1QV0A

Atomic resolution structure of obelin from obelia longissima
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
189
structure length
185
Chain Sequence
VKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNAGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Obelin
publication title Atomic resolution structure of obelin: soaking with calcium enhances electron density of the second oxygen atom substituted at the C2-position of coelenterazine.
pubmed doi rcsb
source organism Obelia longissima
total genus 77
structure length 185
sequence length 189
ec nomenclature ec 1.13.12.5: Renilla-type luciferase.
pdb deposition date 2003-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qv0A00
1PSRA 2HQWA 4DCKA 4GGFC 1YUTA 1S6CA 3HX4A 4BY5A 3JVTC 3IQOA 2LUXA 4YGBB 5I2OA 2KYFA 1XFYO 3EVUA 4ZCVA 1J7QA 2JT3A 1A75B 1M39A 2ZRSA 5KTYA 3TDZA 1R2UA 5I2QA 1QIVA 4OCIA 2SCPA 2LHLA 1S3PA 1J7RA 5AFPA 3JTDC 1KFUS 2R2IA 3I5IC 4ORCB 1B8RA 1DJXA 2K61A 1CMFA 1K95A 1NWDA 1FI5A 3OX6A 1YX7A 3I5FC 3TZ1A 3D10A 1V1GA 2NCPA 3EVVA 3LLEA 5AXIA 1C7VA 1F4QA 1YX8A 2HQ8A 2KYCA 1OSAA 2ZNDA 1SKTA 2KOTA 2BKIB 2BKHB 2JULA 2FOTA 5HLVA 1CKKA 4PE7A 1E8AA 3WXAA 1BOCA 1SYMA 1NIWA 2M9GA 3TS5C 4M2OA 2LUCA 3BOWB 1K9PA 3PLFB 4OV2A 5J3XA 1MHOA 5B8IB 1VRKA 4MRYA 1YRTB 1LXFC 5D69A 1RFJA 3OP0A 3VRPA 5BPJA 1QVIY 1TOPA 3DF0B 2PVBA 2OS8C 3DD4A 2H61C 2M1UA 2QPTA 2SASA 4GFTA 2OPOA 1QLSA 3NSIA 3PM8A 2F3ZA 3E3RA 1EG4A 2PASA 1DMOA 4CFRA 1RROA 4PE1A 4DUQA 1GQMA 5HKWA 1K2HA 3CS1A 2PMYA 2Y1MA 4XYNA 3LK0A 3VRNA 2LC5A 3KF9A 4GBAA 2KFFA 4C0LA 1EL4A 4CFQA 1F71A 1CLMA 1DTLA 1EXRA 2P6BB 2ZN9A 2K2AA 1KWOB 3AKAA 1OMVA 1J1DA 3DVKA 2M7NA 2JXLA 1QTXA 4MRXA 4YGDB 3AAJA 1F70A 1JBAA 2MJWB 1ALWA 1ZUZA 2AUCA 4NDBA 1S6JA 1KCYA 4AOMA 1A03A 2LLTA 3CZTX 1B1GA 1NCZA 1NP8A 2WORA 3DF0A 2DOQA 1KK8C 1NX3A 2KI4C 1TNPA 2LLUA 4M2QA 1CDLA 1S26D 1SR6C 1DJWA 1OMRA 2LM5A 2LP3A 2JU0A 5CSJA 1IKUA 3WHTB 2ZNEA 1MUXA 2BCBA 5JJGA 1LVCD 1KFXS 2NZ0A 5K89A 2JPTA 1CM4A 4HRHA 3CLNA 1S1EA 4MSPA 4YBHB 2KGBC 4C0KA 4USLA 2KNEA 1OE9B 1AHRA 4ORBB 4GUKA 2KAVA 1DT7B 1KK7Y 1SCVA 3EK8A 4JPZB 1PRWA 2WCEA 1W7IB 4DS7A 1GGWA 1JFKA 1Y6WA 1WRLA 2GV5A 5DKNA 1A4PA 2KBMA 5IBWA 2BL0B 2MA2A 1FW4A 4DRWA 2JRFA 4DIRA 4UPGA 3TUYB 1NCYA 3BUNB 1OZOA 2ZKMX 4FQOA 1DGUA 2M7LA 2BE4A 3D0YA 3WNXB 4U8DA 2M1KB 2HF5A 2NCOA 4PHNA 2LAPA 4E68A 3H4SE 5CSFA 5AEQA 1NX0A 1KSOA 1F4OA 1TNXA 4PHKA 3LCPC 1ZFSA 1YVLA 2I18A 5F6TA 1NPQA 3PATA 2BBNA 3VROA 1XFZO 2CCMA 2FJUB 1F55A 1RECA 1R6PA 1B9AA 3SG7A 1G8IA 5G08A 3RM1A 4PALA 2K7OA 3SJSA 3I5HB 1BU3A 1QLKA 2EC6B 1XYDA 2LMTA 4QJ3B 2L2EA 3PN7C 4PCWA 2HPSA 2MHHA 1OZSA 3ZWHA 1LA0A 2G2BA 1SY9A 2E6WA 2LLSA 3O4YA 1SNLA 1IJ6A 1RK9A 4P5OE 1JF0A 1J7PA 4OR9B 1CDMA 1U5IA 2TN4A 2CXJA 2JQ6A 4AQIA 4CIDA 1DJYA 1B8CA 2GGMA 5HYDA 2KAXA 2LNKA 2K7CA 2JTTA 3DVEA 1KWOC 1SL9A 5KSZA 2AAOA 4PHJA 1MWNA 1RWYA 5AERA 3K21A 4YRUA 3O2PA 3CR2A 5GQQC 4ICBA 2V53A 1CFPA 2JWWA 4BY4A 1YUSA 2ZN8A 2L5XB 2KI6D 2LVJA 1A75A 4FTGA 4R1EA 2LMVA 4HRGA 1WDCB 2L51A 2ZRTA 1J1EA 5CPVA 2JTZA 1K9KA 2LP2A 4YGCB 1LKJA 1UHKA 1ZMZA 3O6BA 1TNQA 4Q04A 2BE6A 3JVTB 2I2RE 5I8NA 1AUIB 1S36A 1B4CA 1SL8A 1A29A 3GK2A 4I5NB 5D7FA 1QASA 2AMIA 3GOFA 3JTDB 4GNKB 3I5IB 2L50A 2PSRA 1K93D 2BBMA 1YUUA 2F3YA 1NSHA 3BOWA 4ZCUA 1IH0A 1TCOB 2KAYA 3IQQA 2KDHA 1KQMB 1A2XA 3KPXA 3WHUB 1H4BA 2KBIA 4GGNA 1CFFA 4IL1A 2JNXA 2MBXA 2G9BA 1XVJA 4MZJA 1OQPA 3EVRA 1AP4A 1JFJA 1BT6A 3KO0A 1BODA 1IJ5A 1NX2A 1QX2A 5AANA 1QV1A 3TS5B 3NXAA 1M46A 4WQ3A 1KSMA 1CDPA 1M45A 3TDUA 1NUBA 4D1EA 2JT0A 2Q91A 2WCFA 1K8UA 1B47A 1CNPA 3SG5A 1DVIA 1PVBA 2E30A 2LHIA 3OB1B 5PALA 1WY9A 3EK7A 5I2LA 2CTNA 2QACA 4N5XA 4N1GA 2M3WA 1KFUL 2JOJA 1IQ3A 1AJ5A 2OTGB 1L2OC 1M31A 1MXEA 3CR5X 2EHBA 2Y1NA 1EJ3A 2LVKA 4A4CA 1AJ4A 1TN4A 2FCDA 5CSNA 4JWQA 2NXQA 1QX7A 3BUWB 4M2PA 1BF5A 1PALA 3SIBA 2WNDA 2L4HA 3NSOA 4CPVA 1IWQA 4GAOA 1YR5A 1DJIA 2F2OA 4ORAB 3O78A 1PVAA 3A4UB 2LVVA 3I5GB 5KU1A 1PSBA 3TDIA 1YURA 1XK4A 1QATA 1F54A 2VRGA 2MLEC 1EH2A 2KHNA 1IG5A 1QS7A 4MBEA 1QJTA 4NQGA 1K96A 3BUXB 4PE0A 1DJGA 3M0WA 3CTNA 1TNWA 2ISDA 1XA5A 1DF0B 1LINA 2PALA 4PHMA 1XFWO 2KSPA 1KK8B 3VRRA 2CT9A 1WLZA 2ZFDA 2KQYA 3FS7A 4YI9A 1PULA 1RJVA 1Y1UA 3A8RA 2F8PA 2EGDA 3EKHA 2KGRA 1V1FA 1HT9A 1YVHA 4PDZA 1K90D 4YGEB 2O60A 1W7JB 3FIAA 1JF2A 4MEWA 1IRJA 3CR4X 2KI6C 1CFCA 2M49B 1BMOA 2I7AA 1G4YR 1M63B 1XO5A 1ZACA 1XFXO 3SG6A 1OMDA 1JUOA 1QVIZ 1TCFA 2M8UA 4MVFA 1NCXA 4NDDA 3NSKA 4MN0A 3HCMA 1XFVO 1CFDA 1UHJA 2K8MB 2LVIA 1CLLA 3SIAA 3PFVA 4F0ZB 1J7OA 4XJKB 4MLWA 4QJ5B 2L4IA 3NSLA 2HETA 4PE4A 1DF0A 1D1OA 5CSIA 5ER5A 2K0JA 2K7BA 1QXPA 3GK4X 1KFXL 2LE9B 4CLNA 2WC8A 1KQVA 1BR1B 1KQMC 4QJ4B 2M29A 3CWGA 1SCMB 2JZIA 1UURA 2Y4QA 2MAZA 1K94A 1ALVA 1BR4B 1OOJA 1H8BA 5ER4X 2KFGA 2FCEA 3OX5A 3RLZA 1XK4C 1PK0D 1QX5B 3BQ3A 1UHHA 1ODBA 2WOSA 1Y1AA 1IGVA 2CNPA 1TRFA 1Y1XA 3GK1A 3PSRA 3EKJA 2O5GA 4I5JA 3PN7B 4MZKA 4N1FA 3LL8B 1FBVA 4P2YB 2LCPA 4XJKA 1SW8A 1S6IA 1BG1A 2OTGC 1FI6A 1EG3A 4L9MA 2I94A 4ETOA 2A4JA 2LANA 1IQ5A 4YI8A 5DKQA 1DJZA 2KFHA 2JXCA 3I5FB 1J55A 3BXKA 1GJYA 1B8LA 1DGVA 1KK7Z 3SG2A 1RTP1 2BL0C 2LMUA 1CM1A 4WQ2A 3TUYC 2MLFC 2KQ6A 1QIWA 4C0JA 1G33A 1MQ1A 1AVSA 1SL7A 2F33A 3I5GC 1YRUB 4GPLB 1N65A 1N0YA 1X02A 2Y5IA 4A4BA 2COLB 5TNCA 1CLBA 4GGFA 1B7TZ 2JNFA 1NYAA 1SPYA 1XFUO 1BLQA 1JWDA 3VRQA 1FF1A 2K2FA 3OHMB 1HQVA 1UUSA 2OS8B 1SBJA 3LK1A 1AK8A 1TIZA 4MZLA 1JC2A 1UP5A 4AQJA 3D0YB 3AAKA 3PALA 4WRIA 2JC2A 1CTRA 4I5LB 1N2DA 3I5HC 4HSZA 1MXLC 5DKRA 3BUMB 3C1VA 1S5GZ 5HKZA 1F8HA 1GGZA 2EC6C 2L0PA 4OVNF 1ZOTB 1WRZA 1WRKA 2F2PA 1TTXA 1DJHA 4I5KA 3CGAA 3ZNIA 1UWOA 1CMGA 4YGAA 2JT8A 2BECA 1K9UA 2PRUA 2Q4UA 3KEVA 1YTZC 4NDCA 3OB2B 3VGOA 2LV7A 2M0RA 3QRXA 1WLMA 3EK4A 1MF8B 1MR8A 3FWCA 3IF7A 1BJFA 3DVJA 2B1UA 2K7DA 2MRDA 1Q80A 2KI4B 2WCBA 1NX1A 2H61A 3MSEB 1B7TY 1UHNA 1CDNA 1SR6B 3DVMA 1SRAA 1C7WA 2D8NA 5JOLA 1L7ZA 5HLOA 1U5IB 2CBLA 2GGZA 4TNCA 1QV0A 1FPWA 3F45A 2BCAA 4JQ0D 2NLNA 4HREE 3SG4A 5FYXA 3BUOB 2IS9A 2H2KA 1CB1A 1JSAA 2L98A 2BCXA 3FWBA 4OKHA 1SCMC 3BYAA 1LA3A 3SG3A 3ICBA 3KHEA 5HKYA 1C07A 1WDCC 1S5GY 1SMGA 1Y0VH 2M97A 2RGIA 3AKBA 1L2OB 1UHIA 1SK6D
chains in the Genus database with same CATH superfamily
1PSRA 2HQWA 4DCKA 4GGFC 1YUTA 1S6CA 3HX4A 4BY5A 3FE9A 3JVTC 3IQOA 2LUXA 4YGBB 5I2OA 2KYFA 1XFYO 3EVUA 4ZCVA 1J7QA 2JT3A 1A75B 1M39A 2ZRSA 5FI7A 3TDZA 3UNWA 1R2UA 5I2QA 5KTYA 1QIVA 4OCIA 2SCPA 2LHLA 1S3PA 1J7RA 5AFPA 3JTDC 1KFUS 2R2IA 3I5IC 4ORCB 2ERBA 1B8RA 1DJXA 2K61A 3RZSA 1CMFA 1K95A 1NWDA 1FI5A 3OX6A 1YX7A 3I5FC 3TZ1A 3D10A 1V1GA 2NCPA 3EVVA 3LLEA 5AXIA 2QDIA 3S0FA 1C7VA 1F4QA 1YX8A 2HQ8A 2KYCA 1OSAA 2ZNDA 1SKTA 2KOTA 2BKIB 2BKHB 2JULA 3DZTA 2FOTA 5HLVA 1CKKA 3VB1A 3NHIA 1E8AA 4PE7A 3WXAA 1BOCA 3D75A 1SYMA 1NIWA 2M9GA 3TS5C 4M2OA 2LUCA 3BOWB 1K9PA 3PLFB 4OV2A 5J3XA 1MHOA 5B8IB 1VRKA 4MRYA 1YRTB 3L4AA 2KPHA 1LXFC 5D69A 1RFJA 3OP0A 3VRPA 5BPJA 5FI6A 1QVIY 1TOPA 3DF0B 2PVBA 2OS8C 3DD4A 2H61C 2M1UA 2QPTA 2SASA 4GFTA 2OPOA 1QLSA 3NSIA 3PM8A 2F3ZA 2WCMA 3E3RA 1EG4A 2PASA 3NHTA 3QMEA 1RROA 4PE1A 4CFRA 1DMOA 4DUQA 1GQMA 5HKWA 1K2HA 3CS1A 2PMYA 2WCKA 2Y1MA 4XYNA 3LK0A 3VRNA 2LC5A 3KF9A 4GBAA 2KFFA 4C0LA 1EL4A 4CFQA 3DY9A 1F71A 2L2CA 1CLMA 1DTLA 1EXRA 2P6BB 2ZN9A 2K2AA 3CZ0A 1KWOB 2FJYA 3AKAA 4JD9A 1OMVA 1J1DA 1Z2CB 2M7NA 2JXLA 1QTXA 3DVKA 4MRXA 4YGDB 3AAJA 1F70A 1JBAA 2MJWB 1ALWA 1ZUZA 2AUCA 2QEHA 4NDBA 3UO9A 1S6JA 1KCYA 4AOMA 1A03A 2LLTA 3CZTX 1B1GA 1NCZA 1NP8A 2WORA 3DF0A 2DOQA 1KK8C 1Z4HA 1NX3A 1TNPA 2KI4C 2LLUA 4M2QA 1CDLA 1P28A 1S26D 1SR6C 3L4LA 1DJWA 1OMRA 2LM5A 2LP3A 2JU0A 5CSJA 3SS5A 1IKUA 3WHTB 2ZNEA 1MUXA 2BCBA 3Q8IA 5JJGA 1LVCD 1KFXS 2NZ0A 5K89A 2JPTA 1CM4A 2QEBA 4HRHA 3CLNA 1S1EA 4MSPA 4YBHB 2KGBC 4C0KA 4USLA 2KNEA 1OE9B 1AHRA 4ORBB 4GUKA 2KAVA 1DT7B 1KK7Y 1SCVA 3EK8A 4JPZB 1PRWA 2WCEA 1W7IB 4DS7A 1GGWA 1JFKA 1Y6WA 1WRLA 2GV5A 5DKNA 1A4PA 2KBMA 5IBWA 2BL0B 2MA2A 1FW4A 4OZDA 4F7FA 4DRWA 2JRFA 4DIRA 4UPGA 3TUYB 1C3ZA 1NCYA 1OZOA 2ZKMX 3BUNB 4FQOA 1DGUA 2M7LA 2BE4A 3D0YA 3WNXB 4U8DA 2M1KB 2HF5A 2NCOA 4PHNA 3IVTA 2LAPA 1DQEA 4E68A 3H4SE 5CSFA 5AEQA 4IJ7A 1NX0A 1KSOA 1F4OA 1TNXA 4PHKA 3LCPC 1ZFSA 3DYEA 3PJIA 1YVLA 2I18A 5F6TA 1NPQA 3PATA 2BBNA 3N7HA 3VROA 1XFZO 2CCMA 2FJUB 1F55A 1RECA 1XFRA 1R6PA 1B9AA 3SG7A 1G8IA 5G08A 3RM1A 4PALA 2K7OA 3SJSA 3I5HB 1BU3A 1QLKA 2EC6B 1XYDA 2LMTA 4QJ3B 2L2EA 3OGNA 2WC6A 3D74A 3PN7C 4PCWA 2HPSA 3BFHA 2MHHA 1OZSA 3ZWHA 1LA0A 2G2BA 1SY9A 1TWOA 2E6WA 2LLSA 3O4YA 1SNLA 1IJ6A 1RK9A 4P5OE 1JF0A 2GTEA 1J7PA 4OR9B 1CDMA 1U5IA 2TN4A 2CXJA 2JQ6A 4AQIA 4CIDA 1DJYA 1B8CA 2GGMA 5HYDA 3B87A 2KAXA 2LNKA 2WCHA 3D76A 4PT1A 2H8VA 2K7CA 2KLEA 2JTTA 3DVEA 1KWOC 1SL9A 5FI2A 5KSZA 2AAOA 3FE6A 3R1OA 4PHJA 1MWNA 1RWYA 3PM2A 5AERA 3K21A 3V2LA 4YRUA 3O2PA 3CR2A 5GQQC 4ICBA 2V53A 1CFPA 2JWWA 4BY4A 1YUSA 2ZN8A 2L5XB 2KI6D 2LVJA 1A75A 4FTGA 4R1EA 2LMVA 3DXLA 4HRGA 1WDCB 2L51A 2ZRTA 1J1EA 5CPVA 3SS4A 2JTZA 1K9KA 2LP2A 4YGCB 1LKJA 1UHKA 1ZMZA 3O6BA 1TNQA 4Q04A 2BE6A 3JVTB 2I2RE 5I8NA 3CYZA 1AUIB 1S36A 1B4CA 1SL8A 1A29A 3GK2A 4I5NB 5D7FA 1QASA 4FQTA 2AMIA 3GOFA 3JTDB 4GNKB 3I5IB 2L50A 2PSRA 1K93D 2KLDA 2BBMA 1YUUA 1OOFA 2F3YA 1NSHA 3BOWA 4ZCUA 1DELA 1TCOB 2KAYA 3IQQA 2KDHA 1KQMB 1IH0A 1A2XA 3KPXA 3WHUB 1H4BA 2KBIA 4GGNA 1CFFA 3R1VA 4IL1A 2JNXA 2MBXA 2G9BA 5EL2A 1XVJA 4MZJA 1OQPA 3EVRA 1AP4A 1JFJA 1BT6A 3KO0A 1BODA 1IJ5A 1NX2A 1TUJA 1QX2A 5AANA 1QV1A 3TS5B 3NXAA 1M46A 4WQ3A 1KSMA 1CDPA 1M45A 3TDUA 1NUBA 4D1EA 2JT0A 2Q91A 2WCFA 1K8UA 1B47A 1CNPA 3SG5A 1DVIA 1PVBA 2E30A 2LHIA 3OB1B 5PALA 1WY9A 3EK7A 3B6XA 5I2LA 2CTNA 3NGVA 2QACA 4N5XA 4N1GA 2WCLA 2M3WA 1KFUL 2JOJA 1IQ3A 1AJ5A 2OTGB 1L2OC 1M31A 4INXA 1MXEA 3CR5X 2EHBA 2Y1NA 1EJ3A 2LVKA 4A4CA 3O4XA 1AJ4A 3D78A 1TN4A 2FCDA 5CSNA 3CZ1A 2NXQA 4JWQA 1QX7A 3BUWB 4M2PA 1BF5A 1PALA 3S0BA 3SIBA 2WNDA 2L4HA 3FE8A 3NSOA 4CPVA 1IWQA 4GAOA 1YR5A 1DJIA 2F2OA 5HL1A 5DICA 4ORAB 3O78A 1PVAA 3A4UB 2LVVA 3I5GB 5KU1A 1PSBA 3TDIA 1YURA 1XK4A 1QATA 1F54A 2VRGA 2MLEC 1EH2A 2KHNA 1IG5A 2QEOA 1QS7A 4MBEA 1QJTA 3S0DA 4NQGA 1K96A 3BUXB 4PE0A 1DJGA 3M0WA 3CTNA 1TNWA 2ISDA 1XA5A 1DF0B 1LINA 2PALA 4PHMA 1XFWO 2KSPA 1KK8B 2P70A 4INWA 3VRRA 2CT9A 1WLZA 2ZFDA 2KQYA 3FS7A 4YI9A 1PULA 1RJVA 1Y1UA 3A8RA 4KYNA 2F8PA 2EGDA 3EKHA 2KGRA 1V1FA 1HT9A 1YVHA 4PDZA 1K90D 4YGEB 2O60A 1W7JB 3FIAA 1JF2A 4MEWA 1IRJA 3CR4X 2KI6C 1CFCA 2M49B 1BMOA 2I7AA 1G4YR 1M63B 1XO5A 1TUZA 1C3YA 1ZACA 1XFXO 2P71A 3SG6A 1OMDA 1JUOA 1QVIZ 1TCFA 2M8UA 2PQLA 1NCXA 4MVFA 4NDDA 3NSKA 4MN0A 3HCMA 1XFVO 1CFDA 1UHJA 2K8MB 2LVIA 1CLLA 3SIAA 3PFVA 5D3OA 4F0ZB 1J7OA 4XJKB 1QWVA 4MLWA 1SSEB 4QJ5B 2L4IA 3NSLA 2HETA 4PE4A 1DF0A 1D1OA 3BFBA 5CSIA 5ER5A 1CDNA 4JKTA 2K0JA 2K7BA 1QXPA 3GK4X 1KFXL 2LE9B 3EG5B 4CLNA 2WC8A 1KQVA 2WCJA 3B88A 1BR1B 1KQMC 4QJ4B 2M29A 3CWGA 1SCMB 2JZIA 3OBVA 1UURA 2Y4QA 3S0EA 2MAZA 1K94A 1ORGA 1ALVA 1BR4B 1OOJA 1H8BA 5ER4X 2KFGA 2FCEA 3OX5A 1IIOA 3RLZA 1OOIX 1PK0D 1XK4C 1QX5B 3BQ3A 1UHHA 1ODBA 2WOSA 1Y1AA 1IGVA 2CNPA 1TRFA 1Y1XA 3GK1A 3PSRA 3EKJA 2O5GA 4I5JA 5I94A 3PN7B 4MZKA 4N1FA 3S0AA 3LL8B 2JPOA 2QEVA 1FBVA 4P2YB 2LCPA 4XJKA 1SW8A 1S6IA 1BG1A 2OTGC 1FI6A 1EG3A 4L9MA 2I94A 4ETOA 2A4JA 2LANA 3B7AA 1IQ5A 4YI8A 5DKQA 1DJZA 2KFHA 2JXCA 3I5FB 1J55A 3BXKA 1GJYA 1B8LA 1DGVA 3CDNA 1KK7Z 3CZ2A 3D73A 1RTP1 3SG2A 2BL0C 2LMUA 1DEKA 1CM1A 4WQ2A 3R72A 3TUYC 2MLFC 2KQ6A 1QIWA 4C0JA 1G33A 1MQ1A 1AVSA 1SL7A 2F33A 3I5GC 1YRUB 4GPLB 1N65A 1N0YA 1X02A 2Y5IA 2BAPA 3S0GA 2COLB 3BFAA 3BJHA 5TNCA 4A4BA 1CLBA 4GGFA 1B7TZ 2JNFA 1NYAA 1SPYA 1XFUO 1BLQA 1JWDA 3VRQA 1FF1A 2K2FA 3OHMB 1HQVA 2K60A 1UUSA 3L47A 2OS8B 1SBJA 2YGUA 3LK1A 1AK8A 3R1PA 1TIZA 2L5YA 4MZLA 1JC2A 1UP5A 3CABA 4AQJA 3D0YB 3AAKA 3PALA 4WRIA 2JC2A 1CTRA 1GM0A 4I5LB 1N2DA 3I5HC 4HSZA 1MXLC 5DKRA 3BUMB 3C1VA 1S5GZ 5HKZA 2WC5A 1F8HA 1GGZA 2EC6C 2L0PA 4OVNF 1ZOTB 1WRZA 1WRKA 2F2PA 1TTXA 1DJHA 1DC1A 2PYQA 3CGAA 4I5KA 1UWOA 3ZNIA 1CMGA 4YGAA 2JT8A 2BECA 1K9UA 3D77A 2PRUA 2Q4UA 3KEVA 1OW4A 1YTZC 4NDCA 3OB2B 3SS3A 3VGOA 2LV7A 2M0RA 3QRXA 1WLMA 3EK4A 1LS8A 1MF8B 1MR8A 3FWCA 3IF7A 1BJFA 3DVJA 2B1UA 1OOGA 2K7DA 2MRDA 1Q80A 2KI4B 2WCBA 1NX1A 1W9ZA 2H61A 1B7TY 1UHNA 3MSEB 1SR6B 3DVMA 1SRAA 1C7WA 2D8NA 5JOLA 1L7ZA 5HLOA 1U5IB 2CBLA 2GGZA 4TNCA 1QV0A 1FPWA 3F45A 2BCAA 4JQ0D 2BNXA 2NLNA 4HREE 3SG4A 5FYXA 3BUOB 2IS9A 2H2KA 3K1EA 1CB1A 3B86A 1JSAA 2L98A 2BCXA 3FWBA 4OKHA 1SCMC 3BYAA 1LA3A 1T14A 3SG3A 3ICBA 3KHEA 5HKYA 1C07A 1WDCC 1S5GY 1SMGA 1Y0VH 2M97A 2RGIA 3AKBA 1L2OB 1UHIA 1OOHA 1SK6D
chains in the Genus database with same CATH topology
1PSRA 2HQWA 4DCKA 4GGFC 1YUTA 1S6CA 3HX4A 4BY5A 3JVTC 3IQOA 2LUXA 4YGBB 5I2OA 2KYFA 1XFYO 3EVUA 4ZCVA 1J7QA 2JT3A 1A75B 1M39A 2ZRSA 5KTYA 3TDZA 1R2UA 5I2QA 1QIVA 4OCIA 2SCPA 2LHLA 1S3PA 1J7RA 5AFPA 3JTDC 1KFUS 2R2IA 3I5IC 4ORCB 1B8RA 1DJXA 2K61A 1CMFA 1K95A 1NWDA 1FI5A 3OX6A 1YX7A 3I5FC 3TZ1A 3D10A 1V1GA 2NCPA 3EVVA 3LLEA 5AXIA 1C7VA 1F4QA 1YX8A 2HQ8A 2KYCA 1OSAA 2ZNDA 1SKTA 2KOTA 2BKIB 2BKHB 2JULA 2FOTA 5HLVA 1CKKA 4PE7A 1E8AA 3WXAA 1BOCA 1SYMA 1NIWA 2M9GA 3TS5C 4M2OA 2LUCA 3BOWB 1K9PA 3PLFB 4OV2A 5J3XA 1MHOA 5B8IB 1VRKA 4MRYA 1YRTB 1LXFC 5D69A 1RFJA 3OP0A 3VRPA 5BPJA 1QVIY 1TOPA 3DF0B 2PVBA 2OS8C 3DD4A 2H61C 2M1UA 2QPTA 2SASA 4GFTA 2OPOA 1QLSA 3NSIA 3PM8A 2F3ZA 3E3RA 1EG4A 2PASA 1DMOA 4CFRA 1RROA 4PE1A 4DUQA 1GQMA 5HKWA 1K2HA 3CS1A 2PMYA 2Y1MA 4XYNA 3LK0A 3VRNA 2LC5A 3KF9A 4GBAA 2KFFA 4C0LA 1EL4A 4CFQA 1F71A 1CLMA 1DTLA 1EXRA 2P6BB 2ZN9A 2K2AA 1KWOB 3AKAA 1OMVA 1J1DA 3DVKA 2M7NA 2JXLA 1QTXA 4MRXA 4YGDB 3AAJA 1F70A 1JBAA 2MJWB 1ALWA 1ZUZA 2AUCA 4NDBA 1S6JA 1KCYA 4AOMA 1A03A 2LLTA 3CZTX 1B1GA 1NCZA 1NP8A 2WORA 3DF0A 2DOQA 1KK8C 1NX3A 2KI4C 1TNPA 2LLUA 4M2QA 1CDLA 1S26D 1SR6C 1DJWA 1OMRA 2LM5A 2LP3A 2JU0A 5CSJA 1IKUA 3WHTB 2ZNEA 1MUXA 2BCBA 5JJGA 1LVCD 1KFXS 2NZ0A 5K89A 2JPTA 1CM4A 4HRHA 3CLNA 1S1EA 4MSPA 4YBHB 2KGBC 4C0KA 4USLA 2KNEA 1OE9B 1AHRA 4ORBB 4GUKA 2KAVA 1DT7B 1KK7Y 1SCVA 3EK8A 4JPZB 1PRWA 2WCEA 1W7IB 4DS7A 1GGWA 1JFKA 1Y6WA 1WRLA 2GV5A 5DKNA 1A4PA 2KBMA 5IBWA 2BL0B 2MA2A 1FW4A 4DRWA 2JRFA 4DIRA 4UPGA 3TUYB 1NCYA 3BUNB 1OZOA 2ZKMX 4FQOA 1DGUA 2M7LA 2BE4A 3D0YA 3WNXB 4U8DA 2M1KB 2HF5A 2NCOA 4PHNA 2LAPA 4E68A 3H4SE 5CSFA 5AEQA 1NX0A 1KSOA 1F4OA 1TNXA 4PHKA 3LCPC 1ZFSA 1YVLA 2I18A 5F6TA 1NPQA 3PATA 2BBNA 3VROA 1XFZO 2CCMA 2FJUB 1F55A 1RECA 1R6PA 1B9AA 3SG7A 1G8IA 5G08A 3RM1A 4PALA 2K7OA 3SJSA 3I5HB 1BU3A 1QLKA 2EC6B 1XYDA 2LMTA 4QJ3B 2L2EA 3PN7C 4PCWA 2HPSA 2MHHA 1OZSA 3ZWHA 1LA0A 2G2BA 1SY9A 2E6WA 2LLSA 3O4YA 1SNLA 1IJ6A 1RK9A 4P5OE 1JF0A 1J7PA 4OR9B 1CDMA 1U5IA 2TN4A 2CXJA 2JQ6A 4AQIA 4CIDA 1DJYA 1B8CA 2GGMA 5HYDA 2KAXA 2LNKA 2K7CA 2JTTA 3DVEA 1KWOC 1SL9A 5KSZA 2AAOA 4PHJA 1MWNA 1RWYA 5AERA 3K21A 4YRUA 3O2PA 3CR2A 5GQQC 4ICBA 2V53A 1CFPA 2JWWA 4BY4A 1YUSA 2ZN8A 2L5XB 2KI6D 2LVJA 1A75A 4FTGA 4R1EA 2LMVA 4HRGA 1WDCB 2L51A 2ZRTA 1J1EA 5CPVA 2JTZA 1K9KA 2LP2A 4YGCB 1LKJA 1UHKA 1ZMZA 3O6BA 1TNQA 4Q04A 2BE6A 3JVTB 2I2RE 5I8NA 1AUIB 1S36A 1B4CA 1SL8A 1A29A 3GK2A 4I5NB 5D7FA 1QASA 2AMIA 3GOFA 3JTDB 4GNKB 3I5IB 2L50A 2PSRA 1K93D 2BBMA 1YUUA 2F3YA 1NSHA 3BOWA 4ZCUA 1IH0A 1TCOB 2KAYA 3IQQA 2KDHA 1KQMB 1A2XA 3KPXA 3WHUB 1H4BA 2KBIA 4GGNA 1CFFA 4IL1A 2JNXA 2MBXA 2G9BA 1XVJA 4MZJA 1OQPA 3EVRA 1AP4A 1JFJA 1BT6A 3KO0A 1BODA 1IJ5A 1NX2A 1QX2A 5AANA 1QV1A 3TS5B 3NXAA 1M46A 4WQ3A 1KSMA 1CDPA 1M45A 3TDUA 1NUBA 4D1EA 2JT0A 2Q91A 2WCFA 1K8UA 1B47A 1CNPA 3SG5A 1DVIA 1PVBA 2E30A 2LHIA 3OB1B 5PALA 1WY9A 3EK7A 5I2LA 2CTNA 2QACA 4N5XA 4N1GA 2M3WA 1KFUL 2JOJA 1IQ3A 1AJ5A 2OTGB 1L2OC 1M31A 1MXEA 3CR5X 2EHBA 2Y1NA 1EJ3A 2LVKA 4A4CA 1AJ4A 1TN4A 2FCDA 5CSNA 4JWQA 2NXQA 1QX7A 3BUWB 4M2PA 1BF5A 1PALA 3SIBA 2WNDA 2L4HA 3NSOA 4CPVA 1IWQA 4GAOA 1YR5A 1DJIA 2F2OA 4ORAB 3O78A 1PVAA 3A4UB 2LVVA 3I5GB 5KU1A 1PSBA 3TDIA 1YURA 1XK4A 1QATA 1F54A 2VRGA 2MLEC 1EH2A 2KHNA 1IG5A 1QS7A 4MBEA 1QJTA 4NQGA 1K96A 3BUXB 4PE0A 1DJGA 3M0WA 3CTNA 1TNWA 2ISDA 1XA5A 1DF0B 1LINA 2PALA 4PHMA 1XFWO 2KSPA 1KK8B 3VRRA 2CT9A 1WLZA 2ZFDA 2KQYA 3FS7A 4YI9A 1PULA 1RJVA 1Y1UA 3A8RA 2F8PA 2EGDA 3EKHA 2KGRA 1V1FA 1HT9A 1YVHA 4PDZA 1K90D 4YGEB 2O60A 1W7JB 3FIAA 1JF2A 4MEWA 1IRJA 3CR4X 2KI6C 1CFCA 2M49B 1BMOA 2I7AA 1G4YR 1M63B 1XO5A 1ZACA 1XFXO 3SG6A 1OMDA 1JUOA 1QVIZ 1TCFA 2M8UA 4MVFA 1NCXA 4NDDA 3NSKA 4MN0A 3HCMA 1XFVO 1CFDA 1UHJA 2K8MB 2LVIA 1CLLA 3SIAA 3PFVA 4F0ZB 1J7OA 4XJKB 4MLWA 4QJ5B 2L4IA 3NSLA 2HETA 4PE4A 1DF0A 1D1OA 5CSIA 5ER5A 2K0JA 2K7BA 1QXPA 3GK4X 1KFXL 2LE9B 4CLNA 2WC8A 1KQVA 1BR1B 1KQMC 4QJ4B 2M29A 3CWGA 1SCMB 2JZIA 1UURA 2Y4QA 2MAZA 1K94A 1ALVA 1BR4B 1OOJA 1H8BA 5ER4X 2KFGA 2FCEA 3OX5A 3RLZA 1XK4C 1PK0D 1QX5B 3BQ3A 1UHHA 1ODBA 2WOSA 1Y1AA 1IGVA 2CNPA 1TRFA 1Y1XA 3GK1A 3PSRA 3EKJA 2O5GA 4I5JA 3PN7B 4MZKA 4N1FA 3LL8B 1FBVA 4P2YB 2LCPA 4XJKA 1SW8A 1S6IA 1BG1A 2OTGC 1FI6A 1EG3A 4L9MA 2I94A 4ETOA 2A4JA 2LANA 1IQ5A 4YI8A 5DKQA 1DJZA 2KFHA 2JXCA 3I5FB 1J55A 3BXKA 1GJYA 1B8LA 1DGVA 1KK7Z 3SG2A 1RTP1 2BL0C 2LMUA 1CM1A 4WQ2A 3TUYC 2MLFC 2KQ6A 1QIWA 4C0JA 1G33A 1MQ1A 1AVSA 1SL7A 2F33A 3I5GC 1YRUB 4GPLB 1N65A 1N0YA 1X02A 2Y5IA 4A4BA 2COLB 5TNCA 1CLBA 4GGFA 1B7TZ 2JNFA 1NYAA 1SPYA 1XFUO 1BLQA 1JWDA 3VRQA 1FF1A 2K2FA 3OHMB 1HQVA 1UUSA 2OS8B 1SBJA 3LK1A 1AK8A 1TIZA 4MZLA 1JC2A 1UP5A 4AQJA 3D0YB 3AAKA 3PALA 4WRIA 2JC2A 1CTRA 4I5LB 1N2DA 3I5HC 4HSZA 1MXLC 5DKRA 3BUMB 3C1VA 1S5GZ 5HKZA 1F8HA 1GGZA 2EC6C 2L0PA 4OVNF 1ZOTB 1WRZA 1WRKA 2F2PA 1TTXA 1DJHA 4I5KA 3CGAA 3ZNIA 1UWOA 1CMGA 4YGAA 2JT8A 2BECA 1K9UA 2PRUA 2Q4UA 3KEVA 1YTZC 4NDCA 3OB2B 3VGOA 2LV7A 2M0RA 3QRXA 1WLMA 3EK4A 1MF8B 1MR8A 3FWCA 3IF7A 1BJFA 3DVJA 2B1UA 2K7DA 2MRDA 1Q80A 2KI4B 2WCBA 1NX1A 2H61A 3MSEB 1B7TY 1UHNA 1CDNA 1SR6B 3DVMA 1SRAA 1C7WA 2D8NA 5JOLA 1L7ZA 5HLOA 1U5IB 2CBLA 2GGZA 4TNCA 1QV0A 1FPWA 3F45A 2BCAA 4JQ0D 2NLNA 4HREE 3SG4A 5FYXA 3BUOB 2IS9A 2H2KA 1CB1A 1JSAA 2L98A 2BCXA 3FWBA 4OKHA 1SCMC 3BYAA 1LA3A 3SG3A 3ICBA 3KHEA 5HKYA 1C07A 1WDCC 1S5GY 1SMGA 1Y0VH 2M97A 2RGIA 3AKBA 1L2OB 1UHIA 1SK6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PSR A;  2HQW A;  4DCK A;  4GGF C;  1YUT A;  1S6C A;  3HX4 A;  4BY5 A;  3JVT C;  3IQO A;  2LUX A;  4YGB B;  5I2O A;  2KYF A;  1XFY O;  3EVU A;  4ZCV A;  1J7Q A;  2JT3 A;  1A75 B;  1M39 A;  2ZRS A;  5KTY A;  3TDZ A;  1R2U A;  5I2Q A;  1QIV A;  4OCI A;  2SCP A;  2LHL A;  1S3P A;  1J7R A;  5AFP A;  3JTD C;  1KFU S;  2R2I A;  3I5I C;  4ORC B;  1B8R A;  1DJX A;  2K61 A;  1CMF A;  1K95 A;  1NWD A;  1FI5 A;  3OX6 A;  1YX7 A;  3I5F C;  3TZ1 A;  3D10 A;  1V1G A;  2NCP A;  3EVV A;  3LLE A;  5AXI A;  1C7V A;  1F4Q A;  1YX8 A;  2HQ8 A;  2KYC A;  1OSA A;  2ZND A;  1SKT A;  2KOT A;  2BKI B;  2BKH B;  2JUL A;  2FOT A;  5HLV A;  1CKK A;  4PE7 A;  1E8A A;  3WXA A;  1BOC A;  1SYM A;  1NIW A;  2M9G A;  3TS5 C;  4M2O A;  2LUC A;  3BOW B;  1K9P A;  3PLF B;  4OV2 A;  5J3X A;  1MHO A;  5B8I B;  1VRK A;  4MRY A;  1YRT B;  1LXF C;  5D69 A;  1RFJ A;  3OP0 A;  3VRP A;  5BPJ A;  1QVI Y;  1TOP A;  3DF0 B;  2PVB A;  2OS8 C;  3DD4 A;  2H61 C;  2M1U A;  2QPT A;  2SAS A;  4GFT A;  2OPO A;  1QLS A;  3NSI A;  3PM8 A;  2F3Z A;  3E3R A;  1EG4 A;  2PAS A;  1DMO A;  4CFR A;  1RRO A;  4PE1 A;  4DUQ A;  1GQM A;  5HKW A;  1K2H A;  3CS1 A;  2PMY A;  2Y1M A;  4XYN A;  3LK0 A;  3VRN A;  2LC5 A;  3KF9 A;  4GBA A;  2KFF A;  4C0L A;  1EL4 A;  4CFQ A;  1F71 A;  1CLM A;  1DTL A;  1EXR A;  2P6B B;  2ZN9 A;  2K2A A;  1KWO B;  3AKA A;  1OMV A;  1J1D A;  3DVK A;  2M7N A;  2JXL A;  1QTX A;  4MRX A;  4YGD B;  3AAJ A;  1F70 A;  1JBA A;  2MJW B;  1ALW A;  1ZUZ A;  2AUC A;  4NDB A;  1S6J A;  1KCY A;  4AOM A;  1A03 A;  2LLT A;  3CZT X;  1B1G A;  1NCZ A;  1NP8 A;  2WOR A;  3DF0 A;  2DOQ A;  1KK8 C;  1NX3 A;  2KI4 C;  1TNP A;  2LLU A;  4M2Q A;  1CDL A;  1S26 D;  1SR6 C;  1DJW A;  1OMR A;  2LM5 A;  2LP3 A;  2JU0 A;  5CSJ A;  1IKU A;  3WHT B;  2ZNE A;  1MUX A;  2BCB A;  5JJG A;  1LVC D;  1KFX S;  2NZ0 A;  5K89 A;  2JPT A;  1CM4 A;  4HRH A;  3CLN A;  1S1E A;  4MSP A;  4YBH B;  2KGB C;  4C0K A;  4USL A;  2KNE A;  1OE9 B;  1AHR A;  4ORB B;  4GUK A;  2KAV A;  1DT7 B;  1KK7 Y;  1SCV A;  3EK8 A;  4JPZ B;  1PRW A;  2WCE A;  1W7I B;  4DS7 A;  1GGW A;  1JFK A;  1Y6W A;  1WRL A;  2GV5 A;  5DKN A;  1A4P A;  2KBM A;  5IBW A;  2BL0 B;  2MA2 A;  1FW4 A;  4DRW A;  2JRF A;  4DIR A;  4UPG A;  3TUY B;  1NCY A;  3BUN B;  1OZO A;  2ZKM X;  4FQO A;  1DGU A;  2M7L A;  2BE4 A;  3D0Y A;  3WNX B;  4U8D A;  2M1K B;  2HF5 A;  2NCO A;  4PHN A;  2LAP A;  4E68 A;  3H4S E;  5CSF A;  5AEQ A;  1NX0 A;  1KSO A;  1F4O A;  1TNX A;  4PHK A;  3LCP C;  1ZFS A;  1YVL A;  2I18 A;  5F6T A;  1NPQ A;  3PAT A;  2BBN A;  3VRO A;  1XFZ O;  2CCM A;  2FJU B;  1F55 A;  1REC A;  1R6P A;  1B9A A;  3SG7 A;  1G8I A;  5G08 A;  3RM1 A;  4PAL A;  2K7O A;  3SJS A;  3I5H B;  1BU3 A;  1QLK A;  2EC6 B;  1XYD A;  2LMT A;  4QJ3 B;  2L2E A;  3PN7 C;  4PCW A;  2HPS A;  2MHH A;  1OZS A;  3ZWH A;  1LA0 A;  2G2B A;  1SY9 A;  2E6W A;  2LLS A;  3O4Y A;  1SNL A;  1IJ6 A;  1RK9 A;  4P5O E;  1JF0 A;  1J7P A;  4OR9 B;  1CDM A;  1U5I A;  2TN4 A;  2CXJ A;  2JQ6 A;  4AQI A;  4CID A;  1DJY A;  1B8C A;  2GGM A;  5HYD A;  2KAX A;  2LNK A;  2K7C A;  2JTT A;  3DVE A;  1KWO C;  1SL9 A;  5KSZ A;  2AAO A;  4PHJ A;  1MWN A;  1RWY A;  5AER A;  3K21 A;  4YRU A;  3O2P A;  3CR2 A;  5GQQ C;  4ICB A;  2V53 A;  1CFP A;  2JWW A;  4BY4 A;  1YUS A;  2ZN8 A;  2L5X B;  2KI6 D;  2LVJ A;  1A75 A;  4FTG A;  4R1E A;  2LMV A;  4HRG A;  1WDC B;  2L51 A;  2ZRT A;  1J1E A;  5CPV A;  2JTZ A;  1K9K A;  2LP2 A;  4YGC B;  1LKJ A;  1UHK A;  1ZMZ A;  3O6B A;  1TNQ A;  4Q04 A;  2BE6 A;  3JVT B;  2I2R E;  5I8N A;  1AUI B;  1S36 A;  1B4C A;  1SL8 A;  1A29 A;  3GK2 A;  4I5N B;  5D7F A;  1QAS A;  2AMI A;  3GOF A;  3JTD B;  4GNK B;  3I5I B;  2L50 A;  2PSR A;  1K93 D;  2BBM A;  1YUU A;  2F3Y A;  1NSH A;  3BOW A;  4ZCU A;  1IH0 A;  1TCO B;  2KAY A;  3IQQ A;  2KDH A;  1KQM B;  1A2X A;  3KPX A;  3WHU B;  1H4B A;  2KBI A;  4GGN A;  1CFF A;  4IL1 A;  2JNX A;  2MBX A;  2G9B A;  1XVJ A;  4MZJ A;  1OQP A;  3EVR A;  1AP4 A;  1JFJ A;  1BT6 A;  3KO0 A;  1BOD A;  1IJ5 A;  1NX2 A;  1QX2 A;  5AAN A;  1QV1 A;  3TS5 B;  3NXA A;  1M46 A;  4WQ3 A;  1KSM A;  1CDP A;  1M45 A;  3TDU A;  1NUB A;  4D1E A;  2JT0 A;  2Q91 A;  2WCF A;  1K8U A;  1B47 A;  1CNP A;  3SG5 A;  1DVI A;  1PVB A;  2E30 A;  2LHI A;  3OB1 B;  5PAL A;  1WY9 A;  3EK7 A;  5I2L A;  2CTN A;  2QAC A;  4N5X A;  4N1G A;  2M3W A;  1KFU L;  2JOJ A;  1IQ3 A;  1AJ5 A;  2OTG B;  1L2O C;  1M31 A;  1MXE A;  3CR5 X;  2EHB A;  2Y1N A;  1EJ3 A;  2LVK A;  4A4C A;  1AJ4 A;  1TN4 A;  2FCD A;  5CSN A;  4JWQ A;  2NXQ A;  1QX7 A;  3BUW B;  4M2P A;  1BF5 A;  1PAL A;  3SIB A;  2WND A;  2L4H A;  3NSO A;  4CPV A;  1IWQ A;  4GAO A;  1YR5 A;  1DJI A;  2F2O A;  4ORA B;  3O78 A;  1PVA A;  3A4U B;  2LVV A;  3I5G B;  5KU1 A;  1PSB A;  3TDI A;  1YUR A;  1XK4 A;  1QAT A;  1F54 A;  2VRG A;  2MLE C;  1EH2 A;  2KHN A;  1IG5 A;  1QS7 A;  4MBE A;  1QJT A;  4NQG A;  1K96 A;  3BUX B;  4PE0 A;  1DJG A;  3M0W A;  3CTN A;  1TNW A;  2ISD A;  1XA5 A;  1DF0 B;  1LIN A;  2PAL A;  4PHM A;  1XFW O;  2KSP A;  1KK8 B;  3VRR A;  2CT9 A;  1WLZ A;  2ZFD A;  2KQY A;  3FS7 A;  4YI9 A;  1PUL A;  1RJV A;  1Y1U A;  3A8R A;  2F8P A;  2EGD A;  3EKH A;  2KGR A;  1V1F A;  1HT9 A;  1YVH A;  4PDZ A;  1K90 D;  4YGE B;  2O60 A;  1W7J B;  3FIA A;  1JF2 A;  4MEW A;  1IRJ A;  3CR4 X;  2KI6 C;  1CFC A;  2M49 B;  1BMO A;  2I7A A;  1G4Y R;  1M63 B;  1XO5 A;  1ZAC A;  1XFX O;  3SG6 A;  1OMD A;  1JUO A;  1QVI Z;  1TCF A;  2M8U A;  4MVF A;  1NCX A;  4NDD A;  3NSK A;  4MN0 A;  3HCM A;  1XFV O;  1CFD A;  1UHJ A;  2K8M B;  2LVI A;  1CLL A;  3SIA A;  3PFV A;  4F0Z B;  1J7O A;  4XJK B;  4MLW A;  4QJ5 B;  2L4I A;  3NSL A;  2HET A;  4PE4 A;  1DF0 A;  1D1O A;  5CSI A;  5ER5 A;  2K0J A;  2K7B A;  1QXP A;  3GK4 X;  1KFX L;  2LE9 B;  4CLN A;  2WC8 A;  1KQV A;  1BR1 B;  1KQM C;  4QJ4 B;  2M29 A;  3CWG A;  1SCM B;  2JZI A;  1UUR A;  2Y4Q A;  2MAZ A;  1K94 A;  1ALV A;  1BR4 B;  1OOJ A;  1H8B A;  5ER4 X;  2KFG A;  2FCE A;  3OX5 A;  3RLZ A;  1XK4 C;  1PK0 D;  1QX5 B;  3BQ3 A;  1UHH A;  1ODB A;  2WOS A;  1Y1A A;  1IGV A;  2CNP A;  1TRF A;  1Y1X A;  3GK1 A;  3PSR A;  3EKJ A;  2O5G A;  4I5J A;  3PN7 B;  4MZK A;  4N1F A;  3LL8 B;  1FBV A;  4P2Y B;  2LCP A;  4XJK A;  1SW8 A;  1S6I A;  1BG1 A;  2OTG C;  1FI6 A;  1EG3 A;  4L9M A;  2I94 A;  4ETO A;  2A4J A;  2LAN A;  1IQ5 A;  4YI8 A;  5DKQ A;  1DJZ A;  2KFH A;  2JXC A;  3I5F B;  1J55 A;  3BXK A;  1GJY A;  1B8L A;  1DGV A;  1KK7 Z;  3SG2 A;  1RTP 1;  2BL0 C;  2LMU A;  1CM1 A;  4WQ2 A;  3TUY C;  2MLF C;  2KQ6 A;  1QIW A;  4C0J A;  1G33 A;  1MQ1 A;  1AVS A;  1SL7 A;  2F33 A;  3I5G C;  1YRU B;  4GPL B;  1N65 A;  1N0Y A;  1X02 A;  2Y5I A;  4A4B A;  2COL B;  5TNC A;  1CLB A;  4GGF A;  1B7T Z;  2JNF A;  1NYA A;  1SPY A;  1XFU O;  1BLQ A;  1JWD A;  3VRQ A;  1FF1 A;  2K2F A;  3OHM B;  1HQV A;  1UUS A;  2OS8 B;  1SBJ A;  3LK1 A;  1AK8 A;  1TIZ A;  4MZL A;  1JC2 A;  1UP5 A;  4AQJ A;  3D0Y B;  3AAK A;  3PAL A;  4WRI A;  2JC2 A;  1CTR A;  4I5L B;  1N2D A;  3I5H C;  4HSZ A;  1MXL C;  5DKR A;  3BUM B;  3C1V A;  1S5G Z;  5HKZ A;  1F8H A;  1GGZ A;  2EC6 C;  2L0P A;  4OVN F;  1ZOT B;  1WRZ A;  1WRK A;  2F2P A;  1TTX A;  1DJH A;  4I5K A;  3CGA A;  3ZNI A;  1UWO A;  1CMG A;  4YGA A;  2JT8 A;  2BEC A;  1K9U A;  2PRU A;  2Q4U A;  3KEV A;  1YTZ C;  4NDC A;  3OB2 B;  3VGO A;  2LV7 A;  2M0R A;  3QRX A;  1WLM A;  3EK4 A;  1MF8 B;  1MR8 A;  3FWC A;  3IF7 A;  1BJF A;  3DVJ A;  2B1U A;  2K7D A;  2MRD A;  1Q80 A;  2KI4 B;  2WCB A;  1NX1 A;  2H61 A;  3MSE B;  1B7T Y;  1UHN A;  1CDN A;  1SR6 B;  3DVM A;  1SRA A;  1C7W A;  2D8N A;  5JOL A;  1L7Z A;  5HLO A;  1U5I B;  2CBL A;  2GGZ A;  4TNC A;  1QV0 A;  1FPW A;  3F45 A;  2BCA A;  4JQ0 D;  2NLN A;  4HRE E;  3SG4 A;  5FYX A;  3BUO B;  2IS9 A;  2H2K A;  1CB1 A;  1JSA A;  2L98 A;  2BCX A;  3FWB A;  4OKH A;  1SCM C;  3BYA A;  1LA3 A;  3SG3 A;  3ICB A;  3KHE A;  5HKY A;  1C07 A;  1WDC C;  1S5G Y;  1SMG A;  1Y0V H;  2M97 A;  2RGI A;  3AKB A;  1L2O B;  1UHI A;  1SK6 D; 
#chains in the Genus database with same CATH topology
 1PSR A;  2HQW A;  4DCK A;  4GGF C;  1YUT A;  1S6C A;  3HX4 A;  4BY5 A;  3FE9 A;  3JVT C;  3IQO A;  2LUX A;  4YGB B;  5I2O A;  2KYF A;  1XFY O;  3EVU A;  4ZCV A;  1J7Q A;  2JT3 A;  1A75 B;  1M39 A;  2ZRS A;  5FI7 A;  3TDZ A;  3UNW A;  1R2U A;  5I2Q A;  5KTY A;  1QIV A;  4OCI A;  2SCP A;  2LHL A;  1S3P A;  1J7R A;  5AFP A;  3JTD C;  1KFU S;  2R2I A;  3I5I C;  4ORC B;  2ERB A;  1B8R A;  1DJX A;  2K61 A;  3RZS A;  1CMF A;  1K95 A;  1NWD A;  1FI5 A;  3OX6 A;  1YX7 A;  3I5F C;  3TZ1 A;  3D10 A;  1V1G A;  2NCP A;  3EVV A;  3LLE A;  5AXI A;  2QDI A;  3S0F A;  1C7V A;  1F4Q A;  1YX8 A;  2HQ8 A;  2KYC A;  1OSA A;  2ZND A;  1SKT A;  2KOT A;  2BKI B;  2BKH B;  2JUL A;  3DZT A;  2FOT A;  5HLV A;  1CKK A;  3VB1 A;  3NHI A;  1E8A A;  4PE7 A;  3WXA A;  1BOC A;  3D75 A;  1SYM A;  1NIW A;  2M9G A;  3TS5 C;  4M2O A;  2LUC A;  3BOW B;  1K9P A;  3PLF B;  4OV2 A;  5J3X A;  1MHO A;  5B8I B;  1VRK A;  4MRY A;  1YRT B;  3L4A A;  2KPH A;  1LXF C;  5D69 A;  1RFJ A;  3OP0 A;  3VRP A;  5BPJ A;  5FI6 A;  1QVI Y;  1TOP A;  3DF0 B;  2PVB A;  2OS8 C;  3DD4 A;  2H61 C;  2M1U A;  2QPT A;  2SAS A;  4GFT A;  2OPO A;  1QLS A;  3NSI A;  3PM8 A;  2F3Z A;  2WCM A;  3E3R A;  1EG4 A;  2PAS A;  3NHT A;  3QME A;  1RRO A;  4PE1 A;  4CFR A;  1DMO A;  4DUQ A;  1GQM A;  5HKW A;  1K2H A;  3CS1 A;  2PMY A;  2WCK A;  2Y1M A;  4XYN A;  3LK0 A;  3VRN A;  2LC5 A;  3KF9 A;  4GBA A;  2KFF A;  4C0L A;  1EL4 A;  4CFQ A;  3DY9 A;  1F71 A;  2L2C A;  1CLM A;  1DTL A;  1EXR A;  2P6B B;  2ZN9 A;  2K2A A;  3CZ0 A;  1KWO B;  2FJY A;  3AKA A;  4JD9 A;  1OMV A;  1J1D A;  1Z2C B;  2M7N A;  2JXL A;  1QTX A;  3DVK A;  4MRX A;  4YGD B;  3AAJ A;  1F70 A;  1JBA A;  2MJW B;  1ALW A;  1ZUZ A;  2AUC A;  2QEH A;  4NDB A;  3UO9 A;  1S6J A;  1KCY A;  4AOM A;  1A03 A;  2LLT A;  3CZT X;  1B1G A;  1NCZ A;  1NP8 A;  2WOR A;  3DF0 A;  2DOQ A;  1KK8 C;  1Z4H A;  1NX3 A;  1TNP A;  2KI4 C;  2LLU A;  4M2Q A;  1CDL A;  1P28 A;  1S26 D;  1SR6 C;  3L4L A;  1DJW A;  1OMR A;  2LM5 A;  2LP3 A;  2JU0 A;  5CSJ A;  3SS5 A;  1IKU A;  3WHT B;  2ZNE A;  1MUX A;  2BCB A;  3Q8I A;  5JJG A;  1LVC D;  1KFX S;  2NZ0 A;  5K89 A;  2JPT A;  1CM4 A;  2QEB A;  4HRH A;  3CLN A;  1S1E A;  4MSP A;  4YBH B;  2KGB C;  4C0K A;  4USL A;  2KNE A;  1OE9 B;  1AHR A;  4ORB B;  4GUK A;  2KAV A;  1DT7 B;  1KK7 Y;  1SCV A;  3EK8 A;  4JPZ B;  1PRW A;  2WCE A;  1W7I B;  4DS7 A;  1GGW A;  1JFK A;  1Y6W A;  1WRL A;  2GV5 A;  5DKN A;  1A4P A;  2KBM A;  5IBW A;  2BL0 B;  2MA2 A;  1FW4 A;  4OZD A;  4F7F A;  4DRW A;  2JRF A;  4DIR A;  4UPG A;  3TUY B;  1C3Z A;  1NCY A;  1OZO A;  2ZKM X;  3BUN B;  4FQO A;  1DGU A;  2M7L A;  2BE4 A;  3D0Y A;  3WNX B;  4U8D A;  2M1K B;  2HF5 A;  2NCO A;  4PHN A;  3IVT A;  2LAP A;  1DQE A;  4E68 A;  3H4S E;  5CSF A;  5AEQ A;  4IJ7 A;  1NX0 A;  1KSO A;  1F4O A;  1TNX A;  4PHK A;  3LCP C;  1ZFS A;  3DYE A;  3PJI A;  1YVL A;  2I18 A;  5F6T A;  1NPQ A;  3PAT A;  2BBN A;  3N7H A;  3VRO A;  1XFZ O;  2CCM A;  2FJU B;  1F55 A;  1REC A;  1XFR A;  1R6P A;  1B9A A;  3SG7 A;  1G8I A;  5G08 A;  3RM1 A;  4PAL A;  2K7O A;  3SJS A;  3I5H B;  1BU3 A;  1QLK A;  2EC6 B;  1XYD A;  2LMT A;  4QJ3 B;  2L2E A;  3OGN A;  2WC6 A;  3D74 A;  3PN7 C;  4PCW A;  2HPS A;  3BFH A;  2MHH A;  1OZS A;  3ZWH A;  1LA0 A;  2G2B A;  1SY9 A;  1TWO A;  2E6W A;  2LLS A;  3O4Y A;  1SNL A;  1IJ6 A;  1RK9 A;  4P5O E;  1JF0 A;  2GTE A;  1J7P A;  4OR9 B;  1CDM A;  1U5I A;  2TN4 A;  2CXJ A;  2JQ6 A;  4AQI A;  4CID A;  1DJY A;  1B8C A;  2GGM A;  5HYD A;  3B87 A;  2KAX A;  2LNK A;  2WCH A;  3D76 A;  4PT1 A;  2H8V A;  2K7C A;  2KLE A;  2JTT A;  3DVE A;  1KWO C;  1SL9 A;  5FI2 A;  5KSZ A;  2AAO A;  3FE6 A;  3R1O A;  4PHJ A;  1MWN A;  1RWY A;  3PM2 A;  5AER A;  3K21 A;  3V2L A;  4YRU A;  3O2P A;  3CR2 A;  5GQQ C;  4ICB A;  2V53 A;  1CFP A;  2JWW A;  4BY4 A;  1YUS A;  2ZN8 A;  2L5X B;  2KI6 D;  2LVJ A;  1A75 A;  4FTG A;  4R1E A;  2LMV A;  3DXL A;  4HRG A;  1WDC B;  2L51 A;  2ZRT A;  1J1E A;  5CPV A;  3SS4 A;  2JTZ A;  1K9K A;  2LP2 A;  4YGC B;  1LKJ A;  1UHK A;  1ZMZ A;  3O6B A;  1TNQ A;  4Q04 A;  2BE6 A;  3JVT B;  2I2R E;  5I8N A;  3CYZ A;  1AUI B;  1S36 A;  1B4C A;  1SL8 A;  1A29 A;  3GK2 A;  4I5N B;  5D7F A;  1QAS A;  4FQT A;  2AMI A;  3GOF A;  3JTD B;  4GNK B;  3I5I B;  2L50 A;  2PSR A;  1K93 D;  2KLD A;  2BBM A;  1YUU A;  1OOF A;  2F3Y A;  1NSH A;  3BOW A;  4ZCU A;  1DEL A;  1TCO B;  2KAY A;  3IQQ A;  2KDH A;  1KQM B;  1IH0 A;  1A2X A;  3KPX A;  3WHU B;  1H4B A;  2KBI A;  4GGN A;  1CFF A;  3R1V A;  4IL1 A;  2JNX A;  2MBX A;  2G9B A;  5EL2 A;  1XVJ A;  4MZJ A;  1OQP A;  3EVR A;  1AP4 A;  1JFJ A;  1BT6 A;  3KO0 A;  1BOD A;  1IJ5 A;  1NX2 A;  1TUJ A;  1QX2 A;  5AAN A;  1QV1 A;  3TS5 B;  3NXA A;  1M46 A;  4WQ3 A;  1KSM A;  1CDP A;  1M45 A;  3TDU A;  1NUB A;  4D1E A;  2JT0 A;  2Q91 A;  2WCF A;  1K8U A;  1B47 A;  1CNP A;  3SG5 A;  1DVI A;  1PVB A;  2E30 A;  2LHI A;  3OB1 B;  5PAL A;  1WY9 A;  3EK7 A;  3B6X A;  5I2L A;  2CTN A;  3NGV A;  2QAC A;  4N5X A;  4N1G A;  2WCL A;  2M3W A;  1KFU L;  2JOJ A;  1IQ3 A;  1AJ5 A;  2OTG B;  1L2O C;  1M31 A;  4INX A;  1MXE A;  3CR5 X;  2EHB A;  2Y1N A;  1EJ3 A;  2LVK A;  4A4C A;  3O4X A;  1AJ4 A;  3D78 A;  1TN4 A;  2FCD A;  5CSN A;  3CZ1 A;  2NXQ A;  4JWQ A;  1QX7 A;  3BUW B;  4M2P A;  1BF5 A;  1PAL A;  3S0B A;  3SIB A;  2WND A;  2L4H A;  3FE8 A;  3NSO A;  4CPV A;  1IWQ A;  4GAO A;  1YR5 A;  1DJI A;  2F2O A;  5HL1 A;  5DIC A;  4ORA B;  3O78 A;  1PVA A;  3A4U B;  2LVV A;  3I5G B;  5KU1 A;  1PSB A;  3TDI A;  1YUR A;  1XK4 A;  1QAT A;  1F54 A;  2VRG A;  2MLE C;  1EH2 A;  2KHN A;  1IG5 A;  2QEO A;  1QS7 A;  4MBE A;  1QJT A;  3S0D A;  4NQG A;  1K96 A;  3BUX B;  4PE0 A;  1DJG A;  3M0W A;  3CTN A;  1TNW A;  2ISD A;  1XA5 A;  1DF0 B;  1LIN A;  2PAL A;  4PHM A;  1XFW O;  2KSP A;  1KK8 B;  2P70 A;  4INW A;  3VRR A;  2CT9 A;  1WLZ A;  2ZFD A;  2KQY A;  3FS7 A;  4YI9 A;  1PUL A;  1RJV A;  1Y1U A;  3A8R A;  4KYN A;  2F8P A;  2EGD A;  3EKH A;  2KGR A;  1V1F A;  1HT9 A;  1YVH A;  4PDZ A;  1K90 D;  4YGE B;  2O60 A;  1W7J B;  3FIA A;  1JF2 A;  4MEW A;  1IRJ A;  3CR4 X;  2KI6 C;  1CFC A;  2M49 B;  1BMO A;  2I7A A;  1G4Y R;  1M63 B;  1XO5 A;  1TUZ A;  1C3Y A;  1ZAC A;  1XFX O;  2P71 A;  3SG6 A;  1OMD A;  1JUO A;  1QVI Z;  1TCF A;  2M8U A;  2PQL A;  1NCX A;  4MVF A;  4NDD A;  3NSK A;  4MN0 A;  3HCM A;  1XFV O;  1CFD A;  1UHJ A;  2K8M B;  2LVI A;  1CLL A;  3SIA A;  3PFV A;  5D3O A;  4F0Z B;  1J7O A;  4XJK B;  1QWV A;  4MLW A;  1SSE B;  4QJ5 B;  2L4I A;  3NSL A;  2HET A;  4PE4 A;  1DF0 A;  1D1O A;  3BFB A;  5CSI A;  5ER5 A;  1CDN A;  4JKT A;  2K0J A;  2K7B A;  1QXP A;  3GK4 X;  1KFX L;  2LE9 B;  3EG5 B;  4CLN A;  2WC8 A;  1KQV A;  2WCJ A;  3B88 A;  1BR1 B;  1KQM C;  4QJ4 B;  2M29 A;  3CWG A;  1SCM B;  2JZI A;  3OBV A;  1UUR A;  2Y4Q A;  3S0E A;  2MAZ A;  1K94 A;  1ORG A;  1ALV A;  1BR4 B;  1OOJ A;  1H8B A;  5ER4 X;  2KFG A;  2FCE A;  3OX5 A;  1IIO A;  3RLZ A;  1OOI X;  1PK0 D;  1XK4 C;  1QX5 B;  3BQ3 A;  1UHH A;  1ODB A;  2WOS A;  1Y1A A;  1IGV A;  2CNP A;  1TRF A;  1Y1X A;  3GK1 A;  3PSR A;  3EKJ A;  2O5G A;  4I5J A;  5I94 A;  3PN7 B;  4MZK A;  4N1F A;  3S0A A;  3LL8 B;  2JPO A;  2QEV A;  1FBV A;  4P2Y B;  2LCP A;  4XJK A;  1SW8 A;  1S6I A;  1BG1 A;  2OTG C;  1FI6 A;  1EG3 A;  4L9M A;  2I94 A;  4ETO A;  2A4J A;  2LAN A;  3B7A A;  1IQ5 A;  4YI8 A;  5DKQ A;  1DJZ A;  2KFH A;  2JXC A;  3I5F B;  1J55 A;  3BXK A;  1GJY A;  1B8L A;  1DGV A;  3CDN A;  1KK7 Z;  3CZ2 A;  3D73 A;  1RTP 1;  3SG2 A;  2BL0 C;  2LMU A;  1DEK A;  1CM1 A;  4WQ2 A;  3R72 A;  3TUY C;  2MLF C;  2KQ6 A;  1QIW A;  4C0J A;  1G33 A;  1MQ1 A;  1AVS A;  1SL7 A;  2F33 A;  3I5G C;  1YRU B;  4GPL B;  1N65 A;  1N0Y A;  1X02 A;  2Y5I A;  2BAP A;  3S0G A;  2COL B;  3BFA A;  3BJH A;  5TNC A;  4A4B A;  1CLB A;  4GGF A;  1B7T Z;  2JNF A;  1NYA A;  1SPY A;  1XFU O;  1BLQ A;  1JWD A;  3VRQ A;  1FF1 A;  2K2F A;  3OHM B;  1HQV A;  2K60 A;  1UUS A;  3L47 A;  2OS8 B;  1SBJ A;  2YGU A;  3LK1 A;  1AK8 A;  3R1P A;  1TIZ A;  2L5Y A;  4MZL A;  1JC2 A;  1UP5 A;  3CAB A;  4AQJ A;  3D0Y B;  3AAK A;  3PAL A;  4WRI A;  2JC2 A;  1CTR A;  1GM0 A;  4I5L B;  1N2D A;  3I5H C;  4HSZ A;  1MXL C;  5DKR A;  3BUM B;  3C1V A;  1S5G Z;  5HKZ A;  2WC5 A;  1F8H A;  1GGZ A;  2EC6 C;  2L0P A;  4OVN F;  1ZOT B;  1WRZ A;  1WRK A;  2F2P A;  1TTX A;  1DJH A;  1DC1 A;  2PYQ A;  3CGA A;  4I5K A;  1UWO A;  3ZNI A;  1CMG A;  4YGA A;  2JT8 A;  2BEC A;  1K9U A;  3D77 A;  2PRU A;  2Q4U A;  3KEV A;  1OW4 A;  1YTZ C;  4NDC A;  3OB2 B;  3SS3 A;  3VGO A;  2LV7 A;  2M0R A;  3QRX A;  1WLM A;  3EK4 A;  1LS8 A;  1MF8 B;  1MR8 A;  3FWC A;  3IF7 A;  1BJF A;  3DVJ A;  2B1U A;  1OOG A;  2K7D A;  2MRD A;  1Q80 A;  2KI4 B;  2WCB A;  1NX1 A;  1W9Z A;  2H61 A;  1B7T Y;  1UHN A;  3MSE B;  1SR6 B;  3DVM A;  1SRA A;  1C7W A;  2D8N A;  5JOL A;  1L7Z A;  5HLO A;  1U5I B;  2CBL A;  2GGZ A;  4TNC A;  1QV0 A;  1FPW A;  3F45 A;  2BCA A;  4JQ0 D;  2BNX A;  2NLN A;  4HRE E;  3SG4 A;  5FYX A;  3BUO B;  2IS9 A;  2H2K A;  3K1E A;  1CB1 A;  3B86 A;  1JSA A;  2L98 A;  2BCX A;  3FWB A;  4OKH A;  1SCM C;  3BYA A;  1LA3 A;  1T14 A;  3SG3 A;  3ICB A;  3KHE A;  5HKY A;  1C07 A;  1WDC C;  1S5G Y;  1SMG A;  1Y0V H;  2M97 A;  2RGI A;  3AKB A;  1L2O B;  1UHI A;  1OOH A;  1SK6 D; 
#chains in the Genus database with same CATH homology
 1PSR A;  2HQW A;  4DCK A;  4GGF C;  1YUT A;  1S6C A;  3HX4 A;  4BY5 A;  3JVT C;  3IQO A;  2LUX A;  4YGB B;  5I2O A;  2KYF A;  1XFY O;  3EVU A;  4ZCV A;  1J7Q A;  2JT3 A;  1A75 B;  1M39 A;  2ZRS A;  5KTY A;  3TDZ A;  1R2U A;  5I2Q A;  1QIV A;  4OCI A;  2SCP A;  2LHL A;  1S3P A;  1J7R A;  5AFP A;  3JTD C;  1KFU S;  2R2I A;  3I5I C;  4ORC B;  1B8R A;  1DJX A;  2K61 A;  1CMF A;  1K95 A;  1NWD A;  1FI5 A;  3OX6 A;  1YX7 A;  3I5F C;  3TZ1 A;  3D10 A;  1V1G A;  2NCP A;  3EVV A;  3LLE A;  5AXI A;  1C7V A;  1F4Q A;  1YX8 A;  2HQ8 A;  2KYC A;  1OSA A;  2ZND A;  1SKT A;  2KOT A;  2BKI B;  2BKH B;  2JUL A;  2FOT A;  5HLV A;  1CKK A;  4PE7 A;  1E8A A;  3WXA A;  1BOC A;  1SYM A;  1NIW A;  2M9G A;  3TS5 C;  4M2O A;  2LUC A;  3BOW B;  1K9P A;  3PLF B;  4OV2 A;  5J3X A;  1MHO A;  5B8I B;  1VRK A;  4MRY A;  1YRT B;  1LXF C;  5D69 A;  1RFJ A;  3OP0 A;  3VRP A;  5BPJ A;  1QVI Y;  1TOP A;  3DF0 B;  2PVB A;  2OS8 C;  3DD4 A;  2H61 C;  2M1U A;  2QPT A;  2SAS A;  4GFT A;  2OPO A;  1QLS A;  3NSI A;  3PM8 A;  2F3Z A;  3E3R A;  1EG4 A;  2PAS A;  1DMO A;  4CFR A;  1RRO A;  4PE1 A;  4DUQ A;  1GQM A;  5HKW A;  1K2H A;  3CS1 A;  2PMY A;  2Y1M A;  4XYN A;  3LK0 A;  3VRN A;  2LC5 A;  3KF9 A;  4GBA A;  2KFF A;  4C0L A;  1EL4 A;  4CFQ A;  1F71 A;  1CLM A;  1DTL A;  1EXR A;  2P6B B;  2ZN9 A;  2K2A A;  1KWO B;  3AKA A;  1OMV A;  1J1D A;  3DVK A;  2M7N A;  2JXL A;  1QTX A;  4MRX A;  4YGD B;  3AAJ A;  1F70 A;  1JBA A;  2MJW B;  1ALW A;  1ZUZ A;  2AUC A;  4NDB A;  1S6J A;  1KCY A;  4AOM A;  1A03 A;  2LLT A;  3CZT X;  1B1G A;  1NCZ A;  1NP8 A;  2WOR A;  3DF0 A;  2DOQ A;  1KK8 C;  1NX3 A;  2KI4 C;  1TNP A;  2LLU A;  4M2Q A;  1CDL A;  1S26 D;  1SR6 C;  1DJW A;  1OMR A;  2LM5 A;  2LP3 A;  2JU0 A;  5CSJ A;  1IKU A;  3WHT B;  2ZNE A;  1MUX A;  2BCB A;  5JJG A;  1LVC D;  1KFX S;  2NZ0 A;  5K89 A;  2JPT A;  1CM4 A;  4HRH A;  3CLN A;  1S1E A;  4MSP A;  4YBH B;  2KGB C;  4C0K A;  4USL A;  2KNE A;  1OE9 B;  1AHR A;  4ORB B;  4GUK A;  2KAV A;  1DT7 B;  1KK7 Y;  1SCV A;  3EK8 A;  4JPZ B;  1PRW A;  2WCE A;  1W7I B;  4DS7 A;  1GGW A;  1JFK A;  1Y6W A;  1WRL A;  2GV5 A;  5DKN A;  1A4P A;  2KBM A;  5IBW A;  2BL0 B;  2MA2 A;  1FW4 A;  4DRW A;  2JRF A;  4DIR A;  4UPG A;  3TUY B;  1NCY A;  3BUN B;  1OZO A;  2ZKM X;  4FQO A;  1DGU A;  2M7L A;  2BE4 A;  3D0Y A;  3WNX B;  4U8D A;  2M1K B;  2HF5 A;  2NCO A;  4PHN A;  2LAP A;  4E68 A;  3H4S E;  5CSF A;  5AEQ A;  1NX0 A;  1KSO A;  1F4O A;  1TNX A;  4PHK A;  3LCP C;  1ZFS A;  1YVL A;  2I18 A;  5F6T A;  1NPQ A;  3PAT A;  2BBN A;  3VRO A;  1XFZ O;  2CCM A;  2FJU B;  1F55 A;  1REC A;  1R6P A;  1B9A A;  3SG7 A;  1G8I A;  5G08 A;  3RM1 A;  4PAL A;  2K7O A;  3SJS A;  3I5H B;  1BU3 A;  1QLK A;  2EC6 B;  1XYD A;  2LMT A;  4QJ3 B;  2L2E A;  3PN7 C;  4PCW A;  2HPS A;  2MHH A;  1OZS A;  3ZWH A;  1LA0 A;  2G2B A;  1SY9 A;  2E6W A;  2LLS A;  3O4Y A;  1SNL A;  1IJ6 A;  1RK9 A;  4P5O E;  1JF0 A;  1J7P A;  4OR9 B;  1CDM A;  1U5I A;  2TN4 A;  2CXJ A;  2JQ6 A;  4AQI A;  4CID A;  1DJY A;  1B8C A;  2GGM A;  5HYD A;  2KAX A;  2LNK A;  2K7C A;  2JTT A;  3DVE A;  1KWO C;  1SL9 A;  5KSZ A;  2AAO A;  4PHJ A;  1MWN A;  1RWY A;  5AER A;  3K21 A;  4YRU A;  3O2P A;  3CR2 A;  5GQQ C;  4ICB A;  2V53 A;  1CFP A;  2JWW A;  4BY4 A;  1YUS A;  2ZN8 A;  2L5X B;  2KI6 D;  2LVJ A;  1A75 A;  4FTG A;  4R1E A;  2LMV A;  4HRG A;  1WDC B;  2L51 A;  2ZRT A;  1J1E A;  5CPV A;  2JTZ A;  1K9K A;  2LP2 A;  4YGC B;  1LKJ A;  1UHK A;  1ZMZ A;  3O6B A;  1TNQ A;  4Q04 A;  2BE6 A;  3JVT B;  2I2R E;  5I8N A;  1AUI B;  1S36 A;  1B4C A;  1SL8 A;  1A29 A;  3GK2 A;  4I5N B;  5D7F A;  1QAS A;  2AMI A;  3GOF A;  3JTD B;  4GNK B;  3I5I B;  2L50 A;  2PSR A;  1K93 D;  2BBM A;  1YUU A;  2F3Y A;  1NSH A;  3BOW A;  4ZCU A;  1IH0 A;  1TCO B;  2KAY A;  3IQQ A;  2KDH A;  1KQM B;  1A2X A;  3KPX A;  3WHU B;  1H4B A;  2KBI A;  4GGN A;  1CFF A;  4IL1 A;  2JNX A;  2MBX A;  2G9B A;  1XVJ A;  4MZJ A;  1OQP A;  3EVR A;  1AP4 A;  1JFJ A;  1BT6 A;  3KO0 A;  1BOD A;  1IJ5 A;  1NX2 A;  1QX2 A;  5AAN A;  1QV1 A;  3TS5 B;  3NXA A;  1M46 A;  4WQ3 A;  1KSM A;  1CDP A;  1M45 A;  3TDU A;  1NUB A;  4D1E A;  2JT0 A;  2Q91 A;  2WCF A;  1K8U A;  1B47 A;  1CNP A;  3SG5 A;  1DVI A;  1PVB A;  2E30 A;  2LHI A;  3OB1 B;  5PAL A;  1WY9 A;  3EK7 A;  5I2L A;  2CTN A;  2QAC A;  4N5X A;  4N1G A;  2M3W A;  1KFU L;  2JOJ A;  1IQ3 A;  1AJ5 A;  2OTG B;  1L2O C;  1M31 A;  1MXE A;  3CR5 X;  2EHB A;  2Y1N A;  1EJ3 A;  2LVK A;  4A4C A;  1AJ4 A;  1TN4 A;  2FCD A;  5CSN A;  4JWQ A;  2NXQ A;  1QX7 A;  3BUW B;  4M2P A;  1BF5 A;  1PAL A;  3SIB A;  2WND A;  2L4H A;  3NSO A;  4CPV A;  1IWQ A;  4GAO A;  1YR5 A;  1DJI A;  2F2O A;  4ORA B;  3O78 A;  1PVA A;  3A4U B;  2LVV A;  3I5G B;  5KU1 A;  1PSB A;  3TDI A;  1YUR A;  1XK4 A;  1QAT A;  1F54 A;  2VRG A;  2MLE C;  1EH2 A;  2KHN A;  1IG5 A;  1QS7 A;  4MBE A;  1QJT A;  4NQG A;  1K96 A;  3BUX B;  4PE0 A;  1DJG A;  3M0W A;  3CTN A;  1TNW A;  2ISD A;  1XA5 A;  1DF0 B;  1LIN A;  2PAL A;  4PHM A;  1XFW O;  2KSP A;  1KK8 B;  3VRR A;  2CT9 A;  1WLZ A;  2ZFD A;  2KQY A;  3FS7 A;  4YI9 A;  1PUL A;  1RJV A;  1Y1U A;  3A8R A;  2F8P A;  2EGD A;  3EKH A;  2KGR A;  1V1F A;  1HT9 A;  1YVH A;  4PDZ A;  1K90 D;  4YGE B;  2O60 A;  1W7J B;  3FIA A;  1JF2 A;  4MEW A;  1IRJ A;  3CR4 X;  2KI6 C;  1CFC A;  2M49 B;  1BMO A;  2I7A A;  1G4Y R;  1M63 B;  1XO5 A;  1ZAC A;  1XFX O;  3SG6 A;  1OMD A;  1JUO A;  1QVI Z;  1TCF A;  2M8U A;  4MVF A;  1NCX A;  4NDD A;  3NSK A;  4MN0 A;  3HCM A;  1XFV O;  1CFD A;  1UHJ A;  2K8M B;  2LVI A;  1CLL A;  3SIA A;  3PFV A;  4F0Z B;  1J7O A;  4XJK B;  4MLW A;  4QJ5 B;  2L4I A;  3NSL A;  2HET A;  4PE4 A;  1DF0 A;  1D1O A;  5CSI A;  5ER5 A;  2K0J A;  2K7B A;  1QXP A;  3GK4 X;  1KFX L;  2LE9 B;  4CLN A;  2WC8 A;  1KQV A;  1BR1 B;  1KQM C;  4QJ4 B;  2M29 A;  3CWG A;  1SCM B;  2JZI A;  1UUR A;  2Y4Q A;  2MAZ A;  1K94 A;  1ALV A;  1BR4 B;  1OOJ A;  1H8B A;  5ER4 X;  2KFG A;  2FCE A;  3OX5 A;  3RLZ A;  1XK4 C;  1PK0 D;  1QX5 B;  3BQ3 A;  1UHH A;  1ODB A;  2WOS A;  1Y1A A;  1IGV A;  2CNP A;  1TRF A;  1Y1X A;  3GK1 A;  3PSR A;  3EKJ A;  2O5G A;  4I5J A;  3PN7 B;  4MZK A;  4N1F A;  3LL8 B;  1FBV A;  4P2Y B;  2LCP A;  4XJK A;  1SW8 A;  1S6I A;  1BG1 A;  2OTG C;  1FI6 A;  1EG3 A;  4L9M A;  2I94 A;  4ETO A;  2A4J A;  2LAN A;  1IQ5 A;  4YI8 A;  5DKQ A;  1DJZ A;  2KFH A;  2JXC A;  3I5F B;  1J55 A;  3BXK A;  1GJY A;  1B8L A;  1DGV A;  1KK7 Z;  3SG2 A;  1RTP 1;  2BL0 C;  2LMU A;  1CM1 A;  4WQ2 A;  3TUY C;  2MLF C;  2KQ6 A;  1QIW A;  4C0J A;  1G33 A;  1MQ1 A;  1AVS A;  1SL7 A;  2F33 A;  3I5G C;  1YRU B;  4GPL B;  1N65 A;  1N0Y A;  1X02 A;  2Y5I A;  4A4B A;  2COL B;  5TNC A;  1CLB A;  4GGF A;  1B7T Z;  2JNF A;  1NYA A;  1SPY A;  1XFU O;  1BLQ A;  1JWD A;  3VRQ A;  1FF1 A;  2K2F A;  3OHM B;  1HQV A;  1UUS A;  2OS8 B;  1SBJ A;  3LK1 A;  1AK8 A;  1TIZ A;  4MZL A;  1JC2 A;  1UP5 A;  4AQJ A;  3D0Y B;  3AAK A;  3PAL A;  4WRI A;  2JC2 A;  1CTR A;  4I5L B;  1N2D A;  3I5H C;  4HSZ A;  1MXL C;  5DKR A;  3BUM B;  3C1V A;  1S5G Z;  5HKZ A;  1F8H A;  1GGZ A;  2EC6 C;  2L0P A;  4OVN F;  1ZOT B;  1WRZ A;  1WRK A;  2F2P A;  1TTX A;  1DJH A;  4I5K A;  3CGA A;  3ZNI A;  1UWO A;  1CMG A;  4YGA A;  2JT8 A;  2BEC A;  1K9U A;  2PRU A;  2Q4U A;  3KEV A;  1YTZ C;  4NDC A;  3OB2 B;  3VGO A;  2LV7 A;  2M0R A;  3QRX A;  1WLM A;  3EK4 A;  1MF8 B;  1MR8 A;  3FWC A;  3IF7 A;  1BJF A;  3DVJ A;  2B1U A;  2K7D A;  2MRD A;  1Q80 A;  2KI4 B;  2WCB A;  1NX1 A;  2H61 A;  3MSE B;  1B7T Y;  1UHN A;  1CDN A;  1SR6 B;  3DVM A;  1SRA A;  1C7W A;  2D8N A;  5JOL A;  1L7Z A;  5HLO A;  1U5I B;  2CBL A;  2GGZ A;  4TNC A;  1QV0 A;  1FPW A;  3F45 A;  2BCA A;  4JQ0 D;  2NLN A;  4HRE E;  3SG4 A;  5FYX A;  3BUO B;  2IS9 A;  2H2K A;  1CB1 A;  1JSA A;  2L98 A;  2BCX A;  3FWB A;  4OKH A;  1SCM C;  3BYA A;  1LA3 A;  3SG3 A;  3ICB A;  3KHE A;  5HKY A;  1C07 A;  1WDC C;  1S5G Y;  1SMG A;  1Y0V H;  2M97 A;  2RGI A;  3AKB A;  1L2O B;  1UHI A;  1SK6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...