3FWBA

Sac3:sus1:cdc31 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
153
Chain Sequence
QSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, transcription
molecule keywords Cell division control protein 31
publication title Sus1, Cdc31, and the Sac3 CID region form a conserved interaction platform that promotes nuclear pore association and mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 52
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3fwbA01
1NP8A 3JVTB 1KK8B 2L50A 4YGBB 5G08A 2KOTA 1ZUZA 3EK8A 4AOMA 1ODBA 3SG5A 5K89A 1F4QA 2MA2A 4C0LA 2KYFA 1QASA 2KGRA 4L9MA 1U5IB 2K7CA 1DF0A 4MRXA 2AMIA 2JT0A 3LL8B 1PULA 3D0YA 4PCWA 1SPYA 4HREE 1DVIA 2HETA 2KAYA 1JSAA 4PE7A 2WC8A 1YUTA 1KSMA 2JT3A 1GQMA 1YX8A 3VROA 2FCDA 2BCXA 2F33A 2O5GA 3EKJA 4AQIA 2LUCA 1D1OA 1KFXL 1SKTA 3GOFA 1ZFSA 4TNCA 2KBIA 3BQ3A 1J1EA 4MZJA 4QJ5B 1CM1A 1LVCD 2K61A 1CMFA 2KI6D 1BJFA 1UURA 2I18A 5CSIA 1B8RA 1JFKA 5AANA 1K9PA 4N1FA 3KHEA 2ZRTA 1S6IA 2H61C 3KF9A 1QS7A 3OB1B 4DCKA 3SG6A 1CLBA 4D1EA 3DD4A 5HKWA 3AKAA 2LMVA 2F3YA 1NCYA 1IJ6A 1NX3A 4UPGA 2LC5A 3SG7A 4DUQA 4YI8A 2BECA 1VRKA 2DOQA 3VGOA 1RWYA 1CM4A 1BG1A 1IG5A 1DJWA 4JWQA 4C0KA 4GUKA 1YRUB 3LK0A 4GNKB 2IS9A 3SG2A 5ER5A 2CTNA 5D7FA 1CFCA 5KTYA 2Y1MA 1A29A 1SW8A 4PALA 2LP3A 1YR5A 1YVHA 1UHHA 1K95A 1SCMB 3KO0A 1K9KA 4M2QA 2LAPA 4ZCVA 5HKYA 2PRUA 1SR6B 3M0WA 4DIRA 2ZN9A 2NXQA 4FQOA 4YRUA 2ZKMX 1JWDA 2KI4B 1JF2A 1QX5B 2LM5A 2M3WA 3DVJA 1CB1A 1LA0A 2KHNA 2CNPA 3EVUA 3I5HB 1DF0B 1B7TY 1UHKA 1N65A 1KFUL 4BY5A 1YX7A 3D0YB 1TCFA 1CDLA 1TIZA 2QACA 1XYDA 4NDDA 3DVKA 1B47A 4ICBA 1EG3A 4NQGA 2A4JA 2LHLA 3IQOA 2OPOA 2ZNEA 2QPTA 4XJKA 3I5IC 1EJ3A 3BUXB 2OS8B 4E68A 3O78A 1RFJA 2LANA 2F2OA 1LXFC 2WCBA 1GGWA 3RM1A 1J7OA 4PHJA 1XFWO 3BUMB 1BR4B 1IKUA 5TNCA 1NUBA 2WCFA 2LUXA 2PMYA 1KK7Y 1SBJA 1DTLA 3NSIA 1DGUA 2L5XB 1B8CA 4MN0A 1F4OA 2SCPA 2Q91A 4MEWA 3SIAA 1TRFA 3OX5A 1OOJA 1IGVA 1K96A 4PDZA 1JUOA 1QIWA 4MVFA 5HKZA 3GK1A 1Y6WA 4GAOA 1C7WA 2M1KB 2NLNA 3TZ1A 2WOSA 2F2PA 4M2OA 1SL9A 1WLZA 2KNEA 3I5GB 2LCPA 2JZIA 2PALA 5DKQA 1CFDA 3ZNIA 2EC6B 5I8NA 5I2LA 4GPLB 1SL8A 1NPQA 1K94A 2I2RE 3TDIA 5KSZA 2OS8C 1CLMA 3LLEA 1DJIA 1OE9B 1CKKA 4PHMA 3AKBA 1MXEA 2LVVA 1DGVA 2AUCA 2MRDA 1Y0VH 1B4CA 4ZCUA 1CNPA 3DVEA 5J3XA 1AVSA 2JXCA 3IQQA 1QX2A 3A4UB 1QLKA 1AUIB 4ORBB 2BL0C 2LLUA 3AAJA 4XJKB 1S3PA 1A4PA 2CCMA 1QXPA 1Y1UA 1MR8A 1MQ1A 2KGBC 3O4YA 4HRHA 1B1GA 2BE6A 2F3ZA 2L4IA 2M7NA 1QATA 5DKNA 4NDBA 3EVVA 1JFJA 1K2HA 1WY9A 3ICBA 2LHIA 4OVNF 5CSNA 2JWWA 1CDPA 3HCMA 4YGAA 2BKIB 1S1EA 2CBLA 3I5GC 1KQVA 4MRYA 1YTZC 3PFVA 2ZRSA 1LKJA 2EC6C 3BOWA 1QVIZ 3SG3A 3LCPC 5GQQC 3SJSA 3D10A 4MZLA 1OZOA 5CSJA 2F8PA 2K2FA 2KAVA 3CS1A 1MWNA 2M9GA 1NSHA 3I5IB 4GGFA 3RLZA 5AEQA 1TN4A 1FI6A 3DVMA 1UHIA 2PASA 3PN7C 1N0YA 1YURA 4FTGA 2JT8A 4DRWA 2KI6C 2MLEC 2EGDA 5JJGA 1SNLA 1ALVA 1SK6D 4NDCA 1G33A 3EKHA 2KFHA 5AXIA 4IL1A 2KDHA 1AK8A 1F71A 4GBAA 2R2IA 4YGCB 4PHKA 4CPVA 2B1UA 2KQ6A 1JF0A 2JULA 1UP5A 1UUSA 2BKHB 3FWCA 3I5FC 5PALA 2MHHA 1CDNA 2MJWB 3BYAA 1KWOB 1GGZA 3PSRA 4CFRA 1FBVA 4QJ3B 2PVBA 2Y5IA 4I5JA 4ETOA 1L2OC 3EK7A 2K7OA 2LVJA 1CTRA 2I7AA 1G4YR 2GGMA 3WNXB 1EH2A 2NZ0A 1J55A 5ER4X 1XA5A 1QV0A 1PRWA 3GK4X 3PLFB 4YGDB 3QRXA 2SASA 1K9UA 3K21A 2JNFA 2G9BA 3TDUA 1F54A 1BMOA 2M1UA 3OP0A 4WQ2A 5I2OA 1H4BA 1KSOA 4PE4A 1CLLA 1RROA 2O60A 4GFTA 4ORCB 3OHMB 3O6BA 2AAOA 1ZOTB 1FPWA 3ZWHA 1YVLA 2K2AA 3E3RA 4A4BA 1NX2A 3AAKA 1NWDA 1NCZA 1XFZO 3TS5B 3BOWB 1K8UA 1A2XA 1C07A 2GV5A 2L4HA 1C7VA 1RJVA 1WDCC 2M0RA 2V53A 2BL0B 3LK1A 1N2DA 2CXJA 2D8NA 3FS7A 2K0JA 1TNWA 1Y1XA 1M46A 3BXKA 3HX4A 2M7LA 1OZSA 4I5KA 1XK4A 4WQ3A 1KWOC 4PE1A 2L0PA 1RK9A 3NSLA 5AFPA 1CFPA 1ZACA 3IF7A 2G2BA 3CR2A 4N1GA 2L98A 4CFQA 1DMOA 4JPZB 1QLSA 1A03A 1B7TZ 2TN4A 3GK2A 5IBWA 1M39A 1M31A 1X02A 2JPTA 4YI9A 1B9AA 1EG4A 1PVBA 1UHJA 1AHRA 1S36A 4N5XA 2VRGA 1V1FA 3WXAA 2LMTA 1JC2A 1DJZA 2FJUB 1SCVA 2Q4UA 2EHBA 2BCAA 4I5NB 3PN7B 3VRNA 1A75A 1KQMB 2K8MB 2K7DA 3BUOB 2KSPA 3CLNA 3FIAA 2Y1NA 4CIDA 3BUWB 1IWQA 1BU3A 3TS5C 2LVIA 2GGZA 1QVIY 1SY9A 3CWGA 3PATA 1PSBA 1Y1AA 4USLA 4ORAB 5B8IB 1KK7Z 1QTXA 1PSRA 2K7BA 4GGFC 5BPJA 1YUSA 1UWOA 1Q80A 1RTP1 4WRIA 2M29A 4MSPA 1G8IA 1WRLA 3I5FB 1V1GA 2BBNA 2Y4QA 2M97A 4U8DA 1SMGA 3OX6A 1PALA 1EL4A 4P5OE 3VRQA 1L2OB 2LVKA 4OKHA 2NCOA 2LLTA 1FI5A 5HLOA 1BODA 2LE9B 3TUYC 1LA3A 1UHNA 2P6BB 4MBEA 1PK0D 3OB2B 3TDZA 3NSKA 1S5GZ 1RECA 1WRZA 2KQYA 3EK4A 2RGIA 4I5LB 2LLSA 3C1VA 3CZTX 1R6PA 1KCYA 3DF0A 1KFXS 1IQ5A 1TNQA 1KQMC 1OQPA 1F8HA 3NSOA 1BOCA 1M63B 4AQJA 1FF1A 4PHNA 1DJYA 1SYMA 2JOJA 1BF5A 1BR1B 1TNXA 1W7JB 2FCEA 2JU0A 2LNKA 2ZFDA 3A8RA 4XYNA 1TOPA 2HQ8A 1XFVO 2JQ6A 2JTTA 1MF8B 1WDCB 1MUXA 3F45A 5FYXA 2M49B 4PE0A 1OMVA 3VRRA 1EXRA 3JVTC 2LV7A 1KK8C 1XFYO 1OMRA 1TTXA 2BBMA 3CGAA 4F0ZB 3BUNB 5KU1A 2L2EA 1A75B 1LINA 2MLFC 1K90D 1BLQA 1B8LA 1L7ZA 4R1EA 1IH0A 2H2KA 2MBXA 5CPVA 4A4CA 4OCIA 2CT9A 2E30A 3KEVA 2NCPA 1QX7A 2ZN8A 2KFFA 1TCOB 2WNDA 1ZMZA 1NX0A 2WORA 2JC2A 2H61A 2KFGA 2HQWA 1XK4C 3KPXA 1IRJA 2JNXA 4OR9B 4QJ4B 1PVAA 2I94A 2FOTA 1F70A 1FW4A 3O2PA 1J7PA 5D69A 1S6JA 1J7RA 1E8AA 2JTZA 3CR5X 1AP4A 2KAXA 2OTGB 1KFUS 1U5IA 2LP2A 3JTDB 4JQ0D 2BE4A 2PSRA 1DT7B 1WRKA 5DKRA 3PM8A 1DJXA 4HRGA 1XVJA 1IJ5A 4YGEB 2HPSA 1MHOA 1H8BA 5JOLA 1SL7A 2L51A 1ALWA 3DF0B 4CLNA 1JBAA 5CSFA 4YBHB 4M2PA 2MAZA 1QIVA 3WHTB 1J7QA 4BY4A 1NCXA 2KBMA 2WCEA 1SRAA 1NX1A 3CR4X 3SIBA 5HYDA 1CMGA 3WHUB 2ZNDA 1M45A 2HF5A 4GGNA 2LMUA 1HQVA 2ISDA 1AJ4A 1AJ5A 1XO5A 1QV1A 3TUYB 1CFFA 3SG4A 1YUUA 1SCMC 4C0JA 4OV2A 2JXLA 1XFUO 1SR6C 3FWBA 1J1DA 1DJGA 1OMDA 1OSAA 1XFXO 3VRPA 1S26D 2KI4C 2E6WA 2KYCA 2M8UA 4HSZA 1DJHA 1TNPA 5F6TA 1BT6A 3I5HC 4MZKA 1F55A 1MXLC 2OTGC 3EVRA 3JTDC 1R2UA 1QJTA 1HT9A 1K93D 2BCBA 3CTNA 4Q04A 1CDMA 2JRFA 3NXAA 1S6CA 4DS7A 1NIWA 5HLVA 1NYAA 3PALA 2COLB 1S5GY 4MLWA 1W7IB 5I2QA 1YRTB 4P2YB 1GJYA 3H4SE 3MSEB 1IQ3A 5AERA 1WLMA
chains in the Genus database with same CATH superfamily
1NP8A 3JVTB 1KK8B 2L50A 4YGBB 5G08A 2KOTA 1ZUZA 3EK8A 4AOMA 1ODBA 3S0BA 3SG5A 5K89A 1F4QA 2MA2A 4C0LA 2KYFA 1QASA 2KGRA 4L9MA 1U5IB 2K7CA 1DF0A 4MRXA 2AMIA 2JT0A 3LL8B 1PULA 3D0YA 4PCWA 1SPYA 4HREE 1DELA 1DVIA 2HETA 2KAYA 3BFHA 1JSAA 4PE7A 2WC8A 3B86A 1YUTA 1KSMA 2JT3A 1GQMA 3B7AA 1YX8A 3VROA 2FCDA 2BCXA 2F33A 2O5GA 3EKJA 4AQIA 2LUCA 3L4AA 1KFXL 1SKTA 3GOFA 1D1OA 1ZFSA 4TNCA 2KBIA 3BQ3A 1J1EA 4MZJA 4QJ5B 1CM1A 1LVCD 2K61A 1CMFA 2KI6D 1BJFA 1UURA 2I18A 5CSIA 1B8RA 1JFKA 5AANA 1K9PA 4N1FA 3KHEA 2ZRTA 1S6IA 2H61C 3KF9A 1QS7A 3OB1B 4DCKA 3SG6A 1CLBA 4D1EA 3DD4A 2WCHA 5HKWA 3AKAA 2LMVA 2F3YA 1NCYA 1IJ6A 1NX3A 4UPGA 2LC5A 3SG7A 4DUQA 4YI8A 2BECA 1VRKA 5I94A 2DOQA 3VGOA 1RWYA 1CM4A 1OOFA 1BG1A 1IG5A 3PM2A 1LS8A 1DJWA 4JWQA 4C0KA 4GUKA 1YRUB 2L5YA 3LK0A 4GNKB 2IS9A 3SG2A 5ER5A 2CTNA 5D7FA 1DC1A 1CFCA 5KTYA 2Y1MA 3CZ2A 1A29A 1SW8A 2QEVA 4PALA 2LP3A 1YR5A 1YVHA 1UHHA 1K95A 1SCMB 3KO0A 1K9KA 4M2QA 2LAPA 4ZCVA 5HKYA 2PRUA 1SR6B 3M0WA 4DIRA 2ZN9A 2NXQA 4FQOA 4YRUA 2ZKMX 1JWDA 2KI4B 1JF2A 2WCMA 1QX5B 2LM5A 2M3WA 2WCJA 3DVJA 1LA0A 1CB1A 2KHNA 2CNPA 3EVUA 3I5HB 1DF0B 1B7TY 1UHKA 1N65A 1KFUL 4BY5A 1YX7A 3D0YB 1TCFA 3FE9A 1CDLA 3R1OA 1TIZA 2BNXA 1XYDA 2QACA 2WCKA 3DVKA 1B47A 4ICBA 4NDDA 1EG3A 2KLEA 2A4JA 2LHLA 3IQOA 4NQGA 2OPOA 2ZNEA 2QPTA 4XJKA 3I5IC 3RZSA 1TUJA 1EJ3A 3BUXB 2OS8B 4E68A 3O78A 1RFJA 2LANA 2F2OA 1LXFC 2WCBA 1GGWA 3RM1A 1J7OA 4PHJA 1XFWO 3BUMB 1BR4B 3D75A 1IKUA 2P70A 5TNCA 1NUBA 2WCFA 2LUXA 2PMYA 3S0EA 1KK7Y 1SBJA 1DTLA 3NSIA 1DGUA 3S0FA 2L5XB 1B8CA 4MN0A 1F4OA 2SCPA 2Q91A 4MEWA 3SIAA 1TRFA 3OX5A 1OOJA 1IGVA 1K96A 4FQTA 4PDZA 3K1EA 1JUOA 1QIWA 4MVFA 5HKZA 3GK1A 1Y6WA 4GAOA 1C7WA 2L2CA 2M1KB 2NLNA 3TZ1A 2WOSA 3B6XA 2F2PA 4M2OA 1SL9A 1WLZA 2KNEA 2QEHA 3I5GB 2LCPA 5FI2A 2JZIA 3CZ0A 5D3OA 2K60A 2PALA 2QDIA 5DKQA 1CFDA 2QEOA 3ZNIA 3D73A 2EC6B 2YGUA 5I8NA 5DICA 5I2LA 4GPLB 1SL8A 1NPQA 1K94A 3IVTA 2I2RE 3L4LA 3TDIA 5KSZA 2OS8C 1CLMA 3LLEA 1DJIA 1OE9B 1CKKA 4PHMA 3AKBA 1MXEA 2LVVA 1DGVA 2AUCA 2MRDA 1Y0VH 1B4CA 4ZCUA 1CNPA 3CABA 1XFRA 3DVEA 3UO9A 5J3XA 1AVSA 2JXCA 3IQQA 1QX2A 3A4UB 1QLKA 1AUIB 4ORBB 2BL0C 1OOGA 2LLUA 3AAJA 4XJKB 1S3PA 1A4PA 2CCMA 1QXPA 1Y1UA 1MR8A 1MQ1A 2KGBC 3O4YA 4HRHA 1B1GA 3S0DA 2BE6A 2F3ZA 2L4IA 2M7NA 1QATA 5DKNA 4NDBA 3EVVA 1JFJA 1K2HA 1WY9A 3ICBA 2LHIA 4OVNF 5CSNA 2JWWA 1CDPA 3HCMA 4YGAA 2BKIB 3EG5B 5FI6A 1S1EA 2CBLA 3I5GC 1KQVA 3UNWA 4MRYA 1YTZC 3PFVA 2ZRSA 1LKJA 2EC6C 3BOWA 1QVIZ 3SG3A 3LCPC 5GQQC 3SJSA 3D10A 3L47A 1OZOA 4KYNA 4MZLA 5CSJA 2F8PA 2K2FA 2KAVA 3CS1A 1MWNA 2M9GA 1NSHA 3I5IB 3SS3A 4GGFA 3RLZA 4INXA 1TN4A 5AEQA 1FI6A 3DVMA 1SSEB 1UHIA 2PASA 3PN7C 1N0YA 1YURA 3B87A 4FTGA 2JT8A 4DRWA 2KI6C 2MLEC 2EGDA 5JJGA 1SNLA 1ALVA 1SK6D 4NDCA 1G33A 3EKHA 4INWA 2GTEA 3PJIA 3S0AA 2KFHA 5AXIA 4IL1A 2KDHA 1AK8A 4PT1A 4GBAA 2R2IA 4YGCB 1F71A 4PHKA 4CPVA 2B1UA 2KQ6A 1JF0A 2JULA 1UP5A 1UUSA 2BKHB 3FWCA 3I5FC 5PALA 2MHHA 3SS5A 1CDNA 2MJWB 3BYAA 1KWOB 1GGZA 3PSRA 4CFRA 1FBVA 1TWOA 4QJ3B 2PVBA 2Y5IA 3VB1A 4I5JA 4ETOA 1L2OC 3EK7A 2K7OA 2LVJA 1CTRA 2I7AA 1G4YR 2GGMA 3O4XA 3WNXB 1EH2A 2NZ0A 1J55A 5ER4X 1XA5A 1QV0A 1PRWA 3GK4X 3PLFB 4YGDB 3QRXA 2SASA 1K9UA 3K21A 2JNFA 2G9BA 3TDUA 1F54A 1BMOA 2M1UA 3OP0A 4WQ2A 5I2OA 1H4BA 1KSOA 3DYEA 4PE4A 1CLLA 1RROA 2KLDA 2O60A 4GFTA 4ORCB 2WC5A 3O6BA 3D77A 2AAOA 3OHMB 2H8VA 1ZOTB 1FPWA 3ZWHA 2P71A 1YVLA 2K2AA 3E3RA 2PQLA 4A4BA 1NX2A 3AAKA 1NWDA 1NCZA 1XFZO 3TS5B 3BOWB 1K8UA 1A2XA 1C07A 2GV5A 2L4HA 1C7VA 1RJVA 1WDCC 2M0RA 2V53A 2BL0B 3LK1A 1N2DA 1ORGA 3S0GA 2CXJA 2D8NA 3FS7A 2K0JA 1TNWA 1Y1XA 1M46A 3BXKA 3HX4A 2M7LA 1OZSA 4I5KA 3V2LA 1XK4A 4WQ3A 1KWOC 3BFAA 4PE1A 2L0PA 1RK9A 3D78A 3NSLA 5AFPA 1CFPA 1ZACA 1IIOA 3IF7A 3D74A 2G2BA 3CR2A 4N1GA 2ERBA 2L98A 4CFQA 1DMOA 4JPZB 1QLSA 3CDNA 1A03A 1B7TZ 3FE8A 2TN4A 1W9ZA 3GK2A 4IJ7A 5IBWA 1M39A 1M31A 1X02A 2JPTA 4YI9A 1B9AA 1Z4HA 1EG4A 1PVBA 1UHJA 1AHRA 1S36A 4N5XA 3DY9A 1OOHA 2VRGA 1V1FA 3WXAA 2LMTA 3N7HA 1JC2A 1DJZA 2FJUB 4F7FA 1SCVA 2Q4UA 2EHBA 2BCAA 4I5NB 3PN7B 3VRNA 1A75A 1KQMB 2K8MB 2K7DA 3BUOB 2KSPA 3CLNA 3FIAA 2Y1NA 4CIDA 3BUWB 1IWQA 1BU3A 3TS5C 2LVIA 2GGZA 1QVIY 1SY9A 3CWGA 3PATA 2WCLA 1PSBA 1Y1AA 4USLA 4ORAB 5B8IB 1KK7Z 1QTXA 1PSRA 2K7BA 4GGFC 5BPJA 4JD9A 1YUSA 1UWOA 1Q80A 1RTP1 3NHIA 2M29A 4MSPA 4WRIA 1G8IA 1WRLA 3I5FB 1V1GA 2BBNA 2Y4QA 2M97A 4U8DA 1SMGA 3OX6A 1PALA 1EL4A 4P5OE 3VRQA 3QMEA 1L2OB 2LVKA 3Q8IA 4OKHA 2NCOA 2LLTA 3D76A 1FI5A 1Z2CB 5HLOA 1BODA 3B88A 2LE9B 3TUYC 1LA3A 1UHNA 2P6BB 4MBEA 1PK0D 3OB2B 3TDZA 3NSKA 1S5GZ 1RECA 1WRZA 2KQYA 3EK4A 1T14A 2RGIA 4I5LB 1C3ZA 2LLSA 3C1VA 3CZTX 1R6PA 1KCYA 3DF0A 1KFXS 2BAPA 3R72A 1IQ5A 1TNQA 1KQMC 1OQPA 1F8HA 3NSOA 2PYQA 1BOCA 1M63B 4AQJA 1FF1A 4PHNA 1DJYA 1SYMA 2JOJA 1BF5A 1BR1B 1TNXA 1W7JB 2FCEA 4JKTA 2JU0A 2LNKA 2ZFDA 3A8RA 4XYNA 1TOPA 5FI7A 2HQ8A 1XFVO 2JQ6A 2JTTA 1MF8B 1WDCB 2QEBA 1MUXA 3F45A 5FYXA 2M49B 4PE0A 1OMVA 3OBVA 3VRRA 1EXRA 3JVTC 2LV7A 1KK8C 1XFYO 1OMRA 1TTXA 2BBMA 3CGAA 4F0ZB 3BUNB 5KU1A 2L2EA 1A75B 1LINA 2MLFC 1K90D 3OGNA 1BLQA 1B8LA 1L7ZA 4R1EA 1IH0A 3SS4A 2H2KA 2KPHA 3BFBA 2MBXA 5HL1A 5CPVA 4A4CA 4OCIA 2CT9A 2E30A 3KEVA 2JPOA 2NCPA 1QX7A 2ZN8A 2KFFA 1TCOB 2WNDA 1ZMZA 1NX0A 3R1VA 2WORA 2JC2A 2H61A 2KFGA 2HQWA 1XK4C 3KPXA 1IRJA 2JNXA 5EL2A 2FJYA 4OR9B 4QJ4B 1PVAA 2I94A 2FOTA 3R1PA 1C3YA 1F70A 1FW4A 1DEKA 3O2PA 1J7PA 5D69A 1GM0A 1S6JA 1J7RA 1E8AA 2JTZA 3CR5X 1AP4A 2KAXA 2OTGB 1KFUS 1U5IA 2LP2A 3JTDB 4JQ0D 2BE4A 2PSRA 2WC6A 1DT7B 1WRKA 5DKRA 3PM8A 1DJXA 4HRGA 3BJHA 1XVJA 1IJ5A 4YGEB 2HPSA 1MHOA 1H8BA 5JOLA 1SL7A 2L51A 1ALWA 3DF0B 4OZDA 4CLNA 5CSFA 1JBAA 4YBHB 4M2PA 2MAZA 1QIVA 3WHTB 1J7QA 4BY4A 1NCXA 1DQEA 2KBMA 2WCEA 1SRAA 1NX1A 3CR4X 3SIBA 3NGVA 3DZTA 3WHUB 2ZNDA 5HYDA 1M45A 1CMGA 2HF5A 4GGNA 2LMUA 1HQVA 2ISDA 1AJ4A 1AJ5A 1P28A 1TUZA 1XO5A 1QV1A 3TUYB 1CFFA 3SG4A 1YUUA 1SCMC 3NHTA 4C0JA 4OV2A 2JXLA 1XFUO 1SR6C 3FWBA 1J1DA 1DJGA 1OMDA 1OSAA 1XFXO 3CYZA 3VRPA 1S26D 2KI4C 2E6WA 2KYCA 2M8UA 4HSZA 1DJHA 1TNPA 5F6TA 1QWVA 1BT6A 3I5HC 4MZKA 1F55A 1MXLC 2OTGC 3EVRA 3JTDC 1R2UA 1OW4A 1QJTA 1HT9A 1K93D 2BCBA 3CTNA 4Q04A 1CDMA 2JRFA 3NXAA 1S6CA 4DS7A 1NIWA 5HLVA 3DXLA 1NYAA 3PALA 2COLB 1S5GY 4MLWA 1W7IB 5I2QA 1YRTB 3CZ1A 4P2YB 1GJYA 3H4SE 3MSEB 1OOIX 1IQ3A 3FE6A 5AERA 1WLMA
chains in the Genus database with same CATH topology
1NP8A 3JVTB 1KK8B 2L50A 4YGBB 5G08A 2KOTA 1ZUZA 3EK8A 4AOMA 1ODBA 3SG5A 5K89A 1F4QA 2MA2A 4C0LA 2KYFA 1QASA 2KGRA 4L9MA 1U5IB 2K7CA 1DF0A 4MRXA 2AMIA 2JT0A 3LL8B 1PULA 3D0YA 4PCWA 1SPYA 4HREE 1DVIA 2HETA 2KAYA 1JSAA 4PE7A 2WC8A 1YUTA 1KSMA 2JT3A 1GQMA 1YX8A 3VROA 2FCDA 2BCXA 2F33A 2O5GA 3EKJA 4AQIA 2LUCA 1D1OA 1KFXL 1SKTA 3GOFA 1ZFSA 4TNCA 2KBIA 3BQ3A 1J1EA 4MZJA 4QJ5B 1CM1A 1LVCD 2K61A 1CMFA 2KI6D 1BJFA 1UURA 2I18A 5CSIA 1B8RA 1JFKA 5AANA 1K9PA 4N1FA 3KHEA 2ZRTA 1S6IA 2H61C 3KF9A 1QS7A 3OB1B 4DCKA 3SG6A 1CLBA 4D1EA 3DD4A 5HKWA 3AKAA 2LMVA 2F3YA 1NCYA 1IJ6A 1NX3A 4UPGA 2LC5A 3SG7A 4DUQA 4YI8A 2BECA 1VRKA 2DOQA 3VGOA 1RWYA 1CM4A 1BG1A 1IG5A 1DJWA 4JWQA 4C0KA 4GUKA 1YRUB 3LK0A 4GNKB 2IS9A 3SG2A 5ER5A 2CTNA 5D7FA 1CFCA 5KTYA 2Y1MA 1A29A 1SW8A 4PALA 2LP3A 1YR5A 1YVHA 1UHHA 1K95A 1SCMB 3KO0A 1K9KA 4M2QA 2LAPA 4ZCVA 5HKYA 2PRUA 1SR6B 3M0WA 4DIRA 2ZN9A 2NXQA 4FQOA 4YRUA 2ZKMX 1JWDA 2KI4B 1JF2A 1QX5B 2LM5A 2M3WA 3DVJA 1CB1A 1LA0A 2KHNA 2CNPA 3EVUA 3I5HB 1DF0B 1B7TY 1UHKA 1N65A 1KFUL 4BY5A 1YX7A 3D0YB 1TCFA 1CDLA 1TIZA 2QACA 1XYDA 4NDDA 3DVKA 1B47A 4ICBA 1EG3A 4NQGA 2A4JA 2LHLA 3IQOA 2OPOA 2ZNEA 2QPTA 4XJKA 3I5IC 1EJ3A 3BUXB 2OS8B 4E68A 3O78A 1RFJA 2LANA 2F2OA 1LXFC 2WCBA 1GGWA 3RM1A 1J7OA 4PHJA 1XFWO 3BUMB 1BR4B 1IKUA 5TNCA 1NUBA 2WCFA 2LUXA 2PMYA 1KK7Y 1SBJA 1DTLA 3NSIA 1DGUA 2L5XB 1B8CA 4MN0A 1F4OA 2SCPA 2Q91A 4MEWA 3SIAA 1TRFA 3OX5A 1OOJA 1IGVA 1K96A 4PDZA 1JUOA 1QIWA 4MVFA 5HKZA 3GK1A 1Y6WA 4GAOA 1C7WA 2M1KB 2NLNA 3TZ1A 2WOSA 2F2PA 4M2OA 1SL9A 1WLZA 2KNEA 3I5GB 2LCPA 2JZIA 2PALA 5DKQA 1CFDA 3ZNIA 2EC6B 5I8NA 5I2LA 4GPLB 1SL8A 1NPQA 1K94A 2I2RE 3TDIA 5KSZA 2OS8C 1CLMA 3LLEA 1DJIA 1OE9B 1CKKA 4PHMA 3AKBA 1MXEA 2LVVA 1DGVA 2AUCA 2MRDA 1Y0VH 1B4CA 4ZCUA 1CNPA 3DVEA 5J3XA 1AVSA 2JXCA 3IQQA 1QX2A 3A4UB 1QLKA 1AUIB 4ORBB 2BL0C 2LLUA 3AAJA 4XJKB 1S3PA 1A4PA 2CCMA 1QXPA 1Y1UA 1MR8A 1MQ1A 2KGBC 3O4YA 4HRHA 1B1GA 2BE6A 2F3ZA 2L4IA 2M7NA 1QATA 5DKNA 4NDBA 3EVVA 1JFJA 1K2HA 1WY9A 3ICBA 2LHIA 4OVNF 5CSNA 2JWWA 1CDPA 3HCMA 4YGAA 2BKIB 1S1EA 2CBLA 3I5GC 1KQVA 4MRYA 1YTZC 3PFVA 2ZRSA 1LKJA 2EC6C 3BOWA 1QVIZ 3SG3A 3LCPC 5GQQC 3SJSA 3D10A 4MZLA 1OZOA 5CSJA 2F8PA 2K2FA 2KAVA 3CS1A 1MWNA 2M9GA 1NSHA 3I5IB 4GGFA 3RLZA 5AEQA 1TN4A 1FI6A 3DVMA 1UHIA 2PASA 3PN7C 1N0YA 1YURA 4FTGA 2JT8A 4DRWA 2KI6C 2MLEC 2EGDA 5JJGA 1SNLA 1ALVA 1SK6D 4NDCA 1G33A 3EKHA 2KFHA 5AXIA 4IL1A 2KDHA 1AK8A 1F71A 4GBAA 2R2IA 4YGCB 4PHKA 4CPVA 2B1UA 2KQ6A 1JF0A 2JULA 1UP5A 1UUSA 2BKHB 3FWCA 3I5FC 5PALA 2MHHA 1CDNA 2MJWB 3BYAA 1KWOB 1GGZA 3PSRA 4CFRA 1FBVA 4QJ3B 2PVBA 2Y5IA 4I5JA 4ETOA 1L2OC 3EK7A 2K7OA 2LVJA 1CTRA 2I7AA 1G4YR 2GGMA 3WNXB 1EH2A 2NZ0A 1J55A 5ER4X 1XA5A 1QV0A 1PRWA 3GK4X 3PLFB 4YGDB 3QRXA 2SASA 1K9UA 3K21A 2JNFA 2G9BA 3TDUA 1F54A 1BMOA 2M1UA 3OP0A 4WQ2A 5I2OA 1H4BA 1KSOA 4PE4A 1CLLA 1RROA 2O60A 4GFTA 4ORCB 3OHMB 3O6BA 2AAOA 1ZOTB 1FPWA 3ZWHA 1YVLA 2K2AA 3E3RA 4A4BA 1NX2A 3AAKA 1NWDA 1NCZA 1XFZO 3TS5B 3BOWB 1K8UA 1A2XA 1C07A 2GV5A 2L4HA 1C7VA 1RJVA 1WDCC 2M0RA 2V53A 2BL0B 3LK1A 1N2DA 2CXJA 2D8NA 3FS7A 2K0JA 1TNWA 1Y1XA 1M46A 3BXKA 3HX4A 2M7LA 1OZSA 4I5KA 1XK4A 4WQ3A 1KWOC 4PE1A 2L0PA 1RK9A 3NSLA 5AFPA 1CFPA 1ZACA 3IF7A 2G2BA 3CR2A 4N1GA 2L98A 4CFQA 1DMOA 4JPZB 1QLSA 1A03A 1B7TZ 2TN4A 3GK2A 5IBWA 1M39A 1M31A 1X02A 2JPTA 4YI9A 1B9AA 1EG4A 1PVBA 1UHJA 1AHRA 1S36A 4N5XA 2VRGA 1V1FA 3WXAA 2LMTA 1JC2A 1DJZA 2FJUB 1SCVA 2Q4UA 2EHBA 2BCAA 4I5NB 3PN7B 3VRNA 1A75A 1KQMB 2K8MB 2K7DA 3BUOB 2KSPA 3CLNA 3FIAA 2Y1NA 4CIDA 3BUWB 1IWQA 1BU3A 3TS5C 2LVIA 2GGZA 1QVIY 1SY9A 3CWGA 3PATA 1PSBA 1Y1AA 4USLA 4ORAB 5B8IB 1KK7Z 1QTXA 1PSRA 2K7BA 4GGFC 5BPJA 1YUSA 1UWOA 1Q80A 1RTP1 4WRIA 2M29A 4MSPA 1G8IA 1WRLA 3I5FB 1V1GA 2BBNA 2Y4QA 2M97A 4U8DA 1SMGA 3OX6A 1PALA 1EL4A 4P5OE 3VRQA 1L2OB 2LVKA 4OKHA 2NCOA 2LLTA 1FI5A 5HLOA 1BODA 2LE9B 3TUYC 1LA3A 1UHNA 2P6BB 4MBEA 1PK0D 3OB2B 3TDZA 3NSKA 1S5GZ 1RECA 1WRZA 2KQYA 3EK4A 2RGIA 4I5LB 2LLSA 3C1VA 3CZTX 1R6PA 1KCYA 3DF0A 1KFXS 1IQ5A 1TNQA 1KQMC 1OQPA 1F8HA 3NSOA 1BOCA 1M63B 4AQJA 1FF1A 4PHNA 1DJYA 1SYMA 2JOJA 1BF5A 1BR1B 1TNXA 1W7JB 2FCEA 2JU0A 2LNKA 2ZFDA 3A8RA 4XYNA 1TOPA 2HQ8A 1XFVO 2JQ6A 2JTTA 1MF8B 1WDCB 1MUXA 3F45A 5FYXA 2M49B 4PE0A 1OMVA 3VRRA 1EXRA 3JVTC 2LV7A 1KK8C 1XFYO 1OMRA 1TTXA 2BBMA 3CGAA 4F0ZB 3BUNB 5KU1A 2L2EA 1A75B 1LINA 2MLFC 1K90D 1BLQA 1B8LA 1L7ZA 4R1EA 1IH0A 2H2KA 2MBXA 5CPVA 4A4CA 4OCIA 2CT9A 2E30A 3KEVA 2NCPA 1QX7A 2ZN8A 2KFFA 1TCOB 2WNDA 1ZMZA 1NX0A 2WORA 2JC2A 2H61A 2KFGA 2HQWA 1XK4C 3KPXA 1IRJA 2JNXA 4OR9B 4QJ4B 1PVAA 2I94A 2FOTA 1F70A 1FW4A 3O2PA 1J7PA 5D69A 1S6JA 1J7RA 1E8AA 2JTZA 3CR5X 1AP4A 2KAXA 2OTGB 1KFUS 1U5IA 2LP2A 3JTDB 4JQ0D 2BE4A 2PSRA 1DT7B 1WRKA 5DKRA 3PM8A 1DJXA 4HRGA 1XVJA 1IJ5A 4YGEB 2HPSA 1MHOA 1H8BA 5JOLA 1SL7A 2L51A 1ALWA 3DF0B 4CLNA 1JBAA 5CSFA 4YBHB 4M2PA 2MAZA 1QIVA 3WHTB 1J7QA 4BY4A 1NCXA 2KBMA 2WCEA 1SRAA 1NX1A 3CR4X 3SIBA 5HYDA 1CMGA 3WHUB 2ZNDA 1M45A 2HF5A 4GGNA 2LMUA 1HQVA 2ISDA 1AJ4A 1AJ5A 1XO5A 1QV1A 3TUYB 1CFFA 3SG4A 1YUUA 1SCMC 4C0JA 4OV2A 2JXLA 1XFUO 1SR6C 3FWBA 1J1DA 1DJGA 1OMDA 1OSAA 1XFXO 3VRPA 1S26D 2KI4C 2E6WA 2KYCA 2M8UA 4HSZA 1DJHA 1TNPA 5F6TA 1BT6A 3I5HC 4MZKA 1F55A 1MXLC 2OTGC 3EVRA 3JTDC 1R2UA 1QJTA 1HT9A 1K93D 2BCBA 3CTNA 4Q04A 1CDMA 2JRFA 3NXAA 1S6CA 4DS7A 1NIWA 5HLVA 1NYAA 3PALA 2COLB 1S5GY 4MLWA 1W7IB 5I2QA 1YRTB 4P2YB 1GJYA 3H4SE 3MSEB 1IQ3A 5AERA 1WLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NP8 A;  3JVT B;  1KK8 B;  2L50 A;  4YGB B;  5G08 A;  2KOT A;  1ZUZ A;  3EK8 A;  4AOM A;  1ODB A;  3SG5 A;  5K89 A;  1F4Q A;  2MA2 A;  4C0L A;  2KYF A;  1QAS A;  2KGR A;  4L9M A;  1U5I B;  2K7C A;  1DF0 A;  4MRX A;  2AMI A;  2JT0 A;  3LL8 B;  1PUL A;  3D0Y A;  4PCW A;  1SPY A;  4HRE E;  1DVI A;  2HET A;  2KAY A;  1JSA A;  4PE7 A;  2WC8 A;  1YUT A;  1KSM A;  2JT3 A;  1GQM A;  1YX8 A;  3VRO A;  2FCD A;  2BCX A;  2F33 A;  2O5G A;  3EKJ A;  4AQI A;  2LUC A;  1D1O A;  1KFX L;  1SKT A;  3GOF A;  1ZFS A;  4TNC A;  2KBI A;  3BQ3 A;  1J1E A;  4MZJ A;  4QJ5 B;  1CM1 A;  1LVC D;  2K61 A;  1CMF A;  2KI6 D;  1BJF A;  1UUR A;  2I18 A;  5CSI A;  1B8R A;  1JFK A;  5AAN A;  1K9P A;  4N1F A;  3KHE A;  2ZRT A;  1S6I A;  2H61 C;  3KF9 A;  1QS7 A;  3OB1 B;  4DCK A;  3SG6 A;  1CLB A;  4D1E A;  3DD4 A;  5HKW A;  3AKA A;  2LMV A;  2F3Y A;  1NCY A;  1IJ6 A;  1NX3 A;  4UPG A;  2LC5 A;  3SG7 A;  4DUQ A;  4YI8 A;  2BEC A;  1VRK A;  2DOQ A;  3VGO A;  1RWY A;  1CM4 A;  1BG1 A;  1IG5 A;  1DJW A;  4JWQ A;  4C0K A;  4GUK A;  1YRU B;  3LK0 A;  4GNK B;  2IS9 A;  3SG2 A;  5ER5 A;  2CTN A;  5D7F A;  1CFC A;  5KTY A;  2Y1M A;  1A29 A;  1SW8 A;  4PAL A;  2LP3 A;  1YR5 A;  1YVH A;  1UHH A;  1K95 A;  1SCM B;  3KO0 A;  1K9K A;  4M2Q A;  2LAP A;  4ZCV A;  5HKY A;  2PRU A;  1SR6 B;  3M0W A;  4DIR A;  2ZN9 A;  2NXQ A;  4FQO A;  4YRU A;  2ZKM X;  1JWD A;  2KI4 B;  1JF2 A;  1QX5 B;  2LM5 A;  2M3W A;  3DVJ A;  1CB1 A;  1LA0 A;  2KHN A;  2CNP A;  3EVU A;  3I5H B;  1DF0 B;  1B7T Y;  1UHK A;  1N65 A;  1KFU L;  4BY5 A;  1YX7 A;  3D0Y B;  1TCF A;  1CDL A;  1TIZ A;  2QAC A;  1XYD A;  4NDD A;  3DVK A;  1B47 A;  4ICB A;  1EG3 A;  4NQG A;  2A4J A;  2LHL A;  3IQO A;  2OPO A;  2ZNE A;  2QPT A;  4XJK A;  3I5I C;  1EJ3 A;  3BUX B;  2OS8 B;  4E68 A;  3O78 A;  1RFJ A;  2LAN A;  2F2O A;  1LXF C;  2WCB A;  1GGW A;  3RM1 A;  1J7O A;  4PHJ A;  1XFW O;  3BUM B;  1BR4 B;  1IKU A;  5TNC A;  1NUB A;  2WCF A;  2LUX A;  2PMY A;  1KK7 Y;  1SBJ A;  1DTL A;  3NSI A;  1DGU A;  2L5X B;  1B8C A;  4MN0 A;  1F4O A;  2SCP A;  2Q91 A;  4MEW A;  3SIA A;  1TRF A;  3OX5 A;  1OOJ A;  1IGV A;  1K96 A;  4PDZ A;  1JUO A;  1QIW A;  4MVF A;  5HKZ A;  3GK1 A;  1Y6W A;  4GAO A;  1C7W A;  2M1K B;  2NLN A;  3TZ1 A;  2WOS A;  2F2P A;  4M2O A;  1SL9 A;  1WLZ A;  2KNE A;  3I5G B;  2LCP A;  2JZI A;  2PAL A;  5DKQ A;  1CFD A;  3ZNI A;  2EC6 B;  5I8N A;  5I2L A;  4GPL B;  1SL8 A;  1NPQ A;  1K94 A;  2I2R E;  3TDI A;  5KSZ A;  2OS8 C;  1CLM A;  3LLE A;  1DJI A;  1OE9 B;  1CKK A;  4PHM A;  3AKB A;  1MXE A;  2LVV A;  1DGV A;  2AUC A;  2MRD A;  1Y0V H;  1B4C A;  4ZCU A;  1CNP A;  3DVE A;  5J3X A;  1AVS A;  2JXC A;  3IQQ A;  1QX2 A;  3A4U B;  1QLK A;  1AUI B;  4ORB B;  2BL0 C;  2LLU A;  3AAJ A;  4XJK B;  1S3P A;  1A4P A;  2CCM A;  1QXP A;  1Y1U A;  1MR8 A;  1MQ1 A;  2KGB C;  3O4Y A;  4HRH A;  1B1G A;  2BE6 A;  2F3Z A;  2L4I A;  2M7N A;  1QAT A;  5DKN A;  4NDB A;  3EVV A;  1JFJ A;  1K2H A;  1WY9 A;  3ICB A;  2LHI A;  4OVN F;  5CSN A;  2JWW A;  1CDP A;  3HCM A;  4YGA A;  2BKI B;  1S1E A;  2CBL A;  3I5G C;  1KQV A;  4MRY A;  1YTZ C;  3PFV A;  2ZRS A;  1LKJ A;  2EC6 C;  3BOW A;  1QVI Z;  3SG3 A;  3LCP C;  5GQQ C;  3SJS A;  3D10 A;  4MZL A;  1OZO A;  5CSJ A;  2F8P A;  2K2F A;  2KAV A;  3CS1 A;  1MWN A;  2M9G A;  1NSH A;  3I5I B;  4GGF A;  3RLZ A;  5AEQ A;  1TN4 A;  1FI6 A;  3DVM A;  1UHI A;  2PAS A;  3PN7 C;  1N0Y A;  1YUR A;  4FTG A;  2JT8 A;  4DRW A;  2KI6 C;  2MLE C;  2EGD A;  5JJG A;  1SNL A;  1ALV A;  1SK6 D;  4NDC A;  1G33 A;  3EKH A;  2KFH A;  5AXI A;  4IL1 A;  2KDH A;  1AK8 A;  1F71 A;  4GBA A;  2R2I A;  4YGC B;  4PHK A;  4CPV A;  2B1U A;  2KQ6 A;  1JF0 A;  2JUL A;  1UP5 A;  1UUS A;  2BKH B;  3FWC A;  3I5F C;  5PAL A;  2MHH A;  1CDN A;  2MJW B;  3BYA A;  1KWO B;  1GGZ A;  3PSR A;  4CFR A;  1FBV A;  4QJ3 B;  2PVB A;  2Y5I A;  4I5J A;  4ETO A;  1L2O C;  3EK7 A;  2K7O A;  2LVJ A;  1CTR A;  2I7A A;  1G4Y R;  2GGM A;  3WNX B;  1EH2 A;  2NZ0 A;  1J55 A;  5ER4 X;  1XA5 A;  1QV0 A;  1PRW A;  3GK4 X;  3PLF B;  4YGD B;  3QRX A;  2SAS A;  1K9U A;  3K21 A;  2JNF A;  2G9B A;  3TDU A;  1F54 A;  1BMO A;  2M1U A;  3OP0 A;  4WQ2 A;  5I2O A;  1H4B A;  1KSO A;  4PE4 A;  1CLL A;  1RRO A;  2O60 A;  4GFT A;  4ORC B;  3OHM B;  3O6B A;  2AAO A;  1ZOT B;  1FPW A;  3ZWH A;  1YVL A;  2K2A A;  3E3R A;  4A4B A;  1NX2 A;  3AAK A;  1NWD A;  1NCZ A;  1XFZ O;  3TS5 B;  3BOW B;  1K8U A;  1A2X A;  1C07 A;  2GV5 A;  2L4H A;  1C7V A;  1RJV A;  1WDC C;  2M0R A;  2V53 A;  2BL0 B;  3LK1 A;  1N2D A;  2CXJ A;  2D8N A;  3FS7 A;  2K0J A;  1TNW A;  1Y1X A;  1M46 A;  3BXK A;  3HX4 A;  2M7L A;  1OZS A;  4I5K A;  1XK4 A;  4WQ3 A;  1KWO C;  4PE1 A;  2L0P A;  1RK9 A;  3NSL A;  5AFP A;  1CFP A;  1ZAC A;  3IF7 A;  2G2B A;  3CR2 A;  4N1G A;  2L98 A;  4CFQ A;  1DMO A;  4JPZ B;  1QLS A;  1A03 A;  1B7T Z;  2TN4 A;  3GK2 A;  5IBW A;  1M39 A;  1M31 A;  1X02 A;  2JPT A;  4YI9 A;  1B9A A;  1EG4 A;  1PVB A;  1UHJ A;  1AHR A;  1S36 A;  4N5X A;  2VRG A;  1V1F A;  3WXA A;  2LMT A;  1JC2 A;  1DJZ A;  2FJU B;  1SCV A;  2Q4U A;  2EHB A;  2BCA A;  4I5N B;  3PN7 B;  3VRN A;  1A75 A;  1KQM B;  2K8M B;  2K7D A;  3BUO B;  2KSP A;  3CLN A;  3FIA A;  2Y1N A;  4CID A;  3BUW B;  1IWQ A;  1BU3 A;  3TS5 C;  2LVI A;  2GGZ A;  1QVI Y;  1SY9 A;  3CWG A;  3PAT A;  1PSB A;  1Y1A A;  4USL A;  4ORA B;  5B8I B;  1KK7 Z;  1QTX A;  1PSR A;  2K7B A;  4GGF C;  5BPJ A;  1YUS A;  1UWO A;  1Q80 A;  1RTP 1;  4WRI A;  2M29 A;  4MSP A;  1G8I A;  1WRL A;  3I5F B;  1V1G A;  2BBN A;  2Y4Q A;  2M97 A;  4U8D A;  1SMG A;  3OX6 A;  1PAL A;  1EL4 A;  4P5O E;  3VRQ A;  1L2O B;  2LVK A;  4OKH A;  2NCO A;  2LLT A;  1FI5 A;  5HLO A;  1BOD A;  2LE9 B;  3TUY C;  1LA3 A;  1UHN A;  2P6B B;  4MBE A;  1PK0 D;  3OB2 B;  3TDZ A;  3NSK A;  1S5G Z;  1REC A;  1WRZ A;  2KQY A;  3EK4 A;  2RGI A;  4I5L B;  2LLS A;  3C1V A;  3CZT X;  1R6P A;  1KCY A;  3DF0 A;  1KFX S;  1IQ5 A;  1TNQ A;  1KQM C;  1OQP A;  1F8H A;  3NSO A;  1BOC A;  1M63 B;  4AQJ A;  1FF1 A;  4PHN A;  1DJY A;  1SYM A;  2JOJ A;  1BF5 A;  1BR1 B;  1TNX A;  1W7J B;  2FCE A;  2JU0 A;  2LNK A;  2ZFD A;  3A8R A;  4XYN A;  1TOP A;  2HQ8 A;  1XFV O;  2JQ6 A;  2JTT A;  1MF8 B;  1WDC B;  1MUX A;  3F45 A;  5FYX A;  2M49 B;  4PE0 A;  1OMV A;  3VRR A;  1EXR A;  3JVT C;  2LV7 A;  1KK8 C;  1XFY O;  1OMR A;  1TTX A;  2BBM A;  3CGA A;  4F0Z B;  3BUN B;  5KU1 A;  2L2E A;  1A75 B;  1LIN A;  2MLF C;  1K90 D;  1BLQ A;  1B8L A;  1L7Z A;  4R1E A;  1IH0 A;  2H2K A;  2MBX A;  5CPV A;  4A4C A;  4OCI A;  2CT9 A;  2E30 A;  3KEV A;  2NCP A;  1QX7 A;  2ZN8 A;  2KFF A;  1TCO B;  2WND A;  1ZMZ A;  1NX0 A;  2WOR A;  2JC2 A;  2H61 A;  2KFG A;  2HQW A;  1XK4 C;  3KPX A;  1IRJ A;  2JNX A;  4OR9 B;  4QJ4 B;  1PVA A;  2I94 A;  2FOT A;  1F70 A;  1FW4 A;  3O2P A;  1J7P A;  5D69 A;  1S6J A;  1J7R A;  1E8A A;  2JTZ A;  3CR5 X;  1AP4 A;  2KAX A;  2OTG B;  1KFU S;  1U5I A;  2LP2 A;  3JTD B;  4JQ0 D;  2BE4 A;  2PSR A;  1DT7 B;  1WRK A;  5DKR A;  3PM8 A;  1DJX A;  4HRG A;  1XVJ A;  1IJ5 A;  4YGE B;  2HPS A;  1MHO A;  1H8B A;  5JOL A;  1SL7 A;  2L51 A;  1ALW A;  3DF0 B;  4CLN A;  1JBA A;  5CSF A;  4YBH B;  4M2P A;  2MAZ A;  1QIV A;  3WHT B;  1J7Q A;  4BY4 A;  1NCX A;  2KBM A;  2WCE A;  1SRA A;  1NX1 A;  3CR4 X;  3SIB A;  5HYD A;  1CMG A;  3WHU B;  2ZND A;  1M45 A;  2HF5 A;  4GGN A;  2LMU A;  1HQV A;  2ISD A;  1AJ4 A;  1AJ5 A;  1XO5 A;  1QV1 A;  3TUY B;  1CFF A;  3SG4 A;  1YUU A;  1SCM C;  4C0J A;  4OV2 A;  2JXL A;  1XFU O;  1SR6 C;  3FWB A;  1J1D A;  1DJG A;  1OMD A;  1OSA A;  1XFX O;  3VRP A;  1S26 D;  2KI4 C;  2E6W A;  2KYC A;  2M8U A;  4HSZ A;  1DJH A;  1TNP A;  5F6T A;  1BT6 A;  3I5H C;  4MZK A;  1F55 A;  1MXL C;  2OTG C;  3EVR A;  3JTD C;  1R2U A;  1QJT A;  1HT9 A;  1K93 D;  2BCB A;  3CTN A;  4Q04 A;  1CDM A;  2JRF A;  3NXA A;  1S6C A;  4DS7 A;  1NIW A;  5HLV A;  1NYA A;  3PAL A;  2COL B;  1S5G Y;  4MLW A;  1W7I B;  5I2Q A;  1YRT B;  4P2Y B;  1GJY A;  3H4S E;  3MSE B;  1IQ3 A;  5AER A;  1WLM A; 
#chains in the Genus database with same CATH topology
 1NP8 A;  3JVT B;  1KK8 B;  2L50 A;  4YGB B;  5G08 A;  2KOT A;  1ZUZ A;  3EK8 A;  4AOM A;  1ODB A;  3S0B A;  3SG5 A;  5K89 A;  1F4Q A;  2MA2 A;  4C0L A;  2KYF A;  1QAS A;  2KGR A;  4L9M A;  1U5I B;  2K7C A;  1DF0 A;  4MRX A;  2AMI A;  2JT0 A;  3LL8 B;  1PUL A;  3D0Y A;  4PCW A;  1SPY A;  4HRE E;  1DEL A;  1DVI A;  2HET A;  2KAY A;  3BFH A;  1JSA A;  4PE7 A;  2WC8 A;  3B86 A;  1YUT A;  1KSM A;  2JT3 A;  1GQM A;  3B7A A;  1YX8 A;  3VRO A;  2FCD A;  2BCX A;  2F33 A;  2O5G A;  3EKJ A;  4AQI A;  2LUC A;  3L4A A;  1KFX L;  1SKT A;  3GOF A;  1D1O A;  1ZFS A;  4TNC A;  2KBI A;  3BQ3 A;  1J1E A;  4MZJ A;  4QJ5 B;  1CM1 A;  1LVC D;  2K61 A;  1CMF A;  2KI6 D;  1BJF A;  1UUR A;  2I18 A;  5CSI A;  1B8R A;  1JFK A;  5AAN A;  1K9P A;  4N1F A;  3KHE A;  2ZRT A;  1S6I A;  2H61 C;  3KF9 A;  1QS7 A;  3OB1 B;  4DCK A;  3SG6 A;  1CLB A;  4D1E A;  3DD4 A;  2WCH A;  5HKW A;  3AKA A;  2LMV A;  2F3Y A;  1NCY A;  1IJ6 A;  1NX3 A;  4UPG A;  2LC5 A;  3SG7 A;  4DUQ A;  4YI8 A;  2BEC A;  1VRK A;  5I94 A;  2DOQ A;  3VGO A;  1RWY A;  1CM4 A;  1OOF A;  1BG1 A;  1IG5 A;  3PM2 A;  1LS8 A;  1DJW A;  4JWQ A;  4C0K A;  4GUK A;  1YRU B;  2L5Y A;  3LK0 A;  4GNK B;  2IS9 A;  3SG2 A;  5ER5 A;  2CTN A;  5D7F A;  1DC1 A;  1CFC A;  5KTY A;  2Y1M A;  3CZ2 A;  1A29 A;  1SW8 A;  2QEV A;  4PAL A;  2LP3 A;  1YR5 A;  1YVH A;  1UHH A;  1K95 A;  1SCM B;  3KO0 A;  1K9K A;  4M2Q A;  2LAP A;  4ZCV A;  5HKY A;  2PRU A;  1SR6 B;  3M0W A;  4DIR A;  2ZN9 A;  2NXQ A;  4FQO A;  4YRU A;  2ZKM X;  1JWD A;  2KI4 B;  1JF2 A;  2WCM A;  1QX5 B;  2LM5 A;  2M3W A;  2WCJ A;  3DVJ A;  1LA0 A;  1CB1 A;  2KHN A;  2CNP A;  3EVU A;  3I5H B;  1DF0 B;  1B7T Y;  1UHK A;  1N65 A;  1KFU L;  4BY5 A;  1YX7 A;  3D0Y B;  1TCF A;  3FE9 A;  1CDL A;  3R1O A;  1TIZ A;  2BNX A;  1XYD A;  2QAC A;  2WCK A;  3DVK A;  1B47 A;  4ICB A;  4NDD A;  1EG3 A;  2KLE A;  2A4J A;  2LHL A;  3IQO A;  4NQG A;  2OPO A;  2ZNE A;  2QPT A;  4XJK A;  3I5I C;  3RZS A;  1TUJ A;  1EJ3 A;  3BUX B;  2OS8 B;  4E68 A;  3O78 A;  1RFJ A;  2LAN A;  2F2O A;  1LXF C;  2WCB A;  1GGW A;  3RM1 A;  1J7O A;  4PHJ A;  1XFW O;  3BUM B;  1BR4 B;  3D75 A;  1IKU A;  2P70 A;  5TNC A;  1NUB A;  2WCF A;  2LUX A;  2PMY A;  3S0E A;  1KK7 Y;  1SBJ A;  1DTL A;  3NSI A;  1DGU A;  3S0F A;  2L5X B;  1B8C A;  4MN0 A;  1F4O A;  2SCP A;  2Q91 A;  4MEW A;  3SIA A;  1TRF A;  3OX5 A;  1OOJ A;  1IGV A;  1K96 A;  4FQT A;  4PDZ A;  3K1E A;  1JUO A;  1QIW A;  4MVF A;  5HKZ A;  3GK1 A;  1Y6W A;  4GAO A;  1C7W A;  2L2C A;  2M1K B;  2NLN A;  3TZ1 A;  2WOS A;  3B6X A;  2F2P A;  4M2O A;  1SL9 A;  1WLZ A;  2KNE A;  2QEH A;  3I5G B;  2LCP A;  5FI2 A;  2JZI A;  3CZ0 A;  5D3O A;  2K60 A;  2PAL A;  2QDI A;  5DKQ A;  1CFD A;  2QEO A;  3ZNI A;  3D73 A;  2EC6 B;  2YGU A;  5I8N A;  5DIC A;  5I2L A;  4GPL B;  1SL8 A;  1NPQ A;  1K94 A;  3IVT A;  2I2R E;  3L4L A;  3TDI A;  5KSZ A;  2OS8 C;  1CLM A;  3LLE A;  1DJI A;  1OE9 B;  1CKK A;  4PHM A;  3AKB A;  1MXE A;  2LVV A;  1DGV A;  2AUC A;  2MRD A;  1Y0V H;  1B4C A;  4ZCU A;  1CNP A;  3CAB A;  1XFR A;  3DVE A;  3UO9 A;  5J3X A;  1AVS A;  2JXC A;  3IQQ A;  1QX2 A;  3A4U B;  1QLK A;  1AUI B;  4ORB B;  2BL0 C;  1OOG A;  2LLU A;  3AAJ A;  4XJK B;  1S3P A;  1A4P A;  2CCM A;  1QXP A;  1Y1U A;  1MR8 A;  1MQ1 A;  2KGB C;  3O4Y A;  4HRH A;  1B1G A;  3S0D A;  2BE6 A;  2F3Z A;  2L4I A;  2M7N A;  1QAT A;  5DKN A;  4NDB A;  3EVV A;  1JFJ A;  1K2H A;  1WY9 A;  3ICB A;  2LHI A;  4OVN F;  5CSN A;  2JWW A;  1CDP A;  3HCM A;  4YGA A;  2BKI B;  3EG5 B;  5FI6 A;  1S1E A;  2CBL A;  3I5G C;  1KQV A;  3UNW A;  4MRY A;  1YTZ C;  3PFV A;  2ZRS A;  1LKJ A;  2EC6 C;  3BOW A;  1QVI Z;  3SG3 A;  3LCP C;  5GQQ C;  3SJS A;  3D10 A;  3L47 A;  1OZO A;  4KYN A;  4MZL A;  5CSJ A;  2F8P A;  2K2F A;  2KAV A;  3CS1 A;  1MWN A;  2M9G A;  1NSH A;  3I5I B;  3SS3 A;  4GGF A;  3RLZ A;  4INX A;  1TN4 A;  5AEQ A;  1FI6 A;  3DVM A;  1SSE B;  1UHI A;  2PAS A;  3PN7 C;  1N0Y A;  1YUR A;  3B87 A;  4FTG A;  2JT8 A;  4DRW A;  2KI6 C;  2MLE C;  2EGD A;  5JJG A;  1SNL A;  1ALV A;  1SK6 D;  4NDC A;  1G33 A;  3EKH A;  4INW A;  2GTE A;  3PJI A;  3S0A A;  2KFH A;  5AXI A;  4IL1 A;  2KDH A;  1AK8 A;  4PT1 A;  4GBA A;  2R2I A;  4YGC B;  1F71 A;  4PHK A;  4CPV A;  2B1U A;  2KQ6 A;  1JF0 A;  2JUL A;  1UP5 A;  1UUS A;  2BKH B;  3FWC A;  3I5F C;  5PAL A;  2MHH A;  3SS5 A;  1CDN A;  2MJW B;  3BYA A;  1KWO B;  1GGZ A;  3PSR A;  4CFR A;  1FBV A;  1TWO A;  4QJ3 B;  2PVB A;  2Y5I A;  3VB1 A;  4I5J A;  4ETO A;  1L2O C;  3EK7 A;  2K7O A;  2LVJ A;  1CTR A;  2I7A A;  1G4Y R;  2GGM A;  3O4X A;  3WNX B;  1EH2 A;  2NZ0 A;  1J55 A;  5ER4 X;  1XA5 A;  1QV0 A;  1PRW A;  3GK4 X;  3PLF B;  4YGD B;  3QRX A;  2SAS A;  1K9U A;  3K21 A;  2JNF A;  2G9B A;  3TDU A;  1F54 A;  1BMO A;  2M1U A;  3OP0 A;  4WQ2 A;  5I2O A;  1H4B A;  1KSO A;  3DYE A;  4PE4 A;  1CLL A;  1RRO A;  2KLD A;  2O60 A;  4GFT A;  4ORC B;  2WC5 A;  3O6B A;  3D77 A;  2AAO A;  3OHM B;  2H8V A;  1ZOT B;  1FPW A;  3ZWH A;  2P71 A;  1YVL A;  2K2A A;  3E3R A;  2PQL A;  4A4B A;  1NX2 A;  3AAK A;  1NWD A;  1NCZ A;  1XFZ O;  3TS5 B;  3BOW B;  1K8U A;  1A2X A;  1C07 A;  2GV5 A;  2L4H A;  1C7V A;  1RJV A;  1WDC C;  2M0R A;  2V53 A;  2BL0 B;  3LK1 A;  1N2D A;  1ORG A;  3S0G A;  2CXJ A;  2D8N A;  3FS7 A;  2K0J A;  1TNW A;  1Y1X A;  1M46 A;  3BXK A;  3HX4 A;  2M7L A;  1OZS A;  4I5K A;  3V2L A;  1XK4 A;  4WQ3 A;  1KWO C;  3BFA A;  4PE1 A;  2L0P A;  1RK9 A;  3D78 A;  3NSL A;  5AFP A;  1CFP A;  1ZAC A;  1IIO A;  3IF7 A;  3D74 A;  2G2B A;  3CR2 A;  4N1G A;  2ERB A;  2L98 A;  4CFQ A;  1DMO A;  4JPZ B;  1QLS A;  3CDN A;  1A03 A;  1B7T Z;  3FE8 A;  2TN4 A;  1W9Z A;  3GK2 A;  4IJ7 A;  5IBW A;  1M39 A;  1M31 A;  1X02 A;  2JPT A;  4YI9 A;  1B9A A;  1Z4H A;  1EG4 A;  1PVB A;  1UHJ A;  1AHR A;  1S36 A;  4N5X A;  3DY9 A;  1OOH A;  2VRG A;  1V1F A;  3WXA A;  2LMT A;  3N7H A;  1JC2 A;  1DJZ A;  2FJU B;  4F7F A;  1SCV A;  2Q4U A;  2EHB A;  2BCA A;  4I5N B;  3PN7 B;  3VRN A;  1A75 A;  1KQM B;  2K8M B;  2K7D A;  3BUO B;  2KSP A;  3CLN A;  3FIA A;  2Y1N A;  4CID A;  3BUW B;  1IWQ A;  1BU3 A;  3TS5 C;  2LVI A;  2GGZ A;  1QVI Y;  1SY9 A;  3CWG A;  3PAT A;  2WCL A;  1PSB A;  1Y1A A;  4USL A;  4ORA B;  5B8I B;  1KK7 Z;  1QTX A;  1PSR A;  2K7B A;  4GGF C;  5BPJ A;  4JD9 A;  1YUS A;  1UWO A;  1Q80 A;  1RTP 1;  3NHI A;  2M29 A;  4MSP A;  4WRI A;  1G8I A;  1WRL A;  3I5F B;  1V1G A;  2BBN A;  2Y4Q A;  2M97 A;  4U8D A;  1SMG A;  3OX6 A;  1PAL A;  1EL4 A;  4P5O E;  3VRQ A;  3QME A;  1L2O B;  2LVK A;  3Q8I A;  4OKH A;  2NCO A;  2LLT A;  3D76 A;  1FI5 A;  1Z2C B;  5HLO A;  1BOD A;  3B88 A;  2LE9 B;  3TUY C;  1LA3 A;  1UHN A;  2P6B B;  4MBE A;  1PK0 D;  3OB2 B;  3TDZ A;  3NSK A;  1S5G Z;  1REC A;  1WRZ A;  2KQY A;  3EK4 A;  1T14 A;  2RGI A;  4I5L B;  1C3Z A;  2LLS A;  3C1V A;  3CZT X;  1R6P A;  1KCY A;  3DF0 A;  1KFX S;  2BAP A;  3R72 A;  1IQ5 A;  1TNQ A;  1KQM C;  1OQP A;  1F8H A;  3NSO A;  2PYQ A;  1BOC A;  1M63 B;  4AQJ A;  1FF1 A;  4PHN A;  1DJY A;  1SYM A;  2JOJ A;  1BF5 A;  1BR1 B;  1TNX A;  1W7J B;  2FCE A;  4JKT A;  2JU0 A;  2LNK A;  2ZFD A;  3A8R A;  4XYN A;  1TOP A;  5FI7 A;  2HQ8 A;  1XFV O;  2JQ6 A;  2JTT A;  1MF8 B;  1WDC B;  2QEB A;  1MUX A;  3F45 A;  5FYX A;  2M49 B;  4PE0 A;  1OMV A;  3OBV A;  3VRR A;  1EXR A;  3JVT C;  2LV7 A;  1KK8 C;  1XFY O;  1OMR A;  1TTX A;  2BBM A;  3CGA A;  4F0Z B;  3BUN B;  5KU1 A;  2L2E A;  1A75 B;  1LIN A;  2MLF C;  1K90 D;  3OGN A;  1BLQ A;  1B8L A;  1L7Z A;  4R1E A;  1IH0 A;  3SS4 A;  2H2K A;  2KPH A;  3BFB A;  2MBX A;  5HL1 A;  5CPV A;  4A4C A;  4OCI A;  2CT9 A;  2E30 A;  3KEV A;  2JPO A;  2NCP A;  1QX7 A;  2ZN8 A;  2KFF A;  1TCO B;  2WND A;  1ZMZ A;  1NX0 A;  3R1V A;  2WOR A;  2JC2 A;  2H61 A;  2KFG A;  2HQW A;  1XK4 C;  3KPX A;  1IRJ A;  2JNX A;  5EL2 A;  2FJY A;  4OR9 B;  4QJ4 B;  1PVA A;  2I94 A;  2FOT A;  3R1P A;  1C3Y A;  1F70 A;  1FW4 A;  1DEK A;  3O2P A;  1J7P A;  5D69 A;  1GM0 A;  1S6J A;  1J7R A;  1E8A A;  2JTZ A;  3CR5 X;  1AP4 A;  2KAX A;  2OTG B;  1KFU S;  1U5I A;  2LP2 A;  3JTD B;  4JQ0 D;  2BE4 A;  2PSR A;  2WC6 A;  1DT7 B;  1WRK A;  5DKR A;  3PM8 A;  1DJX A;  4HRG A;  3BJH A;  1XVJ A;  1IJ5 A;  4YGE B;  2HPS A;  1MHO A;  1H8B A;  5JOL A;  1SL7 A;  2L51 A;  1ALW A;  3DF0 B;  4OZD A;  4CLN A;  5CSF A;  1JBA A;  4YBH B;  4M2P A;  2MAZ A;  1QIV A;  3WHT B;  1J7Q A;  4BY4 A;  1NCX A;  1DQE A;  2KBM A;  2WCE A;  1SRA A;  1NX1 A;  3CR4 X;  3SIB A;  3NGV A;  3DZT A;  3WHU B;  2ZND A;  5HYD A;  1M45 A;  1CMG A;  2HF5 A;  4GGN A;  2LMU A;  1HQV A;  2ISD A;  1AJ4 A;  1AJ5 A;  1P28 A;  1TUZ A;  1XO5 A;  1QV1 A;  3TUY B;  1CFF A;  3SG4 A;  1YUU A;  1SCM C;  3NHT A;  4C0J A;  4OV2 A;  2JXL A;  1XFU O;  1SR6 C;  3FWB A;  1J1D A;  1DJG A;  1OMD A;  1OSA A;  1XFX O;  3CYZ A;  3VRP A;  1S26 D;  2KI4 C;  2E6W A;  2KYC A;  2M8U A;  4HSZ A;  1DJH A;  1TNP A;  5F6T A;  1QWV A;  1BT6 A;  3I5H C;  4MZK A;  1F55 A;  1MXL C;  2OTG C;  3EVR A;  3JTD C;  1R2U A;  1OW4 A;  1QJT A;  1HT9 A;  1K93 D;  2BCB A;  3CTN A;  4Q04 A;  1CDM A;  2JRF A;  3NXA A;  1S6C A;  4DS7 A;  1NIW A;  5HLV A;  3DXL A;  1NYA A;  3PAL A;  2COL B;  1S5G Y;  4MLW A;  1W7I B;  5I2Q A;  1YRT B;  3CZ1 A;  4P2Y B;  1GJY A;  3H4S E;  3MSE B;  1OOI X;  1IQ3 A;  3FE6 A;  5AER A;  1WLM A; 
#chains in the Genus database with same CATH homology
 1NP8 A;  3JVT B;  1KK8 B;  2L50 A;  4YGB B;  5G08 A;  2KOT A;  1ZUZ A;  3EK8 A;  4AOM A;  1ODB A;  3SG5 A;  5K89 A;  1F4Q A;  2MA2 A;  4C0L A;  2KYF A;  1QAS A;  2KGR A;  4L9M A;  1U5I B;  2K7C A;  1DF0 A;  4MRX A;  2AMI A;  2JT0 A;  3LL8 B;  1PUL A;  3D0Y A;  4PCW A;  1SPY A;  4HRE E;  1DVI A;  2HET A;  2KAY A;  1JSA A;  4PE7 A;  2WC8 A;  1YUT A;  1KSM A;  2JT3 A;  1GQM A;  1YX8 A;  3VRO A;  2FCD A;  2BCX A;  2F33 A;  2O5G A;  3EKJ A;  4AQI A;  2LUC A;  1D1O A;  1KFX L;  1SKT A;  3GOF A;  1ZFS A;  4TNC A;  2KBI A;  3BQ3 A;  1J1E A;  4MZJ A;  4QJ5 B;  1CM1 A;  1LVC D;  2K61 A;  1CMF A;  2KI6 D;  1BJF A;  1UUR A;  2I18 A;  5CSI A;  1B8R A;  1JFK A;  5AAN A;  1K9P A;  4N1F A;  3KHE A;  2ZRT A;  1S6I A;  2H61 C;  3KF9 A;  1QS7 A;  3OB1 B;  4DCK A;  3SG6 A;  1CLB A;  4D1E A;  3DD4 A;  5HKW A;  3AKA A;  2LMV A;  2F3Y A;  1NCY A;  1IJ6 A;  1NX3 A;  4UPG A;  2LC5 A;  3SG7 A;  4DUQ A;  4YI8 A;  2BEC A;  1VRK A;  2DOQ A;  3VGO A;  1RWY A;  1CM4 A;  1BG1 A;  1IG5 A;  1DJW A;  4JWQ A;  4C0K A;  4GUK A;  1YRU B;  3LK0 A;  4GNK B;  2IS9 A;  3SG2 A;  5ER5 A;  2CTN A;  5D7F A;  1CFC A;  5KTY A;  2Y1M A;  1A29 A;  1SW8 A;  4PAL A;  2LP3 A;  1YR5 A;  1YVH A;  1UHH A;  1K95 A;  1SCM B;  3KO0 A;  1K9K A;  4M2Q A;  2LAP A;  4ZCV A;  5HKY A;  2PRU A;  1SR6 B;  3M0W A;  4DIR A;  2ZN9 A;  2NXQ A;  4FQO A;  4YRU A;  2ZKM X;  1JWD A;  2KI4 B;  1JF2 A;  1QX5 B;  2LM5 A;  2M3W A;  3DVJ A;  1CB1 A;  1LA0 A;  2KHN A;  2CNP A;  3EVU A;  3I5H B;  1DF0 B;  1B7T Y;  1UHK A;  1N65 A;  1KFU L;  4BY5 A;  1YX7 A;  3D0Y B;  1TCF A;  1CDL A;  1TIZ A;  2QAC A;  1XYD A;  4NDD A;  3DVK A;  1B47 A;  4ICB A;  1EG3 A;  4NQG A;  2A4J A;  2LHL A;  3IQO A;  2OPO A;  2ZNE A;  2QPT A;  4XJK A;  3I5I C;  1EJ3 A;  3BUX B;  2OS8 B;  4E68 A;  3O78 A;  1RFJ A;  2LAN A;  2F2O A;  1LXF C;  2WCB A;  1GGW A;  3RM1 A;  1J7O A;  4PHJ A;  1XFW O;  3BUM B;  1BR4 B;  1IKU A;  5TNC A;  1NUB A;  2WCF A;  2LUX A;  2PMY A;  1KK7 Y;  1SBJ A;  1DTL A;  3NSI A;  1DGU A;  2L5X B;  1B8C A;  4MN0 A;  1F4O A;  2SCP A;  2Q91 A;  4MEW A;  3SIA A;  1TRF A;  3OX5 A;  1OOJ A;  1IGV A;  1K96 A;  4PDZ A;  1JUO A;  1QIW A;  4MVF A;  5HKZ A;  3GK1 A;  1Y6W A;  4GAO A;  1C7W A;  2M1K B;  2NLN A;  3TZ1 A;  2WOS A;  2F2P A;  4M2O A;  1SL9 A;  1WLZ A;  2KNE A;  3I5G B;  2LCP A;  2JZI A;  2PAL A;  5DKQ A;  1CFD A;  3ZNI A;  2EC6 B;  5I8N A;  5I2L A;  4GPL B;  1SL8 A;  1NPQ A;  1K94 A;  2I2R E;  3TDI A;  5KSZ A;  2OS8 C;  1CLM A;  3LLE A;  1DJI A;  1OE9 B;  1CKK A;  4PHM A;  3AKB A;  1MXE A;  2LVV A;  1DGV A;  2AUC A;  2MRD A;  1Y0V H;  1B4C A;  4ZCU A;  1CNP A;  3DVE A;  5J3X A;  1AVS A;  2JXC A;  3IQQ A;  1QX2 A;  3A4U B;  1QLK A;  1AUI B;  4ORB B;  2BL0 C;  2LLU A;  3AAJ A;  4XJK B;  1S3P A;  1A4P A;  2CCM A;  1QXP A;  1Y1U A;  1MR8 A;  1MQ1 A;  2KGB C;  3O4Y A;  4HRH A;  1B1G A;  2BE6 A;  2F3Z A;  2L4I A;  2M7N A;  1QAT A;  5DKN A;  4NDB A;  3EVV A;  1JFJ A;  1K2H A;  1WY9 A;  3ICB A;  2LHI A;  4OVN F;  5CSN A;  2JWW A;  1CDP A;  3HCM A;  4YGA A;  2BKI B;  1S1E A;  2CBL A;  3I5G C;  1KQV A;  4MRY A;  1YTZ C;  3PFV A;  2ZRS A;  1LKJ A;  2EC6 C;  3BOW A;  1QVI Z;  3SG3 A;  3LCP C;  5GQQ C;  3SJS A;  3D10 A;  4MZL A;  1OZO A;  5CSJ A;  2F8P A;  2K2F A;  2KAV A;  3CS1 A;  1MWN A;  2M9G A;  1NSH A;  3I5I B;  4GGF A;  3RLZ A;  5AEQ A;  1TN4 A;  1FI6 A;  3DVM A;  1UHI A;  2PAS A;  3PN7 C;  1N0Y A;  1YUR A;  4FTG A;  2JT8 A;  4DRW A;  2KI6 C;  2MLE C;  2EGD A;  5JJG A;  1SNL A;  1ALV A;  1SK6 D;  4NDC A;  1G33 A;  3EKH A;  2KFH A;  5AXI A;  4IL1 A;  2KDH A;  1AK8 A;  1F71 A;  4GBA A;  2R2I A;  4YGC B;  4PHK A;  4CPV A;  2B1U A;  2KQ6 A;  1JF0 A;  2JUL A;  1UP5 A;  1UUS A;  2BKH B;  3FWC A;  3I5F C;  5PAL A;  2MHH A;  1CDN A;  2MJW B;  3BYA A;  1KWO B;  1GGZ A;  3PSR A;  4CFR A;  1FBV A;  4QJ3 B;  2PVB A;  2Y5I A;  4I5J A;  4ETO A;  1L2O C;  3EK7 A;  2K7O A;  2LVJ A;  1CTR A;  2I7A A;  1G4Y R;  2GGM A;  3WNX B;  1EH2 A;  2NZ0 A;  1J55 A;  5ER4 X;  1XA5 A;  1QV0 A;  1PRW A;  3GK4 X;  3PLF B;  4YGD B;  3QRX A;  2SAS A;  1K9U A;  3K21 A;  2JNF A;  2G9B A;  3TDU A;  1F54 A;  1BMO A;  2M1U A;  3OP0 A;  4WQ2 A;  5I2O A;  1H4B A;  1KSO A;  4PE4 A;  1CLL A;  1RRO A;  2O60 A;  4GFT A;  4ORC B;  3OHM B;  3O6B A;  2AAO A;  1ZOT B;  1FPW A;  3ZWH A;  1YVL A;  2K2A A;  3E3R A;  4A4B A;  1NX2 A;  3AAK A;  1NWD A;  1NCZ A;  1XFZ O;  3TS5 B;  3BOW B;  1K8U A;  1A2X A;  1C07 A;  2GV5 A;  2L4H A;  1C7V A;  1RJV A;  1WDC C;  2M0R A;  2V53 A;  2BL0 B;  3LK1 A;  1N2D A;  2CXJ A;  2D8N A;  3FS7 A;  2K0J A;  1TNW A;  1Y1X A;  1M46 A;  3BXK A;  3HX4 A;  2M7L A;  1OZS A;  4I5K A;  1XK4 A;  4WQ3 A;  1KWO C;  4PE1 A;  2L0P A;  1RK9 A;  3NSL A;  5AFP A;  1CFP A;  1ZAC A;  3IF7 A;  2G2B A;  3CR2 A;  4N1G A;  2L98 A;  4CFQ A;  1DMO A;  4JPZ B;  1QLS A;  1A03 A;  1B7T Z;  2TN4 A;  3GK2 A;  5IBW A;  1M39 A;  1M31 A;  1X02 A;  2JPT A;  4YI9 A;  1B9A A;  1EG4 A;  1PVB A;  1UHJ A;  1AHR A;  1S36 A;  4N5X A;  2VRG A;  1V1F A;  3WXA A;  2LMT A;  1JC2 A;  1DJZ A;  2FJU B;  1SCV A;  2Q4U A;  2EHB A;  2BCA A;  4I5N B;  3PN7 B;  3VRN A;  1A75 A;  1KQM B;  2K8M B;  2K7D A;  3BUO B;  2KSP A;  3CLN A;  3FIA A;  2Y1N A;  4CID A;  3BUW B;  1IWQ A;  1BU3 A;  3TS5 C;  2LVI A;  2GGZ A;  1QVI Y;  1SY9 A;  3CWG A;  3PAT A;  1PSB A;  1Y1A A;  4USL A;  4ORA B;  5B8I B;  1KK7 Z;  1QTX A;  1PSR A;  2K7B A;  4GGF C;  5BPJ A;  1YUS A;  1UWO A;  1Q80 A;  1RTP 1;  4WRI A;  2M29 A;  4MSP A;  1G8I A;  1WRL A;  3I5F B;  1V1G A;  2BBN A;  2Y4Q A;  2M97 A;  4U8D A;  1SMG A;  3OX6 A;  1PAL A;  1EL4 A;  4P5O E;  3VRQ A;  1L2O B;  2LVK A;  4OKH A;  2NCO A;  2LLT A;  1FI5 A;  5HLO A;  1BOD A;  2LE9 B;  3TUY C;  1LA3 A;  1UHN A;  2P6B B;  4MBE A;  1PK0 D;  3OB2 B;  3TDZ A;  3NSK A;  1S5G Z;  1REC A;  1WRZ A;  2KQY A;  3EK4 A;  2RGI A;  4I5L B;  2LLS A;  3C1V A;  3CZT X;  1R6P A;  1KCY A;  3DF0 A;  1KFX S;  1IQ5 A;  1TNQ A;  1KQM C;  1OQP A;  1F8H A;  3NSO A;  1BOC A;  1M63 B;  4AQJ A;  1FF1 A;  4PHN A;  1DJY A;  1SYM A;  2JOJ A;  1BF5 A;  1BR1 B;  1TNX A;  1W7J B;  2FCE A;  2JU0 A;  2LNK A;  2ZFD A;  3A8R A;  4XYN A;  1TOP A;  2HQ8 A;  1XFV O;  2JQ6 A;  2JTT A;  1MF8 B;  1WDC B;  1MUX A;  3F45 A;  5FYX A;  2M49 B;  4PE0 A;  1OMV A;  3VRR A;  1EXR A;  3JVT C;  2LV7 A;  1KK8 C;  1XFY O;  1OMR A;  1TTX A;  2BBM A;  3CGA A;  4F0Z B;  3BUN B;  5KU1 A;  2L2E A;  1A75 B;  1LIN A;  2MLF C;  1K90 D;  1BLQ A;  1B8L A;  1L7Z A;  4R1E A;  1IH0 A;  2H2K A;  2MBX A;  5CPV A;  4A4C A;  4OCI A;  2CT9 A;  2E30 A;  3KEV A;  2NCP A;  1QX7 A;  2ZN8 A;  2KFF A;  1TCO B;  2WND A;  1ZMZ A;  1NX0 A;  2WOR A;  2JC2 A;  2H61 A;  2KFG A;  2HQW A;  1XK4 C;  3KPX A;  1IRJ A;  2JNX A;  4OR9 B;  4QJ4 B;  1PVA A;  2I94 A;  2FOT A;  1F70 A;  1FW4 A;  3O2P A;  1J7P A;  5D69 A;  1S6J A;  1J7R A;  1E8A A;  2JTZ A;  3CR5 X;  1AP4 A;  2KAX A;  2OTG B;  1KFU S;  1U5I A;  2LP2 A;  3JTD B;  4JQ0 D;  2BE4 A;  2PSR A;  1DT7 B;  1WRK A;  5DKR A;  3PM8 A;  1DJX A;  4HRG A;  1XVJ A;  1IJ5 A;  4YGE B;  2HPS A;  1MHO A;  1H8B A;  5JOL A;  1SL7 A;  2L51 A;  1ALW A;  3DF0 B;  4CLN A;  1JBA A;  5CSF A;  4YBH B;  4M2P A;  2MAZ A;  1QIV A;  3WHT B;  1J7Q A;  4BY4 A;  1NCX A;  2KBM A;  2WCE A;  1SRA A;  1NX1 A;  3CR4 X;  3SIB A;  5HYD A;  1CMG A;  3WHU B;  2ZND A;  1M45 A;  2HF5 A;  4GGN A;  2LMU A;  1HQV A;  2ISD A;  1AJ4 A;  1AJ5 A;  1XO5 A;  1QV1 A;  3TUY B;  1CFF A;  3SG4 A;  1YUU A;  1SCM C;  4C0J A;  4OV2 A;  2JXL A;  1XFU O;  1SR6 C;  3FWB A;  1J1D A;  1DJG A;  1OMD A;  1OSA A;  1XFX O;  3VRP A;  1S26 D;  2KI4 C;  2E6W A;  2KYC A;  2M8U A;  4HSZ A;  1DJH A;  1TNP A;  5F6T A;  1BT6 A;  3I5H C;  4MZK A;  1F55 A;  1MXL C;  2OTG C;  3EVR A;  3JTD C;  1R2U A;  1QJT A;  1HT9 A;  1K93 D;  2BCB A;  3CTN A;  4Q04 A;  1CDM A;  2JRF A;  3NXA A;  1S6C A;  4DS7 A;  1NIW A;  5HLV A;  1NYA A;  3PAL A;  2COL B;  1S5G Y;  4MLW A;  1W7I B;  5I2Q A;  1YRT B;  4P2Y B;  1GJY A;  3H4S E;  3MSE B;  1IQ3 A;  5AER A;  1WLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...