K96A 1KWOC 1E8AA 2V53A 2KAXA 2LLUA 2LHIA 1PRWA 1K8UA 4OVNF 4YI8A 4MRXA 4QJ3B 3TUYC 1QATA 4IL1A 1W7JB 2B1UA 4PE4A 3SIBA 2LP3A 4GGFA 1JFKA 3VRQA 4FTGA 1J1DA 4MEWA 3SG3A 5AFPA 1CFDA 2VRGA 1QX2A 2KYCA 3F45A 3I5IC 1TIZA 4AQJA 2ZRTA 2L4HA 2LVVA 1H8BA 2NCPA 1GGWA 1G4YR 3SJSA 1QXPA 3WHUB 2EC6C 3CLNA 4PDZA 4XJKA 1JWDA 1PSBA 1IGVA 2JT0A 1XK4A 1SR6C 1J7OA 4ICBA 3K21A 5IBWA 1SCMC 1PALA 1OSAA 1OMDA 2LMVA 4DUQA 5JJGA 1NCYA 2F33A 4PCWA 2NZ0A 1C7VA 1ZUZA 4Q04A 1JC2A 2G2BA 2L51A 2F2PA 1YUSA 2O5GA 1B8LA 1WDCB 2Y4QA 3PM8A 4ORBB 1JF2A 3NSLA 2BKHB 1F70A 2JT3A 1TTXA 3PALA 2KSPA 4P5OE 1SCVA 3GOFA 1IH0A 3EK7A 2O60A 3EK4A 4JQ0D 2K2AA 4XJKB 1AVSA 1WLMA 2OS8B 2L5XB 2ZNDA 1D1OA 4OV2A 2JPTA 1KWOB 3CGAA 3CR5X 2MHHA 4M2QA 4MZKA 2BBMA 2KOTA 2KFGA 4GGNA 1BOCA 1ALVA 1YUTA 2NCOA 2PRUA 5DKQA 3TS5C 2ZN8A 3JTDC 3RLZA 3KHEA 1SYMA 2L4IA 1XFVO 2WCBA 4USLA 1FI5A 2KI4B 4UPGA 1A2XA 1DJXA 1M45A 2RGIA 2M0RA 1ZFSA 2COLB 4E68A 3PN7B 1RTP1 4YGDB 3QRXA 1ODBA 2LP2A 2SCPA 3HX4A 4YGCB 4BY5A 1LKJA 1S6IA 1CFCA 2ZN9A 1W7IB 3BOWA 2HQ8A 1OZOA 1EXRA 5KU1A 3O78A 1C07A 2LMTA 3DF0B 4HRGA 1RFJA 4U8DA 1CM4A 1VRKA 1K2HA 3BUXB 1KFXS 4MZJA 2LLTA 3GK1A 3BQ3A 1PULA 5D69A 3LCPC 1L2OB 3KO0A 4GUKA 3VRPA 1WY9A 3I5HB 3TZ1A 4N1GA 1LINA 1UHKA 2MJWB 3SG7A 3NSIA 4XYNA 2KYFA 1JSAA 1EJ3A 3EKJA 2EGDA 1NX3A 5I2QA 1B7TZ 2JNXA 2LVIA 2BECA 3VROA 3FWCA 4DS7A 3OB2B 3BOWB 1UUSA 1U5IA 3SG2A 2KBMA 3I5FB 4I5KA 1C7WA 3ZNIA 2BBNA 1V1GA 2HETA 5K89A 1KFUS 2JWWA 2AMIA 2JTTA 5ER5A 2KNEA 4GGFC 1NUBA 1YRTB 1WDCC 2Y5IA 2KBIA 1QX7A 1QVIZ 1S36A 1SL8A 2ISDA 1SRAA 3EK8A 3LLEA 5HLVA 1TNPA 5FYXA 1NX0A 1DJYA 1YVLA 2LUCA 5HKWA 4BY4A 2BCBA 2OS8C 1J7RA 2JRFA 2MAZA 1M31A 2MBXA 1XK4C 1A75A 4I5NB 3DVEA 4JWQA 1RJVA 4YRUA 5B8IB 1CLBA 2LVKA 5AANA 1LA0A 2L98A 3ICBA 2CCMA 2LNKA 4MN0A 1Y1XA 2JXLA 1UHNA 2LUXA 4CFQA 4NDCA 1IKUA 2KI4C 3VGOA 2JTZA 1OZSA 3I5GB 3IF7A 3KEVA 1B1GA 3GK4X 4PHJA 3PN7C 1MQ1A 1JBAA 1Y1AA 1V1FA 2I18A 3OHMB 4YI9A 3GK2A 4MLWA 1CB1A 1QLSA 1DJGA 3D0YA 1K9PA 3KPXA 1QIWA 1TCOB 1A75B 1CNPA 1CTRA 1KK8B 1NX1A 2CBLA 2ZFDA 4WQ2A 1YVHA 5HKZA 1CKKA 3D10A 2FCDA 5CSJA 1UWOA 4C0KA 1F71A 2FJUB 3O6BA 5CSFA 1L2OC 4MBEA 1J1EA 1YTZC 2JT8A 1KK7Y 3I5HC 4PE0A 1TNWA 1A29A 1ZOTB 2L2EA 1BJFA 3A4UB 3FS7A 1SBJA 1SW8A 3LK1A 1SL9A 1QX5B 1KSOA 1XA5A 2WOSA 2OPOA 2Y1NA 3AAJA 2F3YA 3OX5A 5AERA 3WXAA 1G33A 1N65A 1S26D 1DGVA 1R2UA 5F6TA 3SG4A 2M8UA 1S5GY 3D0YB 3I5FC 1KQVA 1DVIA 1NX2A 1QV0A 2KAYA 2OTGB 2LE9B 3OP0A 1CDMA 4GFTA 2Q91A 1J55A 1PSRA 2LVJA 5I2LA 1ZMZA 1QTXA 4PHNA 4QJ4B 1UURA 1KFXL 4WRIA 4DIRA 1SL7A 1S1EA 4GNKB 1NPQA 1SNLA 1HQVA 2IS9A 4OKHA 4MRYA 1RROA 3SIAA 4MVFA 3O2PA 2WC8A 1DMOA 1NWDA 1SMGA 3CWGA 1CFFA 2AAOA 4M2OA 3TDZA 1JFJA 2HQWA 1BR1B 2G9BA 2M3WA 1QASA 1BMOA 1N2DA 3LK0A 2GGMA 2K7CA 1K94A 1NSHA 1FF1A 3VRRA 3SG5A 2GGZA 1IRJA 1KFUL 1WRKA 1B4CA 5CSNA 2H61A 1EH2A 1XFZO 1NYAA 2KFHA 1IJ5A 2I7AA 3I5GC 2A4JA 2K0JA 5TNCA 1IQ5A 2M1UA 1WLZA 2BL0B 1CM1A 2FOTA 2M7NA 3EKHA 4R1EA 1Y1UA 2KGRA 2MLEC 4ORCB 3AKAA 2FCEA 2WORA 1Y6WA 2JZIA 4WQ3A 1S3PA 1RECA 1YX8A 1XO5A 2F2OA 1XFUO 4OR9B 1KSMA 1KK8C 4C0LA 2BE4A 1FI6A 2PSRA 1OOJA 2WCFA 1DT7B 1F55A 2BKIB 1NCZA 2CTNA 1BT6A 2K7BA 2M29A 4PALA 4CLNA 1CMFA 2JOJA 2M1KB 2MRDA 1AHRA 3SG6A 3WHTB 1QJTA 2K61A 2BCXA 2LV7A 4I5LB 1DJHA 1SY9A 2HPSA 4PE7A 3MSEB 4NDBA 1PVBA 1JUOA 4YBHB 2ZRSA 2WCEA 3BYAA 2LHLA 3M0WA 1K90D 5AXIA 1WRLA 1M39A 3PFVA 3TDUA 4CIDA 2K7OA 2GV5A 2PVBA 2Q4UA 3H4SE 1UHIA 4ORAB 2OTGC 1BODA 2JC2A 1MHOA 1SK6D 2JQ6A 2KI6C 1YX7A 2MA2A 4HSZA 5G08A 1U5IB 4PHKA 1IQ3A 3BUMB 1PVAA 1CDNA 3NSKA 1S6CA 5HLOA 1X02A 2D8NA 2KGBC 4N1FA 4YGEB 1MUXA 3KF9A 3OX6A 3OB1B 2JXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FQO A;  2LAP A;  4ETO A;  3HCM A;  2CT9 A;  2K7D A;  5I2O A;  1GGZ A;  5HYD A;  3NSO A;  1YRU B;  1AP4 A;  2NXQ A;  3CS1 A;  1R6P A;  4I5J A;  1WRZ A;  2KAV A;  2KDH A;  2QPT A;  5JOL A;  4D1E A;  1K95 A;  1F4O A;  3JVT B;  1EG4 A;  1DJW A;  1BR4 B;  4L9M A;  2ZNE A;  2H2K A;  2ZKM X;  2TN4 A;  4ZCU A;  4CPV A;  2E30 A;  1QIV A;  4YGA A;  2LLS A;  3WNX B;  3FIA A;  1DJI A;  1B47 A;  1Q80 A;  2PAS A;  5KSZ A;  2BL0 C;  4NDD A;  4C0J A;  5HKY A;  2LAN A;  3CZT X;  5BPJ A;  1M63 B;  1BU3 A;  1UP5 A;  4CFR A;  3EVU A;  1J7P A;  5DKR A;  1IG5 A;  2DOQ A;  2P6B B;  1MF8 B;  2BE6 A;  2I2R E;  1LXF C;  2Y1M A;  1CMG A;  1F54 A;  1LVC D;  4PHM A;  2K8M B;  1A4P A;  4M2P A;  2PAL A;  5ER4 X;  3NXA A;  3O4Y A;  1KK7 Z;  1GQM A;  2H61 C;  1ZAC A;  2LM5 A;  1F8H A;  4TNC A;  4HRH A;  4NQG A;  1B9A A;  4N5X A;  1QLK A;  3PAT A;  1ALW A;  5GQQ C;  1KQM B;  1N0Y A;  1AJ5 A;  2CNP A;  2KI6 D;  2KFF A;  5D7F A;  4ZCV A;  1YUU A;  1RWY A;  1XFY O;  1K9K A;  1GJY A;  4DCK A;  4OCI A;  3CTN A;  2M97 A;  3LL8 B;  1S5G Z;  1CLL A;  1OMR A;  2KQY A;  4GPL B;  4AQI A;  5CPV A;  5J3X A;  1K93 D;  1QV1 A;  2JNF A;  1CLM A;  2HF5 A;  1FW4 A;  1NIW A;  3DF0 A;  1FBV A;  1K9U A;  3AKB A;  2WND A;  2I94 A;  4HRE E;  1BG1 A;  4QJ5 B;  4MSP A;  2AUC A;  3TUY B;  4F0Z B;  2QAC A;  1CFP A;  1NCX A;  3C1V A;  1XFW O;  5KTY A;  1MWN A;  3A8R A;  5DKN A;  1SPY A;  1TRF A;  2M9G A;  1AK8 A;  1HT9 A;  1SKT A;  3TDI A;  4AOM A;  1TNX A;  1YR5 A;  1OE9 B;  1TN4 A;  1MR8 A;  3AAK A;  2K2F A;  2L0P A;  1S6J A;  2F3Z A;  5I8N A;  1B8C A;  2JUL A;  4A4C A;  1EG3 A;  2L50 A;  1MXL C;  1OMV A;  1OQP A;  3I5I B;  4DRW A;  4PE1 A;  1AUI B;  1KCY A;  1XFX O;  2EC6 B;  1DF0 A;  1NP8 A;  3JVT C;  4P2Y B;  1XVJ A;  2LCP A;  1IWQ A;  1B7T Y;  1SR6 B;  3BXK A;  1BLQ A;  3BUO B;  1A03 A;  1BF5 A;  1EL4 A;  1SCM B;  2SAS A;  1JF0 A;  2KHN A;  1PK0 D;  2R2I A;  1G8I A;  1QS7 A;  1J7Q A;  3CR2 A;  1YUR A;  5PAL A;  1H4B A;  4YGB B;  1F4Q A;  1AJ4 A;  2NLN A;  2M7L A;  2F8P A;  2JU0 A;  3CR4 X;  5CSI A;  3VRN A;  2MLF C;  1RK9 A;  4JPZ B;  1QVI Y;  3PLF B;  2EHB A;  4MZL A;  1XYD A;  1M46 A;  3DVJ A;  1UHJ A;  1LA3 A;  3FWB A;  3BUN B;  3IQQ A;  3EVR A;  2CXJ A;  2LC5 A;  1CDP A;  2BCA A;  3RM1 A;  1DF0 B;  1IJ6 A;  1DJZ A;  3DD4 A;  3PSR A;  2LMU A;  1FPW A;  1CDL A;  4GBA A;  3IQO A;  4GAO A;  1DGU A;  2M49 B;  3EVV A;  1TNQ A;  1Y0V H;  1UHH A;  2E6W A;  3TS5 B;  1DTL A;  1KQM C;  3JTD B;  3DVM A;  2KQ6 A;  1TCF A;  4A4B A;  3DVK A;  5AEQ A;  3ZWH A;  2PMY A;  3BUW B;  1L7Z A;  1B8R A;  1MXE A;  3E3R A;  1TOP A;  1K96 A;  1KWO C;  1E8A A;  2V53 A;  2KAX A;  2LLU A;  2LHI A;  1PRW A;  1K8U A;  4OVN F;  4YI8 A;  4MRX A;  4QJ3 B;  3TUY C;  1QAT A;  4IL1 A;  1W7J B;  2B1U A;  4PE4 A;  3SIB A;  2LP3 A;  4GGF A;  1JFK A;  3VRQ A;  4FTG A;  1J1D A;  4MEW A;  3SG3 A;  5AFP A;  1CFD A;  2VRG A;  1QX2 A;  2KYC A;  3F45 A;  3I5I C;  1TIZ A;  4AQJ A;  2ZRT A;  2L4H A;  2LVV A;  1H8B A;  2NCP A;  1GGW A;  1G4Y R;  3SJS A;  1QXP A;  3WHU B;  2EC6 C;  3CLN A;  4PDZ A;  4XJK A;  1JWD A;  1PSB A;  1IGV A;  2JT0 A;  1XK4 A;  1SR6 C;  1J7O A;  4ICB A;  3K21 A;  5IBW A;  1SCM C;  1PAL A;  1OSA A;  1OMD A;  2LMV A;  4DUQ A;  5JJG A;  1NCY A;  2F33 A;  4PCW A;  2NZ0 A;  1C7V A;  1ZUZ A;  4Q04 A;  1JC2 A;  2G2B A;  2L51 A;  2F2P A;  1YUS A;  2O5G A;  1B8L A;  1WDC B;  2Y4Q A;  3PM8 A;  4ORB B;  1JF2 A;  3NSL A;  2BKH B;  1F70 A;  2JT3 A;  1TTX A;  3PAL A;  2KSP A;  4P5O E;  1SCV A;  3GOF A;  1IH0 A;  3EK7 A;  2O60 A;  3EK4 A;  4JQ0 D;  2K2A A;  4XJK B;  1AVS A;  1WLM A;  2OS8 B;  2L5X B;  2ZND A;  1D1O A;  4OV2 A;  2JPT A;  1KWO B;  3CGA A;  3CR5 X;  2MHH A;  4M2Q A;  4MZK A;  2BBM A;  2KOT A;  2KFG A;  4GGN A;  1BOC A;  1ALV A;  1YUT A;  2NCO A;  2PRU A;  5DKQ A;  3TS5 C;  2ZN8 A;  3JTD C;  3RLZ A;  3KHE A;  1SYM A;  2L4I A;  1XFV O;  2WCB A;  4USL A;  1FI5 A;  2KI4 B;  4UPG A;  1A2X A;  1DJX A;  1M45 A;  2RGI A;  2M0R A;  1ZFS A;  2COL B;  4E68 A;  3PN7 B;  1RTP 1;  4YGD B;  3QRX A;  1ODB A;  2LP2 A;  2SCP A;  3HX4 A;  4YGC B;  4BY5 A;  1LKJ A;  1S6I A;  1CFC A;  2ZN9 A;  1W7I B;  3BOW A;  2HQ8 A;  1OZO A;  1EXR A;  5KU1 A;  3O78 A;  1C07 A;  2LMT A;  3DF0 B;  4HRG A;  1RFJ A;  4U8D A;  1CM4 A;  1VRK A;  1K2H A;  3BUX B;  1KFX S;  4MZJ A;  2LLT A;  3GK1 A;  3BQ3 A;  1PUL A;  5D69 A;  3LCP C;  1L2O B;  3KO0 A;  4GUK A;  3VRP A;  1WY9 A;  3I5H B;  3TZ1 A;  4N1G A;  1LIN A;  1UHK A;  2MJW B;  3SG7 A;  3NSI A;  4XYN A;  2KYF A;  1JSA A;  1EJ3 A;  3EKJ A;  2EGD A;  1NX3 A;  5I2Q A;  1B7T Z;  2JNX A;  2LVI A;  2BEC A;  3VRO A;  3FWC A;  4DS7 A;  3OB2 B;  3BOW B;  1UUS A;  1U5I A;  3SG2 A;  2KBM A;  3I5F B;  4I5K A;  1C7W A;  3ZNI A;  2BBN A;  1V1G A;  2HET A;  5K89 A;  1KFU S;  2JWW A;  2AMI A;  2JTT A;  5ER5 A;  2KNE A;  4GGF C;  1NUB A;  1YRT B;  1WDC C;  2Y5I A;  2KBI A;  1QX7 A;  1QVI Z;  1S36 A;  1SL8 A;  2ISD A;  1SRA A;  3EK8 A;  3LLE A;  5HLV A;  1TNP A;  5FYX A;  1NX0 A;  1DJY A;  1YVL A;  2LUC A;  5HKW A;  4BY4 A;  2BCB A;  2OS8 C;  1J7R A;  2JRF A;  2MAZ A;  1M31 A;  2MBX A;  1XK4 C;  1A75 A;  4I5N B;  3DVE A;  4JWQ A;  1RJV A;  4YRU A;  5B8I B;  1CLB A;  2LVK A;  5AAN A;  1LA0 A;  2L98 A;  3ICB A;  2CCM A;  2LNK A;  4MN0 A;  1Y1X A;  2JXL A;  1UHN A;  2LUX A;  4CFQ A;  4NDC A;  1IKU A;  2KI4 C;  3VGO A;  2JTZ A;  1OZS A;  3I5G B;  3IF7 A;  3KEV A;  1B1G A;  3GK4 X;  4PHJ A;  3PN7 C;  1MQ1 A;  1JBA A;  1Y1A A;  1V1F A;  2I18 A;  3OHM B;  4YI9 A;  3GK2 A;  4MLW A;  1CB1 A;  1QLS A;  1DJG A;  3D0Y A;  1K9P A;  3KPX A;  1QIW A;  1TCO B;  1A75 B;  1CNP A;  1CTR A;  1KK8 B;  1NX1 A;  2CBL A;  2ZFD A;  4WQ2 A;  1YVH A;  5HKZ A;  1CKK A;  3D10 A;  2FCD A;  5CSJ A;  1UWO A;  4C0K A;  1F71 A;  2FJU B;  3O6B A;  5CSF A;  1L2O C;  4MBE A;  1J1E A;  1YTZ C;  2JT8 A;  1KK7 Y;  3I5H C;  4PE0 A;  1TNW A;  1A29 A;  1ZOT B;  2L2E A;  1BJF A;  3A4U B;  3FS7 A;  1SBJ A;  1SW8 A;  3LK1 A;  1SL9 A;  1QX5 B;  1KSO A;  1XA5 A;  2WOS A;  2OPO A;  2Y1N A;  3AAJ A;  2F3Y A;  3OX5 A;  5AER A;  3WXA A;  1G33 A;  1N65 A;  1S26 D;  1DGV A;  1R2U A;  5F6T A;  3SG4 A;  2M8U A;  1S5G Y;  3D0Y B;  3I5F C;  1KQV A;  1DVI A;  1NX2 A;  1QV0 A;  2KAY A;  2OTG B;  2LE9 B;  3OP0 A;  1CDM A;  4GFT A;  2Q91 A;  1J55 A;  1PSR A;  2LVJ A;  5I2L A;  1ZMZ A;  1QTX A;  4PHN A;  4QJ4 B;  1UUR A;  1KFX L;  4WRI A;  4DIR A;  1SL7 A;  1S1E A;  4GNK B;  1NPQ A;  1SNL A;  1HQV A;  2IS9 A;  4OKH A;  4MRY A;  1RRO A;  3SIA A;  4MVF A;  3O2P A;  2WC8 A;  1DMO A;  1NWD A;  1SMG A;  3CWG A;  1CFF A;  2AAO A;  4M2O A;  3TDZ A;  1JFJ A;  2HQW A;  1BR1 B;  2G9B A;  2M3W A;  1QAS A;  1BMO A;  1N2D A;  3LK0 A;  2GGM A;  2K7C A;  1K94 A;  1NSH A;  1FF1 A;  3VRR A;  3SG5 A;  2GGZ A;  1IRJ A;  1KFU L;  1WRK A;  1B4C A;  5CSN A;  2H61 A;  1EH2 A;  1XFZ O;  1NYA A;  2KFH A;  1IJ5 A;  2I7A A;  3I5G C;  2A4J A;  2K0J A;  5TNC A;  1IQ5 A;  2M1U A;  1WLZ A;  2BL0 B;  1CM1 A;  2FOT A;  2M7N A;  3EKH A;  4R1E A;  1Y1U A;  2KGR A;  2MLE C;  4ORC B;  3AKA A;  2FCE A;  2WOR A;  1Y6W A;  2JZI A;  4WQ3 A;  1S3P A;  1REC A;  1YX8 A;  1XO5 A;  2F2O A;  1XFU O;  4OR9 B;  1KSM A;  1KK8 C;  4C0L A;  2BE4 A;  1FI6 A;  2PSR A;  1OOJ A;  2WCF A;  1DT7 B;  1F55 A;  2BKI B;  1NCZ A;  2CTN A;  1BT6 A;  2K7B A;  2M29 A;  4PAL A;  4CLN A;  1CMF A;  2JOJ A;  2M1K B;  2MRD A;  1AHR A;  3SG6 A;  3WHT B;  1QJT A;  2K61 A;  2BCX A;  2LV7 A;  4I5L B;  1DJH A;  1SY9 A;  2HPS A;  4PE7 A;  3MSE B;  4NDB A;  1PVB A;  1JUO A;  4YBH B;  2ZRS A;  2WCE A;  3BYA A;  2LHL A;  3M0W A;  1K90 D;  5AXI A;  1WRL A;  1M39 A;  3PFV A;  3TDU A;  4CID A;  2K7O A;  2GV5 A;  2PVB A;  2Q4U A;  3H4S E;  1UHI A;  4ORA B;  2OTG C;  1BOD A;  2JC2 A;  1MHO A;  1SK6 D;  2JQ6 A;  2KI6 C;  1YX7 A;  2MA2 A;  4HSZ A;  5G08 A;  1U5I B;  4PHK A;  1IQ3 A;  3BUM B;  1PVA A;  1CDN A;  3NSK A;  1S6C A;  5HLO A;  1X02 A;  2D8N A;  2KGB C;  4N1F A;  4YGE B;  1MUX A;  3KF9 A;  3OX6 A;  3OB1 B;  2JXC A; 
#chains in the Genus database with same CATH topology
 4FQO A;  2LAP A;  4ETO A;  3HCM A;  2CT9 A;  2K7D A;  5I2O A;  2WC5 A;  1GGZ A;  5HYD A;  3NSO A;  1DQE A;  1YRU B;  5FI7 A;  1AP4 A;  2NXQ A;  1SSE B;  3CS1 A;  1R6P A;  4I5J A;  5EL2 A;  1WRZ A;  2KAV A;  2KDH A;  2QPT A;  5JOL A;  4D1E A;  1K95 A;  1F4O A;  3JVT B;  1EG4 A;  1DJW A;  1BR4 B;  4L9M A;  2ZNE A;  2H2K A;  2ZKM X;  2TN4 A;  3D78 A;  4ZCU A;  4CPV A;  2E30 A;  1QIV A;  4YGA A;  2LLS A;  3WNX B;  3FIA A;  3OBV A;  1DJI A;  1B47 A;  1ORG A;  1Q80 A;  2PAS A;  2QEV A;  2BL0 C;  5KSZ A;  3SS5 A;  2PYQ A;  4NDD A;  4C0J A;  5HKY A;  2LAN A;  3D77 A;  5D3O A;  3CZT X;  5BPJ A;  1M63 B;  1BU3 A;  1UP5 A;  4CFR A;  3D74 A;  3EVU A;  1J7P A;  4FQT A;  5FI2 A;  5DKR A;  1IG5 A;  2DOQ A;  2P6B B;  3D75 A;  1MF8 B;  2BE6 A;  2I2R E;  1LXF C;  2Y1M A;  1CMG A;  1F54 A;  1LVC D;  4PHM A;  2K8M B;  1OW4 A;  3S0D A;  1A4P A;  4M2P A;  2PAL A;  5ER4 X;  3PM2 A;  3CZ2 A;  3NXA A;  3O4Y A;  1KK7 Z;  1GQM A;  2H61 C;  1TUJ A;  1ZAC A;  1TUZ A;  2LM5 A;  1F8H A;  4TNC A;  4HRH A;  4NQG A;  1B9A A;  4N5X A;  1QLK A;  3PAT A;  1ALW A;  5GQQ C;  1KQM B;  1N0Y A;  1AJ5 A;  2CNP A;  2KI6 D;  2KFF A;  5D7F A;  4ZCV A;  1YUU A;  1RWY A;  1XFY O;  1K9K A;  1GJY A;  4DCK A;  4OCI A;  3CTN A;  2M97 A;  3LL8 B;  1S5G Z;  1CLL A;  1OMR A;  2KQY A;  4GPL B;  2PQL A;  4AQI A;  5CPV A;  5J3X A;  1K93 D;  1QV1 A;  2JNF A;  1CLM A;  2HF5 A;  4JD9 A;  1FW4 A;  1NIW A;  3DF0 A;  1FBV A;  1K9U A;  3AKB A;  2WND A;  2I94 A;  4HRE E;  1BG1 A;  4JKT A;  4QJ5 B;  4MSP A;  2AUC A;  3TUY B;  4F0Z B;  2QAC A;  1CFP A;  1NCX A;  3C1V A;  1Z2C B;  1XFW O;  3DXL A;  1MWN A;  2L5Y A;  3A8R A;  5DKN A;  5KTY A;  1SPY A;  1TRF A;  2M9G A;  5DIC A;  1AK8 A;  1HT9 A;  1SKT A;  3TDI A;  4AOM A;  1TNX A;  3BFH A;  1YR5 A;  1OE9 B;  1TN4 A;  1MR8 A;  3AAK A;  4IJ7 A;  2K2F A;  2L0P A;  1S6J A;  2F3Z A;  2P71 A;  5I8N A;  1B8C A;  3CDN A;  2BAP A;  2JUL A;  4A4C A;  1EG3 A;  2L50 A;  1MXL C;  1OMV A;  3B88 A;  1OQP A;  3I5I B;  4DRW A;  4PE1 A;  1AUI B;  3B7A A;  1KCY A;  1XFX O;  1XFR A;  2EC6 B;  3R72 A;  4INW A;  1DF0 A;  1NP8 A;  3JVT C;  4P2Y B;  1XVJ A;  2LCP A;  1IWQ A;  1B7T Y;  1SR6 B;  3BXK A;  1BLQ A;  3BUO B;  1A03 A;  1BF5 A;  1EL4 A;  1SCM B;  2SAS A;  1JF0 A;  2ERB A;  2KHN A;  1PK0 D;  2R2I A;  1G8I A;  1QS7 A;  1J7Q A;  3CR2 A;  1YUR A;  5PAL A;  1H4B A;  4YGB B;  1F4Q A;  2KLE A;  1AJ4 A;  3FE6 A;  2NLN A;  2M7L A;  2F8P A;  2JU0 A;  2KPH A;  3CR4 X;  4INX A;  5CSI A;  3VRN A;  2MLF C;  1RK9 A;  4JPZ B;  1QVI Y;  3PLF B;  2EHB A;  4MZL A;  1XYD A;  1DEL A;  1M46 A;  2BNX A;  3DVJ A;  1UHJ A;  1LA3 A;  3FWB A;  3BUN B;  3IQQ A;  3EVR A;  2CXJ A;  2LC5 A;  1CDP A;  2BCA A;  3RM1 A;  1DF0 B;  1IJ6 A;  3SS4 A;  1DJZ A;  2WCJ A;  3DD4 A;  3PSR A;  2LMU A;  1FPW A;  1CDL A;  4GBA A;  3IQO A;  4GAO A;  1DGU A;  2M49 B;  3EVV A;  1TNQ A;  1Y0V H;  1UHH A;  2E6W A;  3TS5 B;  1DTL A;  1KQM C;  3JTD B;  3DVM A;  3O4X A;  2KQ6 A;  1TCF A;  2QEH A;  4A4B A;  3DVK A;  3DZT A;  5AEQ A;  3ZWH A;  2PMY A;  3BUW B;  1L7Z A;  1B8R A;  1MXE A;  3E3R A;  2L2C A;  1TOP A;  5G08 A;  1K96 A;  1KWO C;  1E8A A;  2V53 A;  2KAX A;  2LLU A;  3VB1 A;  2LHI A;  1PRW A;  1K8U A;  4OVN F;  4YI8 A;  4MRX A;  4QJ3 B;  3TUY C;  2QDI A;  1QAT A;  4IL1 A;  1W7J B;  1GM0 A;  2B1U A;  4PE4 A;  3SIB A;  1C3Z A;  2LP3 A;  4GGF A;  1JFK A;  3VRQ A;  4FTG A;  1J1D A;  3PJI A;  4MEW A;  3SG3 A;  5AFP A;  1CFD A;  2VRG A;  1QX2 A;  2KYC A;  3R1V A;  3F45 A;  3I5I C;  1TIZ A;  4AQJ A;  2ZRT A;  2L4H A;  2LVV A;  1H8B A;  2NCP A;  1GGW A;  1G4Y R;  3SJS A;  1QXP A;  3WHU B;  2EC6 C;  3CLN A;  4PDZ A;  4XJK A;  5HL1 A;  1JWD A;  1PSB A;  3L4A A;  2WCM A;  1IGV A;  2JT0 A;  1XK4 A;  1SR6 C;  1J7O A;  4ICB A;  3K21 A;  5IBW A;  1SCM C;  1PAL A;  1OSA A;  1OMD A;  2LMV A;  4DUQ A;  5JJG A;  1NCY A;  2F33 A;  4PCW A;  2NZ0 A;  1C7V A;  1ZUZ A;  4Q04 A;  1JC2 A;  2G2B A;  2L51 A;  3D73 A;  2F2P A;  1YUS A;  3OGN A;  3FE8 A;  2O5G A;  1B8L A;  1WDC B;  2Y4Q A;  3PM8 A;  4ORB B;  1JF2 A;  3NSL A;  2BKH B;  1F70 A;  2JT3 A;  1TTX A;  3PAL A;  2KSP A;  4P5O E;  1DC1 A;  2K60 A;  1SCV A;  3GOF A;  1IH0 A;  3EK7 A;  2O60 A;  3EK4 A;  4JQ0 D;  2KLD A;  2K2A A;  4XJK B;  1AVS A;  1WLM A;  2OS8 B;  2L5X B;  2ZND A;  1D1O A;  4OV2 A;  2JPT A;  3BJH A;  1KWO B;  3CGA A;  3CR5 X;  2MHH A;  4M2Q A;  4MZK A;  2BBM A;  2KOT A;  2KFG A;  4GGN A;  1BOC A;  1ALV A;  1YUT A;  2NCO A;  2PRU A;  5DKQ A;  3TS5 C;  2ZN8 A;  3JTD C;  3RLZ A;  3KHE A;  1SYM A;  1T14 A;  2L4I A;  1XFV O;  2WCB A;  4USL A;  1FI5 A;  1W9Z A;  2KI4 B;  4UPG A;  1A2X A;  1DJX A;  1M45 A;  2RGI A;  2M0R A;  1ZFS A;  2COL B;  4E68 A;  2QEB A;  3PN7 B;  1RTP 1;  4YGD B;  3QRX A;  1ODB A;  2LP2 A;  2SCP A;  3HX4 A;  4YGC B;  4BY5 A;  1LKJ A;  1S6I A;  1CFC A;  2ZN9 A;  1W7I B;  3BOW A;  2HQ8 A;  1OZO A;  1EXR A;  5FI6 A;  5KU1 A;  3O78 A;  1C07 A;  3S0G A;  2LMT A;  3DF0 B;  4HRG A;  1C3Y A;  1RFJ A;  4U8D A;  4F7F A;  1CM4 A;  1VRK A;  1K2H A;  3BUX B;  1KFX S;  4MZJ A;  2LLT A;  3GK1 A;  3BQ3 A;  1PUL A;  5D69 A;  3B6X A;  3LCP C;  1L2O B;  3KO0 A;  4GUK A;  3VRP A;  1WY9 A;  3I5H B;  3TZ1 A;  4N1G A;  1LIN A;  1UHK A;  2MJW B;  3D76 A;  3NSI A;  4XYN A;  3SG7 A;  2KYF A;  1JSA A;  3CZ1 A;  1EJ3 A;  3EKJ A;  2EGD A;  1NX3 A;  3R1O A;  3IVT A;  5I2Q A;  1QWV A;  1B7T Z;  2JNX A;  2LVI A;  2BEC A;  3VRO A;  3FWC A;  4DS7 A;  3OB2 B;  3BOW B;  1UUS A;  1U5I A;  3SG2 A;  2KBM A;  3I5F B;  4I5K A;  1C7W A;  3ZNI A;  2BBN A;  1V1G A;  2HET A;  5K89 A;  1KFU S;  2JWW A;  2JPO A;  2AMI A;  2JTT A;  5ER5 A;  2KNE A;  4GGF C;  1NUB A;  1YRT B;  2GTE A;  1WDC C;  2P70 A;  2Y5I A;  2KBI A;  1QX7 A;  3CAB A;  3Q8I A;  1QVI Z;  1S36 A;  3NHT A;  1SL8 A;  2ISD A;  1SRA A;  3EK8 A;  3LLE A;  5HLV A;  1TNP A;  5FYX A;  1NX0 A;  3L4L A;  1DJY A;  1YVL A;  3QME A;  2LUC A;  5HKW A;  4BY4 A;  2BCB A;  2OS8 C;  1J7R A;  2JRF A;  2MAZ A;  1M31 A;  2WCH A;  1XK4 C;  2MBX A;  1A75 A;  1OOH A;  4I5N B;  3DVE A;  4JWQ A;  1RJV A;  1TWO A;  4YRU A;  5B8I B;  1CLB A;  2LVK A;  3EG5 B;  5AAN A;  1LA0 A;  2L98 A;  3ICB A;  2CCM A;  2H8V A;  2LNK A;  1Y1X A;  4MN0 A;  2JXL A;  1UHN A;  2LUX A;  4CFQ A;  4NDC A;  1IKU A;  2KI4 C;  3VGO A;  2JTZ A;  1OZS A;  3I5G B;  2YGU A;  3UO9 A;  3IF7 A;  3KEV A;  1B1G A;  3GK4 X;  4PHJ A;  3PN7 C;  1MQ1 A;  1JBA A;  1Y1A A;  1V1F A;  2I18 A;  3OHM B;  4YI9 A;  3GK2 A;  4MLW A;  1CB1 A;  1QLS A;  1DJG A;  3D0Y A;  1K9P A;  3KPX A;  1QIW A;  1TCO B;  1A75 B;  1CNP A;  1CTR A;  1KK8 B;  1NX1 A;  2CBL A;  2ZFD A;  4WQ2 A;  1YVH A;  3R1P A;  5HKZ A;  1CKK A;  3D10 A;  2FCD A;  5CSJ A;  1UWO A;  4C0K A;  1F71 A;  2FJU B;  3O6B A;  5CSF A;  1L2O C;  4MBE A;  1J1E A;  2WCK A;  1YTZ C;  2JT8 A;  1KK7 Y;  3I5H C;  4PE0 A;  1TNW A;  1A29 A;  1ZOT B;  2L2E A;  1BJF A;  3A4U B;  3FS7 A;  1IIO A;  1SBJ A;  1P28 A;  1SW8 A;  3LK1 A;  1SL9 A;  1QX5 B;  1KSO A;  1XA5 A;  2WOS A;  2OPO A;  2Y1N A;  3AAJ A;  2F3Y A;  3OX5 A;  5AER A;  3WXA A;  1G33 A;  1N65 A;  1S26 D;  1DGV A;  1R2U A;  5F6T A;  3SG4 A;  2M8U A;  1S5G Y;  3D0Y B;  3DY9 A;  3I5F C;  1KQV A;  1DVI A;  1NX2 A;  1QV0 A;  2KAY A;  2OTG B;  2LE9 B;  3OP0 A;  1CDM A;  4GFT A;  3B87 A;  2Q91 A;  1J55 A;  1PSR A;  2LVJ A;  5I2L A;  1OOI X;  1ZMZ A;  1QTX A;  3B86 A;  4PHN A;  1UUR A;  1KFX L;  4WRI A;  4DIR A;  4QJ4 B;  3CZ0 A;  1SL7 A;  1S1E A;  4GNK B;  1NPQ A;  1SNL A;  5I94 A;  1HQV A;  2IS9 A;  4OKH A;  4MRY A;  1RRO A;  3SIA A;  4MVF A;  3O2P A;  2WC8 A;  1DMO A;  1NWD A;  1SMG A;  3CWG A;  3S0F A;  1CFF A;  2AAO A;  4M2O A;  3NHI A;  3TDZ A;  1JFJ A;  2HQW A;  1BR1 B;  2G9B A;  2M3W A;  1QAS A;  1BMO A;  1N2D A;  3LK0 A;  2GGM A;  2K7C A;  1Z4H A;  1K94 A;  1NSH A;  3NGV A;  1FF1 A;  3VRR A;  1LS8 A;  3SG5 A;  2GGZ A;  2QEO A;  1IRJ A;  1KFU L;  1WRK A;  1B4C A;  5CSN A;  2H61 A;  1EH2 A;  1XFZ O;  1NYA A;  2KFH A;  1IJ5 A;  2I7A A;  3I5G C;  2A4J A;  2K0J A;  5TNC A;  1IQ5 A;  2M1U A;  1WLZ A;  2BL0 B;  1CM1 A;  2FOT A;  2M7N A;  3EKH A;  4R1E A;  1Y1U A;  2KGR A;  2MLE C;  4ORC B;  3BFB A;  3AKA A;  2FCE A;  2WOR A;  1Y6W A;  2JZI A;  4WQ3 A;  1S3P A;  1REC A;  3RZS A;  1YX8 A;  1XO5 A;  2F2O A;  1XFU O;  4OR9 B;  1KSM A;  1KK8 C;  4OZD A;  4C0L A;  2BE4 A;  1FI6 A;  2PSR A;  1OOJ A;  1OOG A;  2WCF A;  1DT7 B;  2BKI B;  1NCZ A;  2CTN A;  1BT6 A;  2K7B A;  1F55 A;  2M29 A;  4PAL A;  3BFA A;  4CLN A;  1CMF A;  3SS3 A;  2JOJ A;  2WCL A;  2M1K B;  3L47 A;  2MRD A;  1AHR A;  3UNW A;  3SG6 A;  2WC6 A;  3FE9 A;  3WHT B;  1QJT A;  2K61 A;  2BCX A;  2LV7 A;  4I5L B;  1DJH A;  1SY9 A;  2HPS A;  4PE7 A;  3MSE B;  3N7H A;  4NDB A;  1PVB A;  1JUO A;  4YBH B;  3S0B A;  2ZRS A;  2WCE A;  3BYA A;  2LHL A;  3M0W A;  1K90 D;  5AXI A;  1WRL A;  1M39 A;  3PFV A;  3TDU A;  3V2L A;  4CID A;  1DEK A;  2K7O A;  2FJY A;  3S0A A;  2GV5 A;  2PVB A;  2Q4U A;  3H4S E;  3S0E A;  1UHI A;  4ORA B;  2OTG C;  1BOD A;  2JC2 A;  3DYE A;  1MHO A;  1SK6 D;  2JQ6 A;  2KI6 C;  1YX7 A;  2MA2 A;  3K1E A;  4HSZ A;  1U5I B;  4PHK A;  1IQ3 A;  3BUM B;  1PVA A;  4KYN A;  1CDN A;  3NSK A;  1S6C A;  5HLO A;  1X02 A;  2D8N A;  2KGB C;  3CYZ A;  4N1F A;  4YGE B;  1MUX A;  3KF9 A;  4PT1 A;  3OX6 A;  1OOF A;  3OB1 B;  2JXC A; 
#chains in the Genus database with same CATH homology
 4FQO A;  2LAP A;  4ETO A;  3HCM A;  2CT9 A;  2K7D A;  5I2O A;  1GGZ A;  5HYD A;  3NSO A;  1YRU B;  1AP4 A;  2NXQ A;  3CS1 A;  1R6P A;  4I5J A;  1WRZ A;  2KAV A;  2KDH A;  2QPT A;  5JOL A;  4D1E A;  1K95 A;  1F4O A;  3JVT B;  1EG4 A;  1DJW A;  1BR4 B;  4L9M A;  2ZNE A;  2H2K A;  2ZKM X;  2TN4 A;  4ZCU A;  4CPV A;  2E30 A;  1QIV A;  4YGA A;  2LLS A;  3WNX B;  3FIA A;  1DJI A;  1B47 A;  1Q80 A;  2PAS A;  5KSZ A;  2BL0 C;  4NDD A;  4C0J A;  5HKY A;  2LAN A;  3CZT X;  5BPJ A;  1M63 B;  1BU3 A;  1UP5 A;  4CFR A;  3EVU A;  1J7P A;  5DKR A;  1IG5 A;  2DOQ A;  2P6B B;  1MF8 B;  2BE6 A;  2I2R E;  1LXF C;  2Y1M A;  1CMG A;  1F54 A;  1LVC D;  4PHM A;  2K8M B;  1A4P A;  4M2P A;  2PAL A;  5ER4 X;  3NXA A;  3O4Y A;  1KK7 Z;  1GQM A;  2H61 C;  1ZAC A;  2LM5 A;  1F8H A;  4TNC A;  4HRH A;  4NQG A;  1B9A A;  4N5X A;  1QLK A;  3PAT A;  1ALW A;  5GQQ C;  1KQM B;  1N0Y A;  1AJ5 A;  2CNP A;  2KI6 D;  2KFF A;  5D7F A;  4ZCV A;  1YUU A;  1RWY A;  1XFY O;  1K9K A;  1GJY A;  4DCK A;  4OCI A;  3CTN A;  2M97 A;  3LL8 B;  1S5G Z;  1CLL A;  1OMR A;  2KQY A;  4GPL B;  4AQI A;  5CPV A;  5J3X A;  1K93 D;  1QV1 A;  2JNF A;  1CLM A;  2HF5 A;  1FW4 A;  1NIW A;  3DF0 A;  1FBV A;  1K9U A;  3AKB A;  2WND A;  2I94 A;  4HRE E;  1BG1 A;  4QJ5 B;  4MSP A;  2AUC A;  3TUY B;  4F0Z B;  2QAC A;  1CFP A;  1NCX A;  3C1V A;  1XFW O;  5KTY A;  1MWN A;  3A8R A;  5DKN A;  1SPY A;  1TRF A;  2M9G A;  1AK8 A;  1HT9 A;  1SKT A;  3TDI A;  4AOM A;  1TNX A;  1YR5 A;  1OE9 B;  1TN4 A;  1MR8 A;  3AAK A;  2K2F A;  2L0P A;  1S6J A;  2F3Z A;  5I8N A;  1B8C A;  2JUL A;  4A4C A;  1EG3 A;  2L50 A;  1MXL C;  1OMV A;  1OQP A;  3I5I B;  4DRW A;  4PE1 A;  1AUI B;  1KCY A;  1XFX O;  2EC6 B;  1DF0 A;  1NP8 A;  3JVT C;  4P2Y B;  1XVJ A;  2LCP A;  1IWQ A;  1B7T Y;  1SR6 B;  3BXK A;  1BLQ A;  3BUO B;  1A03 A;  1BF5 A;  1EL4 A;  1SCM B;  2SAS A;  1JF0 A;  2KHN A;  1PK0 D;  2R2I A;  1G8I A;  1QS7 A;  1J7Q A;  3CR2 A;  1YUR A;  5PAL A;  1H4B A;  4YGB B;  1F4Q A;  1AJ4 A;  2NLN A;  2M7L A;  2F8P A;  2JU0 A;  3CR4 X;  5CSI A;  3VRN A;  2MLF C;  1RK9 A;  4JPZ B;  1QVI Y;  3PLF B;  2EHB A;  4MZL A;  1XYD A;  1M46 A;  3DVJ A;  1UHJ A;  1LA3 A;  3FWB A;  3BUN B;  3IQQ A;  3EVR A;  2CXJ A;  2LC5 A;  1CDP A;  2BCA A;  3RM1 A;  1DF0 B;  1IJ6 A;  1DJZ A;  3DD4 A;  3PSR A;  2LMU A;  1FPW A;  1CDL A;  4GBA A;  3IQO A;  4GAO A;  1DGU A;  2M49 B;  3EVV A;  1TNQ A;  1Y0V H;  1UHH A;  2E6W A;  3TS5 B;  1DTL A;  1KQM C;  3JTD B;  3DVM A;  2KQ6 A;  1TCF A;  4A4B A;  3DVK A;  5AEQ A;  3ZWH A;  2PMY A;  3BUW B;  1L7Z A;  1B8R A;  1MXE A;  3E3R A;  1TOP A;  1K96 A;  1KWO C;  1E8A A;  2V53 A;  2KAX A;  2LLU A;  2LHI A;  1PRW A;  1K8U A;  4OVN F;  4YI8 A;  4MRX A;  4QJ3 B;  3TUY C;  1QAT A;  4IL1 A;  1W7J B;  2B1U A;  4PE4 A;  3SIB A;  2LP3 A;  4GGF A;  1JFK A;  3VRQ A;  4FTG A;  1J1D A;  4MEW A;  3SG3 A;  5AFP A;  1CFD A;  2VRG A;  1QX2 A;  2KYC A;  3F45 A;  3I5I C;  1TIZ A;  4AQJ A;  2ZRT A;  2L4H A;  2LVV A;  1H8B A;  2NCP A;  1GGW A;  1G4Y R;  3SJS A;  1QXP A;  3WHU B;  2EC6 C;  3CLN A;  4PDZ A;  4XJK A;  1JWD A;  1PSB A;  1IGV A;  2JT0 A;  1XK4 A;  1SR6 C;  1J7O A;  4ICB A;  3K21 A;  5IBW A;  1SCM C;  1PAL A;  1OSA A;  1OMD A;  2LMV A;  4DUQ A;  5JJG A;  1NCY A;  2F33 A;  4PCW A;  2NZ0 A;  1C7V A;  1ZUZ A;  4Q04 A;  1JC2 A;  2G2B A;  2L51 A;  2F2P A;  1YUS A;  2O5G A;  1B8L A;  1WDC B;  2Y4Q A;  3PM8 A;  4ORB B;  1JF2 A;  3NSL A;  2BKH B;  1F70 A;  2JT3 A;  1TTX A;  3PAL A;  2KSP A;  4P5O E;  1SCV A;  3GOF A;  1IH0 A;  3EK7 A;  2O60 A;  3EK4 A;  4JQ0 D;  2K2A A;  4XJK B;  1AVS A;  1WLM A;  2OS8 B;  2L5X B;  2ZND A;  1D1O A;  4OV2 A;  2JPT A;  1KWO B;  3CGA A;  3CR5 X;  2MHH A;  4M2Q A;  4MZK A;  2BBM A;  2KOT A;  2KFG A;  4GGN A;  1BOC A;  1ALV A;  1YUT A;  2NCO A;  2PRU A;  5DKQ A;  3TS5 C;  2ZN8 A;  3JTD C;  3RLZ A;  3KHE A;  1SYM A;  2L4I A;  1XFV O;  2WCB A;  4USL A;  1FI5 A;  2KI4 B;  4UPG A;  1A2X A;  1DJX A;  1M45 A;  2RGI A;  2M0R A;  1ZFS A;  2COL B;  4E68 A;  3PN7 B;  1RTP 1;  4YGD B;  3QRX A;  1ODB A;  2LP2 A;  2SCP A;  3HX4 A;  4YGC B;  4BY5 A;  1LKJ A;  1S6I A;  1CFC A;  2ZN9 A;  1W7I B;  3BOW A;  2HQ8 A;  1OZO A;  1EXR A;  5KU1 A;  3O78 A;  1C07 A;  2LMT A;  3DF0 B;  4HRG A;  1RFJ A;  4U8D A;  1CM4 A;  1VRK A;  1K2H A;  3BUX B;  1KFX S;  4MZJ A;  2LLT A;  3GK1 A;  3BQ3 A;  1PUL A;  5D69 A;  3LCP C;  1L2O B;  3KO0 A;  4GUK A;  3VRP A;  1WY9 A;  3I5H B;  3TZ1 A;  4N1G A;  1LIN A;  1UHK A;  2MJW B;  3SG7 A;  3NSI A;  4XYN A;  2KYF A;  1JSA A;  1EJ3 A;  3EKJ A;  2EGD A;  1NX3 A;  5I2Q A;  1B7T Z;  2JNX A;  2LVI A;  2BEC A;  3VRO A;  3FWC A;  4DS7 A;  3OB2 B;  3BOW B;  1UUS A;  1U5I A;  3SG2 A;  2KBM A;  3I5F B;  4I5K A;  1C7W A;  3ZNI A;  2BBN A;  1V1G A;  2HET A;  5K89 A;  1KFU S;  2JWW A;  2AMI A;  2JTT A;  5ER5 A;  2KNE A;  4GGF C;  1NUB A;  1YRT B;  1WDC C;  2Y5I A;  2KBI A;  1QX7 A;  1QVI Z;  1S36 A;  1SL8 A;  2ISD A;  1SRA A;  3EK8 A;  3LLE A;  5HLV A;  1TNP A;  5FYX A;  1NX0 A;  1DJY A;  1YVL A;  2LUC A;  5HKW A;  4BY4 A;  2BCB A;  2OS8 C;  1J7R A;  2JRF A;  2MAZ A;  1M31 A;  2MBX A;  1XK4 C;  1A75 A;  4I5N B;  3DVE A;  4JWQ A;  1RJV A;  4YRU A;  5B8I B;  1CLB A;  2LVK A;  5AAN A;  1LA0 A;  2L98 A;  3ICB A;  2CCM A;  2LNK A;  4MN0 A;  1Y1X A;  2JXL A;  1UHN A;  2LUX A;  4CFQ A;  4NDC A;  1IKU A;  2KI4 C;  3VGO A;  2JTZ A;  1OZS A;  3I5G B;  3IF7 A;  3KEV A;  1B1G A;  3GK4 X;  4PHJ A;  3PN7 C;  1MQ1 A;  1JBA A;  1Y1A A;  1V1F A;  2I18 A;  3OHM B;  4YI9 A;  3GK2 A;  4MLW A;  1CB1 A;  1QLS A;  1DJG A;  3D0Y A;  1K9P A;  3KPX A;  1QIW A;  1TCO B;  1A75 B;  1CNP A;  1CTR A;  1KK8 B;  1NX1 A;  2CBL A;  2ZFD A;  4WQ2 A;  1YVH A;  5HKZ A;  1CKK A;  3D10 A;  2FCD A;  5CSJ A;  1UWO A;  4C0K A;  1F71 A;  2FJU B;  3O6B A;  5CSF A;  1L2O C;  4MBE A;  1J1E A;  1YTZ C;  2JT8 A;  1KK7 Y;  3I5H C;  4PE0 A;  1TNW A;  1A29 A;  1ZOT B;  2L2E A;  1BJF A;  3A4U B;  3FS7 A;  1SBJ A;  1SW8 A;  3LK1 A;  1SL9 A;  1QX5 B;  1KSO A;  1XA5 A;  2WOS A;  2OPO A;  2Y1N A;  3AAJ A;  2F3Y A;  3OX5 A;  5AER A;  3WXA A;  1G33 A;  1N65 A;  1S26 D;  1DGV A;  1R2U A;  5F6T A;  3SG4 A;  2M8U A;  1S5G Y;  3D0Y B;  3I5F C;  1KQV A;  1DVI A;  1NX2 A;  1QV0 A;  2KAY A;  2OTG B;  2LE9 B;  3OP0 A;  1CDM A;  4GFT A;  2Q91 A;  1J55 A;  1PSR A;  2LVJ A;  5I2L A;  1ZMZ A;  1QTX A;  4PHN A;  4QJ4 B;  1UUR A;  1KFX L;  4WRI A;  4DIR A;  1SL7 A;  1S1E A;  4GNK B;  1NPQ A;  1SNL A;  1HQV A;  2IS9 A;  4OKH A;  4MRY A;  1RRO A;  3SIA A;  4MVF A;  3O2P A;  2WC8 A;  1DMO A;  1NWD A;  1SMG A;  3CWG A;  1CFF A;  2AAO A;  4M2O A;  3TDZ A;  1JFJ A;  2HQW A;  1BR1 B;  2G9B A;  2M3W A;  1QAS A;  1BMO A;  1N2D A;  3LK0 A;  2GGM A;  2K7C A;  1K94 A;  1NSH A;  1FF1 A;  3VRR A;  3SG5 A;  2GGZ A;  1IRJ A;  1KFU L;  1WRK A;  1B4C A;  5CSN A;  2H61 A;  1EH2 A;  1XFZ O;  1NYA A;  2KFH A;  1IJ5 A;  2I7A A;  3I5G C;  2A4J A;  2K0J A;  5TNC A;  1IQ5 A;  2M1U A;  1WLZ A;  2BL0 B;  1CM1 A;  2FOT A;  2M7N A;  3EKH A;  4R1E A;  1Y1U A;  2KGR A;  2MLE C;  4ORC B;  3AKA A;  2FCE A;  2WOR A;  1Y6W A;  2JZI A;  4WQ3 A;  1S3P A;  1REC A;  1YX8 A;  1XO5 A;  2F2O A;  1XFU O;  4OR9 B;  1KSM A;  1KK8 C;  4C0L A;  2BE4 A;  1FI6 A;  2PSR A;  1OOJ A;  2WCF A;  1DT7 B;  1F55 A;  2BKI B;  1NCZ A;  2CTN A;  1BT6 A;  2K7B A;  2M29 A;  4PAL A;  4CLN A;  1CMF A;  2JOJ A;  2M1K B;  2MRD A;  1AHR A;  3SG6 A;  3WHT B;  1QJT A;  2K61 A;  2BCX A;  2LV7 A;  4I5L B;  1DJH A;  1SY9 A;  2HPS A;  4PE7 A;  3MSE B;  4NDB A;  1PVB A;  1JUO A;  4YBH B;  2ZRS A;  2WCE A;  3BYA A;  2LHL A;  3M0W A;  1K90 D;  5AXI A;  1WRL A;  1M39 A;  3PFV A;  3TDU A;  4CID A;  2K7O A;  2GV5 A;  2PVB A;  2Q4U A;  3H4S E;  1UHI A;  4ORA B;  2OTG C;  1BOD A;  2JC2 A;  1MHO A;  1SK6 D;  2JQ6 A;  2KI6 C;  1YX7 A;  2MA2 A;  4HSZ A;  5G08 A;  1U5I B;  4PHK A;  1IQ3 A;  3BUM B;  1PVA A;  1CDN A;  3NSK A;  1S6C A;  5HLO A;  1X02 A;  2D8N A;  2KGB C;  4N1F A;  4YGE B;  1MUX A;  3KF9 A;  3OX6 A;  3OB1 B;  2JXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...