3R1VA

Odorant binding protein 7 from anopheles gambiae with four disulfide bridges, in complex with an azo compound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
124
structure length
124
Chain Sequence
FEIPDRYKKPAKMLHEICIAESGASEEQLRTCLDGTVPTAPAAKCYIHCLFDKIDVVDEATGRILLDRLLYIIPDDVKAAVDHLTRECSHIVTPDKCETAYETVKCYFNAHDEVIKFCHLLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant binding protein, antennal
publication title The Crystal Structure of Odorant Binding Protein 7 from Anopheles gambiae Exhibits an Outstanding Adaptability of Its Binding Site.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 41
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3r1vA00
3CABA 3S0EA 4PT1A 2ERBA 2L2CA 3NHTA 1OW4A 1OOHA 3DXLA 3R1VA 3S0BA 3L4AA 3QMEA 1DQEA 2FJYA 3K1EA 2P70A 1P28A 2WCKA 3FE9A 4JD9A 3R1PA 3CDNA 5DICA 3D77A 1OOIX 3RZSA 4INWA 3BJHA 1C3ZA 2WC5A 2WCJA 3BFHA 3NGVA 2JPOA 2H8VA 1GM0A 3NHIA 1OOGA 3B86A 3B6XA 3CZ2A 3B88A 2WC6A 2QEVA 1TWOA 4INXA 3OGNA 1T14A 3VB1A 3D73A 4OZDA 3V2LA 2QEHA 3CZ1A 3FE8A 3DY9A 1C3YA 3D78A 3BFBA 3L4LA 3S0FA 4F7FA 3CZ0A 3DYEA 2GTEA 2QEBA 2QEOA 3R1OA 3S0DA 2WCHA 3S0GA 4FQTA 3L47A 3D76A 1TUJA 2P71A 2WCMA 2KPHA 3Q8IA 1QWVA 2QDIA 1OOFA 3R72A 3B7AA 3FE6A 3CYZA 3D74A 3S0AA 5EL2A 3N7HA 3BFAA 1XFRA 3B87A 2PQLA 1ORGA 3DZTA 3D75A 1LS8A 3PJIA 2WCLA
chains in the Genus database with same CATH superfamily
4AQJA 1NX1A 1IIOA 1NCZA 2D8NA 1YTZC 3S0EA 3DF0A 3TDIA 1TNXA 2MLFC 1Y1UA 4PT1A 1H8BA 1IJ6A 2LMVA 1H4BA 3SG5A 4MEWA 3VRNA 1RROA 4NDDA 1KFXL 1ODBA 2K7CA 1J1DA 4OCIA 2KNEA 5J3XA 1CFCA 1KWOC 4OR9B 4PE1A 1DQEA 1CTRA 2FJUB 1K96A 1WY9A 3NSIA 1MF8B 1YR5A 2JNFA 1RK9A 4PDZA 4GGNA 3TS5B 2LLSA 1SMGA 1P28A 3AKBA 4JD9A 4YGEB 3EK4A 1AHRA 1A29A 1QVIZ 4TNCA 2LHIA 4MVFA 2LV7A 5DKQA 4INWA 3K21A 2ZFDA 3HCMA 1CDNA 3BJHA 1DT7B 2K61A 5FI6A 5I2LA 1CDMA 1DGVA 2LANA 4HRGA 1LA3A 2L2EA 3AAJA 1SR6C 3PATA 4MZKA 2BCAA 4P2YB 3UNWA 1DC1A 1KK8C 1A75B 2BNXA 2HQWA 1C07A 3F45A 3OB2B 2R2IA 2H61C 1QLKA 2LVIA 2EHBA 2M0RA 3B6XA 3BUOB 2M9GA 2WC6A 4N5XA 1IQ3A 1JBAA 4HREE 1IGVA 2G2BA 3OGNA 4IL1A 1NSHA 2M7NA 5CSNA 1OMDA 2WCFA 4YGCB 4OVNF 3KPXA 1MUXA 1AUIB 1BU3A 1B9AA 4GBAA 4YGDB 3CR4X 1N0YA 4MLWA 3I5GC 4GGFA 2JULA 1NX3A 1QS7A 3S0FA 1D1OA 4YGAA 3LLEA 1NUBA 3EK8A 4QJ4B 2PYQA 3BUNB 1WLZA 5D69A 1F55A 5AXIA 2CXJA 2L4IA 2FCDA 2KAYA 1SBJA 1F71A 2KI4B 1HT9A 4FQTA 1CFDA 2F2OA 2A4JA 3SG2A 2LC5A 2OS8C 3SG3A 4I5KA 1V1FA 5TNCA 3D76A 2JT8A 3BUMB 1KSOA 2EGDA 1NX2A 4GPLB 1BJFA 1LA0A 1PVBA 2BECA 2K7DA 2P71A 2WCMA 3PALA 5FI2A 1JFJA 2M1KB 5K89A 1W7IB 1QJTA 1MXLC 1GJYA 1QWVA 2LHLA 2MAZA 2IS9A 2QDIA 2WC8A 3O4YA 3OX6A 1L2OB 3TS5C 3VRRA 1F8HA 1K8UA 1OOFA 3R72A 4GNKB 1UWOA 4YGBB 3FE6A 1DJHA 2BCXA 5KSZA 3NSOA 1K94A 3D74A 5FI7A 1BT6A 2LM5A 3TDUA 1PSRA 1TIZA 3ZNIA 2AAOA 1TNWA 3BFAA 5JJGA 1UHIA 1IWQA 3LL8B 1KSMA 3NXAA 1XK4C 2JOJA 2O5GA 4FTGA 4PE7A 1CNPA 3SG7A 1OQPA 1YUTA 3SIBA 1QX7A 2KI6C 4JPZB 3D75A 1XFZO 3M0WA 4MN0A 1KFXS 1UUSA 2WCLA 1EH2A 4PHKA 2BE6A 1IJ5A 3D0YA 4F0ZB 4NDBA 1M63B 1LKJA 1TUZA 2ERBA 1Z4HA 2L2CA 2LMUA 1NX0A 1G4YR 1SPYA 1J55A 1W7JB 2M97A 4PCWA 2EC6B 1FBVA 2LAPA 4Q04A 2KOTA 1AP4A 1YX8A 1YUSA 1DF0B 1CLLA 1FF1A 1A4PA 1M46A 4E68A 2LMTA 1LXFC 2TN4A 1CMGA 1YUUA 1TOPA 1YRTB 1OMVA 1SCMB 2WCBA 5CSIA 2P70A 1DJWA 1QASA 4WQ3A 1SCVA 2NZ0A 3IF7A 2F33A 5DICA 2ZKMX 1WRKA 1JWDA 3D77A 1SY9A 2KI4C 3VRPA 3O2PA 1KFUS 5FYXA 3CGAA 3SS5A 1MR8A 1CDPA 5F6TA 4MRXA 4CPVA 4U8DA 1CM4A 1BLQA 1C3ZA 3DVMA 3SIAA 3DVKA 1CM1A 1DMOA 4XJKA 1B4CA 4GUKA 2JTTA 3BFHA 4FQOA 3PM8A 2KQ6A 2L5XB 2KFFA 2K0JA 3I5HB 4DRWA 2I94A 1L2OC 1GGWA 1BODA 4CIDA 1CFFA 3CZ2A 2BKIB 3WNXB 4DS7A 1MQ1A 1Z2CB 2CNPA 2MLEC 2MHHA 1KQVA 2JU0A 4NDCA 2LVKA 3D73A 1JFKA 4OZDA 2HETA 3V2LA 1PALA 1WDCB 2QEHA 3IVTA 1LINA 4AOMA 4CFQA 3FE8A 1S26D 2F8PA 2CT9A 1BG1A 1RJVA 3NSLA 2K60A 2H61A 3BFBA 3L4LA 2AUCA 3CZ0A 1J7QA 1QV0A 1Q80A 2QEOA 1KFUL 3S0DA 1VRKA 4GFTA 1XVJA 5AFPA 1WRZA 2WCHA 1QVIY 4ZCVA 4HRHA 4OKHA 1A03A 3SG6A 1S1EA 2EC6C 3KHEA 1SYMA 2QACA 1BR1B 1K90D 4M2QA 5CSFA 1SSEB 5HKYA 4MSPA 2NLNA 4DUQA 2NCOA 2KGRA 2SASA 3AAKA 2PRUA 1K95A 1EG4A 3EKJA 1XA5A 4MZJA 3OHMB 1DJGA 4ICBA 3TUYB 2K2FA 3O78A 4GAOA 1QIVA 2DOQA 1ALWA 2JWWA 1B7TZ 3VROA 1J7RA 2Y1NA 3GK1A 3B7AA 3CTNA 1XO5A 4I5JA 3SS4A 1C7WA 3CYZA 1BOCA 2COLB 4A4CA 1XFYO 1BMOA 3S0AA 2LUCA 5EL2A 3N7HA 1DEKA 3OB1B 3WHUB 2ZNEA 3LK1A 1XFRA 3B87A 1UURA 1BF5A 2M8UA 1QTXA 3FIAA 4OV2A 2JTZA 3KF9A 2HQ8A 2V53A 1QXPA 3D0YB 1DVIA 2E6WA 2MBXA 1S6IA 2LLUA 3I5HC 1JF0A 2K2AA 2O60A 1NCYA 2BCBA 2H2KA 2OTGB 3H4SE 3CLNA 3CABA 1KQMB 2K7OA 3UO9A 1TRFA 1MHOA 2JZIA 3AKAA 2CCMA 5D7FA 1OOHA 3DXLA 3JVTB 3KO0A 1XK4A 2QPTA 1WDCC 3R1VA 1ZOTB 2WORA 2PMYA 3L4AA 3QMEA 1CFPA 2MA2A 3FWBA 1QV1A 1L7ZA 3EK7A 4D1EA 1B8LA 1YVHA 2SCPA 1V1GA 2Q91A 1SL7A 2KFGA 5CPVA 1U5IB 2NCPA 5ER5A 4ORAB 3R1PA 2K7BA 3QRXA 5I2OA 2I18A 3DF0B 1KK7Z 1OOIX 2LCPA 3BUXB 1KWOB 5D3OA 5DKNA 4UPGA 1DJYA 1EJ3A 2KDHA 2HPSA 3RZSA 5HKZA 4XJKB 1TN4A 5CSJA 2BE4A 1JF2A 2NXQA 2WC5A 3BXKA 1FI6A 1M39A 5GQQC 1XFWO 2F2PA 3MSEB 3WHTB 1E8AA 2KQYA 3DVJA 3GOFA 1YURA 1OMRA 2G9BA 4ETOA 1FPWA 1FW4A 2L50A 3CR2A 3PN7B 1UHKA 1KK7Y 3TUYC 1GM0A 2ZNDA 3PSRA 1F70A 1K9KA 1XFVO 2Q4UA 2F3ZA 1OOGA 1OZSA 3FWCA 4C0KA 2I2RE 1NPQA 1EL4A 1OZOA 2QEVA 1TCOB 2KBIA 1TWOA 5HL1A 4I5LB 1J7PA 4YI8A 3HX4A 3I5FB 2M7LA 5HLOA 1PULA 2L98A 3OP0A 3VB1A 3O6BA 4JKTA 2JXCA 3FS7A 1K9UA 2KSPA 3CZ1A 4M2PA 2FCEA 3IQQA 4USLA 4BY4A 1TNPA 2F3YA 3DY9A 1B47A 3LK0A 2ZRTA 1ALVA 2LLTA 3D78A 1AJ5A 1DTLA 4YBHB 1C3YA 4F7FA 1N65A 2KLEA 2OTGC 1NP8A 1RECA 1KQMC 2KYFA 2I7AA 1S6CA 1Y1AA 3PFVA 1NWDA 4A4BA 4KYNA 1YX7A 1CLMA 1R2UA 3DVEA 2JRFA 5HLVA 1JSAA 3CWGA 2JT0A 1CKKA 3CZTX 1M45A 1SK6D 1IRJA 1TUJA 2KFHA 3KEVA 1XFUO 1Y0VH 3VGOA 2LVVA 1UHJA 1ZFSA 2JXLA 2LUXA 4ORBB 2LVJA 1IQ5A 3I5IB 3EVVA 1IH0A 2L4HA 2JQ6A 2M1UA 4C0LA 2HF5A 2GV5A 4QJ5B 2OS8B 1B8RA 2FOTA 1YVLA 2Y4QA 2BL0B 1UHHA 1CB1A 1DGUA 3ICBA 4M2OA 3DD4A 5HKWA 1WLMA 1K93D 2M29A 1ZMZA 3RM1A 1RTP1 3OBVA 1F4QA 1DF0A 1PK0D 1EXRA 1SL9A 1ORGA 1YRUB 2CTNA 1C7VA 1FI5A 1JC2A 4PHMA 3PM2A 2OPOA 3PN7C 1LS8A 3PJIA 2BBMA 1DJIA 2YGUA 3JTDB 1CLBA 2KI6D 3GK2A 1S3PA 2MJWB 4N1FA 3PLFB 3EG5B 4JQ0D 1X02A 3BUWB 3OX5A 1S6JA 1R6PA 3NHTA 1GGZA 2Y1MA 1SCMC 3BOWA 1OW4A 5PALA 3I5FC 1CDLA 2L51A 1QLSA 4R1EA 1F4OA 2WOSA 3EKHA 3S0BA 1ZUZA 1DELA 1LVCD 4ORCB 1EG3A 2LP2A 2PSRA 3TZ1A 3SG4A 2FJYA 3K1EA 3BQ3A 5HYDA 3RLZA 4C0JA 1QIWA 1QX2A 5I94A 5JOLA 1J1EA 3VRQA 4MZLA 1NYAA 4MRYA 1B7TY 4ZCUA 2WCKA 3FE9A 1B8CA 2Y5IA 2BAPA 3CDNA 5KU1A 2LNKA 1AJ4A 1RFJA 1UP5A 3LCPC 2P6BB 3NSKA 1ZACA 1QATA 3D10A 1S5GZ 5ER4X 1TNQA 4BY5A 1SKTA 2KHNA 4WQ2A 4NQGA 4DCKA 1GQMA 4XYNA 2ISDA 1KCYA 1QX5B 4YRUA 2ZN8A 1Y6WA 1DJZA 2WCJA 2M49B 3NGVA 4QJ3B 2JPOA 1S36A 1SRAA 2H8VA 3NHIA 4GGFC 5I2QA 3I5IC 1NCXA 1A75A 3B86A 1S5GY 2GGZA 3A4UB 3B88A 2KAVA 1OSAA 5G08A 1K9PA 4CFRA 1AK8A 2M3WA 2BL0C 4INXA 1PSBA 1W9ZA 1T14A 1M31A 3CS1A 2VRGA 4N1GA 4PE4A 1NIWA 2ZRSA 2PVBA 5IBWA 2KYCA 2LE9B 4HSZA 2L5YA 2WCEA 2JPTA 1MXEA 1TCFA 1F54A 2PALA 1J7OA 1XYDA 4PHJA 5AEQA 2KGBC 1OE9B 3JTDC 1IG5A 2PASA 3SJSA 3EVUA 2KLDA 1RWYA 2WNDA 2GTEA 2KBMA 1BR4B 3DYEA 4PHNA 2QEBA 3R1OA 4I5NB 4P5OE 1WRLA 4CLNA 5KTYA 5I8NA 2ZN9A 1A2XA 3BYAA 2LP3A 2AMIA 4MBEA 4AQIA 4PALA 1B1GA 2RGIA 3S0GA 3A8RA 3EVRA 1JUOA 4JWQA 1MWNA 3L47A 2BKHB 4L9MA 5B8IB 4DIRA 3TDZA 1G8IA 3O4XA 1SR6B 1SL8A 2KPHA 1KK8B 3SS3A 3E3RA 3Q8IA 5DKRA 4YI9A 1CMFA 1DJXA 2JNXA 1AVSA 2KAXA 3CR5X 5AERA 5AANA 1UHNA 1TTXA 5BPJA 2BBNA 4IJ7A 1IKUA 2B1UA 2CBLA 1G33A 4PE0A 1HQVA 2E30A 2JC2A 1Y1XA 3C1VA 3IQOA 1XFXO 3WXAA 1N2DA 1SNLA 1SW8A 1K2HA 1OOJA 2GGMA 2PQLA 2MRDA 3JVTC 3GK4X 3DZTA 3I5GB 4WRIA 2JT3A 1U5IA 3ZWHA 1PVAA 1PRWA 2L0PA 2K8MB 3BOWB
chains in the Genus database with same CATH topology
3CABA 3S0EA 4PT1A 2ERBA 2L2CA 3NHTA 1OW4A 1OOHA 3DXLA 3R1VA 3S0BA 3L4AA 3QMEA 1DQEA 2FJYA 3K1EA 2P70A 1P28A 2WCKA 3FE9A 4JD9A 3R1PA 3CDNA 5DICA 3D77A 1OOIX 3RZSA 4INWA 3BJHA 1C3ZA 2WC5A 2WCJA 3BFHA 3NGVA 2JPOA 2H8VA 1GM0A 3NHIA 1OOGA 3B86A 3B6XA 3CZ2A 3B88A 2WC6A 2QEVA 1TWOA 4INXA 3OGNA 1T14A 3VB1A 3D73A 4OZDA 3V2LA 2QEHA 3CZ1A 3FE8A 3DY9A 1C3YA 3D78A 3BFBA 3L4LA 3S0FA 4F7FA 3CZ0A 3DYEA 2GTEA 2QEBA 2QEOA 3R1OA 3S0DA 2WCHA 3S0GA 4FQTA 3L47A 3D76A 1TUJA 2P71A 2WCMA 2KPHA 3Q8IA 1QWVA 2QDIA 1OOFA 3R72A 3B7AA 3FE6A 3CYZA 3D74A 3S0AA 5EL2A 3N7HA 3BFAA 1XFRA 3B87A 2PQLA 1ORGA 3DZTA 3D75A 1LS8A 3PJIA 2WCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAB A;  3S0E A;  4PT1 A;  2ERB A;  2L2C A;  3NHT A;  1OW4 A;  1OOH A;  3DXL A;  3R1V A;  3S0B A;  3L4A A;  3QME A;  1DQE A;  2FJY A;  3K1E A;  2P70 A;  1P28 A;  2WCK A;  3FE9 A;  4JD9 A;  3R1P A;  3CDN A;  5DIC A;  3D77 A;  1OOI X;  3RZS A;  4INW A;  3BJH A;  1C3Z A;  2WC5 A;  2WCJ A;  3BFH A;  3NGV A;  2JPO A;  2H8V A;  1GM0 A;  3NHI A;  1OOG A;  3B86 A;  3B6X A;  3CZ2 A;  3B88 A;  2WC6 A;  2QEV A;  1TWO A;  4INX A;  3OGN A;  1T14 A;  3VB1 A;  3D73 A;  4OZD A;  3V2L A;  2QEH A;  3CZ1 A;  3FE8 A;  3DY9 A;  1C3Y A;  3D78 A;  3BFB A;  3L4L A;  3S0F A;  4F7F A;  3CZ0 A;  3DYE A;  2GTE A;  2QEB A;  2QEO A;  3R1O A;  3S0D A;  2WCH A;  3S0G A;  4FQT A;  3L47 A;  3D76 A;  1TUJ A;  2P71 A;  2WCM A;  2KPH A;  3Q8I A;  1QWV A;  2QDI A;  1OOF A;  3R72 A;  3B7A A;  3FE6 A;  3CYZ A;  3D74 A;  3S0A A;  5EL2 A;  3N7H A;  3BFA A;  1XFR A;  3B87 A;  2PQL A;  1ORG A;  3DZT A;  3D75 A;  1LS8 A;  3PJI A;  2WCL A; 
#chains in the Genus database with same CATH topology
 4AQJ A;  1NX1 A;  1IIO A;  1NCZ A;  2D8N A;  1YTZ C;  3S0E A;  3DF0 A;  3TDI A;  1TNX A;  2MLF C;  1Y1U A;  4PT1 A;  1H8B A;  1IJ6 A;  2LMV A;  1H4B A;  3SG5 A;  4MEW A;  3VRN A;  1RRO A;  4NDD A;  1KFX L;  1ODB A;  2K7C A;  1J1D A;  4OCI A;  2KNE A;  5J3X A;  1CFC A;  1KWO C;  4OR9 B;  4PE1 A;  1DQE A;  1CTR A;  2FJU B;  1K96 A;  1WY9 A;  3NSI A;  1MF8 B;  1YR5 A;  2JNF A;  1RK9 A;  4PDZ A;  4GGN A;  3TS5 B;  2LLS A;  1SMG A;  1P28 A;  3AKB A;  4JD9 A;  4YGE B;  3EK4 A;  1AHR A;  1A29 A;  1QVI Z;  4TNC A;  2LHI A;  4MVF A;  2LV7 A;  5DKQ A;  4INW A;  3K21 A;  2ZFD A;  3HCM A;  1CDN A;  3BJH A;  1DT7 B;  2K61 A;  5FI6 A;  5I2L A;  1CDM A;  1DGV A;  2LAN A;  4HRG A;  1LA3 A;  2L2E A;  3AAJ A;  1SR6 C;  3PAT A;  4MZK A;  2BCA A;  4P2Y B;  3UNW A;  1DC1 A;  1KK8 C;  1A75 B;  2BNX A;  2HQW A;  1C07 A;  3F45 A;  3OB2 B;  2R2I A;  2H61 C;  1QLK A;  2LVI A;  2EHB A;  2M0R A;  3B6X A;  3BUO B;  2M9G A;  2WC6 A;  4N5X A;  1IQ3 A;  1JBA A;  4HRE E;  1IGV A;  2G2B A;  3OGN A;  4IL1 A;  1NSH A;  2M7N A;  5CSN A;  1OMD A;  2WCF A;  4YGC B;  4OVN F;  3KPX A;  1MUX A;  1AUI B;  1BU3 A;  1B9A A;  4GBA A;  4YGD B;  3CR4 X;  1N0Y A;  4MLW A;  3I5G C;  4GGF A;  2JUL A;  1NX3 A;  1QS7 A;  3S0F A;  1D1O A;  4YGA A;  3LLE A;  1NUB A;  3EK8 A;  4QJ4 B;  2PYQ A;  3BUN B;  1WLZ A;  5D69 A;  1F55 A;  5AXI A;  2CXJ A;  2L4I A;  2FCD A;  2KAY A;  1SBJ A;  1F71 A;  2KI4 B;  1HT9 A;  4FQT A;  1CFD A;  2F2O A;  2A4J A;  3SG2 A;  2LC5 A;  2OS8 C;  3SG3 A;  4I5K A;  1V1F A;  5TNC A;  3D76 A;  2JT8 A;  3BUM B;  1KSO A;  2EGD A;  1NX2 A;  4GPL B;  1BJF A;  1LA0 A;  1PVB A;  2BEC A;  2K7D A;  2P71 A;  2WCM A;  3PAL A;  5FI2 A;  1JFJ A;  2M1K B;  5K89 A;  1W7I B;  1QJT A;  1MXL C;  1GJY A;  1QWV A;  2LHL A;  2MAZ A;  2IS9 A;  2QDI A;  2WC8 A;  3O4Y A;  3OX6 A;  1L2O B;  3TS5 C;  3VRR A;  1F8H A;  1K8U A;  1OOF A;  3R72 A;  4GNK B;  1UWO A;  4YGB B;  3FE6 A;  1DJH A;  2BCX A;  5KSZ A;  3NSO A;  1K94 A;  3D74 A;  5FI7 A;  1BT6 A;  2LM5 A;  3TDU A;  1PSR A;  1TIZ A;  3ZNI A;  2AAO A;  1TNW A;  3BFA A;  5JJG A;  1UHI A;  1IWQ A;  3LL8 B;  1KSM A;  3NXA A;  1XK4 C;  2JOJ A;  2O5G A;  4FTG A;  4PE7 A;  1CNP A;  3SG7 A;  1OQP A;  1YUT A;  3SIB A;  1QX7 A;  2KI6 C;  4JPZ B;  3D75 A;  1XFZ O;  3M0W A;  4MN0 A;  1KFX S;  1UUS A;  2WCL A;  1EH2 A;  4PHK A;  2BE6 A;  1IJ5 A;  3D0Y A;  4F0Z B;  4NDB A;  1M63 B;  1LKJ A;  1TUZ A;  2ERB A;  1Z4H A;  2L2C A;  2LMU A;  1NX0 A;  1G4Y R;  1SPY A;  1J55 A;  1W7J B;  2M97 A;  4PCW A;  2EC6 B;  1FBV A;  2LAP A;  4Q04 A;  2KOT A;  1AP4 A;  1YX8 A;  1YUS A;  1DF0 B;  1CLL A;  1FF1 A;  1A4P A;  1M46 A;  4E68 A;  2LMT A;  1LXF C;  2TN4 A;  1CMG A;  1YUU A;  1TOP A;  1YRT B;  1OMV A;  1SCM B;  2WCB A;  5CSI A;  2P70 A;  1DJW A;  1QAS A;  4WQ3 A;  1SCV A;  2NZ0 A;  3IF7 A;  2F33 A;  5DIC A;  2ZKM X;  1WRK A;  1JWD A;  3D77 A;  1SY9 A;  2KI4 C;  3VRP A;  3O2P A;  1KFU S;  5FYX A;  3CGA A;  3SS5 A;  1MR8 A;  1CDP A;  5F6T A;  4MRX A;  4CPV A;  4U8D A;  1CM4 A;  1BLQ A;  1C3Z A;  3DVM A;  3SIA A;  3DVK A;  1CM1 A;  1DMO A;  4XJK A;  1B4C A;  4GUK A;  2JTT A;  3BFH A;  4FQO A;  3PM8 A;  2KQ6 A;  2L5X B;  2KFF A;  2K0J A;  3I5H B;  4DRW A;  2I94 A;  1L2O C;  1GGW A;  1BOD A;  4CID A;  1CFF A;  3CZ2 A;  2BKI B;  3WNX B;  4DS7 A;  1MQ1 A;  1Z2C B;  2CNP A;  2MLE C;  2MHH A;  1KQV A;  2JU0 A;  4NDC A;  2LVK A;  3D73 A;  1JFK A;  4OZD A;  2HET A;  3V2L A;  1PAL A;  1WDC B;  2QEH A;  3IVT A;  1LIN A;  4AOM A;  4CFQ A;  3FE8 A;  1S26 D;  2F8P A;  2CT9 A;  1BG1 A;  1RJV A;  3NSL A;  2K60 A;  2H61 A;  3BFB A;  3L4L A;  2AUC A;  3CZ0 A;  1J7Q A;  1QV0 A;  1Q80 A;  2QEO A;  1KFU L;  3S0D A;  1VRK A;  4GFT A;  1XVJ A;  5AFP A;  1WRZ A;  2WCH A;  1QVI Y;  4ZCV A;  4HRH A;  4OKH A;  1A03 A;  3SG6 A;  1S1E A;  2EC6 C;  3KHE A;  1SYM A;  2QAC A;  1BR1 B;  1K90 D;  4M2Q A;  5CSF A;  1SSE B;  5HKY A;  4MSP A;  2NLN A;  4DUQ A;  2NCO A;  2KGR A;  2SAS A;  3AAK A;  2PRU A;  1K95 A;  1EG4 A;  3EKJ A;  1XA5 A;  4MZJ A;  3OHM B;  1DJG A;  4ICB A;  3TUY B;  2K2F A;  3O78 A;  4GAO A;  1QIV A;  2DOQ A;  1ALW A;  2JWW A;  1B7T Z;  3VRO A;  1J7R A;  2Y1N A;  3GK1 A;  3B7A A;  3CTN A;  1XO5 A;  4I5J A;  3SS4 A;  1C7W A;  3CYZ A;  1BOC A;  2COL B;  4A4C A;  1XFY O;  1BMO A;  3S0A A;  2LUC A;  5EL2 A;  3N7H A;  1DEK A;  3OB1 B;  3WHU B;  2ZNE A;  3LK1 A;  1XFR A;  3B87 A;  1UUR A;  1BF5 A;  2M8U A;  1QTX A;  3FIA A;  4OV2 A;  2JTZ A;  3KF9 A;  2HQ8 A;  2V53 A;  1QXP A;  3D0Y B;  1DVI A;  2E6W A;  2MBX A;  1S6I A;  2LLU A;  3I5H C;  1JF0 A;  2K2A A;  2O60 A;  1NCY A;  2BCB A;  2H2K A;  2OTG B;  3H4S E;  3CLN A;  3CAB A;  1KQM B;  2K7O A;  3UO9 A;  1TRF A;  1MHO A;  2JZI A;  3AKA A;  2CCM A;  5D7F A;  1OOH A;  3DXL A;  3JVT B;  3KO0 A;  1XK4 A;  2QPT A;  1WDC C;  3R1V A;  1ZOT B;  2WOR A;  2PMY A;  3L4A A;  3QME A;  1CFP A;  2MA2 A;  3FWB A;  1QV1 A;  1L7Z A;  3EK7 A;  4D1E A;  1B8L A;  1YVH A;  2SCP A;  1V1G A;  2Q91 A;  1SL7 A;  2KFG A;  5CPV A;  1U5I B;  2NCP A;  5ER5 A;  4ORA B;  3R1P A;  2K7B A;  3QRX A;  5I2O A;  2I18 A;  3DF0 B;  1KK7 Z;  1OOI X;  2LCP A;  3BUX B;  1KWO B;  5D3O A;  5DKN A;  4UPG A;  1DJY A;  1EJ3 A;  2KDH A;  2HPS A;  3RZS A;  5HKZ A;  4XJK B;  1TN4 A;  5CSJ A;  2BE4 A;  1JF2 A;  2NXQ A;  2WC5 A;  3BXK A;  1FI6 A;  1M39 A;  5GQQ C;  1XFW O;  2F2P A;  3MSE B;  3WHT B;  1E8A A;  2KQY A;  3DVJ A;  3GOF A;  1YUR A;  1OMR A;  2G9B A;  4ETO A;  1FPW A;  1FW4 A;  2L50 A;  3CR2 A;  3PN7 B;  1UHK A;  1KK7 Y;  3TUY C;  1GM0 A;  2ZND A;  3PSR A;  1F70 A;  1K9K A;  1XFV O;  2Q4U A;  2F3Z A;  1OOG A;  1OZS A;  3FWC A;  4C0K A;  2I2R E;  1NPQ A;  1EL4 A;  1OZO A;  2QEV A;  1TCO B;  2KBI A;  1TWO A;  5HL1 A;  4I5L B;  1J7P A;  4YI8 A;  3HX4 A;  3I5F B;  2M7L A;  5HLO A;  1PUL A;  2L98 A;  3OP0 A;  3VB1 A;  3O6B A;  4JKT A;  2JXC A;  3FS7 A;  1K9U A;  2KSP A;  3CZ1 A;  4M2P A;  2FCE A;  3IQQ A;  4USL A;  4BY4 A;  1TNP A;  2F3Y A;  3DY9 A;  1B47 A;  3LK0 A;  2ZRT A;  1ALV A;  2LLT A;  3D78 A;  1AJ5 A;  1DTL A;  4YBH B;  1C3Y A;  4F7F A;  1N65 A;  2KLE A;  2OTG C;  1NP8 A;  1REC A;  1KQM C;  2KYF A;  2I7A A;  1S6C A;  1Y1A A;  3PFV A;  1NWD A;  4A4B A;  4KYN A;  1YX7 A;  1CLM A;  1R2U A;  3DVE A;  2JRF A;  5HLV A;  1JSA A;  3CWG A;  2JT0 A;  1CKK A;  3CZT X;  1M45 A;  1SK6 D;  1IRJ A;  1TUJ A;  2KFH A;  3KEV A;  1XFU O;  1Y0V H;  3VGO A;  2LVV A;  1UHJ A;  1ZFS A;  2JXL A;  2LUX A;  4ORB B;  2LVJ A;  1IQ5 A;  3I5I B;  3EVV A;  1IH0 A;  2L4H A;  2JQ6 A;  2M1U A;  4C0L A;  2HF5 A;  2GV5 A;  4QJ5 B;  2OS8 B;  1B8R A;  2FOT A;  1YVL A;  2Y4Q A;  2BL0 B;  1UHH A;  1CB1 A;  1DGU A;  3ICB A;  4M2O A;  3DD4 A;  5HKW A;  1WLM A;  1K93 D;  2M29 A;  1ZMZ A;  3RM1 A;  1RTP 1;  3OBV A;  1F4Q A;  1DF0 A;  1PK0 D;  1EXR A;  1SL9 A;  1ORG A;  1YRU B;  2CTN A;  1C7V A;  1FI5 A;  1JC2 A;  4PHM A;  3PM2 A;  2OPO A;  3PN7 C;  1LS8 A;  3PJI A;  2BBM A;  1DJI A;  2YGU A;  3JTD B;  1CLB A;  2KI6 D;  3GK2 A;  1S3P A;  2MJW B;  4N1F A;  3PLF B;  3EG5 B;  4JQ0 D;  1X02 A;  3BUW B;  3OX5 A;  1S6J A;  1R6P A;  3NHT A;  1GGZ A;  2Y1M A;  1SCM C;  3BOW A;  1OW4 A;  5PAL A;  3I5F C;  1CDL A;  2L51 A;  1QLS A;  4R1E A;  1F4O A;  2WOS A;  3EKH A;  3S0B A;  1ZUZ A;  1DEL A;  1LVC D;  4ORC B;  1EG3 A;  2LP2 A;  2PSR A;  3TZ1 A;  3SG4 A;  2FJY A;  3K1E A;  3BQ3 A;  5HYD A;  3RLZ A;  4C0J A;  1QIW A;  1QX2 A;  5I94 A;  5JOL A;  1J1E A;  3VRQ A;  4MZL A;  1NYA A;  4MRY A;  1B7T Y;  4ZCU A;  2WCK A;  3FE9 A;  1B8C A;  2Y5I A;  2BAP A;  3CDN A;  5KU1 A;  2LNK A;  1AJ4 A;  1RFJ A;  1UP5 A;  3LCP C;  2P6B B;  3NSK A;  1ZAC A;  1QAT A;  3D10 A;  1S5G Z;  5ER4 X;  1TNQ A;  4BY5 A;  1SKT A;  2KHN A;  4WQ2 A;  4NQG A;  4DCK A;  1GQM A;  4XYN A;  2ISD A;  1KCY A;  1QX5 B;  4YRU A;  2ZN8 A;  1Y6W A;  1DJZ A;  2WCJ A;  2M49 B;  3NGV A;  4QJ3 B;  2JPO A;  1S36 A;  1SRA A;  2H8V A;  3NHI A;  4GGF C;  5I2Q A;  3I5I C;  1NCX A;  1A75 A;  3B86 A;  1S5G Y;  2GGZ A;  3A4U B;  3B88 A;  2KAV A;  1OSA A;  5G08 A;  1K9P A;  4CFR A;  1AK8 A;  2M3W A;  2BL0 C;  4INX A;  1PSB A;  1W9Z A;  1T14 A;  1M31 A;  3CS1 A;  2VRG A;  4N1G A;  4PE4 A;  1NIW A;  2ZRS A;  2PVB A;  5IBW A;  2KYC A;  2LE9 B;  4HSZ A;  2L5Y A;  2WCE A;  2JPT A;  1MXE A;  1TCF A;  1F54 A;  2PAL A;  1J7O A;  1XYD A;  4PHJ A;  5AEQ A;  2KGB C;  1OE9 B;  3JTD C;  1IG5 A;  2PAS A;  3SJS A;  3EVU A;  2KLD A;  1RWY A;  2WND A;  2GTE A;  2KBM A;  1BR4 B;  3DYE A;  4PHN A;  2QEB A;  3R1O A;  4I5N B;  4P5O E;  1WRL A;  4CLN A;  5KTY A;  5I8N A;  2ZN9 A;  1A2X A;  3BYA A;  2LP3 A;  2AMI A;  4MBE A;  4AQI A;  4PAL A;  1B1G A;  2RGI A;  3S0G A;  3A8R A;  3EVR A;  1JUO A;  4JWQ A;  1MWN A;  3L47 A;  2BKH B;  4L9M A;  5B8I B;  4DIR A;  3TDZ A;  1G8I A;  3O4X A;  1SR6 B;  1SL8 A;  2KPH A;  1KK8 B;  3SS3 A;  3E3R A;  3Q8I A;  5DKR A;  4YI9 A;  1CMF A;  1DJX A;  2JNX A;  1AVS A;  2KAX A;  3CR5 X;  5AER A;  5AAN A;  1UHN A;  1TTX A;  5BPJ A;  2BBN A;  4IJ7 A;  1IKU A;  2B1U A;  2CBL A;  1G33 A;  4PE0 A;  1HQV A;  2E30 A;  2JC2 A;  1Y1X A;  3C1V A;  3IQO A;  1XFX O;  3WXA A;  1N2D A;  1SNL A;  1SW8 A;  1K2H A;  1OOJ A;  2GGM A;  2PQL A;  2MRD A;  3JVT C;  3GK4 X;  3DZT A;  3I5G B;  4WRI A;  2JT3 A;  1U5I A;  3ZWH A;  1PVA A;  1PRW A;  2L0P A;  2K8M B;  3BOW B; 
#chains in the Genus database with same CATH homology
 3CAB A;  3S0E A;  4PT1 A;  2ERB A;  2L2C A;  3NHT A;  1OW4 A;  1OOH A;  3DXL A;  3R1V A;  3S0B A;  3L4A A;  3QME A;  1DQE A;  2FJY A;  3K1E A;  2P70 A;  1P28 A;  2WCK A;  3FE9 A;  4JD9 A;  3R1P A;  3CDN A;  5DIC A;  3D77 A;  1OOI X;  3RZS A;  4INW A;  3BJH A;  1C3Z A;  2WC5 A;  2WCJ A;  3BFH A;  3NGV A;  2JPO A;  2H8V A;  1GM0 A;  3NHI A;  1OOG A;  3B86 A;  3B6X A;  3CZ2 A;  3B88 A;  2WC6 A;  2QEV A;  1TWO A;  4INX A;  3OGN A;  1T14 A;  3VB1 A;  3D73 A;  4OZD A;  3V2L A;  2QEH A;  3CZ1 A;  3FE8 A;  3DY9 A;  1C3Y A;  3D78 A;  3BFB A;  3L4L A;  3S0F A;  4F7F A;  3CZ0 A;  3DYE A;  2GTE A;  2QEB A;  2QEO A;  3R1O A;  3S0D A;  2WCH A;  3S0G A;  4FQT A;  3L47 A;  3D76 A;  1TUJ A;  2P71 A;  2WCM A;  2KPH A;  3Q8I A;  1QWV A;  2QDI A;  1OOF A;  3R72 A;  3B7A A;  3FE6 A;  3CYZ A;  3D74 A;  3S0A A;  5EL2 A;  3N7H A;  3BFA A;  1XFR A;  3B87 A;  2PQL A;  1ORG A;  3DZT A;  3D75 A;  1LS8 A;  3PJI A;  2WCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...