1UHJA

Crystal structure of br-aequorin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
187
structure length
187
Chain Sequence
LTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aequorin 2
publication title The crystal structures of semi-synthetic aequorins
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 67
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhjA00
2L51A 1DMOA 3BUWB 1MR8A 1QASA 4YGDB 5GQQC 3HCMA 2HPSA 1KK7Z 1BG1A 1XO5A 1K2HA 1EXRA 2BECA 1CMGA 1NX1A 2F33A 4IL1A 4MBEA 3E3RA 4P5OE 3SG7A 1XFVO 3SG2A 4R1EA 2LHIA 3CGAA 1ODBA 1L2OC 1S36A 1UUSA 2Y1NA 4QJ3B 2F2OA 4DRWA 1NX0A 3NXAA 4PE7A 1CNPA 1S5GY 1Q80A 3BUNB 3SIBA 4A4BA 2JWWA 4GBAA 3IF7A 3OB1B 1IGVA 4HREE 1MXLC 2LLUA 4HRGA 2L2EA 2P6BB 1UHHA 2JC2A 4OKHA 4ORAB 1F55A 2HETA 2LVKA 1K90D 1DT7B 1J7OA 2M7NA 1AHRA 3A4UB 3PSRA 1XFUO 1DGUA 1YUUA 4MZJA 1UHKA 2JOJA 1YVHA 2LP3A 2LM5A 1N65A 3CS1A 1ZOTB 2BKIB 1WDCC 3EK7A 2GGMA 3TUYB 1IQ3A 2TN4A 2CNPA 1JF2A 2IS9A 2LANA 3FWBA 1J7QA 2LHLA 3SJSA 1SPYA 2BE6A 1WRLA 1WRZA 1YRUB 1QLSA 4OR9B 1YX8A 2KAYA 2LVIA 1DJGA 2M1KB 1K93D 1IJ6A 3ICBA 4U8DA 3TS5B 1B7TZ 5AXIA 1KK7Y 2KI6D 1DJIA 4YGCB 1ZFSA 1J1DA 1MXEA 1LVCD 1ZUZA 2F2PA 3LCPC 1CLBA 3CR2A 5B8IB 1DJZA 2LC5A 2JT8A 2LMTA 1QIWA 2CBLA 1BOCA 3O6BA 1IG5A 2MA2A 5HLVA 3OP0A 3AAKA 2MLEC 1JFKA 2BBMA 2K61A 1KFUL 1XFXO 4CPVA 4QJ5B 4F0ZB 1EG3A 1WY9A 4MEWA 1J55A 1X02A 1KCYA 1M46A 3DD4A 4MRXA 2LLSA 2QACA 1OZSA 3KPXA 1L2OB 3VROA 2G9BA 2LE9B 2WOSA 5AERA 4GFTA 1SMGA 4PE4A 1MHOA 3CR4X 3SG4A 1A29A 4MZKA 2L98A 1W7JB 1G33A 2WCFA 1IKUA 1GGWA 1QJTA 2M7LA 1QLKA 3I5HC 4YI8A 1QX2A 1K95A 2KQYA 1CM4A 4BY4A 3C1VA 5I2OA 1RWYA 5G08A 2ZNDA 1CTRA 1BR4B 5JOLA 1NYAA 2I18A 3PLFB 1IJ5A 2KBIA 1CFDA 4PHJA 1QV1A 1N2DA 1UWOA 2F3YA 2K0JA 2PVBA 2R2IA 3WHTB 1BLQA 2F3ZA 3DVJA 1UURA 4CFRA 1S1EA 4P2YB 1JWDA 1XFWO 1R6PA 4N1GA 1ZACA 1B7TY 1M63B 4WRIA 2WCBA 5HKWA 1J7PA 2B1UA 1CFFA 1XA5A 3VGOA 5AFPA 4NDDA 3EK8A 1IQ5A 2ZN9A 1KQMB 4I5LB 1Y1UA 5KU1A 2NLNA 1ALWA 4GPLB 1EL4A 3AKBA 1M45A 2WORA 2WCEA 2KGRA 2KI6C 4PHKA 2BL0C 4JQ0D 1RK9A 3EK4A 3D10A 4MN0A 1PVBA 2BCXA 2M8UA 1TN4A 2SASA 3TDUA 4C0JA 2EC6C 1A75A 1B47A 2I2RE 1NX3A 4WQ3A 1FPWA 1NPQA 2PASA 1NCZA 2ZRSA 4YGEB 1YR5A 2E6WA 1RROA 2HF5A 4XJKA 2K7DA 3CR5X 3LL8B 3GK1A 5I2LA 5AEQA 1E8AA 4YGBB 4GGFC 2PMYA 3GK2A 2MJWB 1Y0VH 3D0YA 1CKKA 3NSIA 1G8IA 1SL9A 3VRRA 1CDPA 1GJYA 3LK0A 1YURA 1BF5A 1SYMA 3KO0A 1F4OA 3KF9A 1EH2A 1F70A 2CT9A 1AUIB 1S6JA 4TNCA 1CMFA 4PE1A 5DKRA 1DJHA 3ZNIA 3KEVA 2CXJA 4GGFA 4MZLA 1UHJA 3I5HB 2K2FA 3EVRA 1J7RA 2CTNA 4ICBA 5JJGA 1AJ4A 2L5XB 3I5IB 1TIZA 2G2BA 1C07A 1EG4A 5CSNA 5HKYA 1KSOA 3JVTC 2BBNA 2M0RA 3GK4X 3SG3A 5KSZA 2M3WA 3WXAA 1K9KA 4Q04A 4YI9A 4MSPA 2O5GA 1QV0A 2Q4UA 4YBHB 2PALA 3PATA 4QJ4B 2JTZA 1CFPA 1K9UA 3VRNA 3DF0A 1KFUS 2COLB 3DVEA 3M0WA 1SCVA 1TTXA 2LVVA 2OTGC 3I5FC 4FTGA 4ORCB 3SIAA 1PSRA 1A75B 3NSLA 3OB2B 1TCOB 2DOQA 1OE9B 1PRWA 4XYNA 5CPVA 4XJKB 3BUOB 1B4CA 2BL0B 1AVSA 2WNDA 2JQ6A 3CWGA 1DGVA 2L4HA 3QRXA 1JSAA 1QX7A 2LVJA 2L4IA 3PN7C 1KQVA 2JT3A 3DVMA 1NUBA 2LV7A 1BR1B 1UHIA 5I2QA 2JULA 4PDZA 5CSIA 3FS7A 1YX7A 1K94A 1SY9A 2M9GA 1CLMA 1FW4A 4OCIA 1C7VA 1DF0A 2JNFA 1MWNA 1SR6C 4JWQA 2LNKA 1AK8A 2OS8C 1J1EA 1S3PA 1LKJA 1KFXL 1TNXA 3EKHA 3A8RA 1B8LA 1SL8A 4M2PA 1QIVA 4YGAA 4AOMA 2LUXA 3CTNA 1QVIZ 1UHNA 5K89A 1Y6WA 4HSZA 4PE0A 1SL7A 2FCEA 2GV5A 1CFCA 2H2KA 4C0LA 2HQWA 2PSRA 1LA0A 1XVJA 3CLNA 3HX4A 3JVTB 3O78A 2ISDA 1KWOC 2JU0A 4CFQA 1RJVA 3OX6A 2ZNEA 2H61C 2D8NA 1ZMZA 2KBMA 3PFVA 1G4YR 2LUCA 4N1FA 2KHNA 2KOTA 1WDCB 5IBWA 1XK4C 2NCOA 1YUSA 4JPZB 1MF8B 2OTGB 3I5FB 1OQPA 2K2AA 2H61A 5DKQA 2JPTA 2Y4QA 5HYDA 4YRUA 2KSPA 2L0PA 1AJ5A 2WC8A 5HKZA 2HQ8A 1DJWA 2AMIA 1XK4A 1B8CA 1YVLA 3GOFA 1CDNA 1OMRA 1JFJA 5CSJA 1IRJA 3PN7B 3TZ1A 1DF0B 1S5GZ 2A4JA 1YRTB 4I5KA 2I94A 2LCPA 1JBAA 2FJUB 2MAZA 1B1GA 4D1EA 1QXPA 2KFGA 2Q91A 2NCPA 3EVVA 2Y1MA 2M97A 1BT6A 1ALVA 2AAOA 1BJFA 5KTYA 1OMVA 3H4SE 3JTDC 1GGZA 1QVIY 4AQIA 5FYXA 3SG5A 4DIRA 1S6IA 1F4QA 1SR6B 5D7FA 3ZWHA 1QATA 1IH0A 1DVIA 2OS8B 2Y5IA 1NIWA 4A4CA 2KAXA 1SCMC 2BCAA 5CSFA 4CIDA 1H4BA 1S6CA 3O2PA 2KAVA 1L7ZA 5TNCA 3BOWA 1V1GA 1C7WA 1IWQA 2LMUA 1M31A 4PHMA 2FCDA 3AKAA 3NSKA 1CDMA 2MBXA 4E68A 2VRGA 1OZOA 2ZKMX 1KWOB 1R2UA 3WNXB 1FF1A 5BPJA 1EJ3A 1YUTA 1U5IA 1OSAA 2KDHA 2QPTA 2K7OA 2SCPA 3I5GC 4GUKA 1SW8A 4MRYA 1A4PA 1Y1AA 1PK0D 1BODA 1D1OA 4PCWA 3MSEB 2M29A 1F8HA 3DVKA 1DJYA 4I5JA 2JTTA 1LXFC 4M2OA 3WHUB 2LMVA 1HQVA 2M49B 3VRQA 1LINA 1F71A 1MUXA 2O60A 1K8UA 2JXLA 1JC2A 4NQGA 5AANA 2KFHA 1TOPA 2LP2A 4ZCVA 1SK6D 1KFXS 1S26D 2BCBA 4UPGA 1KK8C 1SNLA 1OMDA 1RECA 1VRKA 4GAOA 2JNXA 2ZFDA 1TNPA 3IQQA 5ER5A 1QTXA 2EC6B 2JT0A 4NDCA 2JZIA 4ORBB 3FWCA 3D0YB 1FBVA 1SBJA 2BKHB 4OVNF 3JTDB 4USLA 1W7IB 4WQ2A 3O4YA 3F45A 3TDIA 4AQJA 2BE4A 4I5NB 1K9PA 4GGNA 1HT9A 3BOWB 1DJXA 3PM8A 1NCXA 1SRAA 2NXQA 4DCKA 2RGIA 3K21A 3LLEA 1KQMC 4OV2A 3RM1A 2V53A 3OHMB 4MVFA 4N5XA 1SCMB 4ZCUA 5D69A 4CLNA 1F54A 1RFJA 1JF0A 4PALA 3BXKA 1U5IB 2KI4C 1JUOA 2KYFA 3BUMB 1XFZO 5F6TA 1MQ1A 4M2QA 3BUXB 1M39A 1CB1A 1SKTA 1WLZA 4C0KA 1NWDA 3BQ3A 3CZTX 1V1FA 1K96A 3DF0B 1TCFA 1TRFA 3I5GB 1AP4A 1GQMA 1CDLA 2M1UA 1XFYO 2KGBC 3EKJA 3KHEA 1FI5A 4BY5A 2EGDA 1PALA 1KSMA 2NZ0A 4DUQA 4L9MA 1QS7A 1A03A 2I7AA 5I8NA 3NSOA 2KYCA 2JRFA 3PALA 1N0YA 1A2XA 1PULA 1YTZC 1XYDA 2MRDA 1CM1A 5HLOA 1FI6A 4DS7A 3BYAA 2F8PA 1TNQA 3I5IC 2ZRTA 3EVUA 4PHNA 1KK8B 2AUCA 1OOJA 1TNWA 4NDBA 2MLFC 2MHHA 3SG6A 2JXCA 1DTLA 3VRPA 1B8RA 1PVAA 1LA3A 1NX2A 2K7BA 5J3XA 1Y1XA 5PALA 4GNKB 2LLTA 1NP8A 1H8BA 2EHBA 1WRKA 3OX5A 3AAJA 2KQ6A 2LAPA 2PRUA 4HRHA 2K8MB 1WLMA 2ZN8A 3IQOA 4MLWA 3TUYC 2OPOA 5DKNA 1NSHA 1B9AA 1UP5A 4ETOA 2E30A 2L50A 2CCMA 2FOTA 2KI4B 3TS5C 2KFFA 2KNEA 1CLLA 4FQOA 1BMOA 1NCYA 5ER4X 1QX5B 2K7CA 3TDZA 3RLZA 2GGZA 1BU3A 3FIAA 1PSBA 1RTP1 3LK1A
chains in the Genus database with same CATH superfamily
2L51A 1DMOA 3BUWB 1MR8A 1QASA 4YGDB 5GQQC 3R1VA 3HCMA 2HPSA 1KK7Z 1BG1A 1XO5A 1K2HA 3N7HA 1EXRA 3L4AA 2BECA 1CMGA 1NX1A 2F33A 4IL1A 4MBEA 3E3RA 4P5OE 5DICA 3SG7A 1XFVO 3SG2A 4R1EA 2LHIA 3CGAA 1ODBA 1L2OC 1S36A 1UUSA 2Y1NA 3BFHA 4QJ3B 2F2OA 4DRWA 1NX0A 3S0GA 3NXAA 4PE7A 1Z4HA 1CNPA 1S5GY 1Q80A 3BUNB 3SIBA 4A4BA 2JWWA 4GBAA 3IF7A 3OB1B 1IGVA 4HREE 1MXLC 2LLUA 4HRGA 2L2EA 2P6BB 1UHHA 2JC2A 4OKHA 4ORAB 1OOFA 2HETA 1F55A 2LVKA 1K90D 1DT7B 1J7OA 2M7NA 1AHRA 3D73A 3A4UB 3PSRA 1XFUO 3R1OA 1DGUA 1YUUA 4MZJA 1UHKA 1T14A 1YVHA 2JOJA 2LP3A 2LM5A 1N65A 3CS1A 1ZOTB 1OOGA 2BKIB 1WDCC 3EK7A 2GGMA 3TUYB 3B86A 1IQ3A 2TN4A 2CNPA 1JF2A 2IS9A 2LANA 1DELA 3FWBA 1J7QA 2LHLA 2JPOA 3SJSA 1SPYA 2BE6A 3BFBA 1WRLA 3NHIA 1WRZA 1YRUB 1QLSA 4OR9B 1YX8A 2KAYA 2LVIA 1DJGA 2M1KB 1K93D 1IJ6A 2L2CA 3ICBA 3PJIA 4U8DA 3TS5B 1B7TZ 2WCLA 5AXIA 1KK7Y 2KI6D 3SS5A 2P70A 1DJIA 4YGCB 1ZFSA 1J1DA 1MXEA 1LVCD 1ZUZA 2F2PA 3CDNA 3LCPC 1CLBA 3CR2A 5B8IB 3OBVA 1DJZA 2LC5A 2JT8A 2LMTA 1QIWA 2CBLA 1BOCA 3O6BA 1IG5A 2MA2A 5HLVA 3OP0A 3Q8IA 3AAKA 2MLEC 1JFKA 2BBMA 2K61A 1XFXO 1KFUL 2WCMA 4CPVA 4QJ5B 4F0ZB 1EG3A 1WY9A 4MEWA 1J55A 1X02A 1KCYA 1M46A 3DD4A 4MRXA 2LLSA 2QACA 1OZSA 3KPXA 1L2OB 3VROA 2G9BA 2LE9B 1DEKA 2WOSA 5AERA 4GFTA 1SMGA 4PE4A 1MHOA 3CR4X 3SG4A 4PT1A 1A29A 4MZKA 2L98A 1W7JB 1G33A 2WCFA 1IKUA 1GGWA 1QJTA 2M7LA 1QLKA 3I5HC 4YI8A 1QX2A 1K95A 2KQYA 1CM4A 4BY4A 3C1VA 5I2OA 1RWYA 5G08A 2ZNDA 1CTRA 1BR4B 5JOLA 1NYAA 2I18A 3PLFB 1IJ5A 4INWA 2KBIA 1CFDA 4PHJA 1QV1A 1N2DA 1UWOA 2F3YA 2K0JA 2PVBA 2R2IA 3WHTB 1BLQA 2F3ZA 3B88A 3DVJA 1UURA 4CFRA 1S1EA 4P2YB 1JWDA 1XFWO 1R6PA 4N1GA 1ZACA 1B7TY 3L4LA 3S0AA 1M63B 4WRIA 2WCBA 5HKWA 1J7PA 2B1UA 1CFFA 1XA5A 3VGOA 5AFPA 1QWVA 4NDDA 3EK8A 1IIOA 1IQ5A 2ZN9A 2L5YA 1KQMB 4I5LB 1Z2CB 1Y1UA 5KU1A 2NLNA 1ALWA 4GPLB 1EL4A 3AKBA 1M45A 2WORA 2WCEA 2KGRA 2KI6C 4PHKA 2BL0C 4JQ0D 1RK9A 3EK4A 3D10A 4MN0A 1PVBA 2BCXA 2M8UA 3UNWA 2GTEA 1TN4A 2SASA 3TDUA 4C0JA 2EC6C 1A75A 4OZDA 1B47A 2I2RE 1NX3A 4WQ3A 1FPWA 1NPQA 2QEVA 2PASA 1NCZA 2ZRSA 4JKTA 3IVTA 4YGEB 1YR5A 2E6WA 1RROA 2HF5A 4XJKA 2K7DA 3CABA 3CR5X 1P28A 3LL8B 3K1EA 3B6XA 4FQTA 3GK1A 5I2LA 5AEQA 1E8AA 4YGBB 1OOHA 4GGFC 2PMYA 3GK2A 2MJWB 1Y0VH 3D0YA 1CKKA 1DQEA 3NSIA 5EL2A 1G8IA 1SL9A 3D77A 3VRRA 1CDPA 1GJYA 3LK0A 1YURA 1BF5A 1SYMA 3KO0A 1F4OA 3KF9A 1EH2A 1F70A 2CT9A 1AUIB 1S6JA 3CZ0A 4TNCA 4PE1A 5DKRA 3UO9A 1CMFA 3L47A 1DJHA 3ZNIA 3KEVA 2CXJA 4GGFA 4MZLA 1UHJA 3FE6A 2K2FA 3EVRA 3I5HB 1J7RA 2CTNA 4ICBA 3S0DA 5JJGA 1AJ4A 3DXLA 2L5XB 3I5IB 1TIZA 2G2BA 3TUYC 1C07A 1EG4A 5CSNA 5HKYA 1KSOA 3JVTC 1GM0A 2BBNA 2M0RA 3GK4X 3SG3A 5KSZA 2M3WA 3WXAA 1K9KA 4Q04A 4YI9A 4MSPA 2O5GA 1QV0A 2Q4UA 5FI6A 2ERBA 4YBHB 2PALA 3PATA 4QJ4B 2JTZA 1CFPA 1K9UA 1XFRA 3VRNA 3DF0A 1KFUS 2COLB 2QEHA 3DVEA 3M0WA 3RZSA 1SCVA 1TTXA 2KLDA 2LVVA 2OTGC 3I5FC 4FTGA 4ORCB 3SIAA 1PSRA 1A75B 3NSLA 3OB2B 1TCOB 3S0FA 2DOQA 1OE9B 1PRWA 4XYNA 1W9ZA 3CYZA 5CPVA 4XJKB 3BUOB 1B4CA 2BL0B 1AVSA 2WNDA 2JQ6A 3CWGA 3DY9A 1DGVA 2L4HA 3QRXA 1JSAA 3PM2A 1QX7A 2LVJA 2L4IA 3PN7C 1KQVA 2JT3A 3DVMA 1NUBA 2LV7A 1BR1B 1UHIA 5I2QA 2JULA 4IJ7A 4PDZA 5CSIA 3FS7A 1YX7A 1K94A 1SY9A 2M9GA 1CLMA 3DYEA 1FW4A 4OCIA 5HL1A 1DF0A 2JNFA 1MWNA 1C7VA 1SR6C 4JWQA 3R1PA 2LNKA 1AK8A 2OS8C 1J1EA 1S3PA 1LKJA 3O4XA 1KFXL 1TNXA 3EKHA 3A8RA 1B8LA 1SL8A 4M2PA 5FI2A 1QIVA 4YGAA 4AOMA 2LUXA 3CTNA 1QVIZ 1UHNA 2WC5A 5D3OA 3SS4A 1Y6WA 5K89A 4HSZA 4PE0A 1SL7A 2FCEA 2GV5A 3QMEA 1CFCA 2H2KA 4C0LA 2HQWA 2PSRA 1LA0A 1XVJA 3CLNA 3HX4A 3JVTB 3O78A 2ISDA 2QDIA 1KWOC 2WCJA 2JU0A 4CFQA 1RJVA 1TUJA 2ZNEA 3OX6A 2H61C 3B7AA 2D8NA 1ZMZA 2KBMA 3PFVA 1G4YR 2LUCA 4N1FA 2KHNA 2KOTA 3FE8A 1WDCB 2H8VA 5IBWA 1XK4C 2NCOA 1YUSA 4JPZB 1MF8B 2OTGB 3I5FB 1OQPA 2K2AA 2H61A 5DKQA 2JPTA 2Y4QA 5HYDA 4F7FA 1C3ZA 3BFAA 4YRUA 2KSPA 2L0PA 1AJ5A 2WC8A 5HKZA 2HQ8A 1DJWA 2AMIA 2WC6A 1XK4A 1B8CA 1YVLA 3GOFA 1CDNA 1OMRA 1JFJA 5CSJA 1IRJA 3PN7B 3TZ1A 1DF0B 1S5GZ 2A4JA 1YRTB 4I5KA 2I94A 2P71A 3D78A 2LCPA 1JBAA 2FJUB 2MAZA 3VB1A 1B1GA 4D1EA 1QXPA 3D76A 2KFGA 2Q91A 2NCPA 3EVVA 2Y1MA 2M97A 3CZ2A 1BT6A 1ALVA 2AAOA 1BJFA 5KTYA 1OMVA 3H4SE 3JTDC 1GGZA 1QVIY 3B87A 4JD9A 5FYXA 3SG5A 4AQIA 1S6IA 2BAPA 4DIRA 1F4QA 1SR6B 1LS8A 1DC1A 5D7FA 3ZWHA 1QATA 1IH0A 1DVIA 2OS8B 2Y5IA 1NIWA 4A4CA 2KAXA 1SCMC 1ORGA 3S0EA 2BCAA 2QEOA 5CSFA 4CIDA 1H4BA 1S6CA 3O2PA 2KAVA 1L7ZA 5TNCA 3BOWA 1V1GA 1C7WA 2PYQA 1C3YA 1IWQA 2LMUA 1M31A 4PHMA 2FCDA 3AKAA 3NSKA 1CDMA 2MBXA 4E68A 5I94A 2YGUA 2VRGA 3EG5B 1OZOA 2ZKMX 1KWOB 1R2UA 3WNXB 1TUZA 2FJYA 1FF1A 5BPJA 1EJ3A 1YUTA 1U5IA 1OSAA 2KDHA 2QPTA 2K7OA 2SCPA 3I5GC 1SSEB 4GUKA 1SW8A 4MRYA 1A4PA 4KYNA 1TWOA 1Y1AA 1PK0D 1BODA 1D1OA 4PCWA 3MSEB 2M29A 3DZTA 1F8HA 3DVKA 1DJYA 2KLEA 4I5JA 2JTTA 1LXFC 4M2OA 3WHUB 2LMVA 1HQVA 2WCHA 2M49B 3VRQA 1LINA 1F71A 1MUXA 1OW4A 1K8UA 2JXLA 2O60A 1JC2A 4NQGA 5AANA 2KFHA 1TOPA 2LP2A 4ZCVA 1SK6D 1KFXS 1S26D 2BCBA 4UPGA 1KK8C 1SNLA 1OMDA 1RECA 1VRKA 4GAOA 2JNXA 2ZFDA 1TNPA 3IQQA 5ER5A 1QTXA 2EC6B 2JT0A 2KPHA 3OGNA 2JZIA 4NDCA 4ORBB 3FWCA 3S0BA 3D0YB 1FBVA 1SBJA 2BKHB 4OVNF 3JTDB 4USLA 1W7IB 4WQ2A 3O4YA 3F45A 3TDIA 4AQJA 2BE4A 4I5NB 1K9PA 4GGNA 1HT9A 3BOWB 1DJXA 3PM8A 1NCXA 1SRAA 2NXQA 4DCKA 2RGIA 3K21A 3NGVA 3LLEA 1KQMC 4OV2A 3RM1A 2V53A 3OHMB 4MVFA 4N5XA 1SCMB 4ZCUA 5D69A 4CLNA 1F54A 1RFJA 1JF0A 4PALA 3BXKA 1U5IB 2KI4C 1JUOA 2KYFA 3BUMB 1XFZO 5F6TA 1MQ1A 4M2QA 3BUXB 1M39A 1CB1A 1SKTA 1WLZA 4C0KA 1NWDA 3BQ3A 3CZTX 1V1FA 1K96A 3DF0B 1TCFA 1TRFA 3I5GB 1AP4A 1GQMA 1CDLA 2M1UA 1XFYO 2KGBC 3EKJA 3KHEA 3NHTA 4BY5A 2EGDA 1FI5A 1PALA 1KSMA 2NZ0A 4DUQA 4L9MA 1QS7A 1A03A 2I7AA 5I8NA 3NSOA 2KYCA 2JRFA 3PALA 1N0YA 1A2XA 1PULA 1YTZC 1XYDA 2QEBA 2MRDA 1CM1A 5HLOA 1FI6A 4DS7A 3BYAA 2F8PA 1TNQA 3I5IC 2ZRTA 3EVUA 4PHNA 3D75A 1KK8B 2AUCA 3V2LA 1OOJA 1TNWA 4NDBA 2MLFC 2MHHA 2PQLA 1OOIX 3CZ1A 3SG6A 2JXCA 1DTLA 3SS3A 5FI7A 3VRPA 1B8RA 1PVAA 1LA3A 1NX2A 2K7BA 5J3XA 1Y1XA 2K60A 3FE9A 5PALA 4GNKB 2LLTA 1NP8A 1H8BA 2EHBA 1WRKA 3OX5A 3AAJA 2KQ6A 2LAPA 2PRUA 4HRHA 2K8MB 1WLMA 2ZN8A 3IQOA 4MLWA 3R72A 2OPOA 5DKNA 1NSHA 1B9AA 1UP5A 2BNXA 4ETOA 2E30A 2L50A 2CCMA 2FOTA 2KI4B 3TS5C 2KFFA 2KNEA 1CLLA 4FQOA 1BMOA 1NCYA 5ER4X 1QX5B 2K7CA 2WCKA 3TDZA 3RLZA 3BJHA 2GGZA 1BU3A 3FIAA 1PSBA 4INXA 1RTP1 3D74A 3LK1A
chains in the Genus database with same CATH topology
2L51A 1DMOA 3BUWB 1MR8A 1QASA 4YGDB 5GQQC 3HCMA 2HPSA 1KK7Z 1BG1A 1XO5A 1K2HA 1EXRA 2BECA 1CMGA 1NX1A 2F33A 4IL1A 4MBEA 3E3RA 4P5OE 3SG7A 1XFVO 3SG2A 4R1EA 2LHIA 3CGAA 1ODBA 1L2OC 1S36A 1UUSA 2Y1NA 4QJ3B 2F2OA 4DRWA 1NX0A 3NXAA 4PE7A 1CNPA 1S5GY 1Q80A 3BUNB 3SIBA 4A4BA 2JWWA 4GBAA 3IF7A 3OB1B 1IGVA 4HREE 1MXLC 2LLUA 4HRGA 2L2EA 2P6BB 1UHHA 2JC2A 4OKHA 4ORAB 1F55A 2HETA 2LVKA 1K90D 1DT7B 1J7OA 2M7NA 1AHRA 3A4UB 3PSRA 1XFUO 1DGUA 1YUUA 4MZJA 1UHKA 2JOJA 1YVHA 2LP3A 2LM5A 1N65A 3CS1A 1ZOTB 2BKIB 1WDCC 3EK7A 2GGMA 3TUYB 1IQ3A 2TN4A 2CNPA 1JF2A 2IS9A 2LANA 3FWBA 1J7QA 2LHLA 3SJSA 1SPYA 2BE6A 1WRLA 1WRZA 1YRUB 1QLSA 4OR9B 1YX8A 2KAYA 2LVIA 1DJGA 2M1KB 1K93D 1IJ6A 3ICBA 4U8DA 3TS5B 1B7TZ 5AXIA 1KK7Y 2KI6D 1DJIA 4YGCB 1ZFSA 1J1DA 1MXEA 1LVCD 1ZUZA 2F2PA 3LCPC 1CLBA 3CR2A 5B8IB 1DJZA 2LC5A 2JT8A 2LMTA 1QIWA 2CBLA 1BOCA 3O6BA 1IG5A 2MA2A 5HLVA 3OP0A 3AAKA 2MLEC 1JFKA 2BBMA 2K61A 1KFUL 1XFXO 4CPVA 4QJ5B 4F0ZB 1EG3A 1WY9A 4MEWA 1J55A 1X02A 1KCYA 1M46A 3DD4A 4MRXA 2LLSA 2QACA 1OZSA 3KPXA 1L2OB 3VROA 2G9BA 2LE9B 2WOSA 5AERA 4GFTA 1SMGA 4PE4A 1MHOA 3CR4X 3SG4A 1A29A 4MZKA 2L98A 1W7JB 1G33A 2WCFA 1IKUA 1GGWA 1QJTA 2M7LA 1QLKA 3I5HC 4YI8A 1QX2A 1K95A 2KQYA 1CM4A 4BY4A 3C1VA 5I2OA 1RWYA 5G08A 2ZNDA 1CTRA 1BR4B 5JOLA 1NYAA 2I18A 3PLFB 1IJ5A 2KBIA 1CFDA 4PHJA 1QV1A 1N2DA 1UWOA 2F3YA 2K0JA 2PVBA 2R2IA 3WHTB 1BLQA 2F3ZA 3DVJA 1UURA 4CFRA 1S1EA 4P2YB 1JWDA 1XFWO 1R6PA 4N1GA 1ZACA 1B7TY 1M63B 4WRIA 2WCBA 5HKWA 1J7PA 2B1UA 1CFFA 1XA5A 3VGOA 5AFPA 4NDDA 3EK8A 1IQ5A 2ZN9A 1KQMB 4I5LB 1Y1UA 5KU1A 2NLNA 1ALWA 4GPLB 1EL4A 3AKBA 1M45A 2WORA 2WCEA 2KGRA 2KI6C 4PHKA 2BL0C 4JQ0D 1RK9A 3EK4A 3D10A 4MN0A 1PVBA 2BCXA 2M8UA 1TN4A 2SASA 3TDUA 4C0JA 2EC6C 1A75A 1B47A 2I2RE 1NX3A 4WQ3A 1FPWA 1NPQA 2PASA 1NCZA 2ZRSA 4YGEB 1YR5A 2E6WA 1RROA 2HF5A 4XJKA 2K7DA 3CR5X 3LL8B 3GK1A 5I2LA 5AEQA 1E8AA 4YGBB 4GGFC 2PMYA 3GK2A 2MJWB 1Y0VH 3D0YA 1CKKA 3NSIA 1G8IA 1SL9A 3VRRA 1CDPA 1GJYA 3LK0A 1YURA 1BF5A 1SYMA 3KO0A 1F4OA 3KF9A 1EH2A 1F70A 2CT9A 1AUIB 1S6JA 4TNCA 1CMFA 4PE1A 5DKRA 1DJHA 3ZNIA 3KEVA 2CXJA 4GGFA 4MZLA 1UHJA 3I5HB 2K2FA 3EVRA 1J7RA 2CTNA 4ICBA 5JJGA 1AJ4A 2L5XB 3I5IB 1TIZA 2G2BA 1C07A 1EG4A 5CSNA 5HKYA 1KSOA 3JVTC 2BBNA 2M0RA 3GK4X 3SG3A 5KSZA 2M3WA 3WXAA 1K9KA 4Q04A 4YI9A 4MSPA 2O5GA 1QV0A 2Q4UA 4YBHB 2PALA 3PATA 4QJ4B 2JTZA 1CFPA 1K9UA 3VRNA 3DF0A 1KFUS 2COLB 3DVEA 3M0WA 1SCVA 1TTXA 2LVVA 2OTGC 3I5FC 4FTGA 4ORCB 3SIAA 1PSRA 1A75B 3NSLA 3OB2B 1TCOB 2DOQA 1OE9B 1PRWA 4XYNA 5CPVA 4XJKB 3BUOB 1B4CA 2BL0B 1AVSA 2WNDA 2JQ6A 3CWGA 1DGVA 2L4HA 3QRXA 1JSAA 1QX7A 2LVJA 2L4IA 3PN7C 1KQVA 2JT3A 3DVMA 1NUBA 2LV7A 1BR1B 1UHIA 5I2QA 2JULA 4PDZA 5CSIA 3FS7A 1YX7A 1K94A 1SY9A 2M9GA 1CLMA 1FW4A 4OCIA 1C7VA 1DF0A 2JNFA 1MWNA 1SR6C 4JWQA 2LNKA 1AK8A 2OS8C 1J1EA 1S3PA 1LKJA 1KFXL 1TNXA 3EKHA 3A8RA 1B8LA 1SL8A 4M2PA 1QIVA 4YGAA 4AOMA 2LUXA 3CTNA 1QVIZ 1UHNA 5K89A 1Y6WA 4HSZA 4PE0A 1SL7A 2FCEA 2GV5A 1CFCA 2H2KA 4C0LA 2HQWA 2PSRA 1LA0A 1XVJA 3CLNA 3HX4A 3JVTB 3O78A 2ISDA 1KWOC 2JU0A 4CFQA 1RJVA 3OX6A 2ZNEA 2H61C 2D8NA 1ZMZA 2KBMA 3PFVA 1G4YR 2LUCA 4N1FA 2KHNA 2KOTA 1WDCB 5IBWA 1XK4C 2NCOA 1YUSA 4JPZB 1MF8B 2OTGB 3I5FB 1OQPA 2K2AA 2H61A 5DKQA 2JPTA 2Y4QA 5HYDA 4YRUA 2KSPA 2L0PA 1AJ5A 2WC8A 5HKZA 2HQ8A 1DJWA 2AMIA 1XK4A 1B8CA 1YVLA 3GOFA 1CDNA 1OMRA 1JFJA 5CSJA 1IRJA 3PN7B 3TZ1A 1DF0B 1S5GZ 2A4JA 1YRTB 4I5KA 2I94A 2LCPA 1JBAA 2FJUB 2MAZA 1B1GA 4D1EA 1QXPA 2KFGA 2Q91A 2NCPA 3EVVA 2Y1MA 2M97A 1BT6A 1ALVA 2AAOA 1BJFA 5KTYA 1OMVA 3H4SE 3JTDC 1GGZA 1QVIY 4AQIA 5FYXA 3SG5A 4DIRA 1S6IA 1F4QA 1SR6B 5D7FA 3ZWHA 1QATA 1IH0A 1DVIA 2OS8B 2Y5IA 1NIWA 4A4CA 2KAXA 1SCMC 2BCAA 5CSFA 4CIDA 1H4BA 1S6CA 3O2PA 2KAVA 1L7ZA 5TNCA 3BOWA 1V1GA 1C7WA 1IWQA 2LMUA 1M31A 4PHMA 2FCDA 3AKAA 3NSKA 1CDMA 2MBXA 4E68A 2VRGA 1OZOA 2ZKMX 1KWOB 1R2UA 3WNXB 1FF1A 5BPJA 1EJ3A 1YUTA 1U5IA 1OSAA 2KDHA 2QPTA 2K7OA 2SCPA 3I5GC 4GUKA 1SW8A 4MRYA 1A4PA 1Y1AA 1PK0D 1BODA 1D1OA 4PCWA 3MSEB 2M29A 1F8HA 3DVKA 1DJYA 4I5JA 2JTTA 1LXFC 4M2OA 3WHUB 2LMVA 1HQVA 2M49B 3VRQA 1LINA 1F71A 1MUXA 2O60A 1K8UA 2JXLA 1JC2A 4NQGA 5AANA 2KFHA 1TOPA 2LP2A 4ZCVA 1SK6D 1KFXS 1S26D 2BCBA 4UPGA 1KK8C 1SNLA 1OMDA 1RECA 1VRKA 4GAOA 2JNXA 2ZFDA 1TNPA 3IQQA 5ER5A 1QTXA 2EC6B 2JT0A 4NDCA 2JZIA 4ORBB 3FWCA 3D0YB 1FBVA 1SBJA 2BKHB 4OVNF 3JTDB 4USLA 1W7IB 4WQ2A 3O4YA 3F45A 3TDIA 4AQJA 2BE4A 4I5NB 1K9PA 4GGNA 1HT9A 3BOWB 1DJXA 3PM8A 1NCXA 1SRAA 2NXQA 4DCKA 2RGIA 3K21A 3LLEA 1KQMC 4OV2A 3RM1A 2V53A 3OHMB 4MVFA 4N5XA 1SCMB 4ZCUA 5D69A 4CLNA 1F54A 1RFJA 1JF0A 4PALA 3BXKA 1U5IB 2KI4C 1JUOA 2KYFA 3BUMB 1XFZO 5F6TA 1MQ1A 4M2QA 3BUXB 1M39A 1CB1A 1SKTA 1WLZA 4C0KA 1NWDA 3BQ3A 3CZTX 1V1FA 1K96A 3DF0B 1TCFA 1TRFA 3I5GB 1AP4A 1GQMA 1CDLA 2M1UA 1XFYO 2KGBC 3EKJA 3KHEA 1FI5A 4BY5A 2EGDA 1PALA 1KSMA 2NZ0A 4DUQA 4L9MA 1QS7A 1A03A 2I7AA 5I8NA 3NSOA 2KYCA 2JRFA 3PALA 1N0YA 1A2XA 1PULA 1YTZC 1XYDA 2MRDA 1CM1A 5HLOA 1FI6A 4DS7A 3BYAA 2F8PA 1TNQA 3I5IC 2ZRTA 3EVUA 4PHNA 1KK8B 2AUCA 1OOJA 1TNWA 4NDBA 2MLFC 2MHHA 3SG6A 2JXCA 1DTLA 3VRPA 1B8RA 1PVAA 1LA3A 1NX2A 2K7BA 5J3XA 1Y1XA 5PALA 4GNKB 2LLTA 1NP8A 1H8BA 2EHBA 1WRKA 3OX5A 3AAJA 2KQ6A 2LAPA 2PRUA 4HRHA 2K8MB 1WLMA 2ZN8A 3IQOA 4MLWA 3TUYC 2OPOA 5DKNA 1NSHA 1B9AA 1UP5A 4ETOA 2E30A 2L50A 2CCMA 2FOTA 2KI4B 3TS5C 2KFFA 2KNEA 1CLLA 4FQOA 1BMOA 1NCYA 5ER4X 1QX5B 2K7CA 3TDZA 3RLZA 2GGZA 1BU3A 3FIAA 1PSBA 1RTP1 3LK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L51 A;  1DMO A;  3BUW B;  1MR8 A;  1QAS A;  4YGD B;  5GQQ C;  3HCM A;  2HPS A;  1KK7 Z;  1BG1 A;  1XO5 A;  1K2H A;  1EXR A;  2BEC A;  1CMG A;  1NX1 A;  2F33 A;  4IL1 A;  4MBE A;  3E3R A;  4P5O E;  3SG7 A;  1XFV O;  3SG2 A;  4R1E A;  2LHI A;  3CGA A;  1ODB A;  1L2O C;  1S36 A;  1UUS A;  2Y1N A;  4QJ3 B;  2F2O A;  4DRW A;  1NX0 A;  3NXA A;  4PE7 A;  1CNP A;  1S5G Y;  1Q80 A;  3BUN B;  3SIB A;  4A4B A;  2JWW A;  4GBA A;  3IF7 A;  3OB1 B;  1IGV A;  4HRE E;  1MXL C;  2LLU A;  4HRG A;  2L2E A;  2P6B B;  1UHH A;  2JC2 A;  4OKH A;  4ORA B;  1F55 A;  2HET A;  2LVK A;  1K90 D;  1DT7 B;  1J7O A;  2M7N A;  1AHR A;  3A4U B;  3PSR A;  1XFU O;  1DGU A;  1YUU A;  4MZJ A;  1UHK A;  2JOJ A;  1YVH A;  2LP3 A;  2LM5 A;  1N65 A;  3CS1 A;  1ZOT B;  2BKI B;  1WDC C;  3EK7 A;  2GGM A;  3TUY B;  1IQ3 A;  2TN4 A;  2CNP A;  1JF2 A;  2IS9 A;  2LAN A;  3FWB A;  1J7Q A;  2LHL A;  3SJS A;  1SPY A;  2BE6 A;  1WRL A;  1WRZ A;  1YRU B;  1QLS A;  4OR9 B;  1YX8 A;  2KAY A;  2LVI A;  1DJG A;  2M1K B;  1K93 D;  1IJ6 A;  3ICB A;  4U8D A;  3TS5 B;  1B7T Z;  5AXI A;  1KK7 Y;  2KI6 D;  1DJI A;  4YGC B;  1ZFS A;  1J1D A;  1MXE A;  1LVC D;  1ZUZ A;  2F2P A;  3LCP C;  1CLB A;  3CR2 A;  5B8I B;  1DJZ A;  2LC5 A;  2JT8 A;  2LMT A;  1QIW A;  2CBL A;  1BOC A;  3O6B A;  1IG5 A;  2MA2 A;  5HLV A;  3OP0 A;  3AAK A;  2MLE C;  1JFK A;  2BBM A;  2K61 A;  1KFU L;  1XFX O;  4CPV A;  4QJ5 B;  4F0Z B;  1EG3 A;  1WY9 A;  4MEW A;  1J55 A;  1X02 A;  1KCY A;  1M46 A;  3DD4 A;  4MRX A;  2LLS A;  2QAC A;  1OZS A;  3KPX A;  1L2O B;  3VRO A;  2G9B A;  2LE9 B;  2WOS A;  5AER A;  4GFT A;  1SMG A;  4PE4 A;  1MHO A;  3CR4 X;  3SG4 A;  1A29 A;  4MZK A;  2L98 A;  1W7J B;  1G33 A;  2WCF A;  1IKU A;  1GGW A;  1QJT A;  2M7L A;  1QLK A;  3I5H C;  4YI8 A;  1QX2 A;  1K95 A;  2KQY A;  1CM4 A;  4BY4 A;  3C1V A;  5I2O A;  1RWY A;  5G08 A;  2ZND A;  1CTR A;  1BR4 B;  5JOL A;  1NYA A;  2I18 A;  3PLF B;  1IJ5 A;  2KBI A;  1CFD A;  4PHJ A;  1QV1 A;  1N2D A;  1UWO A;  2F3Y A;  2K0J A;  2PVB A;  2R2I A;  3WHT B;  1BLQ A;  2F3Z A;  3DVJ A;  1UUR A;  4CFR A;  1S1E A;  4P2Y B;  1JWD A;  1XFW O;  1R6P A;  4N1G A;  1ZAC A;  1B7T Y;  1M63 B;  4WRI A;  2WCB A;  5HKW A;  1J7P A;  2B1U A;  1CFF A;  1XA5 A;  3VGO A;  5AFP A;  4NDD A;  3EK8 A;  1IQ5 A;  2ZN9 A;  1KQM B;  4I5L B;  1Y1U A;  5KU1 A;  2NLN A;  1ALW A;  4GPL B;  1EL4 A;  3AKB A;  1M45 A;  2WOR A;  2WCE A;  2KGR A;  2KI6 C;  4PHK A;  2BL0 C;  4JQ0 D;  1RK9 A;  3EK4 A;  3D10 A;  4MN0 A;  1PVB A;  2BCX A;  2M8U A;  1TN4 A;  2SAS A;  3TDU A;  4C0J A;  2EC6 C;  1A75 A;  1B47 A;  2I2R E;  1NX3 A;  4WQ3 A;  1FPW A;  1NPQ A;  2PAS A;  1NCZ A;  2ZRS A;  4YGE B;  1YR5 A;  2E6W A;  1RRO A;  2HF5 A;  4XJK A;  2K7D A;  3CR5 X;  3LL8 B;  3GK1 A;  5I2L A;  5AEQ A;  1E8A A;  4YGB B;  4GGF C;  2PMY A;  3GK2 A;  2MJW B;  1Y0V H;  3D0Y A;  1CKK A;  3NSI A;  1G8I A;  1SL9 A;  3VRR A;  1CDP A;  1GJY A;  3LK0 A;  1YUR A;  1BF5 A;  1SYM A;  3KO0 A;  1F4O A;  3KF9 A;  1EH2 A;  1F70 A;  2CT9 A;  1AUI B;  1S6J A;  4TNC A;  1CMF A;  4PE1 A;  5DKR A;  1DJH A;  3ZNI A;  3KEV A;  2CXJ A;  4GGF A;  4MZL A;  1UHJ A;  3I5H B;  2K2F A;  3EVR A;  1J7R A;  2CTN A;  4ICB A;  5JJG A;  1AJ4 A;  2L5X B;  3I5I B;  1TIZ A;  2G2B A;  1C07 A;  1EG4 A;  5CSN A;  5HKY A;  1KSO A;  3JVT C;  2BBN A;  2M0R A;  3GK4 X;  3SG3 A;  5KSZ A;  2M3W A;  3WXA A;  1K9K A;  4Q04 A;  4YI9 A;  4MSP A;  2O5G A;  1QV0 A;  2Q4U A;  4YBH B;  2PAL A;  3PAT A;  4QJ4 B;  2JTZ A;  1CFP A;  1K9U A;  3VRN A;  3DF0 A;  1KFU S;  2COL B;  3DVE A;  3M0W A;  1SCV A;  1TTX A;  2LVV A;  2OTG C;  3I5F C;  4FTG A;  4ORC B;  3SIA A;  1PSR A;  1A75 B;  3NSL A;  3OB2 B;  1TCO B;  2DOQ A;  1OE9 B;  1PRW A;  4XYN A;  5CPV A;  4XJK B;  3BUO B;  1B4C A;  2BL0 B;  1AVS A;  2WND A;  2JQ6 A;  3CWG A;  1DGV A;  2L4H A;  3QRX A;  1JSA A;  1QX7 A;  2LVJ A;  2L4I A;  3PN7 C;  1KQV A;  2JT3 A;  3DVM A;  1NUB A;  2LV7 A;  1BR1 B;  1UHI A;  5I2Q A;  2JUL A;  4PDZ A;  5CSI A;  3FS7 A;  1YX7 A;  1K94 A;  1SY9 A;  2M9G A;  1CLM A;  1FW4 A;  4OCI A;  1C7V A;  1DF0 A;  2JNF A;  1MWN A;  1SR6 C;  4JWQ A;  2LNK A;  1AK8 A;  2OS8 C;  1J1E A;  1S3P A;  1LKJ A;  1KFX L;  1TNX A;  3EKH A;  3A8R A;  1B8L A;  1SL8 A;  4M2P A;  1QIV A;  4YGA A;  4AOM A;  2LUX A;  3CTN A;  1QVI Z;  1UHN A;  5K89 A;  1Y6W A;  4HSZ A;  4PE0 A;  1SL7 A;  2FCE A;  2GV5 A;  1CFC A;  2H2K A;  4C0L A;  2HQW A;  2PSR A;  1LA0 A;  1XVJ A;  3CLN A;  3HX4 A;  3JVT B;  3O78 A;  2ISD A;  1KWO C;  2JU0 A;  4CFQ A;  1RJV A;  3OX6 A;  2ZNE A;  2H61 C;  2D8N A;  1ZMZ A;  2KBM A;  3PFV A;  1G4Y R;  2LUC A;  4N1F A;  2KHN A;  2KOT A;  1WDC B;  5IBW A;  1XK4 C;  2NCO A;  1YUS A;  4JPZ B;  1MF8 B;  2OTG B;  3I5F B;  1OQP A;  2K2A A;  2H61 A;  5DKQ A;  2JPT A;  2Y4Q A;  5HYD A;  4YRU A;  2KSP A;  2L0P A;  1AJ5 A;  2WC8 A;  5HKZ A;  2HQ8 A;  1DJW A;  2AMI A;  1XK4 A;  1B8C A;  1YVL A;  3GOF A;  1CDN A;  1OMR A;  1JFJ A;  5CSJ A;  1IRJ A;  3PN7 B;  3TZ1 A;  1DF0 B;  1S5G Z;  2A4J A;  1YRT B;  4I5K A;  2I94 A;  2LCP A;  1JBA A;  2FJU B;  2MAZ A;  1B1G A;  4D1E A;  1QXP A;  2KFG A;  2Q91 A;  2NCP A;  3EVV A;  2Y1M A;  2M97 A;  1BT6 A;  1ALV A;  2AAO A;  1BJF A;  5KTY A;  1OMV A;  3H4S E;  3JTD C;  1GGZ A;  1QVI Y;  4AQI A;  5FYX A;  3SG5 A;  4DIR A;  1S6I A;  1F4Q A;  1SR6 B;  5D7F A;  3ZWH A;  1QAT A;  1IH0 A;  1DVI A;  2OS8 B;  2Y5I A;  1NIW A;  4A4C A;  2KAX A;  1SCM C;  2BCA A;  5CSF A;  4CID A;  1H4B A;  1S6C A;  3O2P A;  2KAV A;  1L7Z A;  5TNC A;  3BOW A;  1V1G A;  1C7W A;  1IWQ A;  2LMU A;  1M31 A;  4PHM A;  2FCD A;  3AKA A;  3NSK A;  1CDM A;  2MBX A;  4E68 A;  2VRG A;  1OZO A;  2ZKM X;  1KWO B;  1R2U A;  3WNX B;  1FF1 A;  5BPJ A;  1EJ3 A;  1YUT A;  1U5I A;  1OSA A;  2KDH A;  2QPT A;  2K7O A;  2SCP A;  3I5G C;  4GUK A;  1SW8 A;  4MRY A;  1A4P A;  1Y1A A;  1PK0 D;  1BOD A;  1D1O A;  4PCW A;  3MSE B;  2M29 A;  1F8H A;  3DVK A;  1DJY A;  4I5J A;  2JTT A;  1LXF C;  4M2O A;  3WHU B;  2LMV A;  1HQV A;  2M49 B;  3VRQ A;  1LIN A;  1F71 A;  1MUX A;  2O60 A;  1K8U A;  2JXL A;  1JC2 A;  4NQG A;  5AAN A;  2KFH A;  1TOP A;  2LP2 A;  4ZCV A;  1SK6 D;  1KFX S;  1S26 D;  2BCB A;  4UPG A;  1KK8 C;  1SNL A;  1OMD A;  1REC A;  1VRK A;  4GAO A;  2JNX A;  2ZFD A;  1TNP A;  3IQQ A;  5ER5 A;  1QTX A;  2EC6 B;  2JT0 A;  4NDC A;  2JZI A;  4ORB B;  3FWC A;  3D0Y B;  1FBV A;  1SBJ A;  2BKH B;  4OVN F;  3JTD B;  4USL A;  1W7I B;  4WQ2 A;  3O4Y A;  3F45 A;  3TDI A;  4AQJ A;  2BE4 A;  4I5N B;  1K9P A;  4GGN A;  1HT9 A;  3BOW B;  1DJX A;  3PM8 A;  1NCX A;  1SRA A;  2NXQ A;  4DCK A;  2RGI A;  3K21 A;  3LLE A;  1KQM C;  4OV2 A;  3RM1 A;  2V53 A;  3OHM B;  4MVF A;  4N5X A;  1SCM B;  4ZCU A;  5D69 A;  4CLN A;  1F54 A;  1RFJ A;  1JF0 A;  4PAL A;  3BXK A;  1U5I B;  2KI4 C;  1JUO A;  2KYF A;  3BUM B;  1XFZ O;  5F6T A;  1MQ1 A;  4M2Q A;  3BUX B;  1M39 A;  1CB1 A;  1SKT A;  1WLZ A;  4C0K A;  1NWD A;  3BQ3 A;  3CZT X;  1V1F A;  1K96 A;  3DF0 B;  1TCF A;  1TRF A;  3I5G B;  1AP4 A;  1GQM A;  1CDL A;  2M1U A;  1XFY O;  2KGB C;  3EKJ A;  3KHE A;  1FI5 A;  4BY5 A;  2EGD A;  1PAL A;  1KSM A;  2NZ0 A;  4DUQ A;  4L9M A;  1QS7 A;  1A03 A;  2I7A A;  5I8N A;  3NSO A;  2KYC A;  2JRF A;  3PAL A;  1N0Y A;  1A2X A;  1PUL A;  1YTZ C;  1XYD A;  2MRD A;  1CM1 A;  5HLO A;  1FI6 A;  4DS7 A;  3BYA A;  2F8P A;  1TNQ A;  3I5I C;  2ZRT A;  3EVU A;  4PHN A;  1KK8 B;  2AUC A;  1OOJ A;  1TNW A;  4NDB A;  2MLF C;  2MHH A;  3SG6 A;  2JXC A;  1DTL A;  3VRP A;  1B8R A;  1PVA A;  1LA3 A;  1NX2 A;  2K7B A;  5J3X A;  1Y1X A;  5PAL A;  4GNK B;  2LLT A;  1NP8 A;  1H8B A;  2EHB A;  1WRK A;  3OX5 A;  3AAJ A;  2KQ6 A;  2LAP A;  2PRU A;  4HRH A;  2K8M B;  1WLM A;  2ZN8 A;  3IQO A;  4MLW A;  3TUY C;  2OPO A;  5DKN A;  1NSH A;  1B9A A;  1UP5 A;  4ETO A;  2E30 A;  2L50 A;  2CCM A;  2FOT A;  2KI4 B;  3TS5 C;  2KFF A;  2KNE A;  1CLL A;  4FQO A;  1BMO A;  1NCY A;  5ER4 X;  1QX5 B;  2K7C A;  3TDZ A;  3RLZ A;  2GGZ A;  1BU3 A;  3FIA A;  1PSB A;  1RTP 1;  3LK1 A; 
#chains in the Genus database with same CATH topology
 2L51 A;  1DMO A;  3BUW B;  1MR8 A;  1QAS A;  4YGD B;  5GQQ C;  3R1V A;  3HCM A;  2HPS A;  1KK7 Z;  1BG1 A;  1XO5 A;  1K2H A;  3N7H A;  1EXR A;  3L4A A;  2BEC A;  1CMG A;  1NX1 A;  2F33 A;  4IL1 A;  4MBE A;  3E3R A;  4P5O E;  5DIC A;  3SG7 A;  1XFV O;  3SG2 A;  4R1E A;  2LHI A;  3CGA A;  1ODB A;  1L2O C;  1S36 A;  1UUS A;  2Y1N A;  3BFH A;  4QJ3 B;  2F2O A;  4DRW A;  1NX0 A;  3S0G A;  3NXA A;  4PE7 A;  1Z4H A;  1CNP A;  1S5G Y;  1Q80 A;  3BUN B;  3SIB A;  4A4B A;  2JWW A;  4GBA A;  3IF7 A;  3OB1 B;  1IGV A;  4HRE E;  1MXL C;  2LLU A;  4HRG A;  2L2E A;  2P6B B;  1UHH A;  2JC2 A;  4OKH A;  4ORA B;  1OOF A;  2HET A;  1F55 A;  2LVK A;  1K90 D;  1DT7 B;  1J7O A;  2M7N A;  1AHR A;  3D73 A;  3A4U B;  3PSR A;  1XFU O;  3R1O A;  1DGU A;  1YUU A;  4MZJ A;  1UHK A;  1T14 A;  1YVH A;  2JOJ A;  2LP3 A;  2LM5 A;  1N65 A;  3CS1 A;  1ZOT B;  1OOG A;  2BKI B;  1WDC C;  3EK7 A;  2GGM A;  3TUY B;  3B86 A;  1IQ3 A;  2TN4 A;  2CNP A;  1JF2 A;  2IS9 A;  2LAN A;  1DEL A;  3FWB A;  1J7Q A;  2LHL A;  2JPO A;  3SJS A;  1SPY A;  2BE6 A;  3BFB A;  1WRL A;  3NHI A;  1WRZ A;  1YRU B;  1QLS A;  4OR9 B;  1YX8 A;  2KAY A;  2LVI A;  1DJG A;  2M1K B;  1K93 D;  1IJ6 A;  2L2C A;  3ICB A;  3PJI A;  4U8D A;  3TS5 B;  1B7T Z;  2WCL A;  5AXI A;  1KK7 Y;  2KI6 D;  3SS5 A;  2P70 A;  1DJI A;  4YGC B;  1ZFS A;  1J1D A;  1MXE A;  1LVC D;  1ZUZ A;  2F2P A;  3CDN A;  3LCP C;  1CLB A;  3CR2 A;  5B8I B;  3OBV A;  1DJZ A;  2LC5 A;  2JT8 A;  2LMT A;  1QIW A;  2CBL A;  1BOC A;  3O6B A;  1IG5 A;  2MA2 A;  5HLV A;  3OP0 A;  3Q8I A;  3AAK A;  2MLE C;  1JFK A;  2BBM A;  2K61 A;  1XFX O;  1KFU L;  2WCM A;  4CPV A;  4QJ5 B;  4F0Z B;  1EG3 A;  1WY9 A;  4MEW A;  1J55 A;  1X02 A;  1KCY A;  1M46 A;  3DD4 A;  4MRX A;  2LLS A;  2QAC A;  1OZS A;  3KPX A;  1L2O B;  3VRO A;  2G9B A;  2LE9 B;  1DEK A;  2WOS A;  5AER A;  4GFT A;  1SMG A;  4PE4 A;  1MHO A;  3CR4 X;  3SG4 A;  4PT1 A;  1A29 A;  4MZK A;  2L98 A;  1W7J B;  1G33 A;  2WCF A;  1IKU A;  1GGW A;  1QJT A;  2M7L A;  1QLK A;  3I5H C;  4YI8 A;  1QX2 A;  1K95 A;  2KQY A;  1CM4 A;  4BY4 A;  3C1V A;  5I2O A;  1RWY A;  5G08 A;  2ZND A;  1CTR A;  1BR4 B;  5JOL A;  1NYA A;  2I18 A;  3PLF B;  1IJ5 A;  4INW A;  2KBI A;  1CFD A;  4PHJ A;  1QV1 A;  1N2D A;  1UWO A;  2F3Y A;  2K0J A;  2PVB A;  2R2I A;  3WHT B;  1BLQ A;  2F3Z A;  3B88 A;  3DVJ A;  1UUR A;  4CFR A;  1S1E A;  4P2Y B;  1JWD A;  1XFW O;  1R6P A;  4N1G A;  1ZAC A;  1B7T Y;  3L4L A;  3S0A A;  1M63 B;  4WRI A;  2WCB A;  5HKW A;  1J7P A;  2B1U A;  1CFF A;  1XA5 A;  3VGO A;  5AFP A;  1QWV A;  4NDD A;  3EK8 A;  1IIO A;  1IQ5 A;  2ZN9 A;  2L5Y A;  1KQM B;  4I5L B;  1Z2C B;  1Y1U A;  5KU1 A;  2NLN A;  1ALW A;  4GPL B;  1EL4 A;  3AKB A;  1M45 A;  2WOR A;  2WCE A;  2KGR A;  2KI6 C;  4PHK A;  2BL0 C;  4JQ0 D;  1RK9 A;  3EK4 A;  3D10 A;  4MN0 A;  1PVB A;  2BCX A;  2M8U A;  3UNW A;  2GTE A;  1TN4 A;  2SAS A;  3TDU A;  4C0J A;  2EC6 C;  1A75 A;  4OZD A;  1B47 A;  2I2R E;  1NX3 A;  4WQ3 A;  1FPW A;  1NPQ A;  2QEV A;  2PAS A;  1NCZ A;  2ZRS A;  4JKT A;  3IVT A;  4YGE B;  1YR5 A;  2E6W A;  1RRO A;  2HF5 A;  4XJK A;  2K7D A;  3CAB A;  3CR5 X;  1P28 A;  3LL8 B;  3K1E A;  3B6X A;  4FQT A;  3GK1 A;  5I2L A;  5AEQ A;  1E8A A;  4YGB B;  1OOH A;  4GGF C;  2PMY A;  3GK2 A;  2MJW B;  1Y0V H;  3D0Y A;  1CKK A;  1DQE A;  3NSI A;  5EL2 A;  1G8I A;  1SL9 A;  3D77 A;  3VRR A;  1CDP A;  1GJY A;  3LK0 A;  1YUR A;  1BF5 A;  1SYM A;  3KO0 A;  1F4O A;  3KF9 A;  1EH2 A;  1F70 A;  2CT9 A;  1AUI B;  1S6J A;  3CZ0 A;  4TNC A;  4PE1 A;  5DKR A;  3UO9 A;  1CMF A;  3L47 A;  1DJH A;  3ZNI A;  3KEV A;  2CXJ A;  4GGF A;  4MZL A;  1UHJ A;  3FE6 A;  2K2F A;  3EVR A;  3I5H B;  1J7R A;  2CTN A;  4ICB A;  3S0D A;  5JJG A;  1AJ4 A;  3DXL A;  2L5X B;  3I5I B;  1TIZ A;  2G2B A;  3TUY C;  1C07 A;  1EG4 A;  5CSN A;  5HKY A;  1KSO A;  3JVT C;  1GM0 A;  2BBN A;  2M0R A;  3GK4 X;  3SG3 A;  5KSZ A;  2M3W A;  3WXA A;  1K9K A;  4Q04 A;  4YI9 A;  4MSP A;  2O5G A;  1QV0 A;  2Q4U A;  5FI6 A;  2ERB A;  4YBH B;  2PAL A;  3PAT A;  4QJ4 B;  2JTZ A;  1CFP A;  1K9U A;  1XFR A;  3VRN A;  3DF0 A;  1KFU S;  2COL B;  2QEH A;  3DVE A;  3M0W A;  3RZS A;  1SCV A;  1TTX A;  2KLD A;  2LVV A;  2OTG C;  3I5F C;  4FTG A;  4ORC B;  3SIA A;  1PSR A;  1A75 B;  3NSL A;  3OB2 B;  1TCO B;  3S0F A;  2DOQ A;  1OE9 B;  1PRW A;  4XYN A;  1W9Z A;  3CYZ A;  5CPV A;  4XJK B;  3BUO B;  1B4C A;  2BL0 B;  1AVS A;  2WND A;  2JQ6 A;  3CWG A;  3DY9 A;  1DGV A;  2L4H A;  3QRX A;  1JSA A;  3PM2 A;  1QX7 A;  2LVJ A;  2L4I A;  3PN7 C;  1KQV A;  2JT3 A;  3DVM A;  1NUB A;  2LV7 A;  1BR1 B;  1UHI A;  5I2Q A;  2JUL A;  4IJ7 A;  4PDZ A;  5CSI A;  3FS7 A;  1YX7 A;  1K94 A;  1SY9 A;  2M9G A;  1CLM A;  3DYE A;  1FW4 A;  4OCI A;  5HL1 A;  1DF0 A;  2JNF A;  1MWN A;  1C7V A;  1SR6 C;  4JWQ A;  3R1P A;  2LNK A;  1AK8 A;  2OS8 C;  1J1E A;  1S3P A;  1LKJ A;  3O4X A;  1KFX L;  1TNX A;  3EKH A;  3A8R A;  1B8L A;  1SL8 A;  4M2P A;  5FI2 A;  1QIV A;  4YGA A;  4AOM A;  2LUX A;  3CTN A;  1QVI Z;  1UHN A;  2WC5 A;  5D3O A;  3SS4 A;  1Y6W A;  5K89 A;  4HSZ A;  4PE0 A;  1SL7 A;  2FCE A;  2GV5 A;  3QME A;  1CFC A;  2H2K A;  4C0L A;  2HQW A;  2PSR A;  1LA0 A;  1XVJ A;  3CLN A;  3HX4 A;  3JVT B;  3O78 A;  2ISD A;  2QDI A;  1KWO C;  2WCJ A;  2JU0 A;  4CFQ A;  1RJV A;  1TUJ A;  2ZNE A;  3OX6 A;  2H61 C;  3B7A A;  2D8N A;  1ZMZ A;  2KBM A;  3PFV A;  1G4Y R;  2LUC A;  4N1F A;  2KHN A;  2KOT A;  3FE8 A;  1WDC B;  2H8V A;  5IBW A;  1XK4 C;  2NCO A;  1YUS A;  4JPZ B;  1MF8 B;  2OTG B;  3I5F B;  1OQP A;  2K2A A;  2H61 A;  5DKQ A;  2JPT A;  2Y4Q A;  5HYD A;  4F7F A;  1C3Z A;  3BFA A;  4YRU A;  2KSP A;  2L0P A;  1AJ5 A;  2WC8 A;  5HKZ A;  2HQ8 A;  1DJW A;  2AMI A;  2WC6 A;  1XK4 A;  1B8C A;  1YVL A;  3GOF A;  1CDN A;  1OMR A;  1JFJ A;  5CSJ A;  1IRJ A;  3PN7 B;  3TZ1 A;  1DF0 B;  1S5G Z;  2A4J A;  1YRT B;  4I5K A;  2I94 A;  2P71 A;  3D78 A;  2LCP A;  1JBA A;  2FJU B;  2MAZ A;  3VB1 A;  1B1G A;  4D1E A;  1QXP A;  3D76 A;  2KFG A;  2Q91 A;  2NCP A;  3EVV A;  2Y1M A;  2M97 A;  3CZ2 A;  1BT6 A;  1ALV A;  2AAO A;  1BJF A;  5KTY A;  1OMV A;  3H4S E;  3JTD C;  1GGZ A;  1QVI Y;  3B87 A;  4JD9 A;  5FYX A;  3SG5 A;  4AQI A;  1S6I A;  2BAP A;  4DIR A;  1F4Q A;  1SR6 B;  1LS8 A;  1DC1 A;  5D7F A;  3ZWH A;  1QAT A;  1IH0 A;  1DVI A;  2OS8 B;  2Y5I A;  1NIW A;  4A4C A;  2KAX A;  1SCM C;  1ORG A;  3S0E A;  2BCA A;  2QEO A;  5CSF A;  4CID A;  1H4B A;  1S6C A;  3O2P A;  2KAV A;  1L7Z A;  5TNC A;  3BOW A;  1V1G A;  1C7W A;  2PYQ A;  1C3Y A;  1IWQ A;  2LMU A;  1M31 A;  4PHM A;  2FCD A;  3AKA A;  3NSK A;  1CDM A;  2MBX A;  4E68 A;  5I94 A;  2YGU A;  2VRG A;  3EG5 B;  1OZO A;  2ZKM X;  1KWO B;  1R2U A;  3WNX B;  1TUZ A;  2FJY A;  1FF1 A;  5BPJ A;  1EJ3 A;  1YUT A;  1U5I A;  1OSA A;  2KDH A;  2QPT A;  2K7O A;  2SCP A;  3I5G C;  1SSE B;  4GUK A;  1SW8 A;  4MRY A;  1A4P A;  4KYN A;  1TWO A;  1Y1A A;  1PK0 D;  1BOD A;  1D1O A;  4PCW A;  3MSE B;  2M29 A;  3DZT A;  1F8H A;  3DVK A;  1DJY A;  2KLE A;  4I5J A;  2JTT A;  1LXF C;  4M2O A;  3WHU B;  2LMV A;  1HQV A;  2WCH A;  2M49 B;  3VRQ A;  1LIN A;  1F71 A;  1MUX A;  1OW4 A;  1K8U A;  2JXL A;  2O60 A;  1JC2 A;  4NQG A;  5AAN A;  2KFH A;  1TOP A;  2LP2 A;  4ZCV A;  1SK6 D;  1KFX S;  1S26 D;  2BCB A;  4UPG A;  1KK8 C;  1SNL A;  1OMD A;  1REC A;  1VRK A;  4GAO A;  2JNX A;  2ZFD A;  1TNP A;  3IQQ A;  5ER5 A;  1QTX A;  2EC6 B;  2JT0 A;  2KPH A;  3OGN A;  2JZI A;  4NDC A;  4ORB B;  3FWC A;  3S0B A;  3D0Y B;  1FBV A;  1SBJ A;  2BKH B;  4OVN F;  3JTD B;  4USL A;  1W7I B;  4WQ2 A;  3O4Y A;  3F45 A;  3TDI A;  4AQJ A;  2BE4 A;  4I5N B;  1K9P A;  4GGN A;  1HT9 A;  3BOW B;  1DJX A;  3PM8 A;  1NCX A;  1SRA A;  2NXQ A;  4DCK A;  2RGI A;  3K21 A;  3NGV A;  3LLE A;  1KQM C;  4OV2 A;  3RM1 A;  2V53 A;  3OHM B;  4MVF A;  4N5X A;  1SCM B;  4ZCU A;  5D69 A;  4CLN A;  1F54 A;  1RFJ A;  1JF0 A;  4PAL A;  3BXK A;  1U5I B;  2KI4 C;  1JUO A;  2KYF A;  3BUM B;  1XFZ O;  5F6T A;  1MQ1 A;  4M2Q A;  3BUX B;  1M39 A;  1CB1 A;  1SKT A;  1WLZ A;  4C0K A;  1NWD A;  3BQ3 A;  3CZT X;  1V1F A;  1K96 A;  3DF0 B;  1TCF A;  1TRF A;  3I5G B;  1AP4 A;  1GQM A;  1CDL A;  2M1U A;  1XFY O;  2KGB C;  3EKJ A;  3KHE A;  3NHT A;  4BY5 A;  2EGD A;  1FI5 A;  1PAL A;  1KSM A;  2NZ0 A;  4DUQ A;  4L9M A;  1QS7 A;  1A03 A;  2I7A A;  5I8N A;  3NSO A;  2KYC A;  2JRF A;  3PAL A;  1N0Y A;  1A2X A;  1PUL A;  1YTZ C;  1XYD A;  2QEB A;  2MRD A;  1CM1 A;  5HLO A;  1FI6 A;  4DS7 A;  3BYA A;  2F8P A;  1TNQ A;  3I5I C;  2ZRT A;  3EVU A;  4PHN A;  3D75 A;  1KK8 B;  2AUC A;  3V2L A;  1OOJ A;  1TNW A;  4NDB A;  2MLF C;  2MHH A;  2PQL A;  1OOI X;  3CZ1 A;  3SG6 A;  2JXC A;  1DTL A;  3SS3 A;  5FI7 A;  3VRP A;  1B8R A;  1PVA A;  1LA3 A;  1NX2 A;  2K7B A;  5J3X A;  1Y1X A;  2K60 A;  3FE9 A;  5PAL A;  4GNK B;  2LLT A;  1NP8 A;  1H8B A;  2EHB A;  1WRK A;  3OX5 A;  3AAJ A;  2KQ6 A;  2LAP A;  2PRU A;  4HRH A;  2K8M B;  1WLM A;  2ZN8 A;  3IQO A;  4MLW A;  3R72 A;  2OPO A;  5DKN A;  1NSH A;  1B9A A;  1UP5 A;  2BNX A;  4ETO A;  2E30 A;  2L50 A;  2CCM A;  2FOT A;  2KI4 B;  3TS5 C;  2KFF A;  2KNE A;  1CLL A;  4FQO A;  1BMO A;  1NCY A;  5ER4 X;  1QX5 B;  2K7C A;  2WCK A;  3TDZ A;  3RLZ A;  3BJH A;  2GGZ A;  1BU3 A;  3FIA A;  1PSB A;  4INX A;  1RTP 1;  3D74 A;  3LK1 A; 
#chains in the Genus database with same CATH homology
 2L51 A;  1DMO A;  3BUW B;  1MR8 A;  1QAS A;  4YGD B;  5GQQ C;  3HCM A;  2HPS A;  1KK7 Z;  1BG1 A;  1XO5 A;  1K2H A;  1EXR A;  2BEC A;  1CMG A;  1NX1 A;  2F33 A;  4IL1 A;  4MBE A;  3E3R A;  4P5O E;  3SG7 A;  1XFV O;  3SG2 A;  4R1E A;  2LHI A;  3CGA A;  1ODB A;  1L2O C;  1S36 A;  1UUS A;  2Y1N A;  4QJ3 B;  2F2O A;  4DRW A;  1NX0 A;  3NXA A;  4PE7 A;  1CNP A;  1S5G Y;  1Q80 A;  3BUN B;  3SIB A;  4A4B A;  2JWW A;  4GBA A;  3IF7 A;  3OB1 B;  1IGV A;  4HRE E;  1MXL C;  2LLU A;  4HRG A;  2L2E A;  2P6B B;  1UHH A;  2JC2 A;  4OKH A;  4ORA B;  1F55 A;  2HET A;  2LVK A;  1K90 D;  1DT7 B;  1J7O A;  2M7N A;  1AHR A;  3A4U B;  3PSR A;  1XFU O;  1DGU A;  1YUU A;  4MZJ A;  1UHK A;  2JOJ A;  1YVH A;  2LP3 A;  2LM5 A;  1N65 A;  3CS1 A;  1ZOT B;  2BKI B;  1WDC C;  3EK7 A;  2GGM A;  3TUY B;  1IQ3 A;  2TN4 A;  2CNP A;  1JF2 A;  2IS9 A;  2LAN A;  3FWB A;  1J7Q A;  2LHL A;  3SJS A;  1SPY A;  2BE6 A;  1WRL A;  1WRZ A;  1YRU B;  1QLS A;  4OR9 B;  1YX8 A;  2KAY A;  2LVI A;  1DJG A;  2M1K B;  1K93 D;  1IJ6 A;  3ICB A;  4U8D A;  3TS5 B;  1B7T Z;  5AXI A;  1KK7 Y;  2KI6 D;  1DJI A;  4YGC B;  1ZFS A;  1J1D A;  1MXE A;  1LVC D;  1ZUZ A;  2F2P A;  3LCP C;  1CLB A;  3CR2 A;  5B8I B;  1DJZ A;  2LC5 A;  2JT8 A;  2LMT A;  1QIW A;  2CBL A;  1BOC A;  3O6B A;  1IG5 A;  2MA2 A;  5HLV A;  3OP0 A;  3AAK A;  2MLE C;  1JFK A;  2BBM A;  2K61 A;  1KFU L;  1XFX O;  4CPV A;  4QJ5 B;  4F0Z B;  1EG3 A;  1WY9 A;  4MEW A;  1J55 A;  1X02 A;  1KCY A;  1M46 A;  3DD4 A;  4MRX A;  2LLS A;  2QAC A;  1OZS A;  3KPX A;  1L2O B;  3VRO A;  2G9B A;  2LE9 B;  2WOS A;  5AER A;  4GFT A;  1SMG A;  4PE4 A;  1MHO A;  3CR4 X;  3SG4 A;  1A29 A;  4MZK A;  2L98 A;  1W7J B;  1G33 A;  2WCF A;  1IKU A;  1GGW A;  1QJT A;  2M7L A;  1QLK A;  3I5H C;  4YI8 A;  1QX2 A;  1K95 A;  2KQY A;  1CM4 A;  4BY4 A;  3C1V A;  5I2O A;  1RWY A;  5G08 A;  2ZND A;  1CTR A;  1BR4 B;  5JOL A;  1NYA A;  2I18 A;  3PLF B;  1IJ5 A;  2KBI A;  1CFD A;  4PHJ A;  1QV1 A;  1N2D A;  1UWO A;  2F3Y A;  2K0J A;  2PVB A;  2R2I A;  3WHT B;  1BLQ A;  2F3Z A;  3DVJ A;  1UUR A;  4CFR A;  1S1E A;  4P2Y B;  1JWD A;  1XFW O;  1R6P A;  4N1G A;  1ZAC A;  1B7T Y;  1M63 B;  4WRI A;  2WCB A;  5HKW A;  1J7P A;  2B1U A;  1CFF A;  1XA5 A;  3VGO A;  5AFP A;  4NDD A;  3EK8 A;  1IQ5 A;  2ZN9 A;  1KQM B;  4I5L B;  1Y1U A;  5KU1 A;  2NLN A;  1ALW A;  4GPL B;  1EL4 A;  3AKB A;  1M45 A;  2WOR A;  2WCE A;  2KGR A;  2KI6 C;  4PHK A;  2BL0 C;  4JQ0 D;  1RK9 A;  3EK4 A;  3D10 A;  4MN0 A;  1PVB A;  2BCX A;  2M8U A;  1TN4 A;  2SAS A;  3TDU A;  4C0J A;  2EC6 C;  1A75 A;  1B47 A;  2I2R E;  1NX3 A;  4WQ3 A;  1FPW A;  1NPQ A;  2PAS A;  1NCZ A;  2ZRS A;  4YGE B;  1YR5 A;  2E6W A;  1RRO A;  2HF5 A;  4XJK A;  2K7D A;  3CR5 X;  3LL8 B;  3GK1 A;  5I2L A;  5AEQ A;  1E8A A;  4YGB B;  4GGF C;  2PMY A;  3GK2 A;  2MJW B;  1Y0V H;  3D0Y A;  1CKK A;  3NSI A;  1G8I A;  1SL9 A;  3VRR A;  1CDP A;  1GJY A;  3LK0 A;  1YUR A;  1BF5 A;  1SYM A;  3KO0 A;  1F4O A;  3KF9 A;  1EH2 A;  1F70 A;  2CT9 A;  1AUI B;  1S6J A;  4TNC A;  1CMF A;  4PE1 A;  5DKR A;  1DJH A;  3ZNI A;  3KEV A;  2CXJ A;  4GGF A;  4MZL A;  1UHJ A;  3I5H B;  2K2F A;  3EVR A;  1J7R A;  2CTN A;  4ICB A;  5JJG A;  1AJ4 A;  2L5X B;  3I5I B;  1TIZ A;  2G2B A;  1C07 A;  1EG4 A;  5CSN A;  5HKY A;  1KSO A;  3JVT C;  2BBN A;  2M0R A;  3GK4 X;  3SG3 A;  5KSZ A;  2M3W A;  3WXA A;  1K9K A;  4Q04 A;  4YI9 A;  4MSP A;  2O5G A;  1QV0 A;  2Q4U A;  4YBH B;  2PAL A;  3PAT A;  4QJ4 B;  2JTZ A;  1CFP A;  1K9U A;  3VRN A;  3DF0 A;  1KFU S;  2COL B;  3DVE A;  3M0W A;  1SCV A;  1TTX A;  2LVV A;  2OTG C;  3I5F C;  4FTG A;  4ORC B;  3SIA A;  1PSR A;  1A75 B;  3NSL A;  3OB2 B;  1TCO B;  2DOQ A;  1OE9 B;  1PRW A;  4XYN A;  5CPV A;  4XJK B;  3BUO B;  1B4C A;  2BL0 B;  1AVS A;  2WND A;  2JQ6 A;  3CWG A;  1DGV A;  2L4H A;  3QRX A;  1JSA A;  1QX7 A;  2LVJ A;  2L4I A;  3PN7 C;  1KQV A;  2JT3 A;  3DVM A;  1NUB A;  2LV7 A;  1BR1 B;  1UHI A;  5I2Q A;  2JUL A;  4PDZ A;  5CSI A;  3FS7 A;  1YX7 A;  1K94 A;  1SY9 A;  2M9G A;  1CLM A;  1FW4 A;  4OCI A;  1C7V A;  1DF0 A;  2JNF A;  1MWN A;  1SR6 C;  4JWQ A;  2LNK A;  1AK8 A;  2OS8 C;  1J1E A;  1S3P A;  1LKJ A;  1KFX L;  1TNX A;  3EKH A;  3A8R A;  1B8L A;  1SL8 A;  4M2P A;  1QIV A;  4YGA A;  4AOM A;  2LUX A;  3CTN A;  1QVI Z;  1UHN A;  5K89 A;  1Y6W A;  4HSZ A;  4PE0 A;  1SL7 A;  2FCE A;  2GV5 A;  1CFC A;  2H2K A;  4C0L A;  2HQW A;  2PSR A;  1LA0 A;  1XVJ A;  3CLN A;  3HX4 A;  3JVT B;  3O78 A;  2ISD A;  1KWO C;  2JU0 A;  4CFQ A;  1RJV A;  3OX6 A;  2ZNE A;  2H61 C;  2D8N A;  1ZMZ A;  2KBM A;  3PFV A;  1G4Y R;  2LUC A;  4N1F A;  2KHN A;  2KOT A;  1WDC B;  5IBW A;  1XK4 C;  2NCO A;  1YUS A;  4JPZ B;  1MF8 B;  2OTG B;  3I5F B;  1OQP A;  2K2A A;  2H61 A;  5DKQ A;  2JPT A;  2Y4Q A;  5HYD A;  4YRU A;  2KSP A;  2L0P A;  1AJ5 A;  2WC8 A;  5HKZ A;  2HQ8 A;  1DJW A;  2AMI A;  1XK4 A;  1B8C A;  1YVL A;  3GOF A;  1CDN A;  1OMR A;  1JFJ A;  5CSJ A;  1IRJ A;  3PN7 B;  3TZ1 A;  1DF0 B;  1S5G Z;  2A4J A;  1YRT B;  4I5K A;  2I94 A;  2LCP A;  1JBA A;  2FJU B;  2MAZ A;  1B1G A;  4D1E A;  1QXP A;  2KFG A;  2Q91 A;  2NCP A;  3EVV A;  2Y1M A;  2M97 A;  1BT6 A;  1ALV A;  2AAO A;  1BJF A;  5KTY A;  1OMV A;  3H4S E;  3JTD C;  1GGZ A;  1QVI Y;  4AQI A;  5FYX A;  3SG5 A;  4DIR A;  1S6I A;  1F4Q A;  1SR6 B;  5D7F A;  3ZWH A;  1QAT A;  1IH0 A;  1DVI A;  2OS8 B;  2Y5I A;  1NIW A;  4A4C A;  2KAX A;  1SCM C;  2BCA A;  5CSF A;  4CID A;  1H4B A;  1S6C A;  3O2P A;  2KAV A;  1L7Z A;  5TNC A;  3BOW A;  1V1G A;  1C7W A;  1IWQ A;  2LMU A;  1M31 A;  4PHM A;  2FCD A;  3AKA A;  3NSK A;  1CDM A;  2MBX A;  4E68 A;  2VRG A;  1OZO A;  2ZKM X;  1KWO B;  1R2U A;  3WNX B;  1FF1 A;  5BPJ A;  1EJ3 A;  1YUT A;  1U5I A;  1OSA A;  2KDH A;  2QPT A;  2K7O A;  2SCP A;  3I5G C;  4GUK A;  1SW8 A;  4MRY A;  1A4P A;  1Y1A A;  1PK0 D;  1BOD A;  1D1O A;  4PCW A;  3MSE B;  2M29 A;  1F8H A;  3DVK A;  1DJY A;  4I5J A;  2JTT A;  1LXF C;  4M2O A;  3WHU B;  2LMV A;  1HQV A;  2M49 B;  3VRQ A;  1LIN A;  1F71 A;  1MUX A;  2O60 A;  1K8U A;  2JXL A;  1JC2 A;  4NQG A;  5AAN A;  2KFH A;  1TOP A;  2LP2 A;  4ZCV A;  1SK6 D;  1KFX S;  1S26 D;  2BCB A;  4UPG A;  1KK8 C;  1SNL A;  1OMD A;  1REC A;  1VRK A;  4GAO A;  2JNX A;  2ZFD A;  1TNP A;  3IQQ A;  5ER5 A;  1QTX A;  2EC6 B;  2JT0 A;  4NDC A;  2JZI A;  4ORB B;  3FWC A;  3D0Y B;  1FBV A;  1SBJ A;  2BKH B;  4OVN F;  3JTD B;  4USL A;  1W7I B;  4WQ2 A;  3O4Y A;  3F45 A;  3TDI A;  4AQJ A;  2BE4 A;  4I5N B;  1K9P A;  4GGN A;  1HT9 A;  3BOW B;  1DJX A;  3PM8 A;  1NCX A;  1SRA A;  2NXQ A;  4DCK A;  2RGI A;  3K21 A;  3LLE A;  1KQM C;  4OV2 A;  3RM1 A;  2V53 A;  3OHM B;  4MVF A;  4N5X A;  1SCM B;  4ZCU A;  5D69 A;  4CLN A;  1F54 A;  1RFJ A;  1JF0 A;  4PAL A;  3BXK A;  1U5I B;  2KI4 C;  1JUO A;  2KYF A;  3BUM B;  1XFZ O;  5F6T A;  1MQ1 A;  4M2Q A;  3BUX B;  1M39 A;  1CB1 A;  1SKT A;  1WLZ A;  4C0K A;  1NWD A;  3BQ3 A;  3CZT X;  1V1F A;  1K96 A;  3DF0 B;  1TCF A;  1TRF A;  3I5G B;  1AP4 A;  1GQM A;  1CDL A;  2M1U A;  1XFY O;  2KGB C;  3EKJ A;  3KHE A;  1FI5 A;  4BY5 A;  2EGD A;  1PAL A;  1KSM A;  2NZ0 A;  4DUQ A;  4L9M A;  1QS7 A;  1A03 A;  2I7A A;  5I8N A;  3NSO A;  2KYC A;  2JRF A;  3PAL A;  1N0Y A;  1A2X A;  1PUL A;  1YTZ C;  1XYD A;  2MRD A;  1CM1 A;  5HLO A;  1FI6 A;  4DS7 A;  3BYA A;  2F8P A;  1TNQ A;  3I5I C;  2ZRT A;  3EVU A;  4PHN A;  1KK8 B;  2AUC A;  1OOJ A;  1TNW A;  4NDB A;  2MLF C;  2MHH A;  3SG6 A;  2JXC A;  1DTL A;  3VRP A;  1B8R A;  1PVA A;  1LA3 A;  1NX2 A;  2K7B A;  5J3X A;  1Y1X A;  5PAL A;  4GNK B;  2LLT A;  1NP8 A;  1H8B A;  2EHB A;  1WRK A;  3OX5 A;  3AAJ A;  2KQ6 A;  2LAP A;  2PRU A;  4HRH A;  2K8M B;  1WLM A;  2ZN8 A;  3IQO A;  4MLW A;  3TUY C;  2OPO A;  5DKN A;  1NSH A;  1B9A A;  1UP5 A;  4ETO A;  2E30 A;  2L50 A;  2CCM A;  2FOT A;  2KI4 B;  3TS5 C;  2KFF A;  2KNE A;  1CLL A;  4FQO A;  1BMO A;  1NCY A;  5ER4 X;  1QX5 B;  2K7C A;  3TDZ A;  3RLZ A;  2GGZ A;  1BU3 A;  3FIA A;  1PSB A;  1RTP 1;  3LK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...