3GK4X

X-ray structure of bovine sbi523,ca(2+)-s100b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3gk4X00
3NSKA 1YX8A 1QX7A 1OMRA 1S6JA 1V1FA 1J1DA 3JVTC 4WRIA 2KI6C 1QX5B 1WRLA 3DF0B 1OOJA 4GPLB 1AJ4A 2HQ8A 1JF0A 2ZRSA 1AK8A 1BOCA 2KYCA 4DCKA 1IJ5A 1RJVA 3D0YA 2LVIA 2PRUA 3QRXA 2G9BA 1E8AA 3VGOA 2M9GA 1OMDA 4ZCUA 1MR8A 2PALA 1B8RA 2LP2A 2QPTA 4P5OE 1IQ5A 1CDLA 4PDZA 1X02A 2JTZA 4GBAA 1FF1A 2LHLA 2JNXA 1NX1A 1CB1A 1SPYA 1XFYO 2K7DA 1K2HA 3NSIA 1KQMB 2PMYA 1J7PA 3KF9A 3LK0A 1M39A 2E6WA 2K8MB 2OS8B 1KQMC 1DJGA 1PRWA 4BY4A 4PCWA 1PALA 5JJGA 4P2YB 3SG4A 2OS8C 1KK8B 4OR9B 3CTNA 3OB1B 2PASA 4ICBA 1TRFA 4YGDB 2L0PA 1YVLA 3WNXB 3VROA 1KK8C 5KSZA 2H2KA 3CGAA 2K0JA 1CM1A 2F3ZA 1YX7A 2L98A 4QJ5B 3E3RA 2GGZA 4CLNA 1EXRA 4YGBB 2JNFA 2M49B 1TNPA 2GGMA 1CDMA 4HRHA 4OV2A 5I8NA 1DT7B 1CMGA 1LKJA 5B8IB 1JFJA 2JT3A 3FIAA 1SL8A 2CCMA 2BE4A 1J7OA 1L7ZA 3CLNA 1OZOA 3EVVA 1Y1UA 4MEWA 3I5HB 2FCEA 1J55A 1K9UA 5KTYA 1F4QA 3I5HC 2LUCA 4NDBA 4R1EA 2FJUB 5CPVA 2WOSA 1W7JB 1XA5A 3C1VA 1NX2A 1KQVA 1JC2A 2KNEA 3VRQA 1TTXA 4GAOA 1B7TY 4M2QA 1IWQA 1R6PA 1K94A 2M97A 2P6BB 2K61A 2LV7A 1CFCA 4A4CA 4MZKA 3PLFB 3BUNB 4PHKA 4NDDA 2D8NA 1QVIY 1A29A 1KFXL 2LM5A 2JQ6A 4YRUA 1EH2A 3DVJA 1XK4A 3MSEB 1BF5A 2ZRTA 3O78A 2L5XB 5TNCA 2NLNA 3SIBA 2LMTA 2BCAA 3BXKA 4UPGA 4YI9A 3IQOA 2ZN9A 3JTDB 1PVAA 4CIDA 2JOJA 5GQQC 2F33A 2BECA 1MXLC 3EK8A 1SR6B 2CXJA 3JTDC 2V53A 2EHBA 1D1OA 3DD4A 2LANA 4ORCB 1BR1B 5CSNA 2LC5A 2M0RA 4F0ZB 2KAVA 2MA2A 1SR6C 1CFDA 1KFUS 1M45A 2KAYA 2Q91A 1CKKA 2BBNA 1RWYA 1NP8A 4QJ4B 4I5JA 2KFFA 1WY9A 4NQGA 1XFZO 1CDPA 1EG3A 2KI6D 4MLWA 4GGFA 1S3PA 3WHTB 2NCPA 5CSIA 4QJ3B 1KSOA 4XJKB 1PK0D 1QS7A 2JT0A 3SG7A 4WQ2A 1CFPA 4I5LB 3SG5A 3PSRA 1RROA 3OX6A 1Y1XA 1F54A 2Y1NA 2JWWA 4PHNA 2KGRA 2MHHA 5HLOA 2FCDA 3TZ1A 1B9AA 1GGWA 1RK9A 4PALA 2KSPA 3NSOA 1S5GZ 1QIVA 2KBMA 1TCOB 3BUWB 1MWNA 2JULA 1DJZA 1BLQA 4C0KA 1IQ3A 2M1KB 4PHJA 2K2AA 1SKTA 3HX4A 4AQJA 2F8PA 1EJ3A 1S6CA 5ER4X 2KFHA 4ETOA 2BCBA 5HKWA 1NSHA 5J3XA 1OQPA 3TDUA 4CFRA 1YUTA 1ZFSA 1R2UA 1WDCB 5K89A 2VRGA 4GGNA 1DJHA 2K7OA 3BUOB 2L51A 3H4SE 4N5XA 1RECA 4C0JA 4WQ3A 2R2IA 3DF0A 1CTRA 1WDCC 1LA3A 1SMGA 1EG4A 1RTP1 4MN0A 5ER5A 1DGVA 1CLBA 3WXAA 1DF0A 3ZWHA 2EGDA 1A03A 3NXAA 3CZTX 4N1FA 4MZLA 3BUXB 1A75A 4PHMA 5AFPA 2HETA 1LXFC 3A8RA 1QASA 2MRDA 2COLB 1K96A 3AKBA 4TNCA 1KCYA 3PATA 4DIRA 3PFVA 2ZNEA 4YGEB 2HF5A 5JOLA 2LVVA 3AAKA 1S6IA 4ORAB 3PALA 3HCMA 3SG2A 1W7IB 4A4BA 4MZJA 2F3YA 4YI8A 1K8UA 4CPVA 3LK1A 1CFFA 1CNPA 3VRPA 1VRKA 3DVKA 3SJSA 1NUBA 4I5KA 1JF2A 1NWDA 2CTNA 1K90D 1F4OA 3IF7A 1WRKA 2Y1MA 3ZNIA 1CLLA 1Y6WA 2KYFA 4MBEA 1XFXO 3LCPC 4GUKA 4C0LA 4DS7A 2LUXA 1F55A 1OMVA 2SCPA 4CFQA 1YUUA 2PVBA 2K2FA 2JRFA 4YGCB 3SG6A 2BKHB 2LAPA 1SL7A 1SY9A 2JXLA 5AEQA 3O2PA 3O6BA 4DRWA 4OKHA 1IH0A 3AKAA 4AOMA 1QV1A 4XYNA 2B1UA 1BJFA 3EVUA 1G33A 2M1UA 1ALWA 1RFJA 2RGIA 2KHNA 4FQOA 2E30A 2LMUA 1SNLA 1UWOA 1K93D 5DKRA 1SK6D 4USLA 2LNKA 1B4CA 1A4PA 2JZIA 2H61C 1DJXA 2MLEC 4N1GA 2KBIA 5AXIA 4YGAA 3CR2A 3FWCA 1S26D 5DKQA 2IS9A 1A2XA 3AAJA 4OCIA 2ISDA 1QX2A 5D69A 3CR4X 1PVBA 2JC2A 2A4JA 1ZUZA 1NX0A 3TDIA 2WCFA 4GFTA 2JTTA 1ALVA 1MXEA 1U5IB 1GJYA 1WLMA 1PSRA 2GV5A 2JPTA 4M2PA 2KI4B 2AUCA 4MSPA 4ZCVA 3O4YA 2KGBC 1LINA 1YURA 3OHMB 2KI4C 1CDNA 3OX5A 1KSMA 2Y4QA 1KWOB 3BOWB 4PE0A 2PSRA 2Y5IA 1MHOA 1DTLA 1B7TZ 1DVIA 1YUSA 1KWOC 3BYAA 1FI6A 2NXQA 1NCXA 2I94A 1UHJA 2WCEA 2K7BA 5BPJA 3SIAA 1QVIZ 2ZKMX 1ZOTB 4Q04A 1IRJA 1ODBA 2K7CA 1K9KA 1SBJA 4XJKA 1C07A 1NCZA 4JPZB 1IG5A 1KFUL 2LLUA 3I5GB 4MRYA 3VRNA 5AERA 1XVJA 3GK4X 1NCYA 3TUYB 1OZSA 5HKZA 3I5GC 5CSJA 1JWDA 1IKUA 1G8IA 1N0YA 2LLSA 4GNKB 1N2DA 1KK7Y 4HRGA 2M7NA 1QIWA 1UHHA 4L9MA 1S1EA 3A4UB 5PALA 4MVFA 3GK2A 3EKJA 5HLVA 1BMOA 4AQIA 2BCXA 1IGVA 2HQWA 3DVEA 3WHUB 2KDHA 2M29A 3VRRA 2WORA 1DJYA 1TOPA 1AUIB 1J7RA 3D0YB 4I5NB 5HKYA 1NYAA 2BL0B 2M8UA 4PE1A 1TNQA 1UP5A 1CMFA 4FTGA 2LP3A 1XFUO 2BE6A 2BL0C 2O5GA 4D1EA 5KU1A 1UHNA 2Q4UA 1DF0B 1JBAA 2WNDA 3EK4A 1YR5A 2ZN8A 5CSFA 5I2LA 1C7VA 1QLSA 2L4HA 2HPSA 1DGUA 3KEVA 2QACA 1A75B 2LMVA 2TN4A 3CWGA 5D7FA 1DMOA 1MUXA 1QV0A 1YRUB 4MRXA 5F6TA 1JSAA 1JUOA 1B8CA 1CM4A 1QLKA 4OVNF 2KFGA 2MAZA 3I5IB 2CT9A 2L4IA 3KPXA 1YTZC 3FS7A 1KK7Z 4DUQA 1B47A 4NDCA 2I7AA 3I5IC 2ZFDA 2LHIA 3EKHA 1NX3A 2KQYA 3F45A 1QJTA 1FBVA 1G4YR 1BG1A 1CLMA 2DOQA 2F2PA 1Y1AA 1K95A 3IQQA 1H8BA 2WC8A 4HSZA 3ICBA 1SRAA 2M3WA 1V1GA 2MJWB 2LVJA 2SASA 3DVMA 1ZMZA 1KFXS 1SW8A 2EC6B 1PSBA 1H4BA 3EK7A 1BT6A 1WRZA 1F70A 4U8DA 1DJWA 4M2OA 2EC6C 4BY5A 2JT8A 1MF8B 2I18A 3KO0A 3NSLA 1F8HA 3M0WA 1BR4B 1LA0A 1ZACA 2WCBA 1DJIA 2CBLA 3D10A 2LLTA 3TDZA 1FPWA 1GQMA 1XO5A 2LCPA 5DKNA 3CR5X 1AHRA 1M31A 1OE9B 1OSAA 2M7LA 1UUSA 1PULA 1AVSA 1UHKA 3PN7B 3LL8B 1QATA 1M46A 2CNPA 2LE9B 1NIWA 1XK4C 1Y0VH 1MQ1A 1SYMA 1C7WA 2H61A 3GK1A 1N65A 3KHEA 3PN7C 2MLFC 3RM1A 1J7QA 1UHIA 3BQ3A 4JQ0D 2JXCA 1FI5A 1B8LA 3CS1A 1B1GA 1YRTB 3PM8A 1SL9A 1L2OB 1S5GY 1EL4A 1TN4A 3OP0A 4E68A 2OPOA 2BBMA 2FOTA 1L2OC 2L2EA 4HREE 1U5IA 3TS5B 3EVRA 5I2QA 2JU0A 4ORBB 5G08A 5HYDA 3TS5C 1BODA 3BUMB 1S36A 2LVKA 2NZ0A 3LLEA 1XYDA 1XFVO 3FWBA 4GGFC 1SCVA 2F2OA 3BOWA 1BU3A 1AP4A 2L50A 1FW4A 1HT9A 2KQ6A 1TNXA 1HQVA 3OB2B 4YBHB 2AMIA 2ZNDA 5AANA 1K9PA 1Q80A 1WLZA 2OTGB 5IBWA 1UURA 2MBXA 3I5FB 3K21A 3RLZA 1SCMB 2OTGC 1NPQA 3SG3A 3I5FC 3TUYC 2NCOA 1AJ5A 1SCMC 1GGZA 2KOTA 4JWQA 1J1EA 1M63B 1IJ6A 1QTXA 1QXPA 2I2RE 1TNWA 1YVHA 1JFKA 3GOFA 5I2OA 1TIZA 2O60A 4PE4A 4PE7A 5FYXA 2AAOA 1XFWO 4IL1A 1LVCD 3JVTB 2KAXA 2G2BA 1TCFA 2BKIB 1F71A
chains in the Genus database with same CATH superfamily
3NSKA 4WQ3A 1YX8A 1QX7A 1OMRA 1S6JA 1V1FA 1J1DA 3JVTC 4WRIA 1XFRA 2KI6C 1QX5B 1WRLA 3DF0B 1OOJA 4GPLB 1AJ4A 2HQ8A 1JF0A 2ZRSA 1AK8A 1BOCA 2KYCA 3L4LA 4DCKA 1IJ5A 1RJVA 3D0YA 2LVIA 2PRUA 3QRXA 2G9BA 1E8AA 3VGOA 2M9GA 1OMDA 4ZCUA 5D3OA 1MR8A 2PALA 1B8RA 2LP2A 2QPTA 4P5OE 1IQ5A 1CDLA 4PDZA 1X02A 2JTZA 4GBAA 1FF1A 2LHLA 2JNXA 1NX1A 1CB1A 1SPYA 1XFYO 2K7DA 3FE6A 1K2HA 3NSIA 1KQMB 2PMYA 3R72A 1J7PA 3KF9A 3LK0A 1IIOA 1M39A 2E6WA 2K8MB 2OS8B 1KQMC 1DJGA 1PRWA 3DZTA 2L5YA 4BY4A 4PCWA 1PALA 5JJGA 4P2YB 3SG4A 2OS8C 1KK8B 4OR9B 3CTNA 3OB1B 2PASA 4ICBA 1TRFA 4YGDB 2L0PA 1YVLA 3WNXB 3S0GA 3VROA 1KK8C 5KSZA 2H2KA 3CGAA 2K0JA 2KPHA 1CM1A 3PM2A 4JKTA 2F3ZA 1YX7A 2L98A 4QJ5B 3E3RA 2GGZA 4CLNA 1EXRA 4YGBB 2JNFA 2M49B 1TNPA 2GGMA 2FJYA 1CDMA 4HRHA 4OV2A 5I8NA 1DT7B 1CMGA 1LKJA 5B8IB 1JFJA 2JT3A 3FIAA 1SL8A 2CCMA 2BE4A 1J7OA 1L7ZA 3CLNA 1OZOA 3EVVA 1Y1UA 4MEWA 3I5HB 2FCEA 5FI2A 1J55A 1K9UA 5KTYA 1F4QA 3I5HC 2LUCA 4NDBA 4R1EA 2FJUB 5CPVA 2WOSA 1W7JB 1XA5A 3C1VA 1NX2A 3NHIA 1JC2A 2KNEA 3VRQA 1KQVA 1TTXA 4GAOA 1B7TY 3BFHA 4M2QA 1IWQA 3D77A 1R6PA 1K94A 2M97A 2P6BB 2K61A 2LV7A 1CFCA 4A4CA 4MZKA 3PLFB 3BUNB 4PHKA 4NDDA 2D8NA 1QVIY 1A29A 1KFXL 2LM5A 2JQ6A 4YRUA 2L2CA 1EH2A 3D74A 3DVJA 1XK4A 3MSEB 1BF5A 2ZRTA 3O78A 2L5XB 5TNCA 2NLNA 3SIBA 2LMTA 2BCAA 3BXKA 4UPGA 4YI9A 3IQOA 2ZN9A 3JTDB 1PVAA 4CIDA 2JOJA 5GQQC 2F33A 2BECA 1MXLC 3EK8A 1SR6B 2CXJA 3JTDC 2V53A 2EHBA 1D1OA 3DD4A 2LANA 1DEKA 1BR1B 3L47A 4ORCB 2LC5A 5CSNA 2M0RA 4F0ZB 2KAVA 2MA2A 1SR6C 1CFDA 1KFUS 1M45A 2KAYA 2Q91A 1C3ZA 1CKKA 2BBNA 1RWYA 2QEOA 1NP8A 4QJ4B 4I5JA 2KFFA 1WY9A 4NQGA 1XFZO 1CDPA 1EG3A 4JD9A 2KI6D 4MLWA 4GGFA 1S3PA 3UNWA 2NCPA 5CSIA 3WHTB 4QJ3B 1KSOA 4XJKB 1PK0D 2GTEA 1QS7A 2JT0A 3SG7A 1Z4HA 4WQ2A 5HL1A 1CFPA 4I5LB 3SG5A 3SS4A 2ERBA 3PSRA 1RROA 3OX6A 1Y1XA 3SS3A 1F54A 2Y1NA 2JWWA 4PHNA 2KGRA 3PJIA 2MHHA 3S0FA 5HLOA 2FCDA 3TZ1A 1B9AA 1GGWA 1RK9A 4PALA 2KSPA 3NSOA 5DICA 1S5GZ 1QIVA 4INWA 2KBMA 1TCOB 3BUWB 1MWNA 2JULA 1DJZA 1BLQA 4C0KA 1IQ3A 2M1KB 4PHJA 2K2AA 1SKTA 3HX4A 4AQJA 2F8PA 1EJ3A 1S6CA 5ER4X 3D75A 2KFHA 4ETOA 2BCBA 5HKWA 1NSHA 5J3XA 1OQPA 3TDUA 4CFRA 1YUTA 1ZFSA 1R2UA 1WDCB 5K89A 2VRGA 4GGNA 1DJHA 2K7OA 3BUOB 2L51A 3H4SE 4N5XA 1RECA 4C0JA 3FE9A 2R2IA 3DF0A 1CTRA 1WDCC 1LA3A 1SMGA 1EG4A 1RTP1 4MN0A 5ER5A 1DGVA 1CLBA 3WXAA 1DF0A 3B7AA 3ZWHA 2EGDA 1A03A 3NXAA 3CZTX 4N1FA 3CZ0A 3BUXB 1A75A 4MZLA 4PHMA 1C3YA 5AFPA 2HETA 1LXFC 3A8RA 1QASA 2MRDA 2COLB 1K96A 3AKBA 3D73A 4TNCA 3BFBA 1KCYA 3PATA 4DIRA 3PFVA 2ZNEA 3DY9A 4YGEB 2HF5A 4OZDA 5JOLA 1LS8A 1SSEB 2QEVA 3EG5B 2LVVA 3AAKA 1S6IA 4ORAB 3PALA 3HCMA 3SG2A 1W7IB 4A4BA 4MZJA 2F3YA 4YI8A 1K8UA 4CPVA 3LK1A 1CFFA 1CNPA 3VRPA 1VRKA 3DVKA 3O4XA 3SJSA 1OOGA 2WCHA 1NUBA 4I5KA 3Q8IA 1JF2A 1NWDA 2CTNA 3NGVA 3DXLA 1K90D 1F4OA 1DC1A 3IF7A 1WRKA 2Y1MA 3ZNIA 1CLLA 1Y6WA 2KYFA 4MBEA 1XFXO 2P71A 3LCPC 4GUKA 4C0LA 4DS7A 2LUXA 1F55A 1OMVA 2SCPA 4CFQA 1YUUA 2PVBA 3OBVA 2K2FA 2JRFA 2KLEA 4YGCB 3SG6A 2BKHB 2LAPA 1SL7A 1SY9A 2JXLA 5AEQA 3O2PA 3O6BA 4DRWA 4OKHA 1IH0A 3AKAA 4AOMA 1QV1A 4XYNA 1BJFA 2B1UA 1OOHA 3EVUA 1G33A 2M1UA 3B87A 1ALWA 1RFJA 2RGIA 2KHNA 3SS5A 4FQOA 3RZSA 2E30A 2LMUA 1SNLA 1UWOA 1K93D 5DKRA 1SK6D 4USLA 2LNKA 1B4CA 1A4PA 5I94A 2JZIA 3BFAA 2H61C 1DJXA 2MLEC 4N1GA 2KBIA 5AXIA 4YGAA 3CR2A 3FWCA 1S26D 5DKQA 2IS9A 1A2XA 3AAJA 4OCIA 2ISDA 1QX2A 5D69A 3CR4X 1PVBA 2YGUA 2JC2A 2BNXA 2A4JA 1ZUZA 1NX0A 3TDIA 2WCFA 1OW4A 4GFTA 2JTTA 3R1VA 1ALVA 1MXEA 1U5IB 1GJYA 1WLMA 1PSRA 2GV5A 2JPTA 3D78A 2KI4B 2AUCA 4MSPA 4ZCVA 3O4YA 2KGBC 1LINA 1YURA 3OHMB 2KI4C 1CDNA 3OX5A 1KSMA 2Y4QA 1KWOB 1QWVA 3B86A 3BOWB 1TWOA 3D76A 4PE0A 2PSRA 2Y5IA 1MHOA 1DTLA 1B7TZ 1DVIA 1YUSA 1KWOC 3BYAA 1FI6A 2NXQA 1NCXA 2I94A 3CABA 1UHJA 2BAPA 2WCEA 2K7BA 3R1PA 3V2LA 5BPJA 3SIAA 1QVIZ 2ZKMX 1ZOTB 4Q04A 1IRJA 1ODBA 2K7CA 1K9KA 1SBJA 4XJKA 1C07A 1NCZA 2QEBA 4JPZB 1GM0A 3B6XA 1IG5A 1KFUL 2LLUA 3I5GB 4MRYA 3VRNA 5AERA 1XVJA 3GK4X 1NCYA 3TUYB 1OZSA 5HKZA 3I5GC 5CSJA 1JWDA 1IKUA 1G8IA 1N0YA 2LLSA 4GNKB 1N2DA 1KK7Y 4HRGA 2M7NA 2QEHA 2PYQA 1QIWA 1UHHA 4L9MA 1S1EA 3N7HA 3A4UB 3L4AA 5PALA 4MVFA 3GK2A 3EKJA 5HLVA 1BMOA 4AQIA 2BCXA 1IGVA 2HQWA 3DVEA 3WHUB 2KDHA 3CDNA 2JPOA 2M29A 3IVTA 2WCJA 3VRRA 2WORA 3S0BA 3R1OA 1DJYA 1TOPA 1AUIB 1J7RA 3D0YB 4I5NB 5HKYA 1NYAA 2BL0B 2M8UA 4PE1A 1TNQA 1UP5A 1CMFA 2KLDA 2LP3A 1XFUO 2K60A 4FTGA 2BE6A 2BL0C 2O5GA 4D1EA 5KU1A 1UHNA 2Q4UA 1DF0B 2WC5A 1JBAA 2WNDA 3EK4A 1YR5A 2ZN8A 5CSFA 5I2LA 1C7VA 2P70A 1QLSA 2L4HA 2HPSA 1DGUA 3KEVA 4M2PA 1P28A 1A75B 2LMVA 2QACA 3S0EA 4F7FA 2TN4A 3CWGA 5D7FA 1DMOA 1MUXA 1QV0A 1YRUB 4MRXA 5F6TA 2H8VA 1JSAA 1JUOA 1B8CA 1CM4A 1QLKA 4OVNF 2KFGA 2MAZA 3I5IB 2CT9A 2L4IA 3KPXA 3CYZA 1YTZC 3FS7A 1KK7Z 1T14A 5FI7A 1B47A 4DUQA 4NDCA 4FQTA 2I7AA 3I5IC 2ZFDA 2LHIA 3EKHA 1NX3A 2KQYA 5EL2A 3F45A 1QJTA 1FBVA 1G4YR 1BG1A 1CLMA 2DOQA 2F2PA 1Y1AA 1K95A 3IQQA 4INXA 3CZ2A 1H8BA 2WC8A 4HSZA 3ICBA 1SRAA 2M3WA 1V1GA 2MJWB 1OOIX 2LVJA 2SASA 1OOFA 3DVMA 1ZMZA 1KFXS 1SW8A 2EC6B 1PSBA 1H4BA 3EK7A 1BT6A 1DQEA 1WRZA 2WCMA 4U8DA 1DJWA 4M2OA 1F70A 2EC6C 4BY5A 2JT8A 1MF8B 3NHTA 2I18A 3KO0A 3NSLA 1F8HA 3M0WA 1BR4B 1LA0A 1ZACA 2WCBA 1DJIA 3BJHA 2CBLA 3D10A 2LLTA 3TDZA 1FPWA 1GQMA 1XO5A 4KYNA 2LCPA 5DKNA 3CR5X 2WC6A 1TUZA 1AHRA 1M31A 1OE9B 1OSAA 2WCKA 2M7LA 1UUSA 1PULA 1AVSA 1UHKA 3PN7B 3B88A 3LL8B 1QATA 1M46A 2CNPA 2LE9B 1NIWA 1XK4C 1Z2CB 1Y0VH 1MQ1A 1C7WA 1SYMA 2H61A 1N65A 3GK1A 3KHEA 3PN7C 1W9ZA 4IJ7A 2MLFC 3RM1A 1J7QA 1UHIA 3BQ3A 4JQ0D 2JXCA 1FI5A 1B8LA 3DYEA 3CS1A 1B1GA 3FE8A 1YRTB 5FI6A 3PM8A 2WCLA 1SL9A 3OGNA 1L2OB 1S5GY 1EL4A 1TN4A 3OP0A 4E68A 2OPOA 2BBMA 2PQLA 2FOTA 1L2OC 2L2EA 4HREE 1U5IA 3TS5B 3EVRA 5I2QA 2JU0A 4ORBB 1DELA 5G08A 5HYDA 3TS5C 1BODA 3BUMB 1S36A 2LVKA 2NZ0A 3LLEA 3S0DA 1XYDA 1XFVO 3FWBA 4GGFC 1SCVA 2F2OA 3BOWA 1BU3A 1AP4A 2L50A 4PT1A 1FW4A 1HT9A 2KQ6A 3CZ1A 1TNXA 1HQVA 3S0AA 3OB2B 2QDIA 2AMIA 2ZNDA 4YBHB 1K9PA 1Q80A 1WLZA 5AANA 2OTGB 5IBWA 1UURA 2MBXA 3I5FB 3K21A 3RLZA 1SCMB 2OTGC 1NPQA 3K1EA 3SG3A 3I5FC 3TUYC 1TUJA 2NCOA 1AJ5A 1SCMC 1GGZA 2KOTA 4JWQA 1J1EA 1M63B 1IJ6A 1QTXA 1ORGA 1QXPA 2I2RE 1TNWA 3QMEA 1YVHA 1JFKA 3UO9A 3GOFA 5I2OA 1TIZA 2O60A 3VB1A 4PE4A 4PE7A 5FYXA 2AAOA 1XFWO 4IL1A 1LVCD 3JVTB 2KAXA 2G2BA 1TCFA 2BKIB 1F71A
chains in the Genus database with same CATH topology
3NSKA 1YX8A 1QX7A 1OMRA 1S6JA 1V1FA 1J1DA 3JVTC 4WRIA 2KI6C 1QX5B 1WRLA 3DF0B 1OOJA 4GPLB 1AJ4A 2HQ8A 1JF0A 2ZRSA 1AK8A 1BOCA 2KYCA 4DCKA 1IJ5A 1RJVA 3D0YA 2LVIA 2PRUA 3QRXA 2G9BA 1E8AA 3VGOA 2M9GA 1OMDA 4ZCUA 1MR8A 2PALA 1B8RA 2LP2A 2QPTA 4P5OE 1IQ5A 1CDLA 4PDZA 1X02A 2JTZA 4GBAA 1FF1A 2LHLA 2JNXA 1NX1A 1CB1A 1SPYA 1XFYO 2K7DA 1K2HA 3NSIA 1KQMB 2PMYA 1J7PA 3KF9A 3LK0A 1M39A 2E6WA 2K8MB 2OS8B 1KQMC 1DJGA 1PRWA 4BY4A 4PCWA 1PALA 5JJGA 4P2YB 3SG4A 2OS8C 1KK8B 4OR9B 3CTNA 3OB1B 2PASA 4ICBA 1TRFA 4YGDB 2L0PA 1YVLA 3WNXB 3VROA 1KK8C 5KSZA 2H2KA 3CGAA 2K0JA 1CM1A 2F3ZA 1YX7A 2L98A 4QJ5B 3E3RA 2GGZA 4CLNA 1EXRA 4YGBB 2JNFA 2M49B 1TNPA 2GGMA 1CDMA 4HRHA 4OV2A 5I8NA 1DT7B 1CMGA 1LKJA 5B8IB 1JFJA 2JT3A 3FIAA 1SL8A 2CCMA 2BE4A 1J7OA 1L7ZA 3CLNA 1OZOA 3EVVA 1Y1UA 4MEWA 3I5HB 2FCEA 1J55A 1K9UA 5KTYA 1F4QA 3I5HC 2LUCA 4NDBA 4R1EA 2FJUB 5CPVA 2WOSA 1W7JB 1XA5A 3C1VA 1NX2A 1KQVA 1JC2A 2KNEA 3VRQA 1TTXA 4GAOA 1B7TY 4M2QA 1IWQA 1R6PA 1K94A 2M97A 2P6BB 2K61A 2LV7A 1CFCA 4A4CA 4MZKA 3PLFB 3BUNB 4PHKA 4NDDA 2D8NA 1QVIY 1A29A 1KFXL 2LM5A 2JQ6A 4YRUA 1EH2A 3DVJA 1XK4A 3MSEB 1BF5A 2ZRTA 3O78A 2L5XB 5TNCA 2NLNA 3SIBA 2LMTA 2BCAA 3BXKA 4UPGA 4YI9A 3IQOA 2ZN9A 3JTDB 1PVAA 4CIDA 2JOJA 5GQQC 2F33A 2BECA 1MXLC 3EK8A 1SR6B 2CXJA 3JTDC 2V53A 2EHBA 1D1OA 3DD4A 2LANA 4ORCB 1BR1B 5CSNA 2LC5A 2M0RA 4F0ZB 2KAVA 2MA2A 1SR6C 1CFDA 1KFUS 1M45A 2KAYA 2Q91A 1CKKA 2BBNA 1RWYA 1NP8A 4QJ4B 4I5JA 2KFFA 1WY9A 4NQGA 1XFZO 1CDPA 1EG3A 2KI6D 4MLWA 4GGFA 1S3PA 3WHTB 2NCPA 5CSIA 4QJ3B 1KSOA 4XJKB 1PK0D 1QS7A 2JT0A 3SG7A 4WQ2A 1CFPA 4I5LB 3SG5A 3PSRA 1RROA 3OX6A 1Y1XA 1F54A 2Y1NA 2JWWA 4PHNA 2KGRA 2MHHA 5HLOA 2FCDA 3TZ1A 1B9AA 1GGWA 1RK9A 4PALA 2KSPA 3NSOA 1S5GZ 1QIVA 2KBMA 1TCOB 3BUWB 1MWNA 2JULA 1DJZA 1BLQA 4C0KA 1IQ3A 2M1KB 4PHJA 2K2AA 1SKTA 3HX4A 4AQJA 2F8PA 1EJ3A 1S6CA 5ER4X 2KFHA 4ETOA 2BCBA 5HKWA 1NSHA 5J3XA 1OQPA 3TDUA 4CFRA 1YUTA 1ZFSA 1R2UA 1WDCB 5K89A 2VRGA 4GGNA 1DJHA 2K7OA 3BUOB 2L51A 3H4SE 4N5XA 1RECA 4C0JA 4WQ3A 2R2IA 3DF0A 1CTRA 1WDCC 1LA3A 1SMGA 1EG4A 1RTP1 4MN0A 5ER5A 1DGVA 1CLBA 3WXAA 1DF0A 3ZWHA 2EGDA 1A03A 3NXAA 3CZTX 4N1FA 4MZLA 3BUXB 1A75A 4PHMA 5AFPA 2HETA 1LXFC 3A8RA 1QASA 2MRDA 2COLB 1K96A 3AKBA 4TNCA 1KCYA 3PATA 4DIRA 3PFVA 2ZNEA 4YGEB 2HF5A 5JOLA 2LVVA 3AAKA 1S6IA 4ORAB 3PALA 3HCMA 3SG2A 1W7IB 4A4BA 4MZJA 2F3YA 4YI8A 1K8UA 4CPVA 3LK1A 1CFFA 1CNPA 3VRPA 1VRKA 3DVKA 3SJSA 1NUBA 4I5KA 1JF2A 1NWDA 2CTNA 1K90D 1F4OA 3IF7A 1WRKA 2Y1MA 3ZNIA 1CLLA 1Y6WA 2KYFA 4MBEA 1XFXO 3LCPC 4GUKA 4C0LA 4DS7A 2LUXA 1F55A 1OMVA 2SCPA 4CFQA 1YUUA 2PVBA 2K2FA 2JRFA 4YGCB 3SG6A 2BKHB 2LAPA 1SL7A 1SY9A 2JXLA 5AEQA 3O2PA 3O6BA 4DRWA 4OKHA 1IH0A 3AKAA 4AOMA 1QV1A 4XYNA 2B1UA 1BJFA 3EVUA 1G33A 2M1UA 1ALWA 1RFJA 2RGIA 2KHNA 4FQOA 2E30A 2LMUA 1SNLA 1UWOA 1K93D 5DKRA 1SK6D 4USLA 2LNKA 1B4CA 1A4PA 2JZIA 2H61C 1DJXA 2MLEC 4N1GA 2KBIA 5AXIA 4YGAA 3CR2A 3FWCA 1S26D 5DKQA 2IS9A 1A2XA 3AAJA 4OCIA 2ISDA 1QX2A 5D69A 3CR4X 1PVBA 2JC2A 2A4JA 1ZUZA 1NX0A 3TDIA 2WCFA 4GFTA 2JTTA 1ALVA 1MXEA 1U5IB 1GJYA 1WLMA 1PSRA 2GV5A 2JPTA 4M2PA 2KI4B 2AUCA 4MSPA 4ZCVA 3O4YA 2KGBC 1LINA 1YURA 3OHMB 2KI4C 1CDNA 3OX5A 1KSMA 2Y4QA 1KWOB 3BOWB 4PE0A 2PSRA 2Y5IA 1MHOA 1DTLA 1B7TZ 1DVIA 1YUSA 1KWOC 3BYAA 1FI6A 2NXQA 1NCXA 2I94A 1UHJA 2WCEA 2K7BA 5BPJA 3SIAA 1QVIZ 2ZKMX 1ZOTB 4Q04A 1IRJA 1ODBA 2K7CA 1K9KA 1SBJA 4XJKA 1C07A 1NCZA 4JPZB 1IG5A 1KFUL 2LLUA 3I5GB 4MRYA 3VRNA 5AERA 1XVJA 3GK4X 1NCYA 3TUYB 1OZSA 5HKZA 3I5GC 5CSJA 1JWDA 1IKUA 1G8IA 1N0YA 2LLSA 4GNKB 1N2DA 1KK7Y 4HRGA 2M7NA 1QIWA 1UHHA 4L9MA 1S1EA 3A4UB 5PALA 4MVFA 3GK2A 3EKJA 5HLVA 1BMOA 4AQIA 2BCXA 1IGVA 2HQWA 3DVEA 3WHUB 2KDHA 2M29A 3VRRA 2WORA 1DJYA 1TOPA 1AUIB 1J7RA 3D0YB 4I5NB 5HKYA 1NYAA 2BL0B 2M8UA 4PE1A 1TNQA 1UP5A 1CMFA 4FTGA 2LP3A 1XFUO 2BE6A 2BL0C 2O5GA 4D1EA 5KU1A 1UHNA 2Q4UA 1DF0B 1JBAA 2WNDA 3EK4A 1YR5A 2ZN8A 5CSFA 5I2LA 1C7VA 1QLSA 2L4HA 2HPSA 1DGUA 3KEVA 2QACA 1A75B 2LMVA 2TN4A 3CWGA 5D7FA 1DMOA 1MUXA 1QV0A 1YRUB 4MRXA 5F6TA 1JSAA 1JUOA 1B8CA 1CM4A 1QLKA 4OVNF 2KFGA 2MAZA 3I5IB 2CT9A 2L4IA 3KPXA 1YTZC 3FS7A 1KK7Z 4DUQA 1B47A 4NDCA 2I7AA 3I5IC 2ZFDA 2LHIA 3EKHA 1NX3A 2KQYA 3F45A 1QJTA 1FBVA 1G4YR 1BG1A 1CLMA 2DOQA 2F2PA 1Y1AA 1K95A 3IQQA 1H8BA 2WC8A 4HSZA 3ICBA 1SRAA 2M3WA 1V1GA 2MJWB 2LVJA 2SASA 3DVMA 1ZMZA 1KFXS 1SW8A 2EC6B 1PSBA 1H4BA 3EK7A 1BT6A 1WRZA 1F70A 4U8DA 1DJWA 4M2OA 2EC6C 4BY5A 2JT8A 1MF8B 2I18A 3KO0A 3NSLA 1F8HA 3M0WA 1BR4B 1LA0A 1ZACA 2WCBA 1DJIA 2CBLA 3D10A 2LLTA 3TDZA 1FPWA 1GQMA 1XO5A 2LCPA 5DKNA 3CR5X 1AHRA 1M31A 1OE9B 1OSAA 2M7LA 1UUSA 1PULA 1AVSA 1UHKA 3PN7B 3LL8B 1QATA 1M46A 2CNPA 2LE9B 1NIWA 1XK4C 1Y0VH 1MQ1A 1SYMA 1C7WA 2H61A 3GK1A 1N65A 3KHEA 3PN7C 2MLFC 3RM1A 1J7QA 1UHIA 3BQ3A 4JQ0D 2JXCA 1FI5A 1B8LA 3CS1A 1B1GA 1YRTB 3PM8A 1SL9A 1L2OB 1S5GY 1EL4A 1TN4A 3OP0A 4E68A 2OPOA 2BBMA 2FOTA 1L2OC 2L2EA 4HREE 1U5IA 3TS5B 3EVRA 5I2QA 2JU0A 4ORBB 5G08A 5HYDA 3TS5C 1BODA 3BUMB 1S36A 2LVKA 2NZ0A 3LLEA 1XYDA 1XFVO 3FWBA 4GGFC 1SCVA 2F2OA 3BOWA 1BU3A 1AP4A 2L50A 1FW4A 1HT9A 2KQ6A 1TNXA 1HQVA 3OB2B 4YBHB 2AMIA 2ZNDA 5AANA 1K9PA 1Q80A 1WLZA 2OTGB 5IBWA 1UURA 2MBXA 3I5FB 3K21A 3RLZA 1SCMB 2OTGC 1NPQA 3SG3A 3I5FC 3TUYC 2NCOA 1AJ5A 1SCMC 1GGZA 2KOTA 4JWQA 1J1EA 1M63B 1IJ6A 1QTXA 1QXPA 2I2RE 1TNWA 1YVHA 1JFKA 3GOFA 5I2OA 1TIZA 2O60A 4PE4A 4PE7A 5FYXA 2AAOA 1XFWO 4IL1A 1LVCD 3JVTB 2KAXA 2G2BA 1TCFA 2BKIB 1F71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSK A;  1YX8 A;  1QX7 A;  1OMR A;  1S6J A;  1V1F A;  1J1D A;  3JVT C;  4WRI A;  2KI6 C;  1QX5 B;  1WRL A;  3DF0 B;  1OOJ A;  4GPL B;  1AJ4 A;  2HQ8 A;  1JF0 A;  2ZRS A;  1AK8 A;  1BOC A;  2KYC A;  4DCK A;  1IJ5 A;  1RJV A;  3D0Y A;  2LVI A;  2PRU A;  3QRX A;  2G9B A;  1E8A A;  3VGO A;  2M9G A;  1OMD A;  4ZCU A;  1MR8 A;  2PAL A;  1B8R A;  2LP2 A;  2QPT A;  4P5O E;  1IQ5 A;  1CDL A;  4PDZ A;  1X02 A;  2JTZ A;  4GBA A;  1FF1 A;  2LHL A;  2JNX A;  1NX1 A;  1CB1 A;  1SPY A;  1XFY O;  2K7D A;  1K2H A;  3NSI A;  1KQM B;  2PMY A;  1J7P A;  3KF9 A;  3LK0 A;  1M39 A;  2E6W A;  2K8M B;  2OS8 B;  1KQM C;  1DJG A;  1PRW A;  4BY4 A;  4PCW A;  1PAL A;  5JJG A;  4P2Y B;  3SG4 A;  2OS8 C;  1KK8 B;  4OR9 B;  3CTN A;  3OB1 B;  2PAS A;  4ICB A;  1TRF A;  4YGD B;  2L0P A;  1YVL A;  3WNX B;  3VRO A;  1KK8 C;  5KSZ A;  2H2K A;  3CGA A;  2K0J A;  1CM1 A;  2F3Z A;  1YX7 A;  2L98 A;  4QJ5 B;  3E3R A;  2GGZ A;  4CLN A;  1EXR A;  4YGB B;  2JNF A;  2M49 B;  1TNP A;  2GGM A;  1CDM A;  4HRH A;  4OV2 A;  5I8N A;  1DT7 B;  1CMG A;  1LKJ A;  5B8I B;  1JFJ A;  2JT3 A;  3FIA A;  1SL8 A;  2CCM A;  2BE4 A;  1J7O A;  1L7Z A;  3CLN A;  1OZO A;  3EVV A;  1Y1U A;  4MEW A;  3I5H B;  2FCE A;  1J55 A;  1K9U A;  5KTY A;  1F4Q A;  3I5H C;  2LUC A;  4NDB A;  4R1E A;  2FJU B;  5CPV A;  2WOS A;  1W7J B;  1XA5 A;  3C1V A;  1NX2 A;  1KQV A;  1JC2 A;  2KNE A;  3VRQ A;  1TTX A;  4GAO A;  1B7T Y;  4M2Q A;  1IWQ A;  1R6P A;  1K94 A;  2M97 A;  2P6B B;  2K61 A;  2LV7 A;  1CFC A;  4A4C A;  4MZK A;  3PLF B;  3BUN B;  4PHK A;  4NDD A;  2D8N A;  1QVI Y;  1A29 A;  1KFX L;  2LM5 A;  2JQ6 A;  4YRU A;  1EH2 A;  3DVJ A;  1XK4 A;  3MSE B;  1BF5 A;  2ZRT A;  3O78 A;  2L5X B;  5TNC A;  2NLN A;  3SIB A;  2LMT A;  2BCA A;  3BXK A;  4UPG A;  4YI9 A;  3IQO A;  2ZN9 A;  3JTD B;  1PVA A;  4CID A;  2JOJ A;  5GQQ C;  2F33 A;  2BEC A;  1MXL C;  3EK8 A;  1SR6 B;  2CXJ A;  3JTD C;  2V53 A;  2EHB A;  1D1O A;  3DD4 A;  2LAN A;  4ORC B;  1BR1 B;  5CSN A;  2LC5 A;  2M0R A;  4F0Z B;  2KAV A;  2MA2 A;  1SR6 C;  1CFD A;  1KFU S;  1M45 A;  2KAY A;  2Q91 A;  1CKK A;  2BBN A;  1RWY A;  1NP8 A;  4QJ4 B;  4I5J A;  2KFF A;  1WY9 A;  4NQG A;  1XFZ O;  1CDP A;  1EG3 A;  2KI6 D;  4MLW A;  4GGF A;  1S3P A;  3WHT B;  2NCP A;  5CSI A;  4QJ3 B;  1KSO A;  4XJK B;  1PK0 D;  1QS7 A;  2JT0 A;  3SG7 A;  4WQ2 A;  1CFP A;  4I5L B;  3SG5 A;  3PSR A;  1RRO A;  3OX6 A;  1Y1X A;  1F54 A;  2Y1N A;  2JWW A;  4PHN A;  2KGR A;  2MHH A;  5HLO A;  2FCD A;  3TZ1 A;  1B9A A;  1GGW A;  1RK9 A;  4PAL A;  2KSP A;  3NSO A;  1S5G Z;  1QIV A;  2KBM A;  1TCO B;  3BUW B;  1MWN A;  2JUL A;  1DJZ A;  1BLQ A;  4C0K A;  1IQ3 A;  2M1K B;  4PHJ A;  2K2A A;  1SKT A;  3HX4 A;  4AQJ A;  2F8P A;  1EJ3 A;  1S6C A;  5ER4 X;  2KFH A;  4ETO A;  2BCB A;  5HKW A;  1NSH A;  5J3X A;  1OQP A;  3TDU A;  4CFR A;  1YUT A;  1ZFS A;  1R2U A;  1WDC B;  5K89 A;  2VRG A;  4GGN A;  1DJH A;  2K7O A;  3BUO B;  2L51 A;  3H4S E;  4N5X A;  1REC A;  4C0J A;  4WQ3 A;  2R2I A;  3DF0 A;  1CTR A;  1WDC C;  1LA3 A;  1SMG A;  1EG4 A;  1RTP 1;  4MN0 A;  5ER5 A;  1DGV A;  1CLB A;  3WXA A;  1DF0 A;  3ZWH A;  2EGD A;  1A03 A;  3NXA A;  3CZT X;  4N1F A;  4MZL A;  3BUX B;  1A75 A;  4PHM A;  5AFP A;  2HET A;  1LXF C;  3A8R A;  1QAS A;  2MRD A;  2COL B;  1K96 A;  3AKB A;  4TNC A;  1KCY A;  3PAT A;  4DIR A;  3PFV A;  2ZNE A;  4YGE B;  2HF5 A;  5JOL A;  2LVV A;  3AAK A;  1S6I A;  4ORA B;  3PAL A;  3HCM A;  3SG2 A;  1W7I B;  4A4B A;  4MZJ A;  2F3Y A;  4YI8 A;  1K8U A;  4CPV A;  3LK1 A;  1CFF A;  1CNP A;  3VRP A;  1VRK A;  3DVK A;  3SJS A;  1NUB A;  4I5K A;  1JF2 A;  1NWD A;  2CTN A;  1K90 D;  1F4O A;  3IF7 A;  1WRK A;  2Y1M A;  3ZNI A;  1CLL A;  1Y6W A;  2KYF A;  4MBE A;  1XFX O;  3LCP C;  4GUK A;  4C0L A;  4DS7 A;  2LUX A;  1F55 A;  1OMV A;  2SCP A;  4CFQ A;  1YUU A;  2PVB A;  2K2F A;  2JRF A;  4YGC B;  3SG6 A;  2BKH B;  2LAP A;  1SL7 A;  1SY9 A;  2JXL A;  5AEQ A;  3O2P A;  3O6B A;  4DRW A;  4OKH A;  1IH0 A;  3AKA A;  4AOM A;  1QV1 A;  4XYN A;  2B1U A;  1BJF A;  3EVU A;  1G33 A;  2M1U A;  1ALW A;  1RFJ A;  2RGI A;  2KHN A;  4FQO A;  2E30 A;  2LMU A;  1SNL A;  1UWO A;  1K93 D;  5DKR A;  1SK6 D;  4USL A;  2LNK A;  1B4C A;  1A4P A;  2JZI A;  2H61 C;  1DJX A;  2MLE C;  4N1G A;  2KBI A;  5AXI A;  4YGA A;  3CR2 A;  3FWC A;  1S26 D;  5DKQ A;  2IS9 A;  1A2X A;  3AAJ A;  4OCI A;  2ISD A;  1QX2 A;  5D69 A;  3CR4 X;  1PVB A;  2JC2 A;  2A4J A;  1ZUZ A;  1NX0 A;  3TDI A;  2WCF A;  4GFT A;  2JTT A;  1ALV A;  1MXE A;  1U5I B;  1GJY A;  1WLM A;  1PSR A;  2GV5 A;  2JPT A;  4M2P A;  2KI4 B;  2AUC A;  4MSP A;  4ZCV A;  3O4Y A;  2KGB C;  1LIN A;  1YUR A;  3OHM B;  2KI4 C;  1CDN A;  3OX5 A;  1KSM A;  2Y4Q A;  1KWO B;  3BOW B;  4PE0 A;  2PSR A;  2Y5I A;  1MHO A;  1DTL A;  1B7T Z;  1DVI A;  1YUS A;  1KWO C;  3BYA A;  1FI6 A;  2NXQ A;  1NCX A;  2I94 A;  1UHJ A;  2WCE A;  2K7B A;  5BPJ A;  3SIA A;  1QVI Z;  2ZKM X;  1ZOT B;  4Q04 A;  1IRJ A;  1ODB A;  2K7C A;  1K9K A;  1SBJ A;  4XJK A;  1C07 A;  1NCZ A;  4JPZ B;  1IG5 A;  1KFU L;  2LLU A;  3I5G B;  4MRY A;  3VRN A;  5AER A;  1XVJ A;  3GK4 X;  1NCY A;  3TUY B;  1OZS A;  5HKZ A;  3I5G C;  5CSJ A;  1JWD A;  1IKU A;  1G8I A;  1N0Y A;  2LLS A;  4GNK B;  1N2D A;  1KK7 Y;  4HRG A;  2M7N A;  1QIW A;  1UHH A;  4L9M A;  1S1E A;  3A4U B;  5PAL A;  4MVF A;  3GK2 A;  3EKJ A;  5HLV A;  1BMO A;  4AQI A;  2BCX A;  1IGV A;  2HQW A;  3DVE A;  3WHU B;  2KDH A;  2M29 A;  3VRR A;  2WOR A;  1DJY A;  1TOP A;  1AUI B;  1J7R A;  3D0Y B;  4I5N B;  5HKY A;  1NYA A;  2BL0 B;  2M8U A;  4PE1 A;  1TNQ A;  1UP5 A;  1CMF A;  4FTG A;  2LP3 A;  1XFU O;  2BE6 A;  2BL0 C;  2O5G A;  4D1E A;  5KU1 A;  1UHN A;  2Q4U A;  1DF0 B;  1JBA A;  2WND A;  3EK4 A;  1YR5 A;  2ZN8 A;  5CSF A;  5I2L A;  1C7V A;  1QLS A;  2L4H A;  2HPS A;  1DGU A;  3KEV A;  2QAC A;  1A75 B;  2LMV A;  2TN4 A;  3CWG A;  5D7F A;  1DMO A;  1MUX A;  1QV0 A;  1YRU B;  4MRX A;  5F6T A;  1JSA A;  1JUO A;  1B8C A;  1CM4 A;  1QLK A;  4OVN F;  2KFG A;  2MAZ A;  3I5I B;  2CT9 A;  2L4I A;  3KPX A;  1YTZ C;  3FS7 A;  1KK7 Z;  4DUQ A;  1B47 A;  4NDC A;  2I7A A;  3I5I C;  2ZFD A;  2LHI A;  3EKH A;  1NX3 A;  2KQY A;  3F45 A;  1QJT A;  1FBV A;  1G4Y R;  1BG1 A;  1CLM A;  2DOQ A;  2F2P A;  1Y1A A;  1K95 A;  3IQQ A;  1H8B A;  2WC8 A;  4HSZ A;  3ICB A;  1SRA A;  2M3W A;  1V1G A;  2MJW B;  2LVJ A;  2SAS A;  3DVM A;  1ZMZ A;  1KFX S;  1SW8 A;  2EC6 B;  1PSB A;  1H4B A;  3EK7 A;  1BT6 A;  1WRZ A;  1F70 A;  4U8D A;  1DJW A;  4M2O A;  2EC6 C;  4BY5 A;  2JT8 A;  1MF8 B;  2I18 A;  3KO0 A;  3NSL A;  1F8H A;  3M0W A;  1BR4 B;  1LA0 A;  1ZAC A;  2WCB A;  1DJI A;  2CBL A;  3D10 A;  2LLT A;  3TDZ A;  1FPW A;  1GQM A;  1XO5 A;  2LCP A;  5DKN A;  3CR5 X;  1AHR A;  1M31 A;  1OE9 B;  1OSA A;  2M7L A;  1UUS A;  1PUL A;  1AVS A;  1UHK A;  3PN7 B;  3LL8 B;  1QAT A;  1M46 A;  2CNP A;  2LE9 B;  1NIW A;  1XK4 C;  1Y0V H;  1MQ1 A;  1SYM A;  1C7W A;  2H61 A;  3GK1 A;  1N65 A;  3KHE A;  3PN7 C;  2MLF C;  3RM1 A;  1J7Q A;  1UHI A;  3BQ3 A;  4JQ0 D;  2JXC A;  1FI5 A;  1B8L A;  3CS1 A;  1B1G A;  1YRT B;  3PM8 A;  1SL9 A;  1L2O B;  1S5G Y;  1EL4 A;  1TN4 A;  3OP0 A;  4E68 A;  2OPO A;  2BBM A;  2FOT A;  1L2O C;  2L2E A;  4HRE E;  1U5I A;  3TS5 B;  3EVR A;  5I2Q A;  2JU0 A;  4ORB B;  5G08 A;  5HYD A;  3TS5 C;  1BOD A;  3BUM B;  1S36 A;  2LVK A;  2NZ0 A;  3LLE A;  1XYD A;  1XFV O;  3FWB A;  4GGF C;  1SCV A;  2F2O A;  3BOW A;  1BU3 A;  1AP4 A;  2L50 A;  1FW4 A;  1HT9 A;  2KQ6 A;  1TNX A;  1HQV A;  3OB2 B;  4YBH B;  2AMI A;  2ZND A;  5AAN A;  1K9P A;  1Q80 A;  1WLZ A;  2OTG B;  5IBW A;  1UUR A;  2MBX A;  3I5F B;  3K21 A;  3RLZ A;  1SCM B;  2OTG C;  1NPQ A;  3SG3 A;  3I5F C;  3TUY C;  2NCO A;  1AJ5 A;  1SCM C;  1GGZ A;  2KOT A;  4JWQ A;  1J1E A;  1M63 B;  1IJ6 A;  1QTX A;  1QXP A;  2I2R E;  1TNW A;  1YVH A;  1JFK A;  3GOF A;  5I2O A;  1TIZ A;  2O60 A;  4PE4 A;  4PE7 A;  5FYX A;  2AAO A;  1XFW O;  4IL1 A;  1LVC D;  3JVT B;  2KAX A;  2G2B A;  1TCF A;  2BKI B;  1F71 A; 
#chains in the Genus database with same CATH topology
 3NSK A;  4WQ3 A;  1YX8 A;  1QX7 A;  1OMR A;  1S6J A;  1V1F A;  1J1D A;  3JVT C;  4WRI A;  1XFR A;  2KI6 C;  1QX5 B;  1WRL A;  3DF0 B;  1OOJ A;  4GPL B;  1AJ4 A;  2HQ8 A;  1JF0 A;  2ZRS A;  1AK8 A;  1BOC A;  2KYC A;  3L4L A;  4DCK A;  1IJ5 A;  1RJV A;  3D0Y A;  2LVI A;  2PRU A;  3QRX A;  2G9B A;  1E8A A;  3VGO A;  2M9G A;  1OMD A;  4ZCU A;  5D3O A;  1MR8 A;  2PAL A;  1B8R A;  2LP2 A;  2QPT A;  4P5O E;  1IQ5 A;  1CDL A;  4PDZ A;  1X02 A;  2JTZ A;  4GBA A;  1FF1 A;  2LHL A;  2JNX A;  1NX1 A;  1CB1 A;  1SPY A;  1XFY O;  2K7D A;  3FE6 A;  1K2H A;  3NSI A;  1KQM B;  2PMY A;  3R72 A;  1J7P A;  3KF9 A;  3LK0 A;  1IIO A;  1M39 A;  2E6W A;  2K8M B;  2OS8 B;  1KQM C;  1DJG A;  1PRW A;  3DZT A;  2L5Y A;  4BY4 A;  4PCW A;  1PAL A;  5JJG A;  4P2Y B;  3SG4 A;  2OS8 C;  1KK8 B;  4OR9 B;  3CTN A;  3OB1 B;  2PAS A;  4ICB A;  1TRF A;  4YGD B;  2L0P A;  1YVL A;  3WNX B;  3S0G A;  3VRO A;  1KK8 C;  5KSZ A;  2H2K A;  3CGA A;  2K0J A;  2KPH A;  1CM1 A;  3PM2 A;  4JKT A;  2F3Z A;  1YX7 A;  2L98 A;  4QJ5 B;  3E3R A;  2GGZ A;  4CLN A;  1EXR A;  4YGB B;  2JNF A;  2M49 B;  1TNP A;  2GGM A;  2FJY A;  1CDM A;  4HRH A;  4OV2 A;  5I8N A;  1DT7 B;  1CMG A;  1LKJ A;  5B8I B;  1JFJ A;  2JT3 A;  3FIA A;  1SL8 A;  2CCM A;  2BE4 A;  1J7O A;  1L7Z A;  3CLN A;  1OZO A;  3EVV A;  1Y1U A;  4MEW A;  3I5H B;  2FCE A;  5FI2 A;  1J55 A;  1K9U A;  5KTY A;  1F4Q A;  3I5H C;  2LUC A;  4NDB A;  4R1E A;  2FJU B;  5CPV A;  2WOS A;  1W7J B;  1XA5 A;  3C1V A;  1NX2 A;  3NHI A;  1JC2 A;  2KNE A;  3VRQ A;  1KQV A;  1TTX A;  4GAO A;  1B7T Y;  3BFH A;  4M2Q A;  1IWQ A;  3D77 A;  1R6P A;  1K94 A;  2M97 A;  2P6B B;  2K61 A;  2LV7 A;  1CFC A;  4A4C A;  4MZK A;  3PLF B;  3BUN B;  4PHK A;  4NDD A;  2D8N A;  1QVI Y;  1A29 A;  1KFX L;  2LM5 A;  2JQ6 A;  4YRU A;  2L2C A;  1EH2 A;  3D74 A;  3DVJ A;  1XK4 A;  3MSE B;  1BF5 A;  2ZRT A;  3O78 A;  2L5X B;  5TNC A;  2NLN A;  3SIB A;  2LMT A;  2BCA A;  3BXK A;  4UPG A;  4YI9 A;  3IQO A;  2ZN9 A;  3JTD B;  1PVA A;  4CID A;  2JOJ A;  5GQQ C;  2F33 A;  2BEC A;  1MXL C;  3EK8 A;  1SR6 B;  2CXJ A;  3JTD C;  2V53 A;  2EHB A;  1D1O A;  3DD4 A;  2LAN A;  1DEK A;  1BR1 B;  3L47 A;  4ORC B;  2LC5 A;  5CSN A;  2M0R A;  4F0Z B;  2KAV A;  2MA2 A;  1SR6 C;  1CFD A;  1KFU S;  1M45 A;  2KAY A;  2Q91 A;  1C3Z A;  1CKK A;  2BBN A;  1RWY A;  2QEO A;  1NP8 A;  4QJ4 B;  4I5J A;  2KFF A;  1WY9 A;  4NQG A;  1XFZ O;  1CDP A;  1EG3 A;  4JD9 A;  2KI6 D;  4MLW A;  4GGF A;  1S3P A;  3UNW A;  2NCP A;  5CSI A;  3WHT B;  4QJ3 B;  1KSO A;  4XJK B;  1PK0 D;  2GTE A;  1QS7 A;  2JT0 A;  3SG7 A;  1Z4H A;  4WQ2 A;  5HL1 A;  1CFP A;  4I5L B;  3SG5 A;  3SS4 A;  2ERB A;  3PSR A;  1RRO A;  3OX6 A;  1Y1X A;  3SS3 A;  1F54 A;  2Y1N A;  2JWW A;  4PHN A;  2KGR A;  3PJI A;  2MHH A;  3S0F A;  5HLO A;  2FCD A;  3TZ1 A;  1B9A A;  1GGW A;  1RK9 A;  4PAL A;  2KSP A;  3NSO A;  5DIC A;  1S5G Z;  1QIV A;  4INW A;  2KBM A;  1TCO B;  3BUW B;  1MWN A;  2JUL A;  1DJZ A;  1BLQ A;  4C0K A;  1IQ3 A;  2M1K B;  4PHJ A;  2K2A A;  1SKT A;  3HX4 A;  4AQJ A;  2F8P A;  1EJ3 A;  1S6C A;  5ER4 X;  3D75 A;  2KFH A;  4ETO A;  2BCB A;  5HKW A;  1NSH A;  5J3X A;  1OQP A;  3TDU A;  4CFR A;  1YUT A;  1ZFS A;  1R2U A;  1WDC B;  5K89 A;  2VRG A;  4GGN A;  1DJH A;  2K7O A;  3BUO B;  2L51 A;  3H4S E;  4N5X A;  1REC A;  4C0J A;  3FE9 A;  2R2I A;  3DF0 A;  1CTR A;  1WDC C;  1LA3 A;  1SMG A;  1EG4 A;  1RTP 1;  4MN0 A;  5ER5 A;  1DGV A;  1CLB A;  3WXA A;  1DF0 A;  3B7A A;  3ZWH A;  2EGD A;  1A03 A;  3NXA A;  3CZT X;  4N1F A;  3CZ0 A;  3BUX B;  1A75 A;  4MZL A;  4PHM A;  1C3Y A;  5AFP A;  2HET A;  1LXF C;  3A8R A;  1QAS A;  2MRD A;  2COL B;  1K96 A;  3AKB A;  3D73 A;  4TNC A;  3BFB A;  1KCY A;  3PAT A;  4DIR A;  3PFV A;  2ZNE A;  3DY9 A;  4YGE B;  2HF5 A;  4OZD A;  5JOL A;  1LS8 A;  1SSE B;  2QEV A;  3EG5 B;  2LVV A;  3AAK A;  1S6I A;  4ORA B;  3PAL A;  3HCM A;  3SG2 A;  1W7I B;  4A4B A;  4MZJ A;  2F3Y A;  4YI8 A;  1K8U A;  4CPV A;  3LK1 A;  1CFF A;  1CNP A;  3VRP A;  1VRK A;  3DVK A;  3O4X A;  3SJS A;  1OOG A;  2WCH A;  1NUB A;  4I5K A;  3Q8I A;  1JF2 A;  1NWD A;  2CTN A;  3NGV A;  3DXL A;  1K90 D;  1F4O A;  1DC1 A;  3IF7 A;  1WRK A;  2Y1M A;  3ZNI A;  1CLL A;  1Y6W A;  2KYF A;  4MBE A;  1XFX O;  2P71 A;  3LCP C;  4GUK A;  4C0L A;  4DS7 A;  2LUX A;  1F55 A;  1OMV A;  2SCP A;  4CFQ A;  1YUU A;  2PVB A;  3OBV A;  2K2F A;  2JRF A;  2KLE A;  4YGC B;  3SG6 A;  2BKH B;  2LAP A;  1SL7 A;  1SY9 A;  2JXL A;  5AEQ A;  3O2P A;  3O6B A;  4DRW A;  4OKH A;  1IH0 A;  3AKA A;  4AOM A;  1QV1 A;  4XYN A;  1BJF A;  2B1U A;  1OOH A;  3EVU A;  1G33 A;  2M1U A;  3B87 A;  1ALW A;  1RFJ A;  2RGI A;  2KHN A;  3SS5 A;  4FQO A;  3RZS A;  2E30 A;  2LMU A;  1SNL A;  1UWO A;  1K93 D;  5DKR A;  1SK6 D;  4USL A;  2LNK A;  1B4C A;  1A4P A;  5I94 A;  2JZI A;  3BFA A;  2H61 C;  1DJX A;  2MLE C;  4N1G A;  2KBI A;  5AXI A;  4YGA A;  3CR2 A;  3FWC A;  1S26 D;  5DKQ A;  2IS9 A;  1A2X A;  3AAJ A;  4OCI A;  2ISD A;  1QX2 A;  5D69 A;  3CR4 X;  1PVB A;  2YGU A;  2JC2 A;  2BNX A;  2A4J A;  1ZUZ A;  1NX0 A;  3TDI A;  2WCF A;  1OW4 A;  4GFT A;  2JTT A;  3R1V A;  1ALV A;  1MXE A;  1U5I B;  1GJY A;  1WLM A;  1PSR A;  2GV5 A;  2JPT A;  3D78 A;  2KI4 B;  2AUC A;  4MSP A;  4ZCV A;  3O4Y A;  2KGB C;  1LIN A;  1YUR A;  3OHM B;  2KI4 C;  1CDN A;  3OX5 A;  1KSM A;  2Y4Q A;  1KWO B;  1QWV A;  3B86 A;  3BOW B;  1TWO A;  3D76 A;  4PE0 A;  2PSR A;  2Y5I A;  1MHO A;  1DTL A;  1B7T Z;  1DVI A;  1YUS A;  1KWO C;  3BYA A;  1FI6 A;  2NXQ A;  1NCX A;  2I94 A;  3CAB A;  1UHJ A;  2BAP A;  2WCE A;  2K7B A;  3R1P A;  3V2L A;  5BPJ A;  3SIA A;  1QVI Z;  2ZKM X;  1ZOT B;  4Q04 A;  1IRJ A;  1ODB A;  2K7C A;  1K9K A;  1SBJ A;  4XJK A;  1C07 A;  1NCZ A;  2QEB A;  4JPZ B;  1GM0 A;  3B6X A;  1IG5 A;  1KFU L;  2LLU A;  3I5G B;  4MRY A;  3VRN A;  5AER A;  1XVJ A;  3GK4 X;  1NCY A;  3TUY B;  1OZS A;  5HKZ A;  3I5G C;  5CSJ A;  1JWD A;  1IKU A;  1G8I A;  1N0Y A;  2LLS A;  4GNK B;  1N2D A;  1KK7 Y;  4HRG A;  2M7N A;  2QEH A;  2PYQ A;  1QIW A;  1UHH A;  4L9M A;  1S1E A;  3N7H A;  3A4U B;  3L4A A;  5PAL A;  4MVF A;  3GK2 A;  3EKJ A;  5HLV A;  1BMO A;  4AQI A;  2BCX A;  1IGV A;  2HQW A;  3DVE A;  3WHU B;  2KDH A;  3CDN A;  2JPO A;  2M29 A;  3IVT A;  2WCJ A;  3VRR A;  2WOR A;  3S0B A;  3R1O A;  1DJY A;  1TOP A;  1AUI B;  1J7R A;  3D0Y B;  4I5N B;  5HKY A;  1NYA A;  2BL0 B;  2M8U A;  4PE1 A;  1TNQ A;  1UP5 A;  1CMF A;  2KLD A;  2LP3 A;  1XFU O;  2K60 A;  4FTG A;  2BE6 A;  2BL0 C;  2O5G A;  4D1E A;  5KU1 A;  1UHN A;  2Q4U A;  1DF0 B;  2WC5 A;  1JBA A;  2WND A;  3EK4 A;  1YR5 A;  2ZN8 A;  5CSF A;  5I2L A;  1C7V A;  2P70 A;  1QLS A;  2L4H A;  2HPS A;  1DGU A;  3KEV A;  4M2P A;  1P28 A;  1A75 B;  2LMV A;  2QAC A;  3S0E A;  4F7F A;  2TN4 A;  3CWG A;  5D7F A;  1DMO A;  1MUX A;  1QV0 A;  1YRU B;  4MRX A;  5F6T A;  2H8V A;  1JSA A;  1JUO A;  1B8C A;  1CM4 A;  1QLK A;  4OVN F;  2KFG A;  2MAZ A;  3I5I B;  2CT9 A;  2L4I A;  3KPX A;  3CYZ A;  1YTZ C;  3FS7 A;  1KK7 Z;  1T14 A;  5FI7 A;  1B47 A;  4DUQ A;  4NDC A;  4FQT A;  2I7A A;  3I5I C;  2ZFD A;  2LHI A;  3EKH A;  1NX3 A;  2KQY A;  5EL2 A;  3F45 A;  1QJT A;  1FBV A;  1G4Y R;  1BG1 A;  1CLM A;  2DOQ A;  2F2P A;  1Y1A A;  1K95 A;  3IQQ A;  4INX A;  3CZ2 A;  1H8B A;  2WC8 A;  4HSZ A;  3ICB A;  1SRA A;  2M3W A;  1V1G A;  2MJW B;  1OOI X;  2LVJ A;  2SAS A;  1OOF A;  3DVM A;  1ZMZ A;  1KFX S;  1SW8 A;  2EC6 B;  1PSB A;  1H4B A;  3EK7 A;  1BT6 A;  1DQE A;  1WRZ A;  2WCM A;  4U8D A;  1DJW A;  4M2O A;  1F70 A;  2EC6 C;  4BY5 A;  2JT8 A;  1MF8 B;  3NHT A;  2I18 A;  3KO0 A;  3NSL A;  1F8H A;  3M0W A;  1BR4 B;  1LA0 A;  1ZAC A;  2WCB A;  1DJI A;  3BJH A;  2CBL A;  3D10 A;  2LLT A;  3TDZ A;  1FPW A;  1GQM A;  1XO5 A;  4KYN A;  2LCP A;  5DKN A;  3CR5 X;  2WC6 A;  1TUZ A;  1AHR A;  1M31 A;  1OE9 B;  1OSA A;  2WCK A;  2M7L A;  1UUS A;  1PUL A;  1AVS A;  1UHK A;  3PN7 B;  3B88 A;  3LL8 B;  1QAT A;  1M46 A;  2CNP A;  2LE9 B;  1NIW A;  1XK4 C;  1Z2C B;  1Y0V H;  1MQ1 A;  1C7W A;  1SYM A;  2H61 A;  1N65 A;  3GK1 A;  3KHE A;  3PN7 C;  1W9Z A;  4IJ7 A;  2MLF C;  3RM1 A;  1J7Q A;  1UHI A;  3BQ3 A;  4JQ0 D;  2JXC A;  1FI5 A;  1B8L A;  3DYE A;  3CS1 A;  1B1G A;  3FE8 A;  1YRT B;  5FI6 A;  3PM8 A;  2WCL A;  1SL9 A;  3OGN A;  1L2O B;  1S5G Y;  1EL4 A;  1TN4 A;  3OP0 A;  4E68 A;  2OPO A;  2BBM A;  2PQL A;  2FOT A;  1L2O C;  2L2E A;  4HRE E;  1U5I A;  3TS5 B;  3EVR A;  5I2Q A;  2JU0 A;  4ORB B;  1DEL A;  5G08 A;  5HYD A;  3TS5 C;  1BOD A;  3BUM B;  1S36 A;  2LVK A;  2NZ0 A;  3LLE A;  3S0D A;  1XYD A;  1XFV O;  3FWB A;  4GGF C;  1SCV A;  2F2O A;  3BOW A;  1BU3 A;  1AP4 A;  2L50 A;  4PT1 A;  1FW4 A;  1HT9 A;  2KQ6 A;  3CZ1 A;  1TNX A;  1HQV A;  3S0A A;  3OB2 B;  2QDI A;  2AMI A;  2ZND A;  4YBH B;  1K9P A;  1Q80 A;  1WLZ A;  5AAN A;  2OTG B;  5IBW A;  1UUR A;  2MBX A;  3I5F B;  3K21 A;  3RLZ A;  1SCM B;  2OTG C;  1NPQ A;  3K1E A;  3SG3 A;  3I5F C;  3TUY C;  1TUJ A;  2NCO A;  1AJ5 A;  1SCM C;  1GGZ A;  2KOT A;  4JWQ A;  1J1E A;  1M63 B;  1IJ6 A;  1QTX A;  1ORG A;  1QXP A;  2I2R E;  1TNW A;  3QME A;  1YVH A;  1JFK A;  3UO9 A;  3GOF A;  5I2O A;  1TIZ A;  2O60 A;  3VB1 A;  4PE4 A;  4PE7 A;  5FYX A;  2AAO A;  1XFW O;  4IL1 A;  1LVC D;  3JVT B;  2KAX A;  2G2B A;  1TCF A;  2BKI B;  1F71 A; 
#chains in the Genus database with same CATH homology
 3NSK A;  1YX8 A;  1QX7 A;  1OMR A;  1S6J A;  1V1F A;  1J1D A;  3JVT C;  4WRI A;  2KI6 C;  1QX5 B;  1WRL A;  3DF0 B;  1OOJ A;  4GPL B;  1AJ4 A;  2HQ8 A;  1JF0 A;  2ZRS A;  1AK8 A;  1BOC A;  2KYC A;  4DCK A;  1IJ5 A;  1RJV A;  3D0Y A;  2LVI A;  2PRU A;  3QRX A;  2G9B A;  1E8A A;  3VGO A;  2M9G A;  1OMD A;  4ZCU A;  1MR8 A;  2PAL A;  1B8R A;  2LP2 A;  2QPT A;  4P5O E;  1IQ5 A;  1CDL A;  4PDZ A;  1X02 A;  2JTZ A;  4GBA A;  1FF1 A;  2LHL A;  2JNX A;  1NX1 A;  1CB1 A;  1SPY A;  1XFY O;  2K7D A;  1K2H A;  3NSI A;  1KQM B;  2PMY A;  1J7P A;  3KF9 A;  3LK0 A;  1M39 A;  2E6W A;  2K8M B;  2OS8 B;  1KQM C;  1DJG A;  1PRW A;  4BY4 A;  4PCW A;  1PAL A;  5JJG A;  4P2Y B;  3SG4 A;  2OS8 C;  1KK8 B;  4OR9 B;  3CTN A;  3OB1 B;  2PAS A;  4ICB A;  1TRF A;  4YGD B;  2L0P A;  1YVL A;  3WNX B;  3VRO A;  1KK8 C;  5KSZ A;  2H2K A;  3CGA A;  2K0J A;  1CM1 A;  2F3Z A;  1YX7 A;  2L98 A;  4QJ5 B;  3E3R A;  2GGZ A;  4CLN A;  1EXR A;  4YGB B;  2JNF A;  2M49 B;  1TNP A;  2GGM A;  1CDM A;  4HRH A;  4OV2 A;  5I8N A;  1DT7 B;  1CMG A;  1LKJ A;  5B8I B;  1JFJ A;  2JT3 A;  3FIA A;  1SL8 A;  2CCM A;  2BE4 A;  1J7O A;  1L7Z A;  3CLN A;  1OZO A;  3EVV A;  1Y1U A;  4MEW A;  3I5H B;  2FCE A;  1J55 A;  1K9U A;  5KTY A;  1F4Q A;  3I5H C;  2LUC A;  4NDB A;  4R1E A;  2FJU B;  5CPV A;  2WOS A;  1W7J B;  1XA5 A;  3C1V A;  1NX2 A;  1KQV A;  1JC2 A;  2KNE A;  3VRQ A;  1TTX A;  4GAO A;  1B7T Y;  4M2Q A;  1IWQ A;  1R6P A;  1K94 A;  2M97 A;  2P6B B;  2K61 A;  2LV7 A;  1CFC A;  4A4C A;  4MZK A;  3PLF B;  3BUN B;  4PHK A;  4NDD A;  2D8N A;  1QVI Y;  1A29 A;  1KFX L;  2LM5 A;  2JQ6 A;  4YRU A;  1EH2 A;  3DVJ A;  1XK4 A;  3MSE B;  1BF5 A;  2ZRT A;  3O78 A;  2L5X B;  5TNC A;  2NLN A;  3SIB A;  2LMT A;  2BCA A;  3BXK A;  4UPG A;  4YI9 A;  3IQO A;  2ZN9 A;  3JTD B;  1PVA A;  4CID A;  2JOJ A;  5GQQ C;  2F33 A;  2BEC A;  1MXL C;  3EK8 A;  1SR6 B;  2CXJ A;  3JTD C;  2V53 A;  2EHB A;  1D1O A;  3DD4 A;  2LAN A;  4ORC B;  1BR1 B;  5CSN A;  2LC5 A;  2M0R A;  4F0Z B;  2KAV A;  2MA2 A;  1SR6 C;  1CFD A;  1KFU S;  1M45 A;  2KAY A;  2Q91 A;  1CKK A;  2BBN A;  1RWY A;  1NP8 A;  4QJ4 B;  4I5J A;  2KFF A;  1WY9 A;  4NQG A;  1XFZ O;  1CDP A;  1EG3 A;  2KI6 D;  4MLW A;  4GGF A;  1S3P A;  3WHT B;  2NCP A;  5CSI A;  4QJ3 B;  1KSO A;  4XJK B;  1PK0 D;  1QS7 A;  2JT0 A;  3SG7 A;  4WQ2 A;  1CFP A;  4I5L B;  3SG5 A;  3PSR A;  1RRO A;  3OX6 A;  1Y1X A;  1F54 A;  2Y1N A;  2JWW A;  4PHN A;  2KGR A;  2MHH A;  5HLO A;  2FCD A;  3TZ1 A;  1B9A A;  1GGW A;  1RK9 A;  4PAL A;  2KSP A;  3NSO A;  1S5G Z;  1QIV A;  2KBM A;  1TCO B;  3BUW B;  1MWN A;  2JUL A;  1DJZ A;  1BLQ A;  4C0K A;  1IQ3 A;  2M1K B;  4PHJ A;  2K2A A;  1SKT A;  3HX4 A;  4AQJ A;  2F8P A;  1EJ3 A;  1S6C A;  5ER4 X;  2KFH A;  4ETO A;  2BCB A;  5HKW A;  1NSH A;  5J3X A;  1OQP A;  3TDU A;  4CFR A;  1YUT A;  1ZFS A;  1R2U A;  1WDC B;  5K89 A;  2VRG A;  4GGN A;  1DJH A;  2K7O A;  3BUO B;  2L51 A;  3H4S E;  4N5X A;  1REC A;  4C0J A;  4WQ3 A;  2R2I A;  3DF0 A;  1CTR A;  1WDC C;  1LA3 A;  1SMG A;  1EG4 A;  1RTP 1;  4MN0 A;  5ER5 A;  1DGV A;  1CLB A;  3WXA A;  1DF0 A;  3ZWH A;  2EGD A;  1A03 A;  3NXA A;  3CZT X;  4N1F A;  4MZL A;  3BUX B;  1A75 A;  4PHM A;  5AFP A;  2HET A;  1LXF C;  3A8R A;  1QAS A;  2MRD A;  2COL B;  1K96 A;  3AKB A;  4TNC A;  1KCY A;  3PAT A;  4DIR A;  3PFV A;  2ZNE A;  4YGE B;  2HF5 A;  5JOL A;  2LVV A;  3AAK A;  1S6I A;  4ORA B;  3PAL A;  3HCM A;  3SG2 A;  1W7I B;  4A4B A;  4MZJ A;  2F3Y A;  4YI8 A;  1K8U A;  4CPV A;  3LK1 A;  1CFF A;  1CNP A;  3VRP A;  1VRK A;  3DVK A;  3SJS A;  1NUB A;  4I5K A;  1JF2 A;  1NWD A;  2CTN A;  1K90 D;  1F4O A;  3IF7 A;  1WRK A;  2Y1M A;  3ZNI A;  1CLL A;  1Y6W A;  2KYF A;  4MBE A;  1XFX O;  3LCP C;  4GUK A;  4C0L A;  4DS7 A;  2LUX A;  1F55 A;  1OMV A;  2SCP A;  4CFQ A;  1YUU A;  2PVB A;  2K2F A;  2JRF A;  4YGC B;  3SG6 A;  2BKH B;  2LAP A;  1SL7 A;  1SY9 A;  2JXL A;  5AEQ A;  3O2P A;  3O6B A;  4DRW A;  4OKH A;  1IH0 A;  3AKA A;  4AOM A;  1QV1 A;  4XYN A;  2B1U A;  1BJF A;  3EVU A;  1G33 A;  2M1U A;  1ALW A;  1RFJ A;  2RGI A;  2KHN A;  4FQO A;  2E30 A;  2LMU A;  1SNL A;  1UWO A;  1K93 D;  5DKR A;  1SK6 D;  4USL A;  2LNK A;  1B4C A;  1A4P A;  2JZI A;  2H61 C;  1DJX A;  2MLE C;  4N1G A;  2KBI A;  5AXI A;  4YGA A;  3CR2 A;  3FWC A;  1S26 D;  5DKQ A;  2IS9 A;  1A2X A;  3AAJ A;  4OCI A;  2ISD A;  1QX2 A;  5D69 A;  3CR4 X;  1PVB A;  2JC2 A;  2A4J A;  1ZUZ A;  1NX0 A;  3TDI A;  2WCF A;  4GFT A;  2JTT A;  1ALV A;  1MXE A;  1U5I B;  1GJY A;  1WLM A;  1PSR A;  2GV5 A;  2JPT A;  4M2P A;  2KI4 B;  2AUC A;  4MSP A;  4ZCV A;  3O4Y A;  2KGB C;  1LIN A;  1YUR A;  3OHM B;  2KI4 C;  1CDN A;  3OX5 A;  1KSM A;  2Y4Q A;  1KWO B;  3BOW B;  4PE0 A;  2PSR A;  2Y5I A;  1MHO A;  1DTL A;  1B7T Z;  1DVI A;  1YUS A;  1KWO C;  3BYA A;  1FI6 A;  2NXQ A;  1NCX A;  2I94 A;  1UHJ A;  2WCE A;  2K7B A;  5BPJ A;  3SIA A;  1QVI Z;  2ZKM X;  1ZOT B;  4Q04 A;  1IRJ A;  1ODB A;  2K7C A;  1K9K A;  1SBJ A;  4XJK A;  1C07 A;  1NCZ A;  4JPZ B;  1IG5 A;  1KFU L;  2LLU A;  3I5G B;  4MRY A;  3VRN A;  5AER A;  1XVJ A;  3GK4 X;  1NCY A;  3TUY B;  1OZS A;  5HKZ A;  3I5G C;  5CSJ A;  1JWD A;  1IKU A;  1G8I A;  1N0Y A;  2LLS A;  4GNK B;  1N2D A;  1KK7 Y;  4HRG A;  2M7N A;  1QIW A;  1UHH A;  4L9M A;  1S1E A;  3A4U B;  5PAL A;  4MVF A;  3GK2 A;  3EKJ A;  5HLV A;  1BMO A;  4AQI A;  2BCX A;  1IGV A;  2HQW A;  3DVE A;  3WHU B;  2KDH A;  2M29 A;  3VRR A;  2WOR A;  1DJY A;  1TOP A;  1AUI B;  1J7R A;  3D0Y B;  4I5N B;  5HKY A;  1NYA A;  2BL0 B;  2M8U A;  4PE1 A;  1TNQ A;  1UP5 A;  1CMF A;  4FTG A;  2LP3 A;  1XFU O;  2BE6 A;  2BL0 C;  2O5G A;  4D1E A;  5KU1 A;  1UHN A;  2Q4U A;  1DF0 B;  1JBA A;  2WND A;  3EK4 A;  1YR5 A;  2ZN8 A;  5CSF A;  5I2L A;  1C7V A;  1QLS A;  2L4H A;  2HPS A;  1DGU A;  3KEV A;  2QAC A;  1A75 B;  2LMV A;  2TN4 A;  3CWG A;  5D7F A;  1DMO A;  1MUX A;  1QV0 A;  1YRU B;  4MRX A;  5F6T A;  1JSA A;  1JUO A;  1B8C A;  1CM4 A;  1QLK A;  4OVN F;  2KFG A;  2MAZ A;  3I5I B;  2CT9 A;  2L4I A;  3KPX A;  1YTZ C;  3FS7 A;  1KK7 Z;  4DUQ A;  1B47 A;  4NDC A;  2I7A A;  3I5I C;  2ZFD A;  2LHI A;  3EKH A;  1NX3 A;  2KQY A;  3F45 A;  1QJT A;  1FBV A;  1G4Y R;  1BG1 A;  1CLM A;  2DOQ A;  2F2P A;  1Y1A A;  1K95 A;  3IQQ A;  1H8B A;  2WC8 A;  4HSZ A;  3ICB A;  1SRA A;  2M3W A;  1V1G A;  2MJW B;  2LVJ A;  2SAS A;  3DVM A;  1ZMZ A;  1KFX S;  1SW8 A;  2EC6 B;  1PSB A;  1H4B A;  3EK7 A;  1BT6 A;  1WRZ A;  1F70 A;  4U8D A;  1DJW A;  4M2O A;  2EC6 C;  4BY5 A;  2JT8 A;  1MF8 B;  2I18 A;  3KO0 A;  3NSL A;  1F8H A;  3M0W A;  1BR4 B;  1LA0 A;  1ZAC A;  2WCB A;  1DJI A;  2CBL A;  3D10 A;  2LLT A;  3TDZ A;  1FPW A;  1GQM A;  1XO5 A;  2LCP A;  5DKN A;  3CR5 X;  1AHR A;  1M31 A;  1OE9 B;  1OSA A;  2M7L A;  1UUS A;  1PUL A;  1AVS A;  1UHK A;  3PN7 B;  3LL8 B;  1QAT A;  1M46 A;  2CNP A;  2LE9 B;  1NIW A;  1XK4 C;  1Y0V H;  1MQ1 A;  1SYM A;  1C7W A;  2H61 A;  3GK1 A;  1N65 A;  3KHE A;  3PN7 C;  2MLF C;  3RM1 A;  1J7Q A;  1UHI A;  3BQ3 A;  4JQ0 D;  2JXC A;  1FI5 A;  1B8L A;  3CS1 A;  1B1G A;  1YRT B;  3PM8 A;  1SL9 A;  1L2O B;  1S5G Y;  1EL4 A;  1TN4 A;  3OP0 A;  4E68 A;  2OPO A;  2BBM A;  2FOT A;  1L2O C;  2L2E A;  4HRE E;  1U5I A;  3TS5 B;  3EVR A;  5I2Q A;  2JU0 A;  4ORB B;  5G08 A;  5HYD A;  3TS5 C;  1BOD A;  3BUM B;  1S36 A;  2LVK A;  2NZ0 A;  3LLE A;  1XYD A;  1XFV O;  3FWB A;  4GGF C;  1SCV A;  2F2O A;  3BOW A;  1BU3 A;  1AP4 A;  2L50 A;  1FW4 A;  1HT9 A;  2KQ6 A;  1TNX A;  1HQV A;  3OB2 B;  4YBH B;  2AMI A;  2ZND A;  5AAN A;  1K9P A;  1Q80 A;  1WLZ A;  2OTG B;  5IBW A;  1UUR A;  2MBX A;  3I5F B;  3K21 A;  3RLZ A;  1SCM B;  2OTG C;  1NPQ A;  3SG3 A;  3I5F C;  3TUY C;  2NCO A;  1AJ5 A;  1SCM C;  1GGZ A;  2KOT A;  4JWQ A;  1J1E A;  1M63 B;  1IJ6 A;  1QTX A;  1QXP A;  2I2R E;  1TNW A;  1YVH A;  1JFK A;  3GOF A;  5I2O A;  1TIZ A;  2O60 A;  4PE4 A;  4PE7 A;  5FYX A;  2AAO A;  1XFW O;  4IL1 A;  1LVC D;  3JVT B;  2KAX A;  2G2B A;  1TCF A;  2BKI B;  1F71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...