2LP3A

Solution structure of s100a1 ca2+
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of calcium binding and thionylation of S100A1 protein on its nuclear magnetic resonance-derived structure and backbone dynamics.
pubmed doi rcsb
molecule keywords Protein S100-A1
molecule tags Metal binding protein
source organism Homo sapiens
total genus 28
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lp3A00
5PALA 1MXLC 1RECA 2K7BA 2LMTA 2LNKA 2Y1NA 1YRUB 3IQOA 2K7DA 3SIBA 2WC8A 1SCMB 3FS7A 1Q80A 1QLSA 1NCXA 2JT0A 3SG2A 4R1EA 2AUCA 2CXJA 1H8BA 3VRQA 4WQ3A 2Y4QA 1F54A 4MN0A 3BUWB 2A4JA 2CNPA 1F4OA 3OB2B 3GOFA 3O78A 1K9KA 4N5XA 3GK4X 1GGZA 2LLUA 1QVIY 2KQYA 1R6PA 1CDMA 3OX6A 3A8RA 3VRRA 1WDCB 1B4CA 1NWDA 1QASA 1EJ3A 1QIVA 1TNQA 1G8IA 1J7QA 2BCAA 3EKHA 2KYCA 1KQMC 3SG3A 4OV2A 2M29A 4U8DA 1B47A 1SMGA 1YTZC 3A4UB 4FQOA 1M39A 3OHMB 2M97A 3PSRA 1DTLA 1UUSA 1MXEA 1PSRA 1RK9A 1XFYO 1Y0VH 2CT9A 2WCFA 3SG4A 1M45A 1Y1AA 2JTZA 2JOJA 1S6IA 2JZIA 2NCPA 3OX5A 1MWNA 1K94A 1M31A 2OTGC 3I5IB 1XFXO 1XFWO 2BECA 3I5FC 1IWQA 4CIDA 3LL8B 1TN4A 3K21A 1PRWA 1ODBA 1C07A 2KAXA 4NDCA 1AHRA 1QATA 1K9UA 4P5OE 4ORAB 2L4HA 1LA3A 1OMVA 4PHNA 2LLSA 1AJ5A 2F3YA 4YGDB 2KDHA 1KSMA 1F8HA 5KTYA 4JWQA 1KK7Y 3DVMA 4ICBA 1XK4A 1RFJA 2KSPA 2FCEA 1EH2A 1A2XA 3O4YA 2KBMA 2QPTA 2RGIA 1BG1A 3ZWHA 1SKTA 1OZSA 2LP3A 4DIRA 3VRNA 1XA5A 5AFPA 2D8NA 2LV7A 5GQQC 1NX3A 3TDIA 1KCYA 2OPOA 3PLFB 1NUBA 3JVTC 2KAYA 3TZ1A 2KBIA 2LCPA 2LMUA 4YGEB 3F45A 1A75B 1JWDA 4GBAA 4YRUA 2WOSA 2HF5A 2AAOA 4JQ0D 1KFXS 5JJGA 3SG7A 2FJUB 1CNPA 1N0YA 1WRKA 1J55A 1UWOA 3PM8A 2LMVA 4FTGA 4AQJA 1QVIZ 3RM1A 4MVFA 3MSEB 2L51A 2WCEA 2ISDA 3TDZA 2DOQA 2R2IA 4DUQA 4GNKB 2ZNDA 1IGVA 2JULA 3JTDB 2LVKA 2PASA 1BU3A 1AUIB 1JUOA 1DGUA 1LVCD 1XFZO 3TUYC 1RJVA 2H61A 1CDPA 1FBVA 5KU1A 2MRDA 1L7ZA 3FIAA 4CFQA 1NX1A 4OVNF 2KI6C 1XFVO 3BOWA 4DS7A 2ZN9A 1XYDA 1SR6B 4MBEA 3KHEA 4E68A 1F71A 3NSLA 1DGVA 1CMGA 2KAVA 2M1UA 2HQWA 5BPJA 4GGNA 2F8PA 1UP5A 5TNCA 1RROA 1AK8A 1K9PA 1JC2A 2F2PA 4I5LB 5I2QA 4GAOA 3QRXA 2JXLA 3D0YA 1FI5A 4QJ5B 2LLTA 1B8LA 1B8CA 2BL0B 5DKRA 1N65A 2AMIA 2KI4C 4PHKA 1WRZA 2CBLA 3LCPC 1TNWA 4AQIA 4PHJA 4PHMA 1FW4A 2GGZA 4IL1A 3OB1B 5AANA 3DVJA 1DMOA 3I5GC 1KK7Z 2I18A 1CLLA 1CB1A 2OS8C 2JT3A 1EG3A 2BE6A 3AKBA 3EVRA 3VROA 2L5XB 1FF1A 2L4IA 3EVVA 5JOLA 3EK4A 1K2HA 1XK4C 2G2BA 1CM1A 1IQ5A 3PN7B 1YUUA 4GFTA 4PE1A 1EG4A 1MUXA 1NX2A 1X02A 1J7RA 2KOTA 1FPWA 3JVTB 1ZMZA 2MAZA 4UPGA 4BY4A 3BXKA 1AJ4A 2M8UA 1KQVA 3KEVA 1TNPA 4MRXA 2K2AA 1J1DA 1Y6WA 4GGFA 1SYMA 3DF0B 1A4PA 5D69A 5CPVA 4PCWA 1JF2A 2JQ6A 1CM4A 1IJ6A 4ZCUA 5AEQA 2LM5A 3CWGA 2ZKMX 1B9AA 1IG5A 4QJ3B 1NP8A 1Y1UA 4N1FA 3EK8A 1IJ5A 1QIWA 1W7JB 3TUYB 2O60A 3NSKA 2L50A 1K8UA 2NZ0A 2KHNA 1K93D 2M9GA 3GK2A 4WRIA 4XYNA 1PULA 2LHLA 4QJ4B 3I5HC 2FCDA 3BYAA 1M46A 1AP4A 1UHJA 1W7IB 1WLZA 2H61C 1OMDA 2L98A 1BR4B 2KQ6A 1WY9A 4TNCA 1BOCA 2LVIA 1LA0A 1QX2A 3FWCA 4CPVA 3H4SE 1XO5A 1LXFC 2BKHB 2I94A 2M0RA 4YI8A 1G33A 4ORCB 5DKQA 5F6TA 4ETOA 1U5IA 4CFRA 1DJIA 3TS5C 1SCVA 2K0JA 1S1EA 3EK7A 3BQ3A 1JFJA 5ER5A 1LKJA 3BUMB 1F4QA 1TTXA 2JU0A 1B8RA 1SW8A 1WRLA 1S36A 2G9BA 2HPSA 1NCZA 4M2PA 1JBAA 2OS8B 1ALVA 3HCMA 2K2FA 3RLZA 3CLNA 4USLA 2HETA 1IQ3A 2WNDA 2LE9B 3CS1A 3SJSA 4F0ZB 1QXPA 1SPYA 1Y1XA 2KI6D 1S6CA 2LVJA 1B7TY 3LK0A 2EHBA 1UURA 3DVEA 1S5GY 2LP2A 3AAJA 4MSPA 5AERA 1KFUS 1BR1B 1DJGA 1GQMA 2BBMA 3LK1A 5CSIA 2NLNA 1NX0A 4MZKA 1SL8A 2KGBC 1DF0B 2TN4A 2JNXA 1QX7A 4JPZB 2JC2A 1OOJA 5HKZA 4HREE 1SCMC 4DCKA 3SG6A 1UHKA 5I2OA 2MJWB 3WXAA 3WNXB 2M7NA 1ZOTB 3KPXA 4HRHA 1MF8B 2I2RE 4D1EA 1DT7B 4GGFC 1KQMB 4C0LA 2JT8A 1YX7A 1FI6A 2ZFDA 1LINA 1CLMA 2Q91A 1BODA 4MLWA 2PSRA 4GUKA 1XFUO 4C0JA 5HYDA 2HQ8A 4Q04A 4YI9A 3M0WA 2MLFC 4PE4A 2BCXA 3I5HB 3PFVA 4MZLA 3PALA 2OTGB 2ZNEA 1WDCC 4OKHA 1DJHA 1JF0A 3I5FB 5IBWA 2WCBA 2LUXA 1DVIA 4ORBB 5AXIA 3IF7A 1YVHA 3BOWB 1J7PA 2ZN8A 1PVBA 1IRJA 2KGRA 1F55A 3O6BA 5I8NA 1NSHA 1ZFSA 1MHOA 2B1UA 2Q4UA 3KF9A 4DRWA 1NIWA 1OE9B 2KFHA 5B8IB 3TS5B 1GGWA 3D0YB 4M2OA 3WHTB 1HQVA 3I5IC 2KYFA 2I7AA 3LLEA 4XJKA 3PATA 1A29A 1K95A 1SL9A 2EGDA 2L2EA 1UHHA 1KSOA 3NSIA 4I5JA 4YGCB 1KK8C 1QV0A 2LAPA 2JRFA 5KSZA 1GJYA 1SY9A 5ER4X 2M1KB 2QACA 1B7TZ 1KFXL 1PALA 2M3WA 1PVAA 4HSZA 1J7OA 1KWOC 3NSOA 1S5GZ 1CLBA 1C7WA 3BUNB 1ALWA 1UHNA 3NXAA 1BF5A 1YUTA 3AKAA 1CFFA 2M49B 2F3ZA 1B1GA 5HLOA 4NDBA 1CDNA 2JTTA 4GPLB 4OCIA 4ZCVA 1ZUZA 4N1GA 1NPQA 1OMRA 4MRYA 1SBJA 3HX4A 1UHIA 1RWYA 3CR4X 3ZNIA 3ICBA 2KFFA 2K8MB 3DF0A 2JPTA 1TOPA 1CKKA 1CFCA 1OQPA 3TDUA 4OR9B 1S26D 2SASA 2E30A 2P6BB 4M2QA 3SIAA 1M63B 1QX5B 2BKIB 2KFGA 4AOMA 2K7CA 1K90D 2CTNA 1TCOB 4PALA 2H2KA 5HKWA 2MA2A 3D10A 2K7OA 2BBNA 3JTDC 1EXRA 2MBXA 1H4BA 5J3XA 2ZRSA 3CTNA 1CDLA 2KI4B 3O2PA 2JWWA 2LUCA 1CFPA 1IH0A 2KNEA 1SR6C 5D7FA 1JFKA 1MR8A 2MLEC 3I5GB 1TRFA 4PDZA 1OZOA 1YX8A 1L2OC 1U5IB 2L0PA 1EL4A 4C0KA 5CSFA 1J1EA 1SNLA 2EC6C 2LC5A 1SK6D 1R2UA 1MQ1A 2F2OA 2JNFA 1QTXA 2LHIA 2BL0C 1BLQA 1QJTA 1KK8B 2PRUA 2F33A 1TNXA 1VRKA 1S6JA 5CSJA 1F70A 4HRGA 4CLNA 1TCFA 2BE4A 1CTRA 1KWOB 1A03A 1DJZA 4PE0A 1SRAA 3IQQA 2LVVA 1XVJA 1YVLA 3EKJA 1G4YR 3CGAA 1QLKA 4I5KA 1YR5A 4A4BA 1A75A 1ZACA 2SCPA 3KO0A 4BY5A 1D1OA 1BJFA 3AAKA 3PN7C 5G08A 1OSAA 1DJXA 1YURA 1DF0A 2WORA 4YGAA 5CSNA 1DJWA 3OP0A 1DJYA 5HKYA 2PALA 2PVBA 2CCMA 4YGBB 4L9MA 2LANA 2O5GA 2NCOA 4A4CA 1V1FA 1TIZA 1PK0D 3VGOA 2K61A 1CMFA 3BUOB 5HLVA 3DVKA 1WLMA 2GV5A 2GGMA 2M7LA 4NQGA 1S3PA 1K96A 1QS7A 2PMYA 2IS9A 3CZTX 3E3RA 4MZJA 4NDDA 2E6WA 1C7VA 2Y5IA 1V1GA 1PSBA 1RTP1 2V53A 1YRTB 1IKUA 2Y1MA 3BUXB 3CR2A 3VRPA 4YBHB 3FWBA 1E8AA 1L2OB 1QV1A 4PE7A 1YUSA 2ZRTA 1HT9A 2EC6B 5FYXA 1JSAA 2FOTA 3C1VA 5K89A 1BMOA 1N2DA 1NCYA 2MHHA 3EVUA 2COLB 5DKNA 2VRGA 3CR5X 2BCBA 4I5NB 4XJKB 1KFUL 2JXCA 5I2LA 3DD4A 1AVSA 3SG5A 4P2YB 1CFDA 3WHUB 4MEWA 2NXQA 3GK1A 1BT6A 4WQ2A 1NYAA 1SL7A
chains in the Genus database with same CATH superfamily
5PALA 1MXLC 1RECA 3SS4A 2K7BA 2LMTA 2LNKA 2Y1NA 1OOFA 1YRUB 3IQOA 2K7DA 3SIBA 2WC8A 1SCMB 3FS7A 1Q80A 2L5YA 1QLSA 4IJ7A 1NCXA 3NGVA 2JT0A 3SG2A 4OZDA 4R1EA 2AUCA 2CXJA 1H8BA 3VRQA 4WQ3A 2Y4QA 1F54A 1SSEB 4MN0A 3BUWB 2A4JA 2CNPA 1F4OA 3OB2B 3PJIA 3GOFA 3O78A 1K9KA 4N5XA 3GK4X 1GGZA 2LLUA 5DICA 1QVIY 2KQYA 1R6PA 1CDMA 3OX6A 3A8RA 2WCMA 3VRRA 1WDCB 2QEBA 1B4CA 1NWDA 1QASA 1EJ3A 1QIVA 1TNQA 3NHTA 1G8IA 1J7QA 2BCAA 3EKHA 2KYCA 1KQMC 3SG3A 4OV2A 2M29A 4U8DA 1B47A 1SMGA 1YTZC 3A4UB 4FQOA 1M39A 3OHMB 2M97A 3PSRA 1DTLA 1UUSA 1MXEA 1PSRA 1RK9A 1XFYO 1Y0VH 2CT9A 2WCFA 3SG4A 1M45A 1Y1AA 2JTZA 2JOJA 1S6IA 3CZ2A 2JZIA 2NCPA 2WCHA 3OX5A 3D73A 1MWNA 3BFBA 1K94A 1M31A 2OTGC 3I5IB 1XFXO 1XFWO 2BECA 3I5FC 1IWQA 4CIDA 3LL8B 1TN4A 1Z2CB 1LS8A 1PRWA 3K21A 1ODBA 1C07A 2KAXA 2KPHA 4NDCA 1AHRA 1QATA 1K9UA 4P5OE 4ORAB 2L4HA 1LA3A 1OMVA 4PHNA 5FI6A 2LLSA 1AJ5A 2F3YA 3B6XA 4YGDB 2KDHA 1KSMA 2YGUA 3R1OA 4JWQA 5KTYA 1F8HA 1KK7Y 1DELA 3DVMA 4ICBA 1XK4A 1RFJA 4JKTA 2KSPA 1P28A 2FCEA 2BNXA 1EH2A 1A2XA 3O4YA 2KBMA 2QPTA 2RGIA 3PM2A 1BG1A 3ZWHA 2KLDA 1SKTA 1OZSA 2LP3A 4DIRA 3VRNA 1XA5A 5AFPA 2D8NA 2LV7A 2WC5A 1NX3A 5GQQC 3TDIA 1KCYA 2OPOA 3PLFB 1QWVA 2ERBA 1NUBA 3JVTC 2KAYA 3TZ1A 2KBIA 2LCPA 2LMUA 3R1PA 3F45A 1A75B 4YGEB 1JWDA 4GBAA 4YRUA 2WOSA 2PQLA 2HF5A 2AAOA 4JQ0D 1KFXS 5JJGA 3SG7A 2FJUB 1CNPA 1N0YA 1DQEA 1WRKA 1J55A 1UWOA 2L2CA 3PM8A 2LMVA 4KYNA 4FTGA 1DC1A 4AQJA 1QVIZ 3RM1A 2FJYA 3MSEB 2L51A 2WCEA 4MVFA 2ISDA 2DOQA 2R2IA 3TDZA 4DUQA 4GNKB 2ZNDA 1IGVA 2JULA 3JTDB 2LVKA 2PASA 1BU3A 1AUIB 1JUOA 1DGUA 1LVCD 3DYEA 4F7FA 1XFZO 3TUYC 1RJVA 2H61A 1CDPA 1FBVA 5KU1A 2MRDA 1L7ZA 3FIAA 4CFQA 1NX1A 4OVNF 2KI6C 1XFVO 3BOWA 4DS7A 2ZN9A 1XYDA 3RZSA 3N7HA 1SR6B 4MBEA 3KHEA 4E68A 1F71A 3NSLA 1DGVA 1CMGA 2KAVA 2M1UA 2HQWA 2P71A 4GGNA 5BPJA 2F8PA 1UP5A 5TNCA 1RROA 1AK8A 2WCJA 1K9PA 3NHIA 5FI2A 1JC2A 2F2PA 4I5LB 5I2QA 4GAOA 3QRXA 2JXLA 3D0YA 1FI5A 4QJ5B 2LLTA 1B8LA 1B8CA 2BL0B 5DKRA 1N65A 2AMIA 2KI4C 4PHKA 1WRZA 2CBLA 3LCPC 1TNWA 4AQIA 3V2LA 4PHJA 4PHMA 1FW4A 2GGZA 4IL1A 3OB1B 5AANA 3DVJA 1DMOA 3I5GC 1KK7Z 2I18A 1CLLA 1CB1A 2OS8C 2JT3A 1EG3A 2BE6A 3AKBA 3EVRA 3VROA 2L5XB 1FF1A 2L4IA 3EVVA 5JOLA 3EK4A 1K2HA 1XK4C 2G2BA 1CM1A 1IQ5A 1TWOA 3PN7B 1YUUA 4GFTA 4PE1A 1EG4A 1MUXA 1NX2A 1X02A 1J7RA 2KOTA 1FPWA 3JVTB 1ZMZA 2MAZA 4UPGA 4BY4A 3BXKA 1AJ4A 2M8UA 1KQVA 3KEVA 1TNPA 4MRXA 3S0GA 3S0DA 2K2AA 1J1DA 1Y6WA 4GGFA 1C3ZA 1SYMA 3DF0B 1A4PA 2WCKA 5CPVA 1TUZA 4PCWA 1JF2A 5D69A 2JQ6A 1CM4A 1IJ6A 4ZCUA 5AEQA 2LM5A 3CWGA 2ZKMX 1B9AA 1IG5A 4QJ3B 1NP8A 1Y1UA 4N1FA 3EK8A 1IJ5A 1QIWA 1W7JB 3TUYB 2O60A 3BFAA 3NSKA 2L50A 1K8UA 2NZ0A 2KHNA 1K93D 2M9GA 3GK2A 4WRIA 4XYNA 1PULA 2LHLA 4QJ4B 3I5HC 2FCDA 3BYAA 3FE6A 1M46A 1AP4A 1UHJA 1W7IB 1WLZA 2H61C 1OMDA 2L98A 3SS5A 1BR4B 5HL1A 2KQ6A 1WY9A 4TNCA 1BOCA 1IIOA 2LVIA 1LA0A 1QX2A 3FWCA 4CPVA 3H4SE 3VB1A 4JD9A 3B87A 1XO5A 1LXFC 2BKHB 2I94A 2M0RA 4YI8A 1G33A 4ORCB 2PYQA 5DKQA 5F6TA 4ETOA 1U5IA 4CFRA 1DJIA 3TS5C 1SCVA 2K0JA 1S1EA 3EK7A 3BQ3A 1JFJA 5ER5A 1LKJA 3BUMB 3D74A 1TTXA 1F4QA 2JU0A 1B8RA 1SW8A 1WRLA 1S36A 2G9BA 2HPSA 1NCZA 2WC6A 3BJHA 4M2PA 5EL2A 1JBAA 2OS8B 1ALVA 3HCMA 3S0FA 2K2FA 3RLZA 3UO9A 3CLNA 4USLA 2HETA 1IQ3A 2WNDA 2LE9B 3CS1A 3SJSA 4F0ZB 1QXPA 1SPYA 1Y1XA 2KI6D 1S6CA 2H8VA 2LVJA 1B7TY 3LK0A 2EHBA 3SS3A 1UURA 3DVEA 1S5GY 2LP2A 2WCLA 3AAJA 4MSPA 5AERA 1KFUS 1BR1B 1DJGA 1GQMA 2BBMA 3B86A 3LK1A 5CSIA 2NLNA 1NX0A 4MZKA 1SL8A 2KGBC 1DF0B 2TN4A 2JNXA 1QX7A 4JPZB 2JC2A 1OOJA 5HKZA 4HREE 4INXA 2GTEA 1SCMC 4DCKA 3SG6A 1UHKA 5I2OA 2MJWB 3WXAA 2KLEA 3WNXB 2M7NA 1ZOTB 3KPXA 4HRHA 1MF8B 2I2RE 4D1EA 1DT7B 4GGFC 1KQMB 3DY9A 4C0LA 2JT8A 1YX7A 1FI6A 2ZFDA 1LINA 1CLMA 2Q91A 1DEKA 4MLWA 1BODA 2PSRA 4GUKA 1T14A 1XFUO 4C0JA 5HYDA 2HQ8A 4Q04A 1C3YA 4YI9A 3M0WA 3IVTA 2MLFC 4PE4A 2BCXA 1TUJA 3I5HB 3PFVA 4MZLA 3B88A 3D76A 3DZTA 3PALA 2OTGB 2QEOA 1WDCC 2ZNEA 4OKHA 1DJHA 1JF0A 3I5FB 5IBWA 2WCBA 2LUXA 1DVIA 4ORBB 5AXIA 3S0EA 3IF7A 1YVHA 3BOWB 3UNWA 1J7PA 2ZN8A 1PVBA 1IRJA 2KGRA 1OOIX 1F55A 3O6BA 5I8NA 1NSHA 1ZFSA 1MHOA 2B1UA 2Q4UA 2K60A 3KF9A 4DRWA 1NIWA 1OE9B 2KFHA 5B8IB 3TS5B 3OBVA 1GM0A 1XFRA 1GGWA 3D0YB 5I94A 4M2OA 3WHTB 1HQVA 3I5IC 5D3OA 2KYFA 3FE8A 2I7AA 3LLEA 4XJKA 3PATA 1A29A 1K95A 1SL9A 2EGDA 2JPOA 2L2EA 1UHHA 3R72A 1KSOA 3NSIA 4I5JA 4YGCB 1KK8C 1QV0A 2LAPA 2JRFA 5KSZA 1GJYA 1SY9A 5ER4X 2M1KB 2QDIA 2QACA 1B7TZ 1KFXL 1PALA 2M3WA 1PVAA 4HSZA 1J7OA 1KWOC 3NSOA 3Q8IA 1S5GZ 1CLBA 1C7WA 3BUNB 1ALWA 1UHNA 3NXAA 1BF5A 1YUTA 3AKAA 1CFFA 2M49B 2F3ZA 1B1GA 3B7AA 5HLOA 4NDBA 2QEHA 1CDNA 4INWA 2JTTA 4GPLB 4OCIA 4ZCVA 4FQTA 1ZUZA 4N1GA 3S0AA 1NPQA 1Z4HA 1OMRA 4MRYA 1SBJA 3HX4A 3CABA 1UHIA 1RWYA 3CR4X 3ZNIA 3ICBA 2KFFA 3D78A 2K8MB 3DF0A 2JPTA 1TOPA 1CKKA 1CFCA 1OQPA 3CYZA 1ORGA 3EG5B 4OR9B 3TDUA 1S26D 2SASA 2E30A 2P6BB 4M2QA 3SIAA 1M63B 1QX5B 2BKIB 2KFGA 4AOMA 2K7CA 1K90D 2CTNA 1TCOB 4PALA 2H2KA 3CZ0A 5HKWA 2MA2A 3D10A 2K7OA 2BBNA 1OOHA 3D75A 3JTDC 3O4XA 1EXRA 2MBXA 1H4BA 5J3XA 2ZRSA 3CTNA 1CDLA 2KI4B 3O2PA 2JWWA 2LUCA 1CFPA 1IH0A 2KNEA 1SR6C 5D7FA 1JFKA 1MR8A 2MLEC 3I5GB 1TRFA 3DXLA 4PDZA 1OZOA 1YX8A 1L2OC 1U5IB 2L0PA 1EL4A 4C0KA 5CSFA 1J1EA 1SNLA 2EC6C 2LC5A 1SK6D 1R2UA 1MQ1A 2F2OA 2JNFA 1QTXA 2LHIA 2BL0C 1BLQA 1QJTA 1KK8B 2PRUA 2F33A 1TNXA 1VRKA 1S6JA 5CSJA 3OGNA 3QMEA 1F70A 4HRGA 4CLNA 1TCFA 2BE4A 1CTRA 1KWOB 3S0BA 1DJZA 1A03A 4PE0A 1SRAA 3IQQA 2LVVA 1XVJA 1YVLA 3EKJA 1G4YR 3CGAA 1QLKA 4I5KA 1YR5A 4A4BA 1A75A 1ZACA 2SCPA 3KO0A 4BY5A 1D1OA 1BJFA 3CZ1A 3AAKA 3PN7C 5G08A 1OSAA 1DJXA 1YURA 1DF0A 2WORA 4YGAA 5CSNA 1DJWA 3OP0A 1DJYA 5HKYA 2PALA 2BAPA 2PVBA 3R1VA 2CCMA 4PT1A 3L4LA 4YGBB 1W9ZA 4L9MA 2LANA 2O5GA 1OW4A 2NCOA 4A4CA 1V1FA 1TIZA 1PK0D 3FE9A 3VGOA 2K61A 1CMFA 3CDNA 3BUOB 5HLVA 3DVKA 1WLMA 2GV5A 2GGMA 2M7LA 5FI7A 3D77A 4NQGA 1S3PA 1K96A 1QS7A 2PMYA 2IS9A 3CZTX 3E3RA 4MZJA 4NDDA 2E6WA 1C7VA 2Y5IA 1V1GA 1PSBA 1RTP1 2V53A 1YRTB 1IKUA 2Y1MA 3BUXB 3CR2A 3VRPA 4YBHB 3FWBA 1E8AA 1L2OB 1QV1A 4PE7A 1YUSA 2ZRTA 1HT9A 2EC6B 3K1EA 5FYXA 2FOTA 1JSAA 3C1VA 5K89A 1BMOA 1N2DA 1NCYA 1OOGA 2MHHA 2COLB 3EVUA 2VRGA 5DKNA 3CR5X 3L4AA 2BCBA 4I5NB 4XJKB 1KFUL 2JXCA 5I2LA 2QEVA 2P70A 3DD4A 3BFHA 1AVSA 3SG5A 4P2YB 1CFDA 3WHUB 4MEWA 2NXQA 3GK1A 1BT6A 3L47A 4WQ2A 1NYAA 1SL7A
chains in the Genus database with same CATH topology
5PALA 1MXLC 1RECA 2K7BA 2LMTA 2LNKA 2Y1NA 1YRUB 3IQOA 2K7DA 3SIBA 2WC8A 1SCMB 3FS7A 1Q80A 1QLSA 1NCXA 2JT0A 3SG2A 4R1EA 2AUCA 2CXJA 1H8BA 3VRQA 4WQ3A 2Y4QA 1F54A 4MN0A 3BUWB 2A4JA 2CNPA 1F4OA 3OB2B 3GOFA 3O78A 1K9KA 4N5XA 3GK4X 1GGZA 2LLUA 1QVIY 2KQYA 1R6PA 1CDMA 3OX6A 3A8RA 3VRRA 1WDCB 1B4CA 1NWDA 1QASA 1EJ3A 1QIVA 1TNQA 1G8IA 1J7QA 2BCAA 3EKHA 2KYCA 1KQMC 3SG3A 4OV2A 2M29A 4U8DA 1B47A 1SMGA 1YTZC 3A4UB 4FQOA 1M39A 3OHMB 2M97A 3PSRA 1DTLA 1UUSA 1MXEA 1PSRA 1RK9A 1XFYO 1Y0VH 2CT9A 2WCFA 3SG4A 1M45A 1Y1AA 2JTZA 2JOJA 1S6IA 2JZIA 2NCPA 3OX5A 1MWNA 1K94A 1M31A 2OTGC 3I5IB 1XFXO 1XFWO 2BECA 3I5FC 1IWQA 4CIDA 3LL8B 1TN4A 3K21A 1PRWA 1ODBA 1C07A 2KAXA 4NDCA 1AHRA 1QATA 1K9UA 4P5OE 4ORAB 2L4HA 1LA3A 1OMVA 4PHNA 2LLSA 1AJ5A 2F3YA 4YGDB 2KDHA 1KSMA 1F8HA 5KTYA 4JWQA 1KK7Y 3DVMA 4ICBA 1XK4A 1RFJA 2KSPA 2FCEA 1EH2A 1A2XA 3O4YA 2KBMA 2QPTA 2RGIA 1BG1A 3ZWHA 1SKTA 1OZSA 2LP3A 4DIRA 3VRNA 1XA5A 5AFPA 2D8NA 2LV7A 5GQQC 1NX3A 3TDIA 1KCYA 2OPOA 3PLFB 1NUBA 3JVTC 2KAYA 3TZ1A 2KBIA 2LCPA 2LMUA 4YGEB 3F45A 1A75B 1JWDA 4GBAA 4YRUA 2WOSA 2HF5A 2AAOA 4JQ0D 1KFXS 5JJGA 3SG7A 2FJUB 1CNPA 1N0YA 1WRKA 1J55A 1UWOA 3PM8A 2LMVA 4FTGA 4AQJA 1QVIZ 3RM1A 4MVFA 3MSEB 2L51A 2WCEA 2ISDA 3TDZA 2DOQA 2R2IA 4DUQA 4GNKB 2ZNDA 1IGVA 2JULA 3JTDB 2LVKA 2PASA 1BU3A 1AUIB 1JUOA 1DGUA 1LVCD 1XFZO 3TUYC 1RJVA 2H61A 1CDPA 1FBVA 5KU1A 2MRDA 1L7ZA 3FIAA 4CFQA 1NX1A 4OVNF 2KI6C 1XFVO 3BOWA 4DS7A 2ZN9A 1XYDA 1SR6B 4MBEA 3KHEA 4E68A 1F71A 3NSLA 1DGVA 1CMGA 2KAVA 2M1UA 2HQWA 5BPJA 4GGNA 2F8PA 1UP5A 5TNCA 1RROA 1AK8A 1K9PA 1JC2A 2F2PA 4I5LB 5I2QA 4GAOA 3QRXA 2JXLA 3D0YA 1FI5A 4QJ5B 2LLTA 1B8LA 1B8CA 2BL0B 5DKRA 1N65A 2AMIA 2KI4C 4PHKA 1WRZA 2CBLA 3LCPC 1TNWA 4AQIA 4PHJA 4PHMA 1FW4A 2GGZA 4IL1A 3OB1B 5AANA 3DVJA 1DMOA 3I5GC 1KK7Z 2I18A 1CLLA 1CB1A 2OS8C 2JT3A 1EG3A 2BE6A 3AKBA 3EVRA 3VROA 2L5XB 1FF1A 2L4IA 3EVVA 5JOLA 3EK4A 1K2HA 1XK4C 2G2BA 1CM1A 1IQ5A 3PN7B 1YUUA 4GFTA 4PE1A 1EG4A 1MUXA 1NX2A 1X02A 1J7RA 2KOTA 1FPWA 3JVTB 1ZMZA 2MAZA 4UPGA 4BY4A 3BXKA 1AJ4A 2M8UA 1KQVA 3KEVA 1TNPA 4MRXA 2K2AA 1J1DA 1Y6WA 4GGFA 1SYMA 3DF0B 1A4PA 5D69A 5CPVA 4PCWA 1JF2A 2JQ6A 1CM4A 1IJ6A 4ZCUA 5AEQA 2LM5A 3CWGA 2ZKMX 1B9AA 1IG5A 4QJ3B 1NP8A 1Y1UA 4N1FA 3EK8A 1IJ5A 1QIWA 1W7JB 3TUYB 2O60A 3NSKA 2L50A 1K8UA 2NZ0A 2KHNA 1K93D 2M9GA 3GK2A 4WRIA 4XYNA 1PULA 2LHLA 4QJ4B 3I5HC 2FCDA 3BYAA 1M46A 1AP4A 1UHJA 1W7IB 1WLZA 2H61C 1OMDA 2L98A 1BR4B 2KQ6A 1WY9A 4TNCA 1BOCA 2LVIA 1LA0A 1QX2A 3FWCA 4CPVA 3H4SE 1XO5A 1LXFC 2BKHB 2I94A 2M0RA 4YI8A 1G33A 4ORCB 5DKQA 5F6TA 4ETOA 1U5IA 4CFRA 1DJIA 3TS5C 1SCVA 2K0JA 1S1EA 3EK7A 3BQ3A 1JFJA 5ER5A 1LKJA 3BUMB 1F4QA 1TTXA 2JU0A 1B8RA 1SW8A 1WRLA 1S36A 2G9BA 2HPSA 1NCZA 4M2PA 1JBAA 2OS8B 1ALVA 3HCMA 2K2FA 3RLZA 3CLNA 4USLA 2HETA 1IQ3A 2WNDA 2LE9B 3CS1A 3SJSA 4F0ZB 1QXPA 1SPYA 1Y1XA 2KI6D 1S6CA 2LVJA 1B7TY 3LK0A 2EHBA 1UURA 3DVEA 1S5GY 2LP2A 3AAJA 4MSPA 5AERA 1KFUS 1BR1B 1DJGA 1GQMA 2BBMA 3LK1A 5CSIA 2NLNA 1NX0A 4MZKA 1SL8A 2KGBC 1DF0B 2TN4A 2JNXA 1QX7A 4JPZB 2JC2A 1OOJA 5HKZA 4HREE 1SCMC 4DCKA 3SG6A 1UHKA 5I2OA 2MJWB 3WXAA 3WNXB 2M7NA 1ZOTB 3KPXA 4HRHA 1MF8B 2I2RE 4D1EA 1DT7B 4GGFC 1KQMB 4C0LA 2JT8A 1YX7A 1FI6A 2ZFDA 1LINA 1CLMA 2Q91A 1BODA 4MLWA 2PSRA 4GUKA 1XFUO 4C0JA 5HYDA 2HQ8A 4Q04A 4YI9A 3M0WA 2MLFC 4PE4A 2BCXA 3I5HB 3PFVA 4MZLA 3PALA 2OTGB 2ZNEA 1WDCC 4OKHA 1DJHA 1JF0A 3I5FB 5IBWA 2WCBA 2LUXA 1DVIA 4ORBB 5AXIA 3IF7A 1YVHA 3BOWB 1J7PA 2ZN8A 1PVBA 1IRJA 2KGRA 1F55A 3O6BA 5I8NA 1NSHA 1ZFSA 1MHOA 2B1UA 2Q4UA 3KF9A 4DRWA 1NIWA 1OE9B 2KFHA 5B8IB 3TS5B 1GGWA 3D0YB 4M2OA 3WHTB 1HQVA 3I5IC 2KYFA 2I7AA 3LLEA 4XJKA 3PATA 1A29A 1K95A 1SL9A 2EGDA 2L2EA 1UHHA 1KSOA 3NSIA 4I5JA 4YGCB 1KK8C 1QV0A 2LAPA 2JRFA 5KSZA 1GJYA 1SY9A 5ER4X 2M1KB 2QACA 1B7TZ 1KFXL 1PALA 2M3WA 1PVAA 4HSZA 1J7OA 1KWOC 3NSOA 1S5GZ 1CLBA 1C7WA 3BUNB 1ALWA 1UHNA 3NXAA 1BF5A 1YUTA 3AKAA 1CFFA 2M49B 2F3ZA 1B1GA 5HLOA 4NDBA 1CDNA 2JTTA 4GPLB 4OCIA 4ZCVA 1ZUZA 4N1GA 1NPQA 1OMRA 4MRYA 1SBJA 3HX4A 1UHIA 1RWYA 3CR4X 3ZNIA 3ICBA 2KFFA 2K8MB 3DF0A 2JPTA 1TOPA 1CKKA 1CFCA 1OQPA 3TDUA 4OR9B 1S26D 2SASA 2E30A 2P6BB 4M2QA 3SIAA 1M63B 1QX5B 2BKIB 2KFGA 4AOMA 2K7CA 1K90D 2CTNA 1TCOB 4PALA 2H2KA 5HKWA 2MA2A 3D10A 2K7OA 2BBNA 3JTDC 1EXRA 2MBXA 1H4BA 5J3XA 2ZRSA 3CTNA 1CDLA 2KI4B 3O2PA 2JWWA 2LUCA 1CFPA 1IH0A 2KNEA 1SR6C 5D7FA 1JFKA 1MR8A 2MLEC 3I5GB 1TRFA 4PDZA 1OZOA 1YX8A 1L2OC 1U5IB 2L0PA 1EL4A 4C0KA 5CSFA 1J1EA 1SNLA 2EC6C 2LC5A 1SK6D 1R2UA 1MQ1A 2F2OA 2JNFA 1QTXA 2LHIA 2BL0C 1BLQA 1QJTA 1KK8B 2PRUA 2F33A 1TNXA 1VRKA 1S6JA 5CSJA 1F70A 4HRGA 4CLNA 1TCFA 2BE4A 1CTRA 1KWOB 1A03A 1DJZA 4PE0A 1SRAA 3IQQA 2LVVA 1XVJA 1YVLA 3EKJA 1G4YR 3CGAA 1QLKA 4I5KA 1YR5A 4A4BA 1A75A 1ZACA 2SCPA 3KO0A 4BY5A 1D1OA 1BJFA 3AAKA 3PN7C 5G08A 1OSAA 1DJXA 1YURA 1DF0A 2WORA 4YGAA 5CSNA 1DJWA 3OP0A 1DJYA 5HKYA 2PALA 2PVBA 2CCMA 4YGBB 4L9MA 2LANA 2O5GA 2NCOA 4A4CA 1V1FA 1TIZA 1PK0D 3VGOA 2K61A 1CMFA 3BUOB 5HLVA 3DVKA 1WLMA 2GV5A 2GGMA 2M7LA 4NQGA 1S3PA 1K96A 1QS7A 2PMYA 2IS9A 3CZTX 3E3RA 4MZJA 4NDDA 2E6WA 1C7VA 2Y5IA 1V1GA 1PSBA 1RTP1 2V53A 1YRTB 1IKUA 2Y1MA 3BUXB 3CR2A 3VRPA 4YBHB 3FWBA 1E8AA 1L2OB 1QV1A 4PE7A 1YUSA 2ZRTA 1HT9A 2EC6B 5FYXA 1JSAA 2FOTA 3C1VA 5K89A 1BMOA 1N2DA 1NCYA 2MHHA 3EVUA 2COLB 5DKNA 2VRGA 3CR5X 2BCBA 4I5NB 4XJKB 1KFUL 2JXCA 5I2LA 3DD4A 1AVSA 3SG5A 4P2YB 1CFDA 3WHUB 4MEWA 2NXQA 3GK1A 1BT6A 4WQ2A 1NYAA 1SL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5PAL A;  1MXL C;  1REC A;  2K7B A;  2LMT A;  2LNK A;  2Y1N A;  1YRU B;  3IQO A;  2K7D A;  3SIB A;  2WC8 A;  1SCM B;  3FS7 A;  1Q80 A;  1QLS A;  1NCX A;  2JT0 A;  3SG2 A;  4R1E A;  2AUC A;  2CXJ A;  1H8B A;  3VRQ A;  4WQ3 A;  2Y4Q A;  1F54 A;  4MN0 A;  3BUW B;  2A4J A;  2CNP A;  1F4O A;  3OB2 B;  3GOF A;  3O78 A;  1K9K A;  4N5X A;  3GK4 X;  1GGZ A;  2LLU A;  1QVI Y;  2KQY A;  1R6P A;  1CDM A;  3OX6 A;  3A8R A;  3VRR A;  1WDC B;  1B4C A;  1NWD A;  1QAS A;  1EJ3 A;  1QIV A;  1TNQ A;  1G8I A;  1J7Q A;  2BCA A;  3EKH A;  2KYC A;  1KQM C;  3SG3 A;  4OV2 A;  2M29 A;  4U8D A;  1B47 A;  1SMG A;  1YTZ C;  3A4U B;  4FQO A;  1M39 A;  3OHM B;  2M97 A;  3PSR A;  1DTL A;  1UUS A;  1MXE A;  1PSR A;  1RK9 A;  1XFY O;  1Y0V H;  2CT9 A;  2WCF A;  3SG4 A;  1M45 A;  1Y1A A;  2JTZ A;  2JOJ A;  1S6I A;  2JZI A;  2NCP A;  3OX5 A;  1MWN A;  1K94 A;  1M31 A;  2OTG C;  3I5I B;  1XFX O;  1XFW O;  2BEC A;  3I5F C;  1IWQ A;  4CID A;  3LL8 B;  1TN4 A;  3K21 A;  1PRW A;  1ODB A;  1C07 A;  2KAX A;  4NDC A;  1AHR A;  1QAT A;  1K9U A;  4P5O E;  4ORA B;  2L4H A;  1LA3 A;  1OMV A;  4PHN A;  2LLS A;  1AJ5 A;  2F3Y A;  4YGD B;  2KDH A;  1KSM A;  1F8H A;  5KTY A;  4JWQ A;  1KK7 Y;  3DVM A;  4ICB A;  1XK4 A;  1RFJ A;  2KSP A;  2FCE A;  1EH2 A;  1A2X A;  3O4Y A;  2KBM A;  2QPT A;  2RGI A;  1BG1 A;  3ZWH A;  1SKT A;  1OZS A;  2LP3 A;  4DIR A;  3VRN A;  1XA5 A;  5AFP A;  2D8N A;  2LV7 A;  5GQQ C;  1NX3 A;  3TDI A;  1KCY A;  2OPO A;  3PLF B;  1NUB A;  3JVT C;  2KAY A;  3TZ1 A;  2KBI A;  2LCP A;  2LMU A;  4YGE B;  3F45 A;  1A75 B;  1JWD A;  4GBA A;  4YRU A;  2WOS A;  2HF5 A;  2AAO A;  4JQ0 D;  1KFX S;  5JJG A;  3SG7 A;  2FJU B;  1CNP A;  1N0Y A;  1WRK A;  1J55 A;  1UWO A;  3PM8 A;  2LMV A;  4FTG A;  4AQJ A;  1QVI Z;  3RM1 A;  4MVF A;  3MSE B;  2L51 A;  2WCE A;  2ISD A;  3TDZ A;  2DOQ A;  2R2I A;  4DUQ A;  4GNK B;  2ZND A;  1IGV A;  2JUL A;  3JTD B;  2LVK A;  2PAS A;  1BU3 A;  1AUI B;  1JUO A;  1DGU A;  1LVC D;  1XFZ O;  3TUY C;  1RJV A;  2H61 A;  1CDP A;  1FBV A;  5KU1 A;  2MRD A;  1L7Z A;  3FIA A;  4CFQ A;  1NX1 A;  4OVN F;  2KI6 C;  1XFV O;  3BOW A;  4DS7 A;  2ZN9 A;  1XYD A;  1SR6 B;  4MBE A;  3KHE A;  4E68 A;  1F71 A;  3NSL A;  1DGV A;  1CMG A;  2KAV A;  2M1U A;  2HQW A;  5BPJ A;  4GGN A;  2F8P A;  1UP5 A;  5TNC A;  1RRO A;  1AK8 A;  1K9P A;  1JC2 A;  2F2P A;  4I5L B;  5I2Q A;  4GAO A;  3QRX A;  2JXL A;  3D0Y A;  1FI5 A;  4QJ5 B;  2LLT A;  1B8L A;  1B8C A;  2BL0 B;  5DKR A;  1N65 A;  2AMI A;  2KI4 C;  4PHK A;  1WRZ A;  2CBL A;  3LCP C;  1TNW A;  4AQI A;  4PHJ A;  4PHM A;  1FW4 A;  2GGZ A;  4IL1 A;  3OB1 B;  5AAN A;  3DVJ A;  1DMO A;  3I5G C;  1KK7 Z;  2I18 A;  1CLL A;  1CB1 A;  2OS8 C;  2JT3 A;  1EG3 A;  2BE6 A;  3AKB A;  3EVR A;  3VRO A;  2L5X B;  1FF1 A;  2L4I A;  3EVV A;  5JOL A;  3EK4 A;  1K2H A;  1XK4 C;  2G2B A;  1CM1 A;  1IQ5 A;  3PN7 B;  1YUU A;  4GFT A;  4PE1 A;  1EG4 A;  1MUX A;  1NX2 A;  1X02 A;  1J7R A;  2KOT A;  1FPW A;  3JVT B;  1ZMZ A;  2MAZ A;  4UPG A;  4BY4 A;  3BXK A;  1AJ4 A;  2M8U A;  1KQV A;  3KEV A;  1TNP A;  4MRX A;  2K2A A;  1J1D A;  1Y6W A;  4GGF A;  1SYM A;  3DF0 B;  1A4P A;  5D69 A;  5CPV A;  4PCW A;  1JF2 A;  2JQ6 A;  1CM4 A;  1IJ6 A;  4ZCU A;  5AEQ A;  2LM5 A;  3CWG A;  2ZKM X;  1B9A A;  1IG5 A;  4QJ3 B;  1NP8 A;  1Y1U A;  4N1F A;  3EK8 A;  1IJ5 A;  1QIW A;  1W7J B;  3TUY B;  2O60 A;  3NSK A;  2L50 A;  1K8U A;  2NZ0 A;  2KHN A;  1K93 D;  2M9G A;  3GK2 A;  4WRI A;  4XYN A;  1PUL A;  2LHL A;  4QJ4 B;  3I5H C;  2FCD A;  3BYA A;  1M46 A;  1AP4 A;  1UHJ A;  1W7I B;  1WLZ A;  2H61 C;  1OMD A;  2L98 A;  1BR4 B;  2KQ6 A;  1WY9 A;  4TNC A;  1BOC A;  2LVI A;  1LA0 A;  1QX2 A;  3FWC A;  4CPV A;  3H4S E;  1XO5 A;  1LXF C;  2BKH B;  2I94 A;  2M0R A;  4YI8 A;  1G33 A;  4ORC B;  5DKQ A;  5F6T A;  4ETO A;  1U5I A;  4CFR A;  1DJI A;  3TS5 C;  1SCV A;  2K0J A;  1S1E A;  3EK7 A;  3BQ3 A;  1JFJ A;  5ER5 A;  1LKJ A;  3BUM B;  1F4Q A;  1TTX A;  2JU0 A;  1B8R A;  1SW8 A;  1WRL A;  1S36 A;  2G9B A;  2HPS A;  1NCZ A;  4M2P A;  1JBA A;  2OS8 B;  1ALV A;  3HCM A;  2K2F A;  3RLZ A;  3CLN A;  4USL A;  2HET A;  1IQ3 A;  2WND A;  2LE9 B;  3CS1 A;  3SJS A;  4F0Z B;  1QXP A;  1SPY A;  1Y1X A;  2KI6 D;  1S6C A;  2LVJ A;  1B7T Y;  3LK0 A;  2EHB A;  1UUR A;  3DVE A;  1S5G Y;  2LP2 A;  3AAJ A;  4MSP A;  5AER A;  1KFU S;  1BR1 B;  1DJG A;  1GQM A;  2BBM A;  3LK1 A;  5CSI A;  2NLN A;  1NX0 A;  4MZK A;  1SL8 A;  2KGB C;  1DF0 B;  2TN4 A;  2JNX A;  1QX7 A;  4JPZ B;  2JC2 A;  1OOJ A;  5HKZ A;  4HRE E;  1SCM C;  4DCK A;  3SG6 A;  1UHK A;  5I2O A;  2MJW B;  3WXA A;  3WNX B;  2M7N A;  1ZOT B;  3KPX A;  4HRH A;  1MF8 B;  2I2R E;  4D1E A;  1DT7 B;  4GGF C;  1KQM B;  4C0L A;  2JT8 A;  1YX7 A;  1FI6 A;  2ZFD A;  1LIN A;  1CLM A;  2Q91 A;  1BOD A;  4MLW A;  2PSR A;  4GUK A;  1XFU O;  4C0J A;  5HYD A;  2HQ8 A;  4Q04 A;  4YI9 A;  3M0W A;  2MLF C;  4PE4 A;  2BCX A;  3I5H B;  3PFV A;  4MZL A;  3PAL A;  2OTG B;  2ZNE A;  1WDC C;  4OKH A;  1DJH A;  1JF0 A;  3I5F B;  5IBW A;  2WCB A;  2LUX A;  1DVI A;  4ORB B;  5AXI A;  3IF7 A;  1YVH A;  3BOW B;  1J7P A;  2ZN8 A;  1PVB A;  1IRJ A;  2KGR A;  1F55 A;  3O6B A;  5I8N A;  1NSH A;  1ZFS A;  1MHO A;  2B1U A;  2Q4U A;  3KF9 A;  4DRW A;  1NIW A;  1OE9 B;  2KFH A;  5B8I B;  3TS5 B;  1GGW A;  3D0Y B;  4M2O A;  3WHT B;  1HQV A;  3I5I C;  2KYF A;  2I7A A;  3LLE A;  4XJK A;  3PAT A;  1A29 A;  1K95 A;  1SL9 A;  2EGD A;  2L2E A;  1UHH A;  1KSO A;  3NSI A;  4I5J A;  4YGC B;  1KK8 C;  1QV0 A;  2LAP A;  2JRF A;  5KSZ A;  1GJY A;  1SY9 A;  5ER4 X;  2M1K B;  2QAC A;  1B7T Z;  1KFX L;  1PAL A;  2M3W A;  1PVA A;  4HSZ A;  1J7O A;  1KWO C;  3NSO A;  1S5G Z;  1CLB A;  1C7W A;  3BUN B;  1ALW A;  1UHN A;  3NXA A;  1BF5 A;  1YUT A;  3AKA A;  1CFF A;  2M49 B;  2F3Z A;  1B1G A;  5HLO A;  4NDB A;  1CDN A;  2JTT A;  4GPL B;  4OCI A;  4ZCV A;  1ZUZ A;  4N1G A;  1NPQ A;  1OMR A;  4MRY A;  1SBJ A;  3HX4 A;  1UHI A;  1RWY A;  3CR4 X;  3ZNI A;  3ICB A;  2KFF A;  2K8M B;  3DF0 A;  2JPT A;  1TOP A;  1CKK A;  1CFC A;  1OQP A;  3TDU A;  4OR9 B;  1S26 D;  2SAS A;  2E30 A;  2P6B B;  4M2Q A;  3SIA A;  1M63 B;  1QX5 B;  2BKI B;  2KFG A;  4AOM A;  2K7C A;  1K90 D;  2CTN A;  1TCO B;  4PAL A;  2H2K A;  5HKW A;  2MA2 A;  3D10 A;  2K7O A;  2BBN A;  3JTD C;  1EXR A;  2MBX A;  1H4B A;  5J3X A;  2ZRS A;  3CTN A;  1CDL A;  2KI4 B;  3O2P A;  2JWW A;  2LUC A;  1CFP A;  1IH0 A;  2KNE A;  1SR6 C;  5D7F A;  1JFK A;  1MR8 A;  2MLE C;  3I5G B;  1TRF A;  4PDZ A;  1OZO A;  1YX8 A;  1L2O C;  1U5I B;  2L0P A;  1EL4 A;  4C0K A;  5CSF A;  1J1E A;  1SNL A;  2EC6 C;  2LC5 A;  1SK6 D;  1R2U A;  1MQ1 A;  2F2O A;  2JNF A;  1QTX A;  2LHI A;  2BL0 C;  1BLQ A;  1QJT A;  1KK8 B;  2PRU A;  2F33 A;  1TNX A;  1VRK A;  1S6J A;  5CSJ A;  1F70 A;  4HRG A;  4CLN A;  1TCF A;  2BE4 A;  1CTR A;  1KWO B;  1A03 A;  1DJZ A;  4PE0 A;  1SRA A;  3IQQ A;  2LVV A;  1XVJ A;  1YVL A;  3EKJ A;  1G4Y R;  3CGA A;  1QLK A;  4I5K A;  1YR5 A;  4A4B A;  1A75 A;  1ZAC A;  2SCP A;  3KO0 A;  4BY5 A;  1D1O A;  1BJF A;  3AAK A;  3PN7 C;  5G08 A;  1OSA A;  1DJX A;  1YUR A;  1DF0 A;  2WOR A;  4YGA A;  5CSN A;  1DJW A;  3OP0 A;  1DJY A;  5HKY A;  2PAL A;  2PVB A;  2CCM A;  4YGB B;  4L9M A;  2LAN A;  2O5G A;  2NCO A;  4A4C A;  1V1F A;  1TIZ A;  1PK0 D;  3VGO A;  2K61 A;  1CMF A;  3BUO B;  5HLV A;  3DVK A;  1WLM A;  2GV5 A;  2GGM A;  2M7L A;  4NQG A;  1S3P A;  1K96 A;  1QS7 A;  2PMY A;  2IS9 A;  3CZT X;  3E3R A;  4MZJ A;  4NDD A;  2E6W A;  1C7V A;  2Y5I A;  1V1G A;  1PSB A;  1RTP 1;  2V53 A;  1YRT B;  1IKU A;  2Y1M A;  3BUX B;  3CR2 A;  3VRP A;  4YBH B;  3FWB A;  1E8A A;  1L2O B;  1QV1 A;  4PE7 A;  1YUS A;  2ZRT A;  1HT9 A;  2EC6 B;  5FYX A;  1JSA A;  2FOT A;  3C1V A;  5K89 A;  1BMO A;  1N2D A;  1NCY A;  2MHH A;  3EVU A;  2COL B;  5DKN A;  2VRG A;  3CR5 X;  2BCB A;  4I5N B;  4XJK B;  1KFU L;  2JXC A;  5I2L A;  3DD4 A;  1AVS A;  3SG5 A;  4P2Y B;  1CFD A;  3WHU B;  4MEW A;  2NXQ A;  3GK1 A;  1BT6 A;  4WQ2 A;  1NYA A;  1SL7 A; 
#chains in the Genus database with same CATH topology
 5PAL A;  1MXL C;  1REC A;  3SS4 A;  2K7B A;  2LMT A;  2LNK A;  2Y1N A;  1OOF A;  1YRU B;  3IQO A;  2K7D A;  3SIB A;  2WC8 A;  1SCM B;  3FS7 A;  1Q80 A;  2L5Y A;  1QLS A;  4IJ7 A;  1NCX A;  3NGV A;  2JT0 A;  3SG2 A;  4OZD A;  4R1E A;  2AUC A;  2CXJ A;  1H8B A;  3VRQ A;  4WQ3 A;  2Y4Q A;  1F54 A;  1SSE B;  4MN0 A;  3BUW B;  2A4J A;  2CNP A;  1F4O A;  3OB2 B;  3PJI A;  3GOF A;  3O78 A;  1K9K A;  4N5X A;  3GK4 X;  1GGZ A;  2LLU A;  5DIC A;  1QVI Y;  2KQY A;  1R6P A;  1CDM A;  3OX6 A;  3A8R A;  2WCM A;  3VRR A;  1WDC B;  2QEB A;  1B4C A;  1NWD A;  1QAS A;  1EJ3 A;  1QIV A;  1TNQ A;  3NHT A;  1G8I A;  1J7Q A;  2BCA A;  3EKH A;  2KYC A;  1KQM C;  3SG3 A;  4OV2 A;  2M29 A;  4U8D A;  1B47 A;  1SMG A;  1YTZ C;  3A4U B;  4FQO A;  1M39 A;  3OHM B;  2M97 A;  3PSR A;  1DTL A;  1UUS A;  1MXE A;  1PSR A;  1RK9 A;  1XFY O;  1Y0V H;  2CT9 A;  2WCF A;  3SG4 A;  1M45 A;  1Y1A A;  2JTZ A;  2JOJ A;  1S6I A;  3CZ2 A;  2JZI A;  2NCP A;  2WCH A;  3OX5 A;  3D73 A;  1MWN A;  3BFB A;  1K94 A;  1M31 A;  2OTG C;  3I5I B;  1XFX O;  1XFW O;  2BEC A;  3I5F C;  1IWQ A;  4CID A;  3LL8 B;  1TN4 A;  1Z2C B;  1LS8 A;  1PRW A;  3K21 A;  1ODB A;  1C07 A;  2KAX A;  2KPH A;  4NDC A;  1AHR A;  1QAT A;  1K9U A;  4P5O E;  4ORA B;  2L4H A;  1LA3 A;  1OMV A;  4PHN A;  5FI6 A;  2LLS A;  1AJ5 A;  2F3Y A;  3B6X A;  4YGD B;  2KDH A;  1KSM A;  2YGU A;  3R1O A;  4JWQ A;  5KTY A;  1F8H A;  1KK7 Y;  1DEL A;  3DVM A;  4ICB A;  1XK4 A;  1RFJ A;  4JKT A;  2KSP A;  1P28 A;  2FCE A;  2BNX A;  1EH2 A;  1A2X A;  3O4Y A;  2KBM A;  2QPT A;  2RGI A;  3PM2 A;  1BG1 A;  3ZWH A;  2KLD A;  1SKT A;  1OZS A;  2LP3 A;  4DIR A;  3VRN A;  1XA5 A;  5AFP A;  2D8N A;  2LV7 A;  2WC5 A;  1NX3 A;  5GQQ C;  3TDI A;  1KCY A;  2OPO A;  3PLF B;  1QWV A;  2ERB A;  1NUB A;  3JVT C;  2KAY A;  3TZ1 A;  2KBI A;  2LCP A;  2LMU A;  3R1P A;  3F45 A;  1A75 B;  4YGE B;  1JWD A;  4GBA A;  4YRU A;  2WOS A;  2PQL A;  2HF5 A;  2AAO A;  4JQ0 D;  1KFX S;  5JJG A;  3SG7 A;  2FJU B;  1CNP A;  1N0Y A;  1DQE A;  1WRK A;  1J55 A;  1UWO A;  2L2C A;  3PM8 A;  2LMV A;  4KYN A;  4FTG A;  1DC1 A;  4AQJ A;  1QVI Z;  3RM1 A;  2FJY A;  3MSE B;  2L51 A;  2WCE A;  4MVF A;  2ISD A;  2DOQ A;  2R2I A;  3TDZ A;  4DUQ A;  4GNK B;  2ZND A;  1IGV A;  2JUL A;  3JTD B;  2LVK A;  2PAS A;  1BU3 A;  1AUI B;  1JUO A;  1DGU A;  1LVC D;  3DYE A;  4F7F A;  1XFZ O;  3TUY C;  1RJV A;  2H61 A;  1CDP A;  1FBV A;  5KU1 A;  2MRD A;  1L7Z A;  3FIA A;  4CFQ A;  1NX1 A;  4OVN F;  2KI6 C;  1XFV O;  3BOW A;  4DS7 A;  2ZN9 A;  1XYD A;  3RZS A;  3N7H A;  1SR6 B;  4MBE A;  3KHE A;  4E68 A;  1F71 A;  3NSL A;  1DGV A;  1CMG A;  2KAV A;  2M1U A;  2HQW A;  2P71 A;  4GGN A;  5BPJ A;  2F8P A;  1UP5 A;  5TNC A;  1RRO A;  1AK8 A;  2WCJ A;  1K9P A;  3NHI A;  5FI2 A;  1JC2 A;  2F2P A;  4I5L B;  5I2Q A;  4GAO A;  3QRX A;  2JXL A;  3D0Y A;  1FI5 A;  4QJ5 B;  2LLT A;  1B8L A;  1B8C A;  2BL0 B;  5DKR A;  1N65 A;  2AMI A;  2KI4 C;  4PHK A;  1WRZ A;  2CBL A;  3LCP C;  1TNW A;  4AQI A;  3V2L A;  4PHJ A;  4PHM A;  1FW4 A;  2GGZ A;  4IL1 A;  3OB1 B;  5AAN A;  3DVJ A;  1DMO A;  3I5G C;  1KK7 Z;  2I18 A;  1CLL A;  1CB1 A;  2OS8 C;  2JT3 A;  1EG3 A;  2BE6 A;  3AKB A;  3EVR A;  3VRO A;  2L5X B;  1FF1 A;  2L4I A;  3EVV A;  5JOL A;  3EK4 A;  1K2H A;  1XK4 C;  2G2B A;  1CM1 A;  1IQ5 A;  1TWO A;  3PN7 B;  1YUU A;  4GFT A;  4PE1 A;  1EG4 A;  1MUX A;  1NX2 A;  1X02 A;  1J7R A;  2KOT A;  1FPW A;  3JVT B;  1ZMZ A;  2MAZ A;  4UPG A;  4BY4 A;  3BXK A;  1AJ4 A;  2M8U A;  1KQV A;  3KEV A;  1TNP A;  4MRX A;  3S0G A;  3S0D A;  2K2A A;  1J1D A;  1Y6W A;  4GGF A;  1C3Z A;  1SYM A;  3DF0 B;  1A4P A;  2WCK A;  5CPV A;  1TUZ A;  4PCW A;  1JF2 A;  5D69 A;  2JQ6 A;  1CM4 A;  1IJ6 A;  4ZCU A;  5AEQ A;  2LM5 A;  3CWG A;  2ZKM X;  1B9A A;  1IG5 A;  4QJ3 B;  1NP8 A;  1Y1U A;  4N1F A;  3EK8 A;  1IJ5 A;  1QIW A;  1W7J B;  3TUY B;  2O60 A;  3BFA A;  3NSK A;  2L50 A;  1K8U A;  2NZ0 A;  2KHN A;  1K93 D;  2M9G A;  3GK2 A;  4WRI A;  4XYN A;  1PUL A;  2LHL A;  4QJ4 B;  3I5H C;  2FCD A;  3BYA A;  3FE6 A;  1M46 A;  1AP4 A;  1UHJ A;  1W7I B;  1WLZ A;  2H61 C;  1OMD A;  2L98 A;  3SS5 A;  1BR4 B;  5HL1 A;  2KQ6 A;  1WY9 A;  4TNC A;  1BOC A;  1IIO A;  2LVI A;  1LA0 A;  1QX2 A;  3FWC A;  4CPV A;  3H4S E;  3VB1 A;  4JD9 A;  3B87 A;  1XO5 A;  1LXF C;  2BKH B;  2I94 A;  2M0R A;  4YI8 A;  1G33 A;  4ORC B;  2PYQ A;  5DKQ A;  5F6T A;  4ETO A;  1U5I A;  4CFR A;  1DJI A;  3TS5 C;  1SCV A;  2K0J A;  1S1E A;  3EK7 A;  3BQ3 A;  1JFJ A;  5ER5 A;  1LKJ A;  3BUM B;  3D74 A;  1TTX A;  1F4Q A;  2JU0 A;  1B8R A;  1SW8 A;  1WRL A;  1S36 A;  2G9B A;  2HPS A;  1NCZ A;  2WC6 A;  3BJH A;  4M2P A;  5EL2 A;  1JBA A;  2OS8 B;  1ALV A;  3HCM A;  3S0F A;  2K2F A;  3RLZ A;  3UO9 A;  3CLN A;  4USL A;  2HET A;  1IQ3 A;  2WND A;  2LE9 B;  3CS1 A;  3SJS A;  4F0Z B;  1QXP A;  1SPY A;  1Y1X A;  2KI6 D;  1S6C A;  2H8V A;  2LVJ A;  1B7T Y;  3LK0 A;  2EHB A;  3SS3 A;  1UUR A;  3DVE A;  1S5G Y;  2LP2 A;  2WCL A;  3AAJ A;  4MSP A;  5AER A;  1KFU S;  1BR1 B;  1DJG A;  1GQM A;  2BBM A;  3B86 A;  3LK1 A;  5CSI A;  2NLN A;  1NX0 A;  4MZK A;  1SL8 A;  2KGB C;  1DF0 B;  2TN4 A;  2JNX A;  1QX7 A;  4JPZ B;  2JC2 A;  1OOJ A;  5HKZ A;  4HRE E;  4INX A;  2GTE A;  1SCM C;  4DCK A;  3SG6 A;  1UHK A;  5I2O A;  2MJW B;  3WXA A;  2KLE A;  3WNX B;  2M7N A;  1ZOT B;  3KPX A;  4HRH A;  1MF8 B;  2I2R E;  4D1E A;  1DT7 B;  4GGF C;  1KQM B;  3DY9 A;  4C0L A;  2JT8 A;  1YX7 A;  1FI6 A;  2ZFD A;  1LIN A;  1CLM A;  2Q91 A;  1DEK A;  4MLW A;  1BOD A;  2PSR A;  4GUK A;  1T14 A;  1XFU O;  4C0J A;  5HYD A;  2HQ8 A;  4Q04 A;  1C3Y A;  4YI9 A;  3M0W A;  3IVT A;  2MLF C;  4PE4 A;  2BCX A;  1TUJ A;  3I5H B;  3PFV A;  4MZL A;  3B88 A;  3D76 A;  3DZT A;  3PAL A;  2OTG B;  2QEO A;  1WDC C;  2ZNE A;  4OKH A;  1DJH A;  1JF0 A;  3I5F B;  5IBW A;  2WCB A;  2LUX A;  1DVI A;  4ORB B;  5AXI A;  3S0E A;  3IF7 A;  1YVH A;  3BOW B;  3UNW A;  1J7P A;  2ZN8 A;  1PVB A;  1IRJ A;  2KGR A;  1OOI X;  1F55 A;  3O6B A;  5I8N A;  1NSH A;  1ZFS A;  1MHO A;  2B1U A;  2Q4U A;  2K60 A;  3KF9 A;  4DRW A;  1NIW A;  1OE9 B;  2KFH A;  5B8I B;  3TS5 B;  3OBV A;  1GM0 A;  1XFR A;  1GGW A;  3D0Y B;  5I94 A;  4M2O A;  3WHT B;  1HQV A;  3I5I C;  5D3O A;  2KYF A;  3FE8 A;  2I7A A;  3LLE A;  4XJK A;  3PAT A;  1A29 A;  1K95 A;  1SL9 A;  2EGD A;  2JPO A;  2L2E A;  1UHH A;  3R72 A;  1KSO A;  3NSI A;  4I5J A;  4YGC B;  1KK8 C;  1QV0 A;  2LAP A;  2JRF A;  5KSZ A;  1GJY A;  1SY9 A;  5ER4 X;  2M1K B;  2QDI A;  2QAC A;  1B7T Z;  1KFX L;  1PAL A;  2M3W A;  1PVA A;  4HSZ A;  1J7O A;  1KWO C;  3NSO A;  3Q8I A;  1S5G Z;  1CLB A;  1C7W A;  3BUN B;  1ALW A;  1UHN A;  3NXA A;  1BF5 A;  1YUT A;  3AKA A;  1CFF A;  2M49 B;  2F3Z A;  1B1G A;  3B7A A;  5HLO A;  4NDB A;  2QEH A;  1CDN A;  4INW A;  2JTT A;  4GPL B;  4OCI A;  4ZCV A;  4FQT A;  1ZUZ A;  4N1G A;  3S0A A;  1NPQ A;  1Z4H A;  1OMR A;  4MRY A;  1SBJ A;  3HX4 A;  3CAB A;  1UHI A;  1RWY A;  3CR4 X;  3ZNI A;  3ICB A;  2KFF A;  3D78 A;  2K8M B;  3DF0 A;  2JPT A;  1TOP A;  1CKK A;  1CFC A;  1OQP A;  3CYZ A;  1ORG A;  3EG5 B;  4OR9 B;  3TDU A;  1S26 D;  2SAS A;  2E30 A;  2P6B B;  4M2Q A;  3SIA A;  1M63 B;  1QX5 B;  2BKI B;  2KFG A;  4AOM A;  2K7C A;  1K90 D;  2CTN A;  1TCO B;  4PAL A;  2H2K A;  3CZ0 A;  5HKW A;  2MA2 A;  3D10 A;  2K7O A;  2BBN A;  1OOH A;  3D75 A;  3JTD C;  3O4X A;  1EXR A;  2MBX A;  1H4B A;  5J3X A;  2ZRS A;  3CTN A;  1CDL A;  2KI4 B;  3O2P A;  2JWW A;  2LUC A;  1CFP A;  1IH0 A;  2KNE A;  1SR6 C;  5D7F A;  1JFK A;  1MR8 A;  2MLE C;  3I5G B;  1TRF A;  3DXL A;  4PDZ A;  1OZO A;  1YX8 A;  1L2O C;  1U5I B;  2L0P A;  1EL4 A;  4C0K A;  5CSF A;  1J1E A;  1SNL A;  2EC6 C;  2LC5 A;  1SK6 D;  1R2U A;  1MQ1 A;  2F2O A;  2JNF A;  1QTX A;  2LHI A;  2BL0 C;  1BLQ A;  1QJT A;  1KK8 B;  2PRU A;  2F33 A;  1TNX A;  1VRK A;  1S6J A;  5CSJ A;  3OGN A;  3QME A;  1F70 A;  4HRG A;  4CLN A;  1TCF A;  2BE4 A;  1CTR A;  1KWO B;  3S0B A;  1DJZ A;  1A03 A;  4PE0 A;  1SRA A;  3IQQ A;  2LVV A;  1XVJ A;  1YVL A;  3EKJ A;  1G4Y R;  3CGA A;  1QLK A;  4I5K A;  1YR5 A;  4A4B A;  1A75 A;  1ZAC A;  2SCP A;  3KO0 A;  4BY5 A;  1D1O A;  1BJF A;  3CZ1 A;  3AAK A;  3PN7 C;  5G08 A;  1OSA A;  1DJX A;  1YUR A;  1DF0 A;  2WOR A;  4YGA A;  5CSN A;  1DJW A;  3OP0 A;  1DJY A;  5HKY A;  2PAL A;  2BAP A;  2PVB A;  3R1V A;  2CCM A;  4PT1 A;  3L4L A;  4YGB B;  1W9Z A;  4L9M A;  2LAN A;  2O5G A;  1OW4 A;  2NCO A;  4A4C A;  1V1F A;  1TIZ A;  1PK0 D;  3FE9 A;  3VGO A;  2K61 A;  1CMF A;  3CDN A;  3BUO B;  5HLV A;  3DVK A;  1WLM A;  2GV5 A;  2GGM A;  2M7L A;  5FI7 A;  3D77 A;  4NQG A;  1S3P A;  1K96 A;  1QS7 A;  2PMY A;  2IS9 A;  3CZT X;  3E3R A;  4MZJ A;  4NDD A;  2E6W A;  1C7V A;  2Y5I A;  1V1G A;  1PSB A;  1RTP 1;  2V53 A;  1YRT B;  1IKU A;  2Y1M A;  3BUX B;  3CR2 A;  3VRP A;  4YBH B;  3FWB A;  1E8A A;  1L2O B;  1QV1 A;  4PE7 A;  1YUS A;  2ZRT A;  1HT9 A;  2EC6 B;  3K1E A;  5FYX A;  2FOT A;  1JSA A;  3C1V A;  5K89 A;  1BMO A;  1N2D A;  1NCY A;  1OOG A;  2MHH A;  2COL B;  3EVU A;  2VRG A;  5DKN A;  3CR5 X;  3L4A A;  2BCB A;  4I5N B;  4XJK B;  1KFU L;  2JXC A;  5I2L A;  2QEV A;  2P70 A;  3DD4 A;  3BFH A;  1AVS A;  3SG5 A;  4P2Y B;  1CFD A;  3WHU B;  4MEW A;  2NXQ A;  3GK1 A;  1BT6 A;  3L47 A;  4WQ2 A;  1NYA A;  1SL7 A; 
#chains in the Genus database with same CATH homology
 5PAL A;  1MXL C;  1REC A;  2K7B A;  2LMT A;  2LNK A;  2Y1N A;  1YRU B;  3IQO A;  2K7D A;  3SIB A;  2WC8 A;  1SCM B;  3FS7 A;  1Q80 A;  1QLS A;  1NCX A;  2JT0 A;  3SG2 A;  4R1E A;  2AUC A;  2CXJ A;  1H8B A;  3VRQ A;  4WQ3 A;  2Y4Q A;  1F54 A;  4MN0 A;  3BUW B;  2A4J A;  2CNP A;  1F4O A;  3OB2 B;  3GOF A;  3O78 A;  1K9K A;  4N5X A;  3GK4 X;  1GGZ A;  2LLU A;  1QVI Y;  2KQY A;  1R6P A;  1CDM A;  3OX6 A;  3A8R A;  3VRR A;  1WDC B;  1B4C A;  1NWD A;  1QAS A;  1EJ3 A;  1QIV A;  1TNQ A;  1G8I A;  1J7Q A;  2BCA A;  3EKH A;  2KYC A;  1KQM C;  3SG3 A;  4OV2 A;  2M29 A;  4U8D A;  1B47 A;  1SMG A;  1YTZ C;  3A4U B;  4FQO A;  1M39 A;  3OHM B;  2M97 A;  3PSR A;  1DTL A;  1UUS A;  1MXE A;  1PSR A;  1RK9 A;  1XFY O;  1Y0V H;  2CT9 A;  2WCF A;  3SG4 A;  1M45 A;  1Y1A A;  2JTZ A;  2JOJ A;  1S6I A;  2JZI A;  2NCP A;  3OX5 A;  1MWN A;  1K94 A;  1M31 A;  2OTG C;  3I5I B;  1XFX O;  1XFW O;  2BEC A;  3I5F C;  1IWQ A;  4CID A;  3LL8 B;  1TN4 A;  3K21 A;  1PRW A;  1ODB A;  1C07 A;  2KAX A;  4NDC A;  1AHR A;  1QAT A;  1K9U A;  4P5O E;  4ORA B;  2L4H A;  1LA3 A;  1OMV A;  4PHN A;  2LLS A;  1AJ5 A;  2F3Y A;  4YGD B;  2KDH A;  1KSM A;  1F8H A;  5KTY A;  4JWQ A;  1KK7 Y;  3DVM A;  4ICB A;  1XK4 A;  1RFJ A;  2KSP A;  2FCE A;  1EH2 A;  1A2X A;  3O4Y A;  2KBM A;  2QPT A;  2RGI A;  1BG1 A;  3ZWH A;  1SKT A;  1OZS A;  2LP3 A;  4DIR A;  3VRN A;  1XA5 A;  5AFP A;  2D8N A;  2LV7 A;  5GQQ C;  1NX3 A;  3TDI A;  1KCY A;  2OPO A;  3PLF B;  1NUB A;  3JVT C;  2KAY A;  3TZ1 A;  2KBI A;  2LCP A;  2LMU A;  4YGE B;  3F45 A;  1A75 B;  1JWD A;  4GBA A;  4YRU A;  2WOS A;  2HF5 A;  2AAO A;  4JQ0 D;  1KFX S;  5JJG A;  3SG7 A;  2FJU B;  1CNP A;  1N0Y A;  1WRK A;  1J55 A;  1UWO A;  3PM8 A;  2LMV A;  4FTG A;  4AQJ A;  1QVI Z;  3RM1 A;  4MVF A;  3MSE B;  2L51 A;  2WCE A;  2ISD A;  3TDZ A;  2DOQ A;  2R2I A;  4DUQ A;  4GNK B;  2ZND A;  1IGV A;  2JUL A;  3JTD B;  2LVK A;  2PAS A;  1BU3 A;  1AUI B;  1JUO A;  1DGU A;  1LVC D;  1XFZ O;  3TUY C;  1RJV A;  2H61 A;  1CDP A;  1FBV A;  5KU1 A;  2MRD A;  1L7Z A;  3FIA A;  4CFQ A;  1NX1 A;  4OVN F;  2KI6 C;  1XFV O;  3BOW A;  4DS7 A;  2ZN9 A;  1XYD A;  1SR6 B;  4MBE A;  3KHE A;  4E68 A;  1F71 A;  3NSL A;  1DGV A;  1CMG A;  2KAV A;  2M1U A;  2HQW A;  5BPJ A;  4GGN A;  2F8P A;  1UP5 A;  5TNC A;  1RRO A;  1AK8 A;  1K9P A;  1JC2 A;  2F2P A;  4I5L B;  5I2Q A;  4GAO A;  3QRX A;  2JXL A;  3D0Y A;  1FI5 A;  4QJ5 B;  2LLT A;  1B8L A;  1B8C A;  2BL0 B;  5DKR A;  1N65 A;  2AMI A;  2KI4 C;  4PHK A;  1WRZ A;  2CBL A;  3LCP C;  1TNW A;  4AQI A;  4PHJ A;  4PHM A;  1FW4 A;  2GGZ A;  4IL1 A;  3OB1 B;  5AAN A;  3DVJ A;  1DMO A;  3I5G C;  1KK7 Z;  2I18 A;  1CLL A;  1CB1 A;  2OS8 C;  2JT3 A;  1EG3 A;  2BE6 A;  3AKB A;  3EVR A;  3VRO A;  2L5X B;  1FF1 A;  2L4I A;  3EVV A;  5JOL A;  3EK4 A;  1K2H A;  1XK4 C;  2G2B A;  1CM1 A;  1IQ5 A;  3PN7 B;  1YUU A;  4GFT A;  4PE1 A;  1EG4 A;  1MUX A;  1NX2 A;  1X02 A;  1J7R A;  2KOT A;  1FPW A;  3JVT B;  1ZMZ A;  2MAZ A;  4UPG A;  4BY4 A;  3BXK A;  1AJ4 A;  2M8U A;  1KQV A;  3KEV A;  1TNP A;  4MRX A;  2K2A A;  1J1D A;  1Y6W A;  4GGF A;  1SYM A;  3DF0 B;  1A4P A;  5D69 A;  5CPV A;  4PCW A;  1JF2 A;  2JQ6 A;  1CM4 A;  1IJ6 A;  4ZCU A;  5AEQ A;  2LM5 A;  3CWG A;  2ZKM X;  1B9A A;  1IG5 A;  4QJ3 B;  1NP8 A;  1Y1U A;  4N1F A;  3EK8 A;  1IJ5 A;  1QIW A;  1W7J B;  3TUY B;  2O60 A;  3NSK A;  2L50 A;  1K8U A;  2NZ0 A;  2KHN A;  1K93 D;  2M9G A;  3GK2 A;  4WRI A;  4XYN A;  1PUL A;  2LHL A;  4QJ4 B;  3I5H C;  2FCD A;  3BYA A;  1M46 A;  1AP4 A;  1UHJ A;  1W7I B;  1WLZ A;  2H61 C;  1OMD A;  2L98 A;  1BR4 B;  2KQ6 A;  1WY9 A;  4TNC A;  1BOC A;  2LVI A;  1LA0 A;  1QX2 A;  3FWC A;  4CPV A;  3H4S E;  1XO5 A;  1LXF C;  2BKH B;  2I94 A;  2M0R A;  4YI8 A;  1G33 A;  4ORC B;  5DKQ A;  5F6T A;  4ETO A;  1U5I A;  4CFR A;  1DJI A;  3TS5 C;  1SCV A;  2K0J A;  1S1E A;  3EK7 A;  3BQ3 A;  1JFJ A;  5ER5 A;  1LKJ A;  3BUM B;  1F4Q A;  1TTX A;  2JU0 A;  1B8R A;  1SW8 A;  1WRL A;  1S36 A;  2G9B A;  2HPS A;  1NCZ A;  4M2P A;  1JBA A;  2OS8 B;  1ALV A;  3HCM A;  2K2F A;  3RLZ A;  3CLN A;  4USL A;  2HET A;  1IQ3 A;  2WND A;  2LE9 B;  3CS1 A;  3SJS A;  4F0Z B;  1QXP A;  1SPY A;  1Y1X A;  2KI6 D;  1S6C A;  2LVJ A;  1B7T Y;  3LK0 A;  2EHB A;  1UUR A;  3DVE A;  1S5G Y;  2LP2 A;  3AAJ A;  4MSP A;  5AER A;  1KFU S;  1BR1 B;  1DJG A;  1GQM A;  2BBM A;  3LK1 A;  5CSI A;  2NLN A;  1NX0 A;  4MZK A;  1SL8 A;  2KGB C;  1DF0 B;  2TN4 A;  2JNX A;  1QX7 A;  4JPZ B;  2JC2 A;  1OOJ A;  5HKZ A;  4HRE E;  1SCM C;  4DCK A;  3SG6 A;  1UHK A;  5I2O A;  2MJW B;  3WXA A;  3WNX B;  2M7N A;  1ZOT B;  3KPX A;  4HRH A;  1MF8 B;  2I2R E;  4D1E A;  1DT7 B;  4GGF C;  1KQM B;  4C0L A;  2JT8 A;  1YX7 A;  1FI6 A;  2ZFD A;  1LIN A;  1CLM A;  2Q91 A;  1BOD A;  4MLW A;  2PSR A;  4GUK A;  1XFU O;  4C0J A;  5HYD A;  2HQ8 A;  4Q04 A;  4YI9 A;  3M0W A;  2MLF C;  4PE4 A;  2BCX A;  3I5H B;  3PFV A;  4MZL A;  3PAL A;  2OTG B;  2ZNE A;  1WDC C;  4OKH A;  1DJH A;  1JF0 A;  3I5F B;  5IBW A;  2WCB A;  2LUX A;  1DVI A;  4ORB B;  5AXI A;  3IF7 A;  1YVH A;  3BOW B;  1J7P A;  2ZN8 A;  1PVB A;  1IRJ A;  2KGR A;  1F55 A;  3O6B A;  5I8N A;  1NSH A;  1ZFS A;  1MHO A;  2B1U A;  2Q4U A;  3KF9 A;  4DRW A;  1NIW A;  1OE9 B;  2KFH A;  5B8I B;  3TS5 B;  1GGW A;  3D0Y B;  4M2O A;  3WHT B;  1HQV A;  3I5I C;  2KYF A;  2I7A A;  3LLE A;  4XJK A;  3PAT A;  1A29 A;  1K95 A;  1SL9 A;  2EGD A;  2L2E A;  1UHH A;  1KSO A;  3NSI A;  4I5J A;  4YGC B;  1KK8 C;  1QV0 A;  2LAP A;  2JRF A;  5KSZ A;  1GJY A;  1SY9 A;  5ER4 X;  2M1K B;  2QAC A;  1B7T Z;  1KFX L;  1PAL A;  2M3W A;  1PVA A;  4HSZ A;  1J7O A;  1KWO C;  3NSO A;  1S5G Z;  1CLB A;  1C7W A;  3BUN B;  1ALW A;  1UHN A;  3NXA A;  1BF5 A;  1YUT A;  3AKA A;  1CFF A;  2M49 B;  2F3Z A;  1B1G A;  5HLO A;  4NDB A;  1CDN A;  2JTT A;  4GPL B;  4OCI A;  4ZCV A;  1ZUZ A;  4N1G A;  1NPQ A;  1OMR A;  4MRY A;  1SBJ A;  3HX4 A;  1UHI A;  1RWY A;  3CR4 X;  3ZNI A;  3ICB A;  2KFF A;  2K8M B;  3DF0 A;  2JPT A;  1TOP A;  1CKK A;  1CFC A;  1OQP A;  3TDU A;  4OR9 B;  1S26 D;  2SAS A;  2E30 A;  2P6B B;  4M2Q A;  3SIA A;  1M63 B;  1QX5 B;  2BKI B;  2KFG A;  4AOM A;  2K7C A;  1K90 D;  2CTN A;  1TCO B;  4PAL A;  2H2K A;  5HKW A;  2MA2 A;  3D10 A;  2K7O A;  2BBN A;  3JTD C;  1EXR A;  2MBX A;  1H4B A;  5J3X A;  2ZRS A;  3CTN A;  1CDL A;  2KI4 B;  3O2P A;  2JWW A;  2LUC A;  1CFP A;  1IH0 A;  2KNE A;  1SR6 C;  5D7F A;  1JFK A;  1MR8 A;  2MLE C;  3I5G B;  1TRF A;  4PDZ A;  1OZO A;  1YX8 A;  1L2O C;  1U5I B;  2L0P A;  1EL4 A;  4C0K A;  5CSF A;  1J1E A;  1SNL A;  2EC6 C;  2LC5 A;  1SK6 D;  1R2U A;  1MQ1 A;  2F2O A;  2JNF A;  1QTX A;  2LHI A;  2BL0 C;  1BLQ A;  1QJT A;  1KK8 B;  2PRU A;  2F33 A;  1TNX A;  1VRK A;  1S6J A;  5CSJ A;  1F70 A;  4HRG A;  4CLN A;  1TCF A;  2BE4 A;  1CTR A;  1KWO B;  1A03 A;  1DJZ A;  4PE0 A;  1SRA A;  3IQQ A;  2LVV A;  1XVJ A;  1YVL A;  3EKJ A;  1G4Y R;  3CGA A;  1QLK A;  4I5K A;  1YR5 A;  4A4B A;  1A75 A;  1ZAC A;  2SCP A;  3KO0 A;  4BY5 A;  1D1O A;  1BJF A;  3AAK A;  3PN7 C;  5G08 A;  1OSA A;  1DJX A;  1YUR A;  1DF0 A;  2WOR A;  4YGA A;  5CSN A;  1DJW A;  3OP0 A;  1DJY A;  5HKY A;  2PAL A;  2PVB A;  2CCM A;  4YGB B;  4L9M A;  2LAN A;  2O5G A;  2NCO A;  4A4C A;  1V1F A;  1TIZ A;  1PK0 D;  3VGO A;  2K61 A;  1CMF A;  3BUO B;  5HLV A;  3DVK A;  1WLM A;  2GV5 A;  2GGM A;  2M7L A;  4NQG A;  1S3P A;  1K96 A;  1QS7 A;  2PMY A;  2IS9 A;  3CZT X;  3E3R A;  4MZJ A;  4NDD A;  2E6W A;  1C7V A;  2Y5I A;  1V1G A;  1PSB A;  1RTP 1;  2V53 A;  1YRT B;  1IKU A;  2Y1M A;  3BUX B;  3CR2 A;  3VRP A;  4YBH B;  3FWB A;  1E8A A;  1L2O B;  1QV1 A;  4PE7 A;  1YUS A;  2ZRT A;  1HT9 A;  2EC6 B;  5FYX A;  1JSA A;  2FOT A;  3C1V A;  5K89 A;  1BMO A;  1N2D A;  1NCY A;  2MHH A;  3EVU A;  2COL B;  5DKN A;  2VRG A;  3CR5 X;  2BCB A;  4I5N B;  4XJK B;  1KFU L;  2JXC A;  5I2L A;  3DD4 A;  1AVS A;  3SG5 A;  4P2Y B;  1CFD A;  3WHU B;  4MEW A;  2NXQ A;  3GK1 A;  1BT6 A;  4WQ2 A;  1NYA A;  1SL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...