1UHJA

Crystal structure of br-aequorin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
187
structure length
187
Chain Sequence
LTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Aequorin 2
publication title The crystal structures of semi-synthetic aequorins
pubmed doi rcsb
source organism Aequorea victoria
total genus 67
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhjA00
1QJTA 2FCEA 2MRDA 1F71A 3GK2A 3SG4A 4PHMA 4ETOA 1OMVA 4CFQA 4N5XA 2LANA 3PN7C 1K95A 5AFPA 1K90D 4I5KA 2JU0A 1LA0A 1NUBA 2ZKMX 3PFVA 3TZ1A 3MSEB 1XFWO 3BUMB 3O4YA 1TTXA 1K9KA 1F4OA 2G2BA 2JTTA 1CB1A 1DJGA 2K61A 2A4JA 3SG5A 1EG4A 2BCXA 2K7CA 4ORCB 3GK1A 1TOPA 2MHHA 3CR5X 1DGVA 3LLEA 4MEWA 4NDCA 2BCBA 3LL8B 1CM4A 3NSIA 2MLEC 5IBWA 1DJXA 2DOQA 2F2PA 3D0YB 1S1EA 1X02A 3I5GC 1KK8C 3VRNA 2Y1MA 1BLQA 4BY5A 1IJ5A 2LC5A 1WLMA 2LVIA 3BUOB 3K21A 2AMIA 4I5JA 1LINA 1YUUA 2OTGB 4GUKA 5I2QA 1S36A 4CPVA 3HX4A 2M29A 4OCIA 2LCPA 2LLUA 4PHNA 1OMRA 4YI9A 3TDIA 3SJSA 1QVIY 1B8LA 3TS5C 1YRTB 3VROA 2EGDA 5DKRA 1XFXO 1QS7A 1KFXL 4E68A 2JRFA 3H4SE 2E30A 4C0JA 4P2YB 2LHLA 2M3WA 2COLB 4OV2A 2K8MB 3BOWB 4YBHB 1QV0A 1B1GA 1L7ZA 2R2IA 4GPLB 2QACA 4U8DA 3TDUA 1L2OB 1MXEA 3CZTX 1UHKA 1DT7B 1B47A 2KYCA 1V1GA 1OQPA 3NXAA 1F70A 2FOTA 1OE9B 2M97A 2KFGA 1SCMC 1EH2A 1GQMA 1NWDA 4MVFA 1S3PA 1KFUS 1RK9A 2L4IA 2MAZA 5I8NA 4BY4A 3LK1A 3I5HB 2JT8A 1GJYA 2FCDA 2NXQA 4DUQA 1K93D 1DJHA 2OS8B 1A29A 1ZOTB 4OR9B 4PE0A 5HKWA 3KEVA 3WNXB 1D1OA 1BU3A 1UP5A 2ZNDA 1J7OA 5AXIA 1JF0A 2H61C 1AUIB 1KSOA 1YVHA 2LAPA 2FJUB 1KWOB 4R1EA 1E8AA 4USLA 1MWNA 3I5FB 1NX0A 1SY9A 2GGMA 1B8CA 2KGBC 4WRIA 2K0JA 1CLMA 1TRFA 1YVLA 2MBXA 3KO0A 2ZRSA 2KAYA 4GAOA 4DIRA 3SG3A 3M0WA 1H8BA 4AQJA 2NZ0A 1YR5A 1B7TY 1JF2A 2IS9A 3IQQA 5HKZA 1SR6B 2H2KA 1YX7A 2BL0C 2L4HA 2HPSA 2ISDA 5CSFA 5DKQA 1TCFA 4MSPA 3VRRA 4YGBB 5KSZA 1SL7A 2JULA 4HREE 3WHTB 1NCYA 1UHNA 3GK4X 1AVSA 1UURA 2JZIA 1IRJA 2LVVA 2V53A 3C1VA 4DS7A 2WC8A 3O6BA 1EL4A 2LNKA 3EVVA 2LM5A 4JQ0D 3CLNA 2ZN9A 2CXJA 3O78A 1AP4A 4L9MA 1DJZA 1ODBA 1QXPA 3JTDB 2CBLA 1CFDA 1Y0VH 5CSNA 5DKNA 1CKKA 2JTZA 1FF1A 2JNFA 4MZJA 2G9BA 2K7BA 3EK4A 1DJWA 2KYFA 1J1DA 1NP8A 2K2FA 1J55A 2L98A 1A75A 1KQMB 5ER5A 1NIWA 1BJFA 5HKYA 1EJ3A 1RTP1 1RWYA 4MRYA 1YUSA 2KI4B 1ZACA 4ZCVA 3ICBA 3QRXA 4YGEB 2CT9A 5CSJA 1MR8A 1F4QA 2LV7A 2WCFA 1YTZC 2JXCA 3TUYC 1XFYO 1Y6WA 4QJ5B 1K94A 1CDLA 1LVCD 1RROA 3D10A 5JJGA 4PALA 3BYAA 1OSAA 4PE7A 4NQGA 3HCMA 2KSPA 3A8RA 1FW4A 1HQVA 1SBJA 2HQ8A 2LMTA 3DVJA 1QVIZ 2JXLA 2L0PA 1MXLC 3CR4X 1DJIA 1LKJA 1NYAA 4OKHA 1FBVA 2Y4QA 1QX7A 2KFFA 1MQ1A 1WRZA 1XVJA 1IQ3A 2PRUA 2LP3A 1G33A 1OMDA 2MJWB 5JOLA 1WRKA 2VRGA 1XK4A 2LVJA 4YGCB 2JQ6A 4JPZB 1XFZO 3LK0A 3D0YA 4TNCA 2EC6B 4DCKA 1UHJA 4F0ZB 1KFUL 1XYDA 3PATA 5D7FA 1CDMA 3RLZA 2JT3A 5ER4X 5HLOA 1F54A 4CFRA 1DGUA 3O2PA 2CNPA 1N65A 2NLNA 3PALA 4YRUA 2JOJA 1NX1A 4M2QA 1RECA 4ZCUA 5F6TA 1F8HA 1M31A 4YGDB 5B8IB 2BBMA 1S6IA 2KBMA 3TDZA 1UWOA 1Y1AA 2SASA 2O5GA 5PALA 2CCMA 1AJ4A 2Y5IA 2NCPA 3NSLA 1B8RA 1YUTA 4N1FA 4HSZA 1WDCC 1FPWA 2HF5A 2L2EA 3BOWA 1QX5B 1A2XA 2KAXA 2JT0A 3AAJA 1B9AA 1BG1A 1KK7Z 2M8UA 2BE4A 1AHRA 5D69A 1N2DA 5J3XA 1SNLA 3NSKA 1DJYA 3PM8A 4MLWA 5TNCA 1WY9A 2KHNA 4IL1A 1NSHA 3WXAA 2BKIB 2KQ6A 3RM1A 2F2OA 2KFHA 1XK4C 2K7OA 1YX8A 4MN0A 1B7TZ 1IKUA 2WCBA 4XYNA 2LUCA 2KNEA 1V1FA 2WOSA 1CNPA 2SCPA 4FQOA 3JVTC 2BCAA 3I5IB 2OTGC 2NCOA 3VGOA 1BMOA 1KK7Y 5KU1A 1BR4B 2KOTA 5HYDA 1UHHA 2PMYA 3VRQA 3ZWHA 1M63B 1PALA 3EK7A 4GGNA 2F3ZA 3EK8A 4GFTA 2KQYA 3GOFA 4HRGA 4PE1A 1PSBA 2KI6C 1XFVO 4MZLA 3PN7B 3AAKA 1CTRA 1R2UA 1CDPA 2KAVA 1L2OC 3DVEA 4GGFA 4MZKA 1JWDA 2RGIA 3TUYB 2LLTA 2O60A 3EVUA 3OX6A 1A4PA 1QIVA 1TNXA 4FTGA 3BUWB 2WNDA 3EKJA 1S6JA 2HQWA 1WRLA 1ZMZA 2K2AA 2P6BB 5I2OA 1PSRA 3AKBA 3IQOA 3I5HC 3OB2B 2L50A 3OHMB 4JWQA 4QJ3B 3CS1A 1OZOA 3CTNA 4MRXA 1NX2A 1DVIA 1R6PA 2BBNA 4GBAA 1RFJA 2OS8C 1DF0B 1Y1UA 3I5GB 3FIAA 1G8IA 1KK8B 2OPOA 1CM1A 1HT9A 1A03A 4N1GA 1NX3A 1FI5A 1AJ5A 2ZRTA 3OX5A 1XO5A 2B1UA 3WHUB 1CMFA 2BKHB 1YURA 1DF0A 2M0RA 2E6WA 1KWOC 1PK0D 1QX2A 3I5FC 1U5IB 3PSRA 3TS5B 4PHKA 1M45A 1OZSA 2PALA 3BUNB 1S5GZ 1K2HA 3SG7A 1PULA 1BOCA 1FI6A 1C7WA 2BE6A 4PE4A 1K9PA 4I5NB 4QJ4B 1CLBA 1S26D 1TIZA 1U5IA 2L5XB 3DVKA 2GGZA 2LVKA 1SYMA 5FYXA 1IGVA 4ICBA 1KCYA 2KDHA 4CLNA 4NDDA 1SW8A 2EHBA 4NDBA 4ORAB 3E3RA 1ALVA 1W7JB 3LCPC 4AOMA 1WDCB 2F33A 1SPYA 1SCMB 1S5GY 2M1UA 1JC2A 2LMUA 5BPJA 1UHIA 2ZN8A 2JPTA 2Q4UA 1TNWA 2QPTA 2K7DA 3JTDC 1MF8B 1JUOA 1IH0A 1TN4A 1ALWA 1K8UA 1SMGA 4OVNF 1EXRA 3VRPA 3DD4A 1IJ6A 3KPXA 2M9GA 1QTXA 2AAOA 2F3YA 2M7NA 4PCWA 1SKTA 1DTLA 1KQMC 3EKHA 2LLSA 4GNKB 4A4BA 2GV5A 3JVTB 4DRWA 1VRKA 1GGWA 1ZUZA 1AK8A 1JBAA 1ZFSA 2KI4C 4M2PA 2I7AA 4ORBB 2PASA 3FWBA 2HETA 5HLVA 2PVBA 4MBEA 2KBIA 3F45A 2MLFC 4Q04A 1QLKA 2H61A 1G4YR 2ZFDA 5GQQC 4XJKB 4WQ3A 4HRHA 3BUXB 1PVAA 1TCOB 1XA5A 1N0YA 1CFFA 2BL0B 1J7PA 2M49B 1WLZA 1BF5A 3IF7A 1M46A 4XJKA 2KGRA 2I94A 1S6CA 2ZNEA 1CFPA 1IWQA 5I2LA 2WCEA 3BQ3A 1OOJA 4CIDA 1NPQA 1SL8A 3ZNIA 1BT6A 2LE9B 2JNXA 4M2OA 3SIBA 2L51A 2I2RE 1KQVA 2EC6C 1MUXA 2M7LA 1F55A 3BXKA 4UPGA 2D8NA 2LHIA 5CSIA 1QASA 2WORA 3CR2A 4P5OE 1KFXS 1H4BA 1QV1A 1J7RA 5AERA 4WQ2A 5K89A 1J7QA 1CMGA 4YGAA 4C0KA 1UUSA 2MA2A 3KF9A 4A4CA 1LA3A 1JFKA 5AANA 1GGZA 1XFUO 4I5LB 2KI6D 2LMVA 2JC2A 3SG2A 5KTYA 1QATA 1SCVA 3A4UB 1C07A 3OB1B 2CTNA 1IQ5A 1BODA 1CDNA 1SRAA 4PHJA 5CPVA 2Q91A 1KSMA 1QLSA 1TNPA 3SIAA 2I18A 4D1EA 1NCXA 1SK6D 3CWGA 4PDZA 1IG5A 1PRWA 1BR1B 2TN4A 4YI8A 1NCZA 1EG3A 5AEQA 1B4CA 2AUCA 3AKAA 3OP0A 1YRUB 1RJVA 1DMOA 1CFCA 2F8PA 3KHEA 3DF0B 1W7IB 3EVRA 2Y1NA 1JSAA 2JWWA 4AQIA 2LP2A 4C0LA 1QIWA 5G08A 1Y1XA 1Q80A 3I5IC 2PSRA 1LXFC 1MHOA 3FS7A 1A75B 2M1KB 3DF0A 1JFJA 1K96A 3FWCA 3NSOA 1J1EA 1M39A 3SG6A 2LUXA 1TNQA 1C7VA 1PVBA 1CLLA 1K9UA 3DVMA 2BECA 3PLFB 4GGFC 1SR6C 1SL9A 3CGAA
chains in the Genus database with same CATH superfamily
1QJTA 2FCEA 2MRDA 5I94A 1F71A 3GK2A 3SG4A 4PHMA 3B86A 4FQTA 4ETOA 1OMVA 4CFQA 4N5XA 1T14A 2LANA 1K95A 3PN7C 5AFPA 1K90D 4I5KA 2JU0A 1LA0A 1NUBA 2ZKMX 3DY9A 3PFVA 3TZ1A 2QEHA 3MSEB 1XFWO 3BUMB 2L5YA 3O4YA 1TTXA 1K9KA 1F4OA 2G2BA 2JTTA 1CB1A 1DJGA 2K61A 2WCJA 2A4JA 3SG5A 1EG4A 2BCXA 2K7CA 4ORCB 3GK1A 1TOPA 2MHHA 3CR5X 1DGVA 3LLEA 4MEWA 4NDCA 3OGNA 2BCBA 3LL8B 1CM4A 3NSIA 2MLEC 5IBWA 1DJXA 2DOQA 2F2PA 3D0YB 1S1EA 1X02A 3I5GC 1KK8C 3VRNA 2Y1MA 1BLQA 4BY5A 1IJ5A 2LC5A 1WLMA 2LVIA 3BUOB 3L47A 4JKTA 3K21A 2AMIA 4I5JA 1LINA 1YUUA 2OTGB 4GUKA 5I2QA 1S36A 5EL2A 4CPVA 3HX4A 2M29A 4OCIA 2LCPA 1XFRA 2LLUA 4PHNA 1OMRA 4YI9A 5FI2A 3TDIA 3SJSA 1QVIY 1B8LA 3TS5C 1YRTB 1OOHA 3VROA 2EGDA 5DKRA 1XFXO 1QS7A 1KFXL 4E68A 2JRFA 2ERBA 3H4SE 2E30A 3N7HA 4C0JA 4P2YB 2LHLA 2M3WA 2COLB 4OV2A 2K8MB 3BOWB 4YBHB 1QV0A 1B1GA 1L7ZA 1DELA 2R2IA 2PQLA 2QACA 4GPLB 4U8DA 3NHIA 3PM2A 3TDUA 3IVTA 1L2OB 1MXEA 3CZTX 1UHKA 1DT7B 1B47A 2KYCA 1V1GA 1OQPA 3NXAA 1F70A 2FOTA 1OE9B 2BNXA 2M97A 2KFGA 1SCMC 1EH2A 1GQMA 1NWDA 4MVFA 1S3PA 1KFUS 1RK9A 2L4IA 2MAZA 5I8NA 4BY4A 1DQEA 4KYNA 3LK1A 3I5HB 2JT8A 3SS5A 1GJYA 2FCDA 2NXQA 4DUQA 5DICA 1K93D 1DJHA 2OS8B 5FI7A 1A29A 1ZOTB 4OR9B 4PE0A 5HKWA 3KEVA 3WNXB 1D1OA 1BU3A 1OW4A 1UP5A 2ZNDA 1J7OA 5AXIA 1JF0A 3O4XA 2H61C 1AUIB 3D78A 1KSOA 1YVHA 2LAPA 2FJUB 1KWOB 4R1EA 1E8AA 1C3ZA 4USLA 1MWNA 3I5FB 1NX0A 1SY9A 2GGMA 2KLEA 2WCLA 1B8CA 1ORGA 2KGBC 2K0JA 1CLMA 1TRFA 1YVLA 3D77A 4WRIA 2MBXA 3KO0A 2ZRSA 2KAYA 2QEOA 4GAOA 4DIRA 3S0GA 1P28A 3M0WA 3SG3A 2NZ0A 4AQJA 1YR5A 1B7TY 1JF2A 2IS9A 3IQQA 3FE6A 5HKZA 1DC1A 1SR6B 1OOFA 2H2KA 1YX7A 2BL0C 2L4HA 2HPSA 3CYZA 2ISDA 5CSFA 5DKQA 1TCFA 3EG5B 4MSPA 3VRRA 4YGBB 5KSZA 1SL7A 2JULA 3R72A 4HREE 3WHTB 1NCYA 1UHNA 3GK4X 1AVSA 1UURA 4PT1A 2JZIA 1IRJA 2LVVA 2V53A 3C1VA 4DS7A 2WC8A 3O6BA 1EL4A 2LNKA 3EVVA 2LM5A 4JQ0D 3CLNA 2ZN9A 3S0FA 2CXJA 3O78A 1AP4A 3BJHA 4L9MA 2KLDA 1DJZA 1ODBA 1QXPA 3JTDB 2CBLA 1CFDA 1Y0VH 5CSNA 5DKNA 1CKKA 2JTZA 1FF1A 2JNFA 4MZJA 2G9BA 2K7BA 3EK4A 3NHTA 1DJWA 2KYFA 1J1DA 3L4LA 1NP8A 2K2FA 1J55A 2L98A 1A75A 1KQMB 5ER5A 3RZSA 1NIWA 1BJFA 5HKYA 1EJ3A 3S0AA 1RTP1 3CABA 1RWYA 4MRYA 1YUSA 2KI4B 1ZACA 4ZCVA 3ICBA 3QRXA 3NGVA 2CT9A 3R1PA 4YGEB 5CSJA 1MR8A 1F4QA 2LV7A 2WCFA 1YTZC 2JXCA 3TUYC 3B6XA 1XFYO 1Y6WA 4QJ5B 1K94A 1CDLA 1LVCD 1RROA 3D10A 5JJGA 4PALA 3BYAA 1OSAA 4PE7A 4NQGA 3HCMA 2KSPA 3A8RA 1FW4A 1HQVA 1SBJA 2HQ8A 2LMTA 2YGUA 3DVJA 1QVIZ 2JXLA 2L0PA 1MXLC 3CR4X 1DJIA 1LKJA 2L2CA 1NYAA 4OKHA 1FBVA 2Y4QA 1QX7A 2KFFA 1DEKA 1MQ1A 1WRZA 1XVJA 2PRUA 3VB1A 1IQ3A 2LP3A 1G33A 1OMDA 2MJWB 5JOLA 1WRKA 2VRGA 1XK4A 2LVJA 4YGCB 2JQ6A 4JPZB 1XFZO 3CDNA 3LK0A 3D0YA 4TNCA 2EC6B 4DCKA 1UHJA 4F0ZB 1KFUL 1XYDA 3PATA 5D7FA 1CDMA 3RLZA 2JT3A 5ER4X 5HLOA 1F54A 4CFRA 2WCMA 1DGUA 3O2PA 2CNPA 1N65A 2NLNA 3PALA 4YRUA 2JOJA 1NX1A 4M2QA 3S0DA 1RECA 1OOGA 4ZCUA 5F6TA 1F8HA 1M31A 4YGDB 5B8IB 2BBMA 1S6IA 2KBMA 3TDZA 1UWOA 1Y1AA 2SASA 2O5GA 5PALA 2CCMA 1AJ4A 2Y5IA 2NCPA 3NSLA 1B8RA 1YUTA 2PYQA 1TWOA 4N1FA 4HSZA 1WDCC 1FPWA 2HF5A 2L2EA 3BOWA 1QX5B 1A2XA 2KAXA 2JT0A 3AAJA 1B9AA 1BG1A 1KK7Z 2M8UA 2BE4A 1AHRA 5D69A 1N2DA 5J3XA 1SNLA 3NSKA 1DJYA 3PM8A 4MLWA 5TNCA 1WY9A 2KHNA 4IL1A 1NSHA 3OBVA 2BKIB 2KQ6A 3WXAA 3RM1A 2WCKA 2P70A 2F2OA 2KFHA 1XK4C 2K7OA 1YX8A 4MN0A 1B7TZ 1IKUA 2WC5A 2WCBA 4XYNA 2LUCA 2KNEA 1V1FA 2WOSA 1CNPA 1OOIX 2SCPA 4FQOA 3JVTC 2BCAA 3I5IB 2OTGC 2NCOA 3DZTA 3VGOA 1BMOA 1KK7Y 5KU1A 1BR4B 3S0EA 2KOTA 5HYDA 1UHHA 2PMYA 2QEVA 3VRQA 3ZWHA 1M63B 1PALA 2KPHA 3EK7A 4GGNA 2F3ZA 3S0BA 3EK8A 4IJ7A 4GFTA 2KQYA 3GOFA 4HRGA 4PE1A 1PSBA 2KI6C 1SSEB 1XFVO 4MZLA 3PN7B 3AAKA 1CTRA 1R2UA 1CDPA 2KAVA 1L2OC 2QDIA 3DVEA 4GGFA 4MZKA 2RGIA 1JWDA 3TUYB 2LLTA 2O60A 3EVUA 3OX6A 1A4PA 1QIVA 1TNXA 3D73A 4FTGA 3BUWB 2WNDA 3Q8IA 3EKJA 1S6JA 2HQWA 1WRLA 1ZMZA 2K2AA 2P6BB 5I2OA 1PSRA 3AKBA 3IQOA 3I5HC 3OB2B 2L50A 3OHMB 3R1OA 4JWQA 3CS1A 1OZOA 4QJ3B 3CTNA 4MRXA 1NX2A 1DVIA 1R6PA 2BBNA 4GBAA 1GM0A 1RFJA 2OS8C 3BFAA 1DF0B 1Y1UA 3I5GB 3FIAA 1G8IA 1KK8B 1Z4HA 2OPOA 1CM1A 1HT9A 1A03A 4N1GA 1NX3A 1FI5A 1AJ5A 2ZRTA 3OX5A 1XO5A 2B1UA 3WHUB 1CMFA 2BKHB 1YURA 1DF0A 2M0RA 2E6WA 1KWOC 1PK0D 1QX2A 2JPOA 3V2LA 3I5FC 1U5IB 3CZ1A 3PSRA 3R1VA 3TS5B 4PHKA 1M45A 1OZSA 2PALA 3BUNB 1S5GZ 1K2HA 3SG7A 1PULA 1BOCA 1FI6A 1C7WA 2BE6A 4PE4A 4JD9A 1K9PA 3SS3A 4I5NB 4QJ4B 1CLBA 1S26D 1TIZA 1U5IA 2L5XB 3D75A 3DVKA 2GGZA 2LVKA 1SYMA 1QWVA 5FYXA 1IGVA 4ICBA 1KCYA 2KDHA 3UO9A 4CLNA 4NDDA 1SW8A 2EHBA 4NDBA 4ORAB 3E3RA 1ALVA 1W7JB 3LCPC 4AOMA 1WDCB 2F33A 1Z2CB 1SPYA 1SCMB 1S5GY 2M1UA 1JC2A 3D74A 2LMUA 5BPJA 1UHIA 2ZN8A 2JPTA 2Q4UA 1TNWA 2QPTA 2K7DA 3JTDC 1MF8B 1JUOA 1IH0A 1TN4A 1ALWA 1K8UA 3FE8A 1SMGA 4OVNF 1EXRA 3VRPA 1TUZA 3DD4A 1IJ6A 1TUJA 3KPXA 2M9GA 1QTXA 2AAOA 2F3YA 2M7NA 4PCWA 1SKTA 1H8BA 1DTLA 1KQMC 3EKHA 2LLSA 4GNKB 5FI6A 4A4BA 2GV5A 3JVTB 4DRWA 1VRKA 1GGWA 1ZUZA 1AK8A 1JBAA 1ZFSA 2KI4C 4M2PA 2I7AA 4ORBB 2PASA 3FWBA 2HETA 3B87A 5HLVA 2PVBA 4MBEA 3SS4A 2KBIA 3F45A 2MLFC 4Q04A 1QLKA 2H61A 1G4YR 2ZFDA 5GQQC 4XJKB 4WQ3A 4HRHA 3QMEA 3BUXB 1PVAA 1TCOB 1XA5A 3BFHA 3D76A 2GTEA 1N0YA 1CFFA 2BL0B 1J7PA 3PJIA 2M49B 1WLZA 3BFBA 1BF5A 2P71A 3IF7A 1M46A 4XJKA 2KGRA 4GGFC 2I94A 1S6CA 2ZNEA 1CFPA 1IWQA 5I2LA 2K60A 2WCEA 3BQ3A 1OOJA 4CIDA 1NPQA 1SL8A 2H8VA 3ZNIA 1BT6A 2LE9B 2JNXA 4INWA 4M2OA 2L51A 3SIBA 2I2RE 1KQVA 5HL1A 3L4AA 2EC6C 1MUXA 2M7LA 1F55A 3BXKA 4UPGA 2D8NA 2LHIA 5CSIA 3UNWA 1QASA 2WORA 3CR2A 4P5OE 1KFXS 1H4BA 1QV1A 1J7RA 5AERA 4WQ2A 5K89A 1J7QA 1CMGA 4YGAA 4C0KA 1UUSA 2FJYA 2MA2A 3KF9A 4A4CA 1LA3A 1JFKA 5AANA 1GGZA 3K1EA 1XFUO 4I5LB 2KI6D 2LMVA 2JC2A 3SG2A 2QEBA 1IIOA 5KTYA 1QATA 1SCVA 3A4UB 1C07A 3OB1B 2CTNA 3CZ2A 1LS8A 1IQ5A 2WCHA 1BODA 1CDNA 1SRAA 4PHJA 5CPVA 2Q91A 1KSMA 1QLSA 1TNPA 3SIAA 2I18A 3CZ0A 4D1EA 1NCXA 1C3YA 1SK6D 3CWGA 4PDZA 1IG5A 1PRWA 1BR1B 3DXLA 5D3OA 2TN4A 4YI8A 1NCZA 1EG3A 5AEQA 1B4CA 2AUCA 2WC6A 3AKAA 4INXA 3OP0A 1YRUB 1RJVA 1DMOA 1CFCA 2F8PA 3KHEA 3DF0B 1W7IB 3EVRA 2Y1NA 1JSAA 2JWWA 4AQIA 4F7FA 2LP2A 4C0LA 1QIWA 5G08A 1Y1XA 1Q80A 2BAPA 3I5IC 2PSRA 1LXFC 1MHOA 3B88A 3FS7A 1A75B 2M1KB 3DF0A 3DYEA 1JFJA 1K96A 3B7AA 3FWCA 4OZDA 3NSOA 1J1EA 1M39A 1W9ZA 3SG6A 2LUXA 1TNQA 1C7VA 1PVBA 1CLLA 1K9UA 3DVMA 2BECA 3PLFB 3FE9A 1SR6C 1SL9A 3CGAA
chains in the Genus database with same CATH topology
1QJTA 2FCEA 2MRDA 1F71A 3GK2A 3SG4A 4PHMA 4ETOA 1OMVA 4CFQA 4N5XA 2LANA 3PN7C 1K95A 5AFPA 1K90D 4I5KA 2JU0A 1LA0A 1NUBA 2ZKMX 3PFVA 3TZ1A 3MSEB 1XFWO 3BUMB 3O4YA 1TTXA 1K9KA 1F4OA 2G2BA 2JTTA 1CB1A 1DJGA 2K61A 2A4JA 3SG5A 1EG4A 2BCXA 2K7CA 4ORCB 3GK1A 1TOPA 2MHHA 3CR5X 1DGVA 3LLEA 4MEWA 4NDCA 2BCBA 3LL8B 1CM4A 3NSIA 2MLEC 5IBWA 1DJXA 2DOQA 2F2PA 3D0YB 1S1EA 1X02A 3I5GC 1KK8C 3VRNA 2Y1MA 1BLQA 4BY5A 1IJ5A 2LC5A 1WLMA 2LVIA 3BUOB 3K21A 2AMIA 4I5JA 1LINA 1YUUA 2OTGB 4GUKA 5I2QA 1S36A 4CPVA 3HX4A 2M29A 4OCIA 2LCPA 2LLUA 4PHNA 1OMRA 4YI9A 3TDIA 3SJSA 1QVIY 1B8LA 3TS5C 1YRTB 3VROA 2EGDA 5DKRA 1XFXO 1QS7A 1KFXL 4E68A 2JRFA 3H4SE 2E30A 4C0JA 4P2YB 2LHLA 2M3WA 2COLB 4OV2A 2K8MB 3BOWB 4YBHB 1QV0A 1B1GA 1L7ZA 2R2IA 4GPLB 2QACA 4U8DA 3TDUA 1L2OB 1MXEA 3CZTX 1UHKA 1DT7B 1B47A 2KYCA 1V1GA 1OQPA 3NXAA 1F70A 2FOTA 1OE9B 2M97A 2KFGA 1SCMC 1EH2A 1GQMA 1NWDA 4MVFA 1S3PA 1KFUS 1RK9A 2L4IA 2MAZA 5I8NA 4BY4A 3LK1A 3I5HB 2JT8A 1GJYA 2FCDA 2NXQA 4DUQA 1K93D 1DJHA 2OS8B 1A29A 1ZOTB 4OR9B 4PE0A 5HKWA 3KEVA 3WNXB 1D1OA 1BU3A 1UP5A 2ZNDA 1J7OA 5AXIA 1JF0A 2H61C 1AUIB 1KSOA 1YVHA 2LAPA 2FJUB 1KWOB 4R1EA 1E8AA 4USLA 1MWNA 3I5FB 1NX0A 1SY9A 2GGMA 1B8CA 2KGBC 4WRIA 2K0JA 1CLMA 1TRFA 1YVLA 2MBXA 3KO0A 2ZRSA 2KAYA 4GAOA 4DIRA 3SG3A 3M0WA 1H8BA 4AQJA 2NZ0A 1YR5A 1B7TY 1JF2A 2IS9A 3IQQA 5HKZA 1SR6B 2H2KA 1YX7A 2BL0C 2L4HA 2HPSA 2ISDA 5CSFA 5DKQA 1TCFA 4MSPA 3VRRA 4YGBB 5KSZA 1SL7A 2JULA 4HREE 3WHTB 1NCYA 1UHNA 3GK4X 1AVSA 1UURA 2JZIA 1IRJA 2LVVA 2V53A 3C1VA 4DS7A 2WC8A 3O6BA 1EL4A 2LNKA 3EVVA 2LM5A 4JQ0D 3CLNA 2ZN9A 2CXJA 3O78A 1AP4A 4L9MA 1DJZA 1ODBA 1QXPA 3JTDB 2CBLA 1CFDA 1Y0VH 5CSNA 5DKNA 1CKKA 2JTZA 1FF1A 2JNFA 4MZJA 2G9BA 2K7BA 3EK4A 1DJWA 2KYFA 1J1DA 1NP8A 2K2FA 1J55A 2L98A 1A75A 1KQMB 5ER5A 1NIWA 1BJFA 5HKYA 1EJ3A 1RTP1 1RWYA 4MRYA 1YUSA 2KI4B 1ZACA 4ZCVA 3ICBA 3QRXA 4YGEB 2CT9A 5CSJA 1MR8A 1F4QA 2LV7A 2WCFA 1YTZC 2JXCA 3TUYC 1XFYO 1Y6WA 4QJ5B 1K94A 1CDLA 1LVCD 1RROA 3D10A 5JJGA 4PALA 3BYAA 1OSAA 4PE7A 4NQGA 3HCMA 2KSPA 3A8RA 1FW4A 1HQVA 1SBJA 2HQ8A 2LMTA 3DVJA 1QVIZ 2JXLA 2L0PA 1MXLC 3CR4X 1DJIA 1LKJA 1NYAA 4OKHA 1FBVA 2Y4QA 1QX7A 2KFFA 1MQ1A 1WRZA 1XVJA 1IQ3A 2PRUA 2LP3A 1G33A 1OMDA 2MJWB 5JOLA 1WRKA 2VRGA 1XK4A 2LVJA 4YGCB 2JQ6A 4JPZB 1XFZO 3LK0A 3D0YA 4TNCA 2EC6B 4DCKA 1UHJA 4F0ZB 1KFUL 1XYDA 3PATA 5D7FA 1CDMA 3RLZA 2JT3A 5ER4X 5HLOA 1F54A 4CFRA 1DGUA 3O2PA 2CNPA 1N65A 2NLNA 3PALA 4YRUA 2JOJA 1NX1A 4M2QA 1RECA 4ZCUA 5F6TA 1F8HA 1M31A 4YGDB 5B8IB 2BBMA 1S6IA 2KBMA 3TDZA 1UWOA 1Y1AA 2SASA 2O5GA 5PALA 2CCMA 1AJ4A 2Y5IA 2NCPA 3NSLA 1B8RA 1YUTA 4N1FA 4HSZA 1WDCC 1FPWA 2HF5A 2L2EA 3BOWA 1QX5B 1A2XA 2KAXA 2JT0A 3AAJA 1B9AA 1BG1A 1KK7Z 2M8UA 2BE4A 1AHRA 5D69A 1N2DA 5J3XA 1SNLA 3NSKA 1DJYA 3PM8A 4MLWA 5TNCA 1WY9A 2KHNA 4IL1A 1NSHA 3WXAA 2BKIB 2KQ6A 3RM1A 2F2OA 2KFHA 1XK4C 2K7OA 1YX8A 4MN0A 1B7TZ 1IKUA 2WCBA 4XYNA 2LUCA 2KNEA 1V1FA 2WOSA 1CNPA 2SCPA 4FQOA 3JVTC 2BCAA 3I5IB 2OTGC 2NCOA 3VGOA 1BMOA 1KK7Y 5KU1A 1BR4B 2KOTA 5HYDA 1UHHA 2PMYA 3VRQA 3ZWHA 1M63B 1PALA 3EK7A 4GGNA 2F3ZA 3EK8A 4GFTA 2KQYA 3GOFA 4HRGA 4PE1A 1PSBA 2KI6C 1XFVO 4MZLA 3PN7B 3AAKA 1CTRA 1R2UA 1CDPA 2KAVA 1L2OC 3DVEA 4GGFA 4MZKA 1JWDA 2RGIA 3TUYB 2LLTA 2O60A 3EVUA 3OX6A 1A4PA 1QIVA 1TNXA 4FTGA 3BUWB 2WNDA 3EKJA 1S6JA 2HQWA 1WRLA 1ZMZA 2K2AA 2P6BB 5I2OA 1PSRA 3AKBA 3IQOA 3I5HC 3OB2B 2L50A 3OHMB 4JWQA 4QJ3B 3CS1A 1OZOA 3CTNA 4MRXA 1NX2A 1DVIA 1R6PA 2BBNA 4GBAA 1RFJA 2OS8C 1DF0B 1Y1UA 3I5GB 3FIAA 1G8IA 1KK8B 2OPOA 1CM1A 1HT9A 1A03A 4N1GA 1NX3A 1FI5A 1AJ5A 2ZRTA 3OX5A 1XO5A 2B1UA 3WHUB 1CMFA 2BKHB 1YURA 1DF0A 2M0RA 2E6WA 1KWOC 1PK0D 1QX2A 3I5FC 1U5IB 3PSRA 3TS5B 4PHKA 1M45A 1OZSA 2PALA 3BUNB 1S5GZ 1K2HA 3SG7A 1PULA 1BOCA 1FI6A 1C7WA 2BE6A 4PE4A 1K9PA 4I5NB 4QJ4B 1CLBA 1S26D 1TIZA 1U5IA 2L5XB 3DVKA 2GGZA 2LVKA 1SYMA 5FYXA 1IGVA 4ICBA 1KCYA 2KDHA 4CLNA 4NDDA 1SW8A 2EHBA 4NDBA 4ORAB 3E3RA 1ALVA 1W7JB 3LCPC 4AOMA 1WDCB 2F33A 1SPYA 1SCMB 1S5GY 2M1UA 1JC2A 2LMUA 5BPJA 1UHIA 2ZN8A 2JPTA 2Q4UA 1TNWA 2QPTA 2K7DA 3JTDC 1MF8B 1JUOA 1IH0A 1TN4A 1ALWA 1K8UA 1SMGA 4OVNF 1EXRA 3VRPA 3DD4A 1IJ6A 3KPXA 2M9GA 1QTXA 2AAOA 2F3YA 2M7NA 4PCWA 1SKTA 1DTLA 1KQMC 3EKHA 2LLSA 4GNKB 4A4BA 2GV5A 3JVTB 4DRWA 1VRKA 1GGWA 1ZUZA 1AK8A 1JBAA 1ZFSA 2KI4C 4M2PA 2I7AA 4ORBB 2PASA 3FWBA 2HETA 5HLVA 2PVBA 4MBEA 2KBIA 3F45A 2MLFC 4Q04A 1QLKA 2H61A 1G4YR 2ZFDA 5GQQC 4XJKB 4WQ3A 4HRHA 3BUXB 1PVAA 1TCOB 1XA5A 1N0YA 1CFFA 2BL0B 1J7PA 2M49B 1WLZA 1BF5A 3IF7A 1M46A 4XJKA 2KGRA 2I94A 1S6CA 2ZNEA 1CFPA 1IWQA 5I2LA 2WCEA 3BQ3A 1OOJA 4CIDA 1NPQA 1SL8A 3ZNIA 1BT6A 2LE9B 2JNXA 4M2OA 3SIBA 2L51A 2I2RE 1KQVA 2EC6C 1MUXA 2M7LA 1F55A 3BXKA 4UPGA 2D8NA 2LHIA 5CSIA 1QASA 2WORA 3CR2A 4P5OE 1KFXS 1H4BA 1QV1A 1J7RA 5AERA 4WQ2A 5K89A 1J7QA 1CMGA 4YGAA 4C0KA 1UUSA 2MA2A 3KF9A 4A4CA 1LA3A 1JFKA 5AANA 1GGZA 1XFUO 4I5LB 2KI6D 2LMVA 2JC2A 3SG2A 5KTYA 1QATA 1SCVA 3A4UB 1C07A 3OB1B 2CTNA 1IQ5A 1BODA 1CDNA 1SRAA 4PHJA 5CPVA 2Q91A 1KSMA 1QLSA 1TNPA 3SIAA 2I18A 4D1EA 1NCXA 1SK6D 3CWGA 4PDZA 1IG5A 1PRWA 1BR1B 2TN4A 4YI8A 1NCZA 1EG3A 5AEQA 1B4CA 2AUCA 3AKAA 3OP0A 1YRUB 1RJVA 1DMOA 1CFCA 2F8PA 3KHEA 3DF0B 1W7IB 3EVRA 2Y1NA 1JSAA 2JWWA 4AQIA 2LP2A 4C0LA 1QIWA 5G08A 1Y1XA 1Q80A 3I5IC 2PSRA 1LXFC 1MHOA 3FS7A 1A75B 2M1KB 3DF0A 1JFJA 1K96A 3FWCA 3NSOA 1J1EA 1M39A 3SG6A 2LUXA 1TNQA 1C7VA 1PVBA 1CLLA 1K9UA 3DVMA 2BECA 3PLFB 4GGFC 1SR6C 1SL9A 3CGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJT A;  2FCE A;  2MRD A;  1F71 A;  3GK2 A;  3SG4 A;  4PHM A;  4ETO A;  1OMV A;  4CFQ A;  4N5X A;  2LAN A;  3PN7 C;  1K95 A;  5AFP A;  1K90 D;  4I5K A;  2JU0 A;  1LA0 A;  1NUB A;  2ZKM X;  3PFV A;  3TZ1 A;  3MSE B;  1XFW O;  3BUM B;  3O4Y A;  1TTX A;  1K9K A;  1F4O A;  2G2B A;  2JTT A;  1CB1 A;  1DJG A;  2K61 A;  2A4J A;  3SG5 A;  1EG4 A;  2BCX A;  2K7C A;  4ORC B;  3GK1 A;  1TOP A;  2MHH A;  3CR5 X;  1DGV A;  3LLE A;  4MEW A;  4NDC A;  2BCB A;  3LL8 B;  1CM4 A;  3NSI A;  2MLE C;  5IBW A;  1DJX A;  2DOQ A;  2F2P A;  3D0Y B;  1S1E A;  1X02 A;  3I5G C;  1KK8 C;  3VRN A;  2Y1M A;  1BLQ A;  4BY5 A;  1IJ5 A;  2LC5 A;  1WLM A;  2LVI A;  3BUO B;  3K21 A;  2AMI A;  4I5J A;  1LIN A;  1YUU A;  2OTG B;  4GUK A;  5I2Q A;  1S36 A;  4CPV A;  3HX4 A;  2M29 A;  4OCI A;  2LCP A;  2LLU A;  4PHN A;  1OMR A;  4YI9 A;  3TDI A;  3SJS A;  1QVI Y;  1B8L A;  3TS5 C;  1YRT B;  3VRO A;  2EGD A;  5DKR A;  1XFX O;  1QS7 A;  1KFX L;  4E68 A;  2JRF A;  3H4S E;  2E30 A;  4C0J A;  4P2Y B;  2LHL A;  2M3W A;  2COL B;  4OV2 A;  2K8M B;  3BOW B;  4YBH B;  1QV0 A;  1B1G A;  1L7Z A;  2R2I A;  4GPL B;  2QAC A;  4U8D A;  3TDU A;  1L2O B;  1MXE A;  3CZT X;  1UHK A;  1DT7 B;  1B47 A;  2KYC A;  1V1G A;  1OQP A;  3NXA A;  1F70 A;  2FOT A;  1OE9 B;  2M97 A;  2KFG A;  1SCM C;  1EH2 A;  1GQM A;  1NWD A;  4MVF A;  1S3P A;  1KFU S;  1RK9 A;  2L4I A;  2MAZ A;  5I8N A;  4BY4 A;  3LK1 A;  3I5H B;  2JT8 A;  1GJY A;  2FCD A;  2NXQ A;  4DUQ A;  1K93 D;  1DJH A;  2OS8 B;  1A29 A;  1ZOT B;  4OR9 B;  4PE0 A;  5HKW A;  3KEV A;  3WNX B;  1D1O A;  1BU3 A;  1UP5 A;  2ZND A;  1J7O A;  5AXI A;  1JF0 A;  2H61 C;  1AUI B;  1KSO A;  1YVH A;  2LAP A;  2FJU B;  1KWO B;  4R1E A;  1E8A A;  4USL A;  1MWN A;  3I5F B;  1NX0 A;  1SY9 A;  2GGM A;  1B8C A;  2KGB C;  4WRI A;  2K0J A;  1CLM A;  1TRF A;  1YVL A;  2MBX A;  3KO0 A;  2ZRS A;  2KAY A;  4GAO A;  4DIR A;  3SG3 A;  3M0W A;  1H8B A;  4AQJ A;  2NZ0 A;  1YR5 A;  1B7T Y;  1JF2 A;  2IS9 A;  3IQQ A;  5HKZ A;  1SR6 B;  2H2K A;  1YX7 A;  2BL0 C;  2L4H A;  2HPS A;  2ISD A;  5CSF A;  5DKQ A;  1TCF A;  4MSP A;  3VRR A;  4YGB B;  5KSZ A;  1SL7 A;  2JUL A;  4HRE E;  3WHT B;  1NCY A;  1UHN A;  3GK4 X;  1AVS A;  1UUR A;  2JZI A;  1IRJ A;  2LVV A;  2V53 A;  3C1V A;  4DS7 A;  2WC8 A;  3O6B A;  1EL4 A;  2LNK A;  3EVV A;  2LM5 A;  4JQ0 D;  3CLN A;  2ZN9 A;  2CXJ A;  3O78 A;  1AP4 A;  4L9M A;  1DJZ A;  1ODB A;  1QXP A;  3JTD B;  2CBL A;  1CFD A;  1Y0V H;  5CSN A;  5DKN A;  1CKK A;  2JTZ A;  1FF1 A;  2JNF A;  4MZJ A;  2G9B A;  2K7B A;  3EK4 A;  1DJW A;  2KYF A;  1J1D A;  1NP8 A;  2K2F A;  1J55 A;  2L98 A;  1A75 A;  1KQM B;  5ER5 A;  1NIW A;  1BJF A;  5HKY A;  1EJ3 A;  1RTP 1;  1RWY A;  4MRY A;  1YUS A;  2KI4 B;  1ZAC A;  4ZCV A;  3ICB A;  3QRX A;  4YGE B;  2CT9 A;  5CSJ A;  1MR8 A;  1F4Q A;  2LV7 A;  2WCF A;  1YTZ C;  2JXC A;  3TUY C;  1XFY O;  1Y6W A;  4QJ5 B;  1K94 A;  1CDL A;  1LVC D;  1RRO A;  3D10 A;  5JJG A;  4PAL A;  3BYA A;  1OSA A;  4PE7 A;  4NQG A;  3HCM A;  2KSP A;  3A8R A;  1FW4 A;  1HQV A;  1SBJ A;  2HQ8 A;  2LMT A;  3DVJ A;  1QVI Z;  2JXL A;  2L0P A;  1MXL C;  3CR4 X;  1DJI A;  1LKJ A;  1NYA A;  4OKH A;  1FBV A;  2Y4Q A;  1QX7 A;  2KFF A;  1MQ1 A;  1WRZ A;  1XVJ A;  1IQ3 A;  2PRU A;  2LP3 A;  1G33 A;  1OMD A;  2MJW B;  5JOL A;  1WRK A;  2VRG A;  1XK4 A;  2LVJ A;  4YGC B;  2JQ6 A;  4JPZ B;  1XFZ O;  3LK0 A;  3D0Y A;  4TNC A;  2EC6 B;  4DCK A;  1UHJ A;  4F0Z B;  1KFU L;  1XYD A;  3PAT A;  5D7F A;  1CDM A;  3RLZ A;  2JT3 A;  5ER4 X;  5HLO A;  1F54 A;  4CFR A;  1DGU A;  3O2P A;  2CNP A;  1N65 A;  2NLN A;  3PAL A;  4YRU A;  2JOJ A;  1NX1 A;  4M2Q A;  1REC A;  4ZCU A;  5F6T A;  1F8H A;  1M31 A;  4YGD B;  5B8I B;  2BBM A;  1S6I A;  2KBM A;  3TDZ A;  1UWO A;  1Y1A A;  2SAS A;  2O5G A;  5PAL A;  2CCM A;  1AJ4 A;  2Y5I A;  2NCP A;  3NSL A;  1B8R A;  1YUT A;  4N1F A;  4HSZ A;  1WDC C;  1FPW A;  2HF5 A;  2L2E A;  3BOW A;  1QX5 B;  1A2X A;  2KAX A;  2JT0 A;  3AAJ A;  1B9A A;  1BG1 A;  1KK7 Z;  2M8U A;  2BE4 A;  1AHR A;  5D69 A;  1N2D A;  5J3X A;  1SNL A;  3NSK A;  1DJY A;  3PM8 A;  4MLW A;  5TNC A;  1WY9 A;  2KHN A;  4IL1 A;  1NSH A;  3WXA A;  2BKI B;  2KQ6 A;  3RM1 A;  2F2O A;  2KFH A;  1XK4 C;  2K7O A;  1YX8 A;  4MN0 A;  1B7T Z;  1IKU A;  2WCB A;  4XYN A;  2LUC A;  2KNE A;  1V1F A;  2WOS A;  1CNP A;  2SCP A;  4FQO A;  3JVT C;  2BCA A;  3I5I B;  2OTG C;  2NCO A;  3VGO A;  1BMO A;  1KK7 Y;  5KU1 A;  1BR4 B;  2KOT A;  5HYD A;  1UHH A;  2PMY A;  3VRQ A;  3ZWH A;  1M63 B;  1PAL A;  3EK7 A;  4GGN A;  2F3Z A;  3EK8 A;  4GFT A;  2KQY A;  3GOF A;  4HRG A;  4PE1 A;  1PSB A;  2KI6 C;  1XFV O;  4MZL A;  3PN7 B;  3AAK A;  1CTR A;  1R2U A;  1CDP A;  2KAV A;  1L2O C;  3DVE A;  4GGF A;  4MZK A;  1JWD A;  2RGI A;  3TUY B;  2LLT A;  2O60 A;  3EVU A;  3OX6 A;  1A4P A;  1QIV A;  1TNX A;  4FTG A;  3BUW B;  2WND A;  3EKJ A;  1S6J A;  2HQW A;  1WRL A;  1ZMZ A;  2K2A A;  2P6B B;  5I2O A;  1PSR A;  3AKB A;  3IQO A;  3I5H C;  3OB2 B;  2L50 A;  3OHM B;  4JWQ A;  4QJ3 B;  3CS1 A;  1OZO A;  3CTN A;  4MRX A;  1NX2 A;  1DVI A;  1R6P A;  2BBN A;  4GBA A;  1RFJ A;  2OS8 C;  1DF0 B;  1Y1U A;  3I5G B;  3FIA A;  1G8I A;  1KK8 B;  2OPO A;  1CM1 A;  1HT9 A;  1A03 A;  4N1G A;  1NX3 A;  1FI5 A;  1AJ5 A;  2ZRT A;  3OX5 A;  1XO5 A;  2B1U A;  3WHU B;  1CMF A;  2BKH B;  1YUR A;  1DF0 A;  2M0R A;  2E6W A;  1KWO C;  1PK0 D;  1QX2 A;  3I5F C;  1U5I B;  3PSR A;  3TS5 B;  4PHK A;  1M45 A;  1OZS A;  2PAL A;  3BUN B;  1S5G Z;  1K2H A;  3SG7 A;  1PUL A;  1BOC A;  1FI6 A;  1C7W A;  2BE6 A;  4PE4 A;  1K9P A;  4I5N B;  4QJ4 B;  1CLB A;  1S26 D;  1TIZ A;  1U5I A;  2L5X B;  3DVK A;  2GGZ A;  2LVK A;  1SYM A;  5FYX A;  1IGV A;  4ICB A;  1KCY A;  2KDH A;  4CLN A;  4NDD A;  1SW8 A;  2EHB A;  4NDB A;  4ORA B;  3E3R A;  1ALV A;  1W7J B;  3LCP C;  4AOM A;  1WDC B;  2F33 A;  1SPY A;  1SCM B;  1S5G Y;  2M1U A;  1JC2 A;  2LMU A;  5BPJ A;  1UHI A;  2ZN8 A;  2JPT A;  2Q4U A;  1TNW A;  2QPT A;  2K7D A;  3JTD C;  1MF8 B;  1JUO A;  1IH0 A;  1TN4 A;  1ALW A;  1K8U A;  1SMG A;  4OVN F;  1EXR A;  3VRP A;  3DD4 A;  1IJ6 A;  3KPX A;  2M9G A;  1QTX A;  2AAO A;  2F3Y A;  2M7N A;  4PCW A;  1SKT A;  1DTL A;  1KQM C;  3EKH A;  2LLS A;  4GNK B;  4A4B A;  2GV5 A;  3JVT B;  4DRW A;  1VRK A;  1GGW A;  1ZUZ A;  1AK8 A;  1JBA A;  1ZFS A;  2KI4 C;  4M2P A;  2I7A A;  4ORB B;  2PAS A;  3FWB A;  2HET A;  5HLV A;  2PVB A;  4MBE A;  2KBI A;  3F45 A;  2MLF C;  4Q04 A;  1QLK A;  2H61 A;  1G4Y R;  2ZFD A;  5GQQ C;  4XJK B;  4WQ3 A;  4HRH A;  3BUX B;  1PVA A;  1TCO B;  1XA5 A;  1N0Y A;  1CFF A;  2BL0 B;  1J7P A;  2M49 B;  1WLZ A;  1BF5 A;  3IF7 A;  1M46 A;  4XJK A;  2KGR A;  2I94 A;  1S6C A;  2ZNE A;  1CFP A;  1IWQ A;  5I2L A;  2WCE A;  3BQ3 A;  1OOJ A;  4CID A;  1NPQ A;  1SL8 A;  3ZNI A;  1BT6 A;  2LE9 B;  2JNX A;  4M2O A;  3SIB A;  2L51 A;  2I2R E;  1KQV A;  2EC6 C;  1MUX A;  2M7L A;  1F55 A;  3BXK A;  4UPG A;  2D8N A;  2LHI A;  5CSI A;  1QAS A;  2WOR A;  3CR2 A;  4P5O E;  1KFX S;  1H4B A;  1QV1 A;  1J7R A;  5AER A;  4WQ2 A;  5K89 A;  1J7Q A;  1CMG A;  4YGA A;  4C0K A;  1UUS A;  2MA2 A;  3KF9 A;  4A4C A;  1LA3 A;  1JFK A;  5AAN A;  1GGZ A;  1XFU O;  4I5L B;  2KI6 D;  2LMV A;  2JC2 A;  3SG2 A;  5KTY A;  1QAT A;  1SCV A;  3A4U B;  1C07 A;  3OB1 B;  2CTN A;  1IQ5 A;  1BOD A;  1CDN A;  1SRA A;  4PHJ A;  5CPV A;  2Q91 A;  1KSM A;  1QLS A;  1TNP A;  3SIA A;  2I18 A;  4D1E A;  1NCX A;  1SK6 D;  3CWG A;  4PDZ A;  1IG5 A;  1PRW A;  1BR1 B;  2TN4 A;  4YI8 A;  1NCZ A;  1EG3 A;  5AEQ A;  1B4C A;  2AUC A;  3AKA A;  3OP0 A;  1YRU B;  1RJV A;  1DMO A;  1CFC A;  2F8P A;  3KHE A;  3DF0 B;  1W7I B;  3EVR A;  2Y1N A;  1JSA A;  2JWW A;  4AQI A;  2LP2 A;  4C0L A;  1QIW A;  5G08 A;  1Y1X A;  1Q80 A;  3I5I C;  2PSR A;  1LXF C;  1MHO A;  3FS7 A;  1A75 B;  2M1K B;  3DF0 A;  1JFJ A;  1K96 A;  3FWC A;  3NSO A;  1J1E A;  1M39 A;  3SG6 A;  2LUX A;  1TNQ A;  1C7V A;  1PVB A;  1CLL A;  1K9U A;  3DVM A;  2BEC A;  3PLF B;  4GGF C;  1SR6 C;  1SL9 A;  3CGA A; 
#chains in the Genus database with same CATH topology
 1QJT A;  2FCE A;  2MRD A;  5I94 A;  1F71 A;  3GK2 A;  3SG4 A;  4PHM A;  3B86 A;  4FQT A;  4ETO A;  1OMV A;  4CFQ A;  4N5X A;  1T14 A;  2LAN A;  1K95 A;  3PN7 C;  5AFP A;  1K90 D;  4I5K A;  2JU0 A;  1LA0 A;  1NUB A;  2ZKM X;  3DY9 A;  3PFV A;  3TZ1 A;  2QEH A;  3MSE B;  1XFW O;  3BUM B;  2L5Y A;  3O4Y A;  1TTX A;  1K9K A;  1F4O A;  2G2B A;  2JTT A;  1CB1 A;  1DJG A;  2K61 A;  2WCJ A;  2A4J A;  3SG5 A;  1EG4 A;  2BCX A;  2K7C A;  4ORC B;  3GK1 A;  1TOP A;  2MHH A;  3CR5 X;  1DGV A;  3LLE A;  4MEW A;  4NDC A;  3OGN A;  2BCB A;  3LL8 B;  1CM4 A;  3NSI A;  2MLE C;  5IBW A;  1DJX A;  2DOQ A;  2F2P A;  3D0Y B;  1S1E A;  1X02 A;  3I5G C;  1KK8 C;  3VRN A;  2Y1M A;  1BLQ A;  4BY5 A;  1IJ5 A;  2LC5 A;  1WLM A;  2LVI A;  3BUO B;  3L47 A;  4JKT A;  3K21 A;  2AMI A;  4I5J A;  1LIN A;  1YUU A;  2OTG B;  4GUK A;  5I2Q A;  1S36 A;  5EL2 A;  4CPV A;  3HX4 A;  2M29 A;  4OCI A;  2LCP A;  1XFR A;  2LLU A;  4PHN A;  1OMR A;  4YI9 A;  5FI2 A;  3TDI A;  3SJS A;  1QVI Y;  1B8L A;  3TS5 C;  1YRT B;  1OOH A;  3VRO A;  2EGD A;  5DKR A;  1XFX O;  1QS7 A;  1KFX L;  4E68 A;  2JRF A;  2ERB A;  3H4S E;  2E30 A;  3N7H A;  4C0J A;  4P2Y B;  2LHL A;  2M3W A;  2COL B;  4OV2 A;  2K8M B;  3BOW B;  4YBH B;  1QV0 A;  1B1G A;  1L7Z A;  1DEL A;  2R2I A;  2PQL A;  2QAC A;  4GPL B;  4U8D A;  3NHI A;  3PM2 A;  3TDU A;  3IVT A;  1L2O B;  1MXE A;  3CZT X;  1UHK A;  1DT7 B;  1B47 A;  2KYC A;  1V1G A;  1OQP A;  3NXA A;  1F70 A;  2FOT A;  1OE9 B;  2BNX A;  2M97 A;  2KFG A;  1SCM C;  1EH2 A;  1GQM A;  1NWD A;  4MVF A;  1S3P A;  1KFU S;  1RK9 A;  2L4I A;  2MAZ A;  5I8N A;  4BY4 A;  1DQE A;  4KYN A;  3LK1 A;  3I5H B;  2JT8 A;  3SS5 A;  1GJY A;  2FCD A;  2NXQ A;  4DUQ A;  5DIC A;  1K93 D;  1DJH A;  2OS8 B;  5FI7 A;  1A29 A;  1ZOT B;  4OR9 B;  4PE0 A;  5HKW A;  3KEV A;  3WNX B;  1D1O A;  1BU3 A;  1OW4 A;  1UP5 A;  2ZND A;  1J7O A;  5AXI A;  1JF0 A;  3O4X A;  2H61 C;  1AUI B;  3D78 A;  1KSO A;  1YVH A;  2LAP A;  2FJU B;  1KWO B;  4R1E A;  1E8A A;  1C3Z A;  4USL A;  1MWN A;  3I5F B;  1NX0 A;  1SY9 A;  2GGM A;  2KLE A;  2WCL A;  1B8C A;  1ORG A;  2KGB C;  2K0J A;  1CLM A;  1TRF A;  1YVL A;  3D77 A;  4WRI A;  2MBX A;  3KO0 A;  2ZRS A;  2KAY A;  2QEO A;  4GAO A;  4DIR A;  3S0G A;  1P28 A;  3M0W A;  3SG3 A;  2NZ0 A;  4AQJ A;  1YR5 A;  1B7T Y;  1JF2 A;  2IS9 A;  3IQQ A;  3FE6 A;  5HKZ A;  1DC1 A;  1SR6 B;  1OOF A;  2H2K A;  1YX7 A;  2BL0 C;  2L4H A;  2HPS A;  3CYZ A;  2ISD A;  5CSF A;  5DKQ A;  1TCF A;  3EG5 B;  4MSP A;  3VRR A;  4YGB B;  5KSZ A;  1SL7 A;  2JUL A;  3R72 A;  4HRE E;  3WHT B;  1NCY A;  1UHN A;  3GK4 X;  1AVS A;  1UUR A;  4PT1 A;  2JZI A;  1IRJ A;  2LVV A;  2V53 A;  3C1V A;  4DS7 A;  2WC8 A;  3O6B A;  1EL4 A;  2LNK A;  3EVV A;  2LM5 A;  4JQ0 D;  3CLN A;  2ZN9 A;  3S0F A;  2CXJ A;  3O78 A;  1AP4 A;  3BJH A;  4L9M A;  2KLD A;  1DJZ A;  1ODB A;  1QXP A;  3JTD B;  2CBL A;  1CFD A;  1Y0V H;  5CSN A;  5DKN A;  1CKK A;  2JTZ A;  1FF1 A;  2JNF A;  4MZJ A;  2G9B A;  2K7B A;  3EK4 A;  3NHT A;  1DJW A;  2KYF A;  1J1D A;  3L4L A;  1NP8 A;  2K2F A;  1J55 A;  2L98 A;  1A75 A;  1KQM B;  5ER5 A;  3RZS A;  1NIW A;  1BJF A;  5HKY A;  1EJ3 A;  3S0A A;  1RTP 1;  3CAB A;  1RWY A;  4MRY A;  1YUS A;  2KI4 B;  1ZAC A;  4ZCV A;  3ICB A;  3QRX A;  3NGV A;  2CT9 A;  3R1P A;  4YGE B;  5CSJ A;  1MR8 A;  1F4Q A;  2LV7 A;  2WCF A;  1YTZ C;  2JXC A;  3TUY C;  3B6X A;  1XFY O;  1Y6W A;  4QJ5 B;  1K94 A;  1CDL A;  1LVC D;  1RRO A;  3D10 A;  5JJG A;  4PAL A;  3BYA A;  1OSA A;  4PE7 A;  4NQG A;  3HCM A;  2KSP A;  3A8R A;  1FW4 A;  1HQV A;  1SBJ A;  2HQ8 A;  2LMT A;  2YGU A;  3DVJ A;  1QVI Z;  2JXL A;  2L0P A;  1MXL C;  3CR4 X;  1DJI A;  1LKJ A;  2L2C A;  1NYA A;  4OKH A;  1FBV A;  2Y4Q A;  1QX7 A;  2KFF A;  1DEK A;  1MQ1 A;  1WRZ A;  1XVJ A;  2PRU A;  3VB1 A;  1IQ3 A;  2LP3 A;  1G33 A;  1OMD A;  2MJW B;  5JOL A;  1WRK A;  2VRG A;  1XK4 A;  2LVJ A;  4YGC B;  2JQ6 A;  4JPZ B;  1XFZ O;  3CDN A;  3LK0 A;  3D0Y A;  4TNC A;  2EC6 B;  4DCK A;  1UHJ A;  4F0Z B;  1KFU L;  1XYD A;  3PAT A;  5D7F A;  1CDM A;  3RLZ A;  2JT3 A;  5ER4 X;  5HLO A;  1F54 A;  4CFR A;  2WCM A;  1DGU A;  3O2P A;  2CNP A;  1N65 A;  2NLN A;  3PAL A;  4YRU A;  2JOJ A;  1NX1 A;  4M2Q A;  3S0D A;  1REC A;  1OOG A;  4ZCU A;  5F6T A;  1F8H A;  1M31 A;  4YGD B;  5B8I B;  2BBM A;  1S6I A;  2KBM A;  3TDZ A;  1UWO A;  1Y1A A;  2SAS A;  2O5G A;  5PAL A;  2CCM A;  1AJ4 A;  2Y5I A;  2NCP A;  3NSL A;  1B8R A;  1YUT A;  2PYQ A;  1TWO A;  4N1F A;  4HSZ A;  1WDC C;  1FPW A;  2HF5 A;  2L2E A;  3BOW A;  1QX5 B;  1A2X A;  2KAX A;  2JT0 A;  3AAJ A;  1B9A A;  1BG1 A;  1KK7 Z;  2M8U A;  2BE4 A;  1AHR A;  5D69 A;  1N2D A;  5J3X A;  1SNL A;  3NSK A;  1DJY A;  3PM8 A;  4MLW A;  5TNC A;  1WY9 A;  2KHN A;  4IL1 A;  1NSH A;  3OBV A;  2BKI B;  2KQ6 A;  3WXA A;  3RM1 A;  2WCK A;  2P70 A;  2F2O A;  2KFH A;  1XK4 C;  2K7O A;  1YX8 A;  4MN0 A;  1B7T Z;  1IKU A;  2WC5 A;  2WCB A;  4XYN A;  2LUC A;  2KNE A;  1V1F A;  2WOS A;  1CNP A;  1OOI X;  2SCP A;  4FQO A;  3JVT C;  2BCA A;  3I5I B;  2OTG C;  2NCO A;  3DZT A;  3VGO A;  1BMO A;  1KK7 Y;  5KU1 A;  1BR4 B;  3S0E A;  2KOT A;  5HYD A;  1UHH A;  2PMY A;  2QEV A;  3VRQ A;  3ZWH A;  1M63 B;  1PAL A;  2KPH A;  3EK7 A;  4GGN A;  2F3Z A;  3S0B A;  3EK8 A;  4IJ7 A;  4GFT A;  2KQY A;  3GOF A;  4HRG A;  4PE1 A;  1PSB A;  2KI6 C;  1SSE B;  1XFV O;  4MZL A;  3PN7 B;  3AAK A;  1CTR A;  1R2U A;  1CDP A;  2KAV A;  1L2O C;  2QDI A;  3DVE A;  4GGF A;  4MZK A;  2RGI A;  1JWD A;  3TUY B;  2LLT A;  2O60 A;  3EVU A;  3OX6 A;  1A4P A;  1QIV A;  1TNX A;  3D73 A;  4FTG A;  3BUW B;  2WND A;  3Q8I A;  3EKJ A;  1S6J A;  2HQW A;  1WRL A;  1ZMZ A;  2K2A A;  2P6B B;  5I2O A;  1PSR A;  3AKB A;  3IQO A;  3I5H C;  3OB2 B;  2L50 A;  3OHM B;  3R1O A;  4JWQ A;  3CS1 A;  1OZO A;  4QJ3 B;  3CTN A;  4MRX A;  1NX2 A;  1DVI A;  1R6P A;  2BBN A;  4GBA A;  1GM0 A;  1RFJ A;  2OS8 C;  3BFA A;  1DF0 B;  1Y1U A;  3I5G B;  3FIA A;  1G8I A;  1KK8 B;  1Z4H A;  2OPO A;  1CM1 A;  1HT9 A;  1A03 A;  4N1G A;  1NX3 A;  1FI5 A;  1AJ5 A;  2ZRT A;  3OX5 A;  1XO5 A;  2B1U A;  3WHU B;  1CMF A;  2BKH B;  1YUR A;  1DF0 A;  2M0R A;  2E6W A;  1KWO C;  1PK0 D;  1QX2 A;  2JPO A;  3V2L A;  3I5F C;  1U5I B;  3CZ1 A;  3PSR A;  3R1V A;  3TS5 B;  4PHK A;  1M45 A;  1OZS A;  2PAL A;  3BUN B;  1S5G Z;  1K2H A;  3SG7 A;  1PUL A;  1BOC A;  1FI6 A;  1C7W A;  2BE6 A;  4PE4 A;  4JD9 A;  1K9P A;  3SS3 A;  4I5N B;  4QJ4 B;  1CLB A;  1S26 D;  1TIZ A;  1U5I A;  2L5X B;  3D75 A;  3DVK A;  2GGZ A;  2LVK A;  1SYM A;  1QWV A;  5FYX A;  1IGV A;  4ICB A;  1KCY A;  2KDH A;  3UO9 A;  4CLN A;  4NDD A;  1SW8 A;  2EHB A;  4NDB A;  4ORA B;  3E3R A;  1ALV A;  1W7J B;  3LCP C;  4AOM A;  1WDC B;  2F33 A;  1Z2C B;  1SPY A;  1SCM B;  1S5G Y;  2M1U A;  1JC2 A;  3D74 A;  2LMU A;  5BPJ A;  1UHI A;  2ZN8 A;  2JPT A;  2Q4U A;  1TNW A;  2QPT A;  2K7D A;  3JTD C;  1MF8 B;  1JUO A;  1IH0 A;  1TN4 A;  1ALW A;  1K8U A;  3FE8 A;  1SMG A;  4OVN F;  1EXR A;  3VRP A;  1TUZ A;  3DD4 A;  1IJ6 A;  1TUJ A;  3KPX A;  2M9G A;  1QTX A;  2AAO A;  2F3Y A;  2M7N A;  4PCW A;  1SKT A;  1H8B A;  1DTL A;  1KQM C;  3EKH A;  2LLS A;  4GNK B;  5FI6 A;  4A4B A;  2GV5 A;  3JVT B;  4DRW A;  1VRK A;  1GGW A;  1ZUZ A;  1AK8 A;  1JBA A;  1ZFS A;  2KI4 C;  4M2P A;  2I7A A;  4ORB B;  2PAS A;  3FWB A;  2HET A;  3B87 A;  5HLV A;  2PVB A;  4MBE A;  3SS4 A;  2KBI A;  3F45 A;  2MLF C;  4Q04 A;  1QLK A;  2H61 A;  1G4Y R;  2ZFD A;  5GQQ C;  4XJK B;  4WQ3 A;  4HRH A;  3QME A;  3BUX B;  1PVA A;  1TCO B;  1XA5 A;  3BFH A;  3D76 A;  2GTE A;  1N0Y A;  1CFF A;  2BL0 B;  1J7P A;  3PJI A;  2M49 B;  1WLZ A;  3BFB A;  1BF5 A;  2P71 A;  3IF7 A;  1M46 A;  4XJK A;  2KGR A;  4GGF C;  2I94 A;  1S6C A;  2ZNE A;  1CFP A;  1IWQ A;  5I2L A;  2K60 A;  2WCE A;  3BQ3 A;  1OOJ A;  4CID A;  1NPQ A;  1SL8 A;  2H8V A;  3ZNI A;  1BT6 A;  2LE9 B;  2JNX A;  4INW A;  4M2O A;  2L51 A;  3SIB A;  2I2R E;  1KQV A;  5HL1 A;  3L4A A;  2EC6 C;  1MUX A;  2M7L A;  1F55 A;  3BXK A;  4UPG A;  2D8N A;  2LHI A;  5CSI A;  3UNW A;  1QAS A;  2WOR A;  3CR2 A;  4P5O E;  1KFX S;  1H4B A;  1QV1 A;  1J7R A;  5AER A;  4WQ2 A;  5K89 A;  1J7Q A;  1CMG A;  4YGA A;  4C0K A;  1UUS A;  2FJY A;  2MA2 A;  3KF9 A;  4A4C A;  1LA3 A;  1JFK A;  5AAN A;  1GGZ A;  3K1E A;  1XFU O;  4I5L B;  2KI6 D;  2LMV A;  2JC2 A;  3SG2 A;  2QEB A;  1IIO A;  5KTY A;  1QAT A;  1SCV A;  3A4U B;  1C07 A;  3OB1 B;  2CTN A;  3CZ2 A;  1LS8 A;  1IQ5 A;  2WCH A;  1BOD A;  1CDN A;  1SRA A;  4PHJ A;  5CPV A;  2Q91 A;  1KSM A;  1QLS A;  1TNP A;  3SIA A;  2I18 A;  3CZ0 A;  4D1E A;  1NCX A;  1C3Y A;  1SK6 D;  3CWG A;  4PDZ A;  1IG5 A;  1PRW A;  1BR1 B;  3DXL A;  5D3O A;  2TN4 A;  4YI8 A;  1NCZ A;  1EG3 A;  5AEQ A;  1B4C A;  2AUC A;  2WC6 A;  3AKA A;  4INX A;  3OP0 A;  1YRU B;  1RJV A;  1DMO A;  1CFC A;  2F8P A;  3KHE A;  3DF0 B;  1W7I B;  3EVR A;  2Y1N A;  1JSA A;  2JWW A;  4AQI A;  4F7F A;  2LP2 A;  4C0L A;  1QIW A;  5G08 A;  1Y1X A;  1Q80 A;  2BAP A;  3I5I C;  2PSR A;  1LXF C;  1MHO A;  3B88 A;  3FS7 A;  1A75 B;  2M1K B;  3DF0 A;  3DYE A;  1JFJ A;  1K96 A;  3B7A A;  3FWC A;  4OZD A;  3NSO A;  1J1E A;  1M39 A;  1W9Z A;  3SG6 A;  2LUX A;  1TNQ A;  1C7V A;  1PVB A;  1CLL A;  1K9U A;  3DVM A;  2BEC A;  3PLF B;  3FE9 A;  1SR6 C;  1SL9 A;  3CGA A; 
#chains in the Genus database with same CATH homology
 1QJT A;  2FCE A;  2MRD A;  1F71 A;  3GK2 A;  3SG4 A;  4PHM A;  4ETO A;  1OMV A;  4CFQ A;  4N5X A;  2LAN A;  3PN7 C;  1K95 A;  5AFP A;  1K90 D;  4I5K A;  2JU0 A;  1LA0 A;  1NUB A;  2ZKM X;  3PFV A;  3TZ1 A;  3MSE B;  1XFW O;  3BUM B;  3O4Y A;  1TTX A;  1K9K A;  1F4O A;  2G2B A;  2JTT A;  1CB1 A;  1DJG A;  2K61 A;  2A4J A;  3SG5 A;  1EG4 A;  2BCX A;  2K7C A;  4ORC B;  3GK1 A;  1TOP A;  2MHH A;  3CR5 X;  1DGV A;  3LLE A;  4MEW A;  4NDC A;  2BCB A;  3LL8 B;  1CM4 A;  3NSI A;  2MLE C;  5IBW A;  1DJX A;  2DOQ A;  2F2P A;  3D0Y B;  1S1E A;  1X02 A;  3I5G C;  1KK8 C;  3VRN A;  2Y1M A;  1BLQ A;  4BY5 A;  1IJ5 A;  2LC5 A;  1WLM A;  2LVI A;  3BUO B;  3K21 A;  2AMI A;  4I5J A;  1LIN A;  1YUU A;  2OTG B;  4GUK A;  5I2Q A;  1S36 A;  4CPV A;  3HX4 A;  2M29 A;  4OCI A;  2LCP A;  2LLU A;  4PHN A;  1OMR A;  4YI9 A;  3TDI A;  3SJS A;  1QVI Y;  1B8L A;  3TS5 C;  1YRT B;  3VRO A;  2EGD A;  5DKR A;  1XFX O;  1QS7 A;  1KFX L;  4E68 A;  2JRF A;  3H4S E;  2E30 A;  4C0J A;  4P2Y B;  2LHL A;  2M3W A;  2COL B;  4OV2 A;  2K8M B;  3BOW B;  4YBH B;  1QV0 A;  1B1G A;  1L7Z A;  2R2I A;  4GPL B;  2QAC A;  4U8D A;  3TDU A;  1L2O B;  1MXE A;  3CZT X;  1UHK A;  1DT7 B;  1B47 A;  2KYC A;  1V1G A;  1OQP A;  3NXA A;  1F70 A;  2FOT A;  1OE9 B;  2M97 A;  2KFG A;  1SCM C;  1EH2 A;  1GQM A;  1NWD A;  4MVF A;  1S3P A;  1KFU S;  1RK9 A;  2L4I A;  2MAZ A;  5I8N A;  4BY4 A;  3LK1 A;  3I5H B;  2JT8 A;  1GJY A;  2FCD A;  2NXQ A;  4DUQ A;  1K93 D;  1DJH A;  2OS8 B;  1A29 A;  1ZOT B;  4OR9 B;  4PE0 A;  5HKW A;  3KEV A;  3WNX B;  1D1O A;  1BU3 A;  1UP5 A;  2ZND A;  1J7O A;  5AXI A;  1JF0 A;  2H61 C;  1AUI B;  1KSO A;  1YVH A;  2LAP A;  2FJU B;  1KWO B;  4R1E A;  1E8A A;  4USL A;  1MWN A;  3I5F B;  1NX0 A;  1SY9 A;  2GGM A;  1B8C A;  2KGB C;  4WRI A;  2K0J A;  1CLM A;  1TRF A;  1YVL A;  2MBX A;  3KO0 A;  2ZRS A;  2KAY A;  4GAO A;  4DIR A;  3SG3 A;  3M0W A;  1H8B A;  4AQJ A;  2NZ0 A;  1YR5 A;  1B7T Y;  1JF2 A;  2IS9 A;  3IQQ A;  5HKZ A;  1SR6 B;  2H2K A;  1YX7 A;  2BL0 C;  2L4H A;  2HPS A;  2ISD A;  5CSF A;  5DKQ A;  1TCF A;  4MSP A;  3VRR A;  4YGB B;  5KSZ A;  1SL7 A;  2JUL A;  4HRE E;  3WHT B;  1NCY A;  1UHN A;  3GK4 X;  1AVS A;  1UUR A;  2JZI A;  1IRJ A;  2LVV A;  2V53 A;  3C1V A;  4DS7 A;  2WC8 A;  3O6B A;  1EL4 A;  2LNK A;  3EVV A;  2LM5 A;  4JQ0 D;  3CLN A;  2ZN9 A;  2CXJ A;  3O78 A;  1AP4 A;  4L9M A;  1DJZ A;  1ODB A;  1QXP A;  3JTD B;  2CBL A;  1CFD A;  1Y0V H;  5CSN A;  5DKN A;  1CKK A;  2JTZ A;  1FF1 A;  2JNF A;  4MZJ A;  2G9B A;  2K7B A;  3EK4 A;  1DJW A;  2KYF A;  1J1D A;  1NP8 A;  2K2F A;  1J55 A;  2L98 A;  1A75 A;  1KQM B;  5ER5 A;  1NIW A;  1BJF A;  5HKY A;  1EJ3 A;  1RTP 1;  1RWY A;  4MRY A;  1YUS A;  2KI4 B;  1ZAC A;  4ZCV A;  3ICB A;  3QRX A;  4YGE B;  2CT9 A;  5CSJ A;  1MR8 A;  1F4Q A;  2LV7 A;  2WCF A;  1YTZ C;  2JXC A;  3TUY C;  1XFY O;  1Y6W A;  4QJ5 B;  1K94 A;  1CDL A;  1LVC D;  1RRO A;  3D10 A;  5JJG A;  4PAL A;  3BYA A;  1OSA A;  4PE7 A;  4NQG A;  3HCM A;  2KSP A;  3A8R A;  1FW4 A;  1HQV A;  1SBJ A;  2HQ8 A;  2LMT A;  3DVJ A;  1QVI Z;  2JXL A;  2L0P A;  1MXL C;  3CR4 X;  1DJI A;  1LKJ A;  1NYA A;  4OKH A;  1FBV A;  2Y4Q A;  1QX7 A;  2KFF A;  1MQ1 A;  1WRZ A;  1XVJ A;  1IQ3 A;  2PRU A;  2LP3 A;  1G33 A;  1OMD A;  2MJW B;  5JOL A;  1WRK A;  2VRG A;  1XK4 A;  2LVJ A;  4YGC B;  2JQ6 A;  4JPZ B;  1XFZ O;  3LK0 A;  3D0Y A;  4TNC A;  2EC6 B;  4DCK A;  1UHJ A;  4F0Z B;  1KFU L;  1XYD A;  3PAT A;  5D7F A;  1CDM A;  3RLZ A;  2JT3 A;  5ER4 X;  5HLO A;  1F54 A;  4CFR A;  1DGU A;  3O2P A;  2CNP A;  1N65 A;  2NLN A;  3PAL A;  4YRU A;  2JOJ A;  1NX1 A;  4M2Q A;  1REC A;  4ZCU A;  5F6T A;  1F8H A;  1M31 A;  4YGD B;  5B8I B;  2BBM A;  1S6I A;  2KBM A;  3TDZ A;  1UWO A;  1Y1A A;  2SAS A;  2O5G A;  5PAL A;  2CCM A;  1AJ4 A;  2Y5I A;  2NCP A;  3NSL A;  1B8R A;  1YUT A;  4N1F A;  4HSZ A;  1WDC C;  1FPW A;  2HF5 A;  2L2E A;  3BOW A;  1QX5 B;  1A2X A;  2KAX A;  2JT0 A;  3AAJ A;  1B9A A;  1BG1 A;  1KK7 Z;  2M8U A;  2BE4 A;  1AHR A;  5D69 A;  1N2D A;  5J3X A;  1SNL A;  3NSK A;  1DJY A;  3PM8 A;  4MLW A;  5TNC A;  1WY9 A;  2KHN A;  4IL1 A;  1NSH A;  3WXA A;  2BKI B;  2KQ6 A;  3RM1 A;  2F2O A;  2KFH A;  1XK4 C;  2K7O A;  1YX8 A;  4MN0 A;  1B7T Z;  1IKU A;  2WCB A;  4XYN A;  2LUC A;  2KNE A;  1V1F A;  2WOS A;  1CNP A;  2SCP A;  4FQO A;  3JVT C;  2BCA A;  3I5I B;  2OTG C;  2NCO A;  3VGO A;  1BMO A;  1KK7 Y;  5KU1 A;  1BR4 B;  2KOT A;  5HYD A;  1UHH A;  2PMY A;  3VRQ A;  3ZWH A;  1M63 B;  1PAL A;  3EK7 A;  4GGN A;  2F3Z A;  3EK8 A;  4GFT A;  2KQY A;  3GOF A;  4HRG A;  4PE1 A;  1PSB A;  2KI6 C;  1XFV O;  4MZL A;  3PN7 B;  3AAK A;  1CTR A;  1R2U A;  1CDP A;  2KAV A;  1L2O C;  3DVE A;  4GGF A;  4MZK A;  1JWD A;  2RGI A;  3TUY B;  2LLT A;  2O60 A;  3EVU A;  3OX6 A;  1A4P A;  1QIV A;  1TNX A;  4FTG A;  3BUW B;  2WND A;  3EKJ A;  1S6J A;  2HQW A;  1WRL A;  1ZMZ A;  2K2A A;  2P6B B;  5I2O A;  1PSR A;  3AKB A;  3IQO A;  3I5H C;  3OB2 B;  2L50 A;  3OHM B;  4JWQ A;  4QJ3 B;  3CS1 A;  1OZO A;  3CTN A;  4MRX A;  1NX2 A;  1DVI A;  1R6P A;  2BBN A;  4GBA A;  1RFJ A;  2OS8 C;  1DF0 B;  1Y1U A;  3I5G B;  3FIA A;  1G8I A;  1KK8 B;  2OPO A;  1CM1 A;  1HT9 A;  1A03 A;  4N1G A;  1NX3 A;  1FI5 A;  1AJ5 A;  2ZRT A;  3OX5 A;  1XO5 A;  2B1U A;  3WHU B;  1CMF A;  2BKH B;  1YUR A;  1DF0 A;  2M0R A;  2E6W A;  1KWO C;  1PK0 D;  1QX2 A;  3I5F C;  1U5I B;  3PSR A;  3TS5 B;  4PHK A;  1M45 A;  1OZS A;  2PAL A;  3BUN B;  1S5G Z;  1K2H A;  3SG7 A;  1PUL A;  1BOC A;  1FI6 A;  1C7W A;  2BE6 A;  4PE4 A;  1K9P A;  4I5N B;  4QJ4 B;  1CLB A;  1S26 D;  1TIZ A;  1U5I A;  2L5X B;  3DVK A;  2GGZ A;  2LVK A;  1SYM A;  5FYX A;  1IGV A;  4ICB A;  1KCY A;  2KDH A;  4CLN A;  4NDD A;  1SW8 A;  2EHB A;  4NDB A;  4ORA B;  3E3R A;  1ALV A;  1W7J B;  3LCP C;  4AOM A;  1WDC B;  2F33 A;  1SPY A;  1SCM B;  1S5G Y;  2M1U A;  1JC2 A;  2LMU A;  5BPJ A;  1UHI A;  2ZN8 A;  2JPT A;  2Q4U A;  1TNW A;  2QPT A;  2K7D A;  3JTD C;  1MF8 B;  1JUO A;  1IH0 A;  1TN4 A;  1ALW A;  1K8U A;  1SMG A;  4OVN F;  1EXR A;  3VRP A;  3DD4 A;  1IJ6 A;  3KPX A;  2M9G A;  1QTX A;  2AAO A;  2F3Y A;  2M7N A;  4PCW A;  1SKT A;  1DTL A;  1KQM C;  3EKH A;  2LLS A;  4GNK B;  4A4B A;  2GV5 A;  3JVT B;  4DRW A;  1VRK A;  1GGW A;  1ZUZ A;  1AK8 A;  1JBA A;  1ZFS A;  2KI4 C;  4M2P A;  2I7A A;  4ORB B;  2PAS A;  3FWB A;  2HET A;  5HLV A;  2PVB A;  4MBE A;  2KBI A;  3F45 A;  2MLF C;  4Q04 A;  1QLK A;  2H61 A;  1G4Y R;  2ZFD A;  5GQQ C;  4XJK B;  4WQ3 A;  4HRH A;  3BUX B;  1PVA A;  1TCO B;  1XA5 A;  1N0Y A;  1CFF A;  2BL0 B;  1J7P A;  2M49 B;  1WLZ A;  1BF5 A;  3IF7 A;  1M46 A;  4XJK A;  2KGR A;  2I94 A;  1S6C A;  2ZNE A;  1CFP A;  1IWQ A;  5I2L A;  2WCE A;  3BQ3 A;  1OOJ A;  4CID A;  1NPQ A;  1SL8 A;  3ZNI A;  1BT6 A;  2LE9 B;  2JNX A;  4M2O A;  3SIB A;  2L51 A;  2I2R E;  1KQV A;  2EC6 C;  1MUX A;  2M7L A;  1F55 A;  3BXK A;  4UPG A;  2D8N A;  2LHI A;  5CSI A;  1QAS A;  2WOR A;  3CR2 A;  4P5O E;  1KFX S;  1H4B A;  1QV1 A;  1J7R A;  5AER A;  4WQ2 A;  5K89 A;  1J7Q A;  1CMG A;  4YGA A;  4C0K A;  1UUS A;  2MA2 A;  3KF9 A;  4A4C A;  1LA3 A;  1JFK A;  5AAN A;  1GGZ A;  1XFU O;  4I5L B;  2KI6 D;  2LMV A;  2JC2 A;  3SG2 A;  5KTY A;  1QAT A;  1SCV A;  3A4U B;  1C07 A;  3OB1 B;  2CTN A;  1IQ5 A;  1BOD A;  1CDN A;  1SRA A;  4PHJ A;  5CPV A;  2Q91 A;  1KSM A;  1QLS A;  1TNP A;  3SIA A;  2I18 A;  4D1E A;  1NCX A;  1SK6 D;  3CWG A;  4PDZ A;  1IG5 A;  1PRW A;  1BR1 B;  2TN4 A;  4YI8 A;  1NCZ A;  1EG3 A;  5AEQ A;  1B4C A;  2AUC A;  3AKA A;  3OP0 A;  1YRU B;  1RJV A;  1DMO A;  1CFC A;  2F8P A;  3KHE A;  3DF0 B;  1W7I B;  3EVR A;  2Y1N A;  1JSA A;  2JWW A;  4AQI A;  2LP2 A;  4C0L A;  1QIW A;  5G08 A;  1Y1X A;  1Q80 A;  3I5I C;  2PSR A;  1LXF C;  1MHO A;  3FS7 A;  1A75 B;  2M1K B;  3DF0 A;  1JFJ A;  1K96 A;  3FWC A;  3NSO A;  1J1E A;  1M39 A;  3SG6 A;  2LUX A;  1TNQ A;  1C7V A;  1PVB A;  1CLL A;  1K9U A;  3DVM A;  2BEC A;  3PLF B;  4GGF C;  1SR6 C;  1SL9 A;  3CGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...