3FWBA

Sac3:sus1:cdc31 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
153
Chain Sequence
QSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 31
publication title Sus1, Cdc31, and the Sac3 CID region form a conserved interaction platform that promotes nuclear pore association and mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle, transcription
total genus 52
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3fwbA01
1U5IB 2OTGC 5B8IB 3K21A 1SCVA 1S1EA 3JTDB 2KFHA 1NUBA 2BE6A 3LL8B 4PHJA 1RJVA 3OP0A 2ZN9A 1UWOA 2AUCA 1YRTB 1J7OA 4UPGA 4M2PA 1CFFA 2JT3A 2L4HA 4Q04A 1Y0VH 3NSKA 5CPVA 1N65A 2K7BA 3I5IC 2DOQA 5KU1A 2M3WA 2H2KA 3LCPC 5D69A 5G08A 4MZKA 5DKNA 1QJTA 1K90D 2M9GA 1FF1A 1Y1UA 2E30A 3CZTX 2LC5A 2CBLA 2MJWB 2Y4QA 5KTYA 4PE7A 5AERA 2JXLA 2ZNEA 2KAXA 1H4BA 2NXQA 1NX3A 1JF0A 1OSAA 1BU3A 2MAZA 2LLUA 1BR1B 4PDZA 2L50A 2LHLA 3SIAA 4CPVA 1PULA 2WCFA 2JRFA 3BUNB 4MLWA 3WNXB 1C7VA 1IJ5A 1XFZO 3M0WA 4BY5A 1QS7A 2KAYA 1SPYA 2PSRA 1J7QA 3WHUB 1SRAA 2PRUA 5DKRA 1M63B 2F33A 3VRNA 1FBVA 2GV5A 3EK8A 1JWDA 1KK8B 3NXAA 2FCDA 2MRDA 1NCXA 1NWDA 2KBMA 3EK7A 5HYDA 4ORAB 1J55A 2JNFA 4GUKA 5I2OA 2SASA 1QTXA 3H4SE 2FOTA 1K9PA 1TNWA 1L7ZA 4P5OE 2OTGB 3FWCA 1K9UA 4MZJA 4D1EA 1XA5A 4ZCUA 1DMOA 1WLZA 1J7PA 1LA3A 2WCEA 1DJHA 1K94A 4MRYA 1A75A 2JNXA 1TNXA 1YUTA 2M29A 3CGAA 1CFPA 1OQPA 1QIVA 2K7DA 4BY4A 4U8DA 2E6WA 2LAPA 1FPWA 2HF5A 5TNCA 1TNPA 2L98A 3I5IB 3ZWHA 1BMOA 1QX7A 2B1UA 1QVIY 2LVIA 2WNDA 1G4YR 1XFUO 1EXRA 1PVAA 4WRIA 1SY9A 5I2QA 1QX5B 2Y1NA 1ODBA 2OPOA 2BKIB 4YGEB 3GK2A 1M31A 1KSOA 3QRXA 4MVFA 1DVIA 2G2BA 2EHBA 1HQVA 3SG7A 2MBXA 4MSPA 2COLB 1X02A 1UP5A 4PE4A 1DT7B 3AAKA 1S36A 4PHNA 2LLSA 3I5FC 3PALA 4CFRA 3CWGA 1PVBA 2M0RA 1TN4A 2JQ6A 1KFUL 1OZOA 2KI4B 4GNKB 1PSRA 1BF5A 2LV7A 1IRJA 3RM1A 1S6JA 3HX4A 1GGWA 5HLVA 3AAJA 1CDPA 3ICBA 1K9KA 4PCWA 1S5GY 2BE4A 3IF7A 1A03A 1MQ1A 3TDUA 1UHNA 2KSPA 2H61A 1EH2A 2MLFC 1BLQA 2Y5IA 1M39A 1EJ3A 2RGIA 1UHJA 2HETA 1NX2A 3O4YA 3TS5B 1WRLA 1FW4A 2D8NA 1QV0A 3SG5A 4MN0A 1CLMA 4NQGA 3FIAA 5PALA 4WQ3A 1N0YA 4GPLB 3OX6A 1IKUA 3PFVA 2M97A 1J1DA 1OE9B 1ZFSA 1DJXA 1NPQA 3GK1A 1SL8A 3LLEA 2KOTA 4HREE 1S6CA 4A4BA 2HPSA 1NCYA 4MZLA 2LVVA 1SMGA 1NYAA 4L9MA 1WDCC 4YGDB 1BR4B 1SK6D 1H8BA 2KFGA 1F71A 2Q91A 3OB2B 1LVCD 2BL0B 2ZKMX 1QATA 3I5HB 2CNPA 1PALA 2PVBA 1MXEA 2LVJA 4XYNA 2JT0A 5FYXA 1SR6B 4ETOA 1MR8A 2MHHA 2F2OA 2G9BA 5CSIA 4ORBB 3EKHA 1ZMZA 1K93D 1R2UA 3LK1A 1WY9A 2GGMA 2H61C 1GJYA 2K0JA 3FS7A 4DS7A 1AP4A 3C1VA 2KYFA 3I5FB 1CDLA 5ER4X 1U5IA 1ZOTB 1MUXA 2AAOA 1GGZA 3TZ1A 1YRUB 2KGRA 2BCBA 1G8IA 1BODA 1DGVA 1UHHA 3PATA 2KI6C 1RTP1 2PALA 1HT9A 2JC2A 4PE0A 4ZCVA 4AQIA 1M46A 2WORA 1DJZA 2L2EA 3DVEA 3ZNIA 2KI4C 1LA0A 1YR5A 4FTGA 2NLNA 1CM4A 2F3ZA 3VGOA 4DCKA 3PM8A 1JFKA 3PLFB 2Q4UA 1UHIA 2VRGA 1K96A 2ZRSA 4YGAA 1KFXL 1CFDA 1FI6A 4TNCA 4HSZA 1CKKA 1TNQA 3CR5X 1WRKA 2BCXA 5BPJA 5CSJA 4JWQA 1R6PA 2PMYA 1OZSA 1CDNA 2M7NA 2LMUA 4OR9B 2K7CA 3DF0B 2KFFA 1B8LA 3TS5C 1SBJA 1LXFC 1TCOB 1F4QA 1TIZA 4YRUA 1DF0B 3D10A 1XVJA 4MRXA 2I7AA 3D0YB 1K2HA 2LP2A 3SG4A 1NP8A 1WDCB 5AFPA 1F4OA 3SG2A 2K7OA 1CLLA 4I5KA 1KCYA 1CNPA 4PHMA 2F2PA 4C0LA 1K95A 1NIWA 1LKJA 1IQ3A 2CCMA 3OX5A 1MXLC 2M1KB 2BL0C 1KQVA 1JUOA 3EK4A 4QJ5B 1SW8A 3I5HC 1YVLA 4XJKB 3NSLA 1UHKA 1MHOA 1FI5A 1SR6C 1MWNA 1V1GA 1TCFA 2JU0A 3DF0A 1JFJA 3BUOB 2ZFDA 4MEWA 4OV2A 4CLNA 2KGBC 1F55A 4N1FA 3IQOA 3CS1A 2F3YA 4YGBB 2HQWA 3WXAA 2NCOA 1CLBA 4DUQA 2JWWA 1N2DA 2WCBA 1KQMB 1RK9A 4E68A 3A8RA 3LK0A 2EGDA 4AOMA 2EC6B 1XYDA 3SIBA 2BKHB 1XK4C 2F8PA 4YI8A 1IWQA 5JOLA 3O78A 1RFJA 3O2PA 2LP3A 1QV1A 1KWOC 3KF9A 2LMVA 1AVSA 5HLOA 1JF2A 2LE9B 1KSMA 3CLNA 2K2AA 1QXPA 4DRWA 1RWYA 3BOWB 2M8UA 1C07A 1CMGA 1B8CA 3SG3A 2R2IA 2V53A 4JPZB 1JBAA 1B7TZ 1AHRA 4GAOA 1SKTA 3GK4X 1PK0D 2ISDA 4DIRA 4YBHB 1YTZC 2LUXA 5AXIA 2PASA 3GOFA 4IL1A 1DJIA 1A2XA 1QLSA 2GGZA 2I94A 3WHTB 2SCPA 1W7IB 1YUUA 1E8AA 3TUYB 2KI6D 1BJFA 1TTXA 2ZN8A 3SJSA 1BG1A 2JT8A 3KHEA 1GQMA 3VRRA 1OOJA 1A29A 1OMDA 1B9AA 2CT9A 2LHIA 2K61A 2JZIA 4GBAA 1NCZA 2MLEC 2WOSA 5I8NA 4MBEA 3BUMB 1MF8B 1S6IA 4GGFC 3BOWA 1SYMA 2A4JA 2OS8B 1XFVO 2FJUB 2JTTA 2NCPA 1TOPA 4GGNA 1B8RA 2M1UA 4OVNF 1Q80A 3OB1B 4HRHA 3NSOA 1CM1A 2KQ6A 4P2YB 1B1GA 2CTNA 1SL7A 1IQ5A 1B4CA 1C7WA 1KFUS 3FWBA 4M2QA 1DJYA 1VRKA 1QIWA 4NDCA 5HKYA 1M45A 3BXKA 5HKZA 3TDZA 1D1OA 1L2OB 3I5GC 1CB1A 4USLA 1QVIZ 2LCPA 2K2FA 1KQMC 1XFWO 3BUWB 3TDIA 4ICBA 1KWOB 1OMRA 2M7LA 1YUSA 2O5GA 4F0ZB 2EC6C 4OCIA 1UURA 3O6BA 4NDDA 4C0JA 1CMFA 1F8HA 1QLKA 2BCAA 1DJGA 3OHMB 1G33A 1W7JB 4WQ2A 1YX8A 2BBMA 1XO5A 1J7RA 2ZNDA 2K8MB 2WC8A 3CR4X 2BBNA 3CR2A 3HCMA 5J3XA 1B7TY 1CFCA 1A75B 5D7FA 2KQYA 2KHNA 2JXCA 4QJ4B 5JJGA 1S26D 4OKHA 4N5XA 5AANA 1B47A 3BUXB 4PALA 1QASA 1XK4A 1JC2A 1CTRA 4C0KA 1ZUZA 2KBIA 1S5GZ 1TRFA 3SG6A 3PN7B 5K89A 4N1GA 4A4CA 3EKJA 3F45A 1AJ5A 1KK7Z 3TUYC 2KDHA 1IGVA 2KAVA 2ZRTA 4ORCB 1SCMC 4JQ0D 4QJ3B 3AKBA 1RECA 1WLMA 3JVTC 2AMIA 2L0PA 2QACA 1V1FA 1ZACA 3MSEB 3A4UB 2HQ8A 3E3RA 2FCEA 2KNEA 2P6BB 1A4PA 1XFXO 2I2RE 2OS8C 5CSFA 3RLZA 1JSAA 3JTDC 1OMVA 1DF0A 2LLTA 1AK8A 5IBWA 3I5GB 3DVMA 3D0YA 1Y1AA 1XFYO 2M49B 1Y6WA 1QX2A 2L5XB 3DVJA 3PSRA 1NX1A 1IJ6A 2L51A 1IH0A 1Y1XA 3EVVA 1ALVA 2QPTA 4R1EA 1EL4A 2LNKA 2CXJA 5KSZA 2JULA 2LANA 1L2OC 1AUIB 5HKWA 1YX7A 2LUCA 3CTNA 1S3PA 4GGFA 1DJWA 1BOCA 1KFXS 4CFQA 3AKAA 4XJKA 4YGCB 2LMTA 4PE1A 1EG4A 1K8UA 3EVUA 4I5NB 5CSNA 3VROA 1PRWA 1IG5A 1AJ4A 2BECA 1RROA 3KPXA 3BYAA 1SNLA 4NDBA 4AQJA 4FQOA 1LINA 3KEVA 2IS9A 4HRGA 4GFTA 3EVRA 5F6TA 5I2LA 1DGUA 2JTZA 1BT6A 1DTLA 2Y1MA 1YURA 2NZ0A 2TN4A 4CIDA 4PHKA 3VRQA 2MA2A 2O60A 4YI9A 2LVKA 3BQ3A 1F54A 1PSBA 1YVHA 4I5LB 2LM5A 1WRZA 1KK7Y 3DVKA 1ALWA 1KK8C 3DD4A 4M2OA 1SCMB 2JOJA 1F70A 3KO0A 1J1EA 2I18A 1UUSA 2KYCA 3JVTB 3NSIA 3PN7C 5ER5A 5GQQC 5AEQA 3IQQA 1NSHA 1CDMA 4I5JA 1NX0A 1SL9A 5DKQA 3VRPA 2JPTA 1EG3A 2L4IA
chains in the Genus database with same CATH superfamily
1XFRA 1U5IB 2OTGC 5B8IB 3K21A 1SCVA 3CZ1A 4JKTA 1Z4HA 1S1EA 3JTDB 2KFHA 1NUBA 1OOFA 2BE6A 3BFAA 3LL8B 4PHJA 1RJVA 3OP0A 1C3ZA 2ZN9A 1UWOA 2AUCA 3PJIA 1YRTB 1J7OA 4UPGA 4M2PA 1CFFA 2JT3A 2L4HA 3L4AA 4Q04A 1Y0VH 3UNWA 3NSKA 5CPVA 1N65A 2K7BA 3BFBA 2DOQA 3I5IC 5KU1A 2M3WA 2H2KA 3LCPC 2KLEA 5D69A 5G08A 4MZKA 5DKNA 1QJTA 1K90D 2M9GA 1FF1A 1Y1UA 2E30A 2JPOA 3CZTX 2LC5A 1OOGA 2CBLA 2MJWB 2Y4QA 5KTYA 4PE7A 1QWVA 5AERA 2JXLA 2ZNEA 2KAXA 1H4BA 2NXQA 1NX3A 1JF0A 5D3OA 2BNXA 1OSAA 1BU3A 2QEBA 2MAZA 2LLUA 1BR1B 4PDZA 2L50A 2LHLA 3SIAA 4CPVA 1PULA 4INXA 2WCFA 2JRFA 3BUNB 4MLWA 3WNXB 1P28A 1C7VA 1IJ5A 1XFZO 3M0WA 4BY5A 1QS7A 2PYQA 3FE6A 2KAYA 1SPYA 2PSRA 1J7QA 3WHUB 3DXLA 1SRAA 2PRUA 5DKRA 1M63B 2F33A 3UO9A 3VRNA 1FBVA 2GV5A 3EK8A 3SS3A 5DICA 1JWDA 1W9ZA 1KK8B 3NXAA 2FCDA 2MRDA 1NCXA 1NWDA 2KBMA 3EK7A 3D75A 5HYDA 4ORAB 1OOIX 1J55A 2JNFA 2QEVA 4GUKA 2SASA 5I2OA 1QTXA 3H4SE 2FOTA 1K9PA 1TNWA 2P70A 2YGUA 1L7ZA 4P5OE 2OTGB 3FWCA 1K9UA 1SSEB 4MZJA 3EG5B 4D1EA 1XA5A 3R1OA 4ZCUA 1DMOA 1WLZA 1J7PA 1LA3A 2WCEA 3RZSA 1DJHA 1K94A 4MRYA 2PQLA 1A75A 2JNXA 1TNXA 1YUTA 2M29A 3CGAA 1CFPA 1OQPA 1QIVA 2K7DA 3CZ0A 4BY4A 4U8DA 2E6WA 2LAPA 1FPWA 2HF5A 5TNCA 1TNPA 2L98A 3D77A 3I5IB 3ZWHA 1BMOA 1QX7A 2B1UA 1QVIY 2LVIA 2WNDA 1G4YR 1XFUO 1EXRA 1PVAA 4WRIA 1SY9A 5I2QA 1QX5B 2Y1NA 1ODBA 2OPOA 4INWA 2BKIB 4YGEB 3GK2A 3OBVA 1M31A 1KSOA 3QRXA 4MVFA 1DVIA 2G2BA 2EHBA 3S0FA 1HQVA 3SG7A 2MBXA 4MSPA 2COLB 1X02A 1UP5A 2QEOA 3D76A 4PE4A 1TWOA 3AAKA 1DT7B 1S36A 4PHNA 2LLSA 3I5FC 3PALA 4CFRA 3CWGA 1PVBA 2M0RA 1TN4A 2JQ6A 1KFUL 1OZOA 2KI4B 1OOHA 1ORGA 4GNKB 1PSRA 1BF5A 2LV7A 1IRJA 3RM1A 1S6JA 3HX4A 1GGWA 5HLVA 3AAJA 1CDPA 3ICBA 1K9KA 4PCWA 1S5GY 2BE4A 3IF7A 1A03A 1MQ1A 3TDUA 1UHNA 2KSPA 2H61A 1EH2A 2MLFC 1BLQA 2Y5IA 1M39A 1EJ3A 2RGIA 1UHJA 2HETA 1NX2A 3O4YA 3TS5B 1WRLA 1FW4A 2D8NA 1QV0A 3SG5A 4MN0A 1CLMA 4NQGA 3FIAA 5PALA 4WQ3A 1N0YA 4GPLB 3OX6A 1IKUA 3PFVA 3SS4A 2M97A 3NHTA 1J1DA 1OE9B 1ZFSA 1DJXA 1NPQA 3GK1A 1SL8A 3B7AA 3LLEA 2KOTA 4HREE 1S6CA 3O4XA 4A4BA 2HPSA 1NCYA 4MZLA 3OGNA 2LVVA 4FQTA 1SMGA 1NYAA 4L9MA 1WDCC 4YGDB 1BR4B 1SK6D 3B88A 2KFGA 3L47A 1F71A 1H8BA 2Q91A 3OB2B 1LVCD 2BL0B 2ZKMX 1QATA 3K1EA 3I5HB 2CNPA 1PALA 2PVBA 1MXEA 2LVJA 3R1VA 2JT0A 4XYNA 1SR6B 5FYXA 4ETOA 1TUJA 1MR8A 2MHHA 2F2OA 2G9BA 5CSIA 4ORBB 3EKHA 1ZMZA 1K93D 1R2UA 3LK1A 1WY9A 2WC5A 2GGMA 2H61C 1GJYA 2K0JA 3FS7A 4DS7A 1AP4A 3C1VA 2KYFA 3I5FB 1CDLA 5ER4X 1U5IA 1ZOTB 1MUXA 2AAOA 1GGZA 3TZ1A 1YRUB 2KGRA 2BCBA 1G8IA 3BFHA 1BODA 1DGVA 1UHHA 3PATA 2KI6C 1RTP1 2PALA 1DEKA 2L5YA 1HT9A 2JC2A 4PE0A 3D78A 4ZCVA 4AQIA 1M46A 2WORA 1DJZA 2L2EA 3DVEA 3ZNIA 2KI4C 3B6XA 1LA0A 1YR5A 4FTGA 2NLNA 1CM4A 2F3ZA 3VGOA 4DCKA 3PM8A 1JFKA 3PLFB 2GTEA 2Q4UA 1UHIA 2VRGA 1K96A 2ZRSA 4YGAA 1KFXL 1CFDA 1TUZA 1FI6A 4TNCA 4HSZA 1CKKA 1TNQA 3CR5X 1WRKA 2BCXA 5BPJA 5CSJA 2FJYA 4JWQA 1R6PA 2PMYA 1OZSA 1CDNA 2M7NA 2LMUA 4OR9B 2K7CA 3DF0B 2KFFA 1B8LA 3TS5C 1SBJA 1LXFC 3Q8IA 1TCOB 1F4QA 1TIZA 3B86A 4YRUA 1DF0B 2WCHA 3D10A 1XVJA 4MRXA 2I7AA 3S0DA 3D0YB 3DYEA 1K2HA 2LP2A 3SG4A 1NP8A 1WDCB 3VB1A 5AFPA 1F4OA 3SG2A 2K7OA 1CLLA 4I5KA 1KCYA 1CNPA 4PHMA 2F2PA 4C0LA 2H8VA 1K95A 1NIWA 1LKJA 1IQ3A 2CCMA 3OX5A 1MXLC 2M1KB 3V2LA 2BL0C 1KQVA 1JUOA 3EK4A 4QJ5B 1SW8A 3I5HC 1YVLA 4XJKB 3NSLA 1UHKA 1MHOA 1FI5A 1SR6C 1MWNA 1V1GA 1TCFA 2JU0A 3DF0A 1JFJA 3BUOB 2ZFDA 4MEWA 4OV2A 4CLNA 2KGBC 1F55A 4N1FA 3CABA 3IQOA 3QMEA 3CS1A 2F3YA 4YGBB 2HQWA 3WXAA 2NCOA 1CLBA 4DUQA 2JWWA 3D74A 1N2DA 2WCBA 1KQMB 1RK9A 4E68A 3A8RA 3LK0A 2EGDA 4AOMA 3DZTA 3S0AA 2EC6B 1XYDA 2L2CA 1DC1A 3SIBA 2BKHB 1XK4C 3NGVA 2F8PA 4YI8A 1IWQA 5JOLA 3O78A 1RFJA 3O2PA 2LP3A 1QV1A 1KWOC 3KF9A 2LMVA 1AVSA 5HLOA 1JF2A 2LE9B 1KSMA 3CLNA 3SS5A 2K2AA 5FI7A 4JD9A 1QXPA 4DRWA 1RWYA 3BOWB 2M8UA 1C07A 1CMGA 1B8CA 3SG3A 2R2IA 2V53A 4JPZB 1JBAA 1B7TZ 3FE9A 1AHRA 4GAOA 1DQEA 1SKTA 3GK4X 1PK0D 2WCJA 2ISDA 4DIRA 4YBHB 1YTZC 2LUXA 3CDNA 5AXIA 2PASA 3GOFA 4IL1A 1DJIA 1A2XA 1QLSA 2GGZA 2I94A 3WHTB 3NHIA 2SCPA 1C3YA 3B87A 1W7IB 1YUUA 1E8AA 3TUYB 2KI6D 1BJFA 1TTXA 2ZN8A 3SJSA 1BG1A 2JT8A 3KHEA 1GQMA 3VRRA 1OOJA 1T14A 1A29A 1OMDA 1B9AA 2CT9A 2LHIA 2K61A 2JZIA 4GBAA 1NCZA 2MLEC 2WOSA 5I8NA 4MBEA 3BUMB 1MF8B 1S6IA 4GGFC 3BOWA 1SYMA 2A4JA 5FI2A 2OS8B 1XFVO 2FJUB 2JTTA 2NCPA 1TOPA 4GGNA 1B8RA 2M1UA 4OVNF 1Q80A 3OB1B 4HRHA 3NSOA 1Z2CB 1CM1A 2KQ6A 4P2YB 3DY9A 1B1GA 2CTNA 1SL7A 1IQ5A 1B4CA 1C7WA 1KFUS 3FWBA 3L4LA 1DJYA 1VRKA 4M2QA 2QEHA 1QIWA 4NDCA 2ERBA 5HKYA 1M45A 3BXKA 5HKZA 3TDZA 1D1OA 1L2OB 3I5GC 1CB1A 4USLA 1QVIZ 2LCPA 3CYZA 2K2FA 1KQMC 1XFWO 3BUWB 3IVTA 2WCKA 5FI6A 4ICBA 3TDIA 1KWOB 1OMRA 1OW4A 2M7LA 1YUSA 2O5GA 4F0ZB 2EC6C 2KPHA 4OCIA 3BJHA 1UURA 3O6BA 4NDDA 4C0JA 1CMFA 1F8HA 1QLKA 2BCAA 1DJGA 3OHMB 5I94A 1G33A 1W7JB 4WQ2A 1YX8A 2BBMA 1XO5A 1J7RA 2ZNDA 2K8MB 2WC8A 3CR4X 2BBNA 3CR2A 3HCMA 5J3XA 1B7TY 1CFCA 1A75B 5D7FA 2KQYA 3CZ2A 2KHNA 2JXCA 4QJ4B 5JJGA 1S26D 2WCLA 5EL2A 4OKHA 4N5XA 5AANA 1B47A 3BUXB 4PALA 1QASA 1XK4A 1JC2A 1CTRA 4C0KA 1ZUZA 2KBIA 1S5GZ 1IIOA 4KYNA 1TRFA 3SG6A 3PN7B 5K89A 4N1GA 4A4CA 3EKJA 3F45A 1AJ5A 1KK7Z 3TUYC 2KDHA 1IGVA 2KAVA 2ZRTA 4ORCB 1SCMC 4JQ0D 4QJ3B 3AKBA 3R72A 1RECA 1WLMA 3JVTC 2AMIA 1GM0A 2L0PA 2QACA 1V1FA 1ZACA 3MSEB 3A4UB 2HQ8A 3E3RA 2FCEA 2KNEA 3PM2A 2P71A 2P6BB 1A4PA 1XFXO 2I2RE 2OS8C 5CSFA 3RLZA 1JSAA 3JTDC 1OMVA 1DF0A 2LLTA 1AK8A 5IBWA 3I5GB 3DVMA 3D0YA 4IJ7A 1Y1AA 1XFYO 2M49B 1Y6WA 5HL1A 1QX2A 2L5XB 3D73A 3DVJA 3PSRA 1NX1A 1IJ6A 2L51A 2QDIA 1IH0A 1Y1XA 3EVVA 1ALVA 2QPTA 4R1EA 1EL4A 4PT1A 2LNKA 2CXJA 3N7HA 5KSZA 4F7FA 2WC6A 2JULA 2LANA 1L2OC 3S0EA 1AUIB 5HKWA 1YX7A 2LUCA 3CTNA 1S3PA 4GGFA 1DJWA 1BOCA 1KFXS 4CFQA 3AKAA 3FE8A 4XJKA 2LMTA 4YGCB 4PE1A 1EG4A 1K8UA 1DELA 4OZDA 3EVUA 4I5NB 5CSNA 3VROA 1PRWA 1IG5A 1AJ4A 2BECA 1RROA 3KPXA 3BYAA 1SNLA 4NDBA 3S0GA 4AQJA 3S0BA 4FQOA 1LINA 3KEVA 2IS9A 4HRGA 4GFTA 2WCMA 3EVRA 5F6TA 5I2LA 1DGUA 2JTZA 1BT6A 1DTLA 2Y1MA 1YURA 2NZ0A 2TN4A 4CIDA 4PHKA 1LS8A 3VRQA 2MA2A 2BAPA 2O60A 2LVKA 4YI9A 3BQ3A 1F54A 1PSBA 1YVHA 2KLDA 4I5LB 2LM5A 1WRZA 1KK7Y 3DVKA 1ALWA 1KK8C 3DD4A 4M2OA 1SCMB 2JOJA 1F70A 3KO0A 1J1EA 2I18A 1UUSA 2KYCA 3JVTB 3NSIA 3PN7C 5ER5A 5GQQC 5AEQA 3IQQA 1NSHA 1CDMA 4I5JA 1NX0A 1SL9A 5DKQA 3R1PA 3VRPA 2JPTA 2K60A 1EG3A 2L4IA
chains in the Genus database with same CATH topology
1U5IB 2OTGC 5B8IB 3K21A 1SCVA 1S1EA 3JTDB 2KFHA 1NUBA 2BE6A 3LL8B 4PHJA 1RJVA 3OP0A 2ZN9A 1UWOA 2AUCA 1YRTB 1J7OA 4UPGA 4M2PA 1CFFA 2JT3A 2L4HA 4Q04A 1Y0VH 3NSKA 5CPVA 1N65A 2K7BA 3I5IC 2DOQA 5KU1A 2M3WA 2H2KA 3LCPC 5D69A 5G08A 4MZKA 5DKNA 1QJTA 1K90D 2M9GA 1FF1A 1Y1UA 2E30A 3CZTX 2LC5A 2CBLA 2MJWB 2Y4QA 5KTYA 4PE7A 5AERA 2JXLA 2ZNEA 2KAXA 1H4BA 2NXQA 1NX3A 1JF0A 1OSAA 1BU3A 2MAZA 2LLUA 1BR1B 4PDZA 2L50A 2LHLA 3SIAA 4CPVA 1PULA 2WCFA 2JRFA 3BUNB 4MLWA 3WNXB 1C7VA 1IJ5A 1XFZO 3M0WA 4BY5A 1QS7A 2KAYA 1SPYA 2PSRA 1J7QA 3WHUB 1SRAA 2PRUA 5DKRA 1M63B 2F33A 3VRNA 1FBVA 2GV5A 3EK8A 1JWDA 1KK8B 3NXAA 2FCDA 2MRDA 1NCXA 1NWDA 2KBMA 3EK7A 5HYDA 4ORAB 1J55A 2JNFA 4GUKA 5I2OA 2SASA 1QTXA 3H4SE 2FOTA 1K9PA 1TNWA 1L7ZA 4P5OE 2OTGB 3FWCA 1K9UA 4MZJA 4D1EA 1XA5A 4ZCUA 1DMOA 1WLZA 1J7PA 1LA3A 2WCEA 1DJHA 1K94A 4MRYA 1A75A 2JNXA 1TNXA 1YUTA 2M29A 3CGAA 1CFPA 1OQPA 1QIVA 2K7DA 4BY4A 4U8DA 2E6WA 2LAPA 1FPWA 2HF5A 5TNCA 1TNPA 2L98A 3I5IB 3ZWHA 1BMOA 1QX7A 2B1UA 1QVIY 2LVIA 2WNDA 1G4YR 1XFUO 1EXRA 1PVAA 4WRIA 1SY9A 5I2QA 1QX5B 2Y1NA 1ODBA 2OPOA 2BKIB 4YGEB 3GK2A 1M31A 1KSOA 3QRXA 4MVFA 1DVIA 2G2BA 2EHBA 1HQVA 3SG7A 2MBXA 4MSPA 2COLB 1X02A 1UP5A 4PE4A 1DT7B 3AAKA 1S36A 4PHNA 2LLSA 3I5FC 3PALA 4CFRA 3CWGA 1PVBA 2M0RA 1TN4A 2JQ6A 1KFUL 1OZOA 2KI4B 4GNKB 1PSRA 1BF5A 2LV7A 1IRJA 3RM1A 1S6JA 3HX4A 1GGWA 5HLVA 3AAJA 1CDPA 3ICBA 1K9KA 4PCWA 1S5GY 2BE4A 3IF7A 1A03A 1MQ1A 3TDUA 1UHNA 2KSPA 2H61A 1EH2A 2MLFC 1BLQA 2Y5IA 1M39A 1EJ3A 2RGIA 1UHJA 2HETA 1NX2A 3O4YA 3TS5B 1WRLA 1FW4A 2D8NA 1QV0A 3SG5A 4MN0A 1CLMA 4NQGA 3FIAA 5PALA 4WQ3A 1N0YA 4GPLB 3OX6A 1IKUA 3PFVA 2M97A 1J1DA 1OE9B 1ZFSA 1DJXA 1NPQA 3GK1A 1SL8A 3LLEA 2KOTA 4HREE 1S6CA 4A4BA 2HPSA 1NCYA 4MZLA 2LVVA 1SMGA 1NYAA 4L9MA 1WDCC 4YGDB 1BR4B 1SK6D 1H8BA 2KFGA 1F71A 2Q91A 3OB2B 1LVCD 2BL0B 2ZKMX 1QATA 3I5HB 2CNPA 1PALA 2PVBA 1MXEA 2LVJA 4XYNA 2JT0A 5FYXA 1SR6B 4ETOA 1MR8A 2MHHA 2F2OA 2G9BA 5CSIA 4ORBB 3EKHA 1ZMZA 1K93D 1R2UA 3LK1A 1WY9A 2GGMA 2H61C 1GJYA 2K0JA 3FS7A 4DS7A 1AP4A 3C1VA 2KYFA 3I5FB 1CDLA 5ER4X 1U5IA 1ZOTB 1MUXA 2AAOA 1GGZA 3TZ1A 1YRUB 2KGRA 2BCBA 1G8IA 1BODA 1DGVA 1UHHA 3PATA 2KI6C 1RTP1 2PALA 1HT9A 2JC2A 4PE0A 4ZCVA 4AQIA 1M46A 2WORA 1DJZA 2L2EA 3DVEA 3ZNIA 2KI4C 1LA0A 1YR5A 4FTGA 2NLNA 1CM4A 2F3ZA 3VGOA 4DCKA 3PM8A 1JFKA 3PLFB 2Q4UA 1UHIA 2VRGA 1K96A 2ZRSA 4YGAA 1KFXL 1CFDA 1FI6A 4TNCA 4HSZA 1CKKA 1TNQA 3CR5X 1WRKA 2BCXA 5BPJA 5CSJA 4JWQA 1R6PA 2PMYA 1OZSA 1CDNA 2M7NA 2LMUA 4OR9B 2K7CA 3DF0B 2KFFA 1B8LA 3TS5C 1SBJA 1LXFC 1TCOB 1F4QA 1TIZA 4YRUA 1DF0B 3D10A 1XVJA 4MRXA 2I7AA 3D0YB 1K2HA 2LP2A 3SG4A 1NP8A 1WDCB 5AFPA 1F4OA 3SG2A 2K7OA 1CLLA 4I5KA 1KCYA 1CNPA 4PHMA 2F2PA 4C0LA 1K95A 1NIWA 1LKJA 1IQ3A 2CCMA 3OX5A 1MXLC 2M1KB 2BL0C 1KQVA 1JUOA 3EK4A 4QJ5B 1SW8A 3I5HC 1YVLA 4XJKB 3NSLA 1UHKA 1MHOA 1FI5A 1SR6C 1MWNA 1V1GA 1TCFA 2JU0A 3DF0A 1JFJA 3BUOB 2ZFDA 4MEWA 4OV2A 4CLNA 2KGBC 1F55A 4N1FA 3IQOA 3CS1A 2F3YA 4YGBB 2HQWA 3WXAA 2NCOA 1CLBA 4DUQA 2JWWA 1N2DA 2WCBA 1KQMB 1RK9A 4E68A 3A8RA 3LK0A 2EGDA 4AOMA 2EC6B 1XYDA 3SIBA 2BKHB 1XK4C 2F8PA 4YI8A 1IWQA 5JOLA 3O78A 1RFJA 3O2PA 2LP3A 1QV1A 1KWOC 3KF9A 2LMVA 1AVSA 5HLOA 1JF2A 2LE9B 1KSMA 3CLNA 2K2AA 1QXPA 4DRWA 1RWYA 3BOWB 2M8UA 1C07A 1CMGA 1B8CA 3SG3A 2R2IA 2V53A 4JPZB 1JBAA 1B7TZ 1AHRA 4GAOA 1SKTA 3GK4X 1PK0D 2ISDA 4DIRA 4YBHB 1YTZC 2LUXA 5AXIA 2PASA 3GOFA 4IL1A 1DJIA 1A2XA 1QLSA 2GGZA 2I94A 3WHTB 2SCPA 1W7IB 1YUUA 1E8AA 3TUYB 2KI6D 1BJFA 1TTXA 2ZN8A 3SJSA 1BG1A 2JT8A 3KHEA 1GQMA 3VRRA 1OOJA 1A29A 1OMDA 1B9AA 2CT9A 2LHIA 2K61A 2JZIA 4GBAA 1NCZA 2MLEC 2WOSA 5I8NA 4MBEA 3BUMB 1MF8B 1S6IA 4GGFC 3BOWA 1SYMA 2A4JA 2OS8B 1XFVO 2FJUB 2JTTA 2NCPA 1TOPA 4GGNA 1B8RA 2M1UA 4OVNF 1Q80A 3OB1B 4HRHA 3NSOA 1CM1A 2KQ6A 4P2YB 1B1GA 2CTNA 1SL7A 1IQ5A 1B4CA 1C7WA 1KFUS 3FWBA 4M2QA 1DJYA 1VRKA 1QIWA 4NDCA 5HKYA 1M45A 3BXKA 5HKZA 3TDZA 1D1OA 1L2OB 3I5GC 1CB1A 4USLA 1QVIZ 2LCPA 2K2FA 1KQMC 1XFWO 3BUWB 3TDIA 4ICBA 1KWOB 1OMRA 2M7LA 1YUSA 2O5GA 4F0ZB 2EC6C 4OCIA 1UURA 3O6BA 4NDDA 4C0JA 1CMFA 1F8HA 1QLKA 2BCAA 1DJGA 3OHMB 1G33A 1W7JB 4WQ2A 1YX8A 2BBMA 1XO5A 1J7RA 2ZNDA 2K8MB 2WC8A 3CR4X 2BBNA 3CR2A 3HCMA 5J3XA 1B7TY 1CFCA 1A75B 5D7FA 2KQYA 2KHNA 2JXCA 4QJ4B 5JJGA 1S26D 4OKHA 4N5XA 5AANA 1B47A 3BUXB 4PALA 1QASA 1XK4A 1JC2A 1CTRA 4C0KA 1ZUZA 2KBIA 1S5GZ 1TRFA 3SG6A 3PN7B 5K89A 4N1GA 4A4CA 3EKJA 3F45A 1AJ5A 1KK7Z 3TUYC 2KDHA 1IGVA 2KAVA 2ZRTA 4ORCB 1SCMC 4JQ0D 4QJ3B 3AKBA 1RECA 1WLMA 3JVTC 2AMIA 2L0PA 2QACA 1V1FA 1ZACA 3MSEB 3A4UB 2HQ8A 3E3RA 2FCEA 2KNEA 2P6BB 1A4PA 1XFXO 2I2RE 2OS8C 5CSFA 3RLZA 1JSAA 3JTDC 1OMVA 1DF0A 2LLTA 1AK8A 5IBWA 3I5GB 3DVMA 3D0YA 1Y1AA 1XFYO 2M49B 1Y6WA 1QX2A 2L5XB 3DVJA 3PSRA 1NX1A 1IJ6A 2L51A 1IH0A 1Y1XA 3EVVA 1ALVA 2QPTA 4R1EA 1EL4A 2LNKA 2CXJA 5KSZA 2JULA 2LANA 1L2OC 1AUIB 5HKWA 1YX7A 2LUCA 3CTNA 1S3PA 4GGFA 1DJWA 1BOCA 1KFXS 4CFQA 3AKAA 4XJKA 4YGCB 2LMTA 4PE1A 1EG4A 1K8UA 3EVUA 4I5NB 5CSNA 3VROA 1PRWA 1IG5A 1AJ4A 2BECA 1RROA 3KPXA 3BYAA 1SNLA 4NDBA 4AQJA 4FQOA 1LINA 3KEVA 2IS9A 4HRGA 4GFTA 3EVRA 5F6TA 5I2LA 1DGUA 2JTZA 1BT6A 1DTLA 2Y1MA 1YURA 2NZ0A 2TN4A 4CIDA 4PHKA 3VRQA 2MA2A 2O60A 4YI9A 2LVKA 3BQ3A 1F54A 1PSBA 1YVHA 4I5LB 2LM5A 1WRZA 1KK7Y 3DVKA 1ALWA 1KK8C 3DD4A 4M2OA 1SCMB 2JOJA 1F70A 3KO0A 1J1EA 2I18A 1UUSA 2KYCA 3JVTB 3NSIA 3PN7C 5ER5A 5GQQC 5AEQA 3IQQA 1NSHA 1CDMA 4I5JA 1NX0A 1SL9A 5DKQA 3VRPA 2JPTA 1EG3A 2L4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5I B;  2OTG C;  5B8I B;  3K21 A;  1SCV A;  1S1E A;  3JTD B;  2KFH A;  1NUB A;  2BE6 A;  3LL8 B;  4PHJ A;  1RJV A;  3OP0 A;  2ZN9 A;  1UWO A;  2AUC A;  1YRT B;  1J7O A;  4UPG A;  4M2P A;  1CFF A;  2JT3 A;  2L4H A;  4Q04 A;  1Y0V H;  3NSK A;  5CPV A;  1N65 A;  2K7B A;  3I5I C;  2DOQ A;  5KU1 A;  2M3W A;  2H2K A;  3LCP C;  5D69 A;  5G08 A;  4MZK A;  5DKN A;  1QJT A;  1K90 D;  2M9G A;  1FF1 A;  1Y1U A;  2E30 A;  3CZT X;  2LC5 A;  2CBL A;  2MJW B;  2Y4Q A;  5KTY A;  4PE7 A;  5AER A;  2JXL A;  2ZNE A;  2KAX A;  1H4B A;  2NXQ A;  1NX3 A;  1JF0 A;  1OSA A;  1BU3 A;  2MAZ A;  2LLU A;  1BR1 B;  4PDZ A;  2L50 A;  2LHL A;  3SIA A;  4CPV A;  1PUL A;  2WCF A;  2JRF A;  3BUN B;  4MLW A;  3WNX B;  1C7V A;  1IJ5 A;  1XFZ O;  3M0W A;  4BY5 A;  1QS7 A;  2KAY A;  1SPY A;  2PSR A;  1J7Q A;  3WHU B;  1SRA A;  2PRU A;  5DKR A;  1M63 B;  2F33 A;  3VRN A;  1FBV A;  2GV5 A;  3EK8 A;  1JWD A;  1KK8 B;  3NXA A;  2FCD A;  2MRD A;  1NCX A;  1NWD A;  2KBM A;  3EK7 A;  5HYD A;  4ORA B;  1J55 A;  2JNF A;  4GUK A;  5I2O A;  2SAS A;  1QTX A;  3H4S E;  2FOT A;  1K9P A;  1TNW A;  1L7Z A;  4P5O E;  2OTG B;  3FWC A;  1K9U A;  4MZJ A;  4D1E A;  1XA5 A;  4ZCU A;  1DMO A;  1WLZ A;  1J7P A;  1LA3 A;  2WCE A;  1DJH A;  1K94 A;  4MRY A;  1A75 A;  2JNX A;  1TNX A;  1YUT A;  2M29 A;  3CGA A;  1CFP A;  1OQP A;  1QIV A;  2K7D A;  4BY4 A;  4U8D A;  2E6W A;  2LAP A;  1FPW A;  2HF5 A;  5TNC A;  1TNP A;  2L98 A;  3I5I B;  3ZWH A;  1BMO A;  1QX7 A;  2B1U A;  1QVI Y;  2LVI A;  2WND A;  1G4Y R;  1XFU O;  1EXR A;  1PVA A;  4WRI A;  1SY9 A;  5I2Q A;  1QX5 B;  2Y1N A;  1ODB A;  2OPO A;  2BKI B;  4YGE B;  3GK2 A;  1M31 A;  1KSO A;  3QRX A;  4MVF A;  1DVI A;  2G2B A;  2EHB A;  1HQV A;  3SG7 A;  2MBX A;  4MSP A;  2COL B;  1X02 A;  1UP5 A;  4PE4 A;  1DT7 B;  3AAK A;  1S36 A;  4PHN A;  2LLS A;  3I5F C;  3PAL A;  4CFR A;  3CWG A;  1PVB A;  2M0R A;  1TN4 A;  2JQ6 A;  1KFU L;  1OZO A;  2KI4 B;  4GNK B;  1PSR A;  1BF5 A;  2LV7 A;  1IRJ A;  3RM1 A;  1S6J A;  3HX4 A;  1GGW A;  5HLV A;  3AAJ A;  1CDP A;  3ICB A;  1K9K A;  4PCW A;  1S5G Y;  2BE4 A;  3IF7 A;  1A03 A;  1MQ1 A;  3TDU A;  1UHN A;  2KSP A;  2H61 A;  1EH2 A;  2MLF C;  1BLQ A;  2Y5I A;  1M39 A;  1EJ3 A;  2RGI A;  1UHJ A;  2HET A;  1NX2 A;  3O4Y A;  3TS5 B;  1WRL A;  1FW4 A;  2D8N A;  1QV0 A;  3SG5 A;  4MN0 A;  1CLM A;  4NQG A;  3FIA A;  5PAL A;  4WQ3 A;  1N0Y A;  4GPL B;  3OX6 A;  1IKU A;  3PFV A;  2M97 A;  1J1D A;  1OE9 B;  1ZFS A;  1DJX A;  1NPQ A;  3GK1 A;  1SL8 A;  3LLE A;  2KOT A;  4HRE E;  1S6C A;  4A4B A;  2HPS A;  1NCY A;  4MZL A;  2LVV A;  1SMG A;  1NYA A;  4L9M A;  1WDC C;  4YGD B;  1BR4 B;  1SK6 D;  1H8B A;  2KFG A;  1F71 A;  2Q91 A;  3OB2 B;  1LVC D;  2BL0 B;  2ZKM X;  1QAT A;  3I5H B;  2CNP A;  1PAL A;  2PVB A;  1MXE A;  2LVJ A;  4XYN A;  2JT0 A;  5FYX A;  1SR6 B;  4ETO A;  1MR8 A;  2MHH A;  2F2O A;  2G9B A;  5CSI A;  4ORB B;  3EKH A;  1ZMZ A;  1K93 D;  1R2U A;  3LK1 A;  1WY9 A;  2GGM A;  2H61 C;  1GJY A;  2K0J A;  3FS7 A;  4DS7 A;  1AP4 A;  3C1V A;  2KYF A;  3I5F B;  1CDL A;  5ER4 X;  1U5I A;  1ZOT B;  1MUX A;  2AAO A;  1GGZ A;  3TZ1 A;  1YRU B;  2KGR A;  2BCB A;  1G8I A;  1BOD A;  1DGV A;  1UHH A;  3PAT A;  2KI6 C;  1RTP 1;  2PAL A;  1HT9 A;  2JC2 A;  4PE0 A;  4ZCV A;  4AQI A;  1M46 A;  2WOR A;  1DJZ A;  2L2E A;  3DVE A;  3ZNI A;  2KI4 C;  1LA0 A;  1YR5 A;  4FTG A;  2NLN A;  1CM4 A;  2F3Z A;  3VGO A;  4DCK A;  3PM8 A;  1JFK A;  3PLF B;  2Q4U A;  1UHI A;  2VRG A;  1K96 A;  2ZRS A;  4YGA A;  1KFX L;  1CFD A;  1FI6 A;  4TNC A;  4HSZ A;  1CKK A;  1TNQ A;  3CR5 X;  1WRK A;  2BCX A;  5BPJ A;  5CSJ A;  4JWQ A;  1R6P A;  2PMY A;  1OZS A;  1CDN A;  2M7N A;  2LMU A;  4OR9 B;  2K7C A;  3DF0 B;  2KFF A;  1B8L A;  3TS5 C;  1SBJ A;  1LXF C;  1TCO B;  1F4Q A;  1TIZ A;  4YRU A;  1DF0 B;  3D10 A;  1XVJ A;  4MRX A;  2I7A A;  3D0Y B;  1K2H A;  2LP2 A;  3SG4 A;  1NP8 A;  1WDC B;  5AFP A;  1F4O A;  3SG2 A;  2K7O A;  1CLL A;  4I5K A;  1KCY A;  1CNP A;  4PHM A;  2F2P A;  4C0L A;  1K95 A;  1NIW A;  1LKJ A;  1IQ3 A;  2CCM A;  3OX5 A;  1MXL C;  2M1K B;  2BL0 C;  1KQV A;  1JUO A;  3EK4 A;  4QJ5 B;  1SW8 A;  3I5H C;  1YVL A;  4XJK B;  3NSL A;  1UHK A;  1MHO A;  1FI5 A;  1SR6 C;  1MWN A;  1V1G A;  1TCF A;  2JU0 A;  3DF0 A;  1JFJ A;  3BUO B;  2ZFD A;  4MEW A;  4OV2 A;  4CLN A;  2KGB C;  1F55 A;  4N1F A;  3IQO A;  3CS1 A;  2F3Y A;  4YGB B;  2HQW A;  3WXA A;  2NCO A;  1CLB A;  4DUQ A;  2JWW A;  1N2D A;  2WCB A;  1KQM B;  1RK9 A;  4E68 A;  3A8R A;  3LK0 A;  2EGD A;  4AOM A;  2EC6 B;  1XYD A;  3SIB A;  2BKH B;  1XK4 C;  2F8P A;  4YI8 A;  1IWQ A;  5JOL A;  3O78 A;  1RFJ A;  3O2P A;  2LP3 A;  1QV1 A;  1KWO C;  3KF9 A;  2LMV A;  1AVS A;  5HLO A;  1JF2 A;  2LE9 B;  1KSM A;  3CLN A;  2K2A A;  1QXP A;  4DRW A;  1RWY A;  3BOW B;  2M8U A;  1C07 A;  1CMG A;  1B8C A;  3SG3 A;  2R2I A;  2V53 A;  4JPZ B;  1JBA A;  1B7T Z;  1AHR A;  4GAO A;  1SKT A;  3GK4 X;  1PK0 D;  2ISD A;  4DIR A;  4YBH B;  1YTZ C;  2LUX A;  5AXI A;  2PAS A;  3GOF A;  4IL1 A;  1DJI A;  1A2X A;  1QLS A;  2GGZ A;  2I94 A;  3WHT B;  2SCP A;  1W7I B;  1YUU A;  1E8A A;  3TUY B;  2KI6 D;  1BJF A;  1TTX A;  2ZN8 A;  3SJS A;  1BG1 A;  2JT8 A;  3KHE A;  1GQM A;  3VRR A;  1OOJ A;  1A29 A;  1OMD A;  1B9A A;  2CT9 A;  2LHI A;  2K61 A;  2JZI A;  4GBA A;  1NCZ A;  2MLE C;  2WOS A;  5I8N A;  4MBE A;  3BUM B;  1MF8 B;  1S6I A;  4GGF C;  3BOW A;  1SYM A;  2A4J A;  2OS8 B;  1XFV O;  2FJU B;  2JTT A;  2NCP A;  1TOP A;  4GGN A;  1B8R A;  2M1U A;  4OVN F;  1Q80 A;  3OB1 B;  4HRH A;  3NSO A;  1CM1 A;  2KQ6 A;  4P2Y B;  1B1G A;  2CTN A;  1SL7 A;  1IQ5 A;  1B4C A;  1C7W A;  1KFU S;  3FWB A;  4M2Q A;  1DJY A;  1VRK A;  1QIW A;  4NDC A;  5HKY A;  1M45 A;  3BXK A;  5HKZ A;  3TDZ A;  1D1O A;  1L2O B;  3I5G C;  1CB1 A;  4USL A;  1QVI Z;  2LCP A;  2K2F A;  1KQM C;  1XFW O;  3BUW B;  3TDI A;  4ICB A;  1KWO B;  1OMR A;  2M7L A;  1YUS A;  2O5G A;  4F0Z B;  2EC6 C;  4OCI A;  1UUR A;  3O6B A;  4NDD A;  4C0J A;  1CMF A;  1F8H A;  1QLK A;  2BCA A;  1DJG A;  3OHM B;  1G33 A;  1W7J B;  4WQ2 A;  1YX8 A;  2BBM A;  1XO5 A;  1J7R A;  2ZND A;  2K8M B;  2WC8 A;  3CR4 X;  2BBN A;  3CR2 A;  3HCM A;  5J3X A;  1B7T Y;  1CFC A;  1A75 B;  5D7F A;  2KQY A;  2KHN A;  2JXC A;  4QJ4 B;  5JJG A;  1S26 D;  4OKH A;  4N5X A;  5AAN A;  1B47 A;  3BUX B;  4PAL A;  1QAS A;  1XK4 A;  1JC2 A;  1CTR A;  4C0K A;  1ZUZ A;  2KBI A;  1S5G Z;  1TRF A;  3SG6 A;  3PN7 B;  5K89 A;  4N1G A;  4A4C A;  3EKJ A;  3F45 A;  1AJ5 A;  1KK7 Z;  3TUY C;  2KDH A;  1IGV A;  2KAV A;  2ZRT A;  4ORC B;  1SCM C;  4JQ0 D;  4QJ3 B;  3AKB A;  1REC A;  1WLM A;  3JVT C;  2AMI A;  2L0P A;  2QAC A;  1V1F A;  1ZAC A;  3MSE B;  3A4U B;  2HQ8 A;  3E3R A;  2FCE A;  2KNE A;  2P6B B;  1A4P A;  1XFX O;  2I2R E;  2OS8 C;  5CSF A;  3RLZ A;  1JSA A;  3JTD C;  1OMV A;  1DF0 A;  2LLT A;  1AK8 A;  5IBW A;  3I5G B;  3DVM A;  3D0Y A;  1Y1A A;  1XFY O;  2M49 B;  1Y6W A;  1QX2 A;  2L5X B;  3DVJ A;  3PSR A;  1NX1 A;  1IJ6 A;  2L51 A;  1IH0 A;  1Y1X A;  3EVV A;  1ALV A;  2QPT A;  4R1E A;  1EL4 A;  2LNK A;  2CXJ A;  5KSZ A;  2JUL A;  2LAN A;  1L2O C;  1AUI B;  5HKW A;  1YX7 A;  2LUC A;  3CTN A;  1S3P A;  4GGF A;  1DJW A;  1BOC A;  1KFX S;  4CFQ A;  3AKA A;  4XJK A;  4YGC B;  2LMT A;  4PE1 A;  1EG4 A;  1K8U A;  3EVU A;  4I5N B;  5CSN A;  3VRO A;  1PRW A;  1IG5 A;  1AJ4 A;  2BEC A;  1RRO A;  3KPX A;  3BYA A;  1SNL A;  4NDB A;  4AQJ A;  4FQO A;  1LIN A;  3KEV A;  2IS9 A;  4HRG A;  4GFT A;  3EVR A;  5F6T A;  5I2L A;  1DGU A;  2JTZ A;  1BT6 A;  1DTL A;  2Y1M A;  1YUR A;  2NZ0 A;  2TN4 A;  4CID A;  4PHK A;  3VRQ A;  2MA2 A;  2O60 A;  4YI9 A;  2LVK A;  3BQ3 A;  1F54 A;  1PSB A;  1YVH A;  4I5L B;  2LM5 A;  1WRZ A;  1KK7 Y;  3DVK A;  1ALW A;  1KK8 C;  3DD4 A;  4M2O A;  1SCM B;  2JOJ A;  1F70 A;  3KO0 A;  1J1E A;  2I18 A;  1UUS A;  2KYC A;  3JVT B;  3NSI A;  3PN7 C;  5ER5 A;  5GQQ C;  5AEQ A;  3IQQ A;  1NSH A;  1CDM A;  4I5J A;  1NX0 A;  1SL9 A;  5DKQ A;  3VRP A;  2JPT A;  1EG3 A;  2L4I A; 
#chains in the Genus database with same CATH topology
 1XFR A;  1U5I B;  2OTG C;  5B8I B;  3K21 A;  1SCV A;  3CZ1 A;  4JKT A;  1Z4H A;  1S1E A;  3JTD B;  2KFH A;  1NUB A;  1OOF A;  2BE6 A;  3BFA A;  3LL8 B;  4PHJ A;  1RJV A;  3OP0 A;  1C3Z A;  2ZN9 A;  1UWO A;  2AUC A;  3PJI A;  1YRT B;  1J7O A;  4UPG A;  4M2P A;  1CFF A;  2JT3 A;  2L4H A;  3L4A A;  4Q04 A;  1Y0V H;  3UNW A;  3NSK A;  5CPV A;  1N65 A;  2K7B A;  3BFB A;  2DOQ A;  3I5I C;  5KU1 A;  2M3W A;  2H2K A;  3LCP C;  2KLE A;  5D69 A;  5G08 A;  4MZK A;  5DKN A;  1QJT A;  1K90 D;  2M9G A;  1FF1 A;  1Y1U A;  2E30 A;  2JPO A;  3CZT X;  2LC5 A;  1OOG A;  2CBL A;  2MJW B;  2Y4Q A;  5KTY A;  4PE7 A;  1QWV A;  5AER A;  2JXL A;  2ZNE A;  2KAX A;  1H4B A;  2NXQ A;  1NX3 A;  1JF0 A;  5D3O A;  2BNX A;  1OSA A;  1BU3 A;  2QEB A;  2MAZ A;  2LLU A;  1BR1 B;  4PDZ A;  2L50 A;  2LHL A;  3SIA A;  4CPV A;  1PUL A;  4INX A;  2WCF A;  2JRF A;  3BUN B;  4MLW A;  3WNX B;  1P28 A;  1C7V A;  1IJ5 A;  1XFZ O;  3M0W A;  4BY5 A;  1QS7 A;  2PYQ A;  3FE6 A;  2KAY A;  1SPY A;  2PSR A;  1J7Q A;  3WHU B;  3DXL A;  1SRA A;  2PRU A;  5DKR A;  1M63 B;  2F33 A;  3UO9 A;  3VRN A;  1FBV A;  2GV5 A;  3EK8 A;  3SS3 A;  5DIC A;  1JWD A;  1W9Z A;  1KK8 B;  3NXA A;  2FCD A;  2MRD A;  1NCX A;  1NWD A;  2KBM A;  3EK7 A;  3D75 A;  5HYD A;  4ORA B;  1OOI X;  1J55 A;  2JNF A;  2QEV A;  4GUK A;  2SAS A;  5I2O A;  1QTX A;  3H4S E;  2FOT A;  1K9P A;  1TNW A;  2P70 A;  2YGU A;  1L7Z A;  4P5O E;  2OTG B;  3FWC A;  1K9U A;  1SSE B;  4MZJ A;  3EG5 B;  4D1E A;  1XA5 A;  3R1O A;  4ZCU A;  1DMO A;  1WLZ A;  1J7P A;  1LA3 A;  2WCE A;  3RZS A;  1DJH A;  1K94 A;  4MRY A;  2PQL A;  1A75 A;  2JNX A;  1TNX A;  1YUT A;  2M29 A;  3CGA A;  1CFP A;  1OQP A;  1QIV A;  2K7D A;  3CZ0 A;  4BY4 A;  4U8D A;  2E6W A;  2LAP A;  1FPW A;  2HF5 A;  5TNC A;  1TNP A;  2L98 A;  3D77 A;  3I5I B;  3ZWH A;  1BMO A;  1QX7 A;  2B1U A;  1QVI Y;  2LVI A;  2WND A;  1G4Y R;  1XFU O;  1EXR A;  1PVA A;  4WRI A;  1SY9 A;  5I2Q A;  1QX5 B;  2Y1N A;  1ODB A;  2OPO A;  4INW A;  2BKI B;  4YGE B;  3GK2 A;  3OBV A;  1M31 A;  1KSO A;  3QRX A;  4MVF A;  1DVI A;  2G2B A;  2EHB A;  3S0F A;  1HQV A;  3SG7 A;  2MBX A;  4MSP A;  2COL B;  1X02 A;  1UP5 A;  2QEO A;  3D76 A;  4PE4 A;  1TWO A;  3AAK A;  1DT7 B;  1S36 A;  4PHN A;  2LLS A;  3I5F C;  3PAL A;  4CFR A;  3CWG A;  1PVB A;  2M0R A;  1TN4 A;  2JQ6 A;  1KFU L;  1OZO A;  2KI4 B;  1OOH A;  1ORG A;  4GNK B;  1PSR A;  1BF5 A;  2LV7 A;  1IRJ A;  3RM1 A;  1S6J A;  3HX4 A;  1GGW A;  5HLV A;  3AAJ A;  1CDP A;  3ICB A;  1K9K A;  4PCW A;  1S5G Y;  2BE4 A;  3IF7 A;  1A03 A;  1MQ1 A;  3TDU A;  1UHN A;  2KSP A;  2H61 A;  1EH2 A;  2MLF C;  1BLQ A;  2Y5I A;  1M39 A;  1EJ3 A;  2RGI A;  1UHJ A;  2HET A;  1NX2 A;  3O4Y A;  3TS5 B;  1WRL A;  1FW4 A;  2D8N A;  1QV0 A;  3SG5 A;  4MN0 A;  1CLM A;  4NQG A;  3FIA A;  5PAL A;  4WQ3 A;  1N0Y A;  4GPL B;  3OX6 A;  1IKU A;  3PFV A;  3SS4 A;  2M97 A;  3NHT A;  1J1D A;  1OE9 B;  1ZFS A;  1DJX A;  1NPQ A;  3GK1 A;  1SL8 A;  3B7A A;  3LLE A;  2KOT A;  4HRE E;  1S6C A;  3O4X A;  4A4B A;  2HPS A;  1NCY A;  4MZL A;  3OGN A;  2LVV A;  4FQT A;  1SMG A;  1NYA A;  4L9M A;  1WDC C;  4YGD B;  1BR4 B;  1SK6 D;  3B88 A;  2KFG A;  3L47 A;  1F71 A;  1H8B A;  2Q91 A;  3OB2 B;  1LVC D;  2BL0 B;  2ZKM X;  1QAT A;  3K1E A;  3I5H B;  2CNP A;  1PAL A;  2PVB A;  1MXE A;  2LVJ A;  3R1V A;  2JT0 A;  4XYN A;  1SR6 B;  5FYX A;  4ETO A;  1TUJ A;  1MR8 A;  2MHH A;  2F2O A;  2G9B A;  5CSI A;  4ORB B;  3EKH A;  1ZMZ A;  1K93 D;  1R2U A;  3LK1 A;  1WY9 A;  2WC5 A;  2GGM A;  2H61 C;  1GJY A;  2K0J A;  3FS7 A;  4DS7 A;  1AP4 A;  3C1V A;  2KYF A;  3I5F B;  1CDL A;  5ER4 X;  1U5I A;  1ZOT B;  1MUX A;  2AAO A;  1GGZ A;  3TZ1 A;  1YRU B;  2KGR A;  2BCB A;  1G8I A;  3BFH A;  1BOD A;  1DGV A;  1UHH A;  3PAT A;  2KI6 C;  1RTP 1;  2PAL A;  1DEK A;  2L5Y A;  1HT9 A;  2JC2 A;  4PE0 A;  3D78 A;  4ZCV A;  4AQI A;  1M46 A;  2WOR A;  1DJZ A;  2L2E A;  3DVE A;  3ZNI A;  2KI4 C;  3B6X A;  1LA0 A;  1YR5 A;  4FTG A;  2NLN A;  1CM4 A;  2F3Z A;  3VGO A;  4DCK A;  3PM8 A;  1JFK A;  3PLF B;  2GTE A;  2Q4U A;  1UHI A;  2VRG A;  1K96 A;  2ZRS A;  4YGA A;  1KFX L;  1CFD A;  1TUZ A;  1FI6 A;  4TNC A;  4HSZ A;  1CKK A;  1TNQ A;  3CR5 X;  1WRK A;  2BCX A;  5BPJ A;  5CSJ A;  2FJY A;  4JWQ A;  1R6P A;  2PMY A;  1OZS A;  1CDN A;  2M7N A;  2LMU A;  4OR9 B;  2K7C A;  3DF0 B;  2KFF A;  1B8L A;  3TS5 C;  1SBJ A;  1LXF C;  3Q8I A;  1TCO B;  1F4Q A;  1TIZ A;  3B86 A;  4YRU A;  1DF0 B;  2WCH A;  3D10 A;  1XVJ A;  4MRX A;  2I7A A;  3S0D A;  3D0Y B;  3DYE A;  1K2H A;  2LP2 A;  3SG4 A;  1NP8 A;  1WDC B;  3VB1 A;  5AFP A;  1F4O A;  3SG2 A;  2K7O A;  1CLL A;  4I5K A;  1KCY A;  1CNP A;  4PHM A;  2F2P A;  4C0L A;  2H8V A;  1K95 A;  1NIW A;  1LKJ A;  1IQ3 A;  2CCM A;  3OX5 A;  1MXL C;  2M1K B;  3V2L A;  2BL0 C;  1KQV A;  1JUO A;  3EK4 A;  4QJ5 B;  1SW8 A;  3I5H C;  1YVL A;  4XJK B;  3NSL A;  1UHK A;  1MHO A;  1FI5 A;  1SR6 C;  1MWN A;  1V1G A;  1TCF A;  2JU0 A;  3DF0 A;  1JFJ A;  3BUO B;  2ZFD A;  4MEW A;  4OV2 A;  4CLN A;  2KGB C;  1F55 A;  4N1F A;  3CAB A;  3IQO A;  3QME A;  3CS1 A;  2F3Y A;  4YGB B;  2HQW A;  3WXA A;  2NCO A;  1CLB A;  4DUQ A;  2JWW A;  3D74 A;  1N2D A;  2WCB A;  1KQM B;  1RK9 A;  4E68 A;  3A8R A;  3LK0 A;  2EGD A;  4AOM A;  3DZT A;  3S0A A;  2EC6 B;  1XYD A;  2L2C A;  1DC1 A;  3SIB A;  2BKH B;  1XK4 C;  3NGV A;  2F8P A;  4YI8 A;  1IWQ A;  5JOL A;  3O78 A;  1RFJ A;  3O2P A;  2LP3 A;  1QV1 A;  1KWO C;  3KF9 A;  2LMV A;  1AVS A;  5HLO A;  1JF2 A;  2LE9 B;  1KSM A;  3CLN A;  3SS5 A;  2K2A A;  5FI7 A;  4JD9 A;  1QXP A;  4DRW A;  1RWY A;  3BOW B;  2M8U A;  1C07 A;  1CMG A;  1B8C A;  3SG3 A;  2R2I A;  2V53 A;  4JPZ B;  1JBA A;  1B7T Z;  3FE9 A;  1AHR A;  4GAO A;  1DQE A;  1SKT A;  3GK4 X;  1PK0 D;  2WCJ A;  2ISD A;  4DIR A;  4YBH B;  1YTZ C;  2LUX A;  3CDN A;  5AXI A;  2PAS A;  3GOF A;  4IL1 A;  1DJI A;  1A2X A;  1QLS A;  2GGZ A;  2I94 A;  3WHT B;  3NHI A;  2SCP A;  1C3Y A;  3B87 A;  1W7I B;  1YUU A;  1E8A A;  3TUY B;  2KI6 D;  1BJF A;  1TTX A;  2ZN8 A;  3SJS A;  1BG1 A;  2JT8 A;  3KHE A;  1GQM A;  3VRR A;  1OOJ A;  1T14 A;  1A29 A;  1OMD A;  1B9A A;  2CT9 A;  2LHI A;  2K61 A;  2JZI A;  4GBA A;  1NCZ A;  2MLE C;  2WOS A;  5I8N A;  4MBE A;  3BUM B;  1MF8 B;  1S6I A;  4GGF C;  3BOW A;  1SYM A;  2A4J A;  5FI2 A;  2OS8 B;  1XFV O;  2FJU B;  2JTT A;  2NCP A;  1TOP A;  4GGN A;  1B8R A;  2M1U A;  4OVN F;  1Q80 A;  3OB1 B;  4HRH A;  3NSO A;  1Z2C B;  1CM1 A;  2KQ6 A;  4P2Y B;  3DY9 A;  1B1G A;  2CTN A;  1SL7 A;  1IQ5 A;  1B4C A;  1C7W A;  1KFU S;  3FWB A;  3L4L A;  1DJY A;  1VRK A;  4M2Q A;  2QEH A;  1QIW A;  4NDC A;  2ERB A;  5HKY A;  1M45 A;  3BXK A;  5HKZ A;  3TDZ A;  1D1O A;  1L2O B;  3I5G C;  1CB1 A;  4USL A;  1QVI Z;  2LCP A;  3CYZ A;  2K2F A;  1KQM C;  1XFW O;  3BUW B;  3IVT A;  2WCK A;  5FI6 A;  4ICB A;  3TDI A;  1KWO B;  1OMR A;  1OW4 A;  2M7L A;  1YUS A;  2O5G A;  4F0Z B;  2EC6 C;  2KPH A;  4OCI A;  3BJH A;  1UUR A;  3O6B A;  4NDD A;  4C0J A;  1CMF A;  1F8H A;  1QLK A;  2BCA A;  1DJG A;  3OHM B;  5I94 A;  1G33 A;  1W7J B;  4WQ2 A;  1YX8 A;  2BBM A;  1XO5 A;  1J7R A;  2ZND A;  2K8M B;  2WC8 A;  3CR4 X;  2BBN A;  3CR2 A;  3HCM A;  5J3X A;  1B7T Y;  1CFC A;  1A75 B;  5D7F A;  2KQY A;  3CZ2 A;  2KHN A;  2JXC A;  4QJ4 B;  5JJG A;  1S26 D;  2WCL A;  5EL2 A;  4OKH A;  4N5X A;  5AAN A;  1B47 A;  3BUX B;  4PAL A;  1QAS A;  1XK4 A;  1JC2 A;  1CTR A;  4C0K A;  1ZUZ A;  2KBI A;  1S5G Z;  1IIO A;  4KYN A;  1TRF A;  3SG6 A;  3PN7 B;  5K89 A;  4N1G A;  4A4C A;  3EKJ A;  3F45 A;  1AJ5 A;  1KK7 Z;  3TUY C;  2KDH A;  1IGV A;  2KAV A;  2ZRT A;  4ORC B;  1SCM C;  4JQ0 D;  4QJ3 B;  3AKB A;  3R72 A;  1REC A;  1WLM A;  3JVT C;  2AMI A;  1GM0 A;  2L0P A;  2QAC A;  1V1F A;  1ZAC A;  3MSE B;  3A4U B;  2HQ8 A;  3E3R A;  2FCE A;  2KNE A;  3PM2 A;  2P71 A;  2P6B B;  1A4P A;  1XFX O;  2I2R E;  2OS8 C;  5CSF A;  3RLZ A;  1JSA A;  3JTD C;  1OMV A;  1DF0 A;  2LLT A;  1AK8 A;  5IBW A;  3I5G B;  3DVM A;  3D0Y A;  4IJ7 A;  1Y1A A;  1XFY O;  2M49 B;  1Y6W A;  5HL1 A;  1QX2 A;  2L5X B;  3D73 A;  3DVJ A;  3PSR A;  1NX1 A;  1IJ6 A;  2L51 A;  2QDI A;  1IH0 A;  1Y1X A;  3EVV A;  1ALV A;  2QPT A;  4R1E A;  1EL4 A;  4PT1 A;  2LNK A;  2CXJ A;  3N7H A;  5KSZ A;  4F7F A;  2WC6 A;  2JUL A;  2LAN A;  1L2O C;  3S0E A;  1AUI B;  5HKW A;  1YX7 A;  2LUC A;  3CTN A;  1S3P A;  4GGF A;  1DJW A;  1BOC A;  1KFX S;  4CFQ A;  3AKA A;  3FE8 A;  4XJK A;  2LMT A;  4YGC B;  4PE1 A;  1EG4 A;  1K8U A;  1DEL A;  4OZD A;  3EVU A;  4I5N B;  5CSN A;  3VRO A;  1PRW A;  1IG5 A;  1AJ4 A;  2BEC A;  1RRO A;  3KPX A;  3BYA A;  1SNL A;  4NDB A;  3S0G A;  4AQJ A;  3S0B A;  4FQO A;  1LIN A;  3KEV A;  2IS9 A;  4HRG A;  4GFT A;  2WCM A;  3EVR A;  5F6T A;  5I2L A;  1DGU A;  2JTZ A;  1BT6 A;  1DTL A;  2Y1M A;  1YUR A;  2NZ0 A;  2TN4 A;  4CID A;  4PHK A;  1LS8 A;  3VRQ A;  2MA2 A;  2BAP A;  2O60 A;  2LVK A;  4YI9 A;  3BQ3 A;  1F54 A;  1PSB A;  1YVH A;  2KLD A;  4I5L B;  2LM5 A;  1WRZ A;  1KK7 Y;  3DVK A;  1ALW A;  1KK8 C;  3DD4 A;  4M2O A;  1SCM B;  2JOJ A;  1F70 A;  3KO0 A;  1J1E A;  2I18 A;  1UUS A;  2KYC A;  3JVT B;  3NSI A;  3PN7 C;  5ER5 A;  5GQQ C;  5AEQ A;  3IQQ A;  1NSH A;  1CDM A;  4I5J A;  1NX0 A;  1SL9 A;  5DKQ A;  3R1P A;  3VRP A;  2JPT A;  2K60 A;  1EG3 A;  2L4I A; 
#chains in the Genus database with same CATH homology
 1U5I B;  2OTG C;  5B8I B;  3K21 A;  1SCV A;  1S1E A;  3JTD B;  2KFH A;  1NUB A;  2BE6 A;  3LL8 B;  4PHJ A;  1RJV A;  3OP0 A;  2ZN9 A;  1UWO A;  2AUC A;  1YRT B;  1J7O A;  4UPG A;  4M2P A;  1CFF A;  2JT3 A;  2L4H A;  4Q04 A;  1Y0V H;  3NSK A;  5CPV A;  1N65 A;  2K7B A;  3I5I C;  2DOQ A;  5KU1 A;  2M3W A;  2H2K A;  3LCP C;  5D69 A;  5G08 A;  4MZK A;  5DKN A;  1QJT A;  1K90 D;  2M9G A;  1FF1 A;  1Y1U A;  2E30 A;  3CZT X;  2LC5 A;  2CBL A;  2MJW B;  2Y4Q A;  5KTY A;  4PE7 A;  5AER A;  2JXL A;  2ZNE A;  2KAX A;  1H4B A;  2NXQ A;  1NX3 A;  1JF0 A;  1OSA A;  1BU3 A;  2MAZ A;  2LLU A;  1BR1 B;  4PDZ A;  2L50 A;  2LHL A;  3SIA A;  4CPV A;  1PUL A;  2WCF A;  2JRF A;  3BUN B;  4MLW A;  3WNX B;  1C7V A;  1IJ5 A;  1XFZ O;  3M0W A;  4BY5 A;  1QS7 A;  2KAY A;  1SPY A;  2PSR A;  1J7Q A;  3WHU B;  1SRA A;  2PRU A;  5DKR A;  1M63 B;  2F33 A;  3VRN A;  1FBV A;  2GV5 A;  3EK8 A;  1JWD A;  1KK8 B;  3NXA A;  2FCD A;  2MRD A;  1NCX A;  1NWD A;  2KBM A;  3EK7 A;  5HYD A;  4ORA B;  1J55 A;  2JNF A;  4GUK A;  5I2O A;  2SAS A;  1QTX A;  3H4S E;  2FOT A;  1K9P A;  1TNW A;  1L7Z A;  4P5O E;  2OTG B;  3FWC A;  1K9U A;  4MZJ A;  4D1E A;  1XA5 A;  4ZCU A;  1DMO A;  1WLZ A;  1J7P A;  1LA3 A;  2WCE A;  1DJH A;  1K94 A;  4MRY A;  1A75 A;  2JNX A;  1TNX A;  1YUT A;  2M29 A;  3CGA A;  1CFP A;  1OQP A;  1QIV A;  2K7D A;  4BY4 A;  4U8D A;  2E6W A;  2LAP A;  1FPW A;  2HF5 A;  5TNC A;  1TNP A;  2L98 A;  3I5I B;  3ZWH A;  1BMO A;  1QX7 A;  2B1U A;  1QVI Y;  2LVI A;  2WND A;  1G4Y R;  1XFU O;  1EXR A;  1PVA A;  4WRI A;  1SY9 A;  5I2Q A;  1QX5 B;  2Y1N A;  1ODB A;  2OPO A;  2BKI B;  4YGE B;  3GK2 A;  1M31 A;  1KSO A;  3QRX A;  4MVF A;  1DVI A;  2G2B A;  2EHB A;  1HQV A;  3SG7 A;  2MBX A;  4MSP A;  2COL B;  1X02 A;  1UP5 A;  4PE4 A;  1DT7 B;  3AAK A;  1S36 A;  4PHN A;  2LLS A;  3I5F C;  3PAL A;  4CFR A;  3CWG A;  1PVB A;  2M0R A;  1TN4 A;  2JQ6 A;  1KFU L;  1OZO A;  2KI4 B;  4GNK B;  1PSR A;  1BF5 A;  2LV7 A;  1IRJ A;  3RM1 A;  1S6J A;  3HX4 A;  1GGW A;  5HLV A;  3AAJ A;  1CDP A;  3ICB A;  1K9K A;  4PCW A;  1S5G Y;  2BE4 A;  3IF7 A;  1A03 A;  1MQ1 A;  3TDU A;  1UHN A;  2KSP A;  2H61 A;  1EH2 A;  2MLF C;  1BLQ A;  2Y5I A;  1M39 A;  1EJ3 A;  2RGI A;  1UHJ A;  2HET A;  1NX2 A;  3O4Y A;  3TS5 B;  1WRL A;  1FW4 A;  2D8N A;  1QV0 A;  3SG5 A;  4MN0 A;  1CLM A;  4NQG A;  3FIA A;  5PAL A;  4WQ3 A;  1N0Y A;  4GPL B;  3OX6 A;  1IKU A;  3PFV A;  2M97 A;  1J1D A;  1OE9 B;  1ZFS A;  1DJX A;  1NPQ A;  3GK1 A;  1SL8 A;  3LLE A;  2KOT A;  4HRE E;  1S6C A;  4A4B A;  2HPS A;  1NCY A;  4MZL A;  2LVV A;  1SMG A;  1NYA A;  4L9M A;  1WDC C;  4YGD B;  1BR4 B;  1SK6 D;  1H8B A;  2KFG A;  1F71 A;  2Q91 A;  3OB2 B;  1LVC D;  2BL0 B;  2ZKM X;  1QAT A;  3I5H B;  2CNP A;  1PAL A;  2PVB A;  1MXE A;  2LVJ A;  4XYN A;  2JT0 A;  5FYX A;  1SR6 B;  4ETO A;  1MR8 A;  2MHH A;  2F2O A;  2G9B A;  5CSI A;  4ORB B;  3EKH A;  1ZMZ A;  1K93 D;  1R2U A;  3LK1 A;  1WY9 A;  2GGM A;  2H61 C;  1GJY A;  2K0J A;  3FS7 A;  4DS7 A;  1AP4 A;  3C1V A;  2KYF A;  3I5F B;  1CDL A;  5ER4 X;  1U5I A;  1ZOT B;  1MUX A;  2AAO A;  1GGZ A;  3TZ1 A;  1YRU B;  2KGR A;  2BCB A;  1G8I A;  1BOD A;  1DGV A;  1UHH A;  3PAT A;  2KI6 C;  1RTP 1;  2PAL A;  1HT9 A;  2JC2 A;  4PE0 A;  4ZCV A;  4AQI A;  1M46 A;  2WOR A;  1DJZ A;  2L2E A;  3DVE A;  3ZNI A;  2KI4 C;  1LA0 A;  1YR5 A;  4FTG A;  2NLN A;  1CM4 A;  2F3Z A;  3VGO A;  4DCK A;  3PM8 A;  1JFK A;  3PLF B;  2Q4U A;  1UHI A;  2VRG A;  1K96 A;  2ZRS A;  4YGA A;  1KFX L;  1CFD A;  1FI6 A;  4TNC A;  4HSZ A;  1CKK A;  1TNQ A;  3CR5 X;  1WRK A;  2BCX A;  5BPJ A;  5CSJ A;  4JWQ A;  1R6P A;  2PMY A;  1OZS A;  1CDN A;  2M7N A;  2LMU A;  4OR9 B;  2K7C A;  3DF0 B;  2KFF A;  1B8L A;  3TS5 C;  1SBJ A;  1LXF C;  1TCO B;  1F4Q A;  1TIZ A;  4YRU A;  1DF0 B;  3D10 A;  1XVJ A;  4MRX A;  2I7A A;  3D0Y B;  1K2H A;  2LP2 A;  3SG4 A;  1NP8 A;  1WDC B;  5AFP A;  1F4O A;  3SG2 A;  2K7O A;  1CLL A;  4I5K A;  1KCY A;  1CNP A;  4PHM A;  2F2P A;  4C0L A;  1K95 A;  1NIW A;  1LKJ A;  1IQ3 A;  2CCM A;  3OX5 A;  1MXL C;  2M1K B;  2BL0 C;  1KQV A;  1JUO A;  3EK4 A;  4QJ5 B;  1SW8 A;  3I5H C;  1YVL A;  4XJK B;  3NSL A;  1UHK A;  1MHO A;  1FI5 A;  1SR6 C;  1MWN A;  1V1G A;  1TCF A;  2JU0 A;  3DF0 A;  1JFJ A;  3BUO B;  2ZFD A;  4MEW A;  4OV2 A;  4CLN A;  2KGB C;  1F55 A;  4N1F A;  3IQO A;  3CS1 A;  2F3Y A;  4YGB B;  2HQW A;  3WXA A;  2NCO A;  1CLB A;  4DUQ A;  2JWW A;  1N2D A;  2WCB A;  1KQM B;  1RK9 A;  4E68 A;  3A8R A;  3LK0 A;  2EGD A;  4AOM A;  2EC6 B;  1XYD A;  3SIB A;  2BKH B;  1XK4 C;  2F8P A;  4YI8 A;  1IWQ A;  5JOL A;  3O78 A;  1RFJ A;  3O2P A;  2LP3 A;  1QV1 A;  1KWO C;  3KF9 A;  2LMV A;  1AVS A;  5HLO A;  1JF2 A;  2LE9 B;  1KSM A;  3CLN A;  2K2A A;  1QXP A;  4DRW A;  1RWY A;  3BOW B;  2M8U A;  1C07 A;  1CMG A;  1B8C A;  3SG3 A;  2R2I A;  2V53 A;  4JPZ B;  1JBA A;  1B7T Z;  1AHR A;  4GAO A;  1SKT A;  3GK4 X;  1PK0 D;  2ISD A;  4DIR A;  4YBH B;  1YTZ C;  2LUX A;  5AXI A;  2PAS A;  3GOF A;  4IL1 A;  1DJI A;  1A2X A;  1QLS A;  2GGZ A;  2I94 A;  3WHT B;  2SCP A;  1W7I B;  1YUU A;  1E8A A;  3TUY B;  2KI6 D;  1BJF A;  1TTX A;  2ZN8 A;  3SJS A;  1BG1 A;  2JT8 A;  3KHE A;  1GQM A;  3VRR A;  1OOJ A;  1A29 A;  1OMD A;  1B9A A;  2CT9 A;  2LHI A;  2K61 A;  2JZI A;  4GBA A;  1NCZ A;  2MLE C;  2WOS A;  5I8N A;  4MBE A;  3BUM B;  1MF8 B;  1S6I A;  4GGF C;  3BOW A;  1SYM A;  2A4J A;  2OS8 B;  1XFV O;  2FJU B;  2JTT A;  2NCP A;  1TOP A;  4GGN A;  1B8R A;  2M1U A;  4OVN F;  1Q80 A;  3OB1 B;  4HRH A;  3NSO A;  1CM1 A;  2KQ6 A;  4P2Y B;  1B1G A;  2CTN A;  1SL7 A;  1IQ5 A;  1B4C A;  1C7W A;  1KFU S;  3FWB A;  4M2Q A;  1DJY A;  1VRK A;  1QIW A;  4NDC A;  5HKY A;  1M45 A;  3BXK A;  5HKZ A;  3TDZ A;  1D1O A;  1L2O B;  3I5G C;  1CB1 A;  4USL A;  1QVI Z;  2LCP A;  2K2F A;  1KQM C;  1XFW O;  3BUW B;  3TDI A;  4ICB A;  1KWO B;  1OMR A;  2M7L A;  1YUS A;  2O5G A;  4F0Z B;  2EC6 C;  4OCI A;  1UUR A;  3O6B A;  4NDD A;  4C0J A;  1CMF A;  1F8H A;  1QLK A;  2BCA A;  1DJG A;  3OHM B;  1G33 A;  1W7J B;  4WQ2 A;  1YX8 A;  2BBM A;  1XO5 A;  1J7R A;  2ZND A;  2K8M B;  2WC8 A;  3CR4 X;  2BBN A;  3CR2 A;  3HCM A;  5J3X A;  1B7T Y;  1CFC A;  1A75 B;  5D7F A;  2KQY A;  2KHN A;  2JXC A;  4QJ4 B;  5JJG A;  1S26 D;  4OKH A;  4N5X A;  5AAN A;  1B47 A;  3BUX B;  4PAL A;  1QAS A;  1XK4 A;  1JC2 A;  1CTR A;  4C0K A;  1ZUZ A;  2KBI A;  1S5G Z;  1TRF A;  3SG6 A;  3PN7 B;  5K89 A;  4N1G A;  4A4C A;  3EKJ A;  3F45 A;  1AJ5 A;  1KK7 Z;  3TUY C;  2KDH A;  1IGV A;  2KAV A;  2ZRT A;  4ORC B;  1SCM C;  4JQ0 D;  4QJ3 B;  3AKB A;  1REC A;  1WLM A;  3JVT C;  2AMI A;  2L0P A;  2QAC A;  1V1F A;  1ZAC A;  3MSE B;  3A4U B;  2HQ8 A;  3E3R A;  2FCE A;  2KNE A;  2P6B B;  1A4P A;  1XFX O;  2I2R E;  2OS8 C;  5CSF A;  3RLZ A;  1JSA A;  3JTD C;  1OMV A;  1DF0 A;  2LLT A;  1AK8 A;  5IBW A;  3I5G B;  3DVM A;  3D0Y A;  1Y1A A;  1XFY O;  2M49 B;  1Y6W A;  1QX2 A;  2L5X B;  3DVJ A;  3PSR A;  1NX1 A;  1IJ6 A;  2L51 A;  1IH0 A;  1Y1X A;  3EVV A;  1ALV A;  2QPT A;  4R1E A;  1EL4 A;  2LNK A;  2CXJ A;  5KSZ A;  2JUL A;  2LAN A;  1L2O C;  1AUI B;  5HKW A;  1YX7 A;  2LUC A;  3CTN A;  1S3P A;  4GGF A;  1DJW A;  1BOC A;  1KFX S;  4CFQ A;  3AKA A;  4XJK A;  4YGC B;  2LMT A;  4PE1 A;  1EG4 A;  1K8U A;  3EVU A;  4I5N B;  5CSN A;  3VRO A;  1PRW A;  1IG5 A;  1AJ4 A;  2BEC A;  1RRO A;  3KPX A;  3BYA A;  1SNL A;  4NDB A;  4AQJ A;  4FQO A;  1LIN A;  3KEV A;  2IS9 A;  4HRG A;  4GFT A;  3EVR A;  5F6T A;  5I2L A;  1DGU A;  2JTZ A;  1BT6 A;  1DTL A;  2Y1M A;  1YUR A;  2NZ0 A;  2TN4 A;  4CID A;  4PHK A;  3VRQ A;  2MA2 A;  2O60 A;  4YI9 A;  2LVK A;  3BQ3 A;  1F54 A;  1PSB A;  1YVH A;  4I5L B;  2LM5 A;  1WRZ A;  1KK7 Y;  3DVK A;  1ALW A;  1KK8 C;  3DD4 A;  4M2O A;  1SCM B;  2JOJ A;  1F70 A;  3KO0 A;  1J1E A;  2I18 A;  1UUS A;  2KYC A;  3JVT B;  3NSI A;  3PN7 C;  5ER5 A;  5GQQ C;  5AEQ A;  3IQQ A;  1NSH A;  1CDM A;  4I5J A;  1NX0 A;  1SL9 A;  5DKQ A;  3VRP A;  2JPT A;  1EG3 A;  2L4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...