3GK4X

X-ray structure of bovine sbi523,ca(2+)-s100b
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Small molecules bound to unique sites in the target protein binding cleft of calcium-bound S100B as characterized by nuclear magnetic resonance and X-ray crystallography.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00036 EF-hand_1 EF hand
X PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3gk4X00
1BMOA 1PSRA 4ICBA 2F3ZA 3SG7A 1M45A 1H8BA 1RFJA 1J1EA 1XA5A 4GBAA 2G2BA 1F4QA 1SL8A 2H61A 1XYDA 4I5JA 1ZACA 1A75B 1FPWA 1PALA 1WRLA 1UHHA 1CLLA 1YUSA 2BL0B 4GUKA 4M2OA 1BLQA 1LA3A 2JOJA 2MRDA 3LL8B 4E68A 1CB1A 2KFGA 2KFHA 4L9MA 3KPXA 1F70A 1TCFA 4PE4A 1ODBA 5JOLA 2Y5IA 1SNLA 2JWWA 4NDDA 1KCYA 1MUXA 3SG2A 1XFUO 3I5GC 1NX2A 1RJVA 3BUWB 1YURA 3PFVA 2O60A 1K90D 2JTTA 1E8AA 3KHEA 5HKZA 4UPGA 2KAYA 2EC6C 2COLB 2KGRA 5K89A 1JWDA 2PALA 1OMVA 1PULA 2ZFDA 1KWOB 1L2OC 1QJTA 1WRKA 4MN0A 1OZSA 2K8MB 1C7WA 1SK6D 2Y1MA 1QVIY 1NX0A 4F0ZB 1KK8C 2L0PA 1F55A 1S6IA 1KK7Z 1QS7A 1SCVA 1FI5A 2JRFA 3I5FB 2K0JA 5HKWA 1TTXA 1CFPA 1SRAA 4ZCVA 2KOTA 3BQ3A 1KQVA 2M0RA 5CSIA 5I2OA 3NXAA 4ORCB 1SR6C 1CKKA 1F4OA 4C0JA 1J7OA 2R2IA 1XFZO 1GJYA 1NX3A 1QX5B 2LC5A 1V1FA 2FOTA 3CZTX 2KI4B 3I5IC 1DGUA 4GGNA 4N1FA 2M7LA 5KTYA 2M29A 1RROA 1J55A 1TNQA 1B1GA 4FQOA 5AFPA 1GGWA 5J3XA 2TN4A 1B8LA 2LCPA 3D0YB 3OX6A 5B8IB 3AAKA 4WQ2A 4YBHB 4TNCA 1SL9A 3BUMB 1SBJA 2LUCA 4YGDB 1NWDA 1UURA 1YUUA 1A03A 5CPVA 1S1EA 4YGCB 5AEQA 3A4UB 4QJ4B 4YI8A 3TDIA 1OOJA 3KF9A 2I2RE 1LKJA 4HSZA 2KHNA 1Q80A 1Y6WA 1MR8A 1YRTB 1QTXA 4YI9A 3FS7A 3TZ1A 3PSRA 3DVEA 1M46A 4HRGA 3CLNA 5PALA 2CCMA 2F8PA 1A75A 1KFXL 3PN7B 2JULA 1IQ5A 1CDPA 1SL7A 2LP3A 3NSLA 1K9PA 1K9UA 1KQMC 1S26D 2D8NA 1NSHA 1U5IB 1UHJA 2KFFA 2FCDA 4XJKB 4C0LA 1B4CA 1HT9A 1C07A 1TNWA 1C7VA 4AOMA 3SG5A 2Q91A 1K94A 1RWYA 2BKIB 1DJGA 1QV1A 1AK8A 4C0KA 5HYDA 2EHBA 1DT7B 4YRUA 5AXIA 3PLFB 3NSIA 2IS9A 2E30A 4MLWA 1EG4A 2AMIA 3EKHA 3OHMB 2BBMA 2FCEA 1G33A 1Y0VH 1IQ3A 1QIWA 3VGOA 1DJHA 1K93D 4YGAA 1AJ5A 1BU3A 1PVAA 1KK7Y 1QX7A 2ZRSA 4Q04A 1Y1AA 1UHNA 1BG1A 1EL4A 3LK1A 1NX1A 5D69A 1HQVA 1ZOTB 2LMTA 2Y4QA 1FW4A 1RK9A 2GGMA 3TDZA 3WHUB 1LINA 5KSZA 1DJXA 2WNDA 2Y1NA 1M31A 1J7RA 3F45A 3D0YA 3BUNB 1BT6A 4D1EA 1K96A 1XK4C 1AVSA 1S3PA 2H2KA 2HQWA 2MLFC 2MHHA 4QJ5B 2GGZA 2KNEA 1JFKA 2M8UA 4HRHA 3JVTC 2NCOA 3TUYB 3O4YA 4MRXA 1Y1UA 4PE0A 3IF7A 1AUIB 1CM4A 1JF2A 3VRRA 4MVFA 3ZNIA 2F33A 2CBLA 3PATA 2MBXA 1NCZA 1NPQA 4QJ3B 1J7PA 1G4YR 1XFWO 5GQQC 1AHRA 3BUOB 3FIAA 3WHTB 2L98A 2JT8A 3EKJA 1B9AA 1DF0B 4MZJA 1DJZA 1G8IA 3DVMA 4FTGA 1N65A 2O5GA 4HREE 1XVJA 1U5IA 1ZMZA 4XJKA 3VRPA 2LUXA 2HF5A 1QX2A 2FJUB 2KYCA 2LLUA 1H4BA 3CWGA 2L50A 2DOQA 2KQ6A 2CNPA 4N5XA 3WNXB 2K2FA 4USLA 1CLBA 3GK4X 3E3RA 1QV0A 4DRWA 1UP5A 1PK0D 5HLVA 1PVBA 2LE9B 1MXEA 4P2YB 1IWQA 2HETA 1B47A 2LVVA 2OS8C 4NQGA 3FWBA 1XFYO 1NP8A 2LHLA 4MRYA 1Y1XA 4I5KA 2LLTA 2H61C 1KFXS 5AANA 2LP2A 2JU0A 3I5GB 2M49B 1V1GA 4GAOA 2Q4UA 2RGIA 2AAOA 4MZKA 2JZIA 3IQQA 1BF5A 2EC6B 2L2EA 1IH0A 1YUTA 3M0WA 2MA2A 1L2OB 1SCMC 4ZCUA 2OTGC 2E6WA 1S6JA 2JT3A 4OKHA 1K9KA 4AQIA 1W7IB 2K7OA 1FI6A 1KK8B 2M1UA 1X02A 2CXJA 1EJ3A 2NZ0A 1QXPA 2LMVA 2PVBA 4GGFA 3EK8A 1TN4A 4OVNF 5DKRA 2KYFA 1IKUA 3KO0A 2CT9A 3H4SE 4PALA 3EVVA 1GQMA 5TNCA 2HPSA 1SR6B 3HCMA 3I5IB 1IJ6A 1BJFA 1WDCC 2KAVA 1RECA 1CFDA 1OQPA 2BCAA 2L51A 3GK1A 1IGVA 4AQJA 3JTDC 3O2PA 3RLZA 3I5HC 4OV2A 1XFXO 2LV7A 3DD4A 2LVKA 1XO5A 2ZNEA 1OMRA 4U8DA 1DJYA 3SG3A 2SCPA 5I2LA 1DF0A 1UHIA 3GK2A 5CSJA 2BECA 5I8NA 1CM1A 1OE9B 5JJGA 2JPTA 1CLMA 2MJWB 1AP4A 2JC2A 1M63B 2LLSA 2P6BB 1W7JB 4DS7A 3GOFA 1NUBA 1ZFSA 1QLSA 1SMGA 1J7QA 1K2HA 1NCYA 1K95A 1LA0A 1NYAA 1OZOA 1F8HA 1YVHA 2LVJA 1DVIA 4MSPA 4PHNA 3CR2A 2VRGA 2M9GA 3TS5C 4DIRA 1SKTA 2KI6C 3OP0A 4IL1A 3TDUA 1NCXA 1YVLA 2JXCA 2KBMA 1KQMB 3VROA 1QATA 5BPJA 3EVRA 3C1VA 1MWNA 4NDBA 4BY4A 4N1GA 1SPYA 3SIAA 3PM8A 1CTRA 2AUCA 3ICBA 2MAZA 4MEWA 2KBIA 2LM5A 5F6TA 4WRIA 5IBWA 2BL0C 2MLEC 5ER4X 1KFUL 4PE1A 4PHJA 4P5OE 3VRNA 1CDNA 2I18A 1RTP1 2PSRA 2QPTA 1M39A 2LMUA 4MZLA 4YGBB 1A2XA 1KSMA 2PASA 2BCBA 5HKYA 2M97A 2KQYA 1QLKA 3CR4X 2G9BA 1BR4B 3TS5B 2BKHB 3EK7A 1UHKA 3AAJA 2JTZA 3CR5X 4ETOA 1B7TY 2KSPA 1BODA 1QASA 2SASA 2BCXA 4M2PA 1XFVO 2L5XB 1SYMA 3BOWB 1KWOC 3CGAA 2M1KB 3MSEB 1LXFC 1TRFA 3IQOA 3VRQA 1ALWA 1TIZA 2KGBC 4YGEB 2EGDA 2BBNA 1S36A 3K21A 3SG4A 1JF0A 2CTNA 4JQ0D 3LLEA 4DUQA 2WOSA 2ISDA 1AJ4A 1DJWA 3I5FC 4JPZB 1L7ZA 5D7FA 4BY5A 3PALA 1ZUZA 1QIVA 1WRZA 2NLNA 1N0YA 1S5GY 3KEVA 1YTZC 1WLZA 2L4IA 4M2QA 3NSOA 3JVTB 4PDZA 2KI4C 2K2AA 2WCBA 3AKAA 3DF0B 4I5NB 1LVCD 1JBAA 1EH2A 1BOCA 1CDLA 1SY9A 4MBEA 3SIBA 2HQ8A 2WORA 1DJIA 2JT0A 1OMDA 1EXRA 2WCEA 5KU1A 4PHMA 2I7AA 4A4BA 1WY9A 2PMYA 4ORBB 4JWQA 2LHIA 1YR5A 3BYAA 5I2QA 1D1OA 4GPLB 3O6BA 2M7NA 4CFRA 1CDMA 2ZN9A 1IRJA 3NSKA 2F2PA 3DVJA 3SG6A 2PRUA 3PN7C 1F71A 5CSFA 5ER5A 3OX5A 2L4HA 5DKNA 1JUOA 1CMFA 1B7TZ 1MXLC 3AKBA 1YX8A 4ORAB 1PSBA 3D10A 4A4CA 2OS8B 2NXQA 1B8CA 3BXKA 3CS1A 5G08A 2LVIA 1MQ1A 1S6CA 2I94A 3SJSA 2B1UA 5DKQA 1CMGA 3LCPC 2A4JA 2JQ6A 1ALVA 1CNPA 2LNKA 1F54A 1UUSA 2F3YA 2K61A 1J1DA 3EK4A 2JNFA 2NCPA 3BOWA 2M3WA 1CFCA 4DCKA 4OCIA 2GV5A 1DGVA 1S5GZ 2BE6A 2ZKMX 1OSAA 1SCMB 3OB1B 2OTGB 3RM1A 2WC8A 5AERA 1KSOA 4PE7A 1DMOA 3QRXA 2BE4A 1XK4A 1A4PA 4R1EA 1TOPA 1KFUS 2JXLA 3O78A 2K7BA 1JSAA 3DVKA 1EG3A 2JNXA 1IJ5A 1SW8A 1YRUB 3DF0A 1PRWA 4OR9B 1BR1B 1WDCB 2LANA 3HX4A 2ZNDA 1QVIZ 2KAXA 3JTDB 4GNKB 2LAPA 2K7CA 3I5HB 1YX7A 4PCWA 3FWCA 1A29A 1FBVA 1VRKA 2KI6D 3LK0A 4GGFC 1MF8B 1N2DA 1K8UA 4XYNA 3CTNA 3A8RA 2QACA 5CSNA 1IG5A 4CLNA 4NDCA 1R6PA 1FF1A 1TCOB 1MHOA 2ZRTA 3WXAA 2F2OA 2KDHA 4GFTA 3TUYC 4PHKA 2OPOA 1TNPA 1JFJA 1TNXA 2K7DA 1GGZA 4CFQA 4CIDA 1UWOA 4I5LB 1B8RA 5FYXA 1R2UA 1JC2A 1CFFA 5HLOA 3EVUA 1DTLA 3BUXB 1WLMA 2V53A 2ZN8A 4WQ3A 3ZWHA 1NIWA 4CPVA 3OB2B 2WCFA
chains in the Genus database with same CATH superfamily
1BMOA 1PSRA 3D77A 3N7HA 4ICBA 2F3ZA 3SG7A 1M45A 1H8BA 1RFJA 1J1EA 1XA5A 3BFAA 4GBAA 2G2BA 1F4QA 1SL8A 2H61A 1XYDA 1OOFA 3CYZA 4I5JA 1ZACA 1A75B 1FPWA 3LK0A 1PALA 1WRLA 1P28A 1UHHA 1XFRA 1CLLA 1YUSA 2BL0B 4GUKA 4M2OA 1BLQA 1LA3A 2JOJA 2MRDA 3LL8B 4E68A 1CB1A 2KFGA 2KFHA 4L9MA 3KPXA 1F70A 1TCFA 4PE4A 1ODBA 5JOLA 2Y5IA 1SNLA 2JWWA 4NDDA 1KCYA 1MUXA 3SG2A 1XFUO 3I5GC 1NX2A 1RJVA 3BUWB 1YURA 3CZ0A 3PFVA 2O60A 1K90D 2JTTA 1E8AA 3KHEA 5HKZA 4UPGA 2KAYA 5FI2A 2EC6C 2COLB 2KGRA 5K89A 1JWDA 2PALA 3SG3A 1OMVA 1PULA 2ZFDA 1KWOB 1L2OC 1QJTA 1WRKA 4MN0A 1OZSA 2K8MB 4INWA 1C7WA 1SK6D 2Y1MA 2WC5A 1QVIY 1NX0A 4F0ZB 1KK8C 2L0PA 1F55A 1S6IA 1KK7Z 1QS7A 1SCVA 1FI5A 2JRFA 3I5FB 2K0JA 5HKWA 1TTXA 1CFPA 1SRAA 3S0GA 1SSEB 4ZCVA 2KOTA 3BQ3A 1KQVA 2L2CA 2M0RA 3S0BA 5CSIA 1W9ZA 3NXAA 4ORCB 1SR6C 5I2OA 1F4OA 4C0JA 1CKKA 2R2IA 1J7OA 1XFZO 1GJYA 1NX3A 1QX5B 2LC5A 1V1FA 2FOTA 3CZTX 2KI4B 3I5IC 1DGUA 4GGNA 4N1FA 2M7LA 2KLDA 4F7FA 5KTYA 2M29A 1RROA 1J55A 1TNQA 1B1GA 1TUZA 4FQOA 5AFPA 1GGWA 1ORGA 5J3XA 2TN4A 3SS3A 1B8LA 2LCPA 3D0YB 3OX6A 5B8IB 3AAKA 4WQ2A 4YBHB 4TNCA 1SL9A 3BUMB 1SBJA 2LUCA 4YGDB 1NWDA 1TWOA 1UURA 1YUUA 1A03A 5CPVA 1S1EA 4YGCB 5AEQA 3A4UB 4QJ4B 4YI8A 3TDIA 1OOJA 3KF9A 2I2RE 2WC6A 1LKJA 4HSZA 2KHNA 1Q80A 5FI7A 1Y6WA 5HL1A 1MR8A 1YRTB 1QTXA 4YI9A 3FS7A 3TZ1A 3PSRA 3DVEA 1M46A 4HRGA 3CLNA 5PALA 2CCMA 2F8PA 1A75A 1KFXL 3PN7B 2JULA 1IQ5A 1CDPA 1SL7A 2LP3A 3NSLA 1K9PA 1K9UA 1KQMC 1S26D 2D8NA 1NSHA 1U5IB 1UHJA 2KFFA 2FCDA 4XJKB 4C0LA 1B4CA 1HT9A 1C07A 1TNWA 1C7VA 3CZ2A 3SG5A 4AOMA 2Q91A 1K94A 1RWYA 2BKIB 1DJGA 1QV1A 1AK8A 2QEHA 4C0KA 5HYDA 2EHBA 1DT7B 4YRUA 5AXIA 3CDNA 3PLFB 3NSIA 2IS9A 2E30A 4MLWA 1EG4A 2AMIA 3EKHA 3OHMB 2BBMA 2FCEA 1G33A 1Y0VH 1IQ3A 1QIWA 3VGOA 1C3YA 1DJHA 1K93D 4YGAA 1AJ5A 1BU3A 1PVAA 1KK7Y 1QX7A 2ZRSA 4Q04A 1Y1AA 1UHNA 1BG1A 3O4XA 1EL4A 3LK1A 1NX1A 3DZTA 3DXLA 5D69A 1HQVA 1ZOTB 1Z2CB 2LMTA 3S0AA 2Y4QA 1FW4A 1RK9A 2GGMA 3TDZA 3WHUB 5EL2A 1LINA 5KSZA 1DJXA 2WNDA 2Y1NA 1M31A 1J7RA 3F45A 2ERBA 3D0YA 3BUNB 1BT6A 4D1EA 1K96A 1XK4C 1AVSA 1S3PA 2H2KA 2HQWA 2MLFC 2MHHA 4QJ5B 2GGZA 2KNEA 1JFKA 2M8UA 4HRHA 3JVTC 2WCHA 3R1PA 2NCOA 1DELA 3TUYB 3O4YA 4MRXA 1Y1UA 4PE0A 3IF7A 1AUIB 1CM4A 1JF2A 2H8VA 4MVFA 3VRRA 2F33A 2CBLA 3PATA 3R1OA 1NCZA 1NPQA 2MBXA 4QJ3B 3ZNIA 1J7PA 1G4YR 1XFWO 5GQQC 1AHRA 3BUOB 2BAPA 3FIAA 3WHTB 2L98A 2JT8A 3EKJA 1B9AA 1DF0B 4MZJA 1DJZA 1G8IA 3D76A 3DVMA 3D74A 4FTGA 1N65A 2L5YA 2O5GA 4HREE 1XVJA 2WCLA 1U5IA 1ZMZA 4INXA 4XJKA 4PT1A 3VRPA 2LUXA 2HF5A 1QX2A 2FJUB 2QEVA 2KYCA 3L4AA 2LLUA 2P71A 1H4BA 3CWGA 2L50A 2DOQA 2KQ6A 2CNPA 4N5XA 3WNXB 2K2FA 2PYQA 4USLA 1CLBA 1T14A 3E3RA 3GK4X 1QV0A 4DRWA 5D3OA 3PJIA 1UP5A 1PK0D 2WCKA 1PVBA 2LE9B 5HLVA 1MXEA 4P2YB 1QWVA 1IWQA 2HETA 1B47A 2LVVA 2OS8C 4NQGA 3FWBA 1XFYO 1NP8A 2LHLA 4MRYA 4AQJA 1Y1XA 4I5KA 2LLTA 2H61C 1KFXS 5AANA 3QMEA 2LP2A 2JU0A 3I5GB 2M49B 1V1GA 1DQEA 4GAOA 2Q4UA 2RGIA 2AAOA 4MZKA 2JZIA 3IQQA 1BF5A 2EC6B 2L2EA 1IH0A 3IVTA 1YUTA 3M0WA 2MA2A 1L2OB 1SCMC 4ZCUA 2OTGC 2E6WA 1S6JA 2JT3A 4OKHA 1K9KA 4AQIA 1W7IB 2K60A 2K7OA 1FI6A 1KK8B 1GM0A 3CZ1A 2M1UA 1X02A 2CXJA 1EJ3A 2NZ0A 1QXPA 2LMVA 2PVBA 4GGFA 3EK8A 1TN4A 4OVNF 5DKRA 2KYFA 1IKUA 3KO0A 2CT9A 3H4SE 4PALA 3EVVA 4OZDA 1GQMA 5TNCA 2HPSA 2WCJA 1LS8A 1SR6B 3HCMA 3D75A 3SS5A 3I5IB 1IJ6A 1BJFA 1C3ZA 1WDCC 1RECA 1CFDA 1OQPA 2BCAA 2KAVA 2L51A 1IGVA 3GK1A 3S0EA 3JTDC 3O2PA 3RLZA 3I5HC 4OV2A 1XFXO 2LV7A 3B87A 2LVKA 1XO5A 2ZNEA 1OMRA 3DD4A 1DJYA 4U8DA 2SCPA 3SS4A 1TUJA 5I2LA 1DF0A 3V2LA 1UHIA 3GK2A 3B6XA 5CSJA 1Z4HA 2BECA 5I8NA 1CM1A 1OE9B 5JJGA 2JPTA 1CLMA 2MJWB 1AP4A 2JC2A 1M63B 2LLSA 2P6BB 1W7JB 4IJ7A 2FJYA 4DS7A 3GOFA 1NUBA 1ZFSA 1QLSA 1SMGA 1J7QA 1OW4A 3D73A 3L47A 1K2HA 1NCYA 1K95A 1LA0A 1NYAA 1OZOA 3B86A 1F8HA 1YVHA 3K1EA 2LVJA 1DVIA 3OGNA 4MSPA 4PHNA 3CR2A 2VRGA 2M9GA 3TS5C 4DIRA 1SKTA 2KI6C 3OP0A 4IL1A 3TDUA 1NCXA 1YVLA 2GTEA 2JXCA 3FE6A 2KBMA 1KQMB 3VROA 1QATA 2KLEA 1OOHA 5BPJA 3EVRA 3C1VA 1MWNA 3R72A 4NDBA 4BY4A 4N1GA 1SPYA 3SIAA 3PM8A 1CTRA 2AUCA 3ICBA 2MAZA 4MEWA 2KBIA 2LM5A 5F6TA 4WRIA 5IBWA 3FE8A 2BL0C 2MLEC 5ER4X 1KFUL 4PE1A 4PHJA 4P5OE 3VRNA 1CDNA 3NGVA 2I18A 1RTP1 2PSRA 2QPTA 1M39A 2LMUA 4MZLA 4YGBB 1A2XA 1KSMA 2PASA 2BCBA 5HKYA 4KYNA 3L4LA 2M97A 2KQYA 1QLKA 3CR4X 2G9BA 1BR4B 3TS5B 2BKHB 3EK7A 1UHKA 3AAJA 1DC1A 2JTZA 3CR5X 4ETOA 1B7TY 2KSPA 3BFBA 3RZSA 1BODA 1IIOA 1QASA 2SASA 2BCXA 4M2PA 1XFVO 2L5XB 3UNWA 1SYMA 3BOWB 1KWOC 2PQLA 2WCMA 3CGAA 2M1KB 3MSEB 1LXFC 1TRFA 3IQOA 3VRQA 1OOGA 1ALWA 1TIZA 2KGBC 4YGEB 2EGDA 2BBNA 1S36A 3K21A 3SG4A 1JF0A 2CTNA 4JQ0D 3LLEA 4DUQA 2KPHA 2WOSA 2ISDA 1AJ4A 1DJWA 3I5FC 4JPZB 1L7ZA 5D7FA 4BY5A 3PALA 1ZUZA 1QIVA 1WRZA 2NLNA 1N0YA 1S5GY 3KEVA 1YTZC 1WLZA 2L4IA 4M2QA 3NSOA 3JVTB 4PDZA 2KI4C 2K2AA 2WCBA 3AKAA 3DF0B 4I5NB 1LVCD 3B88A 1JBAA 1EH2A 1BOCA 2YGUA 1CDLA 1SY9A 4MBEA 3FE9A 3SIBA 2HQ8A 4JD9A 2WORA 3UO9A 1DJIA 2JT0A 1OMDA 1EXRA 2WCEA 5KU1A 4PHMA 2I7AA 2BNXA 4A4BA 1WY9A 2PMYA 4ORBB 4JWQA 2LHIA 1YR5A 3BYAA 5I2QA 1D1OA 4GPLB 3O6BA 2M7NA 4CFRA 1CDMA 4JKTA 2ZN9A 1IRJA 3NSKA 2F2PA 3DVJA 3SG6A 2PRUA 3PN7C 1F71A 5CSFA 5ER5A 3OX5A 2L4HA 5DKNA 1JUOA 1CMFA 1B7TZ 1MXLC 3AKBA 3B7AA 1YX8A 4ORAB 1PSBA 5I94A 3D10A 4A4CA 2OS8B 2NXQA 1B8CA 3BXKA 3CS1A 3R1VA 5G08A 2LVIA 1MQ1A 1S6CA 2I94A 3SJSA 2B1UA 2QEBA 5DKQA 1CMGA 3LCPC 3NHTA 2A4JA 2JQ6A 1ALVA 4FQTA 1CNPA 2LNKA 1F54A 1UUSA 2F3YA 2K61A 1J1DA 3EK4A 2JNFA 2JPOA 2NCPA 3BOWA 2M3WA 2QDIA 4DCKA 4OCIA 2GV5A 1DGVA 1S5GZ 2BE6A 2ZKMX 1CFCA 1OSAA 1SCMB 3OB1B 2OTGB 3RM1A 2WC8A 5AERA 1KSOA 4PE7A 1DMOA 3Q8IA 3QRXA 2BE4A 1XK4A 3PM2A 1A4PA 2QEOA 1TOPA 4R1EA 1KFUS 3VB1A 3DYEA 2JXLA 3O78A 2K7BA 1JSAA 3BJHA 3DY9A 3DVKA 1EG3A 2JNXA 1IJ5A 1SW8A 1YRUB 3DF0A 1OOIX 1PRWA 4OR9B 1BR1B 1WDCB 2LANA 3D78A 2ZNDA 3HX4A 1QVIZ 2KAXA 3S0DA 3JTDB 4GNKB 2LAPA 2K7CA 3I5HB 3NHIA 1YX7A 4PCWA 3FWCA 1VRKA 1A29A 1DEKA 1FBVA 2KI6D 2P70A 1MF8B 1N2DA 1K8UA 4GGFC 4XYNA 3CTNA 3A8RA 3BFHA 2QACA 5CSNA 5DICA 1IG5A 3CABA 4NDCA 1R6PA 4CLNA 1FF1A 1TCOB 1MHOA 2ZRTA 3WXAA 2F2OA 2KDHA 4GFTA 3TUYC 4PHKA 5FI6A 2OPOA 1TNPA 1JFJA 1TNXA 2K7DA 3OBVA 1GGZA 4CFQA 4CIDA 1UWOA 4I5LB 1B8RA 5FYXA 1R2UA 1JC2A 1CFFA 5HLOA 3EVUA 1DTLA 3BUXB 1WLMA 2V53A 2ZN8A 4WQ3A 3ZWHA 1NIWA 3EG5B 4CPVA 3S0FA 3OB2B 2WCFA
chains in the Genus database with same CATH topology
1BMOA 1PSRA 4ICBA 2F3ZA 3SG7A 1M45A 1H8BA 1RFJA 1J1EA 1XA5A 4GBAA 2G2BA 1F4QA 1SL8A 2H61A 1XYDA 4I5JA 1ZACA 1A75B 1FPWA 1PALA 1WRLA 1UHHA 1CLLA 1YUSA 2BL0B 4GUKA 4M2OA 1BLQA 1LA3A 2JOJA 2MRDA 3LL8B 4E68A 1CB1A 2KFGA 2KFHA 4L9MA 3KPXA 1F70A 1TCFA 4PE4A 1ODBA 5JOLA 2Y5IA 1SNLA 2JWWA 4NDDA 1KCYA 1MUXA 3SG2A 1XFUO 3I5GC 1NX2A 1RJVA 3BUWB 1YURA 3PFVA 2O60A 1K90D 2JTTA 1E8AA 3KHEA 5HKZA 4UPGA 2KAYA 2EC6C 2COLB 2KGRA 5K89A 1JWDA 2PALA 1OMVA 1PULA 2ZFDA 1KWOB 1L2OC 1QJTA 1WRKA 4MN0A 1OZSA 2K8MB 1C7WA 1SK6D 2Y1MA 1QVIY 1NX0A 4F0ZB 1KK8C 2L0PA 1F55A 1S6IA 1KK7Z 1QS7A 1SCVA 1FI5A 2JRFA 3I5FB 2K0JA 5HKWA 1TTXA 1CFPA 1SRAA 4ZCVA 2KOTA 3BQ3A 1KQVA 2M0RA 5CSIA 5I2OA 3NXAA 4ORCB 1SR6C 1CKKA 1F4OA 4C0JA 1J7OA 2R2IA 1XFZO 1GJYA 1NX3A 1QX5B 2LC5A 1V1FA 2FOTA 3CZTX 2KI4B 3I5IC 1DGUA 4GGNA 4N1FA 2M7LA 5KTYA 2M29A 1RROA 1J55A 1TNQA 1B1GA 4FQOA 5AFPA 1GGWA 5J3XA 2TN4A 1B8LA 2LCPA 3D0YB 3OX6A 5B8IB 3AAKA 4WQ2A 4YBHB 4TNCA 1SL9A 3BUMB 1SBJA 2LUCA 4YGDB 1NWDA 1UURA 1YUUA 1A03A 5CPVA 1S1EA 4YGCB 5AEQA 3A4UB 4QJ4B 4YI8A 3TDIA 1OOJA 3KF9A 2I2RE 1LKJA 4HSZA 2KHNA 1Q80A 1Y6WA 1MR8A 1YRTB 1QTXA 4YI9A 3FS7A 3TZ1A 3PSRA 3DVEA 1M46A 4HRGA 3CLNA 5PALA 2CCMA 2F8PA 1A75A 1KFXL 3PN7B 2JULA 1IQ5A 1CDPA 1SL7A 2LP3A 3NSLA 1K9PA 1K9UA 1KQMC 1S26D 2D8NA 1NSHA 1U5IB 1UHJA 2KFFA 2FCDA 4XJKB 4C0LA 1B4CA 1HT9A 1C07A 1TNWA 1C7VA 4AOMA 3SG5A 2Q91A 1K94A 1RWYA 2BKIB 1DJGA 1QV1A 1AK8A 4C0KA 5HYDA 2EHBA 1DT7B 4YRUA 5AXIA 3PLFB 3NSIA 2IS9A 2E30A 4MLWA 1EG4A 2AMIA 3EKHA 3OHMB 2BBMA 2FCEA 1G33A 1Y0VH 1IQ3A 1QIWA 3VGOA 1DJHA 1K93D 4YGAA 1AJ5A 1BU3A 1PVAA 1KK7Y 1QX7A 2ZRSA 4Q04A 1Y1AA 1UHNA 1BG1A 1EL4A 3LK1A 1NX1A 5D69A 1HQVA 1ZOTB 2LMTA 2Y4QA 1FW4A 1RK9A 2GGMA 3TDZA 3WHUB 1LINA 5KSZA 1DJXA 2WNDA 2Y1NA 1M31A 1J7RA 3F45A 3D0YA 3BUNB 1BT6A 4D1EA 1K96A 1XK4C 1AVSA 1S3PA 2H2KA 2HQWA 2MLFC 2MHHA 4QJ5B 2GGZA 2KNEA 1JFKA 2M8UA 4HRHA 3JVTC 2NCOA 3TUYB 3O4YA 4MRXA 1Y1UA 4PE0A 3IF7A 1AUIB 1CM4A 1JF2A 3VRRA 4MVFA 3ZNIA 2F33A 2CBLA 3PATA 2MBXA 1NCZA 1NPQA 4QJ3B 1J7PA 1G4YR 1XFWO 5GQQC 1AHRA 3BUOB 3FIAA 3WHTB 2L98A 2JT8A 3EKJA 1B9AA 1DF0B 4MZJA 1DJZA 1G8IA 3DVMA 4FTGA 1N65A 2O5GA 4HREE 1XVJA 1U5IA 1ZMZA 4XJKA 3VRPA 2LUXA 2HF5A 1QX2A 2FJUB 2KYCA 2LLUA 1H4BA 3CWGA 2L50A 2DOQA 2KQ6A 2CNPA 4N5XA 3WNXB 2K2FA 4USLA 1CLBA 3GK4X 3E3RA 1QV0A 4DRWA 1UP5A 1PK0D 5HLVA 1PVBA 2LE9B 1MXEA 4P2YB 1IWQA 2HETA 1B47A 2LVVA 2OS8C 4NQGA 3FWBA 1XFYO 1NP8A 2LHLA 4MRYA 1Y1XA 4I5KA 2LLTA 2H61C 1KFXS 5AANA 2LP2A 2JU0A 3I5GB 2M49B 1V1GA 4GAOA 2Q4UA 2RGIA 2AAOA 4MZKA 2JZIA 3IQQA 1BF5A 2EC6B 2L2EA 1IH0A 1YUTA 3M0WA 2MA2A 1L2OB 1SCMC 4ZCUA 2OTGC 2E6WA 1S6JA 2JT3A 4OKHA 1K9KA 4AQIA 1W7IB 2K7OA 1FI6A 1KK8B 2M1UA 1X02A 2CXJA 1EJ3A 2NZ0A 1QXPA 2LMVA 2PVBA 4GGFA 3EK8A 1TN4A 4OVNF 5DKRA 2KYFA 1IKUA 3KO0A 2CT9A 3H4SE 4PALA 3EVVA 1GQMA 5TNCA 2HPSA 1SR6B 3HCMA 3I5IB 1IJ6A 1BJFA 1WDCC 2KAVA 1RECA 1CFDA 1OQPA 2BCAA 2L51A 3GK1A 1IGVA 4AQJA 3JTDC 3O2PA 3RLZA 3I5HC 4OV2A 1XFXO 2LV7A 3DD4A 2LVKA 1XO5A 2ZNEA 1OMRA 4U8DA 1DJYA 3SG3A 2SCPA 5I2LA 1DF0A 1UHIA 3GK2A 5CSJA 2BECA 5I8NA 1CM1A 1OE9B 5JJGA 2JPTA 1CLMA 2MJWB 1AP4A 2JC2A 1M63B 2LLSA 2P6BB 1W7JB 4DS7A 3GOFA 1NUBA 1ZFSA 1QLSA 1SMGA 1J7QA 1K2HA 1NCYA 1K95A 1LA0A 1NYAA 1OZOA 1F8HA 1YVHA 2LVJA 1DVIA 4MSPA 4PHNA 3CR2A 2VRGA 2M9GA 3TS5C 4DIRA 1SKTA 2KI6C 3OP0A 4IL1A 3TDUA 1NCXA 1YVLA 2JXCA 2KBMA 1KQMB 3VROA 1QATA 5BPJA 3EVRA 3C1VA 1MWNA 4NDBA 4BY4A 4N1GA 1SPYA 3SIAA 3PM8A 1CTRA 2AUCA 3ICBA 2MAZA 4MEWA 2KBIA 2LM5A 5F6TA 4WRIA 5IBWA 2BL0C 2MLEC 5ER4X 1KFUL 4PE1A 4PHJA 4P5OE 3VRNA 1CDNA 2I18A 1RTP1 2PSRA 2QPTA 1M39A 2LMUA 4MZLA 4YGBB 1A2XA 1KSMA 2PASA 2BCBA 5HKYA 2M97A 2KQYA 1QLKA 3CR4X 2G9BA 1BR4B 3TS5B 2BKHB 3EK7A 1UHKA 3AAJA 2JTZA 3CR5X 4ETOA 1B7TY 2KSPA 1BODA 1QASA 2SASA 2BCXA 4M2PA 1XFVO 2L5XB 1SYMA 3BOWB 1KWOC 3CGAA 2M1KB 3MSEB 1LXFC 1TRFA 3IQOA 3VRQA 1ALWA 1TIZA 2KGBC 4YGEB 2EGDA 2BBNA 1S36A 3K21A 3SG4A 1JF0A 2CTNA 4JQ0D 3LLEA 4DUQA 2WOSA 2ISDA 1AJ4A 1DJWA 3I5FC 4JPZB 1L7ZA 5D7FA 4BY5A 3PALA 1ZUZA 1QIVA 1WRZA 2NLNA 1N0YA 1S5GY 3KEVA 1YTZC 1WLZA 2L4IA 4M2QA 3NSOA 3JVTB 4PDZA 2KI4C 2K2AA 2WCBA 3AKAA 3DF0B 4I5NB 1LVCD 1JBAA 1EH2A 1BOCA 1CDLA 1SY9A 4MBEA 3SIBA 2HQ8A 2WORA 1DJIA 2JT0A 1OMDA 1EXRA 2WCEA 5KU1A 4PHMA 2I7AA 4A4BA 1WY9A 2PMYA 4ORBB 4JWQA 2LHIA 1YR5A 3BYAA 5I2QA 1D1OA 4GPLB 3O6BA 2M7NA 4CFRA 1CDMA 2ZN9A 1IRJA 3NSKA 2F2PA 3DVJA 3SG6A 2PRUA 3PN7C 1F71A 5CSFA 5ER5A 3OX5A 2L4HA 5DKNA 1JUOA 1CMFA 1B7TZ 1MXLC 3AKBA 1YX8A 4ORAB 1PSBA 3D10A 4A4CA 2OS8B 2NXQA 1B8CA 3BXKA 3CS1A 5G08A 2LVIA 1MQ1A 1S6CA 2I94A 3SJSA 2B1UA 5DKQA 1CMGA 3LCPC 2A4JA 2JQ6A 1ALVA 1CNPA 2LNKA 1F54A 1UUSA 2F3YA 2K61A 1J1DA 3EK4A 2JNFA 2NCPA 3BOWA 2M3WA 1CFCA 4DCKA 4OCIA 2GV5A 1DGVA 1S5GZ 2BE6A 2ZKMX 1OSAA 1SCMB 3OB1B 2OTGB 3RM1A 2WC8A 5AERA 1KSOA 4PE7A 1DMOA 3QRXA 2BE4A 1XK4A 1A4PA 4R1EA 1TOPA 1KFUS 2JXLA 3O78A 2K7BA 1JSAA 3DVKA 1EG3A 2JNXA 1IJ5A 1SW8A 1YRUB 3DF0A 1PRWA 4OR9B 1BR1B 1WDCB 2LANA 3HX4A 2ZNDA 1QVIZ 2KAXA 3JTDB 4GNKB 2LAPA 2K7CA 3I5HB 1YX7A 4PCWA 3FWCA 1A29A 1FBVA 1VRKA 2KI6D 3LK0A 4GGFC 1MF8B 1N2DA 1K8UA 4XYNA 3CTNA 3A8RA 2QACA 5CSNA 1IG5A 4CLNA 4NDCA 1R6PA 1FF1A 1TCOB 1MHOA 2ZRTA 3WXAA 2F2OA 2KDHA 4GFTA 3TUYC 4PHKA 2OPOA 1TNPA 1JFJA 1TNXA 2K7DA 1GGZA 4CFQA 4CIDA 1UWOA 4I5LB 1B8RA 5FYXA 1R2UA 1JC2A 1CFFA 5HLOA 3EVUA 1DTLA 3BUXB 1WLMA 2V53A 2ZN8A 4WQ3A 3ZWHA 1NIWA 4CPVA 3OB2B 2WCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMO A;  1PSR A;  4ICB A;  2F3Z A;  3SG7 A;  1M45 A;  1H8B A;  1RFJ A;  1J1E A;  1XA5 A;  4GBA A;  2G2B A;  1F4Q A;  1SL8 A;  2H61 A;  1XYD A;  4I5J A;  1ZAC A;  1A75 B;  1FPW A;  1PAL A;  1WRL A;  1UHH A;  1CLL A;  1YUS A;  2BL0 B;  4GUK A;  4M2O A;  1BLQ A;  1LA3 A;  2JOJ A;  2MRD A;  3LL8 B;  4E68 A;  1CB1 A;  2KFG A;  2KFH A;  4L9M A;  3KPX A;  1F70 A;  1TCF A;  4PE4 A;  1ODB A;  5JOL A;  2Y5I A;  1SNL A;  2JWW A;  4NDD A;  1KCY A;  1MUX A;  3SG2 A;  1XFU O;  3I5G C;  1NX2 A;  1RJV A;  3BUW B;  1YUR A;  3PFV A;  2O60 A;  1K90 D;  2JTT A;  1E8A A;  3KHE A;  5HKZ A;  4UPG A;  2KAY A;  2EC6 C;  2COL B;  2KGR A;  5K89 A;  1JWD A;  2PAL A;  1OMV A;  1PUL A;  2ZFD A;  1KWO B;  1L2O C;  1QJT A;  1WRK A;  4MN0 A;  1OZS A;  2K8M B;  1C7W A;  1SK6 D;  2Y1M A;  1QVI Y;  1NX0 A;  4F0Z B;  1KK8 C;  2L0P A;  1F55 A;  1S6I A;  1KK7 Z;  1QS7 A;  1SCV A;  1FI5 A;  2JRF A;  3I5F B;  2K0J A;  5HKW A;  1TTX A;  1CFP A;  1SRA A;  4ZCV A;  2KOT A;  3BQ3 A;  1KQV A;  2M0R A;  5CSI A;  5I2O A;  3NXA A;  4ORC B;  1SR6 C;  1CKK A;  1F4O A;  4C0J A;  1J7O A;  2R2I A;  1XFZ O;  1GJY A;  1NX3 A;  1QX5 B;  2LC5 A;  1V1F A;  2FOT A;  3CZT X;  2KI4 B;  3I5I C;  1DGU A;  4GGN A;  4N1F A;  2M7L A;  5KTY A;  2M29 A;  1RRO A;  1J55 A;  1TNQ A;  1B1G A;  4FQO A;  5AFP A;  1GGW A;  5J3X A;  2TN4 A;  1B8L A;  2LCP A;  3D0Y B;  3OX6 A;  5B8I B;  3AAK A;  4WQ2 A;  4YBH B;  4TNC A;  1SL9 A;  3BUM B;  1SBJ A;  2LUC A;  4YGD B;  1NWD A;  1UUR A;  1YUU A;  1A03 A;  5CPV A;  1S1E A;  4YGC B;  5AEQ A;  3A4U B;  4QJ4 B;  4YI8 A;  3TDI A;  1OOJ A;  3KF9 A;  2I2R E;  1LKJ A;  4HSZ A;  2KHN A;  1Q80 A;  1Y6W A;  1MR8 A;  1YRT B;  1QTX A;  4YI9 A;  3FS7 A;  3TZ1 A;  3PSR A;  3DVE A;  1M46 A;  4HRG A;  3CLN A;  5PAL A;  2CCM A;  2F8P A;  1A75 A;  1KFX L;  3PN7 B;  2JUL A;  1IQ5 A;  1CDP A;  1SL7 A;  2LP3 A;  3NSL A;  1K9P A;  1K9U A;  1KQM C;  1S26 D;  2D8N A;  1NSH A;  1U5I B;  1UHJ A;  2KFF A;  2FCD A;  4XJK B;  4C0L A;  1B4C A;  1HT9 A;  1C07 A;  1TNW A;  1C7V A;  4AOM A;  3SG5 A;  2Q91 A;  1K94 A;  1RWY A;  2BKI B;  1DJG A;  1QV1 A;  1AK8 A;  4C0K A;  5HYD A;  2EHB A;  1DT7 B;  4YRU A;  5AXI A;  3PLF B;  3NSI A;  2IS9 A;  2E30 A;  4MLW A;  1EG4 A;  2AMI A;  3EKH A;  3OHM B;  2BBM A;  2FCE A;  1G33 A;  1Y0V H;  1IQ3 A;  1QIW A;  3VGO A;  1DJH A;  1K93 D;  4YGA A;  1AJ5 A;  1BU3 A;  1PVA A;  1KK7 Y;  1QX7 A;  2ZRS A;  4Q04 A;  1Y1A A;  1UHN A;  1BG1 A;  1EL4 A;  3LK1 A;  1NX1 A;  5D69 A;  1HQV A;  1ZOT B;  2LMT A;  2Y4Q A;  1FW4 A;  1RK9 A;  2GGM A;  3TDZ A;  3WHU B;  1LIN A;  5KSZ A;  1DJX A;  2WND A;  2Y1N A;  1M31 A;  1J7R A;  3F45 A;  3D0Y A;  3BUN B;  1BT6 A;  4D1E A;  1K96 A;  1XK4 C;  1AVS A;  1S3P A;  2H2K A;  2HQW A;  2MLF C;  2MHH A;  4QJ5 B;  2GGZ A;  2KNE A;  1JFK A;  2M8U A;  4HRH A;  3JVT C;  2NCO A;  3TUY B;  3O4Y A;  4MRX A;  1Y1U A;  4PE0 A;  3IF7 A;  1AUI B;  1CM4 A;  1JF2 A;  3VRR A;  4MVF A;  3ZNI A;  2F33 A;  2CBL A;  3PAT A;  2MBX A;  1NCZ A;  1NPQ A;  4QJ3 B;  1J7P A;  1G4Y R;  1XFW O;  5GQQ C;  1AHR A;  3BUO B;  3FIA A;  3WHT B;  2L98 A;  2JT8 A;  3EKJ A;  1B9A A;  1DF0 B;  4MZJ A;  1DJZ A;  1G8I A;  3DVM A;  4FTG A;  1N65 A;  2O5G A;  4HRE E;  1XVJ A;  1U5I A;  1ZMZ A;  4XJK A;  3VRP A;  2LUX A;  2HF5 A;  1QX2 A;  2FJU B;  2KYC A;  2LLU A;  1H4B A;  3CWG A;  2L50 A;  2DOQ A;  2KQ6 A;  2CNP A;  4N5X A;  3WNX B;  2K2F A;  4USL A;  1CLB A;  3GK4 X;  3E3R A;  1QV0 A;  4DRW A;  1UP5 A;  1PK0 D;  5HLV A;  1PVB A;  2LE9 B;  1MXE A;  4P2Y B;  1IWQ A;  2HET A;  1B47 A;  2LVV A;  2OS8 C;  4NQG A;  3FWB A;  1XFY O;  1NP8 A;  2LHL A;  4MRY A;  1Y1X A;  4I5K A;  2LLT A;  2H61 C;  1KFX S;  5AAN A;  2LP2 A;  2JU0 A;  3I5G B;  2M49 B;  1V1G A;  4GAO A;  2Q4U A;  2RGI A;  2AAO A;  4MZK A;  2JZI A;  3IQQ A;  1BF5 A;  2EC6 B;  2L2E A;  1IH0 A;  1YUT A;  3M0W A;  2MA2 A;  1L2O B;  1SCM C;  4ZCU A;  2OTG C;  2E6W A;  1S6J A;  2JT3 A;  4OKH A;  1K9K A;  4AQI A;  1W7I B;  2K7O A;  1FI6 A;  1KK8 B;  2M1U A;  1X02 A;  2CXJ A;  1EJ3 A;  2NZ0 A;  1QXP A;  2LMV A;  2PVB A;  4GGF A;  3EK8 A;  1TN4 A;  4OVN F;  5DKR A;  2KYF A;  1IKU A;  3KO0 A;  2CT9 A;  3H4S E;  4PAL A;  3EVV A;  1GQM A;  5TNC A;  2HPS A;  1SR6 B;  3HCM A;  3I5I B;  1IJ6 A;  1BJF A;  1WDC C;  2KAV A;  1REC A;  1CFD A;  1OQP A;  2BCA A;  2L51 A;  3GK1 A;  1IGV A;  4AQJ A;  3JTD C;  3O2P A;  3RLZ A;  3I5H C;  4OV2 A;  1XFX O;  2LV7 A;  3DD4 A;  2LVK A;  1XO5 A;  2ZNE A;  1OMR A;  4U8D A;  1DJY A;  3SG3 A;  2SCP A;  5I2L A;  1DF0 A;  1UHI A;  3GK2 A;  5CSJ A;  2BEC A;  5I8N A;  1CM1 A;  1OE9 B;  5JJG A;  2JPT A;  1CLM A;  2MJW B;  1AP4 A;  2JC2 A;  1M63 B;  2LLS A;  2P6B B;  1W7J B;  4DS7 A;  3GOF A;  1NUB A;  1ZFS A;  1QLS A;  1SMG A;  1J7Q A;  1K2H A;  1NCY A;  1K95 A;  1LA0 A;  1NYA A;  1OZO A;  1F8H A;  1YVH A;  2LVJ A;  1DVI A;  4MSP A;  4PHN A;  3CR2 A;  2VRG A;  2M9G A;  3TS5 C;  4DIR A;  1SKT A;  2KI6 C;  3OP0 A;  4IL1 A;  3TDU A;  1NCX A;  1YVL A;  2JXC A;  2KBM A;  1KQM B;  3VRO A;  1QAT A;  5BPJ A;  3EVR A;  3C1V A;  1MWN A;  4NDB A;  4BY4 A;  4N1G A;  1SPY A;  3SIA A;  3PM8 A;  1CTR A;  2AUC A;  3ICB A;  2MAZ A;  4MEW A;  2KBI A;  2LM5 A;  5F6T A;  4WRI A;  5IBW A;  2BL0 C;  2MLE C;  5ER4 X;  1KFU L;  4PE1 A;  4PHJ A;  4P5O E;  3VRN A;  1CDN A;  2I18 A;  1RTP 1;  2PSR A;  2QPT A;  1M39 A;  2LMU A;  4MZL A;  4YGB B;  1A2X A;  1KSM A;  2PAS A;  2BCB A;  5HKY A;  2M97 A;  2KQY A;  1QLK A;  3CR4 X;  2G9B A;  1BR4 B;  3TS5 B;  2BKH B;  3EK7 A;  1UHK A;  3AAJ A;  2JTZ A;  3CR5 X;  4ETO A;  1B7T Y;  2KSP A;  1BOD A;  1QAS A;  2SAS A;  2BCX A;  4M2P A;  1XFV O;  2L5X B;  1SYM A;  3BOW B;  1KWO C;  3CGA A;  2M1K B;  3MSE B;  1LXF C;  1TRF A;  3IQO A;  3VRQ A;  1ALW A;  1TIZ A;  2KGB C;  4YGE B;  2EGD A;  2BBN A;  1S36 A;  3K21 A;  3SG4 A;  1JF0 A;  2CTN A;  4JQ0 D;  3LLE A;  4DUQ A;  2WOS A;  2ISD A;  1AJ4 A;  1DJW A;  3I5F C;  4JPZ B;  1L7Z A;  5D7F A;  4BY5 A;  3PAL A;  1ZUZ A;  1QIV A;  1WRZ A;  2NLN A;  1N0Y A;  1S5G Y;  3KEV A;  1YTZ C;  1WLZ A;  2L4I A;  4M2Q A;  3NSO A;  3JVT B;  4PDZ A;  2KI4 C;  2K2A A;  2WCB A;  3AKA A;  3DF0 B;  4I5N B;  1LVC D;  1JBA A;  1EH2 A;  1BOC A;  1CDL A;  1SY9 A;  4MBE A;  3SIB A;  2HQ8 A;  2WOR A;  1DJI A;  2JT0 A;  1OMD A;  1EXR A;  2WCE A;  5KU1 A;  4PHM A;  2I7A A;  4A4B A;  1WY9 A;  2PMY A;  4ORB B;  4JWQ A;  2LHI A;  1YR5 A;  3BYA A;  5I2Q A;  1D1O A;  4GPL B;  3O6B A;  2M7N A;  4CFR A;  1CDM A;  2ZN9 A;  1IRJ A;  3NSK A;  2F2P A;  3DVJ A;  3SG6 A;  2PRU A;  3PN7 C;  1F71 A;  5CSF A;  5ER5 A;  3OX5 A;  2L4H A;  5DKN A;  1JUO A;  1CMF A;  1B7T Z;  1MXL C;  3AKB A;  1YX8 A;  4ORA B;  1PSB A;  3D10 A;  4A4C A;  2OS8 B;  2NXQ A;  1B8C A;  3BXK A;  3CS1 A;  5G08 A;  2LVI A;  1MQ1 A;  1S6C A;  2I94 A;  3SJS A;  2B1U A;  5DKQ A;  1CMG A;  3LCP C;  2A4J A;  2JQ6 A;  1ALV A;  1CNP A;  2LNK A;  1F54 A;  1UUS A;  2F3Y A;  2K61 A;  1J1D A;  3EK4 A;  2JNF A;  2NCP A;  3BOW A;  2M3W A;  1CFC A;  4DCK A;  4OCI A;  2GV5 A;  1DGV A;  1S5G Z;  2BE6 A;  2ZKM X;  1OSA A;  1SCM B;  3OB1 B;  2OTG B;  3RM1 A;  2WC8 A;  5AER A;  1KSO A;  4PE7 A;  1DMO A;  3QRX A;  2BE4 A;  1XK4 A;  1A4P A;  4R1E A;  1TOP A;  1KFU S;  2JXL A;  3O78 A;  2K7B A;  1JSA A;  3DVK A;  1EG3 A;  2JNX A;  1IJ5 A;  1SW8 A;  1YRU B;  3DF0 A;  1PRW A;  4OR9 B;  1BR1 B;  1WDC B;  2LAN A;  3HX4 A;  2ZND A;  1QVI Z;  2KAX A;  3JTD B;  4GNK B;  2LAP A;  2K7C A;  3I5H B;  1YX7 A;  4PCW A;  3FWC A;  1A29 A;  1FBV A;  1VRK A;  2KI6 D;  3LK0 A;  4GGF C;  1MF8 B;  1N2D A;  1K8U A;  4XYN A;  3CTN A;  3A8R A;  2QAC A;  5CSN A;  1IG5 A;  4CLN A;  4NDC A;  1R6P A;  1FF1 A;  1TCO B;  1MHO A;  2ZRT A;  3WXA A;  2F2O A;  2KDH A;  4GFT A;  3TUY C;  4PHK A;  2OPO A;  1TNP A;  1JFJ A;  1TNX A;  2K7D A;  1GGZ A;  4CFQ A;  4CID A;  1UWO A;  4I5L B;  1B8R A;  5FYX A;  1R2U A;  1JC2 A;  1CFF A;  5HLO A;  3EVU A;  1DTL A;  3BUX B;  1WLM A;  2V53 A;  2ZN8 A;  4WQ3 A;  3ZWH A;  1NIW A;  4CPV A;  3OB2 B;  2WCF A; 
#chains in the Genus database with same CATH topology
 1BMO A;  1PSR A;  3D77 A;  3N7H A;  4ICB A;  2F3Z A;  3SG7 A;  1M45 A;  1H8B A;  1RFJ A;  1J1E A;  1XA5 A;  3BFA A;  4GBA A;  2G2B A;  1F4Q A;  1SL8 A;  2H61 A;  1XYD A;  1OOF A;  3CYZ A;  4I5J A;  1ZAC A;  1A75 B;  1FPW A;  3LK0 A;  1PAL A;  1WRL A;  1P28 A;  1UHH A;  1XFR A;  1CLL A;  1YUS A;  2BL0 B;  4GUK A;  4M2O A;  1BLQ A;  1LA3 A;  2JOJ A;  2MRD A;  3LL8 B;  4E68 A;  1CB1 A;  2KFG A;  2KFH A;  4L9M A;  3KPX A;  1F70 A;  1TCF A;  4PE4 A;  1ODB A;  5JOL A;  2Y5I A;  1SNL A;  2JWW A;  4NDD A;  1KCY A;  1MUX A;  3SG2 A;  1XFU O;  3I5G C;  1NX2 A;  1RJV A;  3BUW B;  1YUR A;  3CZ0 A;  3PFV A;  2O60 A;  1K90 D;  2JTT A;  1E8A A;  3KHE A;  5HKZ A;  4UPG A;  2KAY A;  5FI2 A;  2EC6 C;  2COL B;  2KGR A;  5K89 A;  1JWD A;  2PAL A;  3SG3 A;  1OMV A;  1PUL A;  2ZFD A;  1KWO B;  1L2O C;  1QJT A;  1WRK A;  4MN0 A;  1OZS A;  2K8M B;  4INW A;  1C7W A;  1SK6 D;  2Y1M A;  2WC5 A;  1QVI Y;  1NX0 A;  4F0Z B;  1KK8 C;  2L0P A;  1F55 A;  1S6I A;  1KK7 Z;  1QS7 A;  1SCV A;  1FI5 A;  2JRF A;  3I5F B;  2K0J A;  5HKW A;  1TTX A;  1CFP A;  1SRA A;  3S0G A;  1SSE B;  4ZCV A;  2KOT A;  3BQ3 A;  1KQV A;  2L2C A;  2M0R A;  3S0B A;  5CSI A;  1W9Z A;  3NXA A;  4ORC B;  1SR6 C;  5I2O A;  1F4O A;  4C0J A;  1CKK A;  2R2I A;  1J7O A;  1XFZ O;  1GJY A;  1NX3 A;  1QX5 B;  2LC5 A;  1V1F A;  2FOT A;  3CZT X;  2KI4 B;  3I5I C;  1DGU A;  4GGN A;  4N1F A;  2M7L A;  2KLD A;  4F7F A;  5KTY A;  2M29 A;  1RRO A;  1J55 A;  1TNQ A;  1B1G A;  1TUZ A;  4FQO A;  5AFP A;  1GGW A;  1ORG A;  5J3X A;  2TN4 A;  3SS3 A;  1B8L A;  2LCP A;  3D0Y B;  3OX6 A;  5B8I B;  3AAK A;  4WQ2 A;  4YBH B;  4TNC A;  1SL9 A;  3BUM B;  1SBJ A;  2LUC A;  4YGD B;  1NWD A;  1TWO A;  1UUR A;  1YUU A;  1A03 A;  5CPV A;  1S1E A;  4YGC B;  5AEQ A;  3A4U B;  4QJ4 B;  4YI8 A;  3TDI A;  1OOJ A;  3KF9 A;  2I2R E;  2WC6 A;  1LKJ A;  4HSZ A;  2KHN A;  1Q80 A;  5FI7 A;  1Y6W A;  5HL1 A;  1MR8 A;  1YRT B;  1QTX A;  4YI9 A;  3FS7 A;  3TZ1 A;  3PSR A;  3DVE A;  1M46 A;  4HRG A;  3CLN A;  5PAL A;  2CCM A;  2F8P A;  1A75 A;  1KFX L;  3PN7 B;  2JUL A;  1IQ5 A;  1CDP A;  1SL7 A;  2LP3 A;  3NSL A;  1K9P A;  1K9U A;  1KQM C;  1S26 D;  2D8N A;  1NSH A;  1U5I B;  1UHJ A;  2KFF A;  2FCD A;  4XJK B;  4C0L A;  1B4C A;  1HT9 A;  1C07 A;  1TNW A;  1C7V A;  3CZ2 A;  3SG5 A;  4AOM A;  2Q91 A;  1K94 A;  1RWY A;  2BKI B;  1DJG A;  1QV1 A;  1AK8 A;  2QEH A;  4C0K A;  5HYD A;  2EHB A;  1DT7 B;  4YRU A;  5AXI A;  3CDN A;  3PLF B;  3NSI A;  2IS9 A;  2E30 A;  4MLW A;  1EG4 A;  2AMI A;  3EKH A;  3OHM B;  2BBM A;  2FCE A;  1G33 A;  1Y0V H;  1IQ3 A;  1QIW A;  3VGO A;  1C3Y A;  1DJH A;  1K93 D;  4YGA A;  1AJ5 A;  1BU3 A;  1PVA A;  1KK7 Y;  1QX7 A;  2ZRS A;  4Q04 A;  1Y1A A;  1UHN A;  1BG1 A;  3O4X A;  1EL4 A;  3LK1 A;  1NX1 A;  3DZT A;  3DXL A;  5D69 A;  1HQV A;  1ZOT B;  1Z2C B;  2LMT A;  3S0A A;  2Y4Q A;  1FW4 A;  1RK9 A;  2GGM A;  3TDZ A;  3WHU B;  5EL2 A;  1LIN A;  5KSZ A;  1DJX A;  2WND A;  2Y1N A;  1M31 A;  1J7R A;  3F45 A;  2ERB A;  3D0Y A;  3BUN B;  1BT6 A;  4D1E A;  1K96 A;  1XK4 C;  1AVS A;  1S3P A;  2H2K A;  2HQW A;  2MLF C;  2MHH A;  4QJ5 B;  2GGZ A;  2KNE A;  1JFK A;  2M8U A;  4HRH A;  3JVT C;  2WCH A;  3R1P A;  2NCO A;  1DEL A;  3TUY B;  3O4Y A;  4MRX A;  1Y1U A;  4PE0 A;  3IF7 A;  1AUI B;  1CM4 A;  1JF2 A;  2H8V A;  4MVF A;  3VRR A;  2F33 A;  2CBL A;  3PAT A;  3R1O A;  1NCZ A;  1NPQ A;  2MBX A;  4QJ3 B;  3ZNI A;  1J7P A;  1G4Y R;  1XFW O;  5GQQ C;  1AHR A;  3BUO B;  2BAP A;  3FIA A;  3WHT B;  2L98 A;  2JT8 A;  3EKJ A;  1B9A A;  1DF0 B;  4MZJ A;  1DJZ A;  1G8I A;  3D76 A;  3DVM A;  3D74 A;  4FTG A;  1N65 A;  2L5Y A;  2O5G A;  4HRE E;  1XVJ A;  2WCL A;  1U5I A;  1ZMZ A;  4INX A;  4XJK A;  4PT1 A;  3VRP A;  2LUX A;  2HF5 A;  1QX2 A;  2FJU B;  2QEV A;  2KYC A;  3L4A A;  2LLU A;  2P71 A;  1H4B A;  3CWG A;  2L50 A;  2DOQ A;  2KQ6 A;  2CNP A;  4N5X A;  3WNX B;  2K2F A;  2PYQ A;  4USL A;  1CLB A;  1T14 A;  3E3R A;  3GK4 X;  1QV0 A;  4DRW A;  5D3O A;  3PJI A;  1UP5 A;  1PK0 D;  2WCK A;  1PVB A;  2LE9 B;  5HLV A;  1MXE A;  4P2Y B;  1QWV A;  1IWQ A;  2HET A;  1B47 A;  2LVV A;  2OS8 C;  4NQG A;  3FWB A;  1XFY O;  1NP8 A;  2LHL A;  4MRY A;  4AQJ A;  1Y1X A;  4I5K A;  2LLT A;  2H61 C;  1KFX S;  5AAN A;  3QME A;  2LP2 A;  2JU0 A;  3I5G B;  2M49 B;  1V1G A;  1DQE A;  4GAO A;  2Q4U A;  2RGI A;  2AAO A;  4MZK A;  2JZI A;  3IQQ A;  1BF5 A;  2EC6 B;  2L2E A;  1IH0 A;  3IVT A;  1YUT A;  3M0W A;  2MA2 A;  1L2O B;  1SCM C;  4ZCU A;  2OTG C;  2E6W A;  1S6J A;  2JT3 A;  4OKH A;  1K9K A;  4AQI A;  1W7I B;  2K60 A;  2K7O A;  1FI6 A;  1KK8 B;  1GM0 A;  3CZ1 A;  2M1U A;  1X02 A;  2CXJ A;  1EJ3 A;  2NZ0 A;  1QXP A;  2LMV A;  2PVB A;  4GGF A;  3EK8 A;  1TN4 A;  4OVN F;  5DKR A;  2KYF A;  1IKU A;  3KO0 A;  2CT9 A;  3H4S E;  4PAL A;  3EVV A;  4OZD A;  1GQM A;  5TNC A;  2HPS A;  2WCJ A;  1LS8 A;  1SR6 B;  3HCM A;  3D75 A;  3SS5 A;  3I5I B;  1IJ6 A;  1BJF A;  1C3Z A;  1WDC C;  1REC A;  1CFD A;  1OQP A;  2BCA A;  2KAV A;  2L51 A;  1IGV A;  3GK1 A;  3S0E A;  3JTD C;  3O2P A;  3RLZ A;  3I5H C;  4OV2 A;  1XFX O;  2LV7 A;  3B87 A;  2LVK A;  1XO5 A;  2ZNE A;  1OMR A;  3DD4 A;  1DJY A;  4U8D A;  2SCP A;  3SS4 A;  1TUJ A;  5I2L A;  1DF0 A;  3V2L A;  1UHI A;  3GK2 A;  3B6X A;  5CSJ A;  1Z4H A;  2BEC A;  5I8N A;  1CM1 A;  1OE9 B;  5JJG A;  2JPT A;  1CLM A;  2MJW B;  1AP4 A;  2JC2 A;  1M63 B;  2LLS A;  2P6B B;  1W7J B;  4IJ7 A;  2FJY A;  4DS7 A;  3GOF A;  1NUB A;  1ZFS A;  1QLS A;  1SMG A;  1J7Q A;  1OW4 A;  3D73 A;  3L47 A;  1K2H A;  1NCY A;  1K95 A;  1LA0 A;  1NYA A;  1OZO A;  3B86 A;  1F8H A;  1YVH A;  3K1E A;  2LVJ A;  1DVI A;  3OGN A;  4MSP A;  4PHN A;  3CR2 A;  2VRG A;  2M9G A;  3TS5 C;  4DIR A;  1SKT A;  2KI6 C;  3OP0 A;  4IL1 A;  3TDU A;  1NCX A;  1YVL A;  2GTE A;  2JXC A;  3FE6 A;  2KBM A;  1KQM B;  3VRO A;  1QAT A;  2KLE A;  1OOH A;  5BPJ A;  3EVR A;  3C1V A;  1MWN A;  3R72 A;  4NDB A;  4BY4 A;  4N1G A;  1SPY A;  3SIA A;  3PM8 A;  1CTR A;  2AUC A;  3ICB A;  2MAZ A;  4MEW A;  2KBI A;  2LM5 A;  5F6T A;  4WRI A;  5IBW A;  3FE8 A;  2BL0 C;  2MLE C;  5ER4 X;  1KFU L;  4PE1 A;  4PHJ A;  4P5O E;  3VRN A;  1CDN A;  3NGV A;  2I18 A;  1RTP 1;  2PSR A;  2QPT A;  1M39 A;  2LMU A;  4MZL A;  4YGB B;  1A2X A;  1KSM A;  2PAS A;  2BCB A;  5HKY A;  4KYN A;  3L4L A;  2M97 A;  2KQY A;  1QLK A;  3CR4 X;  2G9B A;  1BR4 B;  3TS5 B;  2BKH B;  3EK7 A;  1UHK A;  3AAJ A;  1DC1 A;  2JTZ A;  3CR5 X;  4ETO A;  1B7T Y;  2KSP A;  3BFB A;  3RZS A;  1BOD A;  1IIO A;  1QAS A;  2SAS A;  2BCX A;  4M2P A;  1XFV O;  2L5X B;  3UNW A;  1SYM A;  3BOW B;  1KWO C;  2PQL A;  2WCM A;  3CGA A;  2M1K B;  3MSE B;  1LXF C;  1TRF A;  3IQO A;  3VRQ A;  1OOG A;  1ALW A;  1TIZ A;  2KGB C;  4YGE B;  2EGD A;  2BBN A;  1S36 A;  3K21 A;  3SG4 A;  1JF0 A;  2CTN A;  4JQ0 D;  3LLE A;  4DUQ A;  2KPH A;  2WOS A;  2ISD A;  1AJ4 A;  1DJW A;  3I5F C;  4JPZ B;  1L7Z A;  5D7F A;  4BY5 A;  3PAL A;  1ZUZ A;  1QIV A;  1WRZ A;  2NLN A;  1N0Y A;  1S5G Y;  3KEV A;  1YTZ C;  1WLZ A;  2L4I A;  4M2Q A;  3NSO A;  3JVT B;  4PDZ A;  2KI4 C;  2K2A A;  2WCB A;  3AKA A;  3DF0 B;  4I5N B;  1LVC D;  3B88 A;  1JBA A;  1EH2 A;  1BOC A;  2YGU A;  1CDL A;  1SY9 A;  4MBE A;  3FE9 A;  3SIB A;  2HQ8 A;  4JD9 A;  2WOR A;  3UO9 A;  1DJI A;  2JT0 A;  1OMD A;  1EXR A;  2WCE A;  5KU1 A;  4PHM A;  2I7A A;  2BNX A;  4A4B A;  1WY9 A;  2PMY A;  4ORB B;  4JWQ A;  2LHI A;  1YR5 A;  3BYA A;  5I2Q A;  1D1O A;  4GPL B;  3O6B A;  2M7N A;  4CFR A;  1CDM A;  4JKT A;  2ZN9 A;  1IRJ A;  3NSK A;  2F2P A;  3DVJ A;  3SG6 A;  2PRU A;  3PN7 C;  1F71 A;  5CSF A;  5ER5 A;  3OX5 A;  2L4H A;  5DKN A;  1JUO A;  1CMF A;  1B7T Z;  1MXL C;  3AKB A;  3B7A A;  1YX8 A;  4ORA B;  1PSB A;  5I94 A;  3D10 A;  4A4C A;  2OS8 B;  2NXQ A;  1B8C A;  3BXK A;  3CS1 A;  3R1V A;  5G08 A;  2LVI A;  1MQ1 A;  1S6C A;  2I94 A;  3SJS A;  2B1U A;  2QEB A;  5DKQ A;  1CMG A;  3LCP C;  3NHT A;  2A4J A;  2JQ6 A;  1ALV A;  4FQT A;  1CNP A;  2LNK A;  1F54 A;  1UUS A;  2F3Y A;  2K61 A;  1J1D A;  3EK4 A;  2JNF A;  2JPO A;  2NCP A;  3BOW A;  2M3W A;  2QDI A;  4DCK A;  4OCI A;  2GV5 A;  1DGV A;  1S5G Z;  2BE6 A;  2ZKM X;  1CFC A;  1OSA A;  1SCM B;  3OB1 B;  2OTG B;  3RM1 A;  2WC8 A;  5AER A;  1KSO A;  4PE7 A;  1DMO A;  3Q8I A;  3QRX A;  2BE4 A;  1XK4 A;  3PM2 A;  1A4P A;  2QEO A;  1TOP A;  4R1E A;  1KFU S;  3VB1 A;  3DYE A;  2JXL A;  3O78 A;  2K7B A;  1JSA A;  3BJH A;  3DY9 A;  3DVK A;  1EG3 A;  2JNX A;  1IJ5 A;  1SW8 A;  1YRU B;  3DF0 A;  1OOI X;  1PRW A;  4OR9 B;  1BR1 B;  1WDC B;  2LAN A;  3D78 A;  2ZND A;  3HX4 A;  1QVI Z;  2KAX A;  3S0D A;  3JTD B;  4GNK B;  2LAP A;  2K7C A;  3I5H B;  3NHI A;  1YX7 A;  4PCW A;  3FWC A;  1VRK A;  1A29 A;  1DEK A;  1FBV A;  2KI6 D;  2P70 A;  1MF8 B;  1N2D A;  1K8U A;  4GGF C;  4XYN A;  3CTN A;  3A8R A;  3BFH A;  2QAC A;  5CSN A;  5DIC A;  1IG5 A;  3CAB A;  4NDC A;  1R6P A;  4CLN A;  1FF1 A;  1TCO B;  1MHO A;  2ZRT A;  3WXA A;  2F2O A;  2KDH A;  4GFT A;  3TUY C;  4PHK A;  5FI6 A;  2OPO A;  1TNP A;  1JFJ A;  1TNX A;  2K7D A;  3OBV A;  1GGZ A;  4CFQ A;  4CID A;  1UWO A;  4I5L B;  1B8R A;  5FYX A;  1R2U A;  1JC2 A;  1CFF A;  5HLO A;  3EVU A;  1DTL A;  3BUX B;  1WLM A;  2V53 A;  2ZN8 A;  4WQ3 A;  3ZWH A;  1NIW A;  3EG5 B;  4CPV A;  3S0F A;  3OB2 B;  2WCF A; 
#chains in the Genus database with same CATH homology
 1BMO A;  1PSR A;  4ICB A;  2F3Z A;  3SG7 A;  1M45 A;  1H8B A;  1RFJ A;  1J1E A;  1XA5 A;  4GBA A;  2G2B A;  1F4Q A;  1SL8 A;  2H61 A;  1XYD A;  4I5J A;  1ZAC A;  1A75 B;  1FPW A;  1PAL A;  1WRL A;  1UHH A;  1CLL A;  1YUS A;  2BL0 B;  4GUK A;  4M2O A;  1BLQ A;  1LA3 A;  2JOJ A;  2MRD A;  3LL8 B;  4E68 A;  1CB1 A;  2KFG A;  2KFH A;  4L9M A;  3KPX A;  1F70 A;  1TCF A;  4PE4 A;  1ODB A;  5JOL A;  2Y5I A;  1SNL A;  2JWW A;  4NDD A;  1KCY A;  1MUX A;  3SG2 A;  1XFU O;  3I5G C;  1NX2 A;  1RJV A;  3BUW B;  1YUR A;  3PFV A;  2O60 A;  1K90 D;  2JTT A;  1E8A A;  3KHE A;  5HKZ A;  4UPG A;  2KAY A;  2EC6 C;  2COL B;  2KGR A;  5K89 A;  1JWD A;  2PAL A;  1OMV A;  1PUL A;  2ZFD A;  1KWO B;  1L2O C;  1QJT A;  1WRK A;  4MN0 A;  1OZS A;  2K8M B;  1C7W A;  1SK6 D;  2Y1M A;  1QVI Y;  1NX0 A;  4F0Z B;  1KK8 C;  2L0P A;  1F55 A;  1S6I A;  1KK7 Z;  1QS7 A;  1SCV A;  1FI5 A;  2JRF A;  3I5F B;  2K0J A;  5HKW A;  1TTX A;  1CFP A;  1SRA A;  4ZCV A;  2KOT A;  3BQ3 A;  1KQV A;  2M0R A;  5CSI A;  5I2O A;  3NXA A;  4ORC B;  1SR6 C;  1CKK A;  1F4O A;  4C0J A;  1J7O A;  2R2I A;  1XFZ O;  1GJY A;  1NX3 A;  1QX5 B;  2LC5 A;  1V1F A;  2FOT A;  3CZT X;  2KI4 B;  3I5I C;  1DGU A;  4GGN A;  4N1F A;  2M7L A;  5KTY A;  2M29 A;  1RRO A;  1J55 A;  1TNQ A;  1B1G A;  4FQO A;  5AFP A;  1GGW A;  5J3X A;  2TN4 A;  1B8L A;  2LCP A;  3D0Y B;  3OX6 A;  5B8I B;  3AAK A;  4WQ2 A;  4YBH B;  4TNC A;  1SL9 A;  3BUM B;  1SBJ A;  2LUC A;  4YGD B;  1NWD A;  1UUR A;  1YUU A;  1A03 A;  5CPV A;  1S1E A;  4YGC B;  5AEQ A;  3A4U B;  4QJ4 B;  4YI8 A;  3TDI A;  1OOJ A;  3KF9 A;  2I2R E;  1LKJ A;  4HSZ A;  2KHN A;  1Q80 A;  1Y6W A;  1MR8 A;  1YRT B;  1QTX A;  4YI9 A;  3FS7 A;  3TZ1 A;  3PSR A;  3DVE A;  1M46 A;  4HRG A;  3CLN A;  5PAL A;  2CCM A;  2F8P A;  1A75 A;  1KFX L;  3PN7 B;  2JUL A;  1IQ5 A;  1CDP A;  1SL7 A;  2LP3 A;  3NSL A;  1K9P A;  1K9U A;  1KQM C;  1S26 D;  2D8N A;  1NSH A;  1U5I B;  1UHJ A;  2KFF A;  2FCD A;  4XJK B;  4C0L A;  1B4C A;  1HT9 A;  1C07 A;  1TNW A;  1C7V A;  4AOM A;  3SG5 A;  2Q91 A;  1K94 A;  1RWY A;  2BKI B;  1DJG A;  1QV1 A;  1AK8 A;  4C0K A;  5HYD A;  2EHB A;  1DT7 B;  4YRU A;  5AXI A;  3PLF B;  3NSI A;  2IS9 A;  2E30 A;  4MLW A;  1EG4 A;  2AMI A;  3EKH A;  3OHM B;  2BBM A;  2FCE A;  1G33 A;  1Y0V H;  1IQ3 A;  1QIW A;  3VGO A;  1DJH A;  1K93 D;  4YGA A;  1AJ5 A;  1BU3 A;  1PVA A;  1KK7 Y;  1QX7 A;  2ZRS A;  4Q04 A;  1Y1A A;  1UHN A;  1BG1 A;  1EL4 A;  3LK1 A;  1NX1 A;  5D69 A;  1HQV A;  1ZOT B;  2LMT A;  2Y4Q A;  1FW4 A;  1RK9 A;  2GGM A;  3TDZ A;  3WHU B;  1LIN A;  5KSZ A;  1DJX A;  2WND A;  2Y1N A;  1M31 A;  1J7R A;  3F45 A;  3D0Y A;  3BUN B;  1BT6 A;  4D1E A;  1K96 A;  1XK4 C;  1AVS A;  1S3P A;  2H2K A;  2HQW A;  2MLF C;  2MHH A;  4QJ5 B;  2GGZ A;  2KNE A;  1JFK A;  2M8U A;  4HRH A;  3JVT C;  2NCO A;  3TUY B;  3O4Y A;  4MRX A;  1Y1U A;  4PE0 A;  3IF7 A;  1AUI B;  1CM4 A;  1JF2 A;  3VRR A;  4MVF A;  3ZNI A;  2F33 A;  2CBL A;  3PAT A;  2MBX A;  1NCZ A;  1NPQ A;  4QJ3 B;  1J7P A;  1G4Y R;  1XFW O;  5GQQ C;  1AHR A;  3BUO B;  3FIA A;  3WHT B;  2L98 A;  2JT8 A;  3EKJ A;  1B9A A;  1DF0 B;  4MZJ A;  1DJZ A;  1G8I A;  3DVM A;  4FTG A;  1N65 A;  2O5G A;  4HRE E;  1XVJ A;  1U5I A;  1ZMZ A;  4XJK A;  3VRP A;  2LUX A;  2HF5 A;  1QX2 A;  2FJU B;  2KYC A;  2LLU A;  1H4B A;  3CWG A;  2L50 A;  2DOQ A;  2KQ6 A;  2CNP A;  4N5X A;  3WNX B;  2K2F A;  4USL A;  1CLB A;  3GK4 X;  3E3R A;  1QV0 A;  4DRW A;  1UP5 A;  1PK0 D;  5HLV A;  1PVB A;  2LE9 B;  1MXE A;  4P2Y B;  1IWQ A;  2HET A;  1B47 A;  2LVV A;  2OS8 C;  4NQG A;  3FWB A;  1XFY O;  1NP8 A;  2LHL A;  4MRY A;  1Y1X A;  4I5K A;  2LLT A;  2H61 C;  1KFX S;  5AAN A;  2LP2 A;  2JU0 A;  3I5G B;  2M49 B;  1V1G A;  4GAO A;  2Q4U A;  2RGI A;  2AAO A;  4MZK A;  2JZI A;  3IQQ A;  1BF5 A;  2EC6 B;  2L2E A;  1IH0 A;  1YUT A;  3M0W A;  2MA2 A;  1L2O B;  1SCM C;  4ZCU A;  2OTG C;  2E6W A;  1S6J A;  2JT3 A;  4OKH A;  1K9K A;  4AQI A;  1W7I B;  2K7O A;  1FI6 A;  1KK8 B;  2M1U A;  1X02 A;  2CXJ A;  1EJ3 A;  2NZ0 A;  1QXP A;  2LMV A;  2PVB A;  4GGF A;  3EK8 A;  1TN4 A;  4OVN F;  5DKR A;  2KYF A;  1IKU A;  3KO0 A;  2CT9 A;  3H4S E;  4PAL A;  3EVV A;  1GQM A;  5TNC A;  2HPS A;  1SR6 B;  3HCM A;  3I5I B;  1IJ6 A;  1BJF A;  1WDC C;  2KAV A;  1REC A;  1CFD A;  1OQP A;  2BCA A;  2L51 A;  3GK1 A;  1IGV A;  4AQJ A;  3JTD C;  3O2P A;  3RLZ A;  3I5H C;  4OV2 A;  1XFX O;  2LV7 A;  3DD4 A;  2LVK A;  1XO5 A;  2ZNE A;  1OMR A;  4U8D A;  1DJY A;  3SG3 A;  2SCP A;  5I2L A;  1DF0 A;  1UHI A;  3GK2 A;  5CSJ A;  2BEC A;  5I8N A;  1CM1 A;  1OE9 B;  5JJG A;  2JPT A;  1CLM A;  2MJW B;  1AP4 A;  2JC2 A;  1M63 B;  2LLS A;  2P6B B;  1W7J B;  4DS7 A;  3GOF A;  1NUB A;  1ZFS A;  1QLS A;  1SMG A;  1J7Q A;  1K2H A;  1NCY A;  1K95 A;  1LA0 A;  1NYA A;  1OZO A;  1F8H A;  1YVH A;  2LVJ A;  1DVI A;  4MSP A;  4PHN A;  3CR2 A;  2VRG A;  2M9G A;  3TS5 C;  4DIR A;  1SKT A;  2KI6 C;  3OP0 A;  4IL1 A;  3TDU A;  1NCX A;  1YVL A;  2JXC A;  2KBM A;  1KQM B;  3VRO A;  1QAT A;  5BPJ A;  3EVR A;  3C1V A;  1MWN A;  4NDB A;  4BY4 A;  4N1G A;  1SPY A;  3SIA A;  3PM8 A;  1CTR A;  2AUC A;  3ICB A;  2MAZ A;  4MEW A;  2KBI A;  2LM5 A;  5F6T A;  4WRI A;  5IBW A;  2BL0 C;  2MLE C;  5ER4 X;  1KFU L;  4PE1 A;  4PHJ A;  4P5O E;  3VRN A;  1CDN A;  2I18 A;  1RTP 1;  2PSR A;  2QPT A;  1M39 A;  2LMU A;  4MZL A;  4YGB B;  1A2X A;  1KSM A;  2PAS A;  2BCB A;  5HKY A;  2M97 A;  2KQY A;  1QLK A;  3CR4 X;  2G9B A;  1BR4 B;  3TS5 B;  2BKH B;  3EK7 A;  1UHK A;  3AAJ A;  2JTZ A;  3CR5 X;  4ETO A;  1B7T Y;  2KSP A;  1BOD A;  1QAS A;  2SAS A;  2BCX A;  4M2P A;  1XFV O;  2L5X B;  1SYM A;  3BOW B;  1KWO C;  3CGA A;  2M1K B;  3MSE B;  1LXF C;  1TRF A;  3IQO A;  3VRQ A;  1ALW A;  1TIZ A;  2KGB C;  4YGE B;  2EGD A;  2BBN A;  1S36 A;  3K21 A;  3SG4 A;  1JF0 A;  2CTN A;  4JQ0 D;  3LLE A;  4DUQ A;  2WOS A;  2ISD A;  1AJ4 A;  1DJW A;  3I5F C;  4JPZ B;  1L7Z A;  5D7F A;  4BY5 A;  3PAL A;  1ZUZ A;  1QIV A;  1WRZ A;  2NLN A;  1N0Y A;  1S5G Y;  3KEV A;  1YTZ C;  1WLZ A;  2L4I A;  4M2Q A;  3NSO A;  3JVT B;  4PDZ A;  2KI4 C;  2K2A A;  2WCB A;  3AKA A;  3DF0 B;  4I5N B;  1LVC D;  1JBA A;  1EH2 A;  1BOC A;  1CDL A;  1SY9 A;  4MBE A;  3SIB A;  2HQ8 A;  2WOR A;  1DJI A;  2JT0 A;  1OMD A;  1EXR A;  2WCE A;  5KU1 A;  4PHM A;  2I7A A;  4A4B A;  1WY9 A;  2PMY A;  4ORB B;  4JWQ A;  2LHI A;  1YR5 A;  3BYA A;  5I2Q A;  1D1O A;  4GPL B;  3O6B A;  2M7N A;  4CFR A;  1CDM A;  2ZN9 A;  1IRJ A;  3NSK A;  2F2P A;  3DVJ A;  3SG6 A;  2PRU A;  3PN7 C;  1F71 A;  5CSF A;  5ER5 A;  3OX5 A;  2L4H A;  5DKN A;  1JUO A;  1CMF A;  1B7T Z;  1MXL C;  3AKB A;  1YX8 A;  4ORA B;  1PSB A;  3D10 A;  4A4C A;  2OS8 B;  2NXQ A;  1B8C A;  3BXK A;  3CS1 A;  5G08 A;  2LVI A;  1MQ1 A;  1S6C A;  2I94 A;  3SJS A;  2B1U A;  5DKQ A;  1CMG A;  3LCP C;  2A4J A;  2JQ6 A;  1ALV A;  1CNP A;  2LNK A;  1F54 A;  1UUS A;  2F3Y A;  2K61 A;  1J1D A;  3EK4 A;  2JNF A;  2NCP A;  3BOW A;  2M3W A;  1CFC A;  4DCK A;  4OCI A;  2GV5 A;  1DGV A;  1S5G Z;  2BE6 A;  2ZKM X;  1OSA A;  1SCM B;  3OB1 B;  2OTG B;  3RM1 A;  2WC8 A;  5AER A;  1KSO A;  4PE7 A;  1DMO A;  3QRX A;  2BE4 A;  1XK4 A;  1A4P A;  4R1E A;  1TOP A;  1KFU S;  2JXL A;  3O78 A;  2K7B A;  1JSA A;  3DVK A;  1EG3 A;  2JNX A;  1IJ5 A;  1SW8 A;  1YRU B;  3DF0 A;  1PRW A;  4OR9 B;  1BR1 B;  1WDC B;  2LAN A;  3HX4 A;  2ZND A;  1QVI Z;  2KAX A;  3JTD B;  4GNK B;  2LAP A;  2K7C A;  3I5H B;  1YX7 A;  4PCW A;  3FWC A;  1A29 A;  1FBV A;  1VRK A;  2KI6 D;  3LK0 A;  4GGF C;  1MF8 B;  1N2D A;  1K8U A;  4XYN A;  3CTN A;  3A8R A;  2QAC A;  5CSN A;  1IG5 A;  4CLN A;  4NDC A;  1R6P A;  1FF1 A;  1TCO B;  1MHO A;  2ZRT A;  3WXA A;  2F2O A;  2KDH A;  4GFT A;  3TUY C;  4PHK A;  2OPO A;  1TNP A;  1JFJ A;  1TNX A;  2K7D A;  1GGZ A;  4CFQ A;  4CID A;  1UWO A;  4I5L B;  1B8R A;  5FYX A;  1R2U A;  1JC2 A;  1CFF A;  5HLO A;  3EVU A;  1DTL A;  3BUX B;  1WLM A;  2V53 A;  2ZN8 A;  4WQ3 A;  3ZWH A;  1NIW A;  4CPV A;  3OB2 B;  2WCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...