1UHJA

Crystal structure of br-aequorin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
187
structure length
187
Chain Sequence
LTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of semi-synthetic aequorins
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
molecule keywords Aequorin 2
total genus 67
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhjA00
4D1EA 2KI6C 1KSMA 1S36A 3CR4X 1OMVA 2CCMA 4YGEB 5DKNA 5KSZA 2L0PA 2HQ8A 1IRJA 3FWBA 2EC6C 2PMYA 5AXIA 2KI4B 1SK6D 4CIDA 1RK9A 2KHNA 1LKJA 1SBJA 2I94A 2EHBA 2K7CA 1KK7Y 2PALA 2ISDA 3I5GC 2A4JA 4C0JA 2JXCA 2MAZA 3C1VA 1M46A 5B8IB 2LUCA 2HPSA 1EXRA 2KQ6A 1SR6B 3PN7B 5HLOA 2L4IA 4N1GA 1PK0D 2JWWA 1CTRA 3TDUA 3PN7C 1PVAA 5TNCA 3EVRA 4USLA 1OZOA 2LUXA 4FTGA 2NXQA 4YGAA 5HLVA 5AEQA 2LCPA 2MBXA 1U5IA 3I5IC 1SMGA 2LVKA 3PSRA 1IQ3A 1NWDA 2JOJA 5JJGA 4XYNA 4GFTA 2P6BB 2ZNEA 3LK0A 5I2LA 4BY5A 1AK8A 1LA3A 2L50A 1OSAA 3NSKA 4CLNA 4QJ4B 2JT3A 3CR5X 1QV0A 5F6TA 4DCKA 1SYMA 1YUSA 2M7NA 2KOTA 2CT9A 1MF8B 3DD4A 5IBWA 2KNEA 3KF9A 4GGFC 2BL0B 2MLEC 1UHKA 1FBVA 2LVIA 3EK7A 2FJUB 3FS7A 1R6PA 1PRWA 3JVTB 2L5XB 1WLMA 1H8BA 3IQOA 1JF0A 2ZKMX 4Q04A 5HYDA 4NDBA 2M0RA 1N2DA 1A4PA 4DUQA 1YVHA 2I2RE 1RWYA 1SL9A 3LK1A 1MHOA 3GK2A 1B8LA 1SKTA 2JTTA 2SASA 2I7AA 5JOLA 2M29A 5FYXA 1IWQA 1S3PA 2L51A 3EKJA 2D8NA 2COLB 3TUYC 1Q80A 1A29A 1B7TZ 5KTYA 1OE9B 1BF5A 1EL4A 2M8UA 3OX6A 5GQQC 1UHHA 4IL1A 3QRXA 4P5OE 3D0YB 3CS1A 4MSPA 5AFPA 1Y1UA 2OS8C 2FOTA 3VRRA 3FIAA 3BUOB 1A75B 4XJKB 1TNQA 2KI4C 1S5GY 4MN0A 1M31A 1WRZA 2DOQA 3A8RA 4GUKA 3EK8A 5AERA 1KFXL 1CB1A 1YTZC 2PSRA 3PATA 1IJ5A 1DTLA 1QATA 2F3YA 2WC8A 1N65A 1BR1B 1LA0A 1CFDA 1TIZA 1JC2A 2LHIA 1MR8A 3LCPC 4JQ0D 1KQMC 3EK4A 1TCOB 1TNXA 1XO5A 1BODA 4ORBB 1KFUL 2H61A 4U8DA 1B4CA 2WORA 1GJYA 4ZCVA 2JT8A 1RTP1 5CSJA 2FCEA 4I5LB 1JFJA 3SIBA 3SG3A 4I5JA 3AKBA 2K7DA 5CSFA 3VGOA 5I2OA 4PDZA 1C07A 2K61A 2KYCA 3HX4A 1JBAA 1SNLA 1XFXO 2LMVA 3LL8B 4YI8A 1DJWA 1G33A 1S26D 4N5XA 1WRKA 2JC2A 2O60A 2WCFA 3O6BA 2L4HA 2LV7A 4PE1A 3IQQA 5CSNA 5I8NA 1ODBA 3CLNA 1IKUA 1CDPA 3OB1B 1K94A 1J55A 1NX0A 1ZOTB 5ER5A 1CDMA 3F45A 4YBHB 2KBIA 2E30A 2E6WA 1YRUB 2H2KA 3IF7A 1BJFA 1BT6A 1FW4A 1QLKA 2CBLA 1KSOA 4CFQA 2B1UA 4E68A 2L98A 2R2IA 2Q91A 5KU1A 1YRTB 2EC6B 4WRIA 2LHLA 1XK4A 3OB2B 3EVUA 3O2PA 4OV2A 1MWNA 1S1EA 2KSPA 3CZTX 1V1FA 1QLSA 3AAKA 1QX5B 2AUCA 2K2AA 2KAYA 1B8RA 1IQ5A 1OOJA 1PSRA 1QX7A 4HRHA 2JNXA 4MBEA 4I5NB 1YUUA 1QS7A 1YX8A 1R2UA 3O78A 2HETA 2JRFA 2LMUA 1K9KA 2LE9B 5D7FA 1KK8C 1RECA 2KDHA 2ZRTA 3I5HC 4AOMA 5BPJA 1B7TY 1UWOA 2TN4A 3PALA 1KK7Z 1L2OB 2O5GA 3OX5A 2QPTA 1IGVA 1CFPA 1BG1A 1TNPA 1K96A 2EGDA 2KFGA 1FI6A 1DGVA 1DGUA 1CMFA 1UURA 2Y1MA 3BUXB 3TS5B 1WY9A 4MRXA 1CM1A 1CLLA 1XFZO 4L9MA 2HF5A 1W7IB 1DF0B 1AJ5A 1K8UA 1NYAA 1WDCC 2PVBA 3TZ1A 4NDDA 3TDZA 5HKWA 1NP8A 1TTXA 1QIWA 1ZFSA 2NCPA 3EVVA 3VRNA 1KWOC 1M39A 1UHIA 2ZFDA 4YGDB 2ZNDA 2CTNA 3KO0A 1NCXA 4ETOA 2HQWA 2MHHA 2MA2A 4HREE 3OHMB 2M3WA 1ALWA 2M1UA 3JTDB 3CTNA 4NDCA 5I2QA 1BOCA 1GGZA 1K9PA 3PLFB 3DF0B 1B1GA 1CDLA 2JU0A 3RLZA 1CDNA 1SCMB 3FWCA 2L2EA 3BOWA 4N1FA 1SL7A 2KFHA 4PHJA 2NZ0A 4PE7A 1G8IA 1PVBA 3CR2A 1FPWA 1QJTA 3AKAA 4M2QA 4TNCA 3WHUB 1A75A 2Q4UA 2M9GA 2GV5A 3BQ3A 4CFRA 1G4YR 4YGCB 1F54A 2FCDA 1A2XA 4GGNA 5K89A 1SCVA 1ZUZA 5AANA 1BR4B 4OR9B 3SIAA 1WLZA 2AMIA 1CNPA 4ZCUA 1WDCB 1RJVA 4JPZB 5D69A 1IG5A 3AAJA 2GGZA 1NX2A 3NSLA 1DT7B 4JWQA 4MRYA 3TDIA 2V53A 2KQYA 2LMTA 1L2OC 1V1GA 1J7OA 1F55A 4CPVA 1F4QA 1TOPA 1F4OA 1GGWA 2KGBC 1J1DA 2JULA 5G08A 1OQPA 3WHTB 3WNXB 4FQOA 4MEWA 4A4BA 4MZLA 2F33A 2LM5A 1ALVA 4PCWA 2ZN9A 1AP4A 1DJGA 2NLNA 2KI6D 3RM1A 1HQVA 1SPYA 1XFUO 1LINA 1E8AA 1PULA 3BXKA 1KK8B 2LNKA 3VROA 5PALA 2BCBA 4MLWA 3SG4A 1D1OA 2ZN8A 2RGIA 1UHJA 1KFXS 1RROA 1B8CA 1UUSA 1FI5A 1YUTA 3SG5A 3CGAA 1DJXA 4PALA 2K8MB 2KYFA 1ZMZA 2PRUA 1YR5A 3PFVA 2GGMA 4YGBB 4DS7A 2H61C 4I5KA 1F8HA 2MLFC 5DKRA 1F70A 1DJZA 2WNDA 1JUOA 1AVSA 2OTGC 1VRKA 2KGRA 3BUWB 4C0LA 3MSEB 2JPTA 1J7QA 2LLSA 1EG3A 1GQMA 1QXPA 3D0YA 1XFYO 1CLMA 2VRGA 3BUMB 1X02A 1SY9A 1K90D 2IS9A 3SJSA 1W7JB 1K93D 1AUIB 1NCYA 4C0KA 3CWGA 2QACA 1SR6C 1TN4A 1CFCA 1XK4C 1OMDA 2F2OA 3EKHA 3I5FB 1SL8A 3WXAA 2JT0A 2WOSA 1UP5A 1J7PA 1JF2A 1LVCD 4MZKA 1L7ZA 4BY4A 3E3RA 1PSBA 1XVJA 2M1KB 4NQGA 1BLQA 1YURA 1BMOA 3TUYB 4XJKA 5CSIA 3GK4X 1TNWA 5J3XA 1PALA 4UPGA 4PE0A 2CNPA 1BU3A 1MQ1A 1TCFA 2MJWB 1KQMB 1QX2A 3K21A 2K7BA 3M0WA 4DRWA 1F71A 4YI9A 2LANA 2LC5A 2M49B 2Y1NA 1NPQA 1S5GZ 1M63B 3JTDC 4QJ5B 4GAOA 2SCPA 1QTXA 2JTZA 1U5IB 3SG6A 1DMOA 4M2PA 2PASA 3GOFA 1EJ3A 1B9AA 1XYDA 3KHEA 1Y6WA 2BE6A 3VRQA 3ICBA 2K2FA 1JFKA 2OS8B 3KPXA 1B47A 1J1EA 1NUBA 1DJHA 2M97A 2F8PA 2NCOA 1DJIA 1DVIA 1C7WA 1ZACA 2LAPA 1UHNA 5DKQA 1XFWO 1EG4A 1QVIZ 2G2BA 1TRFA 3H4SE 2ZRSA 2Y5IA 1DJYA 4PE4A 2BKHB 2AAOA 4F0ZB 1CKKA 3O4YA 3I5IB 4M2OA 2K7OA 1IH0A 2LLUA 2LP2A 3TS5C 1S6CA 4OKHA 2JNFA 2BECA 3SG7A 1CMGA 1H4BA 2WCBA 1RFJA 2BBMA 4OVNF 2LVJA 2WCEA 2I18A 4WQ2A 3DVKA 4YRUA 4P2YB 1CM4A 3JVTC 4OCIA 4AQIA 4AQJA 2JXLA 3D10A 3DVEA 2BKIB 4DIRA 2Y4QA 4ORCB 4WQ3A 2LP3A 5HKYA 1FF1A 4GPLB 4ICBA 4QJ3B 2K0JA 2JZIA 4MVFA 1YX7A 4PHKA 2BBNA 1HT9A 2F2PA 2LVVA 3ZWHA 5CPVA 1QVIY 3LLEA 1QIVA 1XA5A 1DF0A 2KFFA 1SW8A 2F3ZA 1QASA 2KAXA 2G9BA 1S6IA 1MXLC 1JSAA 3I5FC 1Y0VH 1KFUS 4HSZA 3KEVA 1M45A 5HKZA 3ZNIA 1Y1AA 1XFVO 2BCXA 1KWOB 1S6JA 5ER4X 2OTGB 1Y1XA 4GNKB 3OP0A 3BYAA 3GK1A 3HCMA 4MZJA 2OPOA 1OZSA 2BE4A 1EH2A 4ORAB 1SRAA 1K9UA 1LXFC 1WRLA 1NIWA 4PHNA 3I5GB 1YVLA 1SCMC 1A03A 3A4UB 2BCAA 1IJ6A 3DVJA 4GBAA 4GGFA 3DF0A 3SG2A 1AJ4A 2LLTA 1KCYA 3I5HB 3NXAA 4R1EA 1NCZA 1NX1A 3DVMA 1K2HA 2KAVA 1JWDA 3NSOA 2M7LA 4A4CA 1J7RA 1C7VA 3VRPA 1NX3A 1K95A 1OMRA 3BOWB 4HRGA 4PHMA 1MXEA 1N0YA 3PM8A 3NSIA 1KQVA 1MUXA 1NSHA 2KBMA 1CLBA 1AHRA 2CXJA 3BUNB 2BL0C 2JQ6A 1QV1A 2MRDA 1CFFA
chains in the Genus database with same CATH superfamily
2KLDA 3SS3A 4D1EA 2KI6C 1KSMA 1S36A 3CR4X 1OMVA 2CCMA 4YGEB 5DKNA 5KSZA 2L0PA 2HQ8A 1IRJA 3FWBA 2EC6C 2PMYA 3O4XA 2KI4B 1SK6D 5AXIA 4CIDA 1RK9A 1LS8A 1LKJA 2KHNA 3FE8A 1SBJA 2I94A 2EHBA 2K7CA 1KK7Y 2PALA 2ISDA 3I5GC 2A4JA 4C0JA 2JXCA 2MAZA 3C1VA 1M46A 5B8IB 2LUCA 2HPSA 1EXRA 1OW4A 1SR6B 2KQ6A 3PN7B 5HLOA 2L4IA 4N1GA 1PK0D 2JWWA 3K1EA 5HL1A 1CTRA 3TDUA 3PN7C 1C3YA 1PVAA 5TNCA 3EVRA 4USLA 1OZOA 2LUXA 4FTGA 5FI6A 2NXQA 3V2LA 4YGAA 5HLVA 5AEQA 2LCPA 3NHIA 2MBXA 1U5IA 3I5IC 1SMGA 2LVKA 3PSRA 1IQ3A 1NWDA 1TUJA 3D75A 2JOJA 5JJGA 4XYNA 4GFTA 2P6BB 2ZNEA 3LK0A 5I2LA 4BY5A 1AK8A 1LA3A 2WC5A 2L50A 2QDIA 4OZDA 1OSAA 3NSKA 4CLNA 4QJ4B 2JT3A 3CR5X 1GM0A 1QV0A 5F6TA 4DCKA 1SYMA 1YUSA 2M7NA 2KOTA 2QEVA 2CT9A 1MF8B 3CZ2A 3DD4A 2KNEA 3KF9A 4GGFC 5IBWA 2BL0B 2MLEC 2WC6A 1UHKA 1FBVA 2LVIA 3EK7A 2FJUB 3FS7A 1R6PA 1PRWA 3JVTB 2L5XB 1WLMA 1H8BA 3IQOA 1JF0A 1Z4HA 2ZKMX 4Q04A 3EG5B 5HYDA 4NDBA 2M0RA 1N2DA 1A4PA 4DUQA 1ORGA 1T14A 1YVHA 2I2RE 1RWYA 1SL9A 3LK1A 1MHOA 3GK2A 1B8LA 1SKTA 2JTTA 2SASA 2I7AA 5JOLA 2M29A 5FYXA 1IWQA 1S3PA 2L51A 3EKJA 2D8NA 2COLB 3TUYC 1Q80A 1A29A 1B7TZ 5KTYA 1OE9B 1BF5A 1EL4A 2M8UA 3OX6A 5GQQC 1UHHA 4IL1A 3Q8IA 3QRXA 4P5OE 3D0YB 3CS1A 4MSPA 5AFPA 1Y1UA 2OS8C 2FOTA 3CZ0A 3VRRA 3FIAA 3BUOB 1A75B 3UNWA 4XJKB 1TNQA 2KI4C 1S5GY 2WCHA 3DXLA 3R1VA 4MN0A 3DYEA 2KPHA 1M31A 1WRZA 2DOQA 3A8RA 3CDNA 4GUKA 3EK8A 5AERA 1KFXL 1CB1A 1YTZC 1C3ZA 2PSRA 3PATA 3VB1A 1IJ5A 1DTLA 1QATA 2F3YA 2WC8A 1N65A 3FE6A 1BR1B 1LA0A 1CFDA 1TIZA 1JC2A 2LHIA 1MR8A 3LCPC 2K60A 4JQ0D 1KQMC 3EK4A 1TCOB 1TNXA 1XO5A 2BNXA 2KLEA 4ORBB 1KFUL 1BODA 2H61A 4U8DA 1B4CA 2WORA 1GJYA 4ZCVA 2JT8A 1RTP1 5CSJA 2FCEA 4I5LB 1JFJA 3SIBA 3SG3A 4I5JA 3AKBA 2K7DA 5CSFA 3VGOA 5I2OA 4PDZA 1C07A 2K61A 2KYCA 3HX4A 1JBAA 1SNLA 1XFXO 2LMVA 3LL8B 4YI8A 1DJWA 1G33A 1S26D 4N5XA 1DEKA 3S0DA 1WRKA 2JC2A 2O60A 2WCFA 3O6BA 2L4HA 3D77A 2WCJA 5FI7A 2LV7A 4PE1A 3IQQA 4INXA 5CSNA 5I8NA 1ODBA 3CLNA 1DELA 1IKUA 1CDPA 3OB1B 1K94A 1J55A 1NX0A 1ZOTB 5ER5A 1CDMA 3F45A 4YBHB 2KBIA 2E30A 2E6WA 1YRUB 2H2KA 3IF7A 1BJFA 1BT6A 1FW4A 1QLKA 2CBLA 1KSOA 3NHTA 2B1UA 4CFQA 4E68A 2L98A 2P70A 2Q91A 2R2IA 5KU1A 1YRTB 2EC6B 4WRIA 2LHLA 1XK4A 3OB2B 3EVUA 3O2PA 1OOHA 4OV2A 1MWNA 2H8VA 1S1EA 2KSPA 3CZTX 1V1FA 1QLSA 3AAKA 3BFAA 1QX5B 2AUCA 2K2AA 2KAYA 3B86A 1B8RA 1IQ5A 1OOJA 1PSRA 1QX7A 4HRHA 2JNXA 4MBEA 4I5NB 1YUUA 1QS7A 1YX8A 1R2UA 3O78A 2HETA 4JKTA 2JRFA 2LMUA 1K9KA 2LE9B 5D7FA 1KK8C 1RECA 2KDHA 2ZRTA 3I5HC 4AOMA 5BPJA 1B7TY 1UWOA 1DQEA 2TN4A 3PALA 1KK7Z 1L2OB 2O5GA 3OX5A 2QPTA 1IGVA 1W9ZA 4F7FA 1BG1A 1CFPA 5EL2A 5FI2A 1TNPA 1K96A 2EGDA 2KFGA 1OOGA 1DGVA 1FI6A 1DGUA 3N7HA 1UURA 2Y1MA 3BUXB 3TS5B 1CMFA 1WY9A 3QMEA 4MRXA 1CM1A 1CLLA 1XFZO 4L9MA 2HF5A 1W7IB 1DC1A 1DF0B 1AJ5A 1K8UA 1NYAA 1WDCC 2PVBA 3TZ1A 4NDDA 3TDZA 5HKWA 3B88A 1NP8A 1TTXA 1QIWA 1ZFSA 2NCPA 3BFHA 3EVVA 3VRNA 1KWOC 2PYQA 1M39A 1UHIA 2ZFDA 4YGDB 1OOFA 2ZNDA 2CTNA 3KO0A 1NCXA 4ETOA 2HQWA 2MHHA 2MA2A 4HREE 3OHMB 3S0GA 2M3WA 1ALWA 2M1UA 3CABA 3CZ1A 3JTDB 3CTNA 4NDCA 5I2QA 1BOCA 1GGZA 1K9PA 3PLFB 3DF0B 1B1GA 3UO9A 2QEOA 2WCLA 1CDLA 2JU0A 3RLZA 1CDNA 1SCMB 3FWCA 2L2EA 3BOWA 5I94A 4N1FA 1SL7A 2KFHA 4PHJA 2NZ0A 4PE7A 3DZTA 1G8IA 1PVBA 3CR2A 1FPWA 1QJTA 3AKAA 4M2QA 4TNCA 3WHUB 1A75A 2Q4UA 2M9GA 2GV5A 3BQ3A 4CFRA 1G4YR 4YGCB 1F54A 2FCDA 1A2XA 4GGNA 5K89A 1SCVA 1ZUZA 5AANA 1BR4B 4OR9B 3SIAA 1WLZA 2AMIA 2YGUA 4ZCUA 1CNPA 4INWA 3D78A 1WDCB 1RJVA 4JPZB 3L4LA 5D69A 1IG5A 3AAJA 1Z2CB 2GGZA 1NX2A 3NSLA 2GTEA 1DT7B 1OOIX 4JWQA 4MRYA 3TDIA 2V53A 2KQYA 2LMTA 1L2OC 1V1GA 1J7OA 1F55A 4CPVA 1F4QA 1TOPA 1F4OA 1GGWA 2KGBC 1J1DA 2JULA 2QEHA 1OQPA 5G08A 3WHTB 3WNXB 4FQOA 4MEWA 4A4BA 4MZLA 2F33A 2LM5A 1ALVA 4PCWA 2ZN9A 1QWVA 1AP4A 1DJGA 3PM2A 2NLNA 2KI6D 3PJIA 3RM1A 4IJ7A 1HQVA 1SPYA 1XFUO 1LINA 1E8AA 1PULA 3BXKA 1KK8B 2LNKA 3VROA 5PALA 2BCBA 4MLWA 3SG4A 1D1OA 2L2CA 2RGIA 1UHJA 1KFXS 1RROA 2ZN8A 3S0BA 1B8CA 1UUSA 1FI5A 1YUTA 3SG5A 3CGAA 1DJXA 4PT1A 4PALA 2K8MB 2KYFA 1ZMZA 2PRUA 1YR5A 3PFVA 2GGMA 4YGBB 3FE9A 2H61C 4DS7A 4I5KA 1F8HA 2MLFC 5D3OA 5DKRA 1F70A 1DJZA 2WNDA 1JUOA 1AVSA 2OTGC 1VRKA 2KGRA 3BUWB 4C0LA 3MSEB 2JPTA 1J7QA 2LLSA 1EG3A 1GQMA 1QXPA 3D0YA 1XFYO 1CLMA 2VRGA 3BUMB 1X02A 1SY9A 3D73A 1K90D 2IS9A 3SJSA 1W7JB 3R1OA 1K93D 1AUIB 3BFBA 1NCYA 4C0KA 3CWGA 2QACA 1SR6C 1TN4A 2ERBA 2QEBA 1CFCA 1XK4C 1OMDA 2F2OA 3RZSA 3EKHA 3I5FB 1SL8A 3WXAA 2JT0A 2WOSA 1UP5A 2P71A 1J7PA 1JF2A 1LVCD 4MZKA 1L7ZA 4BY4A 1TUZA 1PSBA 3E3RA 3R1PA 1XVJA 2M1KB 4NQGA 1BLQA 2L5YA 1YURA 2JPOA 1BMOA 3TUYB 4XJKA 5CSIA 2WCKA 3GK4X 1TNWA 5J3XA 1PALA 4UPGA 4PE0A 2CNPA 1BU3A 1MQ1A 1TCFA 2MJWB 1KQMB 1QX2A 3K21A 2K7BA 3M0WA 4DRWA 2WCMA 1F71A 2BAPA 4YI9A 2LANA 1SSEB 2LC5A 2M49B 2Y1NA 3CYZA 5DICA 1NPQA 1S5GZ 1M63B 3JTDC 4QJ5B 4GAOA 2SCPA 1TWOA 1QTXA 2JTZA 1U5IB 3SG6A 1DMOA 4M2PA 2PASA 3GOFA 1EJ3A 3B87A 1B9AA 1XYDA 3KHEA 3OBVA 1Y6WA 2BE6A 3VRQA 1IIOA 3ICBA 2K2FA 3SS4A 1JFKA 2OS8B 3KPXA 1B47A 1J1EA 1NUBA 1DJHA 2M97A 2F8PA 2NCOA 4KYNA 3D74A 1DJIA 1XFRA 1DVIA 1C7WA 1ZACA 2LAPA 3L47A 1UHNA 3BJHA 5DKQA 2PQLA 1XFWO 3B6XA 1EG4A 1QVIZ 2G2BA 1TRFA 3H4SE 2ZRSA 2Y5IA 1DJYA 4PE4A 2BKHB 2AAOA 3OGNA 4F0ZB 1CKKA 3O4YA 3I5IB 4M2OA 2FJYA 2K7OA 2LLUA 1IH0A 3SS5A 2LP2A 3TS5C 1S6CA 4OKHA 2JNFA 2BECA 3SG7A 1CMGA 1H4BA 2WCBA 1RFJA 1P28A 2BBMA 4OVNF 2LVJA 2WCEA 3B7AA 2I18A 4WQ2A 3DVKA 4YRUA 4P2YB 1CM4A 3JVTC 4OCIA 4AQIA 4AQJA 2JXLA 3D10A 3S0FA 3DVEA 2BKIB 4DIRA 2Y4QA 4ORCB 3DY9A 4WQ3A 2LP3A 5HKYA 1FF1A 4GPLB 4ICBA 3D76A 4QJ3B 2K0JA 2JZIA 4MVFA 3L4AA 1YX7A 4PHKA 2BBNA 1HT9A 2F2PA 2LVVA 3ZWHA 5CPVA 4FQTA 1QVIY 3LLEA 1QIVA 1XA5A 1DF0A 2KFFA 3IVTA 1SW8A 2F3ZA 1QASA 2KAXA 4JD9A 2G9BA 1S6IA 1MXLC 1JSAA 3R72A 3I5FC 1Y0VH 1KFUS 4HSZA 3KEVA 1M45A 5HKZA 3ZNIA 1Y1AA 1XFVO 2BCXA 1KWOB 1S6JA 5ER4X 2OTGB 1Y1XA 4GNKB 3OP0A 3BYAA 3GK1A 3HCMA 4MZJA 2OPOA 1OZSA 2BE4A 3NGVA 4ORAB 1EH2A 1SRAA 1K9UA 1LXFC 3S0EA 1WRLA 1NIWA 4PHNA 3I5GB 1YVLA 1SCMC 1A03A 3A4UB 2BCAA 1IJ6A 3DVJA 4GBAA 4GGFA 3DF0A 3SG2A 1AJ4A 2LLTA 1KCYA 3I5HB 3NXAA 4R1EA 3S0AA 1NCZA 1NX1A 3DVMA 1K2HA 2KAVA 1JWDA 3NSOA 2M7LA 4A4CA 1J7RA 1C7VA 3VRPA 1NX3A 1K95A 1OMRA 3BOWB 4HRGA 4PHMA 1MXEA 1N0YA 3PM8A 3NSIA 1KQVA 1MUXA 1NSHA 2KBMA 1CLBA 1AHRA 2CXJA 3BUNB 2BL0C 2JQ6A 1QV1A 2MRDA 1CFFA
chains in the Genus database with same CATH topology
4D1EA 2KI6C 1KSMA 1S36A 3CR4X 1OMVA 2CCMA 4YGEB 5DKNA 5KSZA 2L0PA 2HQ8A 1IRJA 3FWBA 2EC6C 2PMYA 5AXIA 2KI4B 1SK6D 4CIDA 1RK9A 2KHNA 1LKJA 1SBJA 2I94A 2EHBA 2K7CA 1KK7Y 2PALA 2ISDA 3I5GC 2A4JA 4C0JA 2JXCA 2MAZA 3C1VA 1M46A 5B8IB 2LUCA 2HPSA 1EXRA 2KQ6A 1SR6B 3PN7B 5HLOA 2L4IA 4N1GA 1PK0D 2JWWA 1CTRA 3TDUA 3PN7C 1PVAA 5TNCA 3EVRA 4USLA 1OZOA 2LUXA 4FTGA 2NXQA 4YGAA 5HLVA 5AEQA 2LCPA 2MBXA 1U5IA 3I5IC 1SMGA 2LVKA 3PSRA 1IQ3A 1NWDA 2JOJA 5JJGA 4XYNA 4GFTA 2P6BB 2ZNEA 3LK0A 5I2LA 4BY5A 1AK8A 1LA3A 2L50A 1OSAA 3NSKA 4CLNA 4QJ4B 2JT3A 3CR5X 1QV0A 5F6TA 4DCKA 1SYMA 1YUSA 2M7NA 2KOTA 2CT9A 1MF8B 3DD4A 5IBWA 2KNEA 3KF9A 4GGFC 2BL0B 2MLEC 1UHKA 1FBVA 2LVIA 3EK7A 2FJUB 3FS7A 1R6PA 1PRWA 3JVTB 2L5XB 1WLMA 1H8BA 3IQOA 1JF0A 2ZKMX 4Q04A 5HYDA 4NDBA 2M0RA 1N2DA 1A4PA 4DUQA 1YVHA 2I2RE 1RWYA 1SL9A 3LK1A 1MHOA 3GK2A 1B8LA 1SKTA 2JTTA 2SASA 2I7AA 5JOLA 2M29A 5FYXA 1IWQA 1S3PA 2L51A 3EKJA 2D8NA 2COLB 3TUYC 1Q80A 1A29A 1B7TZ 5KTYA 1OE9B 1BF5A 1EL4A 2M8UA 3OX6A 5GQQC 1UHHA 4IL1A 3QRXA 4P5OE 3D0YB 3CS1A 4MSPA 5AFPA 1Y1UA 2OS8C 2FOTA 3VRRA 3FIAA 3BUOB 1A75B 4XJKB 1TNQA 2KI4C 1S5GY 4MN0A 1M31A 1WRZA 2DOQA 3A8RA 4GUKA 3EK8A 5AERA 1KFXL 1CB1A 1YTZC 2PSRA 3PATA 1IJ5A 1DTLA 1QATA 2F3YA 2WC8A 1N65A 1BR1B 1LA0A 1CFDA 1TIZA 1JC2A 2LHIA 1MR8A 3LCPC 4JQ0D 1KQMC 3EK4A 1TCOB 1TNXA 1XO5A 1BODA 4ORBB 1KFUL 2H61A 4U8DA 1B4CA 2WORA 1GJYA 4ZCVA 2JT8A 1RTP1 5CSJA 2FCEA 4I5LB 1JFJA 3SIBA 3SG3A 4I5JA 3AKBA 2K7DA 5CSFA 3VGOA 5I2OA 4PDZA 1C07A 2K61A 2KYCA 3HX4A 1JBAA 1SNLA 1XFXO 2LMVA 3LL8B 4YI8A 1DJWA 1G33A 1S26D 4N5XA 1WRKA 2JC2A 2O60A 2WCFA 3O6BA 2L4HA 2LV7A 4PE1A 3IQQA 5CSNA 5I8NA 1ODBA 3CLNA 1IKUA 1CDPA 3OB1B 1K94A 1J55A 1NX0A 1ZOTB 5ER5A 1CDMA 3F45A 4YBHB 2KBIA 2E30A 2E6WA 1YRUB 2H2KA 3IF7A 1BJFA 1BT6A 1FW4A 1QLKA 2CBLA 1KSOA 4CFQA 2B1UA 4E68A 2L98A 2R2IA 2Q91A 5KU1A 1YRTB 2EC6B 4WRIA 2LHLA 1XK4A 3OB2B 3EVUA 3O2PA 4OV2A 1MWNA 1S1EA 2KSPA 3CZTX 1V1FA 1QLSA 3AAKA 1QX5B 2AUCA 2K2AA 2KAYA 1B8RA 1IQ5A 1OOJA 1PSRA 1QX7A 4HRHA 2JNXA 4MBEA 4I5NB 1YUUA 1QS7A 1YX8A 1R2UA 3O78A 2HETA 2JRFA 2LMUA 1K9KA 2LE9B 5D7FA 1KK8C 1RECA 2KDHA 2ZRTA 3I5HC 4AOMA 5BPJA 1B7TY 1UWOA 2TN4A 3PALA 1KK7Z 1L2OB 2O5GA 3OX5A 2QPTA 1IGVA 1CFPA 1BG1A 1TNPA 1K96A 2EGDA 2KFGA 1FI6A 1DGVA 1DGUA 1CMFA 1UURA 2Y1MA 3BUXB 3TS5B 1WY9A 4MRXA 1CM1A 1CLLA 1XFZO 4L9MA 2HF5A 1W7IB 1DF0B 1AJ5A 1K8UA 1NYAA 1WDCC 2PVBA 3TZ1A 4NDDA 3TDZA 5HKWA 1NP8A 1TTXA 1QIWA 1ZFSA 2NCPA 3EVVA 3VRNA 1KWOC 1M39A 1UHIA 2ZFDA 4YGDB 2ZNDA 2CTNA 3KO0A 1NCXA 4ETOA 2HQWA 2MHHA 2MA2A 4HREE 3OHMB 2M3WA 1ALWA 2M1UA 3JTDB 3CTNA 4NDCA 5I2QA 1BOCA 1GGZA 1K9PA 3PLFB 3DF0B 1B1GA 1CDLA 2JU0A 3RLZA 1CDNA 1SCMB 3FWCA 2L2EA 3BOWA 4N1FA 1SL7A 2KFHA 4PHJA 2NZ0A 4PE7A 1G8IA 1PVBA 3CR2A 1FPWA 1QJTA 3AKAA 4M2QA 4TNCA 3WHUB 1A75A 2Q4UA 2M9GA 2GV5A 3BQ3A 4CFRA 1G4YR 4YGCB 1F54A 2FCDA 1A2XA 4GGNA 5K89A 1SCVA 1ZUZA 5AANA 1BR4B 4OR9B 3SIAA 1WLZA 2AMIA 1CNPA 4ZCUA 1WDCB 1RJVA 4JPZB 5D69A 1IG5A 3AAJA 2GGZA 1NX2A 3NSLA 1DT7B 4JWQA 4MRYA 3TDIA 2V53A 2KQYA 2LMTA 1L2OC 1V1GA 1J7OA 1F55A 4CPVA 1F4QA 1TOPA 1F4OA 1GGWA 2KGBC 1J1DA 2JULA 5G08A 1OQPA 3WHTB 3WNXB 4FQOA 4MEWA 4A4BA 4MZLA 2F33A 2LM5A 1ALVA 4PCWA 2ZN9A 1AP4A 1DJGA 2NLNA 2KI6D 3RM1A 1HQVA 1SPYA 1XFUO 1LINA 1E8AA 1PULA 3BXKA 1KK8B 2LNKA 3VROA 5PALA 2BCBA 4MLWA 3SG4A 1D1OA 2ZN8A 2RGIA 1UHJA 1KFXS 1RROA 1B8CA 1UUSA 1FI5A 1YUTA 3SG5A 3CGAA 1DJXA 4PALA 2K8MB 2KYFA 1ZMZA 2PRUA 1YR5A 3PFVA 2GGMA 4YGBB 4DS7A 2H61C 4I5KA 1F8HA 2MLFC 5DKRA 1F70A 1DJZA 2WNDA 1JUOA 1AVSA 2OTGC 1VRKA 2KGRA 3BUWB 4C0LA 3MSEB 2JPTA 1J7QA 2LLSA 1EG3A 1GQMA 1QXPA 3D0YA 1XFYO 1CLMA 2VRGA 3BUMB 1X02A 1SY9A 1K90D 2IS9A 3SJSA 1W7JB 1K93D 1AUIB 1NCYA 4C0KA 3CWGA 2QACA 1SR6C 1TN4A 1CFCA 1XK4C 1OMDA 2F2OA 3EKHA 3I5FB 1SL8A 3WXAA 2JT0A 2WOSA 1UP5A 1J7PA 1JF2A 1LVCD 4MZKA 1L7ZA 4BY4A 3E3RA 1PSBA 1XVJA 2M1KB 4NQGA 1BLQA 1YURA 1BMOA 3TUYB 4XJKA 5CSIA 3GK4X 1TNWA 5J3XA 1PALA 4UPGA 4PE0A 2CNPA 1BU3A 1MQ1A 1TCFA 2MJWB 1KQMB 1QX2A 3K21A 2K7BA 3M0WA 4DRWA 1F71A 4YI9A 2LANA 2LC5A 2M49B 2Y1NA 1NPQA 1S5GZ 1M63B 3JTDC 4QJ5B 4GAOA 2SCPA 1QTXA 2JTZA 1U5IB 3SG6A 1DMOA 4M2PA 2PASA 3GOFA 1EJ3A 1B9AA 1XYDA 3KHEA 1Y6WA 2BE6A 3VRQA 3ICBA 2K2FA 1JFKA 2OS8B 3KPXA 1B47A 1J1EA 1NUBA 1DJHA 2M97A 2F8PA 2NCOA 1DJIA 1DVIA 1C7WA 1ZACA 2LAPA 1UHNA 5DKQA 1XFWO 1EG4A 1QVIZ 2G2BA 1TRFA 3H4SE 2ZRSA 2Y5IA 1DJYA 4PE4A 2BKHB 2AAOA 4F0ZB 1CKKA 3O4YA 3I5IB 4M2OA 2K7OA 1IH0A 2LLUA 2LP2A 3TS5C 1S6CA 4OKHA 2JNFA 2BECA 3SG7A 1CMGA 1H4BA 2WCBA 1RFJA 2BBMA 4OVNF 2LVJA 2WCEA 2I18A 4WQ2A 3DVKA 4YRUA 4P2YB 1CM4A 3JVTC 4OCIA 4AQIA 4AQJA 2JXLA 3D10A 3DVEA 2BKIB 4DIRA 2Y4QA 4ORCB 4WQ3A 2LP3A 5HKYA 1FF1A 4GPLB 4ICBA 4QJ3B 2K0JA 2JZIA 4MVFA 1YX7A 4PHKA 2BBNA 1HT9A 2F2PA 2LVVA 3ZWHA 5CPVA 1QVIY 3LLEA 1QIVA 1XA5A 1DF0A 2KFFA 1SW8A 2F3ZA 1QASA 2KAXA 2G9BA 1S6IA 1MXLC 1JSAA 3I5FC 1Y0VH 1KFUS 4HSZA 3KEVA 1M45A 5HKZA 3ZNIA 1Y1AA 1XFVO 2BCXA 1KWOB 1S6JA 5ER4X 2OTGB 1Y1XA 4GNKB 3OP0A 3BYAA 3GK1A 3HCMA 4MZJA 2OPOA 1OZSA 2BE4A 1EH2A 4ORAB 1SRAA 1K9UA 1LXFC 1WRLA 1NIWA 4PHNA 3I5GB 1YVLA 1SCMC 1A03A 3A4UB 2BCAA 1IJ6A 3DVJA 4GBAA 4GGFA 3DF0A 3SG2A 1AJ4A 2LLTA 1KCYA 3I5HB 3NXAA 4R1EA 1NCZA 1NX1A 3DVMA 1K2HA 2KAVA 1JWDA 3NSOA 2M7LA 4A4CA 1J7RA 1C7VA 3VRPA 1NX3A 1K95A 1OMRA 3BOWB 4HRGA 4PHMA 1MXEA 1N0YA 3PM8A 3NSIA 1KQVA 1MUXA 1NSHA 2KBMA 1CLBA 1AHRA 2CXJA 3BUNB 2BL0C 2JQ6A 1QV1A 2MRDA 1CFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1E A;  2KI6 C;  1KSM A;  1S36 A;  3CR4 X;  1OMV A;  2CCM A;  4YGE B;  5DKN A;  5KSZ A;  2L0P A;  2HQ8 A;  1IRJ A;  3FWB A;  2EC6 C;  2PMY A;  5AXI A;  2KI4 B;  1SK6 D;  4CID A;  1RK9 A;  2KHN A;  1LKJ A;  1SBJ A;  2I94 A;  2EHB A;  2K7C A;  1KK7 Y;  2PAL A;  2ISD A;  3I5G C;  2A4J A;  4C0J A;  2JXC A;  2MAZ A;  3C1V A;  1M46 A;  5B8I B;  2LUC A;  2HPS A;  1EXR A;  2KQ6 A;  1SR6 B;  3PN7 B;  5HLO A;  2L4I A;  4N1G A;  1PK0 D;  2JWW A;  1CTR A;  3TDU A;  3PN7 C;  1PVA A;  5TNC A;  3EVR A;  4USL A;  1OZO A;  2LUX A;  4FTG A;  2NXQ A;  4YGA A;  5HLV A;  5AEQ A;  2LCP A;  2MBX A;  1U5I A;  3I5I C;  1SMG A;  2LVK A;  3PSR A;  1IQ3 A;  1NWD A;  2JOJ A;  5JJG A;  4XYN A;  4GFT A;  2P6B B;  2ZNE A;  3LK0 A;  5I2L A;  4BY5 A;  1AK8 A;  1LA3 A;  2L50 A;  1OSA A;  3NSK A;  4CLN A;  4QJ4 B;  2JT3 A;  3CR5 X;  1QV0 A;  5F6T A;  4DCK A;  1SYM A;  1YUS A;  2M7N A;  2KOT A;  2CT9 A;  1MF8 B;  3DD4 A;  5IBW A;  2KNE A;  3KF9 A;  4GGF C;  2BL0 B;  2MLE C;  1UHK A;  1FBV A;  2LVI A;  3EK7 A;  2FJU B;  3FS7 A;  1R6P A;  1PRW A;  3JVT B;  2L5X B;  1WLM A;  1H8B A;  3IQO A;  1JF0 A;  2ZKM X;  4Q04 A;  5HYD A;  4NDB A;  2M0R A;  1N2D A;  1A4P A;  4DUQ A;  1YVH A;  2I2R E;  1RWY A;  1SL9 A;  3LK1 A;  1MHO A;  3GK2 A;  1B8L A;  1SKT A;  2JTT A;  2SAS A;  2I7A A;  5JOL A;  2M29 A;  5FYX A;  1IWQ A;  1S3P A;  2L51 A;  3EKJ A;  2D8N A;  2COL B;  3TUY C;  1Q80 A;  1A29 A;  1B7T Z;  5KTY A;  1OE9 B;  1BF5 A;  1EL4 A;  2M8U A;  3OX6 A;  5GQQ C;  1UHH A;  4IL1 A;  3QRX A;  4P5O E;  3D0Y B;  3CS1 A;  4MSP A;  5AFP A;  1Y1U A;  2OS8 C;  2FOT A;  3VRR A;  3FIA A;  3BUO B;  1A75 B;  4XJK B;  1TNQ A;  2KI4 C;  1S5G Y;  4MN0 A;  1M31 A;  1WRZ A;  2DOQ A;  3A8R A;  4GUK A;  3EK8 A;  5AER A;  1KFX L;  1CB1 A;  1YTZ C;  2PSR A;  3PAT A;  1IJ5 A;  1DTL A;  1QAT A;  2F3Y A;  2WC8 A;  1N65 A;  1BR1 B;  1LA0 A;  1CFD A;  1TIZ A;  1JC2 A;  2LHI A;  1MR8 A;  3LCP C;  4JQ0 D;  1KQM C;  3EK4 A;  1TCO B;  1TNX A;  1XO5 A;  1BOD A;  4ORB B;  1KFU L;  2H61 A;  4U8D A;  1B4C A;  2WOR A;  1GJY A;  4ZCV A;  2JT8 A;  1RTP 1;  5CSJ A;  2FCE A;  4I5L B;  1JFJ A;  3SIB A;  3SG3 A;  4I5J A;  3AKB A;  2K7D A;  5CSF A;  3VGO A;  5I2O A;  4PDZ A;  1C07 A;  2K61 A;  2KYC A;  3HX4 A;  1JBA A;  1SNL A;  1XFX O;  2LMV A;  3LL8 B;  4YI8 A;  1DJW A;  1G33 A;  1S26 D;  4N5X A;  1WRK A;  2JC2 A;  2O60 A;  2WCF A;  3O6B A;  2L4H A;  2LV7 A;  4PE1 A;  3IQQ A;  5CSN A;  5I8N A;  1ODB A;  3CLN A;  1IKU A;  1CDP A;  3OB1 B;  1K94 A;  1J55 A;  1NX0 A;  1ZOT B;  5ER5 A;  1CDM A;  3F45 A;  4YBH B;  2KBI A;  2E30 A;  2E6W A;  1YRU B;  2H2K A;  3IF7 A;  1BJF A;  1BT6 A;  1FW4 A;  1QLK A;  2CBL A;  1KSO A;  4CFQ A;  2B1U A;  4E68 A;  2L98 A;  2R2I A;  2Q91 A;  5KU1 A;  1YRT B;  2EC6 B;  4WRI A;  2LHL A;  1XK4 A;  3OB2 B;  3EVU A;  3O2P A;  4OV2 A;  1MWN A;  1S1E A;  2KSP A;  3CZT X;  1V1F A;  1QLS A;  3AAK A;  1QX5 B;  2AUC A;  2K2A A;  2KAY A;  1B8R A;  1IQ5 A;  1OOJ A;  1PSR A;  1QX7 A;  4HRH A;  2JNX A;  4MBE A;  4I5N B;  1YUU A;  1QS7 A;  1YX8 A;  1R2U A;  3O78 A;  2HET A;  2JRF A;  2LMU A;  1K9K A;  2LE9 B;  5D7F A;  1KK8 C;  1REC A;  2KDH A;  2ZRT A;  3I5H C;  4AOM A;  5BPJ A;  1B7T Y;  1UWO A;  2TN4 A;  3PAL A;  1KK7 Z;  1L2O B;  2O5G A;  3OX5 A;  2QPT A;  1IGV A;  1CFP A;  1BG1 A;  1TNP A;  1K96 A;  2EGD A;  2KFG A;  1FI6 A;  1DGV A;  1DGU A;  1CMF A;  1UUR A;  2Y1M A;  3BUX B;  3TS5 B;  1WY9 A;  4MRX A;  1CM1 A;  1CLL A;  1XFZ O;  4L9M A;  2HF5 A;  1W7I B;  1DF0 B;  1AJ5 A;  1K8U A;  1NYA A;  1WDC C;  2PVB A;  3TZ1 A;  4NDD A;  3TDZ A;  5HKW A;  1NP8 A;  1TTX A;  1QIW A;  1ZFS A;  2NCP A;  3EVV A;  3VRN A;  1KWO C;  1M39 A;  1UHI A;  2ZFD A;  4YGD B;  2ZND A;  2CTN A;  3KO0 A;  1NCX A;  4ETO A;  2HQW A;  2MHH A;  2MA2 A;  4HRE E;  3OHM B;  2M3W A;  1ALW A;  2M1U A;  3JTD B;  3CTN A;  4NDC A;  5I2Q A;  1BOC A;  1GGZ A;  1K9P A;  3PLF B;  3DF0 B;  1B1G A;  1CDL A;  2JU0 A;  3RLZ A;  1CDN A;  1SCM B;  3FWC A;  2L2E A;  3BOW A;  4N1F A;  1SL7 A;  2KFH A;  4PHJ A;  2NZ0 A;  4PE7 A;  1G8I A;  1PVB A;  3CR2 A;  1FPW A;  1QJT A;  3AKA A;  4M2Q A;  4TNC A;  3WHU B;  1A75 A;  2Q4U A;  2M9G A;  2GV5 A;  3BQ3 A;  4CFR A;  1G4Y R;  4YGC B;  1F54 A;  2FCD A;  1A2X A;  4GGN A;  5K89 A;  1SCV A;  1ZUZ A;  5AAN A;  1BR4 B;  4OR9 B;  3SIA A;  1WLZ A;  2AMI A;  1CNP A;  4ZCU A;  1WDC B;  1RJV A;  4JPZ B;  5D69 A;  1IG5 A;  3AAJ A;  2GGZ A;  1NX2 A;  3NSL A;  1DT7 B;  4JWQ A;  4MRY A;  3TDI A;  2V53 A;  2KQY A;  2LMT A;  1L2O C;  1V1G A;  1J7O A;  1F55 A;  4CPV A;  1F4Q A;  1TOP A;  1F4O A;  1GGW A;  2KGB C;  1J1D A;  2JUL A;  5G08 A;  1OQP A;  3WHT B;  3WNX B;  4FQO A;  4MEW A;  4A4B A;  4MZL A;  2F33 A;  2LM5 A;  1ALV A;  4PCW A;  2ZN9 A;  1AP4 A;  1DJG A;  2NLN A;  2KI6 D;  3RM1 A;  1HQV A;  1SPY A;  1XFU O;  1LIN A;  1E8A A;  1PUL A;  3BXK A;  1KK8 B;  2LNK A;  3VRO A;  5PAL A;  2BCB A;  4MLW A;  3SG4 A;  1D1O A;  2ZN8 A;  2RGI A;  1UHJ A;  1KFX S;  1RRO A;  1B8C A;  1UUS A;  1FI5 A;  1YUT A;  3SG5 A;  3CGA A;  1DJX A;  4PAL A;  2K8M B;  2KYF A;  1ZMZ A;  2PRU A;  1YR5 A;  3PFV A;  2GGM A;  4YGB B;  4DS7 A;  2H61 C;  4I5K A;  1F8H A;  2MLF C;  5DKR A;  1F70 A;  1DJZ A;  2WND A;  1JUO A;  1AVS A;  2OTG C;  1VRK A;  2KGR A;  3BUW B;  4C0L A;  3MSE B;  2JPT A;  1J7Q A;  2LLS A;  1EG3 A;  1GQM A;  1QXP A;  3D0Y A;  1XFY O;  1CLM A;  2VRG A;  3BUM B;  1X02 A;  1SY9 A;  1K90 D;  2IS9 A;  3SJS A;  1W7J B;  1K93 D;  1AUI B;  1NCY A;  4C0K A;  3CWG A;  2QAC A;  1SR6 C;  1TN4 A;  1CFC A;  1XK4 C;  1OMD A;  2F2O A;  3EKH A;  3I5F B;  1SL8 A;  3WXA A;  2JT0 A;  2WOS A;  1UP5 A;  1J7P A;  1JF2 A;  1LVC D;  4MZK A;  1L7Z A;  4BY4 A;  3E3R A;  1PSB A;  1XVJ A;  2M1K B;  4NQG A;  1BLQ A;  1YUR A;  1BMO A;  3TUY B;  4XJK A;  5CSI A;  3GK4 X;  1TNW A;  5J3X A;  1PAL A;  4UPG A;  4PE0 A;  2CNP A;  1BU3 A;  1MQ1 A;  1TCF A;  2MJW B;  1KQM B;  1QX2 A;  3K21 A;  2K7B A;  3M0W A;  4DRW A;  1F71 A;  4YI9 A;  2LAN A;  2LC5 A;  2M49 B;  2Y1N A;  1NPQ A;  1S5G Z;  1M63 B;  3JTD C;  4QJ5 B;  4GAO A;  2SCP A;  1QTX A;  2JTZ A;  1U5I B;  3SG6 A;  1DMO A;  4M2P A;  2PAS A;  3GOF A;  1EJ3 A;  1B9A A;  1XYD A;  3KHE A;  1Y6W A;  2BE6 A;  3VRQ A;  3ICB A;  2K2F A;  1JFK A;  2OS8 B;  3KPX A;  1B47 A;  1J1E A;  1NUB A;  1DJH A;  2M97 A;  2F8P A;  2NCO A;  1DJI A;  1DVI A;  1C7W A;  1ZAC A;  2LAP A;  1UHN A;  5DKQ A;  1XFW O;  1EG4 A;  1QVI Z;  2G2B A;  1TRF A;  3H4S E;  2ZRS A;  2Y5I A;  1DJY A;  4PE4 A;  2BKH B;  2AAO A;  4F0Z B;  1CKK A;  3O4Y A;  3I5I B;  4M2O A;  2K7O A;  1IH0 A;  2LLU A;  2LP2 A;  3TS5 C;  1S6C A;  4OKH A;  2JNF A;  2BEC A;  3SG7 A;  1CMG A;  1H4B A;  2WCB A;  1RFJ A;  2BBM A;  4OVN F;  2LVJ A;  2WCE A;  2I18 A;  4WQ2 A;  3DVK A;  4YRU A;  4P2Y B;  1CM4 A;  3JVT C;  4OCI A;  4AQI A;  4AQJ A;  2JXL A;  3D10 A;  3DVE A;  2BKI B;  4DIR A;  2Y4Q A;  4ORC B;  4WQ3 A;  2LP3 A;  5HKY A;  1FF1 A;  4GPL B;  4ICB A;  4QJ3 B;  2K0J A;  2JZI A;  4MVF A;  1YX7 A;  4PHK A;  2BBN A;  1HT9 A;  2F2P A;  2LVV A;  3ZWH A;  5CPV A;  1QVI Y;  3LLE A;  1QIV A;  1XA5 A;  1DF0 A;  2KFF A;  1SW8 A;  2F3Z A;  1QAS A;  2KAX A;  2G9B A;  1S6I A;  1MXL C;  1JSA A;  3I5F C;  1Y0V H;  1KFU S;  4HSZ A;  3KEV A;  1M45 A;  5HKZ A;  3ZNI A;  1Y1A A;  1XFV O;  2BCX A;  1KWO B;  1S6J A;  5ER4 X;  2OTG B;  1Y1X A;  4GNK B;  3OP0 A;  3BYA A;  3GK1 A;  3HCM A;  4MZJ A;  2OPO A;  1OZS A;  2BE4 A;  1EH2 A;  4ORA B;  1SRA A;  1K9U A;  1LXF C;  1WRL A;  1NIW A;  4PHN A;  3I5G B;  1YVL A;  1SCM C;  1A03 A;  3A4U B;  2BCA A;  1IJ6 A;  3DVJ A;  4GBA A;  4GGF A;  3DF0 A;  3SG2 A;  1AJ4 A;  2LLT A;  1KCY A;  3I5H B;  3NXA A;  4R1E A;  1NCZ A;  1NX1 A;  3DVM A;  1K2H A;  2KAV A;  1JWD A;  3NSO A;  2M7L A;  4A4C A;  1J7R A;  1C7V A;  3VRP A;  1NX3 A;  1K95 A;  1OMR A;  3BOW B;  4HRG A;  4PHM A;  1MXE A;  1N0Y A;  3PM8 A;  3NSI A;  1KQV A;  1MUX A;  1NSH A;  2KBM A;  1CLB A;  1AHR A;  2CXJ A;  3BUN B;  2BL0 C;  2JQ6 A;  1QV1 A;  2MRD A;  1CFF A; 
#chains in the Genus database with same CATH topology
 2KLD A;  3SS3 A;  4D1E A;  2KI6 C;  1KSM A;  1S36 A;  3CR4 X;  1OMV A;  2CCM A;  4YGE B;  5DKN A;  5KSZ A;  2L0P A;  2HQ8 A;  1IRJ A;  3FWB A;  2EC6 C;  2PMY A;  3O4X A;  2KI4 B;  1SK6 D;  5AXI A;  4CID A;  1RK9 A;  1LS8 A;  1LKJ A;  2KHN A;  3FE8 A;  1SBJ A;  2I94 A;  2EHB A;  2K7C A;  1KK7 Y;  2PAL A;  2ISD A;  3I5G C;  2A4J A;  4C0J A;  2JXC A;  2MAZ A;  3C1V A;  1M46 A;  5B8I B;  2LUC A;  2HPS A;  1EXR A;  1OW4 A;  1SR6 B;  2KQ6 A;  3PN7 B;  5HLO A;  2L4I A;  4N1G A;  1PK0 D;  2JWW A;  3K1E A;  5HL1 A;  1CTR A;  3TDU A;  3PN7 C;  1C3Y A;  1PVA A;  5TNC A;  3EVR A;  4USL A;  1OZO A;  2LUX A;  4FTG A;  5FI6 A;  2NXQ A;  3V2L A;  4YGA A;  5HLV A;  5AEQ A;  2LCP A;  3NHI A;  2MBX A;  1U5I A;  3I5I C;  1SMG A;  2LVK A;  3PSR A;  1IQ3 A;  1NWD A;  1TUJ A;  3D75 A;  2JOJ A;  5JJG A;  4XYN A;  4GFT A;  2P6B B;  2ZNE A;  3LK0 A;  5I2L A;  4BY5 A;  1AK8 A;  1LA3 A;  2WC5 A;  2L50 A;  2QDI A;  4OZD A;  1OSA A;  3NSK A;  4CLN A;  4QJ4 B;  2JT3 A;  3CR5 X;  1GM0 A;  1QV0 A;  5F6T A;  4DCK A;  1SYM A;  1YUS A;  2M7N A;  2KOT A;  2QEV A;  2CT9 A;  1MF8 B;  3CZ2 A;  3DD4 A;  2KNE A;  3KF9 A;  4GGF C;  5IBW A;  2BL0 B;  2MLE C;  2WC6 A;  1UHK A;  1FBV A;  2LVI A;  3EK7 A;  2FJU B;  3FS7 A;  1R6P A;  1PRW A;  3JVT B;  2L5X B;  1WLM A;  1H8B A;  3IQO A;  1JF0 A;  1Z4H A;  2ZKM X;  4Q04 A;  3EG5 B;  5HYD A;  4NDB A;  2M0R A;  1N2D A;  1A4P A;  4DUQ A;  1ORG A;  1T14 A;  1YVH A;  2I2R E;  1RWY A;  1SL9 A;  3LK1 A;  1MHO A;  3GK2 A;  1B8L A;  1SKT A;  2JTT A;  2SAS A;  2I7A A;  5JOL A;  2M29 A;  5FYX A;  1IWQ A;  1S3P A;  2L51 A;  3EKJ A;  2D8N A;  2COL B;  3TUY C;  1Q80 A;  1A29 A;  1B7T Z;  5KTY A;  1OE9 B;  1BF5 A;  1EL4 A;  2M8U A;  3OX6 A;  5GQQ C;  1UHH A;  4IL1 A;  3Q8I A;  3QRX A;  4P5O E;  3D0Y B;  3CS1 A;  4MSP A;  5AFP A;  1Y1U A;  2OS8 C;  2FOT A;  3CZ0 A;  3VRR A;  3FIA A;  3BUO B;  1A75 B;  3UNW A;  4XJK B;  1TNQ A;  2KI4 C;  1S5G Y;  2WCH A;  3DXL A;  3R1V A;  4MN0 A;  3DYE A;  2KPH A;  1M31 A;  1WRZ A;  2DOQ A;  3A8R A;  3CDN A;  4GUK A;  3EK8 A;  5AER A;  1KFX L;  1CB1 A;  1YTZ C;  1C3Z A;  2PSR A;  3PAT A;  3VB1 A;  1IJ5 A;  1DTL A;  1QAT A;  2F3Y A;  2WC8 A;  1N65 A;  3FE6 A;  1BR1 B;  1LA0 A;  1CFD A;  1TIZ A;  1JC2 A;  2LHI A;  1MR8 A;  3LCP C;  2K60 A;  4JQ0 D;  1KQM C;  3EK4 A;  1TCO B;  1TNX A;  1XO5 A;  2BNX A;  2KLE A;  4ORB B;  1KFU L;  1BOD A;  2H61 A;  4U8D A;  1B4C A;  2WOR A;  1GJY A;  4ZCV A;  2JT8 A;  1RTP 1;  5CSJ A;  2FCE A;  4I5L B;  1JFJ A;  3SIB A;  3SG3 A;  4I5J A;  3AKB A;  2K7D A;  5CSF A;  3VGO A;  5I2O A;  4PDZ A;  1C07 A;  2K61 A;  2KYC A;  3HX4 A;  1JBA A;  1SNL A;  1XFX O;  2LMV A;  3LL8 B;  4YI8 A;  1DJW A;  1G33 A;  1S26 D;  4N5X A;  1DEK A;  3S0D A;  1WRK A;  2JC2 A;  2O60 A;  2WCF A;  3O6B A;  2L4H A;  3D77 A;  2WCJ A;  5FI7 A;  2LV7 A;  4PE1 A;  3IQQ A;  4INX A;  5CSN A;  5I8N A;  1ODB A;  3CLN A;  1DEL A;  1IKU A;  1CDP A;  3OB1 B;  1K94 A;  1J55 A;  1NX0 A;  1ZOT B;  5ER5 A;  1CDM A;  3F45 A;  4YBH B;  2KBI A;  2E30 A;  2E6W A;  1YRU B;  2H2K A;  3IF7 A;  1BJF A;  1BT6 A;  1FW4 A;  1QLK A;  2CBL A;  1KSO A;  3NHT A;  2B1U A;  4CFQ A;  4E68 A;  2L98 A;  2P70 A;  2Q91 A;  2R2I A;  5KU1 A;  1YRT B;  2EC6 B;  4WRI A;  2LHL A;  1XK4 A;  3OB2 B;  3EVU A;  3O2P A;  1OOH A;  4OV2 A;  1MWN A;  2H8V A;  1S1E A;  2KSP A;  3CZT X;  1V1F A;  1QLS A;  3AAK A;  3BFA A;  1QX5 B;  2AUC A;  2K2A A;  2KAY A;  3B86 A;  1B8R A;  1IQ5 A;  1OOJ A;  1PSR A;  1QX7 A;  4HRH A;  2JNX A;  4MBE A;  4I5N B;  1YUU A;  1QS7 A;  1YX8 A;  1R2U A;  3O78 A;  2HET A;  4JKT A;  2JRF A;  2LMU A;  1K9K A;  2LE9 B;  5D7F A;  1KK8 C;  1REC A;  2KDH A;  2ZRT A;  3I5H C;  4AOM A;  5BPJ A;  1B7T Y;  1UWO A;  1DQE A;  2TN4 A;  3PAL A;  1KK7 Z;  1L2O B;  2O5G A;  3OX5 A;  2QPT A;  1IGV A;  1W9Z A;  4F7F A;  1BG1 A;  1CFP A;  5EL2 A;  5FI2 A;  1TNP A;  1K96 A;  2EGD A;  2KFG A;  1OOG A;  1DGV A;  1FI6 A;  1DGU A;  3N7H A;  1UUR A;  2Y1M A;  3BUX B;  3TS5 B;  1CMF A;  1WY9 A;  3QME A;  4MRX A;  1CM1 A;  1CLL A;  1XFZ O;  4L9M A;  2HF5 A;  1W7I B;  1DC1 A;  1DF0 B;  1AJ5 A;  1K8U A;  1NYA A;  1WDC C;  2PVB A;  3TZ1 A;  4NDD A;  3TDZ A;  5HKW A;  3B88 A;  1NP8 A;  1TTX A;  1QIW A;  1ZFS A;  2NCP A;  3BFH A;  3EVV A;  3VRN A;  1KWO C;  2PYQ A;  1M39 A;  1UHI A;  2ZFD A;  4YGD B;  1OOF A;  2ZND A;  2CTN A;  3KO0 A;  1NCX A;  4ETO A;  2HQW A;  2MHH A;  2MA2 A;  4HRE E;  3OHM B;  3S0G A;  2M3W A;  1ALW A;  2M1U A;  3CAB A;  3CZ1 A;  3JTD B;  3CTN A;  4NDC A;  5I2Q A;  1BOC A;  1GGZ A;  1K9P A;  3PLF B;  3DF0 B;  1B1G A;  3UO9 A;  2QEO A;  2WCL A;  1CDL A;  2JU0 A;  3RLZ A;  1CDN A;  1SCM B;  3FWC A;  2L2E A;  3BOW A;  5I94 A;  4N1F A;  1SL7 A;  2KFH A;  4PHJ A;  2NZ0 A;  4PE7 A;  3DZT A;  1G8I A;  1PVB A;  3CR2 A;  1FPW A;  1QJT A;  3AKA A;  4M2Q A;  4TNC A;  3WHU B;  1A75 A;  2Q4U A;  2M9G A;  2GV5 A;  3BQ3 A;  4CFR A;  1G4Y R;  4YGC B;  1F54 A;  2FCD A;  1A2X A;  4GGN A;  5K89 A;  1SCV A;  1ZUZ A;  5AAN A;  1BR4 B;  4OR9 B;  3SIA A;  1WLZ A;  2AMI A;  2YGU A;  4ZCU A;  1CNP A;  4INW A;  3D78 A;  1WDC B;  1RJV A;  4JPZ B;  3L4L A;  5D69 A;  1IG5 A;  3AAJ A;  1Z2C B;  2GGZ A;  1NX2 A;  3NSL A;  2GTE A;  1DT7 B;  1OOI X;  4JWQ A;  4MRY A;  3TDI A;  2V53 A;  2KQY A;  2LMT A;  1L2O C;  1V1G A;  1J7O A;  1F55 A;  4CPV A;  1F4Q A;  1TOP A;  1F4O A;  1GGW A;  2KGB C;  1J1D A;  2JUL A;  2QEH A;  1OQP A;  5G08 A;  3WHT B;  3WNX B;  4FQO A;  4MEW A;  4A4B A;  4MZL A;  2F33 A;  2LM5 A;  1ALV A;  4PCW A;  2ZN9 A;  1QWV A;  1AP4 A;  1DJG A;  3PM2 A;  2NLN A;  2KI6 D;  3PJI A;  3RM1 A;  4IJ7 A;  1HQV A;  1SPY A;  1XFU O;  1LIN A;  1E8A A;  1PUL A;  3BXK A;  1KK8 B;  2LNK A;  3VRO A;  5PAL A;  2BCB A;  4MLW A;  3SG4 A;  1D1O A;  2L2C A;  2RGI A;  1UHJ A;  1KFX S;  1RRO A;  2ZN8 A;  3S0B A;  1B8C A;  1UUS A;  1FI5 A;  1YUT A;  3SG5 A;  3CGA A;  1DJX A;  4PT1 A;  4PAL A;  2K8M B;  2KYF A;  1ZMZ A;  2PRU A;  1YR5 A;  3PFV A;  2GGM A;  4YGB B;  3FE9 A;  2H61 C;  4DS7 A;  4I5K A;  1F8H A;  2MLF C;  5D3O A;  5DKR A;  1F70 A;  1DJZ A;  2WND A;  1JUO A;  1AVS A;  2OTG C;  1VRK A;  2KGR A;  3BUW B;  4C0L A;  3MSE B;  2JPT A;  1J7Q A;  2LLS A;  1EG3 A;  1GQM A;  1QXP A;  3D0Y A;  1XFY O;  1CLM A;  2VRG A;  3BUM B;  1X02 A;  1SY9 A;  3D73 A;  1K90 D;  2IS9 A;  3SJS A;  1W7J B;  3R1O A;  1K93 D;  1AUI B;  3BFB A;  1NCY A;  4C0K A;  3CWG A;  2QAC A;  1SR6 C;  1TN4 A;  2ERB A;  2QEB A;  1CFC A;  1XK4 C;  1OMD A;  2F2O A;  3RZS A;  3EKH A;  3I5F B;  1SL8 A;  3WXA A;  2JT0 A;  2WOS A;  1UP5 A;  2P71 A;  1J7P A;  1JF2 A;  1LVC D;  4MZK A;  1L7Z A;  4BY4 A;  1TUZ A;  1PSB A;  3E3R A;  3R1P A;  1XVJ A;  2M1K B;  4NQG A;  1BLQ A;  2L5Y A;  1YUR A;  2JPO A;  1BMO A;  3TUY B;  4XJK A;  5CSI A;  2WCK A;  3GK4 X;  1TNW A;  5J3X A;  1PAL A;  4UPG A;  4PE0 A;  2CNP A;  1BU3 A;  1MQ1 A;  1TCF A;  2MJW B;  1KQM B;  1QX2 A;  3K21 A;  2K7B A;  3M0W A;  4DRW A;  2WCM A;  1F71 A;  2BAP A;  4YI9 A;  2LAN A;  1SSE B;  2LC5 A;  2M49 B;  2Y1N A;  3CYZ A;  5DIC A;  1NPQ A;  1S5G Z;  1M63 B;  3JTD C;  4QJ5 B;  4GAO A;  2SCP A;  1TWO A;  1QTX A;  2JTZ A;  1U5I B;  3SG6 A;  1DMO A;  4M2P A;  2PAS A;  3GOF A;  1EJ3 A;  3B87 A;  1B9A A;  1XYD A;  3KHE A;  3OBV A;  1Y6W A;  2BE6 A;  3VRQ A;  1IIO A;  3ICB A;  2K2F A;  3SS4 A;  1JFK A;  2OS8 B;  3KPX A;  1B47 A;  1J1E A;  1NUB A;  1DJH A;  2M97 A;  2F8P A;  2NCO A;  4KYN A;  3D74 A;  1DJI A;  1XFR A;  1DVI A;  1C7W A;  1ZAC A;  2LAP A;  3L47 A;  1UHN A;  3BJH A;  5DKQ A;  2PQL A;  1XFW O;  3B6X A;  1EG4 A;  1QVI Z;  2G2B A;  1TRF A;  3H4S E;  2ZRS A;  2Y5I A;  1DJY A;  4PE4 A;  2BKH B;  2AAO A;  3OGN A;  4F0Z B;  1CKK A;  3O4Y A;  3I5I B;  4M2O A;  2FJY A;  2K7O A;  2LLU A;  1IH0 A;  3SS5 A;  2LP2 A;  3TS5 C;  1S6C A;  4OKH A;  2JNF A;  2BEC A;  3SG7 A;  1CMG A;  1H4B A;  2WCB A;  1RFJ A;  1P28 A;  2BBM A;  4OVN F;  2LVJ A;  2WCE A;  3B7A A;  2I18 A;  4WQ2 A;  3DVK A;  4YRU A;  4P2Y B;  1CM4 A;  3JVT C;  4OCI A;  4AQI A;  4AQJ A;  2JXL A;  3D10 A;  3S0F A;  3DVE A;  2BKI B;  4DIR A;  2Y4Q A;  4ORC B;  3DY9 A;  4WQ3 A;  2LP3 A;  5HKY A;  1FF1 A;  4GPL B;  4ICB A;  3D76 A;  4QJ3 B;  2K0J A;  2JZI A;  4MVF A;  3L4A A;  1YX7 A;  4PHK A;  2BBN A;  1HT9 A;  2F2P A;  2LVV A;  3ZWH A;  5CPV A;  4FQT A;  1QVI Y;  3LLE A;  1QIV A;  1XA5 A;  1DF0 A;  2KFF A;  3IVT A;  1SW8 A;  2F3Z A;  1QAS A;  2KAX A;  4JD9 A;  2G9B A;  1S6I A;  1MXL C;  1JSA A;  3R72 A;  3I5F C;  1Y0V H;  1KFU S;  4HSZ A;  3KEV A;  1M45 A;  5HKZ A;  3ZNI A;  1Y1A A;  1XFV O;  2BCX A;  1KWO B;  1S6J A;  5ER4 X;  2OTG B;  1Y1X A;  4GNK B;  3OP0 A;  3BYA A;  3GK1 A;  3HCM A;  4MZJ A;  2OPO A;  1OZS A;  2BE4 A;  3NGV A;  4ORA B;  1EH2 A;  1SRA A;  1K9U A;  1LXF C;  3S0E A;  1WRL A;  1NIW A;  4PHN A;  3I5G B;  1YVL A;  1SCM C;  1A03 A;  3A4U B;  2BCA A;  1IJ6 A;  3DVJ A;  4GBA A;  4GGF A;  3DF0 A;  3SG2 A;  1AJ4 A;  2LLT A;  1KCY A;  3I5H B;  3NXA A;  4R1E A;  3S0A A;  1NCZ A;  1NX1 A;  3DVM A;  1K2H A;  2KAV A;  1JWD A;  3NSO A;  2M7L A;  4A4C A;  1J7R A;  1C7V A;  3VRP A;  1NX3 A;  1K95 A;  1OMR A;  3BOW B;  4HRG A;  4PHM A;  1MXE A;  1N0Y A;  3PM8 A;  3NSI A;  1KQV A;  1MUX A;  1NSH A;  2KBM A;  1CLB A;  1AHR A;  2CXJ A;  3BUN B;  2BL0 C;  2JQ6 A;  1QV1 A;  2MRD A;  1CFF A; 
#chains in the Genus database with same CATH homology
 4D1E A;  2KI6 C;  1KSM A;  1S36 A;  3CR4 X;  1OMV A;  2CCM A;  4YGE B;  5DKN A;  5KSZ A;  2L0P A;  2HQ8 A;  1IRJ A;  3FWB A;  2EC6 C;  2PMY A;  5AXI A;  2KI4 B;  1SK6 D;  4CID A;  1RK9 A;  2KHN A;  1LKJ A;  1SBJ A;  2I94 A;  2EHB A;  2K7C A;  1KK7 Y;  2PAL A;  2ISD A;  3I5G C;  2A4J A;  4C0J A;  2JXC A;  2MAZ A;  3C1V A;  1M46 A;  5B8I B;  2LUC A;  2HPS A;  1EXR A;  2KQ6 A;  1SR6 B;  3PN7 B;  5HLO A;  2L4I A;  4N1G A;  1PK0 D;  2JWW A;  1CTR A;  3TDU A;  3PN7 C;  1PVA A;  5TNC A;  3EVR A;  4USL A;  1OZO A;  2LUX A;  4FTG A;  2NXQ A;  4YGA A;  5HLV A;  5AEQ A;  2LCP A;  2MBX A;  1U5I A;  3I5I C;  1SMG A;  2LVK A;  3PSR A;  1IQ3 A;  1NWD A;  2JOJ A;  5JJG A;  4XYN A;  4GFT A;  2P6B B;  2ZNE A;  3LK0 A;  5I2L A;  4BY5 A;  1AK8 A;  1LA3 A;  2L50 A;  1OSA A;  3NSK A;  4CLN A;  4QJ4 B;  2JT3 A;  3CR5 X;  1QV0 A;  5F6T A;  4DCK A;  1SYM A;  1YUS A;  2M7N A;  2KOT A;  2CT9 A;  1MF8 B;  3DD4 A;  5IBW A;  2KNE A;  3KF9 A;  4GGF C;  2BL0 B;  2MLE C;  1UHK A;  1FBV A;  2LVI A;  3EK7 A;  2FJU B;  3FS7 A;  1R6P A;  1PRW A;  3JVT B;  2L5X B;  1WLM A;  1H8B A;  3IQO A;  1JF0 A;  2ZKM X;  4Q04 A;  5HYD A;  4NDB A;  2M0R A;  1N2D A;  1A4P A;  4DUQ A;  1YVH A;  2I2R E;  1RWY A;  1SL9 A;  3LK1 A;  1MHO A;  3GK2 A;  1B8L A;  1SKT A;  2JTT A;  2SAS A;  2I7A A;  5JOL A;  2M29 A;  5FYX A;  1IWQ A;  1S3P A;  2L51 A;  3EKJ A;  2D8N A;  2COL B;  3TUY C;  1Q80 A;  1A29 A;  1B7T Z;  5KTY A;  1OE9 B;  1BF5 A;  1EL4 A;  2M8U A;  3OX6 A;  5GQQ C;  1UHH A;  4IL1 A;  3QRX A;  4P5O E;  3D0Y B;  3CS1 A;  4MSP A;  5AFP A;  1Y1U A;  2OS8 C;  2FOT A;  3VRR A;  3FIA A;  3BUO B;  1A75 B;  4XJK B;  1TNQ A;  2KI4 C;  1S5G Y;  4MN0 A;  1M31 A;  1WRZ A;  2DOQ A;  3A8R A;  4GUK A;  3EK8 A;  5AER A;  1KFX L;  1CB1 A;  1YTZ C;  2PSR A;  3PAT A;  1IJ5 A;  1DTL A;  1QAT A;  2F3Y A;  2WC8 A;  1N65 A;  1BR1 B;  1LA0 A;  1CFD A;  1TIZ A;  1JC2 A;  2LHI A;  1MR8 A;  3LCP C;  4JQ0 D;  1KQM C;  3EK4 A;  1TCO B;  1TNX A;  1XO5 A;  1BOD A;  4ORB B;  1KFU L;  2H61 A;  4U8D A;  1B4C A;  2WOR A;  1GJY A;  4ZCV A;  2JT8 A;  1RTP 1;  5CSJ A;  2FCE A;  4I5L B;  1JFJ A;  3SIB A;  3SG3 A;  4I5J A;  3AKB A;  2K7D A;  5CSF A;  3VGO A;  5I2O A;  4PDZ A;  1C07 A;  2K61 A;  2KYC A;  3HX4 A;  1JBA A;  1SNL A;  1XFX O;  2LMV A;  3LL8 B;  4YI8 A;  1DJW A;  1G33 A;  1S26 D;  4N5X A;  1WRK A;  2JC2 A;  2O60 A;  2WCF A;  3O6B A;  2L4H A;  2LV7 A;  4PE1 A;  3IQQ A;  5CSN A;  5I8N A;  1ODB A;  3CLN A;  1IKU A;  1CDP A;  3OB1 B;  1K94 A;  1J55 A;  1NX0 A;  1ZOT B;  5ER5 A;  1CDM A;  3F45 A;  4YBH B;  2KBI A;  2E30 A;  2E6W A;  1YRU B;  2H2K A;  3IF7 A;  1BJF A;  1BT6 A;  1FW4 A;  1QLK A;  2CBL A;  1KSO A;  4CFQ A;  2B1U A;  4E68 A;  2L98 A;  2R2I A;  2Q91 A;  5KU1 A;  1YRT B;  2EC6 B;  4WRI A;  2LHL A;  1XK4 A;  3OB2 B;  3EVU A;  3O2P A;  4OV2 A;  1MWN A;  1S1E A;  2KSP A;  3CZT X;  1V1F A;  1QLS A;  3AAK A;  1QX5 B;  2AUC A;  2K2A A;  2KAY A;  1B8R A;  1IQ5 A;  1OOJ A;  1PSR A;  1QX7 A;  4HRH A;  2JNX A;  4MBE A;  4I5N B;  1YUU A;  1QS7 A;  1YX8 A;  1R2U A;  3O78 A;  2HET A;  2JRF A;  2LMU A;  1K9K A;  2LE9 B;  5D7F A;  1KK8 C;  1REC A;  2KDH A;  2ZRT A;  3I5H C;  4AOM A;  5BPJ A;  1B7T Y;  1UWO A;  2TN4 A;  3PAL A;  1KK7 Z;  1L2O B;  2O5G A;  3OX5 A;  2QPT A;  1IGV A;  1CFP A;  1BG1 A;  1TNP A;  1K96 A;  2EGD A;  2KFG A;  1FI6 A;  1DGV A;  1DGU A;  1CMF A;  1UUR A;  2Y1M A;  3BUX B;  3TS5 B;  1WY9 A;  4MRX A;  1CM1 A;  1CLL A;  1XFZ O;  4L9M A;  2HF5 A;  1W7I B;  1DF0 B;  1AJ5 A;  1K8U A;  1NYA A;  1WDC C;  2PVB A;  3TZ1 A;  4NDD A;  3TDZ A;  5HKW A;  1NP8 A;  1TTX A;  1QIW A;  1ZFS A;  2NCP A;  3EVV A;  3VRN A;  1KWO C;  1M39 A;  1UHI A;  2ZFD A;  4YGD B;  2ZND A;  2CTN A;  3KO0 A;  1NCX A;  4ETO A;  2HQW A;  2MHH A;  2MA2 A;  4HRE E;  3OHM B;  2M3W A;  1ALW A;  2M1U A;  3JTD B;  3CTN A;  4NDC A;  5I2Q A;  1BOC A;  1GGZ A;  1K9P A;  3PLF B;  3DF0 B;  1B1G A;  1CDL A;  2JU0 A;  3RLZ A;  1CDN A;  1SCM B;  3FWC A;  2L2E A;  3BOW A;  4N1F A;  1SL7 A;  2KFH A;  4PHJ A;  2NZ0 A;  4PE7 A;  1G8I A;  1PVB A;  3CR2 A;  1FPW A;  1QJT A;  3AKA A;  4M2Q A;  4TNC A;  3WHU B;  1A75 A;  2Q4U A;  2M9G A;  2GV5 A;  3BQ3 A;  4CFR A;  1G4Y R;  4YGC B;  1F54 A;  2FCD A;  1A2X A;  4GGN A;  5K89 A;  1SCV A;  1ZUZ A;  5AAN A;  1BR4 B;  4OR9 B;  3SIA A;  1WLZ A;  2AMI A;  1CNP A;  4ZCU A;  1WDC B;  1RJV A;  4JPZ B;  5D69 A;  1IG5 A;  3AAJ A;  2GGZ A;  1NX2 A;  3NSL A;  1DT7 B;  4JWQ A;  4MRY A;  3TDI A;  2V53 A;  2KQY A;  2LMT A;  1L2O C;  1V1G A;  1J7O A;  1F55 A;  4CPV A;  1F4Q A;  1TOP A;  1F4O A;  1GGW A;  2KGB C;  1J1D A;  2JUL A;  5G08 A;  1OQP A;  3WHT B;  3WNX B;  4FQO A;  4MEW A;  4A4B A;  4MZL A;  2F33 A;  2LM5 A;  1ALV A;  4PCW A;  2ZN9 A;  1AP4 A;  1DJG A;  2NLN A;  2KI6 D;  3RM1 A;  1HQV A;  1SPY A;  1XFU O;  1LIN A;  1E8A A;  1PUL A;  3BXK A;  1KK8 B;  2LNK A;  3VRO A;  5PAL A;  2BCB A;  4MLW A;  3SG4 A;  1D1O A;  2ZN8 A;  2RGI A;  1UHJ A;  1KFX S;  1RRO A;  1B8C A;  1UUS A;  1FI5 A;  1YUT A;  3SG5 A;  3CGA A;  1DJX A;  4PAL A;  2K8M B;  2KYF A;  1ZMZ A;  2PRU A;  1YR5 A;  3PFV A;  2GGM A;  4YGB B;  4DS7 A;  2H61 C;  4I5K A;  1F8H A;  2MLF C;  5DKR A;  1F70 A;  1DJZ A;  2WND A;  1JUO A;  1AVS A;  2OTG C;  1VRK A;  2KGR A;  3BUW B;  4C0L A;  3MSE B;  2JPT A;  1J7Q A;  2LLS A;  1EG3 A;  1GQM A;  1QXP A;  3D0Y A;  1XFY O;  1CLM A;  2VRG A;  3BUM B;  1X02 A;  1SY9 A;  1K90 D;  2IS9 A;  3SJS A;  1W7J B;  1K93 D;  1AUI B;  1NCY A;  4C0K A;  3CWG A;  2QAC A;  1SR6 C;  1TN4 A;  1CFC A;  1XK4 C;  1OMD A;  2F2O A;  3EKH A;  3I5F B;  1SL8 A;  3WXA A;  2JT0 A;  2WOS A;  1UP5 A;  1J7P A;  1JF2 A;  1LVC D;  4MZK A;  1L7Z A;  4BY4 A;  3E3R A;  1PSB A;  1XVJ A;  2M1K B;  4NQG A;  1BLQ A;  1YUR A;  1BMO A;  3TUY B;  4XJK A;  5CSI A;  3GK4 X;  1TNW A;  5J3X A;  1PAL A;  4UPG A;  4PE0 A;  2CNP A;  1BU3 A;  1MQ1 A;  1TCF A;  2MJW B;  1KQM B;  1QX2 A;  3K21 A;  2K7B A;  3M0W A;  4DRW A;  1F71 A;  4YI9 A;  2LAN A;  2LC5 A;  2M49 B;  2Y1N A;  1NPQ A;  1S5G Z;  1M63 B;  3JTD C;  4QJ5 B;  4GAO A;  2SCP A;  1QTX A;  2JTZ A;  1U5I B;  3SG6 A;  1DMO A;  4M2P A;  2PAS A;  3GOF A;  1EJ3 A;  1B9A A;  1XYD A;  3KHE A;  1Y6W A;  2BE6 A;  3VRQ A;  3ICB A;  2K2F A;  1JFK A;  2OS8 B;  3KPX A;  1B47 A;  1J1E A;  1NUB A;  1DJH A;  2M97 A;  2F8P A;  2NCO A;  1DJI A;  1DVI A;  1C7W A;  1ZAC A;  2LAP A;  1UHN A;  5DKQ A;  1XFW O;  1EG4 A;  1QVI Z;  2G2B A;  1TRF A;  3H4S E;  2ZRS A;  2Y5I A;  1DJY A;  4PE4 A;  2BKH B;  2AAO A;  4F0Z B;  1CKK A;  3O4Y A;  3I5I B;  4M2O A;  2K7O A;  1IH0 A;  2LLU A;  2LP2 A;  3TS5 C;  1S6C A;  4OKH A;  2JNF A;  2BEC A;  3SG7 A;  1CMG A;  1H4B A;  2WCB A;  1RFJ A;  2BBM A;  4OVN F;  2LVJ A;  2WCE A;  2I18 A;  4WQ2 A;  3DVK A;  4YRU A;  4P2Y B;  1CM4 A;  3JVT C;  4OCI A;  4AQI A;  4AQJ A;  2JXL A;  3D10 A;  3DVE A;  2BKI B;  4DIR A;  2Y4Q A;  4ORC B;  4WQ3 A;  2LP3 A;  5HKY A;  1FF1 A;  4GPL B;  4ICB A;  4QJ3 B;  2K0J A;  2JZI A;  4MVF A;  1YX7 A;  4PHK A;  2BBN A;  1HT9 A;  2F2P A;  2LVV A;  3ZWH A;  5CPV A;  1QVI Y;  3LLE A;  1QIV A;  1XA5 A;  1DF0 A;  2KFF A;  1SW8 A;  2F3Z A;  1QAS A;  2KAX A;  2G9B A;  1S6I A;  1MXL C;  1JSA A;  3I5F C;  1Y0V H;  1KFU S;  4HSZ A;  3KEV A;  1M45 A;  5HKZ A;  3ZNI A;  1Y1A A;  1XFV O;  2BCX A;  1KWO B;  1S6J A;  5ER4 X;  2OTG B;  1Y1X A;  4GNK B;  3OP0 A;  3BYA A;  3GK1 A;  3HCM A;  4MZJ A;  2OPO A;  1OZS A;  2BE4 A;  1EH2 A;  4ORA B;  1SRA A;  1K9U A;  1LXF C;  1WRL A;  1NIW A;  4PHN A;  3I5G B;  1YVL A;  1SCM C;  1A03 A;  3A4U B;  2BCA A;  1IJ6 A;  3DVJ A;  4GBA A;  4GGF A;  3DF0 A;  3SG2 A;  1AJ4 A;  2LLT A;  1KCY A;  3I5H B;  3NXA A;  4R1E A;  1NCZ A;  1NX1 A;  3DVM A;  1K2H A;  2KAV A;  1JWD A;  3NSO A;  2M7L A;  4A4C A;  1J7R A;  1C7V A;  3VRP A;  1NX3 A;  1K95 A;  1OMR A;  3BOW B;  4HRG A;  4PHM A;  1MXE A;  1N0Y A;  3PM8 A;  3NSI A;  1KQV A;  1MUX A;  1NSH A;  2KBM A;  1CLB A;  1AHR A;  2CXJ A;  3BUN B;  2BL0 C;  2JQ6 A;  1QV1 A;  2MRD A;  1CFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...