3FWBA

Sac3:sus1:cdc31 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
153
Chain Sequence
QSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sus1, Cdc31, and the Sac3 CID region form a conserved interaction platform that promotes nuclear pore association and mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle, transcription
molecule keywords Cell division control protein 31
total genus 52
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3fwbA01
3CGAA 2M49B 1PULA 1ZOTB 2LNKA 2LM5A 2BE6A 1CM1A 1TNQA 1K2HA 1AP4A 3OHMB 5JOLA 3WHTB 3M0WA 2JNXA 1CNPA 3VGOA 2LE9B 1SK6D 4MBEA 1CFPA 4BY5A 1LVCD 1CFDA 4PCWA 5HLVA 4U8DA 1UUSA 1KQMB 3TUYC 5CSIA 1QX5B 1GQMA 1HT9A 4GUKA 1B9AA 1QXPA 2B1UA 2JT3A 2ZRTA 4GGNA 2KQYA 2R2IA 2CT9A 1S6IA 1WDCB 1B7TY 1NCYA 1QIWA 2WNDA 1DF0A 4PE7A 1CMFA 1NX0A 1TRFA 1DF0B 2MAZA 4ZCUA 2M8UA 4OKHA 3JTDC 2E30A 1DJGA 1LKJA 1RK9A 5K89A 2GGZA 1L2OC 1BR1B 1NCZA 1MF8B 4M2QA 2BL0C 3I5IB 1YR5A 4I5NB 1XYDA 5I2QA 2IS9A 1MXLC 1FBVA 1BODA 5ER4X 1TN4A 2EC6C 2G2BA 1V1GA 2KFGA 2CNPA 2KBIA 3E3RA 1NPQA 3CZTX 5FYXA 1YX8A 4JPZB 4FTGA 1B8LA 1XK4C 5HKWA 1UP5A 4PE4A 5I2OA 2KI4C 5CPVA 1F4QA 3PN7C 3CTNA 2CTNA 4M2OA 1YX7A 3JVTC 3SG6A 1S6JA 1MXEA 1F54A 1A75A 3EVVA 1CB1A 2ISDA 3SG7A 2NCPA 5KTYA 1DVIA 1KK8B 2JU0A 3LLEA 1F8HA 4I5KA 2NLNA 5JJGA 3LCPC 3SG4A 1K90D 1OZOA 1PK0D 2F33A 1F71A 1EH2A 3OP0A 3WXAA 4HRHA 1RJVA 2OS8B 1QLKA 3GK2A 1SNLA 4WQ2A 4MLWA 2ZN9A 1R6PA 1SPYA 2MBXA 1RROA 3ZNIA 1QIVA 4HRGA 2E6WA 1AK8A 3TS5B 2PMYA 3TDUA 1HQVA 2KI6C 1UHIA 3KEVA 2K0JA 4AQIA 1OQPA 3H4SE 3FIAA 1YVLA 3PSRA 1BJFA 2BECA 1SL8A 3PM8A 4OCIA 5CSNA 1SMGA 3OX6A 2F8PA 2LVKA 1K96A 5AERA 4L9MA 1XFYO 1CLMA 1SRAA 1XA5A 2WC8A 2M7LA 2L51A 2Q91A 4OVNF 2H61A 2F2OA 1K9PA 2KFFA 3BOWB 1YURA 3A8RA 1XFWO 1DTLA 1LXFC 3FWBA 3O6BA 5IBWA 4A4CA 3CLNA 4MZJA 4QJ5B 4OV2A 3BUWB 3DVEA 1YRTB 4MRYA 2Y4QA 3OB1B 2M0RA 4MSPA 1W7JB 2L98A 2TN4A 3EK7A 4MVFA 4PALA 2L5XB 1IGVA 4YGBB 4ORBB 5GQQC 2OTGB 4M2PA 1OSAA 3TS5C 3BUXB 1UHHA 1M46A 1Y1AA 2CBLA 2G9BA 4TNCA 4NDBA 5DKNA 1CDLA 2LANA 1A75B 3NSOA 2LP2A 2VRGA 2JPTA 1LA3A 1M31A 1UURA 2LLSA 3PFVA 4I5LB 1CDNA 2ZNDA 3OX5A 5CSJA 1BG1A 1JBAA 5D7FA 3GK4X 1X02A 2HQWA 2M7NA 1KFUL 3I5HB 4WQ3A 1IG5A 1A4PA 1U5IB 4GAOA 4D1EA 1KQMC 3TUYB 1DT7B 2K2AA 4HREE 3VRPA 4N1FA 1OMVA 1S5GY 1J7PA 2CCMA 2JRFA 4ORCB 3SG5A 4MEWA 1SYMA 4USLA 2ZKMX 4DRWA 1F70A 2K2FA 1WRLA 3QRXA 3CWGA 1E8AA 3JTDB 3D10A 1UHJA 1NWDA 5CSFA 1C7VA 2LV7A 1CKKA 1YUUA 2PRUA 4P2YB 1ALWA 1MUXA 1V1FA 1B8RA 1L7ZA 2LLTA 4AOMA 1K9UA 3KF9A 2BE4A 3ICBA 1XFVO 3D0YB 3KPXA 1L2OB 1JWDA 2OS8C 2CXJA 2Q4UA 4YGDB 1IJ5A 3A4UB 5I8NA 3EVUA 4I5JA 5AANA 4XYNA 4QJ3B 1XVJA 3EKJA 3LK1A 1JFKA 3I5FC 1CMGA 2AAOA 2BKIB 2JT8A 1OZSA 1BOCA 1NIWA 1KFXL 1SW8A 2BCAA 4CLNA 1M45A 4MZKA 1Y6WA 5B8IB 2WCFA 2MLFC 3CR2A 2JOJA 1QX7A 1KK8C 2KYFA 3GOFA 3PLFB 2KAVA 1IH0A 2EGDA 2KYCA 1JSAA 2M1UA 1KWOB 4XJKA 1TNPA 3IQOA 1A29A 1J7RA 4WRIA 3I5GB 5DKQA 4CFRA 1XFXO 1MQ1A 2KDHA 2PASA 1CFCA 1JF2A 1DJYA 5HKYA 1N65A 2QPTA 3BUNB 3KHEA 2LVIA 1A2XA 2LC5A 2QACA 1U5IA 2LUXA 2NXQA 4GGFA 2K7DA 2I94A 2FCDA 1WY9A 2WCBA 1NUBA 1KQVA 2I7AA 1PRWA 1QVIZ 3HCMA 3HX4A 4DIRA 4C0JA 4C0LA 2MA2A 2HETA 1ZACA 2ZN8A 1IWQA 1KCYA 4NDCA 5BPJA 3NSKA 4A4BA 1FI6A 1B4CA 1GJYA 1J1EA 2HPSA 1SCMB 2PSRA 1XO5A 2BCBA 2KAYA 2M9GA 1QTXA 2WCEA 2H61C 3AAKA 1J55A 3SJSA 4ZCVA 1BF5A 3EK8A 1YRUB 1DJHA 1WRZA 2K7BA 2FCEA 1GGZA 2K7CA 1EG3A 1W7IB 1DMOA 1PSRA 1JFJA 1H8BA 4ETOA 2KHNA 3IQQA 2MHHA 1K94A 2HQ8A 1SCVA 2KAXA 1YUSA 3O4YA 1QS7A 3VROA 1MHOA 4PHMA 3NSIA 2KSPA 2NCOA 1TTXA 2WORA 3I5FB 3NSLA 2OPOA 3DVKA 2H2KA 3RM1A 1YVHA 3OB2B 1OE9B 1DJWA 1Q80A 3F45A 3BUOB 1J7QA 3JVTB 2LHLA 3BYAA 1QASA 1ZUZA 1OOJA 1DGUA 2KQ6A 1K95A 3TDZA 1DJZA 1NSHA 2LMUA 2JNFA 2KI4B 1WDCC 4MRXA 3I5IC 2JC2A 1CDMA 1SR6C 2O60A 2K61A 3DD4A 1KWOC 1KK7Y 4YRUA 4PHJA 4XJKB 2KBMA 5D69A 1EXRA 2Y1NA 1CLLA 1YTZC 3I5HC 1CFFA 1DJXA 2EC6B 5HKZA 2L4HA 1LA0A 3EVRA 4NQGA 1A03A 1UWOA 2LAPA 1BR4B 1S5GZ 3EK4A 5ER5A 2LMVA 1S6CA 3WNXB 4N5XA 1S36A 3DVJA 1QX2A 1CLBA 4GGFC 3DVMA 4DS7A 2L50A 2COLB 2K7OA 2FOTA 2HF5A 2KOTA 2JXLA 3C1VA 2K8MB 2RGIA 1NP8A 1AHRA 1AJ5A 1SR6B 2JXCA 2WOSA 3SG2A 4JWQA 4PDZA 1TNWA 1EG4A 1BMOA 2AMIA 2SCPA 4PHKA 1S3PA 1IQ3A 2KNEA 2M29A 3O78A 4GPLB 3SIAA 1NX2A 4CFQA 1EL4A 1K93D 1F4OA 4PE1A 3IF7A 4IL1A 2LP3A 4FQOA 2F3ZA 1JC2A 2JTTA 1QV1A 4CPVA 3PATA 1IJ6A 2I18A 4HSZA 4CIDA 3BXKA 4GNKB 3MSEB 1IRJA 4C0KA 1H4BA 1KSOA 1J1DA 2JZIA 1QV0A 1CTRA 3CR4X 1DGVA 2F2PA 1PVAA 1AVSA 5KU1A 1C7WA 4ORAB 1IKUA 1QATA 2MRDA 1GGWA 1BT6A 2I2RE 3PALA 5PALA 2LVJA 1TIZA 2LVVA 1Y1UA 2DOQA 1LINA 2LMTA 2MJWB 2OTGC 2JWWA 5HLOA 2BKHB 1N2DA 4NDDA 2BL0B 3LL8B 4N1GA 3RLZA 5AXIA 1S26D 2AUCA 3WHUB 1KK7Z 1SY9A 1TOPA 1SL7A 3TZ1A 3DF0B 1G4YR 3DF0A 1G8IA 2PVBA 1PALA 3BQ3A 1N0YA 4YBHB 1NYAA 2L4IA 4YI8A 1WLZA 4P5OE 1XFUO 1BLQA 4QJ4B 1SL9A 3VRQA 1K9KA 1QJTA 4ICBA 1IQ5A 1TCFA 3PN7B 2BBMA 4UPGA 3SIBA 1FPWA 2P6BB 4GBAA 2KI6D 4MN0A 4MZLA 1C07A 4YI9A 2GGMA 4R1EA 1SKTA 1ODBA 2M1KB 3BOWA 2JTZA 5AFPA 1PSBA 1NX3A 1JUOA 1RWYA 1SCMC 3D0YA 3AKAA 3TDIA 3FWCA 2MLEC 1BU3A 1M39A 4YGEB 4PHNA 1RECA 1JF0A 4JQ0D 4YGCB 1XFZO 1KFXS 5DKRA 1KSMA 1AUIB 2JQ6A 2M3WA 3NXAA 1ZFSA 2ZRSA 2O5GA 4Q04A 2LUCA 1AJ4A 1FW4A 2SASA 1B8CA 5TNCA 3LK0A 5HYDA 1OMRA 3KO0A 2KFHA 1EJ3A 1MR8A 3ZWHA 1G33A 1Y0VH 4YGAA 4DCKA 1WRKA 2LLUA 4E68A 2L0PA 1PVBA 2KGRA 1TNXA 2JT0A 1CDPA 2PALA 5I2LA 2M97A 3I5GC 2V53A 1QVIY 2D8NA 5J3XA 1F55A 1WLMA 2NZ0A 4BY4A 1OMDA 1B7TZ 1SBJA 3CS1A 1S1EA 1B47A 3CR5X 3VRNA 3VRRA 4F0ZB 5G08A 1NX1A 2BBNA 3SG3A 2Y1MA 5F6TA 2F3YA 2LHIA 4AQJA 1MWNA 3GK1A 2GV5A 1D1OA 3K21A 1R2UA 1UHNA 1J7OA 1DJIA 1TCOB 3EKHA 4GFTA 1Y1XA 1ZMZA 1RFJA 1XK4A 1YUTA 1RTP1 1FF1A 1ALVA 4OR9B 3BUMB 2L2EA 4DUQA 1UHKA 4PE0A 2JULA 5AEQA 2BCXA 2Y5IA 1CM4A 1K8UA 2EHBA 2KGBC 2LCPA 1M63B 2ZNEA 2FJUB 3AKBA 1NCXA 1QLSA 3FS7A 1KFUS 1VRKA 2A4JA 2ZFDA 3O2PA 3AAJA 5KSZA 1B1GA 1FI5A
chains in the Genus database with same CATH superfamily
3CGAA 4INXA 2M49B 1PULA 2L2CA 1ZOTB 2LNKA 3FE8A 2LM5A 2BE6A 1CM1A 1TNQA 3L4AA 5D3OA 1K2HA 1AP4A 3CZ2A 3OHMB 5JOLA 3WHTB 3M0WA 2JNXA 1CNPA 3VGOA 2LE9B 1SK6D 4MBEA 1CFPA 4BY5A 1TWOA 1LVCD 1CFDA 4PCWA 5HLVA 4U8DA 1UUSA 1KQMB 3TUYC 5CSIA 1QX5B 3CABA 1GQMA 1HT9A 2YGUA 4GUKA 1B9AA 1QXPA 2B1UA 2JT3A 2ZRTA 4GGNA 2KQYA 2R2IA 2CT9A 1S6IA 1WDCB 1B7TY 1NCYA 1QIWA 2WNDA 1DF0A 4PE7A 1CMFA 1NX0A 1TRFA 1DF0B 2MAZA 4ZCUA 2M8UA 4OKHA 3JTDC 2E30A 1DJGA 1LKJA 1RK9A 5K89A 2GGZA 1L2OC 1BR1B 1NCZA 1MF8B 4M2QA 2BL0C 3I5IB 1OOIX 1YR5A 4I5NB 1XYDA 5I2QA 2IS9A 1MXLC 1FBVA 1BODA 5ER4X 3FE6A 1TN4A 2EC6C 2G2BA 1V1GA 2KFGA 2CNPA 2KBIA 3E3RA 1NPQA 3CZTX 1LS8A 5FYXA 1YX8A 4JPZB 4FTGA 1B8LA 1XK4C 5HKWA 1UP5A 3SS4A 4PE4A 5I2OA 2KI4C 5CPVA 2H8VA 1F4QA 3PN7C 3CTNA 2CTNA 4M2OA 1YX7A 3JVTC 3NGVA 1S6JA 1MXEA 3SG6A 1A75A 1F54A 3EVVA 1CB1A 2ISDA 3SG7A 2NCPA 1ORGA 5KTYA 1DVIA 1KK8B 2JU0A 3LLEA 3PJIA 3S0EA 1F8HA 4I5KA 2NLNA 1OW4A 5JJGA 3LCPC 3SG4A 1K90D 1OZOA 1PK0D 2F33A 1F71A 1EH2A 3OP0A 3WXAA 4HRHA 1RJVA 2OS8B 1QLKA 3GK2A 1SNLA 4WQ2A 4MLWA 2ZN9A 1R6PA 1SPYA 2MBXA 1RROA 3ZNIA 1QIVA 3BFHA 4HRGA 3R1PA 2E6WA 1AK8A 1C3ZA 3D75A 3TS5B 3CZ0A 2PMYA 3TDUA 1HQVA 2KI6C 1UHIA 3KEVA 2K0JA 4AQIA 1OQPA 3H4SE 3FIAA 1YVLA 3PSRA 1BJFA 2BECA 1SL8A 3PM8A 4OCIA 5CSNA 1SMGA 3OX6A 2F8PA 2LVKA 1K96A 3BJHA 5AERA 4L9MA 1XFYO 1CLMA 1SRAA 1XA5A 2WC8A 3B87A 2L51A 2Q91A 2M7LA 4OVNF 2H61A 2F2OA 1K9PA 2KFFA 2ERBA 3BOWB 1W9ZA 1YURA 4PT1A 3A8RA 1XFWO 1DTLA 1LXFC 3FWBA 3O6BA 5IBWA 1DQEA 4A4CA 2L5YA 3CLNA 4MZJA 4QJ5B 4OV2A 3BUWB 3D77A 2P71A 3DVEA 3BFAA 2FJYA 1YRTB 1TUJA 4MRYA 2Y4QA 3OB1B 2M0RA 4MSPA 1W7JB 2L98A 2TN4A 3EK7A 3OGNA 4MVFA 4PALA 2L5XB 1IGVA 4YGBB 4ORBB 5GQQC 2OTGB 4M2PA 1OSAA 3TS5C 3BUXB 1UHHA 1M46A 1Y1AA 2CBLA 2G9BA 4TNCA 4NDBA 5DKNA 3L4LA 1CDLA 2LANA 1A75B 3NSOA 2LP2A 2QEOA 2VRGA 2JPTA 1LA3A 1M31A 1UURA 2LLSA 3PFVA 4IJ7A 2P70A 1C3YA 4I5LB 5EL2A 2BNXA 5FI2A 1CDNA 2ZNDA 2WCJA 3OX5A 5CSJA 1BG1A 1JBAA 5D7FA 3GK4X 1X02A 2HQWA 2M7NA 1KFUL 3I5HB 4WQ3A 1IG5A 3S0GA 1A4PA 1OOGA 1U5IB 4GAOA 4JKTA 4D1EA 1KQMC 3TUYB 1DT7B 3B6XA 2K2AA 4HREE 3VRPA 3NHTA 4N1FA 1OMVA 1S5GY 1J7PA 2CCMA 2JRFA 4ORCB 3SG5A 4MEWA 1SYMA 4USLA 2ZKMX 4DRWA 1F70A 2K2FA 1WRLA 2QDIA 3QRXA 3CWGA 1E8AA 3JTDB 1DC1A 3CDNA 3D10A 1UHJA 1NWDA 5CSFA 1C7VA 2LV7A 1CKKA 1YUUA 2PRUA 3OBVA 4P2YB 3DXLA 1ALWA 1MUXA 1V1FA 1B8RA 3D74A 2WCLA 5FI7A 1L7ZA 2LLTA 4AOMA 1K9UA 2PYQA 2BE4A 3ICBA 2GTEA 1XFVO 3KF9A 3D0YB 3KPXA 1L2OB 1JWDA 2OS8C 2CXJA 2Q4UA 4YGDB 1IJ5A 2QEBA 3A4UB 5I8NA 3EVUA 4I5JA 5AANA 4XYNA 4QJ3B 1XVJA 3EKJA 3LK1A 1JFKA 1T14A 3I5FC 1CMGA 2AAOA 2BKIB 2JT8A 2KLEA 1OZSA 1BOCA 1NIWA 1KFXL 1SW8A 2BCAA 4CLNA 1M45A 4MZKA 1Y6WA 5B8IB 3S0AA 2WCFA 2MLFC 3CR2A 2JOJA 1QX7A 1KK8C 1IIOA 2KYFA 3GOFA 3PLFB 2KAVA 1IH0A 2EGDA 2KYCA 1JSAA 2M1UA 1KWOB 4XJKA 1TNPA 3IQOA 1A29A 1J7RA 4WRIA 3I5GB 5DKQA 4CFRA 1XFXO 1MQ1A 2KDHA 2PASA 1CFCA 1JF2A 1DJYA 1Z2CB 5HL1A 2JPOA 3PM2A 1N65A 2QPTA 5HKYA 3BUNB 3KHEA 2LVIA 1A2XA 2LC5A 2QACA 1U5IA 2LUXA 3NHIA 2NXQA 4GGFA 2K7DA 2I94A 2FCDA 3B88A 3CYZA 1WY9A 2WCBA 1NUBA 1KQVA 1SSEB 2I7AA 1PRWA 1QVIZ 3HCMA 3HX4A 4DIRA 4C0JA 1OOHA 2MA2A 4C0LA 2HETA 1ZACA 2ZN8A 1IWQA 1KCYA 4NDCA 5BPJA 3NSKA 4JD9A 4A4BA 1FI6A 1B4CA 1GJYA 1J1EA 2HPSA 1SCMB 2WC6A 3D73A 4FQTA 2PSRA 1XO5A 3N7HA 2BCBA 2KAYA 2M9GA 1QTXA 2WCEA 2H61C 3AAKA 1J55A 3SJSA 4ZCVA 1BF5A 3EK8A 1YRUB 1DJHA 1WRZA 2K7BA 2FCEA 1GGZA 2K7CA 1EG3A 1W7IB 1DMOA 1PSRA 1JFJA 1H8BA 4ETOA 2KHNA 3IQQA 2MHHA 1K94A 2HQ8A 4F7FA 1SCVA 2KAXA 1YUSA 3O4YA 1QS7A 3VROA 1MHOA 4PHMA 3NSIA 2KSPA 2NCOA 1TTXA 2WORA 3I5FB 3NSLA 2OPOA 2WCKA 2H2KA 3DVKA 3RM1A 1YVHA 3OB2B 1OE9B 2QEVA 1DJWA 1Q80A 3F45A 3BUOB 1J7QA 3JVTB 2LHLA 3BYAA 1QASA 1ZUZA 1OOJA 1DGUA 2KQ6A 1K95A 3TDZA 1DJZA 1NSHA 2LMUA 2JNFA 2KI4B 1WDCC 4MRXA 3I5IC 3SS3A 2JC2A 3SS5A 3D78A 1CDMA 1SR6C 2O60A 2K61A 3DD4A 1KWOC 1KK7Y 4YRUA 4PHJA 4XJKB 2KBMA 5D69A 1EXRA 2Y1NA 1CLLA 1YTZC 3I5HC 1CFFA 1DJXA 2EC6B 4KYNA 5HKZA 2L4HA 1LA0A 3EVRA 4NQGA 1A03A 1UWOA 2LAPA 1BR4B 1S5GZ 5DICA 3EK4A 5ER5A 2LMVA 1S6CA 3WNXB 4N5XA 1S36A 4OZDA 2KLDA 3DVJA 1QX2A 1CLBA 4GGFC 3DVMA 4DS7A 2L50A 2COLB 2K7OA 2FOTA 2HF5A 2KOTA 2JXLA 3C1VA 2K8MB 2RGIA 1NP8A 1AHRA 1AJ5A 1SR6B 2JXCA 2WOSA 3BFBA 3SG2A 4JWQA 4PDZA 1TNWA 1EG4A 1BMOA 2AMIA 2SCPA 4PHKA 1S3PA 1IQ3A 3S0BA 2KNEA 2M29A 3O78A 4GPLB 3SIAA 1NX2A 4CFQA 3VB1A 1EL4A 1K93D 1F4OA 4PE1A 3IF7A 4IL1A 2LP3A 4FQOA 1DEKA 2F3ZA 1JC2A 1QWVA 2JTTA 1QV1A 4CPVA 3PATA 1IJ6A 2I18A 4HSZA 4CIDA 3BXKA 4GNKB 3MSEB 1IRJA 4C0KA 1H4BA 1KSOA 1J1DA 2JZIA 1QV0A 1CTRA 3CR4X 3B86A 3R72A 1DGVA 2F2PA 1PVAA 3DYEA 1AVSA 2WCHA 5KU1A 1C7WA 4ORAB 1GM0A 1IKUA 1QATA 2MRDA 1P28A 2PQLA 1GGWA 1BT6A 2I2RE 3PALA 5PALA 2LVJA 1TIZA 2LVVA 1Y1UA 2DOQA 1LINA 2LMTA 2MJWB 2OTGC 2JWWA 5HLOA 2BKHB 1N2DA 4NDDA 2BL0B 3LL8B 4N1GA 2QEHA 3RLZA 5AXIA 1S26D 3S0FA 2AUCA 3WHUB 1KK7Z 1SY9A 1TOPA 3DY9A 3Q8IA 1SL7A 3QMEA 3D76A 3DF0B 1G4YR 3TZ1A 2K60A 3DF0A 3R1OA 1G8IA 2PVBA 1PALA 3BQ3A 1N0YA 4YBHB 1NYAA 2L4IA 4YI8A 1WLZA 4P5OE 1XFUO 1BLQA 4QJ4B 1SL9A 3VRQA 1K9KA 1QJTA 4ICBA 3S0DA 1IQ5A 1TCFA 1TUZA 3PN7B 2BBMA 4UPGA 3SIBA 3IVTA 1FPWA 2P6BB 4GBAA 3UO9A 3DZTA 2KI6D 4MN0A 4MZLA 1C07A 4YI9A 2GGMA 4R1EA 1SKTA 1ODBA 2M1KB 3BOWA 2JTZA 5AFPA 1PSBA 1NX3A 1JUOA 1RWYA 1SCMC 1XFRA 3D0YA 3AKAA 3TDIA 3CZ1A 3FWCA 2MLEC 1DELA 1BU3A 1M39A 4YGEB 4PHNA 1RECA 1JF0A 3UNWA 2KPHA 4JQ0D 4YGCB 3K1EA 1XFZO 1KFXS 5DKRA 3V2LA 1Z4HA 1KSMA 1AUIB 2WC5A 2JQ6A 2M3WA 3NXAA 1ZFSA 2ZRSA 2O5GA 4Q04A 2LUCA 2BAPA 1AJ4A 1FW4A 2SASA 1B8CA 1OOFA 3LK0A 5TNCA 5HYDA 1OMRA 3KO0A 2KFHA 1EJ3A 3R1VA 1MR8A 3ZWHA 1G33A 1Y0VH 4YGAA 4DCKA 1WRKA 2LLUA 4E68A 2L0PA 3B7AA 1PVBA 2KGRA 1TNXA 2JT0A 1CDPA 2PALA 5I2LA 2M97A 3I5GC 2V53A 1QVIY 2D8NA 5J3XA 1F55A 1WLMA 2NZ0A 4BY4A 1OMDA 1B7TZ 1SBJA 3CS1A 1S1EA 1B47A 3CR5X 3VRNA 3VRRA 4F0ZB 5G08A 1NX1A 2BBNA 3SG3A 2Y1MA 5F6TA 2F3YA 5I94A 2LHIA 4AQJA 1MWNA 3GK1A 3O4XA 2GV5A 1D1OA 3K21A 3L47A 1R2UA 1UHNA 1J7OA 1DJIA 4INWA 1TCOB 3EKHA 4GFTA 1Y1XA 1ZMZA 1RFJA 1XK4A 1YUTA 1RTP1 2WCMA 1ALVA 1FF1A 4OR9B 3BUMB 2L2EA 4DUQA 1UHKA 4PE0A 3FE9A 2JULA 5AEQA 5FI6A 2BCXA 2Y5IA 1CM4A 1K8UA 2EHBA 2KGBC 2LCPA 1M63B 2ZNEA 2FJUB 3AKBA 1NCXA 1QLSA 3FS7A 3RZSA 1KFUS 1VRKA 2A4JA 2ZFDA 3EG5B 3O2PA 3AAJA 5KSZA 1B1GA 1FI5A
chains in the Genus database with same CATH topology
3CGAA 2M49B 1PULA 1ZOTB 2LNKA 2LM5A 2BE6A 1CM1A 1TNQA 1K2HA 1AP4A 3OHMB 5JOLA 3WHTB 3M0WA 2JNXA 1CNPA 3VGOA 2LE9B 1SK6D 4MBEA 1CFPA 4BY5A 1LVCD 1CFDA 4PCWA 5HLVA 4U8DA 1UUSA 1KQMB 3TUYC 5CSIA 1QX5B 1GQMA 1HT9A 4GUKA 1B9AA 1QXPA 2B1UA 2JT3A 2ZRTA 4GGNA 2KQYA 2R2IA 2CT9A 1S6IA 1WDCB 1B7TY 1NCYA 1QIWA 2WNDA 1DF0A 4PE7A 1CMFA 1NX0A 1TRFA 1DF0B 2MAZA 4ZCUA 2M8UA 4OKHA 3JTDC 2E30A 1DJGA 1LKJA 1RK9A 5K89A 2GGZA 1L2OC 1BR1B 1NCZA 1MF8B 4M2QA 2BL0C 3I5IB 1YR5A 4I5NB 1XYDA 5I2QA 2IS9A 1MXLC 1FBVA 1BODA 5ER4X 1TN4A 2EC6C 2G2BA 1V1GA 2KFGA 2CNPA 2KBIA 3E3RA 1NPQA 3CZTX 5FYXA 1YX8A 4JPZB 4FTGA 1B8LA 1XK4C 5HKWA 1UP5A 4PE4A 5I2OA 2KI4C 5CPVA 1F4QA 3PN7C 3CTNA 2CTNA 4M2OA 1YX7A 3JVTC 3SG6A 1S6JA 1MXEA 1F54A 1A75A 3EVVA 1CB1A 2ISDA 3SG7A 2NCPA 5KTYA 1DVIA 1KK8B 2JU0A 3LLEA 1F8HA 4I5KA 2NLNA 5JJGA 3LCPC 3SG4A 1K90D 1OZOA 1PK0D 2F33A 1F71A 1EH2A 3OP0A 3WXAA 4HRHA 1RJVA 2OS8B 1QLKA 3GK2A 1SNLA 4WQ2A 4MLWA 2ZN9A 1R6PA 1SPYA 2MBXA 1RROA 3ZNIA 1QIVA 4HRGA 2E6WA 1AK8A 3TS5B 2PMYA 3TDUA 1HQVA 2KI6C 1UHIA 3KEVA 2K0JA 4AQIA 1OQPA 3H4SE 3FIAA 1YVLA 3PSRA 1BJFA 2BECA 1SL8A 3PM8A 4OCIA 5CSNA 1SMGA 3OX6A 2F8PA 2LVKA 1K96A 5AERA 4L9MA 1XFYO 1CLMA 1SRAA 1XA5A 2WC8A 2M7LA 2L51A 2Q91A 4OVNF 2H61A 2F2OA 1K9PA 2KFFA 3BOWB 1YURA 3A8RA 1XFWO 1DTLA 1LXFC 3FWBA 3O6BA 5IBWA 4A4CA 3CLNA 4MZJA 4QJ5B 4OV2A 3BUWB 3DVEA 1YRTB 4MRYA 2Y4QA 3OB1B 2M0RA 4MSPA 1W7JB 2L98A 2TN4A 3EK7A 4MVFA 4PALA 2L5XB 1IGVA 4YGBB 4ORBB 5GQQC 2OTGB 4M2PA 1OSAA 3TS5C 3BUXB 1UHHA 1M46A 1Y1AA 2CBLA 2G9BA 4TNCA 4NDBA 5DKNA 1CDLA 2LANA 1A75B 3NSOA 2LP2A 2VRGA 2JPTA 1LA3A 1M31A 1UURA 2LLSA 3PFVA 4I5LB 1CDNA 2ZNDA 3OX5A 5CSJA 1BG1A 1JBAA 5D7FA 3GK4X 1X02A 2HQWA 2M7NA 1KFUL 3I5HB 4WQ3A 1IG5A 1A4PA 1U5IB 4GAOA 4D1EA 1KQMC 3TUYB 1DT7B 2K2AA 4HREE 3VRPA 4N1FA 1OMVA 1S5GY 1J7PA 2CCMA 2JRFA 4ORCB 3SG5A 4MEWA 1SYMA 4USLA 2ZKMX 4DRWA 1F70A 2K2FA 1WRLA 3QRXA 3CWGA 1E8AA 3JTDB 3D10A 1UHJA 1NWDA 5CSFA 1C7VA 2LV7A 1CKKA 1YUUA 2PRUA 4P2YB 1ALWA 1MUXA 1V1FA 1B8RA 1L7ZA 2LLTA 4AOMA 1K9UA 3KF9A 2BE4A 3ICBA 1XFVO 3D0YB 3KPXA 1L2OB 1JWDA 2OS8C 2CXJA 2Q4UA 4YGDB 1IJ5A 3A4UB 5I8NA 3EVUA 4I5JA 5AANA 4XYNA 4QJ3B 1XVJA 3EKJA 3LK1A 1JFKA 3I5FC 1CMGA 2AAOA 2BKIB 2JT8A 1OZSA 1BOCA 1NIWA 1KFXL 1SW8A 2BCAA 4CLNA 1M45A 4MZKA 1Y6WA 5B8IB 2WCFA 2MLFC 3CR2A 2JOJA 1QX7A 1KK8C 2KYFA 3GOFA 3PLFB 2KAVA 1IH0A 2EGDA 2KYCA 1JSAA 2M1UA 1KWOB 4XJKA 1TNPA 3IQOA 1A29A 1J7RA 4WRIA 3I5GB 5DKQA 4CFRA 1XFXO 1MQ1A 2KDHA 2PASA 1CFCA 1JF2A 1DJYA 5HKYA 1N65A 2QPTA 3BUNB 3KHEA 2LVIA 1A2XA 2LC5A 2QACA 1U5IA 2LUXA 2NXQA 4GGFA 2K7DA 2I94A 2FCDA 1WY9A 2WCBA 1NUBA 1KQVA 2I7AA 1PRWA 1QVIZ 3HCMA 3HX4A 4DIRA 4C0JA 4C0LA 2MA2A 2HETA 1ZACA 2ZN8A 1IWQA 1KCYA 4NDCA 5BPJA 3NSKA 4A4BA 1FI6A 1B4CA 1GJYA 1J1EA 2HPSA 1SCMB 2PSRA 1XO5A 2BCBA 2KAYA 2M9GA 1QTXA 2WCEA 2H61C 3AAKA 1J55A 3SJSA 4ZCVA 1BF5A 3EK8A 1YRUB 1DJHA 1WRZA 2K7BA 2FCEA 1GGZA 2K7CA 1EG3A 1W7IB 1DMOA 1PSRA 1JFJA 1H8BA 4ETOA 2KHNA 3IQQA 2MHHA 1K94A 2HQ8A 1SCVA 2KAXA 1YUSA 3O4YA 1QS7A 3VROA 1MHOA 4PHMA 3NSIA 2KSPA 2NCOA 1TTXA 2WORA 3I5FB 3NSLA 2OPOA 3DVKA 2H2KA 3RM1A 1YVHA 3OB2B 1OE9B 1DJWA 1Q80A 3F45A 3BUOB 1J7QA 3JVTB 2LHLA 3BYAA 1QASA 1ZUZA 1OOJA 1DGUA 2KQ6A 1K95A 3TDZA 1DJZA 1NSHA 2LMUA 2JNFA 2KI4B 1WDCC 4MRXA 3I5IC 2JC2A 1CDMA 1SR6C 2O60A 2K61A 3DD4A 1KWOC 1KK7Y 4YRUA 4PHJA 4XJKB 2KBMA 5D69A 1EXRA 2Y1NA 1CLLA 1YTZC 3I5HC 1CFFA 1DJXA 2EC6B 5HKZA 2L4HA 1LA0A 3EVRA 4NQGA 1A03A 1UWOA 2LAPA 1BR4B 1S5GZ 3EK4A 5ER5A 2LMVA 1S6CA 3WNXB 4N5XA 1S36A 3DVJA 1QX2A 1CLBA 4GGFC 3DVMA 4DS7A 2L50A 2COLB 2K7OA 2FOTA 2HF5A 2KOTA 2JXLA 3C1VA 2K8MB 2RGIA 1NP8A 1AHRA 1AJ5A 1SR6B 2JXCA 2WOSA 3SG2A 4JWQA 4PDZA 1TNWA 1EG4A 1BMOA 2AMIA 2SCPA 4PHKA 1S3PA 1IQ3A 2KNEA 2M29A 3O78A 4GPLB 3SIAA 1NX2A 4CFQA 1EL4A 1K93D 1F4OA 4PE1A 3IF7A 4IL1A 2LP3A 4FQOA 2F3ZA 1JC2A 2JTTA 1QV1A 4CPVA 3PATA 1IJ6A 2I18A 4HSZA 4CIDA 3BXKA 4GNKB 3MSEB 1IRJA 4C0KA 1H4BA 1KSOA 1J1DA 2JZIA 1QV0A 1CTRA 3CR4X 1DGVA 2F2PA 1PVAA 1AVSA 5KU1A 1C7WA 4ORAB 1IKUA 1QATA 2MRDA 1GGWA 1BT6A 2I2RE 3PALA 5PALA 2LVJA 1TIZA 2LVVA 1Y1UA 2DOQA 1LINA 2LMTA 2MJWB 2OTGC 2JWWA 5HLOA 2BKHB 1N2DA 4NDDA 2BL0B 3LL8B 4N1GA 3RLZA 5AXIA 1S26D 2AUCA 3WHUB 1KK7Z 1SY9A 1TOPA 1SL7A 3TZ1A 3DF0B 1G4YR 3DF0A 1G8IA 2PVBA 1PALA 3BQ3A 1N0YA 4YBHB 1NYAA 2L4IA 4YI8A 1WLZA 4P5OE 1XFUO 1BLQA 4QJ4B 1SL9A 3VRQA 1K9KA 1QJTA 4ICBA 1IQ5A 1TCFA 3PN7B 2BBMA 4UPGA 3SIBA 1FPWA 2P6BB 4GBAA 2KI6D 4MN0A 4MZLA 1C07A 4YI9A 2GGMA 4R1EA 1SKTA 1ODBA 2M1KB 3BOWA 2JTZA 5AFPA 1PSBA 1NX3A 1JUOA 1RWYA 1SCMC 3D0YA 3AKAA 3TDIA 3FWCA 2MLEC 1BU3A 1M39A 4YGEB 4PHNA 1RECA 1JF0A 4JQ0D 4YGCB 1XFZO 1KFXS 5DKRA 1KSMA 1AUIB 2JQ6A 2M3WA 3NXAA 1ZFSA 2ZRSA 2O5GA 4Q04A 2LUCA 1AJ4A 1FW4A 2SASA 1B8CA 5TNCA 3LK0A 5HYDA 1OMRA 3KO0A 2KFHA 1EJ3A 1MR8A 3ZWHA 1G33A 1Y0VH 4YGAA 4DCKA 1WRKA 2LLUA 4E68A 2L0PA 1PVBA 2KGRA 1TNXA 2JT0A 1CDPA 2PALA 5I2LA 2M97A 3I5GC 2V53A 1QVIY 2D8NA 5J3XA 1F55A 1WLMA 2NZ0A 4BY4A 1OMDA 1B7TZ 1SBJA 3CS1A 1S1EA 1B47A 3CR5X 3VRNA 3VRRA 4F0ZB 5G08A 1NX1A 2BBNA 3SG3A 2Y1MA 5F6TA 2F3YA 2LHIA 4AQJA 1MWNA 3GK1A 2GV5A 1D1OA 3K21A 1R2UA 1UHNA 1J7OA 1DJIA 1TCOB 3EKHA 4GFTA 1Y1XA 1ZMZA 1RFJA 1XK4A 1YUTA 1RTP1 1FF1A 1ALVA 4OR9B 3BUMB 2L2EA 4DUQA 1UHKA 4PE0A 2JULA 5AEQA 2BCXA 2Y5IA 1CM4A 1K8UA 2EHBA 2KGBC 2LCPA 1M63B 2ZNEA 2FJUB 3AKBA 1NCXA 1QLSA 3FS7A 1KFUS 1VRKA 2A4JA 2ZFDA 3O2PA 3AAJA 5KSZA 1B1GA 1FI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGA A;  2M49 B;  1PUL A;  1ZOT B;  2LNK A;  2LM5 A;  2BE6 A;  1CM1 A;  1TNQ A;  1K2H A;  1AP4 A;  3OHM B;  5JOL A;  3WHT B;  3M0W A;  2JNX A;  1CNP A;  3VGO A;  2LE9 B;  1SK6 D;  4MBE A;  1CFP A;  4BY5 A;  1LVC D;  1CFD A;  4PCW A;  5HLV A;  4U8D A;  1UUS A;  1KQM B;  3TUY C;  5CSI A;  1QX5 B;  1GQM A;  1HT9 A;  4GUK A;  1B9A A;  1QXP A;  2B1U A;  2JT3 A;  2ZRT A;  4GGN A;  2KQY A;  2R2I A;  2CT9 A;  1S6I A;  1WDC B;  1B7T Y;  1NCY A;  1QIW A;  2WND A;  1DF0 A;  4PE7 A;  1CMF A;  1NX0 A;  1TRF A;  1DF0 B;  2MAZ A;  4ZCU A;  2M8U A;  4OKH A;  3JTD C;  2E30 A;  1DJG A;  1LKJ A;  1RK9 A;  5K89 A;  2GGZ A;  1L2O C;  1BR1 B;  1NCZ A;  1MF8 B;  4M2Q A;  2BL0 C;  3I5I B;  1YR5 A;  4I5N B;  1XYD A;  5I2Q A;  2IS9 A;  1MXL C;  1FBV A;  1BOD A;  5ER4 X;  1TN4 A;  2EC6 C;  2G2B A;  1V1G A;  2KFG A;  2CNP A;  2KBI A;  3E3R A;  1NPQ A;  3CZT X;  5FYX A;  1YX8 A;  4JPZ B;  4FTG A;  1B8L A;  1XK4 C;  5HKW A;  1UP5 A;  4PE4 A;  5I2O A;  2KI4 C;  5CPV A;  1F4Q A;  3PN7 C;  3CTN A;  2CTN A;  4M2O A;  1YX7 A;  3JVT C;  3SG6 A;  1S6J A;  1MXE A;  1F54 A;  1A75 A;  3EVV A;  1CB1 A;  2ISD A;  3SG7 A;  2NCP A;  5KTY A;  1DVI A;  1KK8 B;  2JU0 A;  3LLE A;  1F8H A;  4I5K A;  2NLN A;  5JJG A;  3LCP C;  3SG4 A;  1K90 D;  1OZO A;  1PK0 D;  2F33 A;  1F71 A;  1EH2 A;  3OP0 A;  3WXA A;  4HRH A;  1RJV A;  2OS8 B;  1QLK A;  3GK2 A;  1SNL A;  4WQ2 A;  4MLW A;  2ZN9 A;  1R6P A;  1SPY A;  2MBX A;  1RRO A;  3ZNI A;  1QIV A;  4HRG A;  2E6W A;  1AK8 A;  3TS5 B;  2PMY A;  3TDU A;  1HQV A;  2KI6 C;  1UHI A;  3KEV A;  2K0J A;  4AQI A;  1OQP A;  3H4S E;  3FIA A;  1YVL A;  3PSR A;  1BJF A;  2BEC A;  1SL8 A;  3PM8 A;  4OCI A;  5CSN A;  1SMG A;  3OX6 A;  2F8P A;  2LVK A;  1K96 A;  5AER A;  4L9M A;  1XFY O;  1CLM A;  1SRA A;  1XA5 A;  2WC8 A;  2M7L A;  2L51 A;  2Q91 A;  4OVN F;  2H61 A;  2F2O A;  1K9P A;  2KFF A;  3BOW B;  1YUR A;  3A8R A;  1XFW O;  1DTL A;  1LXF C;  3FWB A;  3O6B A;  5IBW A;  4A4C A;  3CLN A;  4MZJ A;  4QJ5 B;  4OV2 A;  3BUW B;  3DVE A;  1YRT B;  4MRY A;  2Y4Q A;  3OB1 B;  2M0R A;  4MSP A;  1W7J B;  2L98 A;  2TN4 A;  3EK7 A;  4MVF A;  4PAL A;  2L5X B;  1IGV A;  4YGB B;  4ORB B;  5GQQ C;  2OTG B;  4M2P A;  1OSA A;  3TS5 C;  3BUX B;  1UHH A;  1M46 A;  1Y1A A;  2CBL A;  2G9B A;  4TNC A;  4NDB A;  5DKN A;  1CDL A;  2LAN A;  1A75 B;  3NSO A;  2LP2 A;  2VRG A;  2JPT A;  1LA3 A;  1M31 A;  1UUR A;  2LLS A;  3PFV A;  4I5L B;  1CDN A;  2ZND A;  3OX5 A;  5CSJ A;  1BG1 A;  1JBA A;  5D7F A;  3GK4 X;  1X02 A;  2HQW A;  2M7N A;  1KFU L;  3I5H B;  4WQ3 A;  1IG5 A;  1A4P A;  1U5I B;  4GAO A;  4D1E A;  1KQM C;  3TUY B;  1DT7 B;  2K2A A;  4HRE E;  3VRP A;  4N1F A;  1OMV A;  1S5G Y;  1J7P A;  2CCM A;  2JRF A;  4ORC B;  3SG5 A;  4MEW A;  1SYM A;  4USL A;  2ZKM X;  4DRW A;  1F70 A;  2K2F A;  1WRL A;  3QRX A;  3CWG A;  1E8A A;  3JTD B;  3D10 A;  1UHJ A;  1NWD A;  5CSF A;  1C7V A;  2LV7 A;  1CKK A;  1YUU A;  2PRU A;  4P2Y B;  1ALW A;  1MUX A;  1V1F A;  1B8R A;  1L7Z A;  2LLT A;  4AOM A;  1K9U A;  3KF9 A;  2BE4 A;  3ICB A;  1XFV O;  3D0Y B;  3KPX A;  1L2O B;  1JWD A;  2OS8 C;  2CXJ A;  2Q4U A;  4YGD B;  1IJ5 A;  3A4U B;  5I8N A;  3EVU A;  4I5J A;  5AAN A;  4XYN A;  4QJ3 B;  1XVJ A;  3EKJ A;  3LK1 A;  1JFK A;  3I5F C;  1CMG A;  2AAO A;  2BKI B;  2JT8 A;  1OZS A;  1BOC A;  1NIW A;  1KFX L;  1SW8 A;  2BCA A;  4CLN A;  1M45 A;  4MZK A;  1Y6W A;  5B8I B;  2WCF A;  2MLF C;  3CR2 A;  2JOJ A;  1QX7 A;  1KK8 C;  2KYF A;  3GOF A;  3PLF B;  2KAV A;  1IH0 A;  2EGD A;  2KYC A;  1JSA A;  2M1U A;  1KWO B;  4XJK A;  1TNP A;  3IQO A;  1A29 A;  1J7R A;  4WRI A;  3I5G B;  5DKQ A;  4CFR A;  1XFX O;  1MQ1 A;  2KDH A;  2PAS A;  1CFC A;  1JF2 A;  1DJY A;  5HKY A;  1N65 A;  2QPT A;  3BUN B;  3KHE A;  2LVI A;  1A2X A;  2LC5 A;  2QAC A;  1U5I A;  2LUX A;  2NXQ A;  4GGF A;  2K7D A;  2I94 A;  2FCD A;  1WY9 A;  2WCB A;  1NUB A;  1KQV A;  2I7A A;  1PRW A;  1QVI Z;  3HCM A;  3HX4 A;  4DIR A;  4C0J A;  4C0L A;  2MA2 A;  2HET A;  1ZAC A;  2ZN8 A;  1IWQ A;  1KCY A;  4NDC A;  5BPJ A;  3NSK A;  4A4B A;  1FI6 A;  1B4C A;  1GJY A;  1J1E A;  2HPS A;  1SCM B;  2PSR A;  1XO5 A;  2BCB A;  2KAY A;  2M9G A;  1QTX A;  2WCE A;  2H61 C;  3AAK A;  1J55 A;  3SJS A;  4ZCV A;  1BF5 A;  3EK8 A;  1YRU B;  1DJH A;  1WRZ A;  2K7B A;  2FCE A;  1GGZ A;  2K7C A;  1EG3 A;  1W7I B;  1DMO A;  1PSR A;  1JFJ A;  1H8B A;  4ETO A;  2KHN A;  3IQQ A;  2MHH A;  1K94 A;  2HQ8 A;  1SCV A;  2KAX A;  1YUS A;  3O4Y A;  1QS7 A;  3VRO A;  1MHO A;  4PHM A;  3NSI A;  2KSP A;  2NCO A;  1TTX A;  2WOR A;  3I5F B;  3NSL A;  2OPO A;  3DVK A;  2H2K A;  3RM1 A;  1YVH A;  3OB2 B;  1OE9 B;  1DJW A;  1Q80 A;  3F45 A;  3BUO B;  1J7Q A;  3JVT B;  2LHL A;  3BYA A;  1QAS A;  1ZUZ A;  1OOJ A;  1DGU A;  2KQ6 A;  1K95 A;  3TDZ A;  1DJZ A;  1NSH A;  2LMU A;  2JNF A;  2KI4 B;  1WDC C;  4MRX A;  3I5I C;  2JC2 A;  1CDM A;  1SR6 C;  2O60 A;  2K61 A;  3DD4 A;  1KWO C;  1KK7 Y;  4YRU A;  4PHJ A;  4XJK B;  2KBM A;  5D69 A;  1EXR A;  2Y1N A;  1CLL A;  1YTZ C;  3I5H C;  1CFF A;  1DJX A;  2EC6 B;  5HKZ A;  2L4H A;  1LA0 A;  3EVR A;  4NQG A;  1A03 A;  1UWO A;  2LAP A;  1BR4 B;  1S5G Z;  3EK4 A;  5ER5 A;  2LMV A;  1S6C A;  3WNX B;  4N5X A;  1S36 A;  3DVJ A;  1QX2 A;  1CLB A;  4GGF C;  3DVM A;  4DS7 A;  2L50 A;  2COL B;  2K7O A;  2FOT A;  2HF5 A;  2KOT A;  2JXL A;  3C1V A;  2K8M B;  2RGI A;  1NP8 A;  1AHR A;  1AJ5 A;  1SR6 B;  2JXC A;  2WOS A;  3SG2 A;  4JWQ A;  4PDZ A;  1TNW A;  1EG4 A;  1BMO A;  2AMI A;  2SCP A;  4PHK A;  1S3P A;  1IQ3 A;  2KNE A;  2M29 A;  3O78 A;  4GPL B;  3SIA A;  1NX2 A;  4CFQ A;  1EL4 A;  1K93 D;  1F4O A;  4PE1 A;  3IF7 A;  4IL1 A;  2LP3 A;  4FQO A;  2F3Z A;  1JC2 A;  2JTT A;  1QV1 A;  4CPV A;  3PAT A;  1IJ6 A;  2I18 A;  4HSZ A;  4CID A;  3BXK A;  4GNK B;  3MSE B;  1IRJ A;  4C0K A;  1H4B A;  1KSO A;  1J1D A;  2JZI A;  1QV0 A;  1CTR A;  3CR4 X;  1DGV A;  2F2P A;  1PVA A;  1AVS A;  5KU1 A;  1C7W A;  4ORA B;  1IKU A;  1QAT A;  2MRD A;  1GGW A;  1BT6 A;  2I2R E;  3PAL A;  5PAL A;  2LVJ A;  1TIZ A;  2LVV A;  1Y1U A;  2DOQ A;  1LIN A;  2LMT A;  2MJW B;  2OTG C;  2JWW A;  5HLO A;  2BKH B;  1N2D A;  4NDD A;  2BL0 B;  3LL8 B;  4N1G A;  3RLZ A;  5AXI A;  1S26 D;  2AUC A;  3WHU B;  1KK7 Z;  1SY9 A;  1TOP A;  1SL7 A;  3TZ1 A;  3DF0 B;  1G4Y R;  3DF0 A;  1G8I A;  2PVB A;  1PAL A;  3BQ3 A;  1N0Y A;  4YBH B;  1NYA A;  2L4I A;  4YI8 A;  1WLZ A;  4P5O E;  1XFU O;  1BLQ A;  4QJ4 B;  1SL9 A;  3VRQ A;  1K9K A;  1QJT A;  4ICB A;  1IQ5 A;  1TCF A;  3PN7 B;  2BBM A;  4UPG A;  3SIB A;  1FPW A;  2P6B B;  4GBA A;  2KI6 D;  4MN0 A;  4MZL A;  1C07 A;  4YI9 A;  2GGM A;  4R1E A;  1SKT A;  1ODB A;  2M1K B;  3BOW A;  2JTZ A;  5AFP A;  1PSB A;  1NX3 A;  1JUO A;  1RWY A;  1SCM C;  3D0Y A;  3AKA A;  3TDI A;  3FWC A;  2MLE C;  1BU3 A;  1M39 A;  4YGE B;  4PHN A;  1REC A;  1JF0 A;  4JQ0 D;  4YGC B;  1XFZ O;  1KFX S;  5DKR A;  1KSM A;  1AUI B;  2JQ6 A;  2M3W A;  3NXA A;  1ZFS A;  2ZRS A;  2O5G A;  4Q04 A;  2LUC A;  1AJ4 A;  1FW4 A;  2SAS A;  1B8C A;  5TNC A;  3LK0 A;  5HYD A;  1OMR A;  3KO0 A;  2KFH A;  1EJ3 A;  1MR8 A;  3ZWH A;  1G33 A;  1Y0V H;  4YGA A;  4DCK A;  1WRK A;  2LLU A;  4E68 A;  2L0P A;  1PVB A;  2KGR A;  1TNX A;  2JT0 A;  1CDP A;  2PAL A;  5I2L A;  2M97 A;  3I5G C;  2V53 A;  1QVI Y;  2D8N A;  5J3X A;  1F55 A;  1WLM A;  2NZ0 A;  4BY4 A;  1OMD A;  1B7T Z;  1SBJ A;  3CS1 A;  1S1E A;  1B47 A;  3CR5 X;  3VRN A;  3VRR A;  4F0Z B;  5G08 A;  1NX1 A;  2BBN A;  3SG3 A;  2Y1M A;  5F6T A;  2F3Y A;  2LHI A;  4AQJ A;  1MWN A;  3GK1 A;  2GV5 A;  1D1O A;  3K21 A;  1R2U A;  1UHN A;  1J7O A;  1DJI A;  1TCO B;  3EKH A;  4GFT A;  1Y1X A;  1ZMZ A;  1RFJ A;  1XK4 A;  1YUT A;  1RTP 1;  1FF1 A;  1ALV A;  4OR9 B;  3BUM B;  2L2E A;  4DUQ A;  1UHK A;  4PE0 A;  2JUL A;  5AEQ A;  2BCX A;  2Y5I A;  1CM4 A;  1K8U A;  2EHB A;  2KGB C;  2LCP A;  1M63 B;  2ZNE A;  2FJU B;  3AKB A;  1NCX A;  1QLS A;  3FS7 A;  1KFU S;  1VRK A;  2A4J A;  2ZFD A;  3O2P A;  3AAJ A;  5KSZ A;  1B1G A;  1FI5 A; 
#chains in the Genus database with same CATH topology
 3CGA A;  4INX A;  2M49 B;  1PUL A;  2L2C A;  1ZOT B;  2LNK A;  3FE8 A;  2LM5 A;  2BE6 A;  1CM1 A;  1TNQ A;  3L4A A;  5D3O A;  1K2H A;  1AP4 A;  3CZ2 A;  3OHM B;  5JOL A;  3WHT B;  3M0W A;  2JNX A;  1CNP A;  3VGO A;  2LE9 B;  1SK6 D;  4MBE A;  1CFP A;  4BY5 A;  1TWO A;  1LVC D;  1CFD A;  4PCW A;  5HLV A;  4U8D A;  1UUS A;  1KQM B;  3TUY C;  5CSI A;  1QX5 B;  3CAB A;  1GQM A;  1HT9 A;  2YGU A;  4GUK A;  1B9A A;  1QXP A;  2B1U A;  2JT3 A;  2ZRT A;  4GGN A;  2KQY A;  2R2I A;  2CT9 A;  1S6I A;  1WDC B;  1B7T Y;  1NCY A;  1QIW A;  2WND A;  1DF0 A;  4PE7 A;  1CMF A;  1NX0 A;  1TRF A;  1DF0 B;  2MAZ A;  4ZCU A;  2M8U A;  4OKH A;  3JTD C;  2E30 A;  1DJG A;  1LKJ A;  1RK9 A;  5K89 A;  2GGZ A;  1L2O C;  1BR1 B;  1NCZ A;  1MF8 B;  4M2Q A;  2BL0 C;  3I5I B;  1OOI X;  1YR5 A;  4I5N B;  1XYD A;  5I2Q A;  2IS9 A;  1MXL C;  1FBV A;  1BOD A;  5ER4 X;  3FE6 A;  1TN4 A;  2EC6 C;  2G2B A;  1V1G A;  2KFG A;  2CNP A;  2KBI A;  3E3R A;  1NPQ A;  3CZT X;  1LS8 A;  5FYX A;  1YX8 A;  4JPZ B;  4FTG A;  1B8L A;  1XK4 C;  5HKW A;  1UP5 A;  3SS4 A;  4PE4 A;  5I2O A;  2KI4 C;  5CPV A;  2H8V A;  1F4Q A;  3PN7 C;  3CTN A;  2CTN A;  4M2O A;  1YX7 A;  3JVT C;  3NGV A;  1S6J A;  1MXE A;  3SG6 A;  1A75 A;  1F54 A;  3EVV A;  1CB1 A;  2ISD A;  3SG7 A;  2NCP A;  1ORG A;  5KTY A;  1DVI A;  1KK8 B;  2JU0 A;  3LLE A;  3PJI A;  3S0E A;  1F8H A;  4I5K A;  2NLN A;  1OW4 A;  5JJG A;  3LCP C;  3SG4 A;  1K90 D;  1OZO A;  1PK0 D;  2F33 A;  1F71 A;  1EH2 A;  3OP0 A;  3WXA A;  4HRH A;  1RJV A;  2OS8 B;  1QLK A;  3GK2 A;  1SNL A;  4WQ2 A;  4MLW A;  2ZN9 A;  1R6P A;  1SPY A;  2MBX A;  1RRO A;  3ZNI A;  1QIV A;  3BFH A;  4HRG A;  3R1P A;  2E6W A;  1AK8 A;  1C3Z A;  3D75 A;  3TS5 B;  3CZ0 A;  2PMY A;  3TDU A;  1HQV A;  2KI6 C;  1UHI A;  3KEV A;  2K0J A;  4AQI A;  1OQP A;  3H4S E;  3FIA A;  1YVL A;  3PSR A;  1BJF A;  2BEC A;  1SL8 A;  3PM8 A;  4OCI A;  5CSN A;  1SMG A;  3OX6 A;  2F8P A;  2LVK A;  1K96 A;  3BJH A;  5AER A;  4L9M A;  1XFY O;  1CLM A;  1SRA A;  1XA5 A;  2WC8 A;  3B87 A;  2L51 A;  2Q91 A;  2M7L A;  4OVN F;  2H61 A;  2F2O A;  1K9P A;  2KFF A;  2ERB A;  3BOW B;  1W9Z A;  1YUR A;  4PT1 A;  3A8R A;  1XFW O;  1DTL A;  1LXF C;  3FWB A;  3O6B A;  5IBW A;  1DQE A;  4A4C A;  2L5Y A;  3CLN A;  4MZJ A;  4QJ5 B;  4OV2 A;  3BUW B;  3D77 A;  2P71 A;  3DVE A;  3BFA A;  2FJY A;  1YRT B;  1TUJ A;  4MRY A;  2Y4Q A;  3OB1 B;  2M0R A;  4MSP A;  1W7J B;  2L98 A;  2TN4 A;  3EK7 A;  3OGN A;  4MVF A;  4PAL A;  2L5X B;  1IGV A;  4YGB B;  4ORB B;  5GQQ C;  2OTG B;  4M2P A;  1OSA A;  3TS5 C;  3BUX B;  1UHH A;  1M46 A;  1Y1A A;  2CBL A;  2G9B A;  4TNC A;  4NDB A;  5DKN A;  3L4L A;  1CDL A;  2LAN A;  1A75 B;  3NSO A;  2LP2 A;  2QEO A;  2VRG A;  2JPT A;  1LA3 A;  1M31 A;  1UUR A;  2LLS A;  3PFV A;  4IJ7 A;  2P70 A;  1C3Y A;  4I5L B;  5EL2 A;  2BNX A;  5FI2 A;  1CDN A;  2ZND A;  2WCJ A;  3OX5 A;  5CSJ A;  1BG1 A;  1JBA A;  5D7F A;  3GK4 X;  1X02 A;  2HQW A;  2M7N A;  1KFU L;  3I5H B;  4WQ3 A;  1IG5 A;  3S0G A;  1A4P A;  1OOG A;  1U5I B;  4GAO A;  4JKT A;  4D1E A;  1KQM C;  3TUY B;  1DT7 B;  3B6X A;  2K2A A;  4HRE E;  3VRP A;  3NHT A;  4N1F A;  1OMV A;  1S5G Y;  1J7P A;  2CCM A;  2JRF A;  4ORC B;  3SG5 A;  4MEW A;  1SYM A;  4USL A;  2ZKM X;  4DRW A;  1F70 A;  2K2F A;  1WRL A;  2QDI A;  3QRX A;  3CWG A;  1E8A A;  3JTD B;  1DC1 A;  3CDN A;  3D10 A;  1UHJ A;  1NWD A;  5CSF A;  1C7V A;  2LV7 A;  1CKK A;  1YUU A;  2PRU A;  3OBV A;  4P2Y B;  3DXL A;  1ALW A;  1MUX A;  1V1F A;  1B8R A;  3D74 A;  2WCL A;  5FI7 A;  1L7Z A;  2LLT A;  4AOM A;  1K9U A;  2PYQ A;  2BE4 A;  3ICB A;  2GTE A;  1XFV O;  3KF9 A;  3D0Y B;  3KPX A;  1L2O B;  1JWD A;  2OS8 C;  2CXJ A;  2Q4U A;  4YGD B;  1IJ5 A;  2QEB A;  3A4U B;  5I8N A;  3EVU A;  4I5J A;  5AAN A;  4XYN A;  4QJ3 B;  1XVJ A;  3EKJ A;  3LK1 A;  1JFK A;  1T14 A;  3I5F C;  1CMG A;  2AAO A;  2BKI B;  2JT8 A;  2KLE A;  1OZS A;  1BOC A;  1NIW A;  1KFX L;  1SW8 A;  2BCA A;  4CLN A;  1M45 A;  4MZK A;  1Y6W A;  5B8I B;  3S0A A;  2WCF A;  2MLF C;  3CR2 A;  2JOJ A;  1QX7 A;  1KK8 C;  1IIO A;  2KYF A;  3GOF A;  3PLF B;  2KAV A;  1IH0 A;  2EGD A;  2KYC A;  1JSA A;  2M1U A;  1KWO B;  4XJK A;  1TNP A;  3IQO A;  1A29 A;  1J7R A;  4WRI A;  3I5G B;  5DKQ A;  4CFR A;  1XFX O;  1MQ1 A;  2KDH A;  2PAS A;  1CFC A;  1JF2 A;  1DJY A;  1Z2C B;  5HL1 A;  2JPO A;  3PM2 A;  1N65 A;  2QPT A;  5HKY A;  3BUN B;  3KHE A;  2LVI A;  1A2X A;  2LC5 A;  2QAC A;  1U5I A;  2LUX A;  3NHI A;  2NXQ A;  4GGF A;  2K7D A;  2I94 A;  2FCD A;  3B88 A;  3CYZ A;  1WY9 A;  2WCB A;  1NUB A;  1KQV A;  1SSE B;  2I7A A;  1PRW A;  1QVI Z;  3HCM A;  3HX4 A;  4DIR A;  4C0J A;  1OOH A;  2MA2 A;  4C0L A;  2HET A;  1ZAC A;  2ZN8 A;  1IWQ A;  1KCY A;  4NDC A;  5BPJ A;  3NSK A;  4JD9 A;  4A4B A;  1FI6 A;  1B4C A;  1GJY A;  1J1E A;  2HPS A;  1SCM B;  2WC6 A;  3D73 A;  4FQT A;  2PSR A;  1XO5 A;  3N7H A;  2BCB A;  2KAY A;  2M9G A;  1QTX A;  2WCE A;  2H61 C;  3AAK A;  1J55 A;  3SJS A;  4ZCV A;  1BF5 A;  3EK8 A;  1YRU B;  1DJH A;  1WRZ A;  2K7B A;  2FCE A;  1GGZ A;  2K7C A;  1EG3 A;  1W7I B;  1DMO A;  1PSR A;  1JFJ A;  1H8B A;  4ETO A;  2KHN A;  3IQQ A;  2MHH A;  1K94 A;  2HQ8 A;  4F7F A;  1SCV A;  2KAX A;  1YUS A;  3O4Y A;  1QS7 A;  3VRO A;  1MHO A;  4PHM A;  3NSI A;  2KSP A;  2NCO A;  1TTX A;  2WOR A;  3I5F B;  3NSL A;  2OPO A;  2WCK A;  2H2K A;  3DVK A;  3RM1 A;  1YVH A;  3OB2 B;  1OE9 B;  2QEV A;  1DJW A;  1Q80 A;  3F45 A;  3BUO B;  1J7Q A;  3JVT B;  2LHL A;  3BYA A;  1QAS A;  1ZUZ A;  1OOJ A;  1DGU A;  2KQ6 A;  1K95 A;  3TDZ A;  1DJZ A;  1NSH A;  2LMU A;  2JNF A;  2KI4 B;  1WDC C;  4MRX A;  3I5I C;  3SS3 A;  2JC2 A;  3SS5 A;  3D78 A;  1CDM A;  1SR6 C;  2O60 A;  2K61 A;  3DD4 A;  1KWO C;  1KK7 Y;  4YRU A;  4PHJ A;  4XJK B;  2KBM A;  5D69 A;  1EXR A;  2Y1N A;  1CLL A;  1YTZ C;  3I5H C;  1CFF A;  1DJX A;  2EC6 B;  4KYN A;  5HKZ A;  2L4H A;  1LA0 A;  3EVR A;  4NQG A;  1A03 A;  1UWO A;  2LAP A;  1BR4 B;  1S5G Z;  5DIC A;  3EK4 A;  5ER5 A;  2LMV A;  1S6C A;  3WNX B;  4N5X A;  1S36 A;  4OZD A;  2KLD A;  3DVJ A;  1QX2 A;  1CLB A;  4GGF C;  3DVM A;  4DS7 A;  2L50 A;  2COL B;  2K7O A;  2FOT A;  2HF5 A;  2KOT A;  2JXL A;  3C1V A;  2K8M B;  2RGI A;  1NP8 A;  1AHR A;  1AJ5 A;  1SR6 B;  2JXC A;  2WOS A;  3BFB A;  3SG2 A;  4JWQ A;  4PDZ A;  1TNW A;  1EG4 A;  1BMO A;  2AMI A;  2SCP A;  4PHK A;  1S3P A;  1IQ3 A;  3S0B A;  2KNE A;  2M29 A;  3O78 A;  4GPL B;  3SIA A;  1NX2 A;  4CFQ A;  3VB1 A;  1EL4 A;  1K93 D;  1F4O A;  4PE1 A;  3IF7 A;  4IL1 A;  2LP3 A;  4FQO A;  1DEK A;  2F3Z A;  1JC2 A;  1QWV A;  2JTT A;  1QV1 A;  4CPV A;  3PAT A;  1IJ6 A;  2I18 A;  4HSZ A;  4CID A;  3BXK A;  4GNK B;  3MSE B;  1IRJ A;  4C0K A;  1H4B A;  1KSO A;  1J1D A;  2JZI A;  1QV0 A;  1CTR A;  3CR4 X;  3B86 A;  3R72 A;  1DGV A;  2F2P A;  1PVA A;  3DYE A;  1AVS A;  2WCH A;  5KU1 A;  1C7W A;  4ORA B;  1GM0 A;  1IKU A;  1QAT A;  2MRD A;  1P28 A;  2PQL A;  1GGW A;  1BT6 A;  2I2R E;  3PAL A;  5PAL A;  2LVJ A;  1TIZ A;  2LVV A;  1Y1U A;  2DOQ A;  1LIN A;  2LMT A;  2MJW B;  2OTG C;  2JWW A;  5HLO A;  2BKH B;  1N2D A;  4NDD A;  2BL0 B;  3LL8 B;  4N1G A;  2QEH A;  3RLZ A;  5AXI A;  1S26 D;  3S0F A;  2AUC A;  3WHU B;  1KK7 Z;  1SY9 A;  1TOP A;  3DY9 A;  3Q8I A;  1SL7 A;  3QME A;  3D76 A;  3DF0 B;  1G4Y R;  3TZ1 A;  2K60 A;  3DF0 A;  3R1O A;  1G8I A;  2PVB A;  1PAL A;  3BQ3 A;  1N0Y A;  4YBH B;  1NYA A;  2L4I A;  4YI8 A;  1WLZ A;  4P5O E;  1XFU O;  1BLQ A;  4QJ4 B;  1SL9 A;  3VRQ A;  1K9K A;  1QJT A;  4ICB A;  3S0D A;  1IQ5 A;  1TCF A;  1TUZ A;  3PN7 B;  2BBM A;  4UPG A;  3SIB A;  3IVT A;  1FPW A;  2P6B B;  4GBA A;  3UO9 A;  3DZT A;  2KI6 D;  4MN0 A;  4MZL A;  1C07 A;  4YI9 A;  2GGM A;  4R1E A;  1SKT A;  1ODB A;  2M1K B;  3BOW A;  2JTZ A;  5AFP A;  1PSB A;  1NX3 A;  1JUO A;  1RWY A;  1SCM C;  1XFR A;  3D0Y A;  3AKA A;  3TDI A;  3CZ1 A;  3FWC A;  2MLE C;  1DEL A;  1BU3 A;  1M39 A;  4YGE B;  4PHN A;  1REC A;  1JF0 A;  3UNW A;  2KPH A;  4JQ0 D;  4YGC B;  3K1E A;  1XFZ O;  1KFX S;  5DKR A;  3V2L A;  1Z4H A;  1KSM A;  1AUI B;  2WC5 A;  2JQ6 A;  2M3W A;  3NXA A;  1ZFS A;  2ZRS A;  2O5G A;  4Q04 A;  2LUC A;  2BAP A;  1AJ4 A;  1FW4 A;  2SAS A;  1B8C A;  1OOF A;  3LK0 A;  5TNC A;  5HYD A;  1OMR A;  3KO0 A;  2KFH A;  1EJ3 A;  3R1V A;  1MR8 A;  3ZWH A;  1G33 A;  1Y0V H;  4YGA A;  4DCK A;  1WRK A;  2LLU A;  4E68 A;  2L0P A;  3B7A A;  1PVB A;  2KGR A;  1TNX A;  2JT0 A;  1CDP A;  2PAL A;  5I2L A;  2M97 A;  3I5G C;  2V53 A;  1QVI Y;  2D8N A;  5J3X A;  1F55 A;  1WLM A;  2NZ0 A;  4BY4 A;  1OMD A;  1B7T Z;  1SBJ A;  3CS1 A;  1S1E A;  1B47 A;  3CR5 X;  3VRN A;  3VRR A;  4F0Z B;  5G08 A;  1NX1 A;  2BBN A;  3SG3 A;  2Y1M A;  5F6T A;  2F3Y A;  5I94 A;  2LHI A;  4AQJ A;  1MWN A;  3GK1 A;  3O4X A;  2GV5 A;  1D1O A;  3K21 A;  3L47 A;  1R2U A;  1UHN A;  1J7O A;  1DJI A;  4INW A;  1TCO B;  3EKH A;  4GFT A;  1Y1X A;  1ZMZ A;  1RFJ A;  1XK4 A;  1YUT A;  1RTP 1;  2WCM A;  1ALV A;  1FF1 A;  4OR9 B;  3BUM B;  2L2E A;  4DUQ A;  1UHK A;  4PE0 A;  3FE9 A;  2JUL A;  5AEQ A;  5FI6 A;  2BCX A;  2Y5I A;  1CM4 A;  1K8U A;  2EHB A;  2KGB C;  2LCP A;  1M63 B;  2ZNE A;  2FJU B;  3AKB A;  1NCX A;  1QLS A;  3FS7 A;  3RZS A;  1KFU S;  1VRK A;  2A4J A;  2ZFD A;  3EG5 B;  3O2P A;  3AAJ A;  5KSZ A;  1B1G A;  1FI5 A; 
#chains in the Genus database with same CATH homology
 3CGA A;  2M49 B;  1PUL A;  1ZOT B;  2LNK A;  2LM5 A;  2BE6 A;  1CM1 A;  1TNQ A;  1K2H A;  1AP4 A;  3OHM B;  5JOL A;  3WHT B;  3M0W A;  2JNX A;  1CNP A;  3VGO A;  2LE9 B;  1SK6 D;  4MBE A;  1CFP A;  4BY5 A;  1LVC D;  1CFD A;  4PCW A;  5HLV A;  4U8D A;  1UUS A;  1KQM B;  3TUY C;  5CSI A;  1QX5 B;  1GQM A;  1HT9 A;  4GUK A;  1B9A A;  1QXP A;  2B1U A;  2JT3 A;  2ZRT A;  4GGN A;  2KQY A;  2R2I A;  2CT9 A;  1S6I A;  1WDC B;  1B7T Y;  1NCY A;  1QIW A;  2WND A;  1DF0 A;  4PE7 A;  1CMF A;  1NX0 A;  1TRF A;  1DF0 B;  2MAZ A;  4ZCU A;  2M8U A;  4OKH A;  3JTD C;  2E30 A;  1DJG A;  1LKJ A;  1RK9 A;  5K89 A;  2GGZ A;  1L2O C;  1BR1 B;  1NCZ A;  1MF8 B;  4M2Q A;  2BL0 C;  3I5I B;  1YR5 A;  4I5N B;  1XYD A;  5I2Q A;  2IS9 A;  1MXL C;  1FBV A;  1BOD A;  5ER4 X;  1TN4 A;  2EC6 C;  2G2B A;  1V1G A;  2KFG A;  2CNP A;  2KBI A;  3E3R A;  1NPQ A;  3CZT X;  5FYX A;  1YX8 A;  4JPZ B;  4FTG A;  1B8L A;  1XK4 C;  5HKW A;  1UP5 A;  4PE4 A;  5I2O A;  2KI4 C;  5CPV A;  1F4Q A;  3PN7 C;  3CTN A;  2CTN A;  4M2O A;  1YX7 A;  3JVT C;  3SG6 A;  1S6J A;  1MXE A;  1F54 A;  1A75 A;  3EVV A;  1CB1 A;  2ISD A;  3SG7 A;  2NCP A;  5KTY A;  1DVI A;  1KK8 B;  2JU0 A;  3LLE A;  1F8H A;  4I5K A;  2NLN A;  5JJG A;  3LCP C;  3SG4 A;  1K90 D;  1OZO A;  1PK0 D;  2F33 A;  1F71 A;  1EH2 A;  3OP0 A;  3WXA A;  4HRH A;  1RJV A;  2OS8 B;  1QLK A;  3GK2 A;  1SNL A;  4WQ2 A;  4MLW A;  2ZN9 A;  1R6P A;  1SPY A;  2MBX A;  1RRO A;  3ZNI A;  1QIV A;  4HRG A;  2E6W A;  1AK8 A;  3TS5 B;  2PMY A;  3TDU A;  1HQV A;  2KI6 C;  1UHI A;  3KEV A;  2K0J A;  4AQI A;  1OQP A;  3H4S E;  3FIA A;  1YVL A;  3PSR A;  1BJF A;  2BEC A;  1SL8 A;  3PM8 A;  4OCI A;  5CSN A;  1SMG A;  3OX6 A;  2F8P A;  2LVK A;  1K96 A;  5AER A;  4L9M A;  1XFY O;  1CLM A;  1SRA A;  1XA5 A;  2WC8 A;  2M7L A;  2L51 A;  2Q91 A;  4OVN F;  2H61 A;  2F2O A;  1K9P A;  2KFF A;  3BOW B;  1YUR A;  3A8R A;  1XFW O;  1DTL A;  1LXF C;  3FWB A;  3O6B A;  5IBW A;  4A4C A;  3CLN A;  4MZJ A;  4QJ5 B;  4OV2 A;  3BUW B;  3DVE A;  1YRT B;  4MRY A;  2Y4Q A;  3OB1 B;  2M0R A;  4MSP A;  1W7J B;  2L98 A;  2TN4 A;  3EK7 A;  4MVF A;  4PAL A;  2L5X B;  1IGV A;  4YGB B;  4ORB B;  5GQQ C;  2OTG B;  4M2P A;  1OSA A;  3TS5 C;  3BUX B;  1UHH A;  1M46 A;  1Y1A A;  2CBL A;  2G9B A;  4TNC A;  4NDB A;  5DKN A;  1CDL A;  2LAN A;  1A75 B;  3NSO A;  2LP2 A;  2VRG A;  2JPT A;  1LA3 A;  1M31 A;  1UUR A;  2LLS A;  3PFV A;  4I5L B;  1CDN A;  2ZND A;  3OX5 A;  5CSJ A;  1BG1 A;  1JBA A;  5D7F A;  3GK4 X;  1X02 A;  2HQW A;  2M7N A;  1KFU L;  3I5H B;  4WQ3 A;  1IG5 A;  1A4P A;  1U5I B;  4GAO A;  4D1E A;  1KQM C;  3TUY B;  1DT7 B;  2K2A A;  4HRE E;  3VRP A;  4N1F A;  1OMV A;  1S5G Y;  1J7P A;  2CCM A;  2JRF A;  4ORC B;  3SG5 A;  4MEW A;  1SYM A;  4USL A;  2ZKM X;  4DRW A;  1F70 A;  2K2F A;  1WRL A;  3QRX A;  3CWG A;  1E8A A;  3JTD B;  3D10 A;  1UHJ A;  1NWD A;  5CSF A;  1C7V A;  2LV7 A;  1CKK A;  1YUU A;  2PRU A;  4P2Y B;  1ALW A;  1MUX A;  1V1F A;  1B8R A;  1L7Z A;  2LLT A;  4AOM A;  1K9U A;  3KF9 A;  2BE4 A;  3ICB A;  1XFV O;  3D0Y B;  3KPX A;  1L2O B;  1JWD A;  2OS8 C;  2CXJ A;  2Q4U A;  4YGD B;  1IJ5 A;  3A4U B;  5I8N A;  3EVU A;  4I5J A;  5AAN A;  4XYN A;  4QJ3 B;  1XVJ A;  3EKJ A;  3LK1 A;  1JFK A;  3I5F C;  1CMG A;  2AAO A;  2BKI B;  2JT8 A;  1OZS A;  1BOC A;  1NIW A;  1KFX L;  1SW8 A;  2BCA A;  4CLN A;  1M45 A;  4MZK A;  1Y6W A;  5B8I B;  2WCF A;  2MLF C;  3CR2 A;  2JOJ A;  1QX7 A;  1KK8 C;  2KYF A;  3GOF A;  3PLF B;  2KAV A;  1IH0 A;  2EGD A;  2KYC A;  1JSA A;  2M1U A;  1KWO B;  4XJK A;  1TNP A;  3IQO A;  1A29 A;  1J7R A;  4WRI A;  3I5G B;  5DKQ A;  4CFR A;  1XFX O;  1MQ1 A;  2KDH A;  2PAS A;  1CFC A;  1JF2 A;  1DJY A;  5HKY A;  1N65 A;  2QPT A;  3BUN B;  3KHE A;  2LVI A;  1A2X A;  2LC5 A;  2QAC A;  1U5I A;  2LUX A;  2NXQ A;  4GGF A;  2K7D A;  2I94 A;  2FCD A;  1WY9 A;  2WCB A;  1NUB A;  1KQV A;  2I7A A;  1PRW A;  1QVI Z;  3HCM A;  3HX4 A;  4DIR A;  4C0J A;  4C0L A;  2MA2 A;  2HET A;  1ZAC A;  2ZN8 A;  1IWQ A;  1KCY A;  4NDC A;  5BPJ A;  3NSK A;  4A4B A;  1FI6 A;  1B4C A;  1GJY A;  1J1E A;  2HPS A;  1SCM B;  2PSR A;  1XO5 A;  2BCB A;  2KAY A;  2M9G A;  1QTX A;  2WCE A;  2H61 C;  3AAK A;  1J55 A;  3SJS A;  4ZCV A;  1BF5 A;  3EK8 A;  1YRU B;  1DJH A;  1WRZ A;  2K7B A;  2FCE A;  1GGZ A;  2K7C A;  1EG3 A;  1W7I B;  1DMO A;  1PSR A;  1JFJ A;  1H8B A;  4ETO A;  2KHN A;  3IQQ A;  2MHH A;  1K94 A;  2HQ8 A;  1SCV A;  2KAX A;  1YUS A;  3O4Y A;  1QS7 A;  3VRO A;  1MHO A;  4PHM A;  3NSI A;  2KSP A;  2NCO A;  1TTX A;  2WOR A;  3I5F B;  3NSL A;  2OPO A;  3DVK A;  2H2K A;  3RM1 A;  1YVH A;  3OB2 B;  1OE9 B;  1DJW A;  1Q80 A;  3F45 A;  3BUO B;  1J7Q A;  3JVT B;  2LHL A;  3BYA A;  1QAS A;  1ZUZ A;  1OOJ A;  1DGU A;  2KQ6 A;  1K95 A;  3TDZ A;  1DJZ A;  1NSH A;  2LMU A;  2JNF A;  2KI4 B;  1WDC C;  4MRX A;  3I5I C;  2JC2 A;  1CDM A;  1SR6 C;  2O60 A;  2K61 A;  3DD4 A;  1KWO C;  1KK7 Y;  4YRU A;  4PHJ A;  4XJK B;  2KBM A;  5D69 A;  1EXR A;  2Y1N A;  1CLL A;  1YTZ C;  3I5H C;  1CFF A;  1DJX A;  2EC6 B;  5HKZ A;  2L4H A;  1LA0 A;  3EVR A;  4NQG A;  1A03 A;  1UWO A;  2LAP A;  1BR4 B;  1S5G Z;  3EK4 A;  5ER5 A;  2LMV A;  1S6C A;  3WNX B;  4N5X A;  1S36 A;  3DVJ A;  1QX2 A;  1CLB A;  4GGF C;  3DVM A;  4DS7 A;  2L50 A;  2COL B;  2K7O A;  2FOT A;  2HF5 A;  2KOT A;  2JXL A;  3C1V A;  2K8M B;  2RGI A;  1NP8 A;  1AHR A;  1AJ5 A;  1SR6 B;  2JXC A;  2WOS A;  3SG2 A;  4JWQ A;  4PDZ A;  1TNW A;  1EG4 A;  1BMO A;  2AMI A;  2SCP A;  4PHK A;  1S3P A;  1IQ3 A;  2KNE A;  2M29 A;  3O78 A;  4GPL B;  3SIA A;  1NX2 A;  4CFQ A;  1EL4 A;  1K93 D;  1F4O A;  4PE1 A;  3IF7 A;  4IL1 A;  2LP3 A;  4FQO A;  2F3Z A;  1JC2 A;  2JTT A;  1QV1 A;  4CPV A;  3PAT A;  1IJ6 A;  2I18 A;  4HSZ A;  4CID A;  3BXK A;  4GNK B;  3MSE B;  1IRJ A;  4C0K A;  1H4B A;  1KSO A;  1J1D A;  2JZI A;  1QV0 A;  1CTR A;  3CR4 X;  1DGV A;  2F2P A;  1PVA A;  1AVS A;  5KU1 A;  1C7W A;  4ORA B;  1IKU A;  1QAT A;  2MRD A;  1GGW A;  1BT6 A;  2I2R E;  3PAL A;  5PAL A;  2LVJ A;  1TIZ A;  2LVV A;  1Y1U A;  2DOQ A;  1LIN A;  2LMT A;  2MJW B;  2OTG C;  2JWW A;  5HLO A;  2BKH B;  1N2D A;  4NDD A;  2BL0 B;  3LL8 B;  4N1G A;  3RLZ A;  5AXI A;  1S26 D;  2AUC A;  3WHU B;  1KK7 Z;  1SY9 A;  1TOP A;  1SL7 A;  3TZ1 A;  3DF0 B;  1G4Y R;  3DF0 A;  1G8I A;  2PVB A;  1PAL A;  3BQ3 A;  1N0Y A;  4YBH B;  1NYA A;  2L4I A;  4YI8 A;  1WLZ A;  4P5O E;  1XFU O;  1BLQ A;  4QJ4 B;  1SL9 A;  3VRQ A;  1K9K A;  1QJT A;  4ICB A;  1IQ5 A;  1TCF A;  3PN7 B;  2BBM A;  4UPG A;  3SIB A;  1FPW A;  2P6B B;  4GBA A;  2KI6 D;  4MN0 A;  4MZL A;  1C07 A;  4YI9 A;  2GGM A;  4R1E A;  1SKT A;  1ODB A;  2M1K B;  3BOW A;  2JTZ A;  5AFP A;  1PSB A;  1NX3 A;  1JUO A;  1RWY A;  1SCM C;  3D0Y A;  3AKA A;  3TDI A;  3FWC A;  2MLE C;  1BU3 A;  1M39 A;  4YGE B;  4PHN A;  1REC A;  1JF0 A;  4JQ0 D;  4YGC B;  1XFZ O;  1KFX S;  5DKR A;  1KSM A;  1AUI B;  2JQ6 A;  2M3W A;  3NXA A;  1ZFS A;  2ZRS A;  2O5G A;  4Q04 A;  2LUC A;  1AJ4 A;  1FW4 A;  2SAS A;  1B8C A;  5TNC A;  3LK0 A;  5HYD A;  1OMR A;  3KO0 A;  2KFH A;  1EJ3 A;  1MR8 A;  3ZWH A;  1G33 A;  1Y0V H;  4YGA A;  4DCK A;  1WRK A;  2LLU A;  4E68 A;  2L0P A;  1PVB A;  2KGR A;  1TNX A;  2JT0 A;  1CDP A;  2PAL A;  5I2L A;  2M97 A;  3I5G C;  2V53 A;  1QVI Y;  2D8N A;  5J3X A;  1F55 A;  1WLM A;  2NZ0 A;  4BY4 A;  1OMD A;  1B7T Z;  1SBJ A;  3CS1 A;  1S1E A;  1B47 A;  3CR5 X;  3VRN A;  3VRR A;  4F0Z B;  5G08 A;  1NX1 A;  2BBN A;  3SG3 A;  2Y1M A;  5F6T A;  2F3Y A;  2LHI A;  4AQJ A;  1MWN A;  3GK1 A;  2GV5 A;  1D1O A;  3K21 A;  1R2U A;  1UHN A;  1J7O A;  1DJI A;  1TCO B;  3EKH A;  4GFT A;  1Y1X A;  1ZMZ A;  1RFJ A;  1XK4 A;  1YUT A;  1RTP 1;  1FF1 A;  1ALV A;  4OR9 B;  3BUM B;  2L2E A;  4DUQ A;  1UHK A;  4PE0 A;  2JUL A;  5AEQ A;  2BCX A;  2Y5I A;  1CM4 A;  1K8U A;  2EHB A;  2KGB C;  2LCP A;  1M63 B;  2ZNE A;  2FJU B;  3AKB A;  1NCX A;  1QLS A;  3FS7 A;  1KFU S;  1VRK A;  2A4J A;  2ZFD A;  3O2P A;  3AAJ A;  5KSZ A;  1B1G A;  1FI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...