3GK4X

X-ray structure of bovine sbi523,ca(2+)-s100b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Protein S100-B
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3gk4X00
3IF7A 2LANA 4P2YB 1CNPA 2I94A 1WRZA 1F55A 2V53A 1M46A 1XFYO 1U5IB 2ZN8A 3KF9A 2OTGC 2PMYA 3KHEA 2LHLA 1BG1A 1C07A 1D1OA 1GGZA 1CTRA 1UHHA 3DF0A 3MSEB 4UPGA 1QV0A 4GAOA 5B8IB 1RTP1 5D7FA 1AJ5A 1R2UA 3PN7C 4OKHA 4QJ4B 3JTDC 3TUYB 4CIDA 1SR6C 2KHNA 4GNKB 3OP0A 1S26D 2KAYA 5I2LA 2MHHA 3ZNIA 4GPLB 4I5NB 2Q4UA 1WDCC 4D1EA 1SPYA 2EC6B 1CFCA 1NCZA 2LMVA 4MBEA 3TDUA 1DGUA 1CM4A 3K21A 2EC6C 1V1GA 1CLMA 1TOPA 2L50A 4I5LB 1XFUO 2LLUA 3ICBA 3CR5X 4DS7A 2CCMA 3PM8A 1A75B 2NZ0A 3JTDB 3TUYC 3SG7A 3WNXB 2I2RE 2JXLA 1SL9A 3A4UB 3M0WA 1B7TY 2KI4B 3GK1A 2A4JA 3EVUA 2H61A 2KAXA 1BJFA 1QATA 3CLNA 4R1EA 3SG4A 2MLFC 1XA5A 5IBWA 1PULA 4HSZA 4YGAA 1UP5A 2BE6A 1KQVA 2BBMA 3DD4A 4MEWA 1KSOA 3WHTB 5CSJA 3NSKA 5I8NA 4F0ZB 1QX5B 2JU0A 4PCWA 3SG2A 1ZMZA 2Y5IA 1UUSA 4FTGA 2KYCA 2F2OA 1QIVA 2BBNA 1LA3A 3F45A 1QXPA 2ISDA 2M8UA 1JC2A 2M1KB 1CMGA 2LC5A 1AP4A 2HQ8A 1B47A 3I5HB 1MHOA 2L0PA 5HYDA 2CXJA 2FJUB 2HQWA 2SASA 4DIRA 5CSIA 2OS8C 2WORA 3PN7B 2ZRSA 1IWQA 1PVBA 3HX4A 1Y0VH 4XJKB 2M1UA 1IH0A 2LCPA 4MZKA 2P6BB 1Y6WA 2COLB 2JNXA 4M2PA 3D0YB 1QLKA 3AKBA 1CMFA 4C0KA 3FS7A 4WQ2A 1QV1A 2CNPA 2ZFDA 4OR9B 4GGFC 5AANA 1CDNA 3PATA 1QVIY 1HT9A 3NSLA 5D69A 5I2QA 3SIAA 1G33A 3PALA 2LM5A 3IQOA 3FIAA 2R2IA 1J7OA 2JZIA 3EK4A 3ZWHA 1J7RA 2K8MB 1YUSA 2BKIB 3CWGA 1KCYA 1N65A 3I5FC 1F71A 1KK7Z 2F3ZA 4CPVA 1WY9A 1KFXS 2MLEC 1XO5A 2PSRA 4YGBB 1A2XA 1A29A 1SYMA 4PHMA 1KWOC 3RM1A 1CFFA 1TN4A 2NCPA 3LL8B 3OB2B 5TNCA 2M49B 1MQ1A 4N1FA 1MF8B 2LP3A 2E6WA 3OHMB 1HQVA 2BCXA 3IQQA 1K9UA 2D8NA 2F2PA 4I5JA 2G9BA 4YBHB 4ZCUA 3VRQA 4MRXA 1Y1UA 1L7ZA 1QX2A 3DF0B 1JFKA 1GQMA 3BOWB 3LCPC 1QVIZ 1FW4A 2PASA 2LMUA 4DUQA 1IG5A 2IS9A 1ALVA 1LINA 3LK1A 4C0LA 3TZ1A 3JVTB 4XJKA 1S1EA 5AEQA 2MA2A 1DJYA 1KFUL 1SNLA 3AAKA 3VROA 1R6PA 2JT3A 1L2OC 5DKRA 5I2OA 2ZNDA 2L4IA 2K7DA 1B7TZ 5HKWA 4P5OE 1QLSA 2L98A 1SK6D 2LVKA 4L9MA 5BPJA 2I18A 4N5XA 1LXFC 2BL0C 1YRUB 3PLFB 3TDIA 1BLQA 1Y1AA 2M97A 2KI6D 2JNFA 5DKNA 1SW8A 1AVSA 1X02A 1N2DA 1DTLA 2M9GA 3BQ3A 1ZFSA 1PRWA 1SMGA 2EGDA 2KGBC 3D10A 2AMIA 2LV7A 4NDCA 1DT7B 1CFPA 1OE9B 1RFJA 2NXQA 1SRAA 2AUCA 2VRGA 1OZSA 2BL0B 2JT8A 3OX6A 4MRYA 1XVJA 1N0YA 1QX7A 4MLWA 1JSAA 1ZOTB 2KFGA 4YGDB 1PSBA 1BOCA 2DOQA 1NPQA 1SR6B 1SCMB 2ZN9A 1B8CA 2Q91A 3O4YA 4WQ3A 2LVVA 1QTXA 3DVMA 4PALA 1B1GA 5J3XA 1YX8A 1NYAA 1JF2A 2HETA 2LNKA 3CS1A 2RGIA 3NXAA 1NX2A 1DF0B 2GGMA 2MRDA 3GK4X 2WOSA 1F8HA 2FOTA 1C7VA 1YTZC 1NX0A 2OTGB 3I5IB 3VRPA 1IGVA 1IRJA 1NWDA 5AXIA 2JT0A 4PE7A 1A75A 2NLNA 1UHKA 1DGVA 3CR2A 3DVEA 3WHUB 4A4CA 1CLBA 5ER5A 1SBJA 5FYXA 1FI5A 4TNCA 1S36A 1KK8C 2K0JA 3I5FB 1XK4C 2Y1NA 5HLVA 3EK7A 1CLLA 1YVLA 1WLZA 1NCYA 1V1FA 2H61C 1QASA 3BUWB 4QJ5B 1OSAA 1NUBA 1C7WA 1LA0A 2LMTA 1NX1A 2LLTA 4YGEB 2K61A 2K7CA 5HKZA 4MVFA 4ETOA 3WXAA 3H4SE 5G08A 1EJ3A 1Q80A 1KK7Y 4ORCB 4GUKA 4ORBB 4DRWA 2H2KA 5DKQA 2K7BA 1J55A 2JRFA 4PDZA 3TS5B 2MAZA 1DJWA 1S5GY 2ZNEA 4JPZB 2FCEA 4JWQA 5KTYA 3EKHA 4M2QA 4JQ0D 2JC2A 1TNWA 3KEVA 1TIZA 1SKTA 1B8RA 1K94A 1UURA 4ICBA 1MR8A 4AQIA 1Y1XA 1IJ6A 1EL4A 2LUCA 5CPVA 1XYDA 2ZKMX 1CDPA 1WDCB 1ZACA 4ZCVA 1K90D 1PSRA 2CBLA 2QACA 4YRUA 1L2OB 4N1GA 1WRLA 2M7LA 1ODBA 4OCIA 3BUNB 4PE1A 2L4HA 3DVKA 2KFHA 3EVVA 5JOLA 1PALA 1F70A 2PVBA 1J1DA 3BYAA 4GGFA 1BR4B 1B9AA 2KNEA 2JTTA 1KSMA 4I5KA 1M63B 3I5GB 4PE4A 1DF0A 1DJZA 1CB1A 2LE9B 1MXLC 1B4CA 4AQJA 1GGWA 1TTXA 3VRNA 2KI4C 2EHBA 4YGCB 1PK0D 2MBXA 1AHRA 4CLNA 1MWNA 1BR1B 1S6CA 5JJGA 2LUXA 3JVTC 3QRXA 4MZJA 1EH2A 2KQ6A 4FQOA 4WRIA 3SG5A 3LLEA 1MXEA 1EG4A 1BMOA 3CZTX 3CR4X 4ORAB 1F4OA 1UHIA 2QPTA 4Q04A 2HPSA 3TDZA 1YR5A 3BUMB 1K8UA 1K2HA 1XFWO 1PVAA 1G8IA 2E30A 3E3RA 1K9KA 1BU3A 1SL8A 1K93D 5HLOA 2WCEA 1DVIA 1CDMA 1OMRA 3GOFA 4PE0A 4IL1A 1E8AA 1VRKA 1A4PA 2Y4QA 5KSZA 1ALWA 1JFJA 1F54A 1KFUS 2L51A 2WCBA 1KQMC 1FF1A 1QJTA 2KI6C 5KU1A 1W7JB 2F8PA 4CFQA 4AOMA 1ZUZA 3I5IC 1H8BA 3SIBA 4YI8A 3BUXB 2WNDA 1RWYA 1WRKA 3BOWA 1FPWA 5GQQC 4QJ3B 1RK9A 1UHJA 1IKUA 1CDLA 1TCFA 1KQMB 3O78A 2LLSA 2OPOA 1AUIB 1K95A 1UWOA 2CTNA 4USLA 3A8RA 1K96A 3LK0A 1OQPA 2F33A 1SCVA 4HREE 5K89A 2JOJA 4GGNA 1XFXO 2LAPA 4M2OA 5F6TA 3SG3A 5HKYA 1DJIA 2KBIA 1AJ4A 4CFRA 2O5GA 4BY5A 1A03A 1U5IA 1KFXL 2K7OA 1KK8B 1OMDA 5CSFA 4PHNA 1YVHA 3SG6A 1QIWA 1H4BA 2LVJA 2AAOA 4OVNF 1CM1A 2BCBA 1YURA 3CTNA 1DJHA 1NSHA 3O2PA 5CSNA 1BODA 2ZRTA 2O60A 1WLMA 2BCAA 2KGRA 3SJSA 2HF5A 2B1UA 2KDHA 4NDBA 3PFVA 2KSPA 4A4BA 4OV2A 2M29A 4MSPA 2G2BA 1AK8A 4U8DA 2BKHB 2KFFA 1TRFA 1EXRA 1OZOA 1B8LA 4NQGA 2GGZA 1G4YR 4HRHA 3I5GC 2M7NA 1BT6A 1W7IB 3OB1B 1DJXA 1YUUA 2FCDA 2KYFA 2M0RA 4C0JA 1J1EA 1SCMC 2KOTA 3RLZA 2LHIA 1TCOB 5PALA 1IQ5A 1YX7A 4GBAA 1OMVA 2JWWA 2JPTA 1K9PA 2JQ6A 3KPXA 1OOJA 2SCPA 1IQ3A 4HRGA 1XFZO 1XK4A 1CKKA 3AAJA 5ER4X 4PHJA 4MN0A 1EG3A 4DCKA 1UHNA 1NX3A 1IJ5A 3CGAA 3NSOA 1S6JA 1SY9A 4YI9A 2KAVA 2TN4A 1KWOB 1NP8A 3HCMA 3TS5C 3D0YA 2BECA 1S3PA 1SL7A 3O6BA 1RECA 4MZLA 2KBMA 3EVRA 3KO0A 1J7QA 1TNQA 1FBVA 2WC8A 3VGOA 2I7AA 3AKAA 2PRUA 4NDDA 2BE4A 2M3WA 3NSIA 4E68A 1LKJA 1LVCD 1RROA 1DMOA 1MUXA 3PSRA 3EKJA 2JTZA 2GV5A 1TNXA 1S6IA 2PALA 3FWBA 1DJGA 1CFDA 4XYNA 2JXCA 2KQYA 1M45A 1XFVO 2CT9A 3VRRA 5AERA 3FWCA 2LP2A 4BY4A 3DVJA 3BUOB 1RJVA 2JULA 1FI6A 2F3YA 1QS7A 2OS8B 1TNPA 3EK8A 1JUOA 1GJYA 1S5GZ 2K2AA 1JWDA 1BF5A 2LVIA 2WCFA 2Y1MA 3I5HC 3OX5A 1YUTA 1M31A 1M39A 2L5XB 4PHKA 2NCOA 4GFTA 1YRTB 1J7PA 2K2FA 2MJWB 1JBAA 3GK2A 1NCXA 1F4QA 1NIWA 5AFPA 2L2EA 3C1VA 3BXKA 1JF0A
chains in the Genus database with same CATH superfamily
2YGUA 3IF7A 2LANA 4P2YB 1CNPA 2I94A 1WRZA 1F55A 2V53A 1M46A 1XFYO 1U5IB 2ZN8A 3KF9A 2OTGC 2PMYA 3KHEA 2LHLA 3EG5B 1BG1A 1C07A 1D1OA 3PM2A 1GGZA 3S0FA 1CTRA 1UHHA 3DF0A 3MSEB 3CABA 4UPGA 1QV0A 4GAOA 5B8IB 1RTP1 5D7FA 1AJ5A 1R2UA 3PN7C 4OKHA 2PYQA 4QJ4B 3JTDC 3TUYB 4CIDA 1SR6C 2KHNA 4GNKB 3OP0A 1S26D 2KAYA 5I2LA 2MHHA 3ZNIA 4GPLB 4I5NB 2Q4UA 1WDCC 3N7HA 1SPYA 2EC6B 4D1EA 1NCZA 2LMVA 4MBEA 3TDUA 1CFCA 3B7AA 1DGUA 1CM4A 3K21A 2EC6C 1V1GA 1CLMA 1TOPA 2L50A 3R1PA 4I5LB 1XFUO 2LLUA 3ICBA 3CR5X 4DS7A 4F7FA 2CCMA 3PM8A 1A75B 2NZ0A 3JTDB 3TUYC 5FI2A 3SG7A 3WNXB 2I2RE 2JXLA 1SL9A 3A4UB 3NHIA 3M0WA 1B7TY 2KI4B 3NGVA 3GK1A 3R72A 2A4JA 3DYEA 2H61A 2KAXA 1BJFA 1QATA 3CLNA 3EVUA 4R1EA 2MLFC 1XA5A 3SG4A 5IBWA 1PULA 1OOGA 4HSZA 4YGAA 1UP5A 2BE6A 1KQVA 2BBMA 3CZ1A 3DD4A 1KSOA 2P70A 2L5YA 4MEWA 3WHTB 5CSJA 3NSKA 5I8NA 3D74A 4F0ZB 1IIOA 1QX5B 1QWVA 2JU0A 4PCWA 3SG2A 1ZMZA 2Y5IA 1UUSA 4FTGA 2KYCA 2F2OA 1QIVA 2BBNA 1LA3A 2QDIA 3F45A 3FE6A 1QXPA 2ISDA 2M8UA 1JC2A 2M1KB 1CMGA 2LC5A 1AP4A 2HQ8A 1B47A 3I5HB 1XFRA 1MHOA 2L0PA 5HYDA 2CXJA 2FJUB 2HQWA 3DZTA 2SASA 3S0EA 4DIRA 5CSIA 2OS8C 2WORA 3PN7B 3D78A 2ZRSA 1IWQA 1PVBA 3HX4A 1Y0VH 4XJKB 2M1UA 1IH0A 2LCPA 4MZKA 2P6BB 1Y6WA 2COLB 2JNXA 4M2PA 3D0YB 1QLKA 3AKBA 1CMFA 4C0KA 3FS7A 4WQ2A 1QV1A 2CNPA 2ZFDA 2ERBA 4OR9B 4GGFC 5AANA 1CDNA 3PATA 1QVIY 1HT9A 3NSLA 5D69A 5I2QA 3S0AA 3SIAA 1G33A 3PALA 1W9ZA 2LM5A 3IQOA 3FIAA 2R2IA 5DICA 2JZIA 1J7OA 3EK4A 3ZWHA 1J7RA 2K8MB 2JPOA 3CYZA 1YUSA 2BKIB 4JKTA 3CWGA 1KCYA 1N65A 3I5FC 1F71A 1KK7Z 2F3ZA 4CPVA 1WY9A 1KFXS 2MLEC 1XO5A 2PSRA 4YGBB 1A2XA 1A29A 1SYMA 4PHMA 1KWOC 3RM1A 1CFFA 1TN4A 2NCPA 3LL8B 3OB2B 5TNCA 2M49B 1MQ1A 2WCKA 4N1FA 1MF8B 2LP3A 2E6WA 3OHMB 1HQVA 3OGNA 3L47A 2BCXA 2BNXA 3IQQA 1K9UA 2D8NA 2F2PA 4I5JA 2G9BA 4YBHB 4ZCUA 3VRQA 3L4AA 4MRXA 1Y1UA 1L7ZA 1QX2A 3DF0B 1JFKA 1GQMA 3BOWB 3LCPC 1QVIZ 1FW4A 2PASA 2LMUA 4DUQA 1IG5A 2IS9A 1ALVA 1LINA 3BFAA 3LK1A 4C0LA 3TZ1A 3JVTB 4XJKA 2KLDA 1S1EA 5AEQA 2MA2A 1DJYA 1KFUL 1SNLA 3AAKA 3VROA 1R6PA 2JT3A 1L2OC 5DKRA 5I2OA 2ZNDA 2L4IA 2K7DA 1B7TZ 3R1VA 5HKWA 4P5OE 1QLSA 2L98A 1SK6D 2LVKA 4L9MA 5BPJA 2I18A 4N5XA 1LXFC 2BL0C 1YRUB 3PLFB 3TDIA 1BLQA 1Y1AA 2M97A 2KI6D 3SS4A 2JNFA 5DKNA 1SW8A 1AVSA 1X02A 1N2DA 1DTLA 3PJIA 2M9GA 3BQ3A 1ZFSA 1PRWA 1SMGA 2EGDA 2KGBC 3D10A 2AMIA 2LV7A 4NDCA 1DT7B 1CFPA 1DELA 1OE9B 1RFJA 2NXQA 1SRAA 2AUCA 2VRGA 1OZSA 2BL0B 2JT8A 3OX6A 4MRYA 1XVJA 1N0YA 1QX7A 4MLWA 1JSAA 1ZOTB 2KFGA 4YGDB 1PSBA 1BOCA 2DOQA 1NPQA 1SR6B 1SCMB 2ZN9A 1B8CA 2Q91A 3O4YA 4WQ3A 2LVVA 1TUJA 1QTXA 3DVMA 3DXLA 4PT1A 4PALA 1B1GA 5J3XA 1YX8A 1NYAA 1JF2A 2HETA 2LNKA 3CS1A 2RGIA 3NXAA 2K60A 1NX2A 1DF0B 2GGMA 2MRDA 3GK4X 1SSEB 2WOSA 2FOTA 1C7VA 1F8HA 1YTZC 1NX0A 1TUZA 2OTGB 3I5IB 3VRPA 1IGVA 1IRJA 1NWDA 5AXIA 2JT0A 4PE7A 1A75A 2NLNA 1UHKA 1DGVA 3CR2A 3DVEA 3WHUB 4A4CA 1CLBA 2WCHA 5ER5A 1SBJA 5FYXA 1FI5A 4TNCA 1S36A 1KK8C 2K0JA 3I5FB 1XK4C 2Y1NA 5HLVA 3EK7A 2QEOA 1CLLA 1YVLA 3SS3A 1WLZA 1NCYA 1V1FA 2H61C 1OOFA 4ICBA 1QASA 3BUWB 4QJ5B 1OSAA 1NUBA 1C7WA 1LA0A 3BFBA 3D75A 2LMTA 1NX1A 2LLTA 4YGEB 2K61A 2K7CA 5HKZA 4MVFA 4ETOA 3WXAA 3H4SE 3D73A 5G08A 1EJ3A 1Q80A 1KK7Y 4ORCB 4GUKA 3NHTA 4ORBB 4DRWA 2H2KA 5DKQA 2K7BA 1J55A 2JRFA 2P71A 4PDZA 1TWOA 3TS5B 2MAZA 1DJWA 1S5GY 3D76A 3FE9A 2ZNEA 4JPZB 2FCEA 4JWQA 5KTYA 3EKHA 4M2QA 4JQ0D 2JC2A 1TNWA 3KEVA 1TIZA 1SKTA 1B8RA 1K94A 1UURA 2QEBA 1MR8A 1OOIX 1T14A 1IJ6A 1EL4A 1Y1XA 2LUCA 4INXA 3K1EA 3B87A 5CPVA 1XYDA 2ZKMX 1CDPA 1WDCB 1ZACA 4ZCVA 1K90D 4AQIA 1PSRA 2CBLA 2QACA 4YRUA 1L2OB 4N1GA 1WRLA 2M7LA 1ODBA 4OCIA 3BUNB 4PE1A 2L4HA 2QEVA 3O4XA 3DVKA 2KFHA 3EVVA 5JOLA 1PALA 1F70A 2PVBA 1J1DA 3BYAA 4GGFA 1BR4B 1B9AA 3FE8A 5D3OA 2KNEA 2JTTA 2PQLA 1KSMA 2H8VA 4I5KA 1M63B 3I5GB 4PE4A 1DF0A 1DJZA 1CB1A 2LE9B 1MXLC 1B4CA 4AQJA 1GGWA 1TTXA 3B88A 3VRNA 2KI4C 4KYNA 2EHBA 4YGCB 1PK0D 2MBXA 5HL1A 1AHRA 2GTEA 3S0GA 4CLNA 1MWNA 1BR1B 1S6CA 5JJGA 2LUXA 3JVTC 3QRXA 4MZJA 1EH2A 2KQ6A 2WC5A 4FQOA 2WCJA 3DY9A 3LLEA 4WRIA 1MXEA 1EG4A 3SG5A 1BMOA 3CZTX 3CR4X 4ORAB 1F4OA 1UHIA 3B6XA 5EL2A 2QPTA 4Q04A 2HPSA 3TDZA 1YR5A 3BUMB 1K8UA 3CZ2A 1XFWO 1PVAA 3SS5A 1K2HA 1G8IA 2E30A 3E3RA 1K9KA 1BU3A 1ORGA 1K93D 1SL8A 5HLOA 2WCEA 1DVIA 1CDMA 1OMRA 3GOFA 4PE0A 4IL1A 1E8AA 1VRKA 1A4PA 3RZSA 2Y4QA 5KSZA 1ALWA 1JFJA 1F54A 1KFUS 2L51A 2WCBA 1KQMC 1P28A 1FF1A 1QJTA 2KI6C 3BJHA 5KU1A 3CZ0A 1W7JB 2F8PA 4CFQA 4AOMA 1ZUZA 3I5IC 1H8BA 3SIBA 4YI8A 3BUXB 2WNDA 1RWYA 1WRKA 3BOWA 3VB1A 1FPWA 5GQQC 4QJ3B 1RK9A 2BAPA 1UHJA 1IKUA 1CDLA 1TCFA 1KQMB 3B86A 3O78A 2LLSA 2OPOA 1AUIB 1K95A 1UWOA 2CTNA 4USLA 3A8RA 1K96A 3LK0A 1OQPA 2F33A 1SCVA 4HREE 5K89A 3L4LA 2JOJA 4GGNA 1XFXO 2LAPA 2WCLA 5FI6A 4M2OA 5F6TA 3SG3A 5HKYA 2KPHA 1DJIA 2KBIA 1AJ4A 1LS8A 2O5GA 4BY5A 4CFRA 1U5IA 1A03A 1KFXL 2K7OA 1KK8B 1OMDA 5CSFA 4PHNA 1YVHA 3SG6A 1QIWA 3BFHA 1C3ZA 1H4BA 2LVJA 2AAOA 4OVNF 1CM1A 2BCBA 1YURA 3CTNA 2WC6A 1DJHA 1NSHA 3D77A 3O2PA 5CSNA 1BODA 2ZRTA 2O60A 1WLMA 2BCAA 2KGRA 3SJSA 1DC1A 2HF5A 2B1UA 2KDHA 4NDBA 3PFVA 2KSPA 4A4BA 4OV2A 2M29A 4MSPA 2G2BA 1AK8A 4U8DA 2BKHB 2KFFA 1TRFA 1EXRA 1OZOA 2L2CA 1B8LA 4NQGA 2GGZA 1G4YR 4HRHA 3I5GC 2M7NA 3S0BA 1BT6A 1W7IB 3OB1B 1DJXA 1YUUA 2FCDA 2KYFA 2M0RA 2QEHA 4C0JA 1J1EA 1SCMC 2KOTA 4IJ7A 3RLZA 2LHIA 3V2LA 3QMEA 1TCOB 4OZDA 5PALA 1IQ5A 3R1OA 1YX7A 4GBAA 1OMVA 2JWWA 2KLEA 2JPTA 1K9PA 2JQ6A 3KPXA 1OOJA 2SCPA 1IQ3A 4HRGA 1XFZO 1XK4A 1Z4HA 1CKKA 1GM0A 3AAJA 5ER4X 3OBVA 4PHJA 4MN0A 1EG3A 4DCKA 1UHNA 1NX3A 1IJ5A 3CGAA 3NSOA 1S6JA 1SY9A 4YI9A 2KAVA 2TN4A 1KWOB 1NP8A 3HCMA 4FQTA 3D0YA 3TS5C 2BECA 1S3PA 1SL7A 3O6BA 1RECA 4MZLA 2KBMA 3EVRA 3IVTA 3KO0A 5I94A 1J7QA 1TNQA 3Q8IA 1FBVA 2WC8A 3VGOA 2I7AA 3AKAA 2PRUA 4NDDA 2BE4A 2M3WA 3NSIA 1C3YA 4E68A 1LKJA 1LVCD 1RROA 1DMOA 1DQEA 1MUXA 3PSRA 5FI7A 3EKJA 2JTZA 2GV5A 1TNXA 1S6IA 2PALA 3FWBA 1DJGA 1CFDA 2FJYA 4XYNA 2JXCA 1DEKA 2KQYA 4JD9A 1M45A 1XFVO 2CT9A 1OOHA 3VRRA 1Z2CB 5AERA 3FWCA 2LP2A 4BY4A 3DVJA 3BUOB 3S0DA 1RJVA 2JULA 1FI6A 2F3YA 1QS7A 1OW4A 2OS8B 1TNPA 3EK8A 1JUOA 1GJYA 1S5GZ 2K2AA 1JWDA 1BF5A 2LVIA 2WCFA 2Y1MA 2WCMA 3I5HC 3OX5A 3CDNA 1YUTA 1M31A 3UNWA 1M39A 2L5XB 4PHKA 2NCOA 4GFTA 3UO9A 1YRTB 1J7PA 2K2FA 2MJWB 1JBAA 4INWA 3GK2A 1NCXA 1F4QA 1NIWA 5AFPA 2L2EA 3C1VA 3BXKA 1JF0A
chains in the Genus database with same CATH topology
3IF7A 2LANA 4P2YB 1CNPA 2I94A 1WRZA 1F55A 2V53A 1M46A 1XFYO 1U5IB 2ZN8A 3KF9A 2OTGC 2PMYA 3KHEA 2LHLA 1BG1A 1C07A 1D1OA 1GGZA 1CTRA 1UHHA 3DF0A 3MSEB 4UPGA 1QV0A 4GAOA 5B8IB 1RTP1 5D7FA 1AJ5A 1R2UA 3PN7C 4OKHA 4QJ4B 3JTDC 3TUYB 4CIDA 1SR6C 2KHNA 4GNKB 3OP0A 1S26D 2KAYA 5I2LA 2MHHA 3ZNIA 4GPLB 4I5NB 2Q4UA 1WDCC 4D1EA 1SPYA 2EC6B 1CFCA 1NCZA 2LMVA 4MBEA 3TDUA 1DGUA 1CM4A 3K21A 2EC6C 1V1GA 1CLMA 1TOPA 2L50A 4I5LB 1XFUO 2LLUA 3ICBA 3CR5X 4DS7A 2CCMA 3PM8A 1A75B 2NZ0A 3JTDB 3TUYC 3SG7A 3WNXB 2I2RE 2JXLA 1SL9A 3A4UB 3M0WA 1B7TY 2KI4B 3GK1A 2A4JA 3EVUA 2H61A 2KAXA 1BJFA 1QATA 3CLNA 4R1EA 3SG4A 2MLFC 1XA5A 5IBWA 1PULA 4HSZA 4YGAA 1UP5A 2BE6A 1KQVA 2BBMA 3DD4A 4MEWA 1KSOA 3WHTB 5CSJA 3NSKA 5I8NA 4F0ZB 1QX5B 2JU0A 4PCWA 3SG2A 1ZMZA 2Y5IA 1UUSA 4FTGA 2KYCA 2F2OA 1QIVA 2BBNA 1LA3A 3F45A 1QXPA 2ISDA 2M8UA 1JC2A 2M1KB 1CMGA 2LC5A 1AP4A 2HQ8A 1B47A 3I5HB 1MHOA 2L0PA 5HYDA 2CXJA 2FJUB 2HQWA 2SASA 4DIRA 5CSIA 2OS8C 2WORA 3PN7B 2ZRSA 1IWQA 1PVBA 3HX4A 1Y0VH 4XJKB 2M1UA 1IH0A 2LCPA 4MZKA 2P6BB 1Y6WA 2COLB 2JNXA 4M2PA 3D0YB 1QLKA 3AKBA 1CMFA 4C0KA 3FS7A 4WQ2A 1QV1A 2CNPA 2ZFDA 4OR9B 4GGFC 5AANA 1CDNA 3PATA 1QVIY 1HT9A 3NSLA 5D69A 5I2QA 3SIAA 1G33A 3PALA 2LM5A 3IQOA 3FIAA 2R2IA 1J7OA 2JZIA 3EK4A 3ZWHA 1J7RA 2K8MB 1YUSA 2BKIB 3CWGA 1KCYA 1N65A 3I5FC 1F71A 1KK7Z 2F3ZA 4CPVA 1WY9A 1KFXS 2MLEC 1XO5A 2PSRA 4YGBB 1A2XA 1A29A 1SYMA 4PHMA 1KWOC 3RM1A 1CFFA 1TN4A 2NCPA 3LL8B 3OB2B 5TNCA 2M49B 1MQ1A 4N1FA 1MF8B 2LP3A 2E6WA 3OHMB 1HQVA 2BCXA 3IQQA 1K9UA 2D8NA 2F2PA 4I5JA 2G9BA 4YBHB 4ZCUA 3VRQA 4MRXA 1Y1UA 1L7ZA 1QX2A 3DF0B 1JFKA 1GQMA 3BOWB 3LCPC 1QVIZ 1FW4A 2PASA 2LMUA 4DUQA 1IG5A 2IS9A 1ALVA 1LINA 3LK1A 4C0LA 3TZ1A 3JVTB 4XJKA 1S1EA 5AEQA 2MA2A 1DJYA 1KFUL 1SNLA 3AAKA 3VROA 1R6PA 2JT3A 1L2OC 5DKRA 5I2OA 2ZNDA 2L4IA 2K7DA 1B7TZ 5HKWA 4P5OE 1QLSA 2L98A 1SK6D 2LVKA 4L9MA 5BPJA 2I18A 4N5XA 1LXFC 2BL0C 1YRUB 3PLFB 3TDIA 1BLQA 1Y1AA 2M97A 2KI6D 2JNFA 5DKNA 1SW8A 1AVSA 1X02A 1N2DA 1DTLA 2M9GA 3BQ3A 1ZFSA 1PRWA 1SMGA 2EGDA 2KGBC 3D10A 2AMIA 2LV7A 4NDCA 1DT7B 1CFPA 1OE9B 1RFJA 2NXQA 1SRAA 2AUCA 2VRGA 1OZSA 2BL0B 2JT8A 3OX6A 4MRYA 1XVJA 1N0YA 1QX7A 4MLWA 1JSAA 1ZOTB 2KFGA 4YGDB 1PSBA 1BOCA 2DOQA 1NPQA 1SR6B 1SCMB 2ZN9A 1B8CA 2Q91A 3O4YA 4WQ3A 2LVVA 1QTXA 3DVMA 4PALA 1B1GA 5J3XA 1YX8A 1NYAA 1JF2A 2HETA 2LNKA 3CS1A 2RGIA 3NXAA 1NX2A 1DF0B 2GGMA 2MRDA 3GK4X 2WOSA 1F8HA 2FOTA 1C7VA 1YTZC 1NX0A 2OTGB 3I5IB 3VRPA 1IGVA 1IRJA 1NWDA 5AXIA 2JT0A 4PE7A 1A75A 2NLNA 1UHKA 1DGVA 3CR2A 3DVEA 3WHUB 4A4CA 1CLBA 5ER5A 1SBJA 5FYXA 1FI5A 4TNCA 1S36A 1KK8C 2K0JA 3I5FB 1XK4C 2Y1NA 5HLVA 3EK7A 1CLLA 1YVLA 1WLZA 1NCYA 1V1FA 2H61C 1QASA 3BUWB 4QJ5B 1OSAA 1NUBA 1C7WA 1LA0A 2LMTA 1NX1A 2LLTA 4YGEB 2K61A 2K7CA 5HKZA 4MVFA 4ETOA 3WXAA 3H4SE 5G08A 1EJ3A 1Q80A 1KK7Y 4ORCB 4GUKA 4ORBB 4DRWA 2H2KA 5DKQA 2K7BA 1J55A 2JRFA 4PDZA 3TS5B 2MAZA 1DJWA 1S5GY 2ZNEA 4JPZB 2FCEA 4JWQA 5KTYA 3EKHA 4M2QA 4JQ0D 2JC2A 1TNWA 3KEVA 1TIZA 1SKTA 1B8RA 1K94A 1UURA 4ICBA 1MR8A 4AQIA 1Y1XA 1IJ6A 1EL4A 2LUCA 5CPVA 1XYDA 2ZKMX 1CDPA 1WDCB 1ZACA 4ZCVA 1K90D 1PSRA 2CBLA 2QACA 4YRUA 1L2OB 4N1GA 1WRLA 2M7LA 1ODBA 4OCIA 3BUNB 4PE1A 2L4HA 3DVKA 2KFHA 3EVVA 5JOLA 1PALA 1F70A 2PVBA 1J1DA 3BYAA 4GGFA 1BR4B 1B9AA 2KNEA 2JTTA 1KSMA 4I5KA 1M63B 3I5GB 4PE4A 1DF0A 1DJZA 1CB1A 2LE9B 1MXLC 1B4CA 4AQJA 1GGWA 1TTXA 3VRNA 2KI4C 2EHBA 4YGCB 1PK0D 2MBXA 1AHRA 4CLNA 1MWNA 1BR1B 1S6CA 5JJGA 2LUXA 3JVTC 3QRXA 4MZJA 1EH2A 2KQ6A 4FQOA 4WRIA 3SG5A 3LLEA 1MXEA 1EG4A 1BMOA 3CZTX 3CR4X 4ORAB 1F4OA 1UHIA 2QPTA 4Q04A 2HPSA 3TDZA 1YR5A 3BUMB 1K8UA 1K2HA 1XFWO 1PVAA 1G8IA 2E30A 3E3RA 1K9KA 1BU3A 1SL8A 1K93D 5HLOA 2WCEA 1DVIA 1CDMA 1OMRA 3GOFA 4PE0A 4IL1A 1E8AA 1VRKA 1A4PA 2Y4QA 5KSZA 1ALWA 1JFJA 1F54A 1KFUS 2L51A 2WCBA 1KQMC 1FF1A 1QJTA 2KI6C 5KU1A 1W7JB 2F8PA 4CFQA 4AOMA 1ZUZA 3I5IC 1H8BA 3SIBA 4YI8A 3BUXB 2WNDA 1RWYA 1WRKA 3BOWA 1FPWA 5GQQC 4QJ3B 1RK9A 1UHJA 1IKUA 1CDLA 1TCFA 1KQMB 3O78A 2LLSA 2OPOA 1AUIB 1K95A 1UWOA 2CTNA 4USLA 3A8RA 1K96A 3LK0A 1OQPA 2F33A 1SCVA 4HREE 5K89A 2JOJA 4GGNA 1XFXO 2LAPA 4M2OA 5F6TA 3SG3A 5HKYA 1DJIA 2KBIA 1AJ4A 4CFRA 2O5GA 4BY5A 1A03A 1U5IA 1KFXL 2K7OA 1KK8B 1OMDA 5CSFA 4PHNA 1YVHA 3SG6A 1QIWA 1H4BA 2LVJA 2AAOA 4OVNF 1CM1A 2BCBA 1YURA 3CTNA 1DJHA 1NSHA 3O2PA 5CSNA 1BODA 2ZRTA 2O60A 1WLMA 2BCAA 2KGRA 3SJSA 2HF5A 2B1UA 2KDHA 4NDBA 3PFVA 2KSPA 4A4BA 4OV2A 2M29A 4MSPA 2G2BA 1AK8A 4U8DA 2BKHB 2KFFA 1TRFA 1EXRA 1OZOA 1B8LA 4NQGA 2GGZA 1G4YR 4HRHA 3I5GC 2M7NA 1BT6A 1W7IB 3OB1B 1DJXA 1YUUA 2FCDA 2KYFA 2M0RA 4C0JA 1J1EA 1SCMC 2KOTA 3RLZA 2LHIA 1TCOB 5PALA 1IQ5A 1YX7A 4GBAA 1OMVA 2JWWA 2JPTA 1K9PA 2JQ6A 3KPXA 1OOJA 2SCPA 1IQ3A 4HRGA 1XFZO 1XK4A 1CKKA 3AAJA 5ER4X 4PHJA 4MN0A 1EG3A 4DCKA 1UHNA 1NX3A 1IJ5A 3CGAA 3NSOA 1S6JA 1SY9A 4YI9A 2KAVA 2TN4A 1KWOB 1NP8A 3HCMA 3TS5C 3D0YA 2BECA 1S3PA 1SL7A 3O6BA 1RECA 4MZLA 2KBMA 3EVRA 3KO0A 1J7QA 1TNQA 1FBVA 2WC8A 3VGOA 2I7AA 3AKAA 2PRUA 4NDDA 2BE4A 2M3WA 3NSIA 4E68A 1LKJA 1LVCD 1RROA 1DMOA 1MUXA 3PSRA 3EKJA 2JTZA 2GV5A 1TNXA 1S6IA 2PALA 3FWBA 1DJGA 1CFDA 4XYNA 2JXCA 2KQYA 1M45A 1XFVO 2CT9A 3VRRA 5AERA 3FWCA 2LP2A 4BY4A 3DVJA 3BUOB 1RJVA 2JULA 1FI6A 2F3YA 1QS7A 2OS8B 1TNPA 3EK8A 1JUOA 1GJYA 1S5GZ 2K2AA 1JWDA 1BF5A 2LVIA 2WCFA 2Y1MA 3I5HC 3OX5A 1YUTA 1M31A 1M39A 2L5XB 4PHKA 2NCOA 4GFTA 1YRTB 1J7PA 2K2FA 2MJWB 1JBAA 3GK2A 1NCXA 1F4QA 1NIWA 5AFPA 2L2EA 3C1VA 3BXKA 1JF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF7 A;  2LAN A;  4P2Y B;  1CNP A;  2I94 A;  1WRZ A;  1F55 A;  2V53 A;  1M46 A;  1XFY O;  1U5I B;  2ZN8 A;  3KF9 A;  2OTG C;  2PMY A;  3KHE A;  2LHL A;  1BG1 A;  1C07 A;  1D1O A;  1GGZ A;  1CTR A;  1UHH A;  3DF0 A;  3MSE B;  4UPG A;  1QV0 A;  4GAO A;  5B8I B;  1RTP 1;  5D7F A;  1AJ5 A;  1R2U A;  3PN7 C;  4OKH A;  4QJ4 B;  3JTD C;  3TUY B;  4CID A;  1SR6 C;  2KHN A;  4GNK B;  3OP0 A;  1S26 D;  2KAY A;  5I2L A;  2MHH A;  3ZNI A;  4GPL B;  4I5N B;  2Q4U A;  1WDC C;  4D1E A;  1SPY A;  2EC6 B;  1CFC A;  1NCZ A;  2LMV A;  4MBE A;  3TDU A;  1DGU A;  1CM4 A;  3K21 A;  2EC6 C;  1V1G A;  1CLM A;  1TOP A;  2L50 A;  4I5L B;  1XFU O;  2LLU A;  3ICB A;  3CR5 X;  4DS7 A;  2CCM A;  3PM8 A;  1A75 B;  2NZ0 A;  3JTD B;  3TUY C;  3SG7 A;  3WNX B;  2I2R E;  2JXL A;  1SL9 A;  3A4U B;  3M0W A;  1B7T Y;  2KI4 B;  3GK1 A;  2A4J A;  3EVU A;  2H61 A;  2KAX A;  1BJF A;  1QAT A;  3CLN A;  4R1E A;  3SG4 A;  2MLF C;  1XA5 A;  5IBW A;  1PUL A;  4HSZ A;  4YGA A;  1UP5 A;  2BE6 A;  1KQV A;  2BBM A;  3DD4 A;  4MEW A;  1KSO A;  3WHT B;  5CSJ A;  3NSK A;  5I8N A;  4F0Z B;  1QX5 B;  2JU0 A;  4PCW A;  3SG2 A;  1ZMZ A;  2Y5I A;  1UUS A;  4FTG A;  2KYC A;  2F2O A;  1QIV A;  2BBN A;  1LA3 A;  3F45 A;  1QXP A;  2ISD A;  2M8U A;  1JC2 A;  2M1K B;  1CMG A;  2LC5 A;  1AP4 A;  2HQ8 A;  1B47 A;  3I5H B;  1MHO A;  2L0P A;  5HYD A;  2CXJ A;  2FJU B;  2HQW A;  2SAS A;  4DIR A;  5CSI A;  2OS8 C;  2WOR A;  3PN7 B;  2ZRS A;  1IWQ A;  1PVB A;  3HX4 A;  1Y0V H;  4XJK B;  2M1U A;  1IH0 A;  2LCP A;  4MZK A;  2P6B B;  1Y6W A;  2COL B;  2JNX A;  4M2P A;  3D0Y B;  1QLK A;  3AKB A;  1CMF A;  4C0K A;  3FS7 A;  4WQ2 A;  1QV1 A;  2CNP A;  2ZFD A;  4OR9 B;  4GGF C;  5AAN A;  1CDN A;  3PAT A;  1QVI Y;  1HT9 A;  3NSL A;  5D69 A;  5I2Q A;  3SIA A;  1G33 A;  3PAL A;  2LM5 A;  3IQO A;  3FIA A;  2R2I A;  1J7O A;  2JZI A;  3EK4 A;  3ZWH A;  1J7R A;  2K8M B;  1YUS A;  2BKI B;  3CWG A;  1KCY A;  1N65 A;  3I5F C;  1F71 A;  1KK7 Z;  2F3Z A;  4CPV A;  1WY9 A;  1KFX S;  2MLE C;  1XO5 A;  2PSR A;  4YGB B;  1A2X A;  1A29 A;  1SYM A;  4PHM A;  1KWO C;  3RM1 A;  1CFF A;  1TN4 A;  2NCP A;  3LL8 B;  3OB2 B;  5TNC A;  2M49 B;  1MQ1 A;  4N1F A;  1MF8 B;  2LP3 A;  2E6W A;  3OHM B;  1HQV A;  2BCX A;  3IQQ A;  1K9U A;  2D8N A;  2F2P A;  4I5J A;  2G9B A;  4YBH B;  4ZCU A;  3VRQ A;  4MRX A;  1Y1U A;  1L7Z A;  1QX2 A;  3DF0 B;  1JFK A;  1GQM A;  3BOW B;  3LCP C;  1QVI Z;  1FW4 A;  2PAS A;  2LMU A;  4DUQ A;  1IG5 A;  2IS9 A;  1ALV A;  1LIN A;  3LK1 A;  4C0L A;  3TZ1 A;  3JVT B;  4XJK A;  1S1E A;  5AEQ A;  2MA2 A;  1DJY A;  1KFU L;  1SNL A;  3AAK A;  3VRO A;  1R6P A;  2JT3 A;  1L2O C;  5DKR A;  5I2O A;  2ZND A;  2L4I A;  2K7D A;  1B7T Z;  5HKW A;  4P5O E;  1QLS A;  2L98 A;  1SK6 D;  2LVK A;  4L9M A;  5BPJ A;  2I18 A;  4N5X A;  1LXF C;  2BL0 C;  1YRU B;  3PLF B;  3TDI A;  1BLQ A;  1Y1A A;  2M97 A;  2KI6 D;  2JNF A;  5DKN A;  1SW8 A;  1AVS A;  1X02 A;  1N2D A;  1DTL A;  2M9G A;  3BQ3 A;  1ZFS A;  1PRW A;  1SMG A;  2EGD A;  2KGB C;  3D10 A;  2AMI A;  2LV7 A;  4NDC A;  1DT7 B;  1CFP A;  1OE9 B;  1RFJ A;  2NXQ A;  1SRA A;  2AUC A;  2VRG A;  1OZS A;  2BL0 B;  2JT8 A;  3OX6 A;  4MRY A;  1XVJ A;  1N0Y A;  1QX7 A;  4MLW A;  1JSA A;  1ZOT B;  2KFG A;  4YGD B;  1PSB A;  1BOC A;  2DOQ A;  1NPQ A;  1SR6 B;  1SCM B;  2ZN9 A;  1B8C A;  2Q91 A;  3O4Y A;  4WQ3 A;  2LVV A;  1QTX A;  3DVM A;  4PAL A;  1B1G A;  5J3X A;  1YX8 A;  1NYA A;  1JF2 A;  2HET A;  2LNK A;  3CS1 A;  2RGI A;  3NXA A;  1NX2 A;  1DF0 B;  2GGM A;  2MRD A;  3GK4 X;  2WOS A;  1F8H A;  2FOT A;  1C7V A;  1YTZ C;  1NX0 A;  2OTG B;  3I5I B;  3VRP A;  1IGV A;  1IRJ A;  1NWD A;  5AXI A;  2JT0 A;  4PE7 A;  1A75 A;  2NLN A;  1UHK A;  1DGV A;  3CR2 A;  3DVE A;  3WHU B;  4A4C A;  1CLB A;  5ER5 A;  1SBJ A;  5FYX A;  1FI5 A;  4TNC A;  1S36 A;  1KK8 C;  2K0J A;  3I5F B;  1XK4 C;  2Y1N A;  5HLV A;  3EK7 A;  1CLL A;  1YVL A;  1WLZ A;  1NCY A;  1V1F A;  2H61 C;  1QAS A;  3BUW B;  4QJ5 B;  1OSA A;  1NUB A;  1C7W A;  1LA0 A;  2LMT A;  1NX1 A;  2LLT A;  4YGE B;  2K61 A;  2K7C A;  5HKZ A;  4MVF A;  4ETO A;  3WXA A;  3H4S E;  5G08 A;  1EJ3 A;  1Q80 A;  1KK7 Y;  4ORC B;  4GUK A;  4ORB B;  4DRW A;  2H2K A;  5DKQ A;  2K7B A;  1J55 A;  2JRF A;  4PDZ A;  3TS5 B;  2MAZ A;  1DJW A;  1S5G Y;  2ZNE A;  4JPZ B;  2FCE A;  4JWQ A;  5KTY A;  3EKH A;  4M2Q A;  4JQ0 D;  2JC2 A;  1TNW A;  3KEV A;  1TIZ A;  1SKT A;  1B8R A;  1K94 A;  1UUR A;  4ICB A;  1MR8 A;  4AQI A;  1Y1X A;  1IJ6 A;  1EL4 A;  2LUC A;  5CPV A;  1XYD A;  2ZKM X;  1CDP A;  1WDC B;  1ZAC A;  4ZCV A;  1K90 D;  1PSR A;  2CBL A;  2QAC A;  4YRU A;  1L2O B;  4N1G A;  1WRL A;  2M7L A;  1ODB A;  4OCI A;  3BUN B;  4PE1 A;  2L4H A;  3DVK A;  2KFH A;  3EVV A;  5JOL A;  1PAL A;  1F70 A;  2PVB A;  1J1D A;  3BYA A;  4GGF A;  1BR4 B;  1B9A A;  2KNE A;  2JTT A;  1KSM A;  4I5K A;  1M63 B;  3I5G B;  4PE4 A;  1DF0 A;  1DJZ A;  1CB1 A;  2LE9 B;  1MXL C;  1B4C A;  4AQJ A;  1GGW A;  1TTX A;  3VRN A;  2KI4 C;  2EHB A;  4YGC B;  1PK0 D;  2MBX A;  1AHR A;  4CLN A;  1MWN A;  1BR1 B;  1S6C A;  5JJG A;  2LUX A;  3JVT C;  3QRX A;  4MZJ A;  1EH2 A;  2KQ6 A;  4FQO A;  4WRI A;  3SG5 A;  3LLE A;  1MXE A;  1EG4 A;  1BMO A;  3CZT X;  3CR4 X;  4ORA B;  1F4O A;  1UHI A;  2QPT A;  4Q04 A;  2HPS A;  3TDZ A;  1YR5 A;  3BUM B;  1K8U A;  1K2H A;  1XFW O;  1PVA A;  1G8I A;  2E30 A;  3E3R A;  1K9K A;  1BU3 A;  1SL8 A;  1K93 D;  5HLO A;  2WCE A;  1DVI A;  1CDM A;  1OMR A;  3GOF A;  4PE0 A;  4IL1 A;  1E8A A;  1VRK A;  1A4P A;  2Y4Q A;  5KSZ A;  1ALW A;  1JFJ A;  1F54 A;  1KFU S;  2L51 A;  2WCB A;  1KQM C;  1FF1 A;  1QJT A;  2KI6 C;  5KU1 A;  1W7J B;  2F8P A;  4CFQ A;  4AOM A;  1ZUZ A;  3I5I C;  1H8B A;  3SIB A;  4YI8 A;  3BUX B;  2WND A;  1RWY A;  1WRK A;  3BOW A;  1FPW A;  5GQQ C;  4QJ3 B;  1RK9 A;  1UHJ A;  1IKU A;  1CDL A;  1TCF A;  1KQM B;  3O78 A;  2LLS A;  2OPO A;  1AUI B;  1K95 A;  1UWO A;  2CTN A;  4USL A;  3A8R A;  1K96 A;  3LK0 A;  1OQP A;  2F33 A;  1SCV A;  4HRE E;  5K89 A;  2JOJ A;  4GGN A;  1XFX O;  2LAP A;  4M2O A;  5F6T A;  3SG3 A;  5HKY A;  1DJI A;  2KBI A;  1AJ4 A;  4CFR A;  2O5G A;  4BY5 A;  1A03 A;  1U5I A;  1KFX L;  2K7O A;  1KK8 B;  1OMD A;  5CSF A;  4PHN A;  1YVH A;  3SG6 A;  1QIW A;  1H4B A;  2LVJ A;  2AAO A;  4OVN F;  1CM1 A;  2BCB A;  1YUR A;  3CTN A;  1DJH A;  1NSH A;  3O2P A;  5CSN A;  1BOD A;  2ZRT A;  2O60 A;  1WLM A;  2BCA A;  2KGR A;  3SJS A;  2HF5 A;  2B1U A;  2KDH A;  4NDB A;  3PFV A;  2KSP A;  4A4B A;  4OV2 A;  2M29 A;  4MSP A;  2G2B A;  1AK8 A;  4U8D A;  2BKH B;  2KFF A;  1TRF A;  1EXR A;  1OZO A;  1B8L A;  4NQG A;  2GGZ A;  1G4Y R;  4HRH A;  3I5G C;  2M7N A;  1BT6 A;  1W7I B;  3OB1 B;  1DJX A;  1YUU A;  2FCD A;  2KYF A;  2M0R A;  4C0J A;  1J1E A;  1SCM C;  2KOT A;  3RLZ A;  2LHI A;  1TCO B;  5PAL A;  1IQ5 A;  1YX7 A;  4GBA A;  1OMV A;  2JWW A;  2JPT A;  1K9P A;  2JQ6 A;  3KPX A;  1OOJ A;  2SCP A;  1IQ3 A;  4HRG A;  1XFZ O;  1XK4 A;  1CKK A;  3AAJ A;  5ER4 X;  4PHJ A;  4MN0 A;  1EG3 A;  4DCK A;  1UHN A;  1NX3 A;  1IJ5 A;  3CGA A;  3NSO A;  1S6J A;  1SY9 A;  4YI9 A;  2KAV A;  2TN4 A;  1KWO B;  1NP8 A;  3HCM A;  3TS5 C;  3D0Y A;  2BEC A;  1S3P A;  1SL7 A;  3O6B A;  1REC A;  4MZL A;  2KBM A;  3EVR A;  3KO0 A;  1J7Q A;  1TNQ A;  1FBV A;  2WC8 A;  3VGO A;  2I7A A;  3AKA A;  2PRU A;  4NDD A;  2BE4 A;  2M3W A;  3NSI A;  4E68 A;  1LKJ A;  1LVC D;  1RRO A;  1DMO A;  1MUX A;  3PSR A;  3EKJ A;  2JTZ A;  2GV5 A;  1TNX A;  1S6I A;  2PAL A;  3FWB A;  1DJG A;  1CFD A;  4XYN A;  2JXC A;  2KQY A;  1M45 A;  1XFV O;  2CT9 A;  3VRR A;  5AER A;  3FWC A;  2LP2 A;  4BY4 A;  3DVJ A;  3BUO B;  1RJV A;  2JUL A;  1FI6 A;  2F3Y A;  1QS7 A;  2OS8 B;  1TNP A;  3EK8 A;  1JUO A;  1GJY A;  1S5G Z;  2K2A A;  1JWD A;  1BF5 A;  2LVI A;  2WCF A;  2Y1M A;  3I5H C;  3OX5 A;  1YUT A;  1M31 A;  1M39 A;  2L5X B;  4PHK A;  2NCO A;  4GFT A;  1YRT B;  1J7P A;  2K2F A;  2MJW B;  1JBA A;  3GK2 A;  1NCX A;  1F4Q A;  1NIW A;  5AFP A;  2L2E A;  3C1V A;  3BXK A;  1JF0 A; 
#chains in the Genus database with same CATH topology
 2YGU A;  3IF7 A;  2LAN A;  4P2Y B;  1CNP A;  2I94 A;  1WRZ A;  1F55 A;  2V53 A;  1M46 A;  1XFY O;  1U5I B;  2ZN8 A;  3KF9 A;  2OTG C;  2PMY A;  3KHE A;  2LHL A;  3EG5 B;  1BG1 A;  1C07 A;  1D1O A;  3PM2 A;  1GGZ A;  3S0F A;  1CTR A;  1UHH A;  3DF0 A;  3MSE B;  3CAB A;  4UPG A;  1QV0 A;  4GAO A;  5B8I B;  1RTP 1;  5D7F A;  1AJ5 A;  1R2U A;  3PN7 C;  4OKH A;  2PYQ A;  4QJ4 B;  3JTD C;  3TUY B;  4CID A;  1SR6 C;  2KHN A;  4GNK B;  3OP0 A;  1S26 D;  2KAY A;  5I2L A;  2MHH A;  3ZNI A;  4GPL B;  4I5N B;  2Q4U A;  1WDC C;  3N7H A;  1SPY A;  2EC6 B;  4D1E A;  1NCZ A;  2LMV A;  4MBE A;  3TDU A;  1CFC A;  3B7A A;  1DGU A;  1CM4 A;  3K21 A;  2EC6 C;  1V1G A;  1CLM A;  1TOP A;  2L50 A;  3R1P A;  4I5L B;  1XFU O;  2LLU A;  3ICB A;  3CR5 X;  4DS7 A;  4F7F A;  2CCM A;  3PM8 A;  1A75 B;  2NZ0 A;  3JTD B;  3TUY C;  5FI2 A;  3SG7 A;  3WNX B;  2I2R E;  2JXL A;  1SL9 A;  3A4U B;  3NHI A;  3M0W A;  1B7T Y;  2KI4 B;  3NGV A;  3GK1 A;  3R72 A;  2A4J A;  3DYE A;  2H61 A;  2KAX A;  1BJF A;  1QAT A;  3CLN A;  3EVU A;  4R1E A;  2MLF C;  1XA5 A;  3SG4 A;  5IBW A;  1PUL A;  1OOG A;  4HSZ A;  4YGA A;  1UP5 A;  2BE6 A;  1KQV A;  2BBM A;  3CZ1 A;  3DD4 A;  1KSO A;  2P70 A;  2L5Y A;  4MEW A;  3WHT B;  5CSJ A;  3NSK A;  5I8N A;  3D74 A;  4F0Z B;  1IIO A;  1QX5 B;  1QWV A;  2JU0 A;  4PCW A;  3SG2 A;  1ZMZ A;  2Y5I A;  1UUS A;  4FTG A;  2KYC A;  2F2O A;  1QIV A;  2BBN A;  1LA3 A;  2QDI A;  3F45 A;  3FE6 A;  1QXP A;  2ISD A;  2M8U A;  1JC2 A;  2M1K B;  1CMG A;  2LC5 A;  1AP4 A;  2HQ8 A;  1B47 A;  3I5H B;  1XFR A;  1MHO A;  2L0P A;  5HYD A;  2CXJ A;  2FJU B;  2HQW A;  3DZT A;  2SAS A;  3S0E A;  4DIR A;  5CSI A;  2OS8 C;  2WOR A;  3PN7 B;  3D78 A;  2ZRS A;  1IWQ A;  1PVB A;  3HX4 A;  1Y0V H;  4XJK B;  2M1U A;  1IH0 A;  2LCP A;  4MZK A;  2P6B B;  1Y6W A;  2COL B;  2JNX A;  4M2P A;  3D0Y B;  1QLK A;  3AKB A;  1CMF A;  4C0K A;  3FS7 A;  4WQ2 A;  1QV1 A;  2CNP A;  2ZFD A;  2ERB A;  4OR9 B;  4GGF C;  5AAN A;  1CDN A;  3PAT A;  1QVI Y;  1HT9 A;  3NSL A;  5D69 A;  5I2Q A;  3S0A A;  3SIA A;  1G33 A;  3PAL A;  1W9Z A;  2LM5 A;  3IQO A;  3FIA A;  2R2I A;  5DIC A;  2JZI A;  1J7O A;  3EK4 A;  3ZWH A;  1J7R A;  2K8M B;  2JPO A;  3CYZ A;  1YUS A;  2BKI B;  4JKT A;  3CWG A;  1KCY A;  1N65 A;  3I5F C;  1F71 A;  1KK7 Z;  2F3Z A;  4CPV A;  1WY9 A;  1KFX S;  2MLE C;  1XO5 A;  2PSR A;  4YGB B;  1A2X A;  1A29 A;  1SYM A;  4PHM A;  1KWO C;  3RM1 A;  1CFF A;  1TN4 A;  2NCP A;  3LL8 B;  3OB2 B;  5TNC A;  2M49 B;  1MQ1 A;  2WCK A;  4N1F A;  1MF8 B;  2LP3 A;  2E6W A;  3OHM B;  1HQV A;  3OGN A;  3L47 A;  2BCX A;  2BNX A;  3IQQ A;  1K9U A;  2D8N A;  2F2P A;  4I5J A;  2G9B A;  4YBH B;  4ZCU A;  3VRQ A;  3L4A A;  4MRX A;  1Y1U A;  1L7Z A;  1QX2 A;  3DF0 B;  1JFK A;  1GQM A;  3BOW B;  3LCP C;  1QVI Z;  1FW4 A;  2PAS A;  2LMU A;  4DUQ A;  1IG5 A;  2IS9 A;  1ALV A;  1LIN A;  3BFA A;  3LK1 A;  4C0L A;  3TZ1 A;  3JVT B;  4XJK A;  2KLD A;  1S1E A;  5AEQ A;  2MA2 A;  1DJY A;  1KFU L;  1SNL A;  3AAK A;  3VRO A;  1R6P A;  2JT3 A;  1L2O C;  5DKR A;  5I2O A;  2ZND A;  2L4I A;  2K7D A;  1B7T Z;  3R1V A;  5HKW A;  4P5O E;  1QLS A;  2L98 A;  1SK6 D;  2LVK A;  4L9M A;  5BPJ A;  2I18 A;  4N5X A;  1LXF C;  2BL0 C;  1YRU B;  3PLF B;  3TDI A;  1BLQ A;  1Y1A A;  2M97 A;  2KI6 D;  3SS4 A;  2JNF A;  5DKN A;  1SW8 A;  1AVS A;  1X02 A;  1N2D A;  1DTL A;  3PJI A;  2M9G A;  3BQ3 A;  1ZFS A;  1PRW A;  1SMG A;  2EGD A;  2KGB C;  3D10 A;  2AMI A;  2LV7 A;  4NDC A;  1DT7 B;  1CFP A;  1DEL A;  1OE9 B;  1RFJ A;  2NXQ A;  1SRA A;  2AUC A;  2VRG A;  1OZS A;  2BL0 B;  2JT8 A;  3OX6 A;  4MRY A;  1XVJ A;  1N0Y A;  1QX7 A;  4MLW A;  1JSA A;  1ZOT B;  2KFG A;  4YGD B;  1PSB A;  1BOC A;  2DOQ A;  1NPQ A;  1SR6 B;  1SCM B;  2ZN9 A;  1B8C A;  2Q91 A;  3O4Y A;  4WQ3 A;  2LVV A;  1TUJ A;  1QTX A;  3DVM A;  3DXL A;  4PT1 A;  4PAL A;  1B1G A;  5J3X A;  1YX8 A;  1NYA A;  1JF2 A;  2HET A;  2LNK A;  3CS1 A;  2RGI A;  3NXA A;  2K60 A;  1NX2 A;  1DF0 B;  2GGM A;  2MRD A;  3GK4 X;  1SSE B;  2WOS A;  2FOT A;  1C7V A;  1F8H A;  1YTZ C;  1NX0 A;  1TUZ A;  2OTG B;  3I5I B;  3VRP A;  1IGV A;  1IRJ A;  1NWD A;  5AXI A;  2JT0 A;  4PE7 A;  1A75 A;  2NLN A;  1UHK A;  1DGV A;  3CR2 A;  3DVE A;  3WHU B;  4A4C A;  1CLB A;  2WCH A;  5ER5 A;  1SBJ A;  5FYX A;  1FI5 A;  4TNC A;  1S36 A;  1KK8 C;  2K0J A;  3I5F B;  1XK4 C;  2Y1N A;  5HLV A;  3EK7 A;  2QEO A;  1CLL A;  1YVL A;  3SS3 A;  1WLZ A;  1NCY A;  1V1F A;  2H61 C;  1OOF A;  4ICB A;  1QAS A;  3BUW B;  4QJ5 B;  1OSA A;  1NUB A;  1C7W A;  1LA0 A;  3BFB A;  3D75 A;  2LMT A;  1NX1 A;  2LLT A;  4YGE B;  2K61 A;  2K7C A;  5HKZ A;  4MVF A;  4ETO A;  3WXA A;  3H4S E;  3D73 A;  5G08 A;  1EJ3 A;  1Q80 A;  1KK7 Y;  4ORC B;  4GUK A;  3NHT A;  4ORB B;  4DRW A;  2H2K A;  5DKQ A;  2K7B A;  1J55 A;  2JRF A;  2P71 A;  4PDZ A;  1TWO A;  3TS5 B;  2MAZ A;  1DJW A;  1S5G Y;  3D76 A;  3FE9 A;  2ZNE A;  4JPZ B;  2FCE A;  4JWQ A;  5KTY A;  3EKH A;  4M2Q A;  4JQ0 D;  2JC2 A;  1TNW A;  3KEV A;  1TIZ A;  1SKT A;  1B8R A;  1K94 A;  1UUR A;  2QEB A;  1MR8 A;  1OOI X;  1T14 A;  1IJ6 A;  1EL4 A;  1Y1X A;  2LUC A;  4INX A;  3K1E A;  3B87 A;  5CPV A;  1XYD A;  2ZKM X;  1CDP A;  1WDC B;  1ZAC A;  4ZCV A;  1K90 D;  4AQI A;  1PSR A;  2CBL A;  2QAC A;  4YRU A;  1L2O B;  4N1G A;  1WRL A;  2M7L A;  1ODB A;  4OCI A;  3BUN B;  4PE1 A;  2L4H A;  2QEV A;  3O4X A;  3DVK A;  2KFH A;  3EVV A;  5JOL A;  1PAL A;  1F70 A;  2PVB A;  1J1D A;  3BYA A;  4GGF A;  1BR4 B;  1B9A A;  3FE8 A;  5D3O A;  2KNE A;  2JTT A;  2PQL A;  1KSM A;  2H8V A;  4I5K A;  1M63 B;  3I5G B;  4PE4 A;  1DF0 A;  1DJZ A;  1CB1 A;  2LE9 B;  1MXL C;  1B4C A;  4AQJ A;  1GGW A;  1TTX A;  3B88 A;  3VRN A;  2KI4 C;  4KYN A;  2EHB A;  4YGC B;  1PK0 D;  2MBX A;  5HL1 A;  1AHR A;  2GTE A;  3S0G A;  4CLN A;  1MWN A;  1BR1 B;  1S6C A;  5JJG A;  2LUX A;  3JVT C;  3QRX A;  4MZJ A;  1EH2 A;  2KQ6 A;  2WC5 A;  4FQO A;  2WCJ A;  3DY9 A;  3LLE A;  4WRI A;  1MXE A;  1EG4 A;  3SG5 A;  1BMO A;  3CZT X;  3CR4 X;  4ORA B;  1F4O A;  1UHI A;  3B6X A;  5EL2 A;  2QPT A;  4Q04 A;  2HPS A;  3TDZ A;  1YR5 A;  3BUM B;  1K8U A;  3CZ2 A;  1XFW O;  1PVA A;  3SS5 A;  1K2H A;  1G8I A;  2E30 A;  3E3R A;  1K9K A;  1BU3 A;  1ORG A;  1K93 D;  1SL8 A;  5HLO A;  2WCE A;  1DVI A;  1CDM A;  1OMR A;  3GOF A;  4PE0 A;  4IL1 A;  1E8A A;  1VRK A;  1A4P A;  3RZS A;  2Y4Q A;  5KSZ A;  1ALW A;  1JFJ A;  1F54 A;  1KFU S;  2L51 A;  2WCB A;  1KQM C;  1P28 A;  1FF1 A;  1QJT A;  2KI6 C;  3BJH A;  5KU1 A;  3CZ0 A;  1W7J B;  2F8P A;  4CFQ A;  4AOM A;  1ZUZ A;  3I5I C;  1H8B A;  3SIB A;  4YI8 A;  3BUX B;  2WND A;  1RWY A;  1WRK A;  3BOW A;  3VB1 A;  1FPW A;  5GQQ C;  4QJ3 B;  1RK9 A;  2BAP A;  1UHJ A;  1IKU A;  1CDL A;  1TCF A;  1KQM B;  3B86 A;  3O78 A;  2LLS A;  2OPO A;  1AUI B;  1K95 A;  1UWO A;  2CTN A;  4USL A;  3A8R A;  1K96 A;  3LK0 A;  1OQP A;  2F33 A;  1SCV A;  4HRE E;  5K89 A;  3L4L A;  2JOJ A;  4GGN A;  1XFX O;  2LAP A;  2WCL A;  5FI6 A;  4M2O A;  5F6T A;  3SG3 A;  5HKY A;  2KPH A;  1DJI A;  2KBI A;  1AJ4 A;  1LS8 A;  2O5G A;  4BY5 A;  4CFR A;  1U5I A;  1A03 A;  1KFX L;  2K7O A;  1KK8 B;  1OMD A;  5CSF A;  4PHN A;  1YVH A;  3SG6 A;  1QIW A;  3BFH A;  1C3Z A;  1H4B A;  2LVJ A;  2AAO A;  4OVN F;  1CM1 A;  2BCB A;  1YUR A;  3CTN A;  2WC6 A;  1DJH A;  1NSH A;  3D77 A;  3O2P A;  5CSN A;  1BOD A;  2ZRT A;  2O60 A;  1WLM A;  2BCA A;  2KGR A;  3SJS A;  1DC1 A;  2HF5 A;  2B1U A;  2KDH A;  4NDB A;  3PFV A;  2KSP A;  4A4B A;  4OV2 A;  2M29 A;  4MSP A;  2G2B A;  1AK8 A;  4U8D A;  2BKH B;  2KFF A;  1TRF A;  1EXR A;  1OZO A;  2L2C A;  1B8L A;  4NQG A;  2GGZ A;  1G4Y R;  4HRH A;  3I5G C;  2M7N A;  3S0B A;  1BT6 A;  1W7I B;  3OB1 B;  1DJX A;  1YUU A;  2FCD A;  2KYF A;  2M0R A;  2QEH A;  4C0J A;  1J1E A;  1SCM C;  2KOT A;  4IJ7 A;  3RLZ A;  2LHI A;  3V2L A;  3QME A;  1TCO B;  4OZD A;  5PAL A;  1IQ5 A;  3R1O A;  1YX7 A;  4GBA A;  1OMV A;  2JWW A;  2KLE A;  2JPT A;  1K9P A;  2JQ6 A;  3KPX A;  1OOJ A;  2SCP A;  1IQ3 A;  4HRG A;  1XFZ O;  1XK4 A;  1Z4H A;  1CKK A;  1GM0 A;  3AAJ A;  5ER4 X;  3OBV A;  4PHJ A;  4MN0 A;  1EG3 A;  4DCK A;  1UHN A;  1NX3 A;  1IJ5 A;  3CGA A;  3NSO A;  1S6J A;  1SY9 A;  4YI9 A;  2KAV A;  2TN4 A;  1KWO B;  1NP8 A;  3HCM A;  4FQT A;  3D0Y A;  3TS5 C;  2BEC A;  1S3P A;  1SL7 A;  3O6B A;  1REC A;  4MZL A;  2KBM A;  3EVR A;  3IVT A;  3KO0 A;  5I94 A;  1J7Q A;  1TNQ A;  3Q8I A;  1FBV A;  2WC8 A;  3VGO A;  2I7A A;  3AKA A;  2PRU A;  4NDD A;  2BE4 A;  2M3W A;  3NSI A;  1C3Y A;  4E68 A;  1LKJ A;  1LVC D;  1RRO A;  1DMO A;  1DQE A;  1MUX A;  3PSR A;  5FI7 A;  3EKJ A;  2JTZ A;  2GV5 A;  1TNX A;  1S6I A;  2PAL A;  3FWB A;  1DJG A;  1CFD A;  2FJY A;  4XYN A;  2JXC A;  1DEK A;  2KQY A;  4JD9 A;  1M45 A;  1XFV O;  2CT9 A;  1OOH A;  3VRR A;  1Z2C B;  5AER A;  3FWC A;  2LP2 A;  4BY4 A;  3DVJ A;  3BUO B;  3S0D A;  1RJV A;  2JUL A;  1FI6 A;  2F3Y A;  1QS7 A;  1OW4 A;  2OS8 B;  1TNP A;  3EK8 A;  1JUO A;  1GJY A;  1S5G Z;  2K2A A;  1JWD A;  1BF5 A;  2LVI A;  2WCF A;  2Y1M A;  2WCM A;  3I5H C;  3OX5 A;  3CDN A;  1YUT A;  1M31 A;  3UNW A;  1M39 A;  2L5X B;  4PHK A;  2NCO A;  4GFT A;  3UO9 A;  1YRT B;  1J7P A;  2K2F A;  2MJW B;  1JBA A;  4INW A;  3GK2 A;  1NCX A;  1F4Q A;  1NIW A;  5AFP A;  2L2E A;  3C1V A;  3BXK A;  1JF0 A; 
#chains in the Genus database with same CATH homology
 3IF7 A;  2LAN A;  4P2Y B;  1CNP A;  2I94 A;  1WRZ A;  1F55 A;  2V53 A;  1M46 A;  1XFY O;  1U5I B;  2ZN8 A;  3KF9 A;  2OTG C;  2PMY A;  3KHE A;  2LHL A;  1BG1 A;  1C07 A;  1D1O A;  1GGZ A;  1CTR A;  1UHH A;  3DF0 A;  3MSE B;  4UPG A;  1QV0 A;  4GAO A;  5B8I B;  1RTP 1;  5D7F A;  1AJ5 A;  1R2U A;  3PN7 C;  4OKH A;  4QJ4 B;  3JTD C;  3TUY B;  4CID A;  1SR6 C;  2KHN A;  4GNK B;  3OP0 A;  1S26 D;  2KAY A;  5I2L A;  2MHH A;  3ZNI A;  4GPL B;  4I5N B;  2Q4U A;  1WDC C;  4D1E A;  1SPY A;  2EC6 B;  1CFC A;  1NCZ A;  2LMV A;  4MBE A;  3TDU A;  1DGU A;  1CM4 A;  3K21 A;  2EC6 C;  1V1G A;  1CLM A;  1TOP A;  2L50 A;  4I5L B;  1XFU O;  2LLU A;  3ICB A;  3CR5 X;  4DS7 A;  2CCM A;  3PM8 A;  1A75 B;  2NZ0 A;  3JTD B;  3TUY C;  3SG7 A;  3WNX B;  2I2R E;  2JXL A;  1SL9 A;  3A4U B;  3M0W A;  1B7T Y;  2KI4 B;  3GK1 A;  2A4J A;  3EVU A;  2H61 A;  2KAX A;  1BJF A;  1QAT A;  3CLN A;  4R1E A;  3SG4 A;  2MLF C;  1XA5 A;  5IBW A;  1PUL A;  4HSZ A;  4YGA A;  1UP5 A;  2BE6 A;  1KQV A;  2BBM A;  3DD4 A;  4MEW A;  1KSO A;  3WHT B;  5CSJ A;  3NSK A;  5I8N A;  4F0Z B;  1QX5 B;  2JU0 A;  4PCW A;  3SG2 A;  1ZMZ A;  2Y5I A;  1UUS A;  4FTG A;  2KYC A;  2F2O A;  1QIV A;  2BBN A;  1LA3 A;  3F45 A;  1QXP A;  2ISD A;  2M8U A;  1JC2 A;  2M1K B;  1CMG A;  2LC5 A;  1AP4 A;  2HQ8 A;  1B47 A;  3I5H B;  1MHO A;  2L0P A;  5HYD A;  2CXJ A;  2FJU B;  2HQW A;  2SAS A;  4DIR A;  5CSI A;  2OS8 C;  2WOR A;  3PN7 B;  2ZRS A;  1IWQ A;  1PVB A;  3HX4 A;  1Y0V H;  4XJK B;  2M1U A;  1IH0 A;  2LCP A;  4MZK A;  2P6B B;  1Y6W A;  2COL B;  2JNX A;  4M2P A;  3D0Y B;  1QLK A;  3AKB A;  1CMF A;  4C0K A;  3FS7 A;  4WQ2 A;  1QV1 A;  2CNP A;  2ZFD A;  4OR9 B;  4GGF C;  5AAN A;  1CDN A;  3PAT A;  1QVI Y;  1HT9 A;  3NSL A;  5D69 A;  5I2Q A;  3SIA A;  1G33 A;  3PAL A;  2LM5 A;  3IQO A;  3FIA A;  2R2I A;  1J7O A;  2JZI A;  3EK4 A;  3ZWH A;  1J7R A;  2K8M B;  1YUS A;  2BKI B;  3CWG A;  1KCY A;  1N65 A;  3I5F C;  1F71 A;  1KK7 Z;  2F3Z A;  4CPV A;  1WY9 A;  1KFX S;  2MLE C;  1XO5 A;  2PSR A;  4YGB B;  1A2X A;  1A29 A;  1SYM A;  4PHM A;  1KWO C;  3RM1 A;  1CFF A;  1TN4 A;  2NCP A;  3LL8 B;  3OB2 B;  5TNC A;  2M49 B;  1MQ1 A;  4N1F A;  1MF8 B;  2LP3 A;  2E6W A;  3OHM B;  1HQV A;  2BCX A;  3IQQ A;  1K9U A;  2D8N A;  2F2P A;  4I5J A;  2G9B A;  4YBH B;  4ZCU A;  3VRQ A;  4MRX A;  1Y1U A;  1L7Z A;  1QX2 A;  3DF0 B;  1JFK A;  1GQM A;  3BOW B;  3LCP C;  1QVI Z;  1FW4 A;  2PAS A;  2LMU A;  4DUQ A;  1IG5 A;  2IS9 A;  1ALV A;  1LIN A;  3LK1 A;  4C0L A;  3TZ1 A;  3JVT B;  4XJK A;  1S1E A;  5AEQ A;  2MA2 A;  1DJY A;  1KFU L;  1SNL A;  3AAK A;  3VRO A;  1R6P A;  2JT3 A;  1L2O C;  5DKR A;  5I2O A;  2ZND A;  2L4I A;  2K7D A;  1B7T Z;  5HKW A;  4P5O E;  1QLS A;  2L98 A;  1SK6 D;  2LVK A;  4L9M A;  5BPJ A;  2I18 A;  4N5X A;  1LXF C;  2BL0 C;  1YRU B;  3PLF B;  3TDI A;  1BLQ A;  1Y1A A;  2M97 A;  2KI6 D;  2JNF A;  5DKN A;  1SW8 A;  1AVS A;  1X02 A;  1N2D A;  1DTL A;  2M9G A;  3BQ3 A;  1ZFS A;  1PRW A;  1SMG A;  2EGD A;  2KGB C;  3D10 A;  2AMI A;  2LV7 A;  4NDC A;  1DT7 B;  1CFP A;  1OE9 B;  1RFJ A;  2NXQ A;  1SRA A;  2AUC A;  2VRG A;  1OZS A;  2BL0 B;  2JT8 A;  3OX6 A;  4MRY A;  1XVJ A;  1N0Y A;  1QX7 A;  4MLW A;  1JSA A;  1ZOT B;  2KFG A;  4YGD B;  1PSB A;  1BOC A;  2DOQ A;  1NPQ A;  1SR6 B;  1SCM B;  2ZN9 A;  1B8C A;  2Q91 A;  3O4Y A;  4WQ3 A;  2LVV A;  1QTX A;  3DVM A;  4PAL A;  1B1G A;  5J3X A;  1YX8 A;  1NYA A;  1JF2 A;  2HET A;  2LNK A;  3CS1 A;  2RGI A;  3NXA A;  1NX2 A;  1DF0 B;  2GGM A;  2MRD A;  3GK4 X;  2WOS A;  1F8H A;  2FOT A;  1C7V A;  1YTZ C;  1NX0 A;  2OTG B;  3I5I B;  3VRP A;  1IGV A;  1IRJ A;  1NWD A;  5AXI A;  2JT0 A;  4PE7 A;  1A75 A;  2NLN A;  1UHK A;  1DGV A;  3CR2 A;  3DVE A;  3WHU B;  4A4C A;  1CLB A;  5ER5 A;  1SBJ A;  5FYX A;  1FI5 A;  4TNC A;  1S36 A;  1KK8 C;  2K0J A;  3I5F B;  1XK4 C;  2Y1N A;  5HLV A;  3EK7 A;  1CLL A;  1YVL A;  1WLZ A;  1NCY A;  1V1F A;  2H61 C;  1QAS A;  3BUW B;  4QJ5 B;  1OSA A;  1NUB A;  1C7W A;  1LA0 A;  2LMT A;  1NX1 A;  2LLT A;  4YGE B;  2K61 A;  2K7C A;  5HKZ A;  4MVF A;  4ETO A;  3WXA A;  3H4S E;  5G08 A;  1EJ3 A;  1Q80 A;  1KK7 Y;  4ORC B;  4GUK A;  4ORB B;  4DRW A;  2H2K A;  5DKQ A;  2K7B A;  1J55 A;  2JRF A;  4PDZ A;  3TS5 B;  2MAZ A;  1DJW A;  1S5G Y;  2ZNE A;  4JPZ B;  2FCE A;  4JWQ A;  5KTY A;  3EKH A;  4M2Q A;  4JQ0 D;  2JC2 A;  1TNW A;  3KEV A;  1TIZ A;  1SKT A;  1B8R A;  1K94 A;  1UUR A;  4ICB A;  1MR8 A;  4AQI A;  1Y1X A;  1IJ6 A;  1EL4 A;  2LUC A;  5CPV A;  1XYD A;  2ZKM X;  1CDP A;  1WDC B;  1ZAC A;  4ZCV A;  1K90 D;  1PSR A;  2CBL A;  2QAC A;  4YRU A;  1L2O B;  4N1G A;  1WRL A;  2M7L A;  1ODB A;  4OCI A;  3BUN B;  4PE1 A;  2L4H A;  3DVK A;  2KFH A;  3EVV A;  5JOL A;  1PAL A;  1F70 A;  2PVB A;  1J1D A;  3BYA A;  4GGF A;  1BR4 B;  1B9A A;  2KNE A;  2JTT A;  1KSM A;  4I5K A;  1M63 B;  3I5G B;  4PE4 A;  1DF0 A;  1DJZ A;  1CB1 A;  2LE9 B;  1MXL C;  1B4C A;  4AQJ A;  1GGW A;  1TTX A;  3VRN A;  2KI4 C;  2EHB A;  4YGC B;  1PK0 D;  2MBX A;  1AHR A;  4CLN A;  1MWN A;  1BR1 B;  1S6C A;  5JJG A;  2LUX A;  3JVT C;  3QRX A;  4MZJ A;  1EH2 A;  2KQ6 A;  4FQO A;  4WRI A;  3SG5 A;  3LLE A;  1MXE A;  1EG4 A;  1BMO A;  3CZT X;  3CR4 X;  4ORA B;  1F4O A;  1UHI A;  2QPT A;  4Q04 A;  2HPS A;  3TDZ A;  1YR5 A;  3BUM B;  1K8U A;  1K2H A;  1XFW O;  1PVA A;  1G8I A;  2E30 A;  3E3R A;  1K9K A;  1BU3 A;  1SL8 A;  1K93 D;  5HLO A;  2WCE A;  1DVI A;  1CDM A;  1OMR A;  3GOF A;  4PE0 A;  4IL1 A;  1E8A A;  1VRK A;  1A4P A;  2Y4Q A;  5KSZ A;  1ALW A;  1JFJ A;  1F54 A;  1KFU S;  2L51 A;  2WCB A;  1KQM C;  1FF1 A;  1QJT A;  2KI6 C;  5KU1 A;  1W7J B;  2F8P A;  4CFQ A;  4AOM A;  1ZUZ A;  3I5I C;  1H8B A;  3SIB A;  4YI8 A;  3BUX B;  2WND A;  1RWY A;  1WRK A;  3BOW A;  1FPW A;  5GQQ C;  4QJ3 B;  1RK9 A;  1UHJ A;  1IKU A;  1CDL A;  1TCF A;  1KQM B;  3O78 A;  2LLS A;  2OPO A;  1AUI B;  1K95 A;  1UWO A;  2CTN A;  4USL A;  3A8R A;  1K96 A;  3LK0 A;  1OQP A;  2F33 A;  1SCV A;  4HRE E;  5K89 A;  2JOJ A;  4GGN A;  1XFX O;  2LAP A;  4M2O A;  5F6T A;  3SG3 A;  5HKY A;  1DJI A;  2KBI A;  1AJ4 A;  4CFR A;  2O5G A;  4BY5 A;  1A03 A;  1U5I A;  1KFX L;  2K7O A;  1KK8 B;  1OMD A;  5CSF A;  4PHN A;  1YVH A;  3SG6 A;  1QIW A;  1H4B A;  2LVJ A;  2AAO A;  4OVN F;  1CM1 A;  2BCB A;  1YUR A;  3CTN A;  1DJH A;  1NSH A;  3O2P A;  5CSN A;  1BOD A;  2ZRT A;  2O60 A;  1WLM A;  2BCA A;  2KGR A;  3SJS A;  2HF5 A;  2B1U A;  2KDH A;  4NDB A;  3PFV A;  2KSP A;  4A4B A;  4OV2 A;  2M29 A;  4MSP A;  2G2B A;  1AK8 A;  4U8D A;  2BKH B;  2KFF A;  1TRF A;  1EXR A;  1OZO A;  1B8L A;  4NQG A;  2GGZ A;  1G4Y R;  4HRH A;  3I5G C;  2M7N A;  1BT6 A;  1W7I B;  3OB1 B;  1DJX A;  1YUU A;  2FCD A;  2KYF A;  2M0R A;  4C0J A;  1J1E A;  1SCM C;  2KOT A;  3RLZ A;  2LHI A;  1TCO B;  5PAL A;  1IQ5 A;  1YX7 A;  4GBA A;  1OMV A;  2JWW A;  2JPT A;  1K9P A;  2JQ6 A;  3KPX A;  1OOJ A;  2SCP A;  1IQ3 A;  4HRG A;  1XFZ O;  1XK4 A;  1CKK A;  3AAJ A;  5ER4 X;  4PHJ A;  4MN0 A;  1EG3 A;  4DCK A;  1UHN A;  1NX3 A;  1IJ5 A;  3CGA A;  3NSO A;  1S6J A;  1SY9 A;  4YI9 A;  2KAV A;  2TN4 A;  1KWO B;  1NP8 A;  3HCM A;  3TS5 C;  3D0Y A;  2BEC A;  1S3P A;  1SL7 A;  3O6B A;  1REC A;  4MZL A;  2KBM A;  3EVR A;  3KO0 A;  1J7Q A;  1TNQ A;  1FBV A;  2WC8 A;  3VGO A;  2I7A A;  3AKA A;  2PRU A;  4NDD A;  2BE4 A;  2M3W A;  3NSI A;  4E68 A;  1LKJ A;  1LVC D;  1RRO A;  1DMO A;  1MUX A;  3PSR A;  3EKJ A;  2JTZ A;  2GV5 A;  1TNX A;  1S6I A;  2PAL A;  3FWB A;  1DJG A;  1CFD A;  4XYN A;  2JXC A;  2KQY A;  1M45 A;  1XFV O;  2CT9 A;  3VRR A;  5AER A;  3FWC A;  2LP2 A;  4BY4 A;  3DVJ A;  3BUO B;  1RJV A;  2JUL A;  1FI6 A;  2F3Y A;  1QS7 A;  2OS8 B;  1TNP A;  3EK8 A;  1JUO A;  1GJY A;  1S5G Z;  2K2A A;  1JWD A;  1BF5 A;  2LVI A;  2WCF A;  2Y1M A;  3I5H C;  3OX5 A;  1YUT A;  1M31 A;  1M39 A;  2L5X B;  4PHK A;  2NCO A;  4GFT A;  1YRT B;  1J7P A;  2K2F A;  2MJW B;  1JBA A;  3GK2 A;  1NCX A;  1F4Q A;  1NIW A;  5AFP A;  2L2E A;  3C1V A;  3BXK A;  1JF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...