2LP3A

Solution structure of s100a1 ca2+
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of calcium binding and thionylation of S100A1 protein on its nuclear magnetic resonance-derived structure and backbone dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Protein S100-A1
total genus 28
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lp3A00
2JT0A 3BUOB 1WY9A 1K95A 1S1EA 5ER5A 4ETOA 1CDLA 2KI4C 4C0KA 2LMVA 3ICBA 1EL4A 2ISDA 1XFUO 1G33A 1N65A 1NX0A 2KAYA 2ZNEA 1N0YA 4QJ3B 1H4BA 1JWDA 1KCYA 1ODBA 1JC2A 2GGMA 4A4CA 1J7QA 1N2DA 4XJKA 2LVVA 3O4YA 1QV1A 5D7FA 2BKHB 1CKKA 3I5IC 4MSPA 1AP4A 3DVMA 4CFRA 5HKZA 3DD4A 4MN0A 1DGUA 1M39A 3SIBA 4GFTA 1QASA 4DIRA 1EG3A 1V1FA 4P2YB 1K9PA 2ZKMX 5HLVA 2LNKA 3JTDC 3EKJA 4M2QA 3TZ1A 1UHJA 4I5LB 1OOJA 3LK0A 1SMGA 2JZIA 2O60A 2LP2A 3AAJA 1Y1XA 4TNCA 4XJKB 2M8UA 2PRUA 2KYCA 4ORBB 2SCPA 5GQQC 1TCOB 1IWQA 2JTTA 5FYXA 4YGBB 2JU0A 2JULA 1YX7A 1CFFA 1Y1AA 4PCWA 1ALWA 4DUQA 3CR2A 4CIDA 1NUBA 1NP8A 1B8CA 1MXEA 1NWDA 2MHHA 4HSZA 1XFVO 4IL1A 1KK8C 1OQPA 1TNXA 1WDCC 1QIWA 2LMTA 1WRLA 1SKTA 1W7JB 1KSOA 5G08A 1CLBA 1CLMA 2SASA 4OR9B 1XK4A 4ZCUA 3TDZA 1JF2A 3NSIA 1S5GZ 1MF8B 2K61A 1GQMA 3TUYC 1WLZA 1KQMB 2CT9A 4DS7A 3PFVA 2MBXA 2LUCA 2E30A 2KDHA 2KFGA 4WQ2A 2K2AA 1J7RA 1S3PA 3LLEA 2I18A 4JPZB 1CFCA 2KOTA 1SY9A 1FI6A 2WNDA 3SG7A 5AANA 5AFPA 1XFXO 1DT7B 1AJ5A 2LAPA 1IG5A 5DKQA 2JPTA 2Y4QA 1MXLC 2M9GA 3AKBA 3OP0A 1YRTB 1G4YR 3SG3A 5HLOA 1QVIY 1OZSA 2HPSA 3CR4X 3NSOA 1K8UA 1XO5A 1YVLA 2ZRSA 4BY4A 1XFYO 2P6BB 3EVUA 1H8BA 3DF0A 1L2OB 2JNXA 2JRFA 3PSRA 5D69A 1BJFA 4PHKA 1UHIA 4ICBA 1IQ5A 1L2OC 2KI4B 1OMVA 3NXAA 4I5KA 1CDNA 1RK9A 4GGFA 5HKYA 3I5FC 1AHRA 3SG4A 1U5IA 1ZMZA 1IJ5A 1DJWA 2H61C 2KI6D 2LVKA 2RGIA 3VROA 5KSZA 1A75B 2LE9B 1IKUA 2F2PA 3TS5B 5CSNA 3TDIA 1C7VA 1TIZA 4M2OA 1SL8A 2BL0C 1DTLA 1K90D 3TUYB 1Y1UA 1YURA 1F70A 1G8IA 3TDUA 1NYAA 1R6PA 2LLTA 1WRKA 3ZWHA 4QJ4B 1M31A 4UPGA 1IH0A 1F71A 1NSHA 1WLMA 3DVKA 1JF0A 4HREE 3PN7C 1YUSA 2KFHA 3CS1A 2KNEA 1WDCB 1C07A 1KK8B 3VRRA 5CSFA 4PDZA 4MZJA 1AJ4A 2MAZA 1XA5A 5TNCA 3RLZA 1RJVA 1RTP1 3SG2A 2H2KA 2BCAA 2MLFC 1KQVA 2EC6C 2LUXA 3GK4X 1UWOA 2K7CA 2A4JA 2AUCA 1SR6C 5CSJA 3BUXB 1MUXA 2Y1MA 1ALVA 2OPOA 3A4UB 4Q04A 2Q91A 1XFZO 3O2PA 2Y1NA 2KGBC 1F8HA 3EKHA 2L50A 1BR4B 1TNWA 1MHOA 2FCDA 3JVTB 4GGNA 4PE7A 5HYDA 3IF7A 3D10A 3SG6A 4PE0A 1TNPA 1ZUZA 2LP3A 1IRJA 3GOFA 1U5IB 1FPWA 1WRZA 4ZCVA 4CFQA 5IBWA 3HX4A 1SW8A 1BT6A 4M2PA 2HQWA 2KYFA 2FJUB 2AAOA 4YI8A 3FIAA 2LV7A 4PE4A 4C0JA 1FW4A 2L51A 4FTGA 1X02A 1SL9A 2LM5A 1NCXA 2BBMA 1CM1A 4D1EA 3DF0B 4MVFA 4MZKA 1M63B 1LINA 2GGZA 4WRIA 1K2HA 1RROA 2KI6C 1CDPA 1Y6WA 5KU1A 1B1GA 2G2BA 3EK8A 2CTNA 1K94A 4OCIA 1J7OA 1KFUS 3BUNB 2Q4UA 4HRHA 1NCZA 3BYAA 3HCMA 1BF5A 3KPXA 3D0YB 2JOJA 3GK1A 2F8PA 2K8MB 1TN4A 2M1KB 2M7LA 2G9BA 1MQ1A 4XYNA 2O5GA 1RECA 1B7TY 2F3ZA 2I7AA 4A4BA 1DF0B 2KQ6A 2OTGC 1CNPA 1SYMA 3I5HB 5F6TA 4R1EA 1KFXS 1F54A 1PVBA 1SBJA 4F0ZB 4MRYA 4CPVA 4YRUA 4MBEA 4N1GA 2OS8B 3BUWB 3CTNA 3LK1A 1SNLA 1S6IA 4NQGA 3OB2B 3I5GB 1BMOA 1DMOA 1SCMB 1QJTA 1M46A 4GBAA 5KTYA 1LKJA 1D1OA 3EVVA 4MEWA 1KK7Y 2V53A 2KHNA 1KWOC 3NSLA 1DJIA 4I5JA 4QJ5B 4YGEB 3BOWA 3I5GC 4NDBA 1TOPA 3A8RA 2ZN8A 1XFWO 4ORAB 1OZOA 1OE9B 4YGCB 3WHUB 4BY5A 1GJYA 2LLSA 1DJYA 1PULA 3WHTB 1S36A 2PSRA 2M0RA 1SCVA 3IQOA 4USLA 3D0YA 3LCPC 3BUMB 1J1EA 2I2RE 1K96A 3MSEB 1JBAA 1JSAA 1SPYA 1DGVA 1CTRA 2WCEA 3O6BA 2NLNA 2JC2A 4DRWA 1C7WA 1S26D 2KGRA 3SG5A 2COLB 2K7BA 3EK4A 3F45A 1OSAA 3FS7A 1QIVA 2NZ0A 2B1UA 1B4CA 1MWNA 2TN4A 1L7ZA 3K21A 2L4HA 1KFXL 4JQ0D 1RFJA 1YVHA 1B8RA 5AXIA 1YUUA 2JXCA 2M97A 4NDCA 2I94A 1MR8A 5CPVA 1SCMC 3DVJA 1LXFC 4P5OE 2PALA 2Y5IA 2MLEC 1QX5B 2EHBA 2M49B 3BXKA 1PK0D 1F55A 1AVSA 5B8IB 2D8NA 3KHEA 3LL8B 3VRNA 1A2XA 3BOWB 1A4PA 1TNQA 1LA0A 2LMUA 1QX7A 1F4QA 2BBNA 2LC5A 2VRGA 4ORCB 1PSBA 4GPLB 1A03A 1YRUB 1DJGA 2H61A 5HKWA 2QACA 2WCFA 2F2OA 3FWBA 1S6CA 2ZNDA 2BE6A 1W7IB 1J55A 4L9MA 1AUIB 1Y0VH 2HQ8A 1QATA 4MRXA 4YGDB 3RM1A 4AOMA 1CFPA 4YI9A 1CLLA 1FF1A 2BCXA 2OS8C 1K93D 2JWWA 2E6WA 2F3YA 2LCPA 4NDDA 4GUKA 2BCBA 4PHJA 2K0JA 2JT8A 2EGDA 3SIAA 1NIWA 5DKNA 1UHKA 2ZN9A 2QPTA 1QXPA 2F33A 3I5FB 3IQQA 2OTGB 1TCFA 1TTXA 2M7NA 4I5NB 5BPJA 1B7TZ 3EK7A 4AQIA 3PM8A 2LLUA 1FBVA 3AKAA 1V1GA 1B47A 4FQOA 4PE1A 4PHNA 2JTZA 4JWQA 1BR1B 1S6JA 5ER4X 2WORA 1IGVA 1BG1A 2NXQA 3H4SE 1JFKA 2K7OA 5AEQA 3C1VA 1GGWA 2FCEA 1BODA 1XK4C 2MJWB 2WC8A 1HT9A 4AQJA 1QLSA 1XYDA 3O78A 3OX6A 1QS7A 1CB1A 2L5XB 3I5HC 1Q80A 2R2IA 5I2OA 4YGAA 5JOLA 2KAXA 2BL0B 1K9KA 1DJXA 1KK7Z 4E68A 2EC6B 3TS5C 1LA3A 3KEVA 3SJSA 3EVRA 1ZOTB 2JNFA 2L98A 1EXRA 3PLFB 1B9AA 1KSMA 1NCYA 3DVEA 1RWYA 2JT3A 1M45A 2PASA 2BE4A 1YR5A 2BKIB 1F4OA 4OKHA 1PALA 2BECA 2KBIA 2LVIA 1CMFA 1YTZC 1CMGA 2LHIA 1UP5A 1EH2A 5I8NA 2MA2A 4DCKA 1J7PA 1SL7A 3OB1B 2AMIA 3CWGA 2WOSA 4GGFC 4PHMA 5K89A 2JXLA 2HF5A 2KQYA 1E8AA 4PALA 1YX8A 1K9UA 4MLWA 4GNKB 2KAVA 3CR5X 1SRAA 2M29A 1VRKA 1JUOA 2NCPA 2M1UA 3PN7B 1ZACA 1BU3A 1CDMA 2CCMA 2KSPA 2L2EA 3BQ3A 1AK8A 3PATA 1LVCD 1XVJA 2M3WA 3E3RA 3CGAA 3JVTC 1KFUL 3NSKA 1DVIA 3FWCA 1OMDA 1B8LA 2CNPA 1S5GY 1UHNA 1SR6B 4GAOA 1A75A 1PSRA 1DJZA 4N5XA 5AERA 2LANA 1R2UA 1QX2A 3QRXA 5PALA 4CLNA 1J1DA 3CZTX 5CSIA 1DJHA 3WXAA 4C0LA 2LVJA 2HETA 2DOQA 2KFFA 1DF0A 1QTXA 2MRDA 1KWOB 4N1FA 3CLNA 1JFJA 1ZFSA 2K7DA 2L4IA 1OMRA 2KBMA 1EJ3A 2K2FA 3OHMB 4U8DA 3VRPA 4YBHB 4HRGA 3KF9A 3GK2A 2GV5A 5JJGA 1QVIZ 5I2QA 2JQ6A 1NX2A 1BOCA 4MZLA 1QV0A 3JTDB 4WQ3A 1EG4A 3OX5A 3M0WA 3KO0A 5I2LA 3AAKA 1TRFA 2NCOA 1IJ6A 3ZNIA 4OV2A 3I5IB 1HQVA 1KQMC 1BLQA 1QLKA 2LHLA 5DKRA 1PVAA 1YUTA 2ZFDA 1FI5A 4OVNF 1PRWA 5J3XA 2FOTA 3VGOA 1UUSA 1SK6D 1NX1A 1IQ3A 2ZRTA 2CBLA 3PALA 2IS9A 2PMYA 2WCBA 1GGZA 1A29A 2CXJA 1UURA 2PVBA 3VRQA 3WNXB 1UHHA 1CM4A 1CFDA 1NX3A 2L0PA 1NPQA
chains in the Genus database with same CATH superfamily
1DELA 2JT0A 3DY9A 3S0EA 3BUOB 1OW4A 1WY9A 1K95A 1S1EA 5ER5A 4ETOA 1CDLA 2KI4C 4C0KA 2LMVA 3ICBA 1EL4A 2ISDA 1XFUO 1G33A 1N65A 1NX0A 2KAYA 2ZNEA 1N0YA 4QJ3B 1W9ZA 1H4BA 1JWDA 1ODBA 1KCYA 1JC2A 2GGMA 4A4CA 1J7QA 1N2DA 4XJKA 2LVVA 3O4YA 1QV1A 5D7FA 2BKHB 1CKKA 2WC5A 3B88A 3B86A 3I5IC 4MSPA 3DVMA 4CFRA 1AP4A 5HKZA 3DD4A 4MN0A 1DGUA 1M39A 3SIBA 4GFTA 1QASA 3NHIA 4DIRA 1EG3A 1V1FA 4P2YB 1K9PA 2ZKMX 5HLVA 2LNKA 3JTDC 2BNXA 3SS5A 3EKJA 4M2QA 3TZ1A 1UHJA 4I5LB 1OOJA 3LK0A 1SMGA 1Z2CB 3UO9A 2JZIA 2O60A 2LP2A 3AAJA 1Y1XA 3R1OA 4TNCA 4XJKB 2M8UA 2PRUA 2KYCA 4ORBB 2SCPA 5GQQC 1TCOB 1IWQA 2JTTA 2WCJA 4YGBB 5FYXA 2JU0A 2JULA 1YX7A 1CFFA 1Y1AA 4PCWA 1ALWA 4DUQA 3CR2A 4CIDA 1NUBA 1NP8A 1B8CA 3CZ1A 1MXEA 1NWDA 2MHHA 4HSZA 1XFVO 4IL1A 1KK8C 1OQPA 1TNXA 1WDCC 5HL1A 4KYNA 3R72A 1QIWA 2LMTA 1WRLA 1SKTA 1W7JB 1KSOA 5G08A 1CLBA 1CLMA 2SASA 4OR9B 1XK4A 4ZCUA 3TDZA 1JF2A 3NSIA 1S5GZ 1MF8B 2ERBA 2K61A 1LS8A 1GQMA 3TUYC 1WLZA 1KQMB 2CT9A 4DS7A 3PFVA 2MBXA 2LUCA 2E30A 2KDHA 2KFGA 4WQ2A 1TUZA 1J7RA 2K2AA 1SSEB 1S3PA 3LLEA 1OOFA 2I18A 4INWA 4JPZB 1CFCA 2KOTA 1SY9A 3BFBA 2WNDA 3SG7A 1FI6A 5AANA 5AFPA 1XFXO 1DT7B 1AJ5A 2LAPA 1IG5A 5DKQA 2JPTA 2WC6A 2Y4QA 1MXLC 2M9GA 3AKBA 3OP0A 1YRTB 1G4YR 3SG3A 2L2CA 5HLOA 1QVIY 1OZSA 2HPSA 3CR4X 3NSOA 1IIOA 1K8UA 1XO5A 1YVLA 2ZRSA 4BY4A 5I94A 1XFYO 2P6BB 3EVUA 5D3OA 1H8BA 2L5YA 3DF0A 3NGVA 1L2OB 2JNXA 2JRFA 3PSRA 5D69A 1BJFA 4PHKA 1UHIA 3D75A 4ICBA 1IQ5A 1L2OC 2KI4B 1OMVA 3NXAA 4I5KA 1CDNA 1RK9A 4GGFA 5HKYA 3I5FC 1AHRA 3SG4A 1U5IA 1ZMZA 1IJ5A 1DJWA 2H61C 2KI6D 2LVKA 2RGIA 3VROA 5KSZA 3PM2A 1A75B 2LE9B 3K1EA 1IKUA 3IVTA 2F2PA 3TS5B 5CSNA 3L4AA 3TDIA 1C7VA 1TIZA 4M2OA 1SL8A 2BL0C 1DTLA 1K90D 3TUYB 3Q8IA 1Y1UA 1YURA 3CABA 1G8IA 1F70A 3TDUA 1NYAA 1R6PA 2LLTA 3FE9A 1WRKA 3ZWHA 4QJ4B 1M31A 4UPGA 1IH0A 1F71A 1NSHA 1WLMA 3DVKA 1JF0A 4HREE 3PN7C 1YUSA 2KFHA 3CS1A 2PYQA 2KNEA 1WDCB 1C07A 1KK8B 3VRRA 3PJIA 4PDZA 5CSFA 4MZJA 1AJ4A 2MAZA 1XA5A 5TNCA 3RLZA 1RJVA 3R1VA 1RTP1 3SG2A 2H2KA 2BCAA 2MLFC 1KQVA 2EC6C 2LUXA 3GK4X 1UWOA 2K7CA 2A4JA 2AUCA 1SR6C 5CSJA 3BUXB 3D78A 1MUXA 2Y1MA 3B6XA 1ALVA 2OPOA 3A4UB 4Q04A 2Q91A 1XFZO 2WCMA 2Y1NA 3O2PA 2KGBC 5DICA 3EKHA 1F8HA 2L50A 1GM0A 1BR4B 1TNWA 1MHOA 2FCDA 3JVTB 4GGNA 4PE7A 5HYDA 3IF7A 3S0FA 3D10A 3SG6A 4PE0A 1TNPA 1ZUZA 3OGNA 4INXA 2LP3A 1IRJA 3GOFA 1U5IB 1FPWA 1WRZA 4ZCVA 4CFQA 5IBWA 3HX4A 1SW8A 1BT6A 4M2PA 2HQWA 2KYFA 2AAOA 2FJUB 4YI8A 3FIAA 2LV7A 3B7AA 4PE4A 3DYEA 4C0JA 1FW4A 2L51A 4FTGA 1X02A 1SL9A 2LM5A 2BBMA 1NCXA 1CM1A 4D1EA 3DF0B 3FE8A 4MVFA 4MZKA 1M63B 1LINA 2GGZA 4WRIA 1K2HA 1RROA 2KI6C 1CDPA 1Y6WA 5KU1A 1B1GA 2G2BA 3EK8A 3S0AA 2CTNA 1K94A 4OCIA 1J7OA 1KFUS 3BUNB 2Q4UA 4HRHA 1NCZA 3BYAA 3HCMA 1BF5A 3KPXA 3D0YB 2JOJA 3GK1A 2F8PA 2K8MB 1TN4A 2M1KB 2M7LA 2G9BA 1MQ1A 4XYNA 2O5GA 1RECA 1B7TY 2F3ZA 1ORGA 2I7AA 3D74A 4A4BA 1DF0B 2KQ6A 2OTGC 1CNPA 1SYMA 3I5HB 5F6TA 4R1EA 1KFXS 1F54A 1PVBA 1SBJA 4F0ZB 4MRYA 4CPVA 4YRUA 4MBEA 4N1GA 2QEVA 2P71A 2QEOA 1P28A 2OS8B 3BUWB 3CTNA 3LK1A 4OZDA 1SNLA 1S6IA 4NQGA 5FI2A 3OB2B 3I5GB 1BMOA 3SS3A 1DMOA 1SCMB 1QJTA 1M46A 2GTEA 4GBAA 5KTYA 1LKJA 1D1OA 3EVVA 4MEWA 1KK7Y 2V53A 2KHNA 1KWOC 3NSLA 1DJIA 4I5JA 4QJ5B 4YGEB 3BOWA 3I5GC 4NDBA 1TOPA 3A8RA 2ZN8A 1XFWO 4ORAB 1OZOA 1OE9B 4YGCB 3NHTA 3WHUB 4BY5A 1GJYA 2LLSA 1DJYA 1PULA 3WHTB 3V2LA 1S36A 2PSRA 2M0RA 1SCVA 3IQOA 4USLA 3D0YA 3LCPC 3BUMB 1J1EA 2I2RE 1K96A 3MSEB 1JBAA 1JSAA 1SPYA 1DGVA 1Z4HA 1CTRA 2P70A 2WCEA 3O6BA 1OOGA 2NLNA 2JC2A 4DRWA 1C7WA 1S26D 2KGRA 3SG5A 2COLB 2K7BA 3EK4A 3F45A 1OSAA 3FS7A 1QIVA 2NZ0A 4JD9A 2B1UA 1B4CA 1MWNA 2TN4A 1L7ZA 3K21A 2L4HA 1KFXL 4JQ0D 1RFJA 1YVHA 1B8RA 5AXIA 1YUUA 2JXCA 2M97A 4NDCA 2I94A 1MR8A 5CPVA 1SCMC 3DVJA 5FI6A 1LXFC 3O4XA 1DEKA 1T14A 4P5OE 2PALA 2Y5IA 2MLEC 1QX5B 2EHBA 2M49B 3BXKA 1PK0D 1F55A 1AVSA 5B8IB 2D8NA 3KHEA 3LL8B 3VRNA 1A2XA 3BOWB 1DC1A 1A4PA 2WCHA 3DZTA 1TNQA 4JKTA 1LA0A 3CZ2A 2LMUA 1QX7A 1F4QA 2BBNA 2LC5A 2VRGA 4ORCB 1C3ZA 1PSBA 4GPLB 1A03A 1YRUB 3OBVA 1DJGA 2H61A 3RZSA 5HKWA 2QACA 2WCFA 2F2OA 3FWBA 1S6CA 2ZNDA 2BE6A 1W7IB 1J55A 1TWOA 1AUIB 1Y0VH 2HQ8A 1QATA 4L9MA 4MRXA 4YGDB 2QEBA 3RM1A 4YI9A 1CLLA 4AOMA 1FF1A 2BCXA 2OS8C 2QDIA 1K93D 2JWWA 2E6WA 2KLDA 1CFPA 2F3YA 2LCPA 4NDDA 4GUKA 2BCBA 4PHJA 3CDNA 1C3YA 2K0JA 2JT8A 2EGDA 3SIAA 1NIWA 5DKNA 1UHKA 2ZN9A 2QPTA 1QXPA 2F33A 3I5FB 3IQQA 2OTGB 1TCFA 1TTXA 2M7NA 3D76A 4I5NB 5BPJA 1B7TZ 3EK7A 4AQIA 3PM8A 2LLUA 1FBVA 3AKAA 1V1GA 1B47A 4FQOA 4PE1A 4PHNA 2JTZA 3S0GA 4JWQA 1BR1B 3SS4A 1S6JA 5ER4X 4PT1A 2WORA 1IGVA 3S0BA 1BG1A 2NXQA 3H4SE 1JFKA 2K7OA 5AEQA 3C1VA 1GGWA 2FCEA 1BODA 1XK4C 2MJWB 3CYZA 2WC8A 1HT9A 4AQJA 1QLSA 1XYDA 3O78A 3OX6A 1QS7A 1CB1A 2L5XB 3I5HC 1Q80A 2R2IA 5I2OA 1XFRA 4YGAA 5JOLA 2KAXA 3QMEA 2BL0B 1K9KA 3CZ0A 1DJXA 1KK7Z 4E68A 2EC6B 3TS5C 1LA3A 3KEVA 2FJYA 3SJSA 3EVRA 1ZOTB 2JNFA 2L98A 1EXRA 3PLFB 1B9AA 1KSMA 1NCYA 3DVEA 1RWYA 2JT3A 1M45A 2PASA 2BE4A 1YR5A 2BKIB 1F4OA 4OKHA 1PALA 2BECA 2KBIA 2LVIA 1CMFA 1YTZC 3S0DA 2LHIA 1CMGA 1UP5A 3N7HA 1EH2A 2K60A 2PQLA 5I8NA 2MA2A 3FE6A 3R1PA 4DCKA 2WCLA 1QWVA 1J7PA 3D77A 1SL7A 2H8VA 3OB1B 3L4LA 2AMIA 3CWGA 2WOSA 4GGFC 4IJ7A 4PHMA 2JXLA 2HF5A 5K89A 2KQYA 1E8AA 4PALA 1YX8A 1K9UA 4MLWA 4GNKB 2KAVA 3CR5X 1SRAA 2M29A 1VRKA 1JUOA 2NCPA 2BAPA 2M1UA 3PN7B 1ZACA 1BU3A 1CDMA 2CCMA 2KSPA 2L2EA 3BQ3A 3DXLA 1AK8A 3PATA 1LVCD 1XVJA 2M3WA 5EL2A 1DQEA 3E3RA 3D73A 3CGAA 3JVTC 1KFUL 3NSKA 1DVIA 3FWCA 1OMDA 1B8LA 3EG5B 2CNPA 1S5GY 1UHNA 1SR6B 4GAOA 1A75A 2KLEA 1PSRA 1DJZA 4N5XA 5AERA 2LANA 1R2UA 1QX2A 3QRXA 5PALA 4CLNA 1J1DA 3CZTX 5CSIA 1DJHA 3WXAA 4C0LA 2LVJA 2DOQA 2HETA 3B87A 2KFFA 3BJHA 1DF0A 3BFHA 1QTXA 2QEHA 2MRDA 1KWOB 4N1FA 3CLNA 1JFJA 1ZFSA 2K7DA 2L4IA 2WCKA 1OMRA 4FQTA 2KBMA 1EJ3A 2K2FA 3OHMB 4U8DA 3VRPA 4YBHB 4HRGA 1OOIX 3KF9A 3GK2A 2GV5A 3VB1A 4F7FA 2JPOA 5JJGA 1QVIZ 5I2QA 5FI7A 2JQ6A 1NX2A 1BOCA 4MZLA 1QV0A 3JTDB 1TUJA 4WQ3A 1EG4A 3OX5A 3M0WA 3KO0A 5I2LA 3AAKA 1TRFA 3BFAA 2NCOA 1IJ6A 3ZNIA 4OV2A 3I5IB 1HQVA 1KQMC 2YGUA 1BLQA 1QLKA 2LHLA 5DKRA 1PVAA 1YUTA 2ZFDA 1FI5A 3UNWA 4OVNF 1OOHA 1PRWA 5J3XA 2FOTA 3VGOA 2KPHA 1UUSA 1SK6D 1NX1A 1IQ3A 2ZRTA 2CBLA 3PALA 2IS9A 2PMYA 2WCBA 1GGZA 1A29A 2CXJA 1UURA 2PVBA 3VRQA 3WNXB 1UHHA 1CM4A 1CFDA 1NX3A 2L0PA 1NPQA 3L47A
chains in the Genus database with same CATH topology
2JT0A 3BUOB 1WY9A 1K95A 1S1EA 5ER5A 4ETOA 1CDLA 2KI4C 4C0KA 2LMVA 3ICBA 1EL4A 2ISDA 1XFUO 1G33A 1N65A 1NX0A 2KAYA 2ZNEA 1N0YA 4QJ3B 1H4BA 1JWDA 1KCYA 1ODBA 1JC2A 2GGMA 4A4CA 1J7QA 1N2DA 4XJKA 2LVVA 3O4YA 1QV1A 5D7FA 2BKHB 1CKKA 3I5IC 4MSPA 1AP4A 3DVMA 4CFRA 5HKZA 3DD4A 4MN0A 1DGUA 1M39A 3SIBA 4GFTA 1QASA 4DIRA 1EG3A 1V1FA 4P2YB 1K9PA 2ZKMX 5HLVA 2LNKA 3JTDC 3EKJA 4M2QA 3TZ1A 1UHJA 4I5LB 1OOJA 3LK0A 1SMGA 2JZIA 2O60A 2LP2A 3AAJA 1Y1XA 4TNCA 4XJKB 2M8UA 2PRUA 2KYCA 4ORBB 2SCPA 5GQQC 1TCOB 1IWQA 2JTTA 5FYXA 4YGBB 2JU0A 2JULA 1YX7A 1CFFA 1Y1AA 4PCWA 1ALWA 4DUQA 3CR2A 4CIDA 1NUBA 1NP8A 1B8CA 1MXEA 1NWDA 2MHHA 4HSZA 1XFVO 4IL1A 1KK8C 1OQPA 1TNXA 1WDCC 1QIWA 2LMTA 1WRLA 1SKTA 1W7JB 1KSOA 5G08A 1CLBA 1CLMA 2SASA 4OR9B 1XK4A 4ZCUA 3TDZA 1JF2A 3NSIA 1S5GZ 1MF8B 2K61A 1GQMA 3TUYC 1WLZA 1KQMB 2CT9A 4DS7A 3PFVA 2MBXA 2LUCA 2E30A 2KDHA 2KFGA 4WQ2A 2K2AA 1J7RA 1S3PA 3LLEA 2I18A 4JPZB 1CFCA 2KOTA 1SY9A 1FI6A 2WNDA 3SG7A 5AANA 5AFPA 1XFXO 1DT7B 1AJ5A 2LAPA 1IG5A 5DKQA 2JPTA 2Y4QA 1MXLC 2M9GA 3AKBA 3OP0A 1YRTB 1G4YR 3SG3A 5HLOA 1QVIY 1OZSA 2HPSA 3CR4X 3NSOA 1K8UA 1XO5A 1YVLA 2ZRSA 4BY4A 1XFYO 2P6BB 3EVUA 1H8BA 3DF0A 1L2OB 2JNXA 2JRFA 3PSRA 5D69A 1BJFA 4PHKA 1UHIA 4ICBA 1IQ5A 1L2OC 2KI4B 1OMVA 3NXAA 4I5KA 1CDNA 1RK9A 4GGFA 5HKYA 3I5FC 1AHRA 3SG4A 1U5IA 1ZMZA 1IJ5A 1DJWA 2H61C 2KI6D 2LVKA 2RGIA 3VROA 5KSZA 1A75B 2LE9B 1IKUA 2F2PA 3TS5B 5CSNA 3TDIA 1C7VA 1TIZA 4M2OA 1SL8A 2BL0C 1DTLA 1K90D 3TUYB 1Y1UA 1YURA 1F70A 1G8IA 3TDUA 1NYAA 1R6PA 2LLTA 1WRKA 3ZWHA 4QJ4B 1M31A 4UPGA 1IH0A 1F71A 1NSHA 1WLMA 3DVKA 1JF0A 4HREE 3PN7C 1YUSA 2KFHA 3CS1A 2KNEA 1WDCB 1C07A 1KK8B 3VRRA 5CSFA 4PDZA 4MZJA 1AJ4A 2MAZA 1XA5A 5TNCA 3RLZA 1RJVA 1RTP1 3SG2A 2H2KA 2BCAA 2MLFC 1KQVA 2EC6C 2LUXA 3GK4X 1UWOA 2K7CA 2A4JA 2AUCA 1SR6C 5CSJA 3BUXB 1MUXA 2Y1MA 1ALVA 2OPOA 3A4UB 4Q04A 2Q91A 1XFZO 3O2PA 2Y1NA 2KGBC 1F8HA 3EKHA 2L50A 1BR4B 1TNWA 1MHOA 2FCDA 3JVTB 4GGNA 4PE7A 5HYDA 3IF7A 3D10A 3SG6A 4PE0A 1TNPA 1ZUZA 2LP3A 1IRJA 3GOFA 1U5IB 1FPWA 1WRZA 4ZCVA 4CFQA 5IBWA 3HX4A 1SW8A 1BT6A 4M2PA 2HQWA 2KYFA 2FJUB 2AAOA 4YI8A 3FIAA 2LV7A 4PE4A 4C0JA 1FW4A 2L51A 4FTGA 1X02A 1SL9A 2LM5A 1NCXA 2BBMA 1CM1A 4D1EA 3DF0B 4MVFA 4MZKA 1M63B 1LINA 2GGZA 4WRIA 1K2HA 1RROA 2KI6C 1CDPA 1Y6WA 5KU1A 1B1GA 2G2BA 3EK8A 2CTNA 1K94A 4OCIA 1J7OA 1KFUS 3BUNB 2Q4UA 4HRHA 1NCZA 3BYAA 3HCMA 1BF5A 3KPXA 3D0YB 2JOJA 3GK1A 2F8PA 2K8MB 1TN4A 2M1KB 2M7LA 2G9BA 1MQ1A 4XYNA 2O5GA 1RECA 1B7TY 2F3ZA 2I7AA 4A4BA 1DF0B 2KQ6A 2OTGC 1CNPA 1SYMA 3I5HB 5F6TA 4R1EA 1KFXS 1F54A 1PVBA 1SBJA 4F0ZB 4MRYA 4CPVA 4YRUA 4MBEA 4N1GA 2OS8B 3BUWB 3CTNA 3LK1A 1SNLA 1S6IA 4NQGA 3OB2B 3I5GB 1BMOA 1DMOA 1SCMB 1QJTA 1M46A 4GBAA 5KTYA 1LKJA 1D1OA 3EVVA 4MEWA 1KK7Y 2V53A 2KHNA 1KWOC 3NSLA 1DJIA 4I5JA 4QJ5B 4YGEB 3BOWA 3I5GC 4NDBA 1TOPA 3A8RA 2ZN8A 1XFWO 4ORAB 1OZOA 1OE9B 4YGCB 3WHUB 4BY5A 1GJYA 2LLSA 1DJYA 1PULA 3WHTB 1S36A 2PSRA 2M0RA 1SCVA 3IQOA 4USLA 3D0YA 3LCPC 3BUMB 1J1EA 2I2RE 1K96A 3MSEB 1JBAA 1JSAA 1SPYA 1DGVA 1CTRA 2WCEA 3O6BA 2NLNA 2JC2A 4DRWA 1C7WA 1S26D 2KGRA 3SG5A 2COLB 2K7BA 3EK4A 3F45A 1OSAA 3FS7A 1QIVA 2NZ0A 2B1UA 1B4CA 1MWNA 2TN4A 1L7ZA 3K21A 2L4HA 1KFXL 4JQ0D 1RFJA 1YVHA 1B8RA 5AXIA 1YUUA 2JXCA 2M97A 4NDCA 2I94A 1MR8A 5CPVA 1SCMC 3DVJA 1LXFC 4P5OE 2PALA 2Y5IA 2MLEC 1QX5B 2EHBA 2M49B 3BXKA 1PK0D 1F55A 1AVSA 5B8IB 2D8NA 3KHEA 3LL8B 3VRNA 1A2XA 3BOWB 1A4PA 1TNQA 1LA0A 2LMUA 1QX7A 1F4QA 2BBNA 2LC5A 2VRGA 4ORCB 1PSBA 4GPLB 1A03A 1YRUB 1DJGA 2H61A 5HKWA 2QACA 2WCFA 2F2OA 3FWBA 1S6CA 2ZNDA 2BE6A 1W7IB 1J55A 4L9MA 1AUIB 1Y0VH 2HQ8A 1QATA 4MRXA 4YGDB 3RM1A 4AOMA 1CFPA 4YI9A 1CLLA 1FF1A 2BCXA 2OS8C 1K93D 2JWWA 2E6WA 2F3YA 2LCPA 4NDDA 4GUKA 2BCBA 4PHJA 2K0JA 2JT8A 2EGDA 3SIAA 1NIWA 5DKNA 1UHKA 2ZN9A 2QPTA 1QXPA 2F33A 3I5FB 3IQQA 2OTGB 1TCFA 1TTXA 2M7NA 4I5NB 5BPJA 1B7TZ 3EK7A 4AQIA 3PM8A 2LLUA 1FBVA 3AKAA 1V1GA 1B47A 4FQOA 4PE1A 4PHNA 2JTZA 4JWQA 1BR1B 1S6JA 5ER4X 2WORA 1IGVA 1BG1A 2NXQA 3H4SE 1JFKA 2K7OA 5AEQA 3C1VA 1GGWA 2FCEA 1BODA 1XK4C 2MJWB 2WC8A 1HT9A 4AQJA 1QLSA 1XYDA 3O78A 3OX6A 1QS7A 1CB1A 2L5XB 3I5HC 1Q80A 2R2IA 5I2OA 4YGAA 5JOLA 2KAXA 2BL0B 1K9KA 1DJXA 1KK7Z 4E68A 2EC6B 3TS5C 1LA3A 3KEVA 3SJSA 3EVRA 1ZOTB 2JNFA 2L98A 1EXRA 3PLFB 1B9AA 1KSMA 1NCYA 3DVEA 1RWYA 2JT3A 1M45A 2PASA 2BE4A 1YR5A 2BKIB 1F4OA 4OKHA 1PALA 2BECA 2KBIA 2LVIA 1CMFA 1YTZC 1CMGA 2LHIA 1UP5A 1EH2A 5I8NA 2MA2A 4DCKA 1J7PA 1SL7A 3OB1B 2AMIA 3CWGA 2WOSA 4GGFC 4PHMA 5K89A 2JXLA 2HF5A 2KQYA 1E8AA 4PALA 1YX8A 1K9UA 4MLWA 4GNKB 2KAVA 3CR5X 1SRAA 2M29A 1VRKA 1JUOA 2NCPA 2M1UA 3PN7B 1ZACA 1BU3A 1CDMA 2CCMA 2KSPA 2L2EA 3BQ3A 1AK8A 3PATA 1LVCD 1XVJA 2M3WA 3E3RA 3CGAA 3JVTC 1KFUL 3NSKA 1DVIA 3FWCA 1OMDA 1B8LA 2CNPA 1S5GY 1UHNA 1SR6B 4GAOA 1A75A 1PSRA 1DJZA 4N5XA 5AERA 2LANA 1R2UA 1QX2A 3QRXA 5PALA 4CLNA 1J1DA 3CZTX 5CSIA 1DJHA 3WXAA 4C0LA 2LVJA 2HETA 2DOQA 2KFFA 1DF0A 1QTXA 2MRDA 1KWOB 4N1FA 3CLNA 1JFJA 1ZFSA 2K7DA 2L4IA 1OMRA 2KBMA 1EJ3A 2K2FA 3OHMB 4U8DA 3VRPA 4YBHB 4HRGA 3KF9A 3GK2A 2GV5A 5JJGA 1QVIZ 5I2QA 2JQ6A 1NX2A 1BOCA 4MZLA 1QV0A 3JTDB 4WQ3A 1EG4A 3OX5A 3M0WA 3KO0A 5I2LA 3AAKA 1TRFA 2NCOA 1IJ6A 3ZNIA 4OV2A 3I5IB 1HQVA 1KQMC 1BLQA 1QLKA 2LHLA 5DKRA 1PVAA 1YUTA 2ZFDA 1FI5A 4OVNF 1PRWA 5J3XA 2FOTA 3VGOA 1UUSA 1SK6D 1NX1A 1IQ3A 2ZRTA 2CBLA 3PALA 2IS9A 2PMYA 2WCBA 1GGZA 1A29A 2CXJA 1UURA 2PVBA 3VRQA 3WNXB 1UHHA 1CM4A 1CFDA 1NX3A 2L0PA 1NPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JT0 A;  3BUO B;  1WY9 A;  1K95 A;  1S1E A;  5ER5 A;  4ETO A;  1CDL A;  2KI4 C;  4C0K A;  2LMV A;  3ICB A;  1EL4 A;  2ISD A;  1XFU O;  1G33 A;  1N65 A;  1NX0 A;  2KAY A;  2ZNE A;  1N0Y A;  4QJ3 B;  1H4B A;  1JWD A;  1KCY A;  1ODB A;  1JC2 A;  2GGM A;  4A4C A;  1J7Q A;  1N2D A;  4XJK A;  2LVV A;  3O4Y A;  1QV1 A;  5D7F A;  2BKH B;  1CKK A;  3I5I C;  4MSP A;  1AP4 A;  3DVM A;  4CFR A;  5HKZ A;  3DD4 A;  4MN0 A;  1DGU A;  1M39 A;  3SIB A;  4GFT A;  1QAS A;  4DIR A;  1EG3 A;  1V1F A;  4P2Y B;  1K9P A;  2ZKM X;  5HLV A;  2LNK A;  3JTD C;  3EKJ A;  4M2Q A;  3TZ1 A;  1UHJ A;  4I5L B;  1OOJ A;  3LK0 A;  1SMG A;  2JZI A;  2O60 A;  2LP2 A;  3AAJ A;  1Y1X A;  4TNC A;  4XJK B;  2M8U A;  2PRU A;  2KYC A;  4ORB B;  2SCP A;  5GQQ C;  1TCO B;  1IWQ A;  2JTT A;  5FYX A;  4YGB B;  2JU0 A;  2JUL A;  1YX7 A;  1CFF A;  1Y1A A;  4PCW A;  1ALW A;  4DUQ A;  3CR2 A;  4CID A;  1NUB A;  1NP8 A;  1B8C A;  1MXE A;  1NWD A;  2MHH A;  4HSZ A;  1XFV O;  4IL1 A;  1KK8 C;  1OQP A;  1TNX A;  1WDC C;  1QIW A;  2LMT A;  1WRL A;  1SKT A;  1W7J B;  1KSO A;  5G08 A;  1CLB A;  1CLM A;  2SAS A;  4OR9 B;  1XK4 A;  4ZCU A;  3TDZ A;  1JF2 A;  3NSI A;  1S5G Z;  1MF8 B;  2K61 A;  1GQM A;  3TUY C;  1WLZ A;  1KQM B;  2CT9 A;  4DS7 A;  3PFV A;  2MBX A;  2LUC A;  2E30 A;  2KDH A;  2KFG A;  4WQ2 A;  2K2A A;  1J7R A;  1S3P A;  3LLE A;  2I18 A;  4JPZ B;  1CFC A;  2KOT A;  1SY9 A;  1FI6 A;  2WND A;  3SG7 A;  5AAN A;  5AFP A;  1XFX O;  1DT7 B;  1AJ5 A;  2LAP A;  1IG5 A;  5DKQ A;  2JPT A;  2Y4Q A;  1MXL C;  2M9G A;  3AKB A;  3OP0 A;  1YRT B;  1G4Y R;  3SG3 A;  5HLO A;  1QVI Y;  1OZS A;  2HPS A;  3CR4 X;  3NSO A;  1K8U A;  1XO5 A;  1YVL A;  2ZRS A;  4BY4 A;  1XFY O;  2P6B B;  3EVU A;  1H8B A;  3DF0 A;  1L2O B;  2JNX A;  2JRF A;  3PSR A;  5D69 A;  1BJF A;  4PHK A;  1UHI A;  4ICB A;  1IQ5 A;  1L2O C;  2KI4 B;  1OMV A;  3NXA A;  4I5K A;  1CDN A;  1RK9 A;  4GGF A;  5HKY A;  3I5F C;  1AHR A;  3SG4 A;  1U5I A;  1ZMZ A;  1IJ5 A;  1DJW A;  2H61 C;  2KI6 D;  2LVK A;  2RGI A;  3VRO A;  5KSZ A;  1A75 B;  2LE9 B;  1IKU A;  2F2P A;  3TS5 B;  5CSN A;  3TDI A;  1C7V A;  1TIZ A;  4M2O A;  1SL8 A;  2BL0 C;  1DTL A;  1K90 D;  3TUY B;  1Y1U A;  1YUR A;  1F70 A;  1G8I A;  3TDU A;  1NYA A;  1R6P A;  2LLT A;  1WRK A;  3ZWH A;  4QJ4 B;  1M31 A;  4UPG A;  1IH0 A;  1F71 A;  1NSH A;  1WLM A;  3DVK A;  1JF0 A;  4HRE E;  3PN7 C;  1YUS A;  2KFH A;  3CS1 A;  2KNE A;  1WDC B;  1C07 A;  1KK8 B;  3VRR A;  5CSF A;  4PDZ A;  4MZJ A;  1AJ4 A;  2MAZ A;  1XA5 A;  5TNC A;  3RLZ A;  1RJV A;  1RTP 1;  3SG2 A;  2H2K A;  2BCA A;  2MLF C;  1KQV A;  2EC6 C;  2LUX A;  3GK4 X;  1UWO A;  2K7C A;  2A4J A;  2AUC A;  1SR6 C;  5CSJ A;  3BUX B;  1MUX A;  2Y1M A;  1ALV A;  2OPO A;  3A4U B;  4Q04 A;  2Q91 A;  1XFZ O;  3O2P A;  2Y1N A;  2KGB C;  1F8H A;  3EKH A;  2L50 A;  1BR4 B;  1TNW A;  1MHO A;  2FCD A;  3JVT B;  4GGN A;  4PE7 A;  5HYD A;  3IF7 A;  3D10 A;  3SG6 A;  4PE0 A;  1TNP A;  1ZUZ A;  2LP3 A;  1IRJ A;  3GOF A;  1U5I B;  1FPW A;  1WRZ A;  4ZCV A;  4CFQ A;  5IBW A;  3HX4 A;  1SW8 A;  1BT6 A;  4M2P A;  2HQW A;  2KYF A;  2FJU B;  2AAO A;  4YI8 A;  3FIA A;  2LV7 A;  4PE4 A;  4C0J A;  1FW4 A;  2L51 A;  4FTG A;  1X02 A;  1SL9 A;  2LM5 A;  1NCX A;  2BBM A;  1CM1 A;  4D1E A;  3DF0 B;  4MVF A;  4MZK A;  1M63 B;  1LIN A;  2GGZ A;  4WRI A;  1K2H A;  1RRO A;  2KI6 C;  1CDP A;  1Y6W A;  5KU1 A;  1B1G A;  2G2B A;  3EK8 A;  2CTN A;  1K94 A;  4OCI A;  1J7O A;  1KFU S;  3BUN B;  2Q4U A;  4HRH A;  1NCZ A;  3BYA A;  3HCM A;  1BF5 A;  3KPX A;  3D0Y B;  2JOJ A;  3GK1 A;  2F8P A;  2K8M B;  1TN4 A;  2M1K B;  2M7L A;  2G9B A;  1MQ1 A;  4XYN A;  2O5G A;  1REC A;  1B7T Y;  2F3Z A;  2I7A A;  4A4B A;  1DF0 B;  2KQ6 A;  2OTG C;  1CNP A;  1SYM A;  3I5H B;  5F6T A;  4R1E A;  1KFX S;  1F54 A;  1PVB A;  1SBJ A;  4F0Z B;  4MRY A;  4CPV A;  4YRU A;  4MBE A;  4N1G A;  2OS8 B;  3BUW B;  3CTN A;  3LK1 A;  1SNL A;  1S6I A;  4NQG A;  3OB2 B;  3I5G B;  1BMO A;  1DMO A;  1SCM B;  1QJT A;  1M46 A;  4GBA A;  5KTY A;  1LKJ A;  1D1O A;  3EVV A;  4MEW A;  1KK7 Y;  2V53 A;  2KHN A;  1KWO C;  3NSL A;  1DJI A;  4I5J A;  4QJ5 B;  4YGE B;  3BOW A;  3I5G C;  4NDB A;  1TOP A;  3A8R A;  2ZN8 A;  1XFW O;  4ORA B;  1OZO A;  1OE9 B;  4YGC B;  3WHU B;  4BY5 A;  1GJY A;  2LLS A;  1DJY A;  1PUL A;  3WHT B;  1S36 A;  2PSR A;  2M0R A;  1SCV A;  3IQO A;  4USL A;  3D0Y A;  3LCP C;  3BUM B;  1J1E A;  2I2R E;  1K96 A;  3MSE B;  1JBA A;  1JSA A;  1SPY A;  1DGV A;  1CTR A;  2WCE A;  3O6B A;  2NLN A;  2JC2 A;  4DRW A;  1C7W A;  1S26 D;  2KGR A;  3SG5 A;  2COL B;  2K7B A;  3EK4 A;  3F45 A;  1OSA A;  3FS7 A;  1QIV A;  2NZ0 A;  2B1U A;  1B4C A;  1MWN A;  2TN4 A;  1L7Z A;  3K21 A;  2L4H A;  1KFX L;  4JQ0 D;  1RFJ A;  1YVH A;  1B8R A;  5AXI A;  1YUU A;  2JXC A;  2M97 A;  4NDC A;  2I94 A;  1MR8 A;  5CPV A;  1SCM C;  3DVJ A;  1LXF C;  4P5O E;  2PAL A;  2Y5I A;  2MLE C;  1QX5 B;  2EHB A;  2M49 B;  3BXK A;  1PK0 D;  1F55 A;  1AVS A;  5B8I B;  2D8N A;  3KHE A;  3LL8 B;  3VRN A;  1A2X A;  3BOW B;  1A4P A;  1TNQ A;  1LA0 A;  2LMU A;  1QX7 A;  1F4Q A;  2BBN A;  2LC5 A;  2VRG A;  4ORC B;  1PSB A;  4GPL B;  1A03 A;  1YRU B;  1DJG A;  2H61 A;  5HKW A;  2QAC A;  2WCF A;  2F2O A;  3FWB A;  1S6C A;  2ZND A;  2BE6 A;  1W7I B;  1J55 A;  4L9M A;  1AUI B;  1Y0V H;  2HQ8 A;  1QAT A;  4MRX A;  4YGD B;  3RM1 A;  4AOM A;  1CFP A;  4YI9 A;  1CLL A;  1FF1 A;  2BCX A;  2OS8 C;  1K93 D;  2JWW A;  2E6W A;  2F3Y A;  2LCP A;  4NDD A;  4GUK A;  2BCB A;  4PHJ A;  2K0J A;  2JT8 A;  2EGD A;  3SIA A;  1NIW A;  5DKN A;  1UHK A;  2ZN9 A;  2QPT A;  1QXP A;  2F33 A;  3I5F B;  3IQQ A;  2OTG B;  1TCF A;  1TTX A;  2M7N A;  4I5N B;  5BPJ A;  1B7T Z;  3EK7 A;  4AQI A;  3PM8 A;  2LLU A;  1FBV A;  3AKA A;  1V1G A;  1B47 A;  4FQO A;  4PE1 A;  4PHN A;  2JTZ A;  4JWQ A;  1BR1 B;  1S6J A;  5ER4 X;  2WOR A;  1IGV A;  1BG1 A;  2NXQ A;  3H4S E;  1JFK A;  2K7O A;  5AEQ A;  3C1V A;  1GGW A;  2FCE A;  1BOD A;  1XK4 C;  2MJW B;  2WC8 A;  1HT9 A;  4AQJ A;  1QLS A;  1XYD A;  3O78 A;  3OX6 A;  1QS7 A;  1CB1 A;  2L5X B;  3I5H C;  1Q80 A;  2R2I A;  5I2O A;  4YGA A;  5JOL A;  2KAX A;  2BL0 B;  1K9K A;  1DJX A;  1KK7 Z;  4E68 A;  2EC6 B;  3TS5 C;  1LA3 A;  3KEV A;  3SJS A;  3EVR A;  1ZOT B;  2JNF A;  2L98 A;  1EXR A;  3PLF B;  1B9A A;  1KSM A;  1NCY A;  3DVE A;  1RWY A;  2JT3 A;  1M45 A;  2PAS A;  2BE4 A;  1YR5 A;  2BKI B;  1F4O A;  4OKH A;  1PAL A;  2BEC A;  2KBI A;  2LVI A;  1CMF A;  1YTZ C;  1CMG A;  2LHI A;  1UP5 A;  1EH2 A;  5I8N A;  2MA2 A;  4DCK A;  1J7P A;  1SL7 A;  3OB1 B;  2AMI A;  3CWG A;  2WOS A;  4GGF C;  4PHM A;  5K89 A;  2JXL A;  2HF5 A;  2KQY A;  1E8A A;  4PAL A;  1YX8 A;  1K9U A;  4MLW A;  4GNK B;  2KAV A;  3CR5 X;  1SRA A;  2M29 A;  1VRK A;  1JUO A;  2NCP A;  2M1U A;  3PN7 B;  1ZAC A;  1BU3 A;  1CDM A;  2CCM A;  2KSP A;  2L2E A;  3BQ3 A;  1AK8 A;  3PAT A;  1LVC D;  1XVJ A;  2M3W A;  3E3R A;  3CGA A;  3JVT C;  1KFU L;  3NSK A;  1DVI A;  3FWC A;  1OMD A;  1B8L A;  2CNP A;  1S5G Y;  1UHN A;  1SR6 B;  4GAO A;  1A75 A;  1PSR A;  1DJZ A;  4N5X A;  5AER A;  2LAN A;  1R2U A;  1QX2 A;  3QRX A;  5PAL A;  4CLN A;  1J1D A;  3CZT X;  5CSI A;  1DJH A;  3WXA A;  4C0L A;  2LVJ A;  2HET A;  2DOQ A;  2KFF A;  1DF0 A;  1QTX A;  2MRD A;  1KWO B;  4N1F A;  3CLN A;  1JFJ A;  1ZFS A;  2K7D A;  2L4I A;  1OMR A;  2KBM A;  1EJ3 A;  2K2F A;  3OHM B;  4U8D A;  3VRP A;  4YBH B;  4HRG A;  3KF9 A;  3GK2 A;  2GV5 A;  5JJG A;  1QVI Z;  5I2Q A;  2JQ6 A;  1NX2 A;  1BOC A;  4MZL A;  1QV0 A;  3JTD B;  4WQ3 A;  1EG4 A;  3OX5 A;  3M0W A;  3KO0 A;  5I2L A;  3AAK A;  1TRF A;  2NCO A;  1IJ6 A;  3ZNI A;  4OV2 A;  3I5I B;  1HQV A;  1KQM C;  1BLQ A;  1QLK A;  2LHL A;  5DKR A;  1PVA A;  1YUT A;  2ZFD A;  1FI5 A;  4OVN F;  1PRW A;  5J3X A;  2FOT A;  3VGO A;  1UUS A;  1SK6 D;  1NX1 A;  1IQ3 A;  2ZRT A;  2CBL A;  3PAL A;  2IS9 A;  2PMY A;  2WCB A;  1GGZ A;  1A29 A;  2CXJ A;  1UUR A;  2PVB A;  3VRQ A;  3WNX B;  1UHH A;  1CM4 A;  1CFD A;  1NX3 A;  2L0P A;  1NPQ A; 
#chains in the Genus database with same CATH topology
 1DEL A;  2JT0 A;  3DY9 A;  3S0E A;  3BUO B;  1OW4 A;  1WY9 A;  1K95 A;  1S1E A;  5ER5 A;  4ETO A;  1CDL A;  2KI4 C;  4C0K A;  2LMV A;  3ICB A;  1EL4 A;  2ISD A;  1XFU O;  1G33 A;  1N65 A;  1NX0 A;  2KAY A;  2ZNE A;  1N0Y A;  4QJ3 B;  1W9Z A;  1H4B A;  1JWD A;  1ODB A;  1KCY A;  1JC2 A;  2GGM A;  4A4C A;  1J7Q A;  1N2D A;  4XJK A;  2LVV A;  3O4Y A;  1QV1 A;  5D7F A;  2BKH B;  1CKK A;  2WC5 A;  3B88 A;  3B86 A;  3I5I C;  4MSP A;  3DVM A;  4CFR A;  1AP4 A;  5HKZ A;  3DD4 A;  4MN0 A;  1DGU A;  1M39 A;  3SIB A;  4GFT A;  1QAS A;  3NHI A;  4DIR A;  1EG3 A;  1V1F A;  4P2Y B;  1K9P A;  2ZKM X;  5HLV A;  2LNK A;  3JTD C;  2BNX A;  3SS5 A;  3EKJ A;  4M2Q A;  3TZ1 A;  1UHJ A;  4I5L B;  1OOJ A;  3LK0 A;  1SMG A;  1Z2C B;  3UO9 A;  2JZI A;  2O60 A;  2LP2 A;  3AAJ A;  1Y1X A;  3R1O A;  4TNC A;  4XJK B;  2M8U A;  2PRU A;  2KYC A;  4ORB B;  2SCP A;  5GQQ C;  1TCO B;  1IWQ A;  2JTT A;  2WCJ A;  4YGB B;  5FYX A;  2JU0 A;  2JUL A;  1YX7 A;  1CFF A;  1Y1A A;  4PCW A;  1ALW A;  4DUQ A;  3CR2 A;  4CID A;  1NUB A;  1NP8 A;  1B8C A;  3CZ1 A;  1MXE A;  1NWD A;  2MHH A;  4HSZ A;  1XFV O;  4IL1 A;  1KK8 C;  1OQP A;  1TNX A;  1WDC C;  5HL1 A;  4KYN A;  3R72 A;  1QIW A;  2LMT A;  1WRL A;  1SKT A;  1W7J B;  1KSO A;  5G08 A;  1CLB A;  1CLM A;  2SAS A;  4OR9 B;  1XK4 A;  4ZCU A;  3TDZ A;  1JF2 A;  3NSI A;  1S5G Z;  1MF8 B;  2ERB A;  2K61 A;  1LS8 A;  1GQM A;  3TUY C;  1WLZ A;  1KQM B;  2CT9 A;  4DS7 A;  3PFV A;  2MBX A;  2LUC A;  2E30 A;  2KDH A;  2KFG A;  4WQ2 A;  1TUZ A;  1J7R A;  2K2A A;  1SSE B;  1S3P A;  3LLE A;  1OOF A;  2I18 A;  4INW A;  4JPZ B;  1CFC A;  2KOT A;  1SY9 A;  3BFB A;  2WND A;  3SG7 A;  1FI6 A;  5AAN A;  5AFP A;  1XFX O;  1DT7 B;  1AJ5 A;  2LAP A;  1IG5 A;  5DKQ A;  2JPT A;  2WC6 A;  2Y4Q A;  1MXL C;  2M9G A;  3AKB A;  3OP0 A;  1YRT B;  1G4Y R;  3SG3 A;  2L2C A;  5HLO A;  1QVI Y;  1OZS A;  2HPS A;  3CR4 X;  3NSO A;  1IIO A;  1K8U A;  1XO5 A;  1YVL A;  2ZRS A;  4BY4 A;  5I94 A;  1XFY O;  2P6B B;  3EVU A;  5D3O A;  1H8B A;  2L5Y A;  3DF0 A;  3NGV A;  1L2O B;  2JNX A;  2JRF A;  3PSR A;  5D69 A;  1BJF A;  4PHK A;  1UHI A;  3D75 A;  4ICB A;  1IQ5 A;  1L2O C;  2KI4 B;  1OMV A;  3NXA A;  4I5K A;  1CDN A;  1RK9 A;  4GGF A;  5HKY A;  3I5F C;  1AHR A;  3SG4 A;  1U5I A;  1ZMZ A;  1IJ5 A;  1DJW A;  2H61 C;  2KI6 D;  2LVK A;  2RGI A;  3VRO A;  5KSZ A;  3PM2 A;  1A75 B;  2LE9 B;  3K1E A;  1IKU A;  3IVT A;  2F2P A;  3TS5 B;  5CSN A;  3L4A A;  3TDI A;  1C7V A;  1TIZ A;  4M2O A;  1SL8 A;  2BL0 C;  1DTL A;  1K90 D;  3TUY B;  3Q8I A;  1Y1U A;  1YUR A;  3CAB A;  1G8I A;  1F70 A;  3TDU A;  1NYA A;  1R6P A;  2LLT A;  3FE9 A;  1WRK A;  3ZWH A;  4QJ4 B;  1M31 A;  4UPG A;  1IH0 A;  1F71 A;  1NSH A;  1WLM A;  3DVK A;  1JF0 A;  4HRE E;  3PN7 C;  1YUS A;  2KFH A;  3CS1 A;  2PYQ A;  2KNE A;  1WDC B;  1C07 A;  1KK8 B;  3VRR A;  3PJI A;  4PDZ A;  5CSF A;  4MZJ A;  1AJ4 A;  2MAZ A;  1XA5 A;  5TNC A;  3RLZ A;  1RJV A;  3R1V A;  1RTP 1;  3SG2 A;  2H2K A;  2BCA A;  2MLF C;  1KQV A;  2EC6 C;  2LUX A;  3GK4 X;  1UWO A;  2K7C A;  2A4J A;  2AUC A;  1SR6 C;  5CSJ A;  3BUX B;  3D78 A;  1MUX A;  2Y1M A;  3B6X A;  1ALV A;  2OPO A;  3A4U B;  4Q04 A;  2Q91 A;  1XFZ O;  2WCM A;  2Y1N A;  3O2P A;  2KGB C;  5DIC A;  3EKH A;  1F8H A;  2L50 A;  1GM0 A;  1BR4 B;  1TNW A;  1MHO A;  2FCD A;  3JVT B;  4GGN A;  4PE7 A;  5HYD A;  3IF7 A;  3S0F A;  3D10 A;  3SG6 A;  4PE0 A;  1TNP A;  1ZUZ A;  3OGN A;  4INX A;  2LP3 A;  1IRJ A;  3GOF A;  1U5I B;  1FPW A;  1WRZ A;  4ZCV A;  4CFQ A;  5IBW A;  3HX4 A;  1SW8 A;  1BT6 A;  4M2P A;  2HQW A;  2KYF A;  2AAO A;  2FJU B;  4YI8 A;  3FIA A;  2LV7 A;  3B7A A;  4PE4 A;  3DYE A;  4C0J A;  1FW4 A;  2L51 A;  4FTG A;  1X02 A;  1SL9 A;  2LM5 A;  2BBM A;  1NCX A;  1CM1 A;  4D1E A;  3DF0 B;  3FE8 A;  4MVF A;  4MZK A;  1M63 B;  1LIN A;  2GGZ A;  4WRI A;  1K2H A;  1RRO A;  2KI6 C;  1CDP A;  1Y6W A;  5KU1 A;  1B1G A;  2G2B A;  3EK8 A;  3S0A A;  2CTN A;  1K94 A;  4OCI A;  1J7O A;  1KFU S;  3BUN B;  2Q4U A;  4HRH A;  1NCZ A;  3BYA A;  3HCM A;  1BF5 A;  3KPX A;  3D0Y B;  2JOJ A;  3GK1 A;  2F8P A;  2K8M B;  1TN4 A;  2M1K B;  2M7L A;  2G9B A;  1MQ1 A;  4XYN A;  2O5G A;  1REC A;  1B7T Y;  2F3Z A;  1ORG A;  2I7A A;  3D74 A;  4A4B A;  1DF0 B;  2KQ6 A;  2OTG C;  1CNP A;  1SYM A;  3I5H B;  5F6T A;  4R1E A;  1KFX S;  1F54 A;  1PVB A;  1SBJ A;  4F0Z B;  4MRY A;  4CPV A;  4YRU A;  4MBE A;  4N1G A;  2QEV A;  2P71 A;  2QEO A;  1P28 A;  2OS8 B;  3BUW B;  3CTN A;  3LK1 A;  4OZD A;  1SNL A;  1S6I A;  4NQG A;  5FI2 A;  3OB2 B;  3I5G B;  1BMO A;  3SS3 A;  1DMO A;  1SCM B;  1QJT A;  1M46 A;  2GTE A;  4GBA A;  5KTY A;  1LKJ A;  1D1O A;  3EVV A;  4MEW A;  1KK7 Y;  2V53 A;  2KHN A;  1KWO C;  3NSL A;  1DJI A;  4I5J A;  4QJ5 B;  4YGE B;  3BOW A;  3I5G C;  4NDB A;  1TOP A;  3A8R A;  2ZN8 A;  1XFW O;  4ORA B;  1OZO A;  1OE9 B;  4YGC B;  3NHT A;  3WHU B;  4BY5 A;  1GJY A;  2LLS A;  1DJY A;  1PUL A;  3WHT B;  3V2L A;  1S36 A;  2PSR A;  2M0R A;  1SCV A;  3IQO A;  4USL A;  3D0Y A;  3LCP C;  3BUM B;  1J1E A;  2I2R E;  1K96 A;  3MSE B;  1JBA A;  1JSA A;  1SPY A;  1DGV A;  1Z4H A;  1CTR A;  2P70 A;  2WCE A;  3O6B A;  1OOG A;  2NLN A;  2JC2 A;  4DRW A;  1C7W A;  1S26 D;  2KGR A;  3SG5 A;  2COL B;  2K7B A;  3EK4 A;  3F45 A;  1OSA A;  3FS7 A;  1QIV A;  2NZ0 A;  4JD9 A;  2B1U A;  1B4C A;  1MWN A;  2TN4 A;  1L7Z A;  3K21 A;  2L4H A;  1KFX L;  4JQ0 D;  1RFJ A;  1YVH A;  1B8R A;  5AXI A;  1YUU A;  2JXC A;  2M97 A;  4NDC A;  2I94 A;  1MR8 A;  5CPV A;  1SCM C;  3DVJ A;  5FI6 A;  1LXF C;  3O4X A;  1DEK A;  1T14 A;  4P5O E;  2PAL A;  2Y5I A;  2MLE C;  1QX5 B;  2EHB A;  2M49 B;  3BXK A;  1PK0 D;  1F55 A;  1AVS A;  5B8I B;  2D8N A;  3KHE A;  3LL8 B;  3VRN A;  1A2X A;  3BOW B;  1DC1 A;  1A4P A;  2WCH A;  3DZT A;  1TNQ A;  4JKT A;  1LA0 A;  3CZ2 A;  2LMU A;  1QX7 A;  1F4Q A;  2BBN A;  2LC5 A;  2VRG A;  4ORC B;  1C3Z A;  1PSB A;  4GPL B;  1A03 A;  1YRU B;  3OBV A;  1DJG A;  2H61 A;  3RZS A;  5HKW A;  2QAC A;  2WCF A;  2F2O A;  3FWB A;  1S6C A;  2ZND A;  2BE6 A;  1W7I B;  1J55 A;  1TWO A;  1AUI B;  1Y0V H;  2HQ8 A;  1QAT A;  4L9M A;  4MRX A;  4YGD B;  2QEB A;  3RM1 A;  4YI9 A;  1CLL A;  4AOM A;  1FF1 A;  2BCX A;  2OS8 C;  2QDI A;  1K93 D;  2JWW A;  2E6W A;  2KLD A;  1CFP A;  2F3Y A;  2LCP A;  4NDD A;  4GUK A;  2BCB A;  4PHJ A;  3CDN A;  1C3Y A;  2K0J A;  2JT8 A;  2EGD A;  3SIA A;  1NIW A;  5DKN A;  1UHK A;  2ZN9 A;  2QPT A;  1QXP A;  2F33 A;  3I5F B;  3IQQ A;  2OTG B;  1TCF A;  1TTX A;  2M7N A;  3D76 A;  4I5N B;  5BPJ A;  1B7T Z;  3EK7 A;  4AQI A;  3PM8 A;  2LLU A;  1FBV A;  3AKA A;  1V1G A;  1B47 A;  4FQO A;  4PE1 A;  4PHN A;  2JTZ A;  3S0G A;  4JWQ A;  1BR1 B;  3SS4 A;  1S6J A;  5ER4 X;  4PT1 A;  2WOR A;  1IGV A;  3S0B A;  1BG1 A;  2NXQ A;  3H4S E;  1JFK A;  2K7O A;  5AEQ A;  3C1V A;  1GGW A;  2FCE A;  1BOD A;  1XK4 C;  2MJW B;  3CYZ A;  2WC8 A;  1HT9 A;  4AQJ A;  1QLS A;  1XYD A;  3O78 A;  3OX6 A;  1QS7 A;  1CB1 A;  2L5X B;  3I5H C;  1Q80 A;  2R2I A;  5I2O A;  1XFR A;  4YGA A;  5JOL A;  2KAX A;  3QME A;  2BL0 B;  1K9K A;  3CZ0 A;  1DJX A;  1KK7 Z;  4E68 A;  2EC6 B;  3TS5 C;  1LA3 A;  3KEV A;  2FJY A;  3SJS A;  3EVR A;  1ZOT B;  2JNF A;  2L98 A;  1EXR A;  3PLF B;  1B9A A;  1KSM A;  1NCY A;  3DVE A;  1RWY A;  2JT3 A;  1M45 A;  2PAS A;  2BE4 A;  1YR5 A;  2BKI B;  1F4O A;  4OKH A;  1PAL A;  2BEC A;  2KBI A;  2LVI A;  1CMF A;  1YTZ C;  3S0D A;  2LHI A;  1CMG A;  1UP5 A;  3N7H A;  1EH2 A;  2K60 A;  2PQL A;  5I8N A;  2MA2 A;  3FE6 A;  3R1P A;  4DCK A;  2WCL A;  1QWV A;  1J7P A;  3D77 A;  1SL7 A;  2H8V A;  3OB1 B;  3L4L A;  2AMI A;  3CWG A;  2WOS A;  4GGF C;  4IJ7 A;  4PHM A;  2JXL A;  2HF5 A;  5K89 A;  2KQY A;  1E8A A;  4PAL A;  1YX8 A;  1K9U A;  4MLW A;  4GNK B;  2KAV A;  3CR5 X;  1SRA A;  2M29 A;  1VRK A;  1JUO A;  2NCP A;  2BAP A;  2M1U A;  3PN7 B;  1ZAC A;  1BU3 A;  1CDM A;  2CCM A;  2KSP A;  2L2E A;  3BQ3 A;  3DXL A;  1AK8 A;  3PAT A;  1LVC D;  1XVJ A;  2M3W A;  5EL2 A;  1DQE A;  3E3R A;  3D73 A;  3CGA A;  3JVT C;  1KFU L;  3NSK A;  1DVI A;  3FWC A;  1OMD A;  1B8L A;  3EG5 B;  2CNP A;  1S5G Y;  1UHN A;  1SR6 B;  4GAO A;  1A75 A;  2KLE A;  1PSR A;  1DJZ A;  4N5X A;  5AER A;  2LAN A;  1R2U A;  1QX2 A;  3QRX A;  5PAL A;  4CLN A;  1J1D A;  3CZT X;  5CSI A;  1DJH A;  3WXA A;  4C0L A;  2LVJ A;  2DOQ A;  2HET A;  3B87 A;  2KFF A;  3BJH A;  1DF0 A;  3BFH A;  1QTX A;  2QEH A;  2MRD A;  1KWO B;  4N1F A;  3CLN A;  1JFJ A;  1ZFS A;  2K7D A;  2L4I A;  2WCK A;  1OMR A;  4FQT A;  2KBM A;  1EJ3 A;  2K2F A;  3OHM B;  4U8D A;  3VRP A;  4YBH B;  4HRG A;  1OOI X;  3KF9 A;  3GK2 A;  2GV5 A;  3VB1 A;  4F7F A;  2JPO A;  5JJG A;  1QVI Z;  5I2Q A;  5FI7 A;  2JQ6 A;  1NX2 A;  1BOC A;  4MZL A;  1QV0 A;  3JTD B;  1TUJ A;  4WQ3 A;  1EG4 A;  3OX5 A;  3M0W A;  3KO0 A;  5I2L A;  3AAK A;  1TRF A;  3BFA A;  2NCO A;  1IJ6 A;  3ZNI A;  4OV2 A;  3I5I B;  1HQV A;  1KQM C;  2YGU A;  1BLQ A;  1QLK A;  2LHL A;  5DKR A;  1PVA A;  1YUT A;  2ZFD A;  1FI5 A;  3UNW A;  4OVN F;  1OOH A;  1PRW A;  5J3X A;  2FOT A;  3VGO A;  2KPH A;  1UUS A;  1SK6 D;  1NX1 A;  1IQ3 A;  2ZRT A;  2CBL A;  3PAL A;  2IS9 A;  2PMY A;  2WCB A;  1GGZ A;  1A29 A;  2CXJ A;  1UUR A;  2PVB A;  3VRQ A;  3WNX B;  1UHH A;  1CM4 A;  1CFD A;  1NX3 A;  2L0P A;  1NPQ A;  3L47 A; 
#chains in the Genus database with same CATH homology
 2JT0 A;  3BUO B;  1WY9 A;  1K95 A;  1S1E A;  5ER5 A;  4ETO A;  1CDL A;  2KI4 C;  4C0K A;  2LMV A;  3ICB A;  1EL4 A;  2ISD A;  1XFU O;  1G33 A;  1N65 A;  1NX0 A;  2KAY A;  2ZNE A;  1N0Y A;  4QJ3 B;  1H4B A;  1JWD A;  1KCY A;  1ODB A;  1JC2 A;  2GGM A;  4A4C A;  1J7Q A;  1N2D A;  4XJK A;  2LVV A;  3O4Y A;  1QV1 A;  5D7F A;  2BKH B;  1CKK A;  3I5I C;  4MSP A;  1AP4 A;  3DVM A;  4CFR A;  5HKZ A;  3DD4 A;  4MN0 A;  1DGU A;  1M39 A;  3SIB A;  4GFT A;  1QAS A;  4DIR A;  1EG3 A;  1V1F A;  4P2Y B;  1K9P A;  2ZKM X;  5HLV A;  2LNK A;  3JTD C;  3EKJ A;  4M2Q A;  3TZ1 A;  1UHJ A;  4I5L B;  1OOJ A;  3LK0 A;  1SMG A;  2JZI A;  2O60 A;  2LP2 A;  3AAJ A;  1Y1X A;  4TNC A;  4XJK B;  2M8U A;  2PRU A;  2KYC A;  4ORB B;  2SCP A;  5GQQ C;  1TCO B;  1IWQ A;  2JTT A;  5FYX A;  4YGB B;  2JU0 A;  2JUL A;  1YX7 A;  1CFF A;  1Y1A A;  4PCW A;  1ALW A;  4DUQ A;  3CR2 A;  4CID A;  1NUB A;  1NP8 A;  1B8C A;  1MXE A;  1NWD A;  2MHH A;  4HSZ A;  1XFV O;  4IL1 A;  1KK8 C;  1OQP A;  1TNX A;  1WDC C;  1QIW A;  2LMT A;  1WRL A;  1SKT A;  1W7J B;  1KSO A;  5G08 A;  1CLB A;  1CLM A;  2SAS A;  4OR9 B;  1XK4 A;  4ZCU A;  3TDZ A;  1JF2 A;  3NSI A;  1S5G Z;  1MF8 B;  2K61 A;  1GQM A;  3TUY C;  1WLZ A;  1KQM B;  2CT9 A;  4DS7 A;  3PFV A;  2MBX A;  2LUC A;  2E30 A;  2KDH A;  2KFG A;  4WQ2 A;  2K2A A;  1J7R A;  1S3P A;  3LLE A;  2I18 A;  4JPZ B;  1CFC A;  2KOT A;  1SY9 A;  1FI6 A;  2WND A;  3SG7 A;  5AAN A;  5AFP A;  1XFX O;  1DT7 B;  1AJ5 A;  2LAP A;  1IG5 A;  5DKQ A;  2JPT A;  2Y4Q A;  1MXL C;  2M9G A;  3AKB A;  3OP0 A;  1YRT B;  1G4Y R;  3SG3 A;  5HLO A;  1QVI Y;  1OZS A;  2HPS A;  3CR4 X;  3NSO A;  1K8U A;  1XO5 A;  1YVL A;  2ZRS A;  4BY4 A;  1XFY O;  2P6B B;  3EVU A;  1H8B A;  3DF0 A;  1L2O B;  2JNX A;  2JRF A;  3PSR A;  5D69 A;  1BJF A;  4PHK A;  1UHI A;  4ICB A;  1IQ5 A;  1L2O C;  2KI4 B;  1OMV A;  3NXA A;  4I5K A;  1CDN A;  1RK9 A;  4GGF A;  5HKY A;  3I5F C;  1AHR A;  3SG4 A;  1U5I A;  1ZMZ A;  1IJ5 A;  1DJW A;  2H61 C;  2KI6 D;  2LVK A;  2RGI A;  3VRO A;  5KSZ A;  1A75 B;  2LE9 B;  1IKU A;  2F2P A;  3TS5 B;  5CSN A;  3TDI A;  1C7V A;  1TIZ A;  4M2O A;  1SL8 A;  2BL0 C;  1DTL A;  1K90 D;  3TUY B;  1Y1U A;  1YUR A;  1F70 A;  1G8I A;  3TDU A;  1NYA A;  1R6P A;  2LLT A;  1WRK A;  3ZWH A;  4QJ4 B;  1M31 A;  4UPG A;  1IH0 A;  1F71 A;  1NSH A;  1WLM A;  3DVK A;  1JF0 A;  4HRE E;  3PN7 C;  1YUS A;  2KFH A;  3CS1 A;  2KNE A;  1WDC B;  1C07 A;  1KK8 B;  3VRR A;  5CSF A;  4PDZ A;  4MZJ A;  1AJ4 A;  2MAZ A;  1XA5 A;  5TNC A;  3RLZ A;  1RJV A;  1RTP 1;  3SG2 A;  2H2K A;  2BCA A;  2MLF C;  1KQV A;  2EC6 C;  2LUX A;  3GK4 X;  1UWO A;  2K7C A;  2A4J A;  2AUC A;  1SR6 C;  5CSJ A;  3BUX B;  1MUX A;  2Y1M A;  1ALV A;  2OPO A;  3A4U B;  4Q04 A;  2Q91 A;  1XFZ O;  3O2P A;  2Y1N A;  2KGB C;  1F8H A;  3EKH A;  2L50 A;  1BR4 B;  1TNW A;  1MHO A;  2FCD A;  3JVT B;  4GGN A;  4PE7 A;  5HYD A;  3IF7 A;  3D10 A;  3SG6 A;  4PE0 A;  1TNP A;  1ZUZ A;  2LP3 A;  1IRJ A;  3GOF A;  1U5I B;  1FPW A;  1WRZ A;  4ZCV A;  4CFQ A;  5IBW A;  3HX4 A;  1SW8 A;  1BT6 A;  4M2P A;  2HQW A;  2KYF A;  2FJU B;  2AAO A;  4YI8 A;  3FIA A;  2LV7 A;  4PE4 A;  4C0J A;  1FW4 A;  2L51 A;  4FTG A;  1X02 A;  1SL9 A;  2LM5 A;  1NCX A;  2BBM A;  1CM1 A;  4D1E A;  3DF0 B;  4MVF A;  4MZK A;  1M63 B;  1LIN A;  2GGZ A;  4WRI A;  1K2H A;  1RRO A;  2KI6 C;  1CDP A;  1Y6W A;  5KU1 A;  1B1G A;  2G2B A;  3EK8 A;  2CTN A;  1K94 A;  4OCI A;  1J7O A;  1KFU S;  3BUN B;  2Q4U A;  4HRH A;  1NCZ A;  3BYA A;  3HCM A;  1BF5 A;  3KPX A;  3D0Y B;  2JOJ A;  3GK1 A;  2F8P A;  2K8M B;  1TN4 A;  2M1K B;  2M7L A;  2G9B A;  1MQ1 A;  4XYN A;  2O5G A;  1REC A;  1B7T Y;  2F3Z A;  2I7A A;  4A4B A;  1DF0 B;  2KQ6 A;  2OTG C;  1CNP A;  1SYM A;  3I5H B;  5F6T A;  4R1E A;  1KFX S;  1F54 A;  1PVB A;  1SBJ A;  4F0Z B;  4MRY A;  4CPV A;  4YRU A;  4MBE A;  4N1G A;  2OS8 B;  3BUW B;  3CTN A;  3LK1 A;  1SNL A;  1S6I A;  4NQG A;  3OB2 B;  3I5G B;  1BMO A;  1DMO A;  1SCM B;  1QJT A;  1M46 A;  4GBA A;  5KTY A;  1LKJ A;  1D1O A;  3EVV A;  4MEW A;  1KK7 Y;  2V53 A;  2KHN A;  1KWO C;  3NSL A;  1DJI A;  4I5J A;  4QJ5 B;  4YGE B;  3BOW A;  3I5G C;  4NDB A;  1TOP A;  3A8R A;  2ZN8 A;  1XFW O;  4ORA B;  1OZO A;  1OE9 B;  4YGC B;  3WHU B;  4BY5 A;  1GJY A;  2LLS A;  1DJY A;  1PUL A;  3WHT B;  1S36 A;  2PSR A;  2M0R A;  1SCV A;  3IQO A;  4USL A;  3D0Y A;  3LCP C;  3BUM B;  1J1E A;  2I2R E;  1K96 A;  3MSE B;  1JBA A;  1JSA A;  1SPY A;  1DGV A;  1CTR A;  2WCE A;  3O6B A;  2NLN A;  2JC2 A;  4DRW A;  1C7W A;  1S26 D;  2KGR A;  3SG5 A;  2COL B;  2K7B A;  3EK4 A;  3F45 A;  1OSA A;  3FS7 A;  1QIV A;  2NZ0 A;  2B1U A;  1B4C A;  1MWN A;  2TN4 A;  1L7Z A;  3K21 A;  2L4H A;  1KFX L;  4JQ0 D;  1RFJ A;  1YVH A;  1B8R A;  5AXI A;  1YUU A;  2JXC A;  2M97 A;  4NDC A;  2I94 A;  1MR8 A;  5CPV A;  1SCM C;  3DVJ A;  1LXF C;  4P5O E;  2PAL A;  2Y5I A;  2MLE C;  1QX5 B;  2EHB A;  2M49 B;  3BXK A;  1PK0 D;  1F55 A;  1AVS A;  5B8I B;  2D8N A;  3KHE A;  3LL8 B;  3VRN A;  1A2X A;  3BOW B;  1A4P A;  1TNQ A;  1LA0 A;  2LMU A;  1QX7 A;  1F4Q A;  2BBN A;  2LC5 A;  2VRG A;  4ORC B;  1PSB A;  4GPL B;  1A03 A;  1YRU B;  1DJG A;  2H61 A;  5HKW A;  2QAC A;  2WCF A;  2F2O A;  3FWB A;  1S6C A;  2ZND A;  2BE6 A;  1W7I B;  1J55 A;  4L9M A;  1AUI B;  1Y0V H;  2HQ8 A;  1QAT A;  4MRX A;  4YGD B;  3RM1 A;  4AOM A;  1CFP A;  4YI9 A;  1CLL A;  1FF1 A;  2BCX A;  2OS8 C;  1K93 D;  2JWW A;  2E6W A;  2F3Y A;  2LCP A;  4NDD A;  4GUK A;  2BCB A;  4PHJ A;  2K0J A;  2JT8 A;  2EGD A;  3SIA A;  1NIW A;  5DKN A;  1UHK A;  2ZN9 A;  2QPT A;  1QXP A;  2F33 A;  3I5F B;  3IQQ A;  2OTG B;  1TCF A;  1TTX A;  2M7N A;  4I5N B;  5BPJ A;  1B7T Z;  3EK7 A;  4AQI A;  3PM8 A;  2LLU A;  1FBV A;  3AKA A;  1V1G A;  1B47 A;  4FQO A;  4PE1 A;  4PHN A;  2JTZ A;  4JWQ A;  1BR1 B;  1S6J A;  5ER4 X;  2WOR A;  1IGV A;  1BG1 A;  2NXQ A;  3H4S E;  1JFK A;  2K7O A;  5AEQ A;  3C1V A;  1GGW A;  2FCE A;  1BOD A;  1XK4 C;  2MJW B;  2WC8 A;  1HT9 A;  4AQJ A;  1QLS A;  1XYD A;  3O78 A;  3OX6 A;  1QS7 A;  1CB1 A;  2L5X B;  3I5H C;  1Q80 A;  2R2I A;  5I2O A;  4YGA A;  5JOL A;  2KAX A;  2BL0 B;  1K9K A;  1DJX A;  1KK7 Z;  4E68 A;  2EC6 B;  3TS5 C;  1LA3 A;  3KEV A;  3SJS A;  3EVR A;  1ZOT B;  2JNF A;  2L98 A;  1EXR A;  3PLF B;  1B9A A;  1KSM A;  1NCY A;  3DVE A;  1RWY A;  2JT3 A;  1M45 A;  2PAS A;  2BE4 A;  1YR5 A;  2BKI B;  1F4O A;  4OKH A;  1PAL A;  2BEC A;  2KBI A;  2LVI A;  1CMF A;  1YTZ C;  1CMG A;  2LHI A;  1UP5 A;  1EH2 A;  5I8N A;  2MA2 A;  4DCK A;  1J7P A;  1SL7 A;  3OB1 B;  2AMI A;  3CWG A;  2WOS A;  4GGF C;  4PHM A;  5K89 A;  2JXL A;  2HF5 A;  2KQY A;  1E8A A;  4PAL A;  1YX8 A;  1K9U A;  4MLW A;  4GNK B;  2KAV A;  3CR5 X;  1SRA A;  2M29 A;  1VRK A;  1JUO A;  2NCP A;  2M1U A;  3PN7 B;  1ZAC A;  1BU3 A;  1CDM A;  2CCM A;  2KSP A;  2L2E A;  3BQ3 A;  1AK8 A;  3PAT A;  1LVC D;  1XVJ A;  2M3W A;  3E3R A;  3CGA A;  3JVT C;  1KFU L;  3NSK A;  1DVI A;  3FWC A;  1OMD A;  1B8L A;  2CNP A;  1S5G Y;  1UHN A;  1SR6 B;  4GAO A;  1A75 A;  1PSR A;  1DJZ A;  4N5X A;  5AER A;  2LAN A;  1R2U A;  1QX2 A;  3QRX A;  5PAL A;  4CLN A;  1J1D A;  3CZT X;  5CSI A;  1DJH A;  3WXA A;  4C0L A;  2LVJ A;  2HET A;  2DOQ A;  2KFF A;  1DF0 A;  1QTX A;  2MRD A;  1KWO B;  4N1F A;  3CLN A;  1JFJ A;  1ZFS A;  2K7D A;  2L4I A;  1OMR A;  2KBM A;  1EJ3 A;  2K2F A;  3OHM B;  4U8D A;  3VRP A;  4YBH B;  4HRG A;  3KF9 A;  3GK2 A;  2GV5 A;  5JJG A;  1QVI Z;  5I2Q A;  2JQ6 A;  1NX2 A;  1BOC A;  4MZL A;  1QV0 A;  3JTD B;  4WQ3 A;  1EG4 A;  3OX5 A;  3M0W A;  3KO0 A;  5I2L A;  3AAK A;  1TRF A;  2NCO A;  1IJ6 A;  3ZNI A;  4OV2 A;  3I5I B;  1HQV A;  1KQM C;  1BLQ A;  1QLK A;  2LHL A;  5DKR A;  1PVA A;  1YUT A;  2ZFD A;  1FI5 A;  4OVN F;  1PRW A;  5J3X A;  2FOT A;  3VGO A;  1UUS A;  1SK6 D;  1NX1 A;  1IQ3 A;  2ZRT A;  2CBL A;  3PAL A;  2IS9 A;  2PMY A;  2WCB A;  1GGZ A;  1A29 A;  2CXJ A;  1UUR A;  2PVB A;  3VRQ A;  3WNX B;  1UHH A;  1CM4 A;  1CFD A;  1NX3 A;  2L0P A;  1NPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...