2LP3A

Solution structure of s100a1 ca2+
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title Impact of calcium binding and thionylation of S100A1 protein on its nuclear magnetic resonance-derived structure and backbone dynamics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lp3A00
1XYDA 4GGFC 1JBAA 4HRHA 1AJ4A 3CLNA 1L2OB 1NCXA 2O60A 3GOFA 4YBHB 5DKNA 3DVKA 3IF7A 2F8PA 1RECA 2Y4QA 2Y1MA 2GGZA 2M0RA 1MXLC 3I5FB 2MRDA 1UP5A 3I5IB 4HREE 1B9AA 1SW8A 1NIWA 4U8DA 1KSOA 2MA2A 2OS8B 4N1GA 3SG4A 1QVIY 2LE9B 3WHTB 2K0JA 4PCWA 4ETOA 3GK1A 1F54A 1TOPA 3VRQA 2MAZA 2GGMA 2OTGB 1CM1A 2AMIA 3O4YA 3D0YA 3BUMB 1DT7B 1QIWA 1OZOA 2EC6C 5HYDA 2FOTA 2K7BA 3A8RA 1ODBA 4D1EA 1JC2A 1IQ5A 1DJZA 3NXAA 1R2UA 4GGNA 4WQ3A 3FWBA 2ISDA 5KU1A 2KQ6A 5F6TA 3E3RA 1EL4A 1RFJA 3JVTB 5HKWA 1D1OA 1QX7A 3TUYC 1F70A 2F2PA 4TNCA 3SG6A 3ZWHA 1Y1AA 1OE9B 2KDHA 2OPOA 2BECA 5KTYA 1Y1XA 3AAKA 1BU3A 3DVMA 2FCDA 3KPXA 2LLTA 2ZRSA 1MWNA 1NCZA 2H61A 1HQVA 5DKRA 4DIRA 1A2XA 3LL8B 2CTNA 2Q4UA 5AFPA 4P2YB 4CFQA 2BL0C 2WCFA 1CMFA 1SL9A 1JWDA 2M8UA 3I5GC 4BY4A 1A75A 1LINA 4XJKB 1BOCA 4PE1A 2FJUB 4PE7A 1J7QA 3TUYB 4DUQA 2KBMA 4PALA 1SY9A 4MEWA 2RGIA 1DGUA 3MSEB 2A4JA 3RLZA 1B47A 5TNCA 3A4UB 2ZNEA 1KK7Y 3KEVA 3LK0A 2NXQA 4HSZA 3CR2A 2LMVA 2NZ0A 3PATA 3BOWB 2QACA 4USLA 5HKYA 2SASA 2SCPA 1KK7Z 1Y6WA 1M63B 1XFWO 2F3ZA 1CDLA 1XVJA 2BL0B 4XYNA 4ICBA 5CSIA 2EGDA 3DF0B 1FI6A 1V1FA 3BUXB 4DRWA 1C7WA 4NQGA 1EH2A 3OB1B 3SG7A 3ICBA 1KFUL 5K89A 2WCEA 4YGDB 2BCBA 1UUSA 1S3PA 2K2AA 3O78A 2PASA 4WRIA 4AQIA 3PSRA 1B7TY 1EJ3A 2JT3A 4ORBB 1YRUB 5ER4X 1CFPA 1B7TZ 1BR4B 1ZFSA 2HPSA 2Q91A 2WCBA 1CDNA 4R1EA 3EKJA 2KI6C 1MF8B 1OMDA 1BMOA 1GQMA 4FQOA 2JRFA 1NX3A 4L9MA 2F3YA 2FCEA 2CCMA 4MLWA 4AOMA 1KSMA 1K96A 1CB1A 2B1UA 3CR4X 1NPQA 2JXCA 4NDCA 3HCMA 2LV7A 1B8RA 1KWOC 2JU0A 4YGBB 2QPTA 4FTGA 1B4CA 1F4QA 2NLNA 1PVAA 2PSRA 1SL8A 1KFXL 4OVNF 1WRKA 2EHBA 1FW4A 2F2OA 1B8CA 5CSNA 1GGWA 2BBNA 2JT0A 2I18A 5AXIA 1W7IB 5AANA 1U5IA 3VRPA 4GNKB 1A4PA 3FWCA 1YVLA 5J3XA 4JPZB 3TS5C 1MR8A 1F71A 3OHMB 4PE4A 4CLNA 5PALA 3DVJA 4N5XA 4CIDA 5B8IB 4MZLA 2L4IA 3WXAA 1YVHA 4MN0A 1PRWA 1KWOB 5GQQC 4M2OA 4WQ2A 3CTNA 1K90D 1NSHA 1JUOA 2K7CA 5D69A 3CWGA 1SR6C 4GAOA 1CLLA 3SJSA 1K94A 2K8MB 1ZACA 1XFZO 2L4HA 1K8UA 4PHJA 3TDIA 2CXJA 1GJYA 2M97A 1M31A 5I8NA 1RK9A 2V53A 1N65A 1QV1A 1L7ZA 3BYAA 5AERA 3H4SE 3KHEA 1V1GA 1TNQA 3NSKA 1CKKA 3ZNIA 4DS7A 1NWDA 1KQMC 3WHUB 2KSPA 1UHHA 3KF9A 3TS5B 2JT8A 2BBMA 4GGFA 5I2OA 1DF0B 4A4CA 2JTZA 1B1GA 3RM1A 1LKJA 1UWOA 1XFVO 3LCPC 1TCOB 2PMYA 2ZN9A 1MUXA 1XK4C 2G2BA 2KYFA 2COLB 1SR6B 2KOTA 1AVSA 1UURA 1YX8A 1M45A 1NP8A 1WRLA 1QJTA 2WNDA 3TDZA 1DJWA 2KI6D 5AEQA 1C7VA 1Q80A 2ZFDA 5ER5A 2G9BA 3LK1A 1SBJA 1QASA 2KNEA 1SMGA 2EC6B 3EVRA 1WY9A 2HQWA 2D8NA 4ZCUA 1QIVA 2IS9A 1Y1UA 1J7RA 4CPVA 1KQMB 1YR5A 3EKHA 1EXRA 1BJFA 3BUOB 4C0LA 1H4BA 2LCPA 1EG3A 1A29A 3EK4A 4I5JA 1ZMZA 1LA0A 1PK0D 1SRAA 1J1DA 4XJKA 5BPJA 3DVEA 3JTDC 4YGCB 4YRUA 1OMVA 4ZCVA 5JJGA 4OKHA 4NDDA 3SG5A 4MRYA 5HKZA 1FPWA 2JOJA 1IQ3A 1SKTA 1WLZA 2LM5A 3FIAA 1YUUA 1IJ5A 1RTP1 3AAJA 2PVBA 3O2PA 3BOWA 1SCVA 1TTXA 5CPVA 3OX5A 3EK7A 1ALVA 2KAXA 3OP0A 2LVJA 4ORCB 4PDZA 1CMGA 3I5GB 1KK8C 1M46A 1TIZA 1OMRA 1SNLA 1LVCD 1PSRA 3DF0A 2KHNA 1NX0A 1ZUZA 1BLQA 4C0JA 1DJXA 1S6JA 1PVBA 3WNXB 3JTDB 2LUCA 2AUCA 2Y5IA 4PHKA 3PN7C 2LUXA 2HETA 5JOLA 1RWYA 1QLKA 1MXEA 5HLOA 3K21A 3VROA 1MHOA 1UHKA 2I2RE 2LP2A 2M3WA 2JXLA 2MJWB 2MLFC 1CDPA 2O5GA 2CT9A 2LVVA 4E68A 1CDMA 3IQOA 5FYXA 2L50A 3I5HC 4OCIA 1JF2A 2KAYA 3D10A 1KK8B 1S36A 4NDBA 1JFJA 2KI4C 2ZN8A 1C07A 2L0PA 2LANA 2LC5A 2JC2A 1S5GY 2KQYA 1DTLA 1PULA 2HF5A 3BUNB 2MBXA 2LVKA 2H2KA 1BF5A 1J7OA 1FBVA 1S5GZ 2LAPA 4Q04A 1DJYA 1UHJA 2P6BB 1J1EA 1K95A 1DJIA 3LLEA 1XA5A 1N0YA 3PN7B 4OV2A 4BY5A 1BG1A 2LLUA 1G4YR 2TN4A 2ZKMX 3F45A 4QJ5B 2CNPA 3I5IC 2OS8C 2LP3A 1W7JB 1NCYA 2KAVA 2MLEC 4GBAA 1JSAA 1AHRA 3AKBA 1NYAA 1J7PA 1E8AA 2BKHB 2WORA 5G08A 1B8LA 1CLMA 1LXFC 2JQ6A 1YURA 1OOJA 4C0KA 4DCKA 2DOQA 4MRXA 1BR1B 1YUSA 3M0WA 1QXPA 1QX5B 4HRGA 2NCPA 4PHNA 3OX6A 1DGVA 2LMTA 3EVVA 1YUTA 1SPYA 4I5KA 2R2IA 2M9GA 3JVTC 1TNWA 2KFHA 3BXKA 1XFYO 1OSAA 5CSFA 1S6CA 1K2HA 1G8IA 2VRGA 1K9KA 2M29A 3KO0A 2WC8A 2H61C 4M2QA 1KFUS 4PHMA 2L98A 1QVIZ 1IGVA 1CM4A 1DF0A 1K9PA 5KSZA 3D0YB 2KGRA 3VRNA 1QV0A 2M7NA 3AKAA 3C1VA 1XFXO 3EVUA 3IQQA 5I2LA 4AQJA 2JNFA 2K61A 1QS7A 2L51A 1IKUA 4F0ZB 1KCYA 1NX1A 1WLMA 2L2EA 4I5NB 2M49B 1A03A 4A4BA 1SCMC 4PE0A 5CSJA 3TDUA 1DJHA 1RJVA 1TNPA 3SIBA 2BE4A 4UPGA 4GPLB 1FI5A 1RROA 2ZNDA 3VGOA 1SL7A 1K9UA 2I7AA 2I94A 1CFFA 1ZOTB 2HQ8A 1G33A 2K7DA 1DVIA 3PALA 1K93D 1KFXS 1AP4A 1IRJA 3CZTX 4YI8A 5HLVA 4MBEA 3NSLA 1AUIB 3PLFB 3GK2A 1NX2A 2JNXA 3PFVA 1XK4A 2LNKA 3CS1A 3EK8A 3TZ1A 2LMUA 1CFDA 4YGEB 2CBLA 2JULA 1UHNA 1TRFA 1SCMB 3QRXA 1YX7A 1AK8A 1A75B 2LHLA 3PM8A 1NUBA 1WDCC 2AAOA 2BE6A 3SIAA 1H8BA 2JPTA 5DKQA 4JQ0D 2BKIB 2LLSA 2KFGA 4MZKA 1F8HA 2PALA 4MZJA 2E30A 2NCOA 3OB2B 2K7OA 2K2FA 2KGBC 1IJ6A 2F33A 1Y0VH 2KBIA 2LVIA 5IBWA 1N2DA 1LA3A 3BUWB 4YGAA 4IL1A 2M7LA 3O6BA 1TCFA 1QLSA 3VRRA 4N1FA 1GGZA 3NSIA 1CFCA 2KFFA 2WOSA 4QJ3B 1CTRA 1SK6D 1EG4A 2JTTA 2M1UA 3FS7A 4OR9B 2GV5A 1MQ1A 1R6PA 1X02A 1XO5A 1S1EA 1WDCB 1IH0A 1BT6A 4P5OE 1ALWA 1S26D 2BCAA 5I2QA 1F4OA 4MSPA 3SG3A 1YTZC 2M1KB 1JF0A 1XFUO 2LHIA 3CGAA 3DD4A 1OZSA 3GK4X 4MVFA 1BODA 1IG5A 1VRKA 3BQ3A 1UHIA 1L2OC 1IWQA 1TN4A 4ORAB 1WRZA 1YRTB 2ZRTA 1TNXA 2KYCA 3CR5X 3I5FC 1HT9A 1CNPA 1FF1A 1M39A 4CFRA 1JFKA 4QJ4B 1KQVA 1F55A 4M2PA 1PALA 1J55A 2BCXA 2MHHA 2JWWA 4I5LB 1CLBA 4GUKA 1DMOA 1AJ5A 1SYMA 4YI9A 3HX4A 1QATA 2JZIA 3I5HB 2Y1NA 3NSOA 4JWQA 1QX2A 2OTGC 3SG2A 2PRUA 1DJGA 1PSBA 1S6IA 1QTXA 5D7FA 1OQPA 1U5IB 2KI4B 2E6WA 2L5XB 4GFTA
chains in the Genus database with same CATH superfamily
1C3ZA 1XYDA 3OBVA 4GGFC 1JBAA 3DXLA 1AJ4A 1OOHA 1L2OB 1NCXA 2O60A 3CLNA 3GOFA 4HRHA 4YBHB 3DVKA 3IF7A 2F8PA 1RECA 2Y4QA 2Y1MA 2GGZA 2M0RA 1MXLC 3I5FB 2MRDA 1UP5A 3I5IB 4HREE 1B9AA 1SW8A 1NIWA 4U8DA 1KSOA 2MA2A 2OS8B 2QEBA 4N1GA 3SG4A 1QVIY 2LE9B 3WHTB 2K0JA 4PCWA 4ETOA 3GK1A 1F54A 3CYZA 1TOPA 3N7HA 3VRQA 2MAZA 2GGMA 2OTGB 1CM1A 2AMIA 3B86A 3O4YA 4PT1A 3D0YA 3BUMB 1DT7B 3R1OA 1QIWA 1OZOA 2EC6C 5HYDA 2FOTA 2K7BA 3A8RA 1ODBA 4D1EA 1JC2A 1IQ5A 1DJZA 3NXAA 1R2UA 4GGNA 4WQ3A 3FWBA 2ISDA 5KU1A 2KQ6A 5F6TA 3E3RA 1EL4A 1RFJA 3JVTB 5HKWA 1D1OA 1QX7A 3TUYC 1F70A 3CZ1A 2F2PA 4TNCA 3SG6A 3ZWHA 1Y1AA 1OE9B 2KDHA 2OPOA 2BECA 5KTYA 3L47A 1Y1XA 5EL2A 3O4XA 3AAKA 1OOIX 1BU3A 1TUJA 2FCDA 3DVMA 3KPXA 2LLTA 2ZRSA 1MWNA 1NCZA 2H61A 1HQVA 5DKRA 4DIRA 1A2XA 3LL8B 2CTNA 2Q4UA 5AFPA 4P2YB 4CFQA 2BL0C 2WCFA 5I94A 2QEVA 1CMFA 1SL9A 1P28A 1JWDA 2M8UA 3I5GC 4BY4A 1A75A 1LINA 3L4LA 4XJKB 1BOCA 4PE1A 2FJUB 4PE7A 1J7QA 3TUYB 4DUQA 2KBMA 4PALA 1SY9A 3CZ2A 3BFBA 4MEWA 2RGIA 3V2LA 1DGUA 5FI7A 3MSEB 2A4JA 3RLZA 1B47A 5TNCA 3A4UB 2ZNEA 1KK7Y 3KEVA 3LK0A 2NXQA 4HSZA 2WC5A 3CR2A 3Q8IA 2LMVA 2NZ0A 3PATA 3BOWB 2QACA 4USLA 5HKYA 2SASA 2SCPA 1KK7Z 1Y6WA 1M63B 1XFWO 2F3ZA 3SS3A 3FE9A 1CDLA 3SS5A 2KLEA 3BFHA 1XVJA 2BL0B 4XYNA 4ICBA 3B88A 5CSIA 2EGDA 3DF0B 1FI6A 1V1FA 3BUXB 4DRWA 1C7WA 4NQGA 1EH2A 3OB1B 3BFAA 3SG7A 3ICBA 1KFUL 2WCHA 5K89A 2WCEA 1OOFA 4YGDB 2BCBA 1UUSA 1S3PA 2BAPA 2K2AA 3O78A 2PASA 4WRIA 4AQIA 3PSRA 1B7TY 1EJ3A 2JT3A 1T14A 4ORBB 1YRUB 4OZDA 5ER4X 1CFPA 1B7TZ 1BR4B 1ZFSA 2HPSA 2Q91A 2WCBA 1CDNA 4R1EA 3EKJA 2KI6C 1MF8B 1OMDA 1BMOA 1GQMA 4FQOA 2JRFA 1NX3A 4L9MA 2F3YA 2FCEA 2CCMA 4MLWA 4AOMA 1KSMA 1K96A 1CB1A 2B1UA 2P71A 3CR4X 1NPQA 2JXCA 3B7AA 4NDCA 3HCMA 2LV7A 1B8RA 1KWOC 2JU0A 4YGBB 2QPTA 4FTGA 1B4CA 3DY9A 1F4QA 2NLNA 1PVAA 4F7FA 2PSRA 1SL8A 1KFXL 4OVNF 1WRKA 3BJHA 2EHBA 1FW4A 2F2OA 1B8CA 5CSNA 1GGWA 2BBNA 2JT0A 2I18A 5AXIA 1W7IB 2GTEA 2WCLA 5AANA 1U5IA 3VRPA 2WCKA 1A4PA 3FWCA 1YVLA 4GNKB 5J3XA 4JPZB 3TS5C 1MR8A 1F71A 3OHMB 4PE4A 4CLNA 5PALA 3DVJA 4N5XA 4CIDA 5B8IB 4MZLA 2L4IA 3WXAA 1YVHA 4MN0A 1ORGA 1PRWA 1KWOB 5GQQC 4M2OA 4WQ2A 3OGNA 3CTNA 1K90D 1NSHA 1JUOA 5FI2A 2K7CA 5D69A 3CWGA 1SR6C 4GAOA 1CLLA 4INXA 1K94A 3SJSA 2K8MB 3RZSA 2BNXA 1ZACA 1XFZO 2L4HA 1K8UA 4PHJA 3TDIA 2CXJA 3K1EA 1IIOA 1GJYA 2M97A 4JD9A 1M31A 5I8NA 1RK9A 2V53A 1N65A 1QV1A 1L7ZA 3BYAA 3VB1A 5AERA 3H4SE 3KHEA 1V1GA 1TNQA 3NSKA 1CKKA 3ZNIA 4DS7A 1Z4HA 1NWDA 1KQMC 3WHUB 2KSPA 1UHHA 2K60A 3KF9A 3TS5B 2JT8A 2BBMA 4GGFA 5I2OA 1DF0B 4A4CA 2JTZA 1B1GA 3RM1A 1LKJA 1UWOA 1XFVO 3LCPC 1TCOB 2PMYA 2ZN9A 1MUXA 1XK4C 2G2BA 4INWA 2KYFA 2COLB 1SR6B 2KOTA 1AVSA 1UURA 1YX8A 1M45A 1NP8A 1WRLA 1QJTA 2WNDA 3TDZA 1DJWA 3R1PA 2KI6D 5AEQA 1C7VA 1TWOA 1Q80A 2ZFDA 5ER5A 2G9BA 3LK1A 1SBJA 1QASA 5FI6A 2KNEA 1SMGA 2EC6B 3EVRA 1WY9A 2HQWA 2D8NA 4ZCUA 1QIVA 2IS9A 1Y1UA 1J7RA 4CPVA 1KQMB 1YR5A 3EKHA 1EXRA 1BJFA 3BUOB 4C0LA 1H4BA 2LCPA 1EG3A 1A29A 2QEOA 3EK4A 4I5JA 1ZMZA 1LA0A 1PK0D 1SRAA 1J1DA 4XJKA 5BPJA 3DVEA 3JTDC 4YGCB 4YRUA 1OMVA 4ZCVA 5JJGA 4OKHA 3S0FA 4NDDA 3SG5A 5DKNA 4MRYA 5HKZA 1FPWA 2JOJA 1IQ3A 1SKTA 1WLZA 2LM5A 3FIAA 1YUUA 1IJ5A 3D77A 1RTP1 3AAJA 2PVBA 3O2PA 3BOWA 3FE6A 1SCVA 2QEHA 1TTXA 5CPVA 3OX5A 3EK7A 1ALVA 2KAXA 3OP0A 2LVJA 2YGUA 4ORCB 4PDZA 1CMGA 3D73A 3I5GB 1KK8C 1M46A 1TIZA 1OMRA 1SNLA 1LVCD 1PSRA 3DF0A 2KHNA 1NX0A 1ZUZA 1BLQA 1Z2CB 4C0JA 1DJXA 1S6JA 1PVBA 3WNXB 3JTDB 2LUCA 3S0AA 3DYEA 2AUCA 2Y5IA 4PHKA 3S0GA 3PN7C 2LUXA 2HETA 5JOLA 1RWYA 1QLKA 1MXEA 2KPHA 5HLOA 3K21A 3VROA 1MHOA 1UHKA 2I2RE 2LP2A 2M3WA 2JXLA 2MJWB 2MLFC 1CDPA 2O5GA 2CT9A 2PYQA 2LVVA 3R1VA 1CDMA 3IQOA 5FYXA 2L50A 4E68A 3I5HC 4OCIA 1JF2A 2KAYA 3D10A 1KK8B 1S36A 2P70A 4NDBA 1JFJA 2KI4C 2ZN8A 1OW4A 2L0PA 2LANA 1C07A 2LC5A 3L4AA 2JC2A 1S5GY 1SSEB 2KQYA 1DTLA 1PULA 2HF5A 3BUNB 3PM2A 2MBXA 1TUZA 2LVKA 2H2KA 1BF5A 1J7OA 1FBVA 1S5GZ 2LAPA 2L2CA 1DJYA 1UHJA 4Q04A 2P6BB 1J1EA 1K95A 1DJIA 3LLEA 1XA5A 1N0YA 3PN7B 4OV2A 4BY5A 1BG1A 2LLUA 1G4YR 2TN4A 2ZKMX 3F45A 4QJ5B 1XFRA 4KYNA 2CNPA 3I5IC 3UO9A 2OS8C 2LP3A 1W7JB 1NCYA 2KAVA 2MLEC 3UNWA 4GBAA 1JSAA 3S0DA 1AHRA 3AKBA 1NYAA 1J7PA 1E8AA 2BKHB 2WORA 5G08A 3QMEA 1LS8A 1B8LA 1CLMA 1LXFC 2JQ6A 1YURA 1OOJA 3SS4A 4C0KA 4DCKA 2DOQA 4MRXA 1BR1B 1YUSA 3M0WA 1QXPA 1QX5B 4HRGA 2NCPA 4PHNA 5DICA 3IVTA 3OX6A 2PQLA 1DGVA 2LMTA 3EVVA 1YUTA 1SPYA 4I5KA 2R2IA 2QDIA 3CDNA 2M9GA 3JVTC 4FQTA 1TNWA 2KFHA 3BXKA 1XFYO 3D74A 1OSAA 2KLDA 5CSFA 1S6CA 1K2HA 2ERBA 1G8IA 2VRGA 1K9KA 2M29A 3KO0A 2WC8A 2H61C 4M2QA 1KFUS 4PHMA 2L98A 1QVIZ 1IGVA 1CM4A 1DF0A 1K9PA 5KSZA 3D0YB 2KGRA 3VRNA 1QV0A 2M7NA 3AKAA 3C1VA 1XFXO 3EVUA 3IQQA 5I2LA 4AQJA 2JNFA 2K61A 1QS7A 2L51A 1IKUA 4F0ZB 1KCYA 1NX1A 1WLMA 2L2EA 4I5NB 2M49B 3FE8A 1A03A 4A4BA 1SCMC 4PE0A 4IJ7A 5CSJA 3TDUA 1DJHA 1RJVA 1TNPA 2WCMA 3SIBA 3EG5B 2BE4A 4UPGA 4GPLB 1FI5A 3S0BA 1RROA 3S0EA 2ZNDA 3VGOA 1SL7A 1K9UA 2I7AA 2I94A 1CFFA 2WC6A 3DZTA 1ZOTB 2HQ8A 1G33A 2K7DA 1DVIA 3PALA 3D75A 1K93D 1KFXS 1AP4A 1IRJA 3CZTX 4YI8A 5HLVA 4MBEA 3NSLA 1AUIB 3PLFB 3GK2A 1GM0A 1NX2A 2JNXA 3PFVA 1XK4A 2LNKA 3CS1A 3EK8A 1DQEA 3TZ1A 2L5YA 2LMUA 1CFDA 4YGEB 2CBLA 2JULA 1UHNA 1DELA 1TRFA 3R72A 1SCMB 3QRXA 1YX7A 4JKTA 1A75B 1AK8A 2FJYA 2LHLA 3PM8A 1NUBA 1WDCC 2AAOA 2BE6A 3SIAA 1C3YA 1H8BA 2JPTA 5DKQA 3B87A 4JQ0D 2BKIB 2LLSA 3D78A 2KFGA 4MZKA 1F8HA 2PALA 3CZ0A 2E30A 2NCOA 4MZJA 1DC1A 3OB2B 2K7OA 2K2FA 2KGBC 1IJ6A 2F33A 1Y0VH 2KBIA 2LVIA 5IBWA 1N2DA 1DEKA 1LA3A 3BUWB 3B6XA 1OOGA 4YGAA 1QWVA 4IL1A 2M7LA 3O6BA 1TCFA 1QLSA 3VRRA 4N1FA 1GGZA 3NSIA 1CFCA 2KFFA 2WOSA 3D76A 4QJ3B 1CTRA 1SK6D 1EG4A 2JTTA 2M1UA 3FS7A 4OR9B 2GV5A 1MQ1A 1R6PA 3NHIA 1X02A 1XO5A 1S1EA 1WDCB 1IH0A 1BT6A 4P5OE 1ALWA 1S26D 2BCAA 5I2QA 1F4OA 4MSPA 3SG3A 1YTZC 2M1KB 1JF0A 1XFUO 2LHIA 3CGAA 1W9ZA 3DD4A 2WCJA 2JPOA 1OZSA 3GK4X 4MVFA 1BODA 1IG5A 1VRKA 3BQ3A 1UHIA 1L2OC 1IWQA 1TN4A 4ORAB 1WRZA 1YRTB 2ZRTA 5HL1A 1TNXA 2KYCA 3CR5X 3I5FC 1HT9A 3NHTA 1CNPA 1M39A 3NGVA 1JFKA 4CFRA 4QJ4B 1FF1A 1KQVA 1F55A 4M2PA 1PALA 1J55A 2BCXA 2MHHA 2JWWA 4I5LB 2H8VA 1CLBA 4GUKA 1DMOA 1AJ5A 1SYMA 4YI9A 3HX4A 1QATA 2JZIA 3CABA 3I5HB 2Y1NA 3NSOA 4JWQA 1QX2A 2OTGC 3PJIA 3SG2A 2PRUA 5D3OA 1DJGA 1PSBA 1S6IA 1QTXA 5D7FA 1OQPA 1U5IB 2KI4B 2E6WA 2L5XB 4GFTA
chains in the Genus database with same CATH topology
1XYDA 4GGFC 1JBAA 4HRHA 1AJ4A 3CLNA 1L2OB 1NCXA 2O60A 3GOFA 4YBHB 5DKNA 3DVKA 3IF7A 2F8PA 1RECA 2Y4QA 2Y1MA 2GGZA 2M0RA 1MXLC 3I5FB 2MRDA 1UP5A 3I5IB 4HREE 1B9AA 1SW8A 1NIWA 4U8DA 1KSOA 2MA2A 2OS8B 4N1GA 3SG4A 1QVIY 2LE9B 3WHTB 2K0JA 4PCWA 4ETOA 3GK1A 1F54A 1TOPA 3VRQA 2MAZA 2GGMA 2OTGB 1CM1A 2AMIA 3O4YA 3D0YA 3BUMB 1DT7B 1QIWA 1OZOA 2EC6C 5HYDA 2FOTA 2K7BA 3A8RA 1ODBA 4D1EA 1JC2A 1IQ5A 1DJZA 3NXAA 1R2UA 4GGNA 4WQ3A 3FWBA 2ISDA 5KU1A 2KQ6A 5F6TA 3E3RA 1EL4A 1RFJA 3JVTB 5HKWA 1D1OA 1QX7A 3TUYC 1F70A 2F2PA 4TNCA 3SG6A 3ZWHA 1Y1AA 1OE9B 2KDHA 2OPOA 2BECA 5KTYA 1Y1XA 3AAKA 1BU3A 3DVMA 2FCDA 3KPXA 2LLTA 2ZRSA 1MWNA 1NCZA 2H61A 1HQVA 5DKRA 4DIRA 1A2XA 3LL8B 2CTNA 2Q4UA 5AFPA 4P2YB 4CFQA 2BL0C 2WCFA 1CMFA 1SL9A 1JWDA 2M8UA 3I5GC 4BY4A 1A75A 1LINA 4XJKB 1BOCA 4PE1A 2FJUB 4PE7A 1J7QA 3TUYB 4DUQA 2KBMA 4PALA 1SY9A 4MEWA 2RGIA 1DGUA 3MSEB 2A4JA 3RLZA 1B47A 5TNCA 3A4UB 2ZNEA 1KK7Y 3KEVA 3LK0A 2NXQA 4HSZA 3CR2A 2LMVA 2NZ0A 3PATA 3BOWB 2QACA 4USLA 5HKYA 2SASA 2SCPA 1KK7Z 1Y6WA 1M63B 1XFWO 2F3ZA 1CDLA 1XVJA 2BL0B 4XYNA 4ICBA 5CSIA 2EGDA 3DF0B 1FI6A 1V1FA 3BUXB 4DRWA 1C7WA 4NQGA 1EH2A 3OB1B 3SG7A 3ICBA 1KFUL 5K89A 2WCEA 4YGDB 2BCBA 1UUSA 1S3PA 2K2AA 3O78A 2PASA 4WRIA 4AQIA 3PSRA 1B7TY 1EJ3A 2JT3A 4ORBB 1YRUB 5ER4X 1CFPA 1B7TZ 1BR4B 1ZFSA 2HPSA 2Q91A 2WCBA 1CDNA 4R1EA 3EKJA 2KI6C 1MF8B 1OMDA 1BMOA 1GQMA 4FQOA 2JRFA 1NX3A 4L9MA 2F3YA 2FCEA 2CCMA 4MLWA 4AOMA 1KSMA 1K96A 1CB1A 2B1UA 3CR4X 1NPQA 2JXCA 4NDCA 3HCMA 2LV7A 1B8RA 1KWOC 2JU0A 4YGBB 2QPTA 4FTGA 1B4CA 1F4QA 2NLNA 1PVAA 2PSRA 1SL8A 1KFXL 4OVNF 1WRKA 2EHBA 1FW4A 2F2OA 1B8CA 5CSNA 1GGWA 2BBNA 2JT0A 2I18A 5AXIA 1W7IB 5AANA 1U5IA 3VRPA 4GNKB 1A4PA 3FWCA 1YVLA 5J3XA 4JPZB 3TS5C 1MR8A 1F71A 3OHMB 4PE4A 4CLNA 5PALA 3DVJA 4N5XA 4CIDA 5B8IB 4MZLA 2L4IA 3WXAA 1YVHA 4MN0A 1PRWA 1KWOB 5GQQC 4M2OA 4WQ2A 3CTNA 1K90D 1NSHA 1JUOA 2K7CA 5D69A 3CWGA 1SR6C 4GAOA 1CLLA 3SJSA 1K94A 2K8MB 1ZACA 1XFZO 2L4HA 1K8UA 4PHJA 3TDIA 2CXJA 1GJYA 2M97A 1M31A 5I8NA 1RK9A 2V53A 1N65A 1QV1A 1L7ZA 3BYAA 5AERA 3H4SE 3KHEA 1V1GA 1TNQA 3NSKA 1CKKA 3ZNIA 4DS7A 1NWDA 1KQMC 3WHUB 2KSPA 1UHHA 3KF9A 3TS5B 2JT8A 2BBMA 4GGFA 5I2OA 1DF0B 4A4CA 2JTZA 1B1GA 3RM1A 1LKJA 1UWOA 1XFVO 3LCPC 1TCOB 2PMYA 2ZN9A 1MUXA 1XK4C 2G2BA 2KYFA 2COLB 1SR6B 2KOTA 1AVSA 1UURA 1YX8A 1M45A 1NP8A 1WRLA 1QJTA 2WNDA 3TDZA 1DJWA 2KI6D 5AEQA 1C7VA 1Q80A 2ZFDA 5ER5A 2G9BA 3LK1A 1SBJA 1QASA 2KNEA 1SMGA 2EC6B 3EVRA 1WY9A 2HQWA 2D8NA 4ZCUA 1QIVA 2IS9A 1Y1UA 1J7RA 4CPVA 1KQMB 1YR5A 3EKHA 1EXRA 1BJFA 3BUOB 4C0LA 1H4BA 2LCPA 1EG3A 1A29A 3EK4A 4I5JA 1ZMZA 1LA0A 1PK0D 1SRAA 1J1DA 4XJKA 5BPJA 3DVEA 3JTDC 4YGCB 4YRUA 1OMVA 4ZCVA 5JJGA 4OKHA 4NDDA 3SG5A 4MRYA 5HKZA 1FPWA 2JOJA 1IQ3A 1SKTA 1WLZA 2LM5A 3FIAA 1YUUA 1IJ5A 1RTP1 3AAJA 2PVBA 3O2PA 3BOWA 1SCVA 1TTXA 5CPVA 3OX5A 3EK7A 1ALVA 2KAXA 3OP0A 2LVJA 4ORCB 4PDZA 1CMGA 3I5GB 1KK8C 1M46A 1TIZA 1OMRA 1SNLA 1LVCD 1PSRA 3DF0A 2KHNA 1NX0A 1ZUZA 1BLQA 4C0JA 1DJXA 1S6JA 1PVBA 3WNXB 3JTDB 2LUCA 2AUCA 2Y5IA 4PHKA 3PN7C 2LUXA 2HETA 5JOLA 1RWYA 1QLKA 1MXEA 5HLOA 3K21A 3VROA 1MHOA 1UHKA 2I2RE 2LP2A 2M3WA 2JXLA 2MJWB 2MLFC 1CDPA 2O5GA 2CT9A 2LVVA 4E68A 1CDMA 3IQOA 5FYXA 2L50A 3I5HC 4OCIA 1JF2A 2KAYA 3D10A 1KK8B 1S36A 4NDBA 1JFJA 2KI4C 2ZN8A 1C07A 2L0PA 2LANA 2LC5A 2JC2A 1S5GY 2KQYA 1DTLA 1PULA 2HF5A 3BUNB 2MBXA 2LVKA 2H2KA 1BF5A 1J7OA 1FBVA 1S5GZ 2LAPA 4Q04A 1DJYA 1UHJA 2P6BB 1J1EA 1K95A 1DJIA 3LLEA 1XA5A 1N0YA 3PN7B 4OV2A 4BY5A 1BG1A 2LLUA 1G4YR 2TN4A 2ZKMX 3F45A 4QJ5B 2CNPA 3I5IC 2OS8C 2LP3A 1W7JB 1NCYA 2KAVA 2MLEC 4GBAA 1JSAA 1AHRA 3AKBA 1NYAA 1J7PA 1E8AA 2BKHB 2WORA 5G08A 1B8LA 1CLMA 1LXFC 2JQ6A 1YURA 1OOJA 4C0KA 4DCKA 2DOQA 4MRXA 1BR1B 1YUSA 3M0WA 1QXPA 1QX5B 4HRGA 2NCPA 4PHNA 3OX6A 1DGVA 2LMTA 3EVVA 1YUTA 1SPYA 4I5KA 2R2IA 2M9GA 3JVTC 1TNWA 2KFHA 3BXKA 1XFYO 1OSAA 5CSFA 1S6CA 1K2HA 1G8IA 2VRGA 1K9KA 2M29A 3KO0A 2WC8A 2H61C 4M2QA 1KFUS 4PHMA 2L98A 1QVIZ 1IGVA 1CM4A 1DF0A 1K9PA 5KSZA 3D0YB 2KGRA 3VRNA 1QV0A 2M7NA 3AKAA 3C1VA 1XFXO 3EVUA 3IQQA 5I2LA 4AQJA 2JNFA 2K61A 1QS7A 2L51A 1IKUA 4F0ZB 1KCYA 1NX1A 1WLMA 2L2EA 4I5NB 2M49B 1A03A 4A4BA 1SCMC 4PE0A 5CSJA 3TDUA 1DJHA 1RJVA 1TNPA 3SIBA 2BE4A 4UPGA 4GPLB 1FI5A 1RROA 2ZNDA 3VGOA 1SL7A 1K9UA 2I7AA 2I94A 1CFFA 1ZOTB 2HQ8A 1G33A 2K7DA 1DVIA 3PALA 1K93D 1KFXS 1AP4A 1IRJA 3CZTX 4YI8A 5HLVA 4MBEA 3NSLA 1AUIB 3PLFB 3GK2A 1NX2A 2JNXA 3PFVA 1XK4A 2LNKA 3CS1A 3EK8A 3TZ1A 2LMUA 1CFDA 4YGEB 2CBLA 2JULA 1UHNA 1TRFA 1SCMB 3QRXA 1YX7A 1AK8A 1A75B 2LHLA 3PM8A 1NUBA 1WDCC 2AAOA 2BE6A 3SIAA 1H8BA 2JPTA 5DKQA 4JQ0D 2BKIB 2LLSA 2KFGA 4MZKA 1F8HA 2PALA 4MZJA 2E30A 2NCOA 3OB2B 2K7OA 2K2FA 2KGBC 1IJ6A 2F33A 1Y0VH 2KBIA 2LVIA 5IBWA 1N2DA 1LA3A 3BUWB 4YGAA 4IL1A 2M7LA 3O6BA 1TCFA 1QLSA 3VRRA 4N1FA 1GGZA 3NSIA 1CFCA 2KFFA 2WOSA 4QJ3B 1CTRA 1SK6D 1EG4A 2JTTA 2M1UA 3FS7A 4OR9B 2GV5A 1MQ1A 1R6PA 1X02A 1XO5A 1S1EA 1WDCB 1IH0A 1BT6A 4P5OE 1ALWA 1S26D 2BCAA 5I2QA 1F4OA 4MSPA 3SG3A 1YTZC 2M1KB 1JF0A 1XFUO 2LHIA 3CGAA 3DD4A 1OZSA 3GK4X 4MVFA 1BODA 1IG5A 1VRKA 3BQ3A 1UHIA 1L2OC 1IWQA 1TN4A 4ORAB 1WRZA 1YRTB 2ZRTA 1TNXA 2KYCA 3CR5X 3I5FC 1HT9A 1CNPA 1FF1A 1M39A 4CFRA 1JFKA 4QJ4B 1KQVA 1F55A 4M2PA 1PALA 1J55A 2BCXA 2MHHA 2JWWA 4I5LB 1CLBA 4GUKA 1DMOA 1AJ5A 1SYMA 4YI9A 3HX4A 1QATA 2JZIA 3I5HB 2Y1NA 3NSOA 4JWQA 1QX2A 2OTGC 3SG2A 2PRUA 1DJGA 1PSBA 1S6IA 1QTXA 5D7FA 1OQPA 1U5IB 2KI4B 2E6WA 2L5XB 4GFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XYD A;  4GGF C;  1JBA A;  4HRH A;  1AJ4 A;  3CLN A;  1L2O B;  1NCX A;  2O60 A;  3GOF A;  4YBH B;  5DKN A;  3DVK A;  3IF7 A;  2F8P A;  1REC A;  2Y4Q A;  2Y1M A;  2GGZ A;  2M0R A;  1MXL C;  3I5F B;  2MRD A;  1UP5 A;  3I5I B;  4HRE E;  1B9A A;  1SW8 A;  1NIW A;  4U8D A;  1KSO A;  2MA2 A;  2OS8 B;  4N1G A;  3SG4 A;  1QVI Y;  2LE9 B;  3WHT B;  2K0J A;  4PCW A;  4ETO A;  3GK1 A;  1F54 A;  1TOP A;  3VRQ A;  2MAZ A;  2GGM A;  2OTG B;  1CM1 A;  2AMI A;  3O4Y A;  3D0Y A;  3BUM B;  1DT7 B;  1QIW A;  1OZO A;  2EC6 C;  5HYD A;  2FOT A;  2K7B A;  3A8R A;  1ODB A;  4D1E A;  1JC2 A;  1IQ5 A;  1DJZ A;  3NXA A;  1R2U A;  4GGN A;  4WQ3 A;  3FWB A;  2ISD A;  5KU1 A;  2KQ6 A;  5F6T A;  3E3R A;  1EL4 A;  1RFJ A;  3JVT B;  5HKW A;  1D1O A;  1QX7 A;  3TUY C;  1F70 A;  2F2P A;  4TNC A;  3SG6 A;  3ZWH A;  1Y1A A;  1OE9 B;  2KDH A;  2OPO A;  2BEC A;  5KTY A;  1Y1X A;  3AAK A;  1BU3 A;  3DVM A;  2FCD A;  3KPX A;  2LLT A;  2ZRS A;  1MWN A;  1NCZ A;  2H61 A;  1HQV A;  5DKR A;  4DIR A;  1A2X A;  3LL8 B;  2CTN A;  2Q4U A;  5AFP A;  4P2Y B;  4CFQ A;  2BL0 C;  2WCF A;  1CMF A;  1SL9 A;  1JWD A;  2M8U A;  3I5G C;  4BY4 A;  1A75 A;  1LIN A;  4XJK B;  1BOC A;  4PE1 A;  2FJU B;  4PE7 A;  1J7Q A;  3TUY B;  4DUQ A;  2KBM A;  4PAL A;  1SY9 A;  4MEW A;  2RGI A;  1DGU A;  3MSE B;  2A4J A;  3RLZ A;  1B47 A;  5TNC A;  3A4U B;  2ZNE A;  1KK7 Y;  3KEV A;  3LK0 A;  2NXQ A;  4HSZ A;  3CR2 A;  2LMV A;  2NZ0 A;  3PAT A;  3BOW B;  2QAC A;  4USL A;  5HKY A;  2SAS A;  2SCP A;  1KK7 Z;  1Y6W A;  1M63 B;  1XFW O;  2F3Z A;  1CDL A;  1XVJ A;  2BL0 B;  4XYN A;  4ICB A;  5CSI A;  2EGD A;  3DF0 B;  1FI6 A;  1V1F A;  3BUX B;  4DRW A;  1C7W A;  4NQG A;  1EH2 A;  3OB1 B;  3SG7 A;  3ICB A;  1KFU L;  5K89 A;  2WCE A;  4YGD B;  2BCB A;  1UUS A;  1S3P A;  2K2A A;  3O78 A;  2PAS A;  4WRI A;  4AQI A;  3PSR A;  1B7T Y;  1EJ3 A;  2JT3 A;  4ORB B;  1YRU B;  5ER4 X;  1CFP A;  1B7T Z;  1BR4 B;  1ZFS A;  2HPS A;  2Q91 A;  2WCB A;  1CDN A;  4R1E A;  3EKJ A;  2KI6 C;  1MF8 B;  1OMD A;  1BMO A;  1GQM A;  4FQO A;  2JRF A;  1NX3 A;  4L9M A;  2F3Y A;  2FCE A;  2CCM A;  4MLW A;  4AOM A;  1KSM A;  1K96 A;  1CB1 A;  2B1U A;  3CR4 X;  1NPQ A;  2JXC A;  4NDC A;  3HCM A;  2LV7 A;  1B8R A;  1KWO C;  2JU0 A;  4YGB B;  2QPT A;  4FTG A;  1B4C A;  1F4Q A;  2NLN A;  1PVA A;  2PSR A;  1SL8 A;  1KFX L;  4OVN F;  1WRK A;  2EHB A;  1FW4 A;  2F2O A;  1B8C A;  5CSN A;  1GGW A;  2BBN A;  2JT0 A;  2I18 A;  5AXI A;  1W7I B;  5AAN A;  1U5I A;  3VRP A;  4GNK B;  1A4P A;  3FWC A;  1YVL A;  5J3X A;  4JPZ B;  3TS5 C;  1MR8 A;  1F71 A;  3OHM B;  4PE4 A;  4CLN A;  5PAL A;  3DVJ A;  4N5X A;  4CID A;  5B8I B;  4MZL A;  2L4I A;  3WXA A;  1YVH A;  4MN0 A;  1PRW A;  1KWO B;  5GQQ C;  4M2O A;  4WQ2 A;  3CTN A;  1K90 D;  1NSH A;  1JUO A;  2K7C A;  5D69 A;  3CWG A;  1SR6 C;  4GAO A;  1CLL A;  3SJS A;  1K94 A;  2K8M B;  1ZAC A;  1XFZ O;  2L4H A;  1K8U A;  4PHJ A;  3TDI A;  2CXJ A;  1GJY A;  2M97 A;  1M31 A;  5I8N A;  1RK9 A;  2V53 A;  1N65 A;  1QV1 A;  1L7Z A;  3BYA A;  5AER A;  3H4S E;  3KHE A;  1V1G A;  1TNQ A;  3NSK A;  1CKK A;  3ZNI A;  4DS7 A;  1NWD A;  1KQM C;  3WHU B;  2KSP A;  1UHH A;  3KF9 A;  3TS5 B;  2JT8 A;  2BBM A;  4GGF A;  5I2O A;  1DF0 B;  4A4C A;  2JTZ A;  1B1G A;  3RM1 A;  1LKJ A;  1UWO A;  1XFV O;  3LCP C;  1TCO B;  2PMY A;  2ZN9 A;  1MUX A;  1XK4 C;  2G2B A;  2KYF A;  2COL B;  1SR6 B;  2KOT A;  1AVS A;  1UUR A;  1YX8 A;  1M45 A;  1NP8 A;  1WRL A;  1QJT A;  2WND A;  3TDZ A;  1DJW A;  2KI6 D;  5AEQ A;  1C7V A;  1Q80 A;  2ZFD A;  5ER5 A;  2G9B A;  3LK1 A;  1SBJ A;  1QAS A;  2KNE A;  1SMG A;  2EC6 B;  3EVR A;  1WY9 A;  2HQW A;  2D8N A;  4ZCU A;  1QIV A;  2IS9 A;  1Y1U A;  1J7R A;  4CPV A;  1KQM B;  1YR5 A;  3EKH A;  1EXR A;  1BJF A;  3BUO B;  4C0L A;  1H4B A;  2LCP A;  1EG3 A;  1A29 A;  3EK4 A;  4I5J A;  1ZMZ A;  1LA0 A;  1PK0 D;  1SRA A;  1J1D A;  4XJK A;  5BPJ A;  3DVE A;  3JTD C;  4YGC B;  4YRU A;  1OMV A;  4ZCV A;  5JJG A;  4OKH A;  4NDD A;  3SG5 A;  4MRY A;  5HKZ A;  1FPW A;  2JOJ A;  1IQ3 A;  1SKT A;  1WLZ A;  2LM5 A;  3FIA A;  1YUU A;  1IJ5 A;  1RTP 1;  3AAJ A;  2PVB A;  3O2P A;  3BOW A;  1SCV A;  1TTX A;  5CPV A;  3OX5 A;  3EK7 A;  1ALV A;  2KAX A;  3OP0 A;  2LVJ A;  4ORC B;  4PDZ A;  1CMG A;  3I5G B;  1KK8 C;  1M46 A;  1TIZ A;  1OMR A;  1SNL A;  1LVC D;  1PSR A;  3DF0 A;  2KHN A;  1NX0 A;  1ZUZ A;  1BLQ A;  4C0J A;  1DJX A;  1S6J A;  1PVB A;  3WNX B;  3JTD B;  2LUC A;  2AUC A;  2Y5I A;  4PHK A;  3PN7 C;  2LUX A;  2HET A;  5JOL A;  1RWY A;  1QLK A;  1MXE A;  5HLO A;  3K21 A;  3VRO A;  1MHO A;  1UHK A;  2I2R E;  2LP2 A;  2M3W A;  2JXL A;  2MJW B;  2MLF C;  1CDP A;  2O5G A;  2CT9 A;  2LVV A;  4E68 A;  1CDM A;  3IQO A;  5FYX A;  2L50 A;  3I5H C;  4OCI A;  1JF2 A;  2KAY A;  3D10 A;  1KK8 B;  1S36 A;  4NDB A;  1JFJ A;  2KI4 C;  2ZN8 A;  1C07 A;  2L0P A;  2LAN A;  2LC5 A;  2JC2 A;  1S5G Y;  2KQY A;  1DTL A;  1PUL A;  2HF5 A;  3BUN B;  2MBX A;  2LVK A;  2H2K A;  1BF5 A;  1J7O A;  1FBV A;  1S5G Z;  2LAP A;  4Q04 A;  1DJY A;  1UHJ A;  2P6B B;  1J1E A;  1K95 A;  1DJI A;  3LLE A;  1XA5 A;  1N0Y A;  3PN7 B;  4OV2 A;  4BY5 A;  1BG1 A;  2LLU A;  1G4Y R;  2TN4 A;  2ZKM X;  3F45 A;  4QJ5 B;  2CNP A;  3I5I C;  2OS8 C;  2LP3 A;  1W7J B;  1NCY A;  2KAV A;  2MLE C;  4GBA A;  1JSA A;  1AHR A;  3AKB A;  1NYA A;  1J7P A;  1E8A A;  2BKH B;  2WOR A;  5G08 A;  1B8L A;  1CLM A;  1LXF C;  2JQ6 A;  1YUR A;  1OOJ A;  4C0K A;  4DCK A;  2DOQ A;  4MRX A;  1BR1 B;  1YUS A;  3M0W A;  1QXP A;  1QX5 B;  4HRG A;  2NCP A;  4PHN A;  3OX6 A;  1DGV A;  2LMT A;  3EVV A;  1YUT A;  1SPY A;  4I5K A;  2R2I A;  2M9G A;  3JVT C;  1TNW A;  2KFH A;  3BXK A;  1XFY O;  1OSA A;  5CSF A;  1S6C A;  1K2H A;  1G8I A;  2VRG A;  1K9K A;  2M29 A;  3KO0 A;  2WC8 A;  2H61 C;  4M2Q A;  1KFU S;  4PHM A;  2L98 A;  1QVI Z;  1IGV A;  1CM4 A;  1DF0 A;  1K9P A;  5KSZ A;  3D0Y B;  2KGR A;  3VRN A;  1QV0 A;  2M7N A;  3AKA A;  3C1V A;  1XFX O;  3EVU A;  3IQQ A;  5I2L A;  4AQJ A;  2JNF A;  2K61 A;  1QS7 A;  2L51 A;  1IKU A;  4F0Z B;  1KCY A;  1NX1 A;  1WLM A;  2L2E A;  4I5N B;  2M49 B;  1A03 A;  4A4B A;  1SCM C;  4PE0 A;  5CSJ A;  3TDU A;  1DJH A;  1RJV A;  1TNP A;  3SIB A;  2BE4 A;  4UPG A;  4GPL B;  1FI5 A;  1RRO A;  2ZND A;  3VGO A;  1SL7 A;  1K9U A;  2I7A A;  2I94 A;  1CFF A;  1ZOT B;  2HQ8 A;  1G33 A;  2K7D A;  1DVI A;  3PAL A;  1K93 D;  1KFX S;  1AP4 A;  1IRJ A;  3CZT X;  4YI8 A;  5HLV A;  4MBE A;  3NSL A;  1AUI B;  3PLF B;  3GK2 A;  1NX2 A;  2JNX A;  3PFV A;  1XK4 A;  2LNK A;  3CS1 A;  3EK8 A;  3TZ1 A;  2LMU A;  1CFD A;  4YGE B;  2CBL A;  2JUL A;  1UHN A;  1TRF A;  1SCM B;  3QRX A;  1YX7 A;  1AK8 A;  1A75 B;  2LHL A;  3PM8 A;  1NUB A;  1WDC C;  2AAO A;  2BE6 A;  3SIA A;  1H8B A;  2JPT A;  5DKQ A;  4JQ0 D;  2BKI B;  2LLS A;  2KFG A;  4MZK A;  1F8H A;  2PAL A;  4MZJ A;  2E30 A;  2NCO A;  3OB2 B;  2K7O A;  2K2F A;  2KGB C;  1IJ6 A;  2F33 A;  1Y0V H;  2KBI A;  2LVI A;  5IBW A;  1N2D A;  1LA3 A;  3BUW B;  4YGA A;  4IL1 A;  2M7L A;  3O6B A;  1TCF A;  1QLS A;  3VRR A;  4N1F A;  1GGZ A;  3NSI A;  1CFC A;  2KFF A;  2WOS A;  4QJ3 B;  1CTR A;  1SK6 D;  1EG4 A;  2JTT A;  2M1U A;  3FS7 A;  4OR9 B;  2GV5 A;  1MQ1 A;  1R6P A;  1X02 A;  1XO5 A;  1S1E A;  1WDC B;  1IH0 A;  1BT6 A;  4P5O E;  1ALW A;  1S26 D;  2BCA A;  5I2Q A;  1F4O A;  4MSP A;  3SG3 A;  1YTZ C;  2M1K B;  1JF0 A;  1XFU O;  2LHI A;  3CGA A;  3DD4 A;  1OZS A;  3GK4 X;  4MVF A;  1BOD A;  1IG5 A;  1VRK A;  3BQ3 A;  1UHI A;  1L2O C;  1IWQ A;  1TN4 A;  4ORA B;  1WRZ A;  1YRT B;  2ZRT A;  1TNX A;  2KYC A;  3CR5 X;  3I5F C;  1HT9 A;  1CNP A;  1FF1 A;  1M39 A;  4CFR A;  1JFK A;  4QJ4 B;  1KQV A;  1F55 A;  4M2P A;  1PAL A;  1J55 A;  2BCX A;  2MHH A;  2JWW A;  4I5L B;  1CLB A;  4GUK A;  1DMO A;  1AJ5 A;  1SYM A;  4YI9 A;  3HX4 A;  1QAT A;  2JZI A;  3I5H B;  2Y1N A;  3NSO A;  4JWQ A;  1QX2 A;  2OTG C;  3SG2 A;  2PRU A;  1DJG A;  1PSB A;  1S6I A;  1QTX A;  5D7F A;  1OQP A;  1U5I B;  2KI4 B;  2E6W A;  2L5X B;  4GFT A; 
#chains in the Genus database with same CATH topology
 1C3Z A;  1XYD A;  3OBV A;  4GGF C;  1JBA A;  3DXL A;  1AJ4 A;  1OOH A;  1L2O B;  1NCX A;  2O60 A;  3CLN A;  3GOF A;  4HRH A;  4YBH B;  3DVK A;  3IF7 A;  2F8P A;  1REC A;  2Y4Q A;  2Y1M A;  2GGZ A;  2M0R A;  1MXL C;  3I5F B;  2MRD A;  1UP5 A;  3I5I B;  4HRE E;  1B9A A;  1SW8 A;  1NIW A;  4U8D A;  1KSO A;  2MA2 A;  2OS8 B;  2QEB A;  4N1G A;  3SG4 A;  1QVI Y;  2LE9 B;  3WHT B;  2K0J A;  4PCW A;  4ETO A;  3GK1 A;  1F54 A;  3CYZ A;  1TOP A;  3N7H A;  3VRQ A;  2MAZ A;  2GGM A;  2OTG B;  1CM1 A;  2AMI A;  3B86 A;  3O4Y A;  4PT1 A;  3D0Y A;  3BUM B;  1DT7 B;  3R1O A;  1QIW A;  1OZO A;  2EC6 C;  5HYD A;  2FOT A;  2K7B A;  3A8R A;  1ODB A;  4D1E A;  1JC2 A;  1IQ5 A;  1DJZ A;  3NXA A;  1R2U A;  4GGN A;  4WQ3 A;  3FWB A;  2ISD A;  5KU1 A;  2KQ6 A;  5F6T A;  3E3R A;  1EL4 A;  1RFJ A;  3JVT B;  5HKW A;  1D1O A;  1QX7 A;  3TUY C;  1F70 A;  3CZ1 A;  2F2P A;  4TNC A;  3SG6 A;  3ZWH A;  1Y1A A;  1OE9 B;  2KDH A;  2OPO A;  2BEC A;  5KTY A;  3L47 A;  1Y1X A;  5EL2 A;  3O4X A;  3AAK A;  1OOI X;  1BU3 A;  1TUJ A;  2FCD A;  3DVM A;  3KPX A;  2LLT A;  2ZRS A;  1MWN A;  1NCZ A;  2H61 A;  1HQV A;  5DKR A;  4DIR A;  1A2X A;  3LL8 B;  2CTN A;  2Q4U A;  5AFP A;  4P2Y B;  4CFQ A;  2BL0 C;  2WCF A;  5I94 A;  2QEV A;  1CMF A;  1SL9 A;  1P28 A;  1JWD A;  2M8U A;  3I5G C;  4BY4 A;  1A75 A;  1LIN A;  3L4L A;  4XJK B;  1BOC A;  4PE1 A;  2FJU B;  4PE7 A;  1J7Q A;  3TUY B;  4DUQ A;  2KBM A;  4PAL A;  1SY9 A;  3CZ2 A;  3BFB A;  4MEW A;  2RGI A;  3V2L A;  1DGU A;  5FI7 A;  3MSE B;  2A4J A;  3RLZ A;  1B47 A;  5TNC A;  3A4U B;  2ZNE A;  1KK7 Y;  3KEV A;  3LK0 A;  2NXQ A;  4HSZ A;  2WC5 A;  3CR2 A;  3Q8I A;  2LMV A;  2NZ0 A;  3PAT A;  3BOW B;  2QAC A;  4USL A;  5HKY A;  2SAS A;  2SCP A;  1KK7 Z;  1Y6W A;  1M63 B;  1XFW O;  2F3Z A;  3SS3 A;  3FE9 A;  1CDL A;  3SS5 A;  2KLE A;  3BFH A;  1XVJ A;  2BL0 B;  4XYN A;  4ICB A;  3B88 A;  5CSI A;  2EGD A;  3DF0 B;  1FI6 A;  1V1F A;  3BUX B;  4DRW A;  1C7W A;  4NQG A;  1EH2 A;  3OB1 B;  3BFA A;  3SG7 A;  3ICB A;  1KFU L;  2WCH A;  5K89 A;  2WCE A;  1OOF A;  4YGD B;  2BCB A;  1UUS A;  1S3P A;  2BAP A;  2K2A A;  3O78 A;  2PAS A;  4WRI A;  4AQI A;  3PSR A;  1B7T Y;  1EJ3 A;  2JT3 A;  1T14 A;  4ORB B;  1YRU B;  4OZD A;  5ER4 X;  1CFP A;  1B7T Z;  1BR4 B;  1ZFS A;  2HPS A;  2Q91 A;  2WCB A;  1CDN A;  4R1E A;  3EKJ A;  2KI6 C;  1MF8 B;  1OMD A;  1BMO A;  1GQM A;  4FQO A;  2JRF A;  1NX3 A;  4L9M A;  2F3Y A;  2FCE A;  2CCM A;  4MLW A;  4AOM A;  1KSM A;  1K96 A;  1CB1 A;  2B1U A;  2P71 A;  3CR4 X;  1NPQ A;  2JXC A;  3B7A A;  4NDC A;  3HCM A;  2LV7 A;  1B8R A;  1KWO C;  2JU0 A;  4YGB B;  2QPT A;  4FTG A;  1B4C A;  3DY9 A;  1F4Q A;  2NLN A;  1PVA A;  4F7F A;  2PSR A;  1SL8 A;  1KFX L;  4OVN F;  1WRK A;  3BJH A;  2EHB A;  1FW4 A;  2F2O A;  1B8C A;  5CSN A;  1GGW A;  2BBN A;  2JT0 A;  2I18 A;  5AXI A;  1W7I B;  2GTE A;  2WCL A;  5AAN A;  1U5I A;  3VRP A;  2WCK A;  1A4P A;  3FWC A;  1YVL A;  4GNK B;  5J3X A;  4JPZ B;  3TS5 C;  1MR8 A;  1F71 A;  3OHM B;  4PE4 A;  4CLN A;  5PAL A;  3DVJ A;  4N5X A;  4CID A;  5B8I B;  4MZL A;  2L4I A;  3WXA A;  1YVH A;  4MN0 A;  1ORG A;  1PRW A;  1KWO B;  5GQQ C;  4M2O A;  4WQ2 A;  3OGN A;  3CTN A;  1K90 D;  1NSH A;  1JUO A;  5FI2 A;  2K7C A;  5D69 A;  3CWG A;  1SR6 C;  4GAO A;  1CLL A;  4INX A;  1K94 A;  3SJS A;  2K8M B;  3RZS A;  2BNX A;  1ZAC A;  1XFZ O;  2L4H A;  1K8U A;  4PHJ A;  3TDI A;  2CXJ A;  3K1E A;  1IIO A;  1GJY A;  2M97 A;  4JD9 A;  1M31 A;  5I8N A;  1RK9 A;  2V53 A;  1N65 A;  1QV1 A;  1L7Z A;  3BYA A;  3VB1 A;  5AER A;  3H4S E;  3KHE A;  1V1G A;  1TNQ A;  3NSK A;  1CKK A;  3ZNI A;  4DS7 A;  1Z4H A;  1NWD A;  1KQM C;  3WHU B;  2KSP A;  1UHH A;  2K60 A;  3KF9 A;  3TS5 B;  2JT8 A;  2BBM A;  4GGF A;  5I2O A;  1DF0 B;  4A4C A;  2JTZ A;  1B1G A;  3RM1 A;  1LKJ A;  1UWO A;  1XFV O;  3LCP C;  1TCO B;  2PMY A;  2ZN9 A;  1MUX A;  1XK4 C;  2G2B A;  4INW A;  2KYF A;  2COL B;  1SR6 B;  2KOT A;  1AVS A;  1UUR A;  1YX8 A;  1M45 A;  1NP8 A;  1WRL A;  1QJT A;  2WND A;  3TDZ A;  1DJW A;  3R1P A;  2KI6 D;  5AEQ A;  1C7V A;  1TWO A;  1Q80 A;  2ZFD A;  5ER5 A;  2G9B A;  3LK1 A;  1SBJ A;  1QAS A;  5FI6 A;  2KNE A;  1SMG A;  2EC6 B;  3EVR A;  1WY9 A;  2HQW A;  2D8N A;  4ZCU A;  1QIV A;  2IS9 A;  1Y1U A;  1J7R A;  4CPV A;  1KQM B;  1YR5 A;  3EKH A;  1EXR A;  1BJF A;  3BUO B;  4C0L A;  1H4B A;  2LCP A;  1EG3 A;  1A29 A;  2QEO A;  3EK4 A;  4I5J A;  1ZMZ A;  1LA0 A;  1PK0 D;  1SRA A;  1J1D A;  4XJK A;  5BPJ A;  3DVE A;  3JTD C;  4YGC B;  4YRU A;  1OMV A;  4ZCV A;  5JJG A;  4OKH A;  3S0F A;  4NDD A;  3SG5 A;  5DKN A;  4MRY A;  5HKZ A;  1FPW A;  2JOJ A;  1IQ3 A;  1SKT A;  1WLZ A;  2LM5 A;  3FIA A;  1YUU A;  1IJ5 A;  3D77 A;  1RTP 1;  3AAJ A;  2PVB A;  3O2P A;  3BOW A;  3FE6 A;  1SCV A;  2QEH A;  1TTX A;  5CPV A;  3OX5 A;  3EK7 A;  1ALV A;  2KAX A;  3OP0 A;  2LVJ A;  2YGU A;  4ORC B;  4PDZ A;  1CMG A;  3D73 A;  3I5G B;  1KK8 C;  1M46 A;  1TIZ A;  1OMR A;  1SNL A;  1LVC D;  1PSR A;  3DF0 A;  2KHN A;  1NX0 A;  1ZUZ A;  1BLQ A;  1Z2C B;  4C0J A;  1DJX A;  1S6J A;  1PVB A;  3WNX B;  3JTD B;  2LUC A;  3S0A A;  3DYE A;  2AUC A;  2Y5I A;  4PHK A;  3S0G A;  3PN7 C;  2LUX A;  2HET A;  5JOL A;  1RWY A;  1QLK A;  1MXE A;  2KPH A;  5HLO A;  3K21 A;  3VRO A;  1MHO A;  1UHK A;  2I2R E;  2LP2 A;  2M3W A;  2JXL A;  2MJW B;  2MLF C;  1CDP A;  2O5G A;  2CT9 A;  2PYQ A;  2LVV A;  3R1V A;  1CDM A;  3IQO A;  5FYX A;  2L50 A;  4E68 A;  3I5H C;  4OCI A;  1JF2 A;  2KAY A;  3D10 A;  1KK8 B;  1S36 A;  2P70 A;  4NDB A;  1JFJ A;  2KI4 C;  2ZN8 A;  1OW4 A;  2L0P A;  2LAN A;  1C07 A;  2LC5 A;  3L4A A;  2JC2 A;  1S5G Y;  1SSE B;  2KQY A;  1DTL A;  1PUL A;  2HF5 A;  3BUN B;  3PM2 A;  2MBX A;  1TUZ A;  2LVK A;  2H2K A;  1BF5 A;  1J7O A;  1FBV A;  1S5G Z;  2LAP A;  2L2C A;  1DJY A;  1UHJ A;  4Q04 A;  2P6B B;  1J1E A;  1K95 A;  1DJI A;  3LLE A;  1XA5 A;  1N0Y A;  3PN7 B;  4OV2 A;  4BY5 A;  1BG1 A;  2LLU A;  1G4Y R;  2TN4 A;  2ZKM X;  3F45 A;  4QJ5 B;  1XFR A;  4KYN A;  2CNP A;  3I5I C;  3UO9 A;  2OS8 C;  2LP3 A;  1W7J B;  1NCY A;  2KAV A;  2MLE C;  3UNW A;  4GBA A;  1JSA A;  3S0D A;  1AHR A;  3AKB A;  1NYA A;  1J7P A;  1E8A A;  2BKH B;  2WOR A;  5G08 A;  3QME A;  1LS8 A;  1B8L A;  1CLM A;  1LXF C;  2JQ6 A;  1YUR A;  1OOJ A;  3SS4 A;  4C0K A;  4DCK A;  2DOQ A;  4MRX A;  1BR1 B;  1YUS A;  3M0W A;  1QXP A;  1QX5 B;  4HRG A;  2NCP A;  4PHN A;  5DIC A;  3IVT A;  3OX6 A;  2PQL A;  1DGV A;  2LMT A;  3EVV A;  1YUT A;  1SPY A;  4I5K A;  2R2I A;  2QDI A;  3CDN A;  2M9G A;  3JVT C;  4FQT A;  1TNW A;  2KFH A;  3BXK A;  1XFY O;  3D74 A;  1OSA A;  2KLD A;  5CSF A;  1S6C A;  1K2H A;  2ERB A;  1G8I A;  2VRG A;  1K9K A;  2M29 A;  3KO0 A;  2WC8 A;  2H61 C;  4M2Q A;  1KFU S;  4PHM A;  2L98 A;  1QVI Z;  1IGV A;  1CM4 A;  1DF0 A;  1K9P A;  5KSZ A;  3D0Y B;  2KGR A;  3VRN A;  1QV0 A;  2M7N A;  3AKA A;  3C1V A;  1XFX O;  3EVU A;  3IQQ A;  5I2L A;  4AQJ A;  2JNF A;  2K61 A;  1QS7 A;  2L51 A;  1IKU A;  4F0Z B;  1KCY A;  1NX1 A;  1WLM A;  2L2E A;  4I5N B;  2M49 B;  3FE8 A;  1A03 A;  4A4B A;  1SCM C;  4PE0 A;  4IJ7 A;  5CSJ A;  3TDU A;  1DJH A;  1RJV A;  1TNP A;  2WCM A;  3SIB A;  3EG5 B;  2BE4 A;  4UPG A;  4GPL B;  1FI5 A;  3S0B A;  1RRO A;  3S0E A;  2ZND A;  3VGO A;  1SL7 A;  1K9U A;  2I7A A;  2I94 A;  1CFF A;  2WC6 A;  3DZT A;  1ZOT B;  2HQ8 A;  1G33 A;  2K7D A;  1DVI A;  3PAL A;  3D75 A;  1K93 D;  1KFX S;  1AP4 A;  1IRJ A;  3CZT X;  4YI8 A;  5HLV A;  4MBE A;  3NSL A;  1AUI B;  3PLF B;  3GK2 A;  1GM0 A;  1NX2 A;  2JNX A;  3PFV A;  1XK4 A;  2LNK A;  3CS1 A;  3EK8 A;  1DQE A;  3TZ1 A;  2L5Y A;  2LMU A;  1CFD A;  4YGE B;  2CBL A;  2JUL A;  1UHN A;  1DEL A;  1TRF A;  3R72 A;  1SCM B;  3QRX A;  1YX7 A;  4JKT A;  1A75 B;  1AK8 A;  2FJY A;  2LHL A;  3PM8 A;  1NUB A;  1WDC C;  2AAO A;  2BE6 A;  3SIA A;  1C3Y A;  1H8B A;  2JPT A;  5DKQ A;  3B87 A;  4JQ0 D;  2BKI B;  2LLS A;  3D78 A;  2KFG A;  4MZK A;  1F8H A;  2PAL A;  3CZ0 A;  2E30 A;  2NCO A;  4MZJ A;  1DC1 A;  3OB2 B;  2K7O A;  2K2F A;  2KGB C;  1IJ6 A;  2F33 A;  1Y0V H;  2KBI A;  2LVI A;  5IBW A;  1N2D A;  1DEK A;  1LA3 A;  3BUW B;  3B6X A;  1OOG A;  4YGA A;  1QWV A;  4IL1 A;  2M7L A;  3O6B A;  1TCF A;  1QLS A;  3VRR A;  4N1F A;  1GGZ A;  3NSI A;  1CFC A;  2KFF A;  2WOS A;  3D76 A;  4QJ3 B;  1CTR A;  1SK6 D;  1EG4 A;  2JTT A;  2M1U A;  3FS7 A;  4OR9 B;  2GV5 A;  1MQ1 A;  1R6P A;  3NHI A;  1X02 A;  1XO5 A;  1S1E A;  1WDC B;  1IH0 A;  1BT6 A;  4P5O E;  1ALW A;  1S26 D;  2BCA A;  5I2Q A;  1F4O A;  4MSP A;  3SG3 A;  1YTZ C;  2M1K B;  1JF0 A;  1XFU O;  2LHI A;  3CGA A;  1W9Z A;  3DD4 A;  2WCJ A;  2JPO A;  1OZS A;  3GK4 X;  4MVF A;  1BOD A;  1IG5 A;  1VRK A;  3BQ3 A;  1UHI A;  1L2O C;  1IWQ A;  1TN4 A;  4ORA B;  1WRZ A;  1YRT B;  2ZRT A;  5HL1 A;  1TNX A;  2KYC A;  3CR5 X;  3I5F C;  1HT9 A;  3NHT A;  1CNP A;  1M39 A;  3NGV A;  1JFK A;  4CFR A;  4QJ4 B;  1FF1 A;  1KQV A;  1F55 A;  4M2P A;  1PAL A;  1J55 A;  2BCX A;  2MHH A;  2JWW A;  4I5L B;  2H8V A;  1CLB A;  4GUK A;  1DMO A;  1AJ5 A;  1SYM A;  4YI9 A;  3HX4 A;  1QAT A;  2JZI A;  3CAB A;  3I5H B;  2Y1N A;  3NSO A;  4JWQ A;  1QX2 A;  2OTG C;  3PJI A;  3SG2 A;  2PRU A;  5D3O A;  1DJG A;  1PSB A;  1S6I A;  1QTX A;  5D7F A;  1OQP A;  1U5I B;  2KI4 B;  2E6W A;  2L5X B;  4GFT A; 
#chains in the Genus database with same CATH homology
 1XYD A;  4GGF C;  1JBA A;  4HRH A;  1AJ4 A;  3CLN A;  1L2O B;  1NCX A;  2O60 A;  3GOF A;  4YBH B;  5DKN A;  3DVK A;  3IF7 A;  2F8P A;  1REC A;  2Y4Q A;  2Y1M A;  2GGZ A;  2M0R A;  1MXL C;  3I5F B;  2MRD A;  1UP5 A;  3I5I B;  4HRE E;  1B9A A;  1SW8 A;  1NIW A;  4U8D A;  1KSO A;  2MA2 A;  2OS8 B;  4N1G A;  3SG4 A;  1QVI Y;  2LE9 B;  3WHT B;  2K0J A;  4PCW A;  4ETO A;  3GK1 A;  1F54 A;  1TOP A;  3VRQ A;  2MAZ A;  2GGM A;  2OTG B;  1CM1 A;  2AMI A;  3O4Y A;  3D0Y A;  3BUM B;  1DT7 B;  1QIW A;  1OZO A;  2EC6 C;  5HYD A;  2FOT A;  2K7B A;  3A8R A;  1ODB A;  4D1E A;  1JC2 A;  1IQ5 A;  1DJZ A;  3NXA A;  1R2U A;  4GGN A;  4WQ3 A;  3FWB A;  2ISD A;  5KU1 A;  2KQ6 A;  5F6T A;  3E3R A;  1EL4 A;  1RFJ A;  3JVT B;  5HKW A;  1D1O A;  1QX7 A;  3TUY C;  1F70 A;  2F2P A;  4TNC A;  3SG6 A;  3ZWH A;  1Y1A A;  1OE9 B;  2KDH A;  2OPO A;  2BEC A;  5KTY A;  1Y1X A;  3AAK A;  1BU3 A;  3DVM A;  2FCD A;  3KPX A;  2LLT A;  2ZRS A;  1MWN A;  1NCZ A;  2H61 A;  1HQV A;  5DKR A;  4DIR A;  1A2X A;  3LL8 B;  2CTN A;  2Q4U A;  5AFP A;  4P2Y B;  4CFQ A;  2BL0 C;  2WCF A;  1CMF A;  1SL9 A;  1JWD A;  2M8U A;  3I5G C;  4BY4 A;  1A75 A;  1LIN A;  4XJK B;  1BOC A;  4PE1 A;  2FJU B;  4PE7 A;  1J7Q A;  3TUY B;  4DUQ A;  2KBM A;  4PAL A;  1SY9 A;  4MEW A;  2RGI A;  1DGU A;  3MSE B;  2A4J A;  3RLZ A;  1B47 A;  5TNC A;  3A4U B;  2ZNE A;  1KK7 Y;  3KEV A;  3LK0 A;  2NXQ A;  4HSZ A;  3CR2 A;  2LMV A;  2NZ0 A;  3PAT A;  3BOW B;  2QAC A;  4USL A;  5HKY A;  2SAS A;  2SCP A;  1KK7 Z;  1Y6W A;  1M63 B;  1XFW O;  2F3Z A;  1CDL A;  1XVJ A;  2BL0 B;  4XYN A;  4ICB A;  5CSI A;  2EGD A;  3DF0 B;  1FI6 A;  1V1F A;  3BUX B;  4DRW A;  1C7W A;  4NQG A;  1EH2 A;  3OB1 B;  3SG7 A;  3ICB A;  1KFU L;  5K89 A;  2WCE A;  4YGD B;  2BCB A;  1UUS A;  1S3P A;  2K2A A;  3O78 A;  2PAS A;  4WRI A;  4AQI A;  3PSR A;  1B7T Y;  1EJ3 A;  2JT3 A;  4ORB B;  1YRU B;  5ER4 X;  1CFP A;  1B7T Z;  1BR4 B;  1ZFS A;  2HPS A;  2Q91 A;  2WCB A;  1CDN A;  4R1E A;  3EKJ A;  2KI6 C;  1MF8 B;  1OMD A;  1BMO A;  1GQM A;  4FQO A;  2JRF A;  1NX3 A;  4L9M A;  2F3Y A;  2FCE A;  2CCM A;  4MLW A;  4AOM A;  1KSM A;  1K96 A;  1CB1 A;  2B1U A;  3CR4 X;  1NPQ A;  2JXC A;  4NDC A;  3HCM A;  2LV7 A;  1B8R A;  1KWO C;  2JU0 A;  4YGB B;  2QPT A;  4FTG A;  1B4C A;  1F4Q A;  2NLN A;  1PVA A;  2PSR A;  1SL8 A;  1KFX L;  4OVN F;  1WRK A;  2EHB A;  1FW4 A;  2F2O A;  1B8C A;  5CSN A;  1GGW A;  2BBN A;  2JT0 A;  2I18 A;  5AXI A;  1W7I B;  5AAN A;  1U5I A;  3VRP A;  4GNK B;  1A4P A;  3FWC A;  1YVL A;  5J3X A;  4JPZ B;  3TS5 C;  1MR8 A;  1F71 A;  3OHM B;  4PE4 A;  4CLN A;  5PAL A;  3DVJ A;  4N5X A;  4CID A;  5B8I B;  4MZL A;  2L4I A;  3WXA A;  1YVH A;  4MN0 A;  1PRW A;  1KWO B;  5GQQ C;  4M2O A;  4WQ2 A;  3CTN A;  1K90 D;  1NSH A;  1JUO A;  2K7C A;  5D69 A;  3CWG A;  1SR6 C;  4GAO A;  1CLL A;  3SJS A;  1K94 A;  2K8M B;  1ZAC A;  1XFZ O;  2L4H A;  1K8U A;  4PHJ A;  3TDI A;  2CXJ A;  1GJY A;  2M97 A;  1M31 A;  5I8N A;  1RK9 A;  2V53 A;  1N65 A;  1QV1 A;  1L7Z A;  3BYA A;  5AER A;  3H4S E;  3KHE A;  1V1G A;  1TNQ A;  3NSK A;  1CKK A;  3ZNI A;  4DS7 A;  1NWD A;  1KQM C;  3WHU B;  2KSP A;  1UHH A;  3KF9 A;  3TS5 B;  2JT8 A;  2BBM A;  4GGF A;  5I2O A;  1DF0 B;  4A4C A;  2JTZ A;  1B1G A;  3RM1 A;  1LKJ A;  1UWO A;  1XFV O;  3LCP C;  1TCO B;  2PMY A;  2ZN9 A;  1MUX A;  1XK4 C;  2G2B A;  2KYF A;  2COL B;  1SR6 B;  2KOT A;  1AVS A;  1UUR A;  1YX8 A;  1M45 A;  1NP8 A;  1WRL A;  1QJT A;  2WND A;  3TDZ A;  1DJW A;  2KI6 D;  5AEQ A;  1C7V A;  1Q80 A;  2ZFD A;  5ER5 A;  2G9B A;  3LK1 A;  1SBJ A;  1QAS A;  2KNE A;  1SMG A;  2EC6 B;  3EVR A;  1WY9 A;  2HQW A;  2D8N A;  4ZCU A;  1QIV A;  2IS9 A;  1Y1U A;  1J7R A;  4CPV A;  1KQM B;  1YR5 A;  3EKH A;  1EXR A;  1BJF A;  3BUO B;  4C0L A;  1H4B A;  2LCP A;  1EG3 A;  1A29 A;  3EK4 A;  4I5J A;  1ZMZ A;  1LA0 A;  1PK0 D;  1SRA A;  1J1D A;  4XJK A;  5BPJ A;  3DVE A;  3JTD C;  4YGC B;  4YRU A;  1OMV A;  4ZCV A;  5JJG A;  4OKH A;  4NDD A;  3SG5 A;  4MRY A;  5HKZ A;  1FPW A;  2JOJ A;  1IQ3 A;  1SKT A;  1WLZ A;  2LM5 A;  3FIA A;  1YUU A;  1IJ5 A;  1RTP 1;  3AAJ A;  2PVB A;  3O2P A;  3BOW A;  1SCV A;  1TTX A;  5CPV A;  3OX5 A;  3EK7 A;  1ALV A;  2KAX A;  3OP0 A;  2LVJ A;  4ORC B;  4PDZ A;  1CMG A;  3I5G B;  1KK8 C;  1M46 A;  1TIZ A;  1OMR A;  1SNL A;  1LVC D;  1PSR A;  3DF0 A;  2KHN A;  1NX0 A;  1ZUZ A;  1BLQ A;  4C0J A;  1DJX A;  1S6J A;  1PVB A;  3WNX B;  3JTD B;  2LUC A;  2AUC A;  2Y5I A;  4PHK A;  3PN7 C;  2LUX A;  2HET A;  5JOL A;  1RWY A;  1QLK A;  1MXE A;  5HLO A;  3K21 A;  3VRO A;  1MHO A;  1UHK A;  2I2R E;  2LP2 A;  2M3W A;  2JXL A;  2MJW B;  2MLF C;  1CDP A;  2O5G A;  2CT9 A;  2LVV A;  4E68 A;  1CDM A;  3IQO A;  5FYX A;  2L50 A;  3I5H C;  4OCI A;  1JF2 A;  2KAY A;  3D10 A;  1KK8 B;  1S36 A;  4NDB A;  1JFJ A;  2KI4 C;  2ZN8 A;  1C07 A;  2L0P A;  2LAN A;  2LC5 A;  2JC2 A;  1S5G Y;  2KQY A;  1DTL A;  1PUL A;  2HF5 A;  3BUN B;  2MBX A;  2LVK A;  2H2K A;  1BF5 A;  1J7O A;  1FBV A;  1S5G Z;  2LAP A;  4Q04 A;  1DJY A;  1UHJ A;  2P6B B;  1J1E A;  1K95 A;  1DJI A;  3LLE A;  1XA5 A;  1N0Y A;  3PN7 B;  4OV2 A;  4BY5 A;  1BG1 A;  2LLU A;  1G4Y R;  2TN4 A;  2ZKM X;  3F45 A;  4QJ5 B;  2CNP A;  3I5I C;  2OS8 C;  2LP3 A;  1W7J B;  1NCY A;  2KAV A;  2MLE C;  4GBA A;  1JSA A;  1AHR A;  3AKB A;  1NYA A;  1J7P A;  1E8A A;  2BKH B;  2WOR A;  5G08 A;  1B8L A;  1CLM A;  1LXF C;  2JQ6 A;  1YUR A;  1OOJ A;  4C0K A;  4DCK A;  2DOQ A;  4MRX A;  1BR1 B;  1YUS A;  3M0W A;  1QXP A;  1QX5 B;  4HRG A;  2NCP A;  4PHN A;  3OX6 A;  1DGV A;  2LMT A;  3EVV A;  1YUT A;  1SPY A;  4I5K A;  2R2I A;  2M9G A;  3JVT C;  1TNW A;  2KFH A;  3BXK A;  1XFY O;  1OSA A;  5CSF A;  1S6C A;  1K2H A;  1G8I A;  2VRG A;  1K9K A;  2M29 A;  3KO0 A;  2WC8 A;  2H61 C;  4M2Q A;  1KFU S;  4PHM A;  2L98 A;  1QVI Z;  1IGV A;  1CM4 A;  1DF0 A;  1K9P A;  5KSZ A;  3D0Y B;  2KGR A;  3VRN A;  1QV0 A;  2M7N A;  3AKA A;  3C1V A;  1XFX O;  3EVU A;  3IQQ A;  5I2L A;  4AQJ A;  2JNF A;  2K61 A;  1QS7 A;  2L51 A;  1IKU A;  4F0Z B;  1KCY A;  1NX1 A;  1WLM A;  2L2E A;  4I5N B;  2M49 B;  1A03 A;  4A4B A;  1SCM C;  4PE0 A;  5CSJ A;  3TDU A;  1DJH A;  1RJV A;  1TNP A;  3SIB A;  2BE4 A;  4UPG A;  4GPL B;  1FI5 A;  1RRO A;  2ZND A;  3VGO A;  1SL7 A;  1K9U A;  2I7A A;  2I94 A;  1CFF A;  1ZOT B;  2HQ8 A;  1G33 A;  2K7D A;  1DVI A;  3PAL A;  1K93 D;  1KFX S;  1AP4 A;  1IRJ A;  3CZT X;  4YI8 A;  5HLV A;  4MBE A;  3NSL A;  1AUI B;  3PLF B;  3GK2 A;  1NX2 A;  2JNX A;  3PFV A;  1XK4 A;  2LNK A;  3CS1 A;  3EK8 A;  3TZ1 A;  2LMU A;  1CFD A;  4YGE B;  2CBL A;  2JUL A;  1UHN A;  1TRF A;  1SCM B;  3QRX A;  1YX7 A;  1AK8 A;  1A75 B;  2LHL A;  3PM8 A;  1NUB A;  1WDC C;  2AAO A;  2BE6 A;  3SIA A;  1H8B A;  2JPT A;  5DKQ A;  4JQ0 D;  2BKI B;  2LLS A;  2KFG A;  4MZK A;  1F8H A;  2PAL A;  4MZJ A;  2E30 A;  2NCO A;  3OB2 B;  2K7O A;  2K2F A;  2KGB C;  1IJ6 A;  2F33 A;  1Y0V H;  2KBI A;  2LVI A;  5IBW A;  1N2D A;  1LA3 A;  3BUW B;  4YGA A;  4IL1 A;  2M7L A;  3O6B A;  1TCF A;  1QLS A;  3VRR A;  4N1F A;  1GGZ A;  3NSI A;  1CFC A;  2KFF A;  2WOS A;  4QJ3 B;  1CTR A;  1SK6 D;  1EG4 A;  2JTT A;  2M1U A;  3FS7 A;  4OR9 B;  2GV5 A;  1MQ1 A;  1R6P A;  1X02 A;  1XO5 A;  1S1E A;  1WDC B;  1IH0 A;  1BT6 A;  4P5O E;  1ALW A;  1S26 D;  2BCA A;  5I2Q A;  1F4O A;  4MSP A;  3SG3 A;  1YTZ C;  2M1K B;  1JF0 A;  1XFU O;  2LHI A;  3CGA A;  3DD4 A;  1OZS A;  3GK4 X;  4MVF A;  1BOD A;  1IG5 A;  1VRK A;  3BQ3 A;  1UHI A;  1L2O C;  1IWQ A;  1TN4 A;  4ORA B;  1WRZ A;  1YRT B;  2ZRT A;  1TNX A;  2KYC A;  3CR5 X;  3I5F C;  1HT9 A;  1CNP A;  1FF1 A;  1M39 A;  4CFR A;  1JFK A;  4QJ4 B;  1KQV A;  1F55 A;  4M2P A;  1PAL A;  1J55 A;  2BCX A;  2MHH A;  2JWW A;  4I5L B;  1CLB A;  4GUK A;  1DMO A;  1AJ5 A;  1SYM A;  4YI9 A;  3HX4 A;  1QAT A;  2JZI A;  3I5H B;  2Y1N A;  3NSO A;  4JWQ A;  1QX2 A;  2OTG C;  3SG2 A;  2PRU A;  1DJG A;  1PSB A;  1S6I A;  1QTX A;  5D7F A;  1OQP A;  1U5I B;  2KI4 B;  2E6W A;  2L5X B;  4GFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...