3FWBA

Sac3:sus1:cdc31 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
153
structure length
153
Chain Sequence
QSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 31
publication title Sus1, Cdc31, and the Sac3 CID region form a conserved interaction platform that promotes nuclear pore association and mRNA export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle, transcription
total genus 52
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3fwbA01
1C7WA 3DVJA 2M1UA 5I8NA 5IBWA 3PSRA 1K2HA 1QIVA 3LL8B 1SPYA 1S6JA 2JTZA 1A29A 1N0YA 2K61A 4I5LB 1NWDA 1G8IA 1EG3A 1AVSA 2F2PA 2LANA 3DVKA 1B9AA 3TUYC 4PE1A 2KBMA 2H61A 1DT7B 1B8CA 3A4UB 2MA2A 1TCFA 1PRWA 1PSBA 1UURA 4I5KA 1FI6A 2LVKA 1PSRA 1SCVA 1DTLA 2CNPA 2M7NA 4PHJA 1G33A 1UUSA 1A75A 2MLEC 3GK2A 1UHIA 1JC2A 2KI4B 2KDHA 1YX7A 2G2BA 2M49B 1F4OA 2L50A 2NXQA 2L51A 1J7QA 1DJIA 2DOQA 2PRUA 3OX6A 4MRXA 1JBAA 2KQ6A 3TS5C 1QX7A 1KSOA 4ZCUA 2M97A 1EL4A 4GFTA 5AFPA 4ORAB 1JWDA 1WLZA 1WY9A 5AANA 4QJ4B 1XO5A 3BQ3A 3NSLA 2K8MB 1CFFA 1QLKA 3LK0A 2CT9A 3WHUB 2LV7A 4Q04A 4E68A 1SMGA 3BOWA 2H2KA 1YURA 1YR5A 2KHNA 1QS7A 3CZTX 4YGCB 4JWQA 2F3ZA 1H8BA 2PMYA 2O5GA 4CIDA 2RGIA 4YGAA 1RECA 1K9UA 3EVVA 4A4BA 1QATA 2KGBC 1B8LA 1SL7A 4C0KA 1PVAA 5CSIA 4YI9A 5KSZA 2K7CA 4GAOA 2PSRA 1YX8A 1BR4B 1QX5B 1CFCA 2M29A 2OPOA 2ZN8A 1DJYA 1TTXA 4DCKA 1M46A 1S5GZ 1G4YR 4IL1A 1YRTB 1CLLA 3ZWHA 4PE4A 1BMOA 1DF0B 2KI6D 4N5XA 4HRGA 1F71A 2BCBA 2QACA 2M7LA 4FTGA 2LAPA 3ICBA 2NCOA 3PFVA 4OR9B 4GBAA 1IQ5A 1J1EA 3I5GB 1N65A 1AUIB 1SR6C 4PALA 3I5HB 1W7IB 2JWWA 4MLWA 1WRZA 1IWQA 4I5NB 1BOCA 2GGZA 3PALA 4U8DA 1S3PA 2K0JA 3I5FB 1Y0VH 5CSJA 2KOTA 1W7JB 2JOJA 1U5IB 2JRFA 2WCFA 1QV1A 3DD4A 1EJ3A 1FBVA 3CLNA 1K95A 1IJ6A 1CLMA 1NX3A 2I2RE 4QJ3B 5DKRA 3NSKA 1B7TZ 2LUCA 1IH0A 2LMVA 3OP0A 4USLA 3SIAA 4YI8A 1ZMZA 5B8IB 1DJWA 1XFZO 5PALA 2KI4C 3PM8A 3OB1B 1L2OC 2LUXA 4CFRA 1LINA 2Y1NA 4F0ZB 5G08A 2KFHA 3PN7B 1QIWA 1SCMB 2LCPA 5HKWA 2KFGA 4AOMA 1AHRA 1B47A 3D0YB 1M45A 1FW4A 2G9BA 3IQOA 1BJFA 2FJUB 4NQGA 1JFKA 1S36A 2ZKMX 3BUOB 1V1FA 1A03A 4HSZA 4N1GA 5HKYA 4C0LA 2JXLA 2LHIA 2K7OA 1F4QA 1CDPA 1NCYA 1IQ3A 2K2FA 1QLSA 2M1KB 1OMDA 2BKHB 3MSEB 2LE9B 2LVJA 1HT9A 3F45A 1TN4A 4HREE 3I5IB 1QVIZ 1Q80A 5I2QA 1NCZA 4JPZB 2JPTA 4CPVA 3FIAA 1Y6WA 4BY5A 5ER4X 1SRAA 2LLUA 2MHHA 1BR1B 1MHOA 3GK1A 2MRDA 1KFUS 1SKTA 4GGFC 1SY9A 1J1DA 1TNPA 2F8PA 1A75B 4GNKB 3LLEA 1DMOA 3CR5X 3I5GC 1PALA 3CR4X 3I5HC 2PASA 1YUUA 1MUXA 2F3YA 4CLNA 2ZFDA 2ZN9A 3TDZA 1K8UA 1TCOB 4M2PA 3VRQA 1XFYO 4QJ5B 1TNQA 1L2OB 5F6TA 1CMGA 2Q91A 3O2PA 3I5FC 4PCWA 2OTGB 1NUBA 2F33A 2PVBA 4WQ3A 2COLB 1B4CA 1ZACA 1S5GY 3BOWB 3NXAA 1WRKA 1XFWO 1ZOTB 1KCYA 1ALWA 4C0JA 2JTTA 3FWCA 1Y1AA 3VROA 4JQ0D 1OSAA 2KYFA 1QXPA 4ICBA 1IG5A 1N2DA 2L4IA 1UHHA 4YRUA 1C07A 3KPXA 4YBHB 1OOJA 1SCMC 1UHKA 2WOSA 1YVLA 3PN7C 1CFDA 3QRXA 4P2YB 1CB1A 1DVIA 2O60A 1DGUA 1MR8A 1DJGA 2ZNDA 2HETA 3OHMB 1ZFSA 2FCEA 5HLVA 2D8NA 4MRYA 3LCPC 2SASA 3TZ1A 2OS8B 2K2AA 2JU0A 3KHEA 1CDMA 4MZLA 4YGBB 1F54A 2CCMA 2EGDA 2JULA 1M31A 2E6WA 1RJVA 1M39A 1CDLA 1SL9A 2Q4UA 3O78A 5DKQA 2BL0B 2LVVA 1BT6A 3SIBA 2M3WA 1GJYA 3CWGA 1BG1A 1JUOA 1IRJA 2M8UA 3O6BA 1AJ5A 1KK8B 2NZ0A 3I5IC 1SYMA 1EG4A 5J3XA 2MJWB 1XA5A 5K89A 3EVUA 1J7OA 2M9GA 1AP4A 2L2EA 1K96A 3DF0B 1WLMA 2A4JA 4HRHA 1SNLA 1QTXA 1R2UA 2KAXA 1KK7Y 5BPJA 1MXLC 1BF5A 2MLFC 3BUXB 5TNCA 1UP5A 1CDNA 1DF0A 1EXRA 1KSMA 2JC2A 1B8RA 2BE4A 1RTP1 3JVTB 2MBXA 2CBLA 3BYAA 2NCPA 1KQVA 2LP3A 3A8RA 4I5JA 1KFXS 4WRIA 1RROA 1FI5A 5D69A 2GGMA 1K94A 4OKHA 2BKIB 4MZKA 4ORBB 2OTGC 1QVIY 5ER5A 1K9KA 3SG4A 1YUSA 4PHNA 3EKJA 1RK9A 5HLOA 3TDIA 3DVMA 2LLTA 1S26D 1AK8A 2ZNEA 1J55A 1QV0A 2AAOA 1QJTA 1DJZA 4YGEB 1KWOB 3K21A 2WORA 5DKNA 1BODA 1F70A 4DRWA 1PK0D 4MBEA 1K93D 3E3RA 1A4PA 4PHKA 2L5XB 2Y5IA 2I18A 2K7BA 3JTDB 2L4HA 1TRFA 1KQMB 1XYDA 3DVEA 5HKZA 1CM1A 1IGVA 3NSIA 2KAYA 3VRNA 2OS8C 3BUWB 1S1EA 4MVFA 2BBNA 3ZNIA 3KF9A 3WNXB 2JT3A 3CS1A 1CM4A 2BL0C 2HF5A 3EVRA 1NX2A 1OMRA 5CSFA 1JFJA 5I2LA 1ODBA 2KQYA 3SG7A 1KK8C 4XJKA 2L98A 1PULA 1CLBA 3AAKA 1D1OA 3OX5A 2F2OA 2LLSA 3CTNA 4PE0A 1LXFC 1OQPA 1Y1XA 3FS7A 5AXIA 1M63B 5I2OA 1SBJA 2EHBA 2JNXA 1WDCC 1J7PA 2HQ8A 2LMTA 3VRPA 1ALVA 2FOTA 1LKJA 2KFFA 1V1GA 1FF1A 1NX1A 2B1UA 2ISDA 2QPTA 3JVTC 3RLZA 2M0RA 1DJHA 4M2OA 2BBMA 2HQWA 3WXAA 4GUKA 2KNEA 3WHTB 2JQ6A 2CTNA 3PATA 5CPVA 1XK4C 3H4SE 2GV5A 4D1EA 5KU1A 1H4BA 1QASA 2CXJA 2JNFA 2LMUA 3BXKA 1DJXA 4DUQA 2LVIA 3TDUA 1CNPA 4P5OE 1RWYA 2ZRTA 4MN0A 2ZRSA 4A4CA 3AAJA 4OCIA 1CFPA 4OV2A 1S6CA 1ZUZA 2SCPA 4YGDB 1XFUO 2KAVA 1AJ4A 4L9MA 1TOPA 3PLFB 1MWNA 4GPLB 1WRLA 2WC8A 1KWOC 4PDZA 2KGRA 2BCXA 2V53A 2KBIA 3SJSA 4AQJA 3IQQA 2JXCA 3C1VA 2WNDA 1B7TY 1LA3A 1E8AA 1BU3A 2K7DA 2LM5A 2LP2A 3GOFA 4MEWA 4TNCA 1CKKA 3D10A 1F8HA 1VRKA 3JTDC 2KYCA 5CSNA 1KQMC 1TNWA 2IS9A 3AKBA 3IF7A 5HYDA 4PHMA 3EK4A 1YTZC 2NLNA 3HCMA 1NCXA 3SG2A 1S6IA 2H61C 3NSOA 1LA0A 4NDBA 3SG5A 1OZSA 1KFXL 1WDCB 1OZOA 4DIRA 3AKAA 3EK7A 5AERA 1NIWA 1NP8A 2JT8A 1B1GA 3SG6A 3HX4A 4BY4A 3BUNB 1Y1UA 2Y4QA 1NX0A 2WCBA 1XFXO 2Y1MA 3VRRA 3TUYB 2P6BB 1YVHA 2AUCA 2EC6C 3CGAA 4ETOA 1PVBA 4NDCA 3O4YA 2PALA 3VGOA 4CFQA 5JOLA 4GGFA 1MF8B 1X02A 4ZCVA 2TN4A 3RM1A 4FQOA 1OE9B 1DGVA 2BE6A 2VRGA 2JZIA 1J7RA 1A2XA 1JF0A 2MAZA 1RFJA 3DF0A 3LK1A 1IKUA 5FYXA 2I94A 4GGNA 1UWOA 5GQQC 3TS5B 1EH2A 1JF2A 1IJ5A 1YUTA 3M0WA 1TIZA 1K9PA 2AMIA 4MZJA 3KO0A 1UHNA 2LC5A 3KEVA 3SG3A 1SL8A 1L7ZA 1U5IA 3OB2B 2R2IA 1C7VA 3EKHA 5KTYA 4XYNA 2JT0A 3FWBA 4ORCB 1NSHA 4R1EA 1F55A 1GGWA 1K90D 1GGZA 1SW8A 2BCAA 5JJGA 1NPQA 2I7AA 2LHLA 4OVNF 3EK8A 1JSAA 3CR2A 4MSPA 4UPGA 1BLQA 1KFUL 1KK7Z 3GK4X 4AQIA 4DS7A 4WQ2A 1SK6D 1HQVA 1UHJA 1XK4A 2HPSA 1QX2A 1NYAA 2KI6C 5D7FA 3BUMB 3D0YA 1R6PA 1XVJA 2WCEA 4NDDA 1FPWA 1MXEA 2BECA 1CTRA 1XFVO 4XJKB 1CMFA 2KSPA 2E30A 1OMVA 1LVCD 4N1FA 1GQMA 4M2QA 5AEQA 2LNKA 2FCDA 1YRUB 2EC6B 4PE7A 1MQ1A 1SR6B 1TNXA 2L0PA
chains in the Genus database with same CATH superfamily
1C7WA 2P70A 3DVJA 2M1UA 5I8NA 5IBWA 3PSRA 1K2HA 1QIVA 3LL8B 1SPYA 2QEVA 1S6JA 2JTZA 1A29A 1N0YA 2K61A 4I5LB 1NWDA 1G8IA 1EG3A 1AVSA 2F2PA 2LANA 3DVKA 1B9AA 3TUYC 4PE1A 2KBMA 2H61A 1DT7B 1B8CA 3A4UB 2MA2A 1TCFA 1PRWA 1PSBA 1UURA 4I5KA 1FI6A 3OBVA 2LVKA 1PSRA 1OOFA 1SCVA 1DTLA 1TWOA 2KPHA 2CNPA 2M7NA 3B7AA 2PQLA 3R1VA 4PHJA 1G33A 1UUSA 1A75A 2MLEC 3CABA 1UHIA 3EG5B 2KI4B 3GK2A 1JC2A 2KDHA 1YX7A 2G2BA 2M49B 1F4OA 2L50A 2NXQA 2L51A 1J7QA 1DJIA 2DOQA 2PRUA 3OX6A 3R72A 4MRXA 1JBAA 2KQ6A 3TS5C 2WCLA 1QX7A 1KSOA 4ZCUA 2M97A 1EL4A 4GFTA 5AFPA 3BFAA 4KYNA 1DQEA 1WLZA 1WY9A 4ORAB 5AANA 4QJ4B 1XO5A 1JWDA 3BQ3A 3D77A 3NSLA 2K8MB 1CFFA 1QLKA 3LK0A 1TUZA 2CT9A 3WHUB 2LV7A 4Q04A 4E68A 2GTEA 3BFHA 1SMGA 3BOWA 3R1OA 2H2KA 1YURA 1YR5A 2KHNA 1QS7A 2WCHA 3CZTX 4JWQA 4YGCB 2F3ZA 3L47A 1H8BA 3D75A 2PMYA 2O5GA 4CIDA 2RGIA 4YGAA 1RECA 1K9UA 3EVVA 4A4BA 1QATA 2QEHA 2KGBC 1B8LA 1SL7A 2WC5A 4C0KA 1PVAA 5CSIA 4YI9A 5DICA 5KSZA 2K7CA 4GAOA 2PSRA 3PJIA 1YX8A 1BR4B 1QX5B 1CFCA 2M29A 2OPOA 2ZN8A 1DJYA 1TTXA 4DCKA 1M46A 1S5GZ 1G4YR 4IL1A 1YRTB 1CLLA 3ZWHA 4PE4A 1BMOA 1DF0B 2KI6D 2WCJA 4N5XA 4HRGA 1F71A 2BCBA 2QACA 2M7LA 3BJHA 4FTGA 2LAPA 3ICBA 2NCOA 3PFVA 4OR9B 4GBAA 1IQ5A 1J1EA 3I5GB 1N65A 1AUIB 1SR6C 3CZ0A 3DZTA 4PALA 3I5HB 1W7IB 2JWWA 4MLWA 3FE9A 1WRZA 1IWQA 4I5NB 1BOCA 2GGZA 3K1EA 3PALA 4U8DA 1S3PA 2K0JA 2L2CA 3I5FB 1Y0VH 5CSJA 2KOTA 1W7JB 2JOJA 1U5IB 2JRFA 2WCFA 1QV1A 3DD4A 1EJ3A 1FBVA 3CLNA 3CZ2A 1K95A 1IJ6A 1CLMA 1NX3A 3DY9A 2I2RE 4QJ3B 5DKRA 3NSKA 1B7TZ 2LUCA 3UNWA 1IH0A 2LMVA 3OP0A 2YGUA 4USLA 4YI8A 3SIAA 1ZMZA 5B8IB 1ORGA 1DJWA 1XFZO 5PALA 2KI4C 3PM8A 3OB1B 1L2OC 2LUXA 4CFRA 1LINA 2Y1NA 3NHIA 3QMEA 4F0ZB 5G08A 2KFHA 3PN7B 1QIWA 1SCMB 2LCPA 1OW4A 2KFGA 5HKWA 1AHRA 4AOMA 1B47A 3D0YB 1M45A 1FW4A 2G9BA 3IQOA 1BJFA 3D73A 5FI2A 2FJUB 4NQGA 1JFKA 1S36A 2ZKMX 3BUOB 1V1FA 1A03A 4INXA 3PM2A 4HSZA 4N1GA 3B88A 5HKYA 4C0LA 2JXLA 2LHIA 2K7OA 1F4QA 1CDPA 1NCYA 1IQ3A 3S0GA 3RZSA 2K2FA 1QLSA 2M1KB 1OMDA 2BKHB 3MSEB 2LE9B 3FE6A 2LVJA 1HT9A 3F45A 1TN4A 4HREE 3I5IB 1QVIZ 1Q80A 5I2QA 1NCZA 4JPZB 2JPTA 4CPVA 3FIAA 1Y6WA 4BY5A 5ER4X 1SRAA 2LLUA 2MHHA 1BR1B 3S0BA 1TUJA 1MHOA 3GK1A 2MRDA 1KFUS 1SKTA 4GGFC 1SY9A 1J1DA 1TNPA 2F8PA 3FE8A 1A75B 4GNKB 3LLEA 1DMOA 3CR5X 3I5GC 1PALA 2QEBA 3CR4X 3I5HC 2PASA 1LS8A 1MUXA 1YUUA 2F3YA 2ZFDA 4CLNA 2ZN9A 3TDZA 4PT1A 1K8UA 1TCOB 4M2PA 3VRQA 1XFYO 4QJ5B 1TNQA 1L2OB 2BNXA 5F6TA 1W9ZA 1CMGA 1GM0A 2Q91A 3O2PA 4JD9A 3I5FC 4PCWA 2OTGB 3N7HA 1Z2CB 1NUBA 2F33A 2PVBA 4WQ3A 2COLB 1B4CA 1ZACA 1S5GY 3BOWB 3NXAA 3S0DA 1WRKA 1XFWO 1ZOTB 1KCYA 1ALWA 4C0JA 2JTTA 2WCKA 1Z4HA 3FWCA 1Y1AA 3V2LA 3VROA 4JQ0D 1OSAA 2KYFA 3S0AA 1QXPA 4ICBA 1IG5A 1N2DA 2L4IA 1UHHA 1C3ZA 4YRUA 1C07A 3KPXA 4YBHB 1OOJA 1SCMC 1UHKA 2WOSA 1YVLA 3PN7C 1CFDA 3QRXA 4P2YB 1CB1A 1DVIA 2O60A 1DGUA 1MR8A 1DJGA 2ZNDA 2HETA 3OHMB 2PYQA 4FQTA 1ZFSA 2FCEA 5HLVA 2D8NA 4MRYA 3LCPC 2SASA 3TZ1A 5I94A 2OS8B 2K2AA 2KLEA 2JU0A 3KHEA 1CDMA 4MZLA 4YGBB 1F54A 2CCMA 2EGDA 2JULA 1M31A 2E6WA 3CZ1A 1RJVA 1M39A 1CDLA 1SL9A 2Q4UA 3O78A 5DKQA 2BL0B 2LVVA 1BT6A 3SIBA 2M3WA 1GJYA 3CWGA 1BG1A 1JUOA 1IRJA 1DEKA 2M8UA 3O6BA 1AJ5A 1KK8B 2NZ0A 3I5IC 1SYMA 1EG4A 5J3XA 2MJWB 1XA5A 5K89A 3EVUA 1J7OA 2M9GA 1AP4A 2L2EA 1K96A 3DF0B 1WLMA 2A4JA 4HRHA 1SNLA 1QTXA 1R2UA 2KAXA 1KK7Y 3NGVA 5BPJA 1MXLC 1BF5A 2MLFC 5D3OA 3DYEA 3BUXB 3UO9A 5TNCA 1UP5A 1CDNA 1DF0A 1EXRA 1KSMA 2JC2A 1B8RA 2BE4A 1RTP1 3JVTB 2MBXA 2CBLA 3BYAA 1IIOA 2NCPA 1KQVA 2LP3A 3A8RA 4I5JA 1KFXS 4WRIA 3B6XA 1RROA 1FI5A 5D69A 2GGMA 1K94A 4OKHA 2BKIB 4MZKA 4ORBB 2OTGC 1QVIY 5ER5A 1K9KA 5HL1A 3SG4A 2ERBA 1YUSA 4PHNA 3EKJA 1RK9A 5HLOA 3TDIA 3DVMA 3D76A 2LLTA 1OOIX 1S26D 1AK8A 2ZNEA 1J55A 4OZDA 1QV0A 2AAOA 1P28A 1QJTA 1DJZA 4YGEB 1KWOB 3K21A 2WORA 5DKNA 1BODA 1F70A 4DRWA 1PK0D 4MBEA 1K93D 3E3RA 1A4PA 4PHKA 2L5YA 2L5XB 2Y5IA 2I18A 2K7BA 3JTDB 2P71A 2L4HA 1TRFA 1KQMB 1XYDA 3DVEA 5HKZA 1CM1A 1IGVA 3NSIA 2KAYA 3VRNA 2OS8C 3BUWB 1S1EA 2JPOA 4MVFA 3DXLA 2BBNA 3ZNIA 2K60A 3KF9A 2JT3A 3WNXB 1OOGA 3CS1A 1CM4A 2BL0C 2HF5A 3EVRA 1NX2A 1OMRA 5CSFA 1JFJA 5I2LA 1ODBA 2KQYA 3SG7A 1DELA 1KK8C 1OOHA 1PULA 2L98A 3NHTA 4XJKA 1CLBA 3AAKA 1D1OA 3OX5A 4JKTA 2F2OA 2LLSA 3CTNA 4PE0A 1LXFC 1OQPA 1Y1XA 3FS7A 5AXIA 1M63B 5I2OA 1SBJA 2EHBA 2JNXA 1T14A 1WDCC 1J7PA 1XFRA 2QEOA 3OGNA 2HQ8A 1SSEB 2LMTA 3VRPA 1ALVA 2FOTA 2KLDA 1LKJA 3D74A 2KFFA 1V1GA 1FF1A 1NX1A 3R1PA 2B1UA 3D78A 3IVTA 2ISDA 2QPTA 2FJYA 3JVTC 3RLZA 2M0RA 1DJHA 4M2OA 2BBMA 2HQWA 3WXAA 4GUKA 2KNEA 3WHTB 2JQ6A 2CTNA 3PATA 5CPVA 1XK4C 3H4SE 2GV5A 4D1EA 5KU1A 1H4BA 1QASA 2CXJA 2JNFA 2LMUA 3BXKA 1DJXA 4DUQA 2LVIA 3TDUA 1CNPA 3SS5A 4P5OE 5FI7A 1RWYA 2ZRTA 4IJ7A 4MN0A 2ZRSA 4A4CA 3AAJA 4OCIA 1CFPA 3S0EA 4OV2A 1S6CA 1ZUZA 2SCPA 4F7FA 3VB1A 1QWVA 4YGDB 1XFUO 2KAVA 1AJ4A 4L9MA 1TOPA 3PLFB 1MWNA 3B87A 1WRLA 4GPLB 2WC8A 2WC6A 1KWOC 4PDZA 2KGRA 2BCXA 2V53A 2KBIA 3SJSA 4AQJA 3IQQA 2JXCA 3C1VA 2WNDA 1B7TY 1LA3A 1E8AA 1BU3A 2K7DA 2LM5A 2LP2A 3GOFA 4MEWA 4TNCA 1CKKA 3D10A 1F8HA 1VRKA 3JTDC 2KYCA 5CSNA 1KQMC 1TNWA 2IS9A 3AKBA 3IF7A 5HYDA 5EL2A 4PHMA 3EK4A 1YTZC 2NLNA 3CYZA 1NCXA 3HCMA 3SG2A 1S6IA 2H61C 3NSOA 1LA0A 4NDBA 3SG5A 1OZSA 1KFXL 1WDCB 1OZOA 4DIRA 3AKAA 3EK7A 5AERA 1NIWA 1NP8A 2JT8A 1B1GA 3SG6A 3HX4A 4BY4A 2BAPA 3BUNB 1Y1UA 2Y4QA 1NX0A 2WCBA 4INWA 1XFXO 2Y1MA 3VRRA 3TUYB 2P6BB 1YVHA 2AUCA 2EC6C 3CGAA 4ETOA 1PVBA 4NDCA 3O4YA 2PALA 3VGOA 4CFQA 5JOLA 4GGFA 2WCMA 1MF8B 1X02A 4ZCVA 2TN4A 3RM1A 4FQOA 1OE9B 1DGVA 2BE6A 2VRGA 3Q8IA 2JZIA 3S0FA 1J7RA 1A2XA 1JF0A 2MAZA 1RFJA 3DF0A 3LK1A 1IKUA 3B86A 2I94A 4GGNA 1UWOA 5FYXA 5GQQC 3TS5B 1JF2A 1EH2A 1IJ5A 1YUTA 3M0WA 1TIZA 1K9PA 2AMIA 4MZJA 3KO0A 1UHNA 2LC5A 3KEVA 3SG3A 1SL8A 1L7ZA 1U5IA 3OB2B 2R2IA 1C7VA 3EKHA 5KTYA 4XYNA 2JT0A 3L4AA 3FWBA 4ORCB 1NSHA 4R1EA 3SS4A 1F55A 1GGWA 1K90D 3O4XA 1GGZA 1SW8A 2BCAA 5JJGA 1NPQA 2I7AA 2LHLA 4OVNF 3EK8A 1JSAA 3CR2A 4MSPA 4UPGA 1BLQA 1KFUL 1KK7Z 3GK4X 3L4LA 4AQIA 4WQ2A 4DS7A 1SK6D 1HQVA 3SS3A 1UHJA 1XK4A 1DC1A 2HPSA 1QX2A 1NYAA 2KI6C 5D7FA 5FI6A 3BUMB 3CDNA 1R6PA 1XVJA 2WCEA 3D0YA 4NDDA 1MXEA 1FPWA 2BECA 1CTRA 3BFBA 1XFVO 4XJKB 1CMFA 2KSPA 2E30A 1OMVA 1LVCD 4N1FA 1GQMA 2H8VA 4M2QA 5AEQA 2LNKA 2FCDA 1YRUB 2EC6B 2QDIA 1C3YA 4PE7A 1MQ1A 1SR6B 1TNXA 2L0PA
chains in the Genus database with same CATH topology
1C7WA 3DVJA 2M1UA 5I8NA 5IBWA 3PSRA 1K2HA 1QIVA 3LL8B 1SPYA 1S6JA 2JTZA 1A29A 1N0YA 2K61A 4I5LB 1NWDA 1G8IA 1EG3A 1AVSA 2F2PA 2LANA 3DVKA 1B9AA 3TUYC 4PE1A 2KBMA 2H61A 1DT7B 1B8CA 3A4UB 2MA2A 1TCFA 1PRWA 1PSBA 1UURA 4I5KA 1FI6A 2LVKA 1PSRA 1SCVA 1DTLA 2CNPA 2M7NA 4PHJA 1G33A 1UUSA 1A75A 2MLEC 3GK2A 1UHIA 1JC2A 2KI4B 2KDHA 1YX7A 2G2BA 2M49B 1F4OA 2L50A 2NXQA 2L51A 1J7QA 1DJIA 2DOQA 2PRUA 3OX6A 4MRXA 1JBAA 2KQ6A 3TS5C 1QX7A 1KSOA 4ZCUA 2M97A 1EL4A 4GFTA 5AFPA 4ORAB 1JWDA 1WLZA 1WY9A 5AANA 4QJ4B 1XO5A 3BQ3A 3NSLA 2K8MB 1CFFA 1QLKA 3LK0A 2CT9A 3WHUB 2LV7A 4Q04A 4E68A 1SMGA 3BOWA 2H2KA 1YURA 1YR5A 2KHNA 1QS7A 3CZTX 4YGCB 4JWQA 2F3ZA 1H8BA 2PMYA 2O5GA 4CIDA 2RGIA 4YGAA 1RECA 1K9UA 3EVVA 4A4BA 1QATA 2KGBC 1B8LA 1SL7A 4C0KA 1PVAA 5CSIA 4YI9A 5KSZA 2K7CA 4GAOA 2PSRA 1YX8A 1BR4B 1QX5B 1CFCA 2M29A 2OPOA 2ZN8A 1DJYA 1TTXA 4DCKA 1M46A 1S5GZ 1G4YR 4IL1A 1YRTB 1CLLA 3ZWHA 4PE4A 1BMOA 1DF0B 2KI6D 4N5XA 4HRGA 1F71A 2BCBA 2QACA 2M7LA 4FTGA 2LAPA 3ICBA 2NCOA 3PFVA 4OR9B 4GBAA 1IQ5A 1J1EA 3I5GB 1N65A 1AUIB 1SR6C 4PALA 3I5HB 1W7IB 2JWWA 4MLWA 1WRZA 1IWQA 4I5NB 1BOCA 2GGZA 3PALA 4U8DA 1S3PA 2K0JA 3I5FB 1Y0VH 5CSJA 2KOTA 1W7JB 2JOJA 1U5IB 2JRFA 2WCFA 1QV1A 3DD4A 1EJ3A 1FBVA 3CLNA 1K95A 1IJ6A 1CLMA 1NX3A 2I2RE 4QJ3B 5DKRA 3NSKA 1B7TZ 2LUCA 1IH0A 2LMVA 3OP0A 4USLA 3SIAA 4YI8A 1ZMZA 5B8IB 1DJWA 1XFZO 5PALA 2KI4C 3PM8A 3OB1B 1L2OC 2LUXA 4CFRA 1LINA 2Y1NA 4F0ZB 5G08A 2KFHA 3PN7B 1QIWA 1SCMB 2LCPA 5HKWA 2KFGA 4AOMA 1AHRA 1B47A 3D0YB 1M45A 1FW4A 2G9BA 3IQOA 1BJFA 2FJUB 4NQGA 1JFKA 1S36A 2ZKMX 3BUOB 1V1FA 1A03A 4HSZA 4N1GA 5HKYA 4C0LA 2JXLA 2LHIA 2K7OA 1F4QA 1CDPA 1NCYA 1IQ3A 2K2FA 1QLSA 2M1KB 1OMDA 2BKHB 3MSEB 2LE9B 2LVJA 1HT9A 3F45A 1TN4A 4HREE 3I5IB 1QVIZ 1Q80A 5I2QA 1NCZA 4JPZB 2JPTA 4CPVA 3FIAA 1Y6WA 4BY5A 5ER4X 1SRAA 2LLUA 2MHHA 1BR1B 1MHOA 3GK1A 2MRDA 1KFUS 1SKTA 4GGFC 1SY9A 1J1DA 1TNPA 2F8PA 1A75B 4GNKB 3LLEA 1DMOA 3CR5X 3I5GC 1PALA 3CR4X 3I5HC 2PASA 1YUUA 1MUXA 2F3YA 4CLNA 2ZFDA 2ZN9A 3TDZA 1K8UA 1TCOB 4M2PA 3VRQA 1XFYO 4QJ5B 1TNQA 1L2OB 5F6TA 1CMGA 2Q91A 3O2PA 3I5FC 4PCWA 2OTGB 1NUBA 2F33A 2PVBA 4WQ3A 2COLB 1B4CA 1ZACA 1S5GY 3BOWB 3NXAA 1WRKA 1XFWO 1ZOTB 1KCYA 1ALWA 4C0JA 2JTTA 3FWCA 1Y1AA 3VROA 4JQ0D 1OSAA 2KYFA 1QXPA 4ICBA 1IG5A 1N2DA 2L4IA 1UHHA 4YRUA 1C07A 3KPXA 4YBHB 1OOJA 1SCMC 1UHKA 2WOSA 1YVLA 3PN7C 1CFDA 3QRXA 4P2YB 1CB1A 1DVIA 2O60A 1DGUA 1MR8A 1DJGA 2ZNDA 2HETA 3OHMB 1ZFSA 2FCEA 5HLVA 2D8NA 4MRYA 3LCPC 2SASA 3TZ1A 2OS8B 2K2AA 2JU0A 3KHEA 1CDMA 4MZLA 4YGBB 1F54A 2CCMA 2EGDA 2JULA 1M31A 2E6WA 1RJVA 1M39A 1CDLA 1SL9A 2Q4UA 3O78A 5DKQA 2BL0B 2LVVA 1BT6A 3SIBA 2M3WA 1GJYA 3CWGA 1BG1A 1JUOA 1IRJA 2M8UA 3O6BA 1AJ5A 1KK8B 2NZ0A 3I5IC 1SYMA 1EG4A 5J3XA 2MJWB 1XA5A 5K89A 3EVUA 1J7OA 2M9GA 1AP4A 2L2EA 1K96A 3DF0B 1WLMA 2A4JA 4HRHA 1SNLA 1QTXA 1R2UA 2KAXA 1KK7Y 5BPJA 1MXLC 1BF5A 2MLFC 3BUXB 5TNCA 1UP5A 1CDNA 1DF0A 1EXRA 1KSMA 2JC2A 1B8RA 2BE4A 1RTP1 3JVTB 2MBXA 2CBLA 3BYAA 2NCPA 1KQVA 2LP3A 3A8RA 4I5JA 1KFXS 4WRIA 1RROA 1FI5A 5D69A 2GGMA 1K94A 4OKHA 2BKIB 4MZKA 4ORBB 2OTGC 1QVIY 5ER5A 1K9KA 3SG4A 1YUSA 4PHNA 3EKJA 1RK9A 5HLOA 3TDIA 3DVMA 2LLTA 1S26D 1AK8A 2ZNEA 1J55A 1QV0A 2AAOA 1QJTA 1DJZA 4YGEB 1KWOB 3K21A 2WORA 5DKNA 1BODA 1F70A 4DRWA 1PK0D 4MBEA 1K93D 3E3RA 1A4PA 4PHKA 2L5XB 2Y5IA 2I18A 2K7BA 3JTDB 2L4HA 1TRFA 1KQMB 1XYDA 3DVEA 5HKZA 1CM1A 1IGVA 3NSIA 2KAYA 3VRNA 2OS8C 3BUWB 1S1EA 4MVFA 2BBNA 3ZNIA 3KF9A 3WNXB 2JT3A 3CS1A 1CM4A 2BL0C 2HF5A 3EVRA 1NX2A 1OMRA 5CSFA 1JFJA 5I2LA 1ODBA 2KQYA 3SG7A 1KK8C 4XJKA 2L98A 1PULA 1CLBA 3AAKA 1D1OA 3OX5A 2F2OA 2LLSA 3CTNA 4PE0A 1LXFC 1OQPA 1Y1XA 3FS7A 5AXIA 1M63B 5I2OA 1SBJA 2EHBA 2JNXA 1WDCC 1J7PA 2HQ8A 2LMTA 3VRPA 1ALVA 2FOTA 1LKJA 2KFFA 1V1GA 1FF1A 1NX1A 2B1UA 2ISDA 2QPTA 3JVTC 3RLZA 2M0RA 1DJHA 4M2OA 2BBMA 2HQWA 3WXAA 4GUKA 2KNEA 3WHTB 2JQ6A 2CTNA 3PATA 5CPVA 1XK4C 3H4SE 2GV5A 4D1EA 5KU1A 1H4BA 1QASA 2CXJA 2JNFA 2LMUA 3BXKA 1DJXA 4DUQA 2LVIA 3TDUA 1CNPA 4P5OE 1RWYA 2ZRTA 4MN0A 2ZRSA 4A4CA 3AAJA 4OCIA 1CFPA 4OV2A 1S6CA 1ZUZA 2SCPA 4YGDB 1XFUO 2KAVA 1AJ4A 4L9MA 1TOPA 3PLFB 1MWNA 4GPLB 1WRLA 2WC8A 1KWOC 4PDZA 2KGRA 2BCXA 2V53A 2KBIA 3SJSA 4AQJA 3IQQA 2JXCA 3C1VA 2WNDA 1B7TY 1LA3A 1E8AA 1BU3A 2K7DA 2LM5A 2LP2A 3GOFA 4MEWA 4TNCA 1CKKA 3D10A 1F8HA 1VRKA 3JTDC 2KYCA 5CSNA 1KQMC 1TNWA 2IS9A 3AKBA 3IF7A 5HYDA 4PHMA 3EK4A 1YTZC 2NLNA 3HCMA 1NCXA 3SG2A 1S6IA 2H61C 3NSOA 1LA0A 4NDBA 3SG5A 1OZSA 1KFXL 1WDCB 1OZOA 4DIRA 3AKAA 3EK7A 5AERA 1NIWA 1NP8A 2JT8A 1B1GA 3SG6A 3HX4A 4BY4A 3BUNB 1Y1UA 2Y4QA 1NX0A 2WCBA 1XFXO 2Y1MA 3VRRA 3TUYB 2P6BB 1YVHA 2AUCA 2EC6C 3CGAA 4ETOA 1PVBA 4NDCA 3O4YA 2PALA 3VGOA 4CFQA 5JOLA 4GGFA 1MF8B 1X02A 4ZCVA 2TN4A 3RM1A 4FQOA 1OE9B 1DGVA 2BE6A 2VRGA 2JZIA 1J7RA 1A2XA 1JF0A 2MAZA 1RFJA 3DF0A 3LK1A 1IKUA 5FYXA 2I94A 4GGNA 1UWOA 5GQQC 3TS5B 1EH2A 1JF2A 1IJ5A 1YUTA 3M0WA 1TIZA 1K9PA 2AMIA 4MZJA 3KO0A 1UHNA 2LC5A 3KEVA 3SG3A 1SL8A 1L7ZA 1U5IA 3OB2B 2R2IA 1C7VA 3EKHA 5KTYA 4XYNA 2JT0A 3FWBA 4ORCB 1NSHA 4R1EA 1F55A 1GGWA 1K90D 1GGZA 1SW8A 2BCAA 5JJGA 1NPQA 2I7AA 2LHLA 4OVNF 3EK8A 1JSAA 3CR2A 4MSPA 4UPGA 1BLQA 1KFUL 1KK7Z 3GK4X 4AQIA 4DS7A 4WQ2A 1SK6D 1HQVA 1UHJA 1XK4A 2HPSA 1QX2A 1NYAA 2KI6C 5D7FA 3BUMB 3D0YA 1R6PA 1XVJA 2WCEA 4NDDA 1FPWA 1MXEA 2BECA 1CTRA 1XFVO 4XJKB 1CMFA 2KSPA 2E30A 1OMVA 1LVCD 4N1FA 1GQMA 4M2QA 5AEQA 2LNKA 2FCDA 1YRUB 2EC6B 4PE7A 1MQ1A 1SR6B 1TNXA 2L0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7W A;  3DVJ A;  2M1U A;  5I8N A;  5IBW A;  3PSR A;  1K2H A;  1QIV A;  3LL8 B;  1SPY A;  1S6J A;  2JTZ A;  1A29 A;  1N0Y A;  2K61 A;  4I5L B;  1NWD A;  1G8I A;  1EG3 A;  1AVS A;  2F2P A;  2LAN A;  3DVK A;  1B9A A;  3TUY C;  4PE1 A;  2KBM A;  2H61 A;  1DT7 B;  1B8C A;  3A4U B;  2MA2 A;  1TCF A;  1PRW A;  1PSB A;  1UUR A;  4I5K A;  1FI6 A;  2LVK A;  1PSR A;  1SCV A;  1DTL A;  2CNP A;  2M7N A;  4PHJ A;  1G33 A;  1UUS A;  1A75 A;  2MLE C;  3GK2 A;  1UHI A;  1JC2 A;  2KI4 B;  2KDH A;  1YX7 A;  2G2B A;  2M49 B;  1F4O A;  2L50 A;  2NXQ A;  2L51 A;  1J7Q A;  1DJI A;  2DOQ A;  2PRU A;  3OX6 A;  4MRX A;  1JBA A;  2KQ6 A;  3TS5 C;  1QX7 A;  1KSO A;  4ZCU A;  2M97 A;  1EL4 A;  4GFT A;  5AFP A;  4ORA B;  1JWD A;  1WLZ A;  1WY9 A;  5AAN A;  4QJ4 B;  1XO5 A;  3BQ3 A;  3NSL A;  2K8M B;  1CFF A;  1QLK A;  3LK0 A;  2CT9 A;  3WHU B;  2LV7 A;  4Q04 A;  4E68 A;  1SMG A;  3BOW A;  2H2K A;  1YUR A;  1YR5 A;  2KHN A;  1QS7 A;  3CZT X;  4YGC B;  4JWQ A;  2F3Z A;  1H8B A;  2PMY A;  2O5G A;  4CID A;  2RGI A;  4YGA A;  1REC A;  1K9U A;  3EVV A;  4A4B A;  1QAT A;  2KGB C;  1B8L A;  1SL7 A;  4C0K A;  1PVA A;  5CSI A;  4YI9 A;  5KSZ A;  2K7C A;  4GAO A;  2PSR A;  1YX8 A;  1BR4 B;  1QX5 B;  1CFC A;  2M29 A;  2OPO A;  2ZN8 A;  1DJY A;  1TTX A;  4DCK A;  1M46 A;  1S5G Z;  1G4Y R;  4IL1 A;  1YRT B;  1CLL A;  3ZWH A;  4PE4 A;  1BMO A;  1DF0 B;  2KI6 D;  4N5X A;  4HRG A;  1F71 A;  2BCB A;  2QAC A;  2M7L A;  4FTG A;  2LAP A;  3ICB A;  2NCO A;  3PFV A;  4OR9 B;  4GBA A;  1IQ5 A;  1J1E A;  3I5G B;  1N65 A;  1AUI B;  1SR6 C;  4PAL A;  3I5H B;  1W7I B;  2JWW A;  4MLW A;  1WRZ A;  1IWQ A;  4I5N B;  1BOC A;  2GGZ A;  3PAL A;  4U8D A;  1S3P A;  2K0J A;  3I5F B;  1Y0V H;  5CSJ A;  2KOT A;  1W7J B;  2JOJ A;  1U5I B;  2JRF A;  2WCF A;  1QV1 A;  3DD4 A;  1EJ3 A;  1FBV A;  3CLN A;  1K95 A;  1IJ6 A;  1CLM A;  1NX3 A;  2I2R E;  4QJ3 B;  5DKR A;  3NSK A;  1B7T Z;  2LUC A;  1IH0 A;  2LMV A;  3OP0 A;  4USL A;  3SIA A;  4YI8 A;  1ZMZ A;  5B8I B;  1DJW A;  1XFZ O;  5PAL A;  2KI4 C;  3PM8 A;  3OB1 B;  1L2O C;  2LUX A;  4CFR A;  1LIN A;  2Y1N A;  4F0Z B;  5G08 A;  2KFH A;  3PN7 B;  1QIW A;  1SCM B;  2LCP A;  5HKW A;  2KFG A;  4AOM A;  1AHR A;  1B47 A;  3D0Y B;  1M45 A;  1FW4 A;  2G9B A;  3IQO A;  1BJF A;  2FJU B;  4NQG A;  1JFK A;  1S36 A;  2ZKM X;  3BUO B;  1V1F A;  1A03 A;  4HSZ A;  4N1G A;  5HKY A;  4C0L A;  2JXL A;  2LHI A;  2K7O A;  1F4Q A;  1CDP A;  1NCY A;  1IQ3 A;  2K2F A;  1QLS A;  2M1K B;  1OMD A;  2BKH B;  3MSE B;  2LE9 B;  2LVJ A;  1HT9 A;  3F45 A;  1TN4 A;  4HRE E;  3I5I B;  1QVI Z;  1Q80 A;  5I2Q A;  1NCZ A;  4JPZ B;  2JPT A;  4CPV A;  3FIA A;  1Y6W A;  4BY5 A;  5ER4 X;  1SRA A;  2LLU A;  2MHH A;  1BR1 B;  1MHO A;  3GK1 A;  2MRD A;  1KFU S;  1SKT A;  4GGF C;  1SY9 A;  1J1D A;  1TNP A;  2F8P A;  1A75 B;  4GNK B;  3LLE A;  1DMO A;  3CR5 X;  3I5G C;  1PAL A;  3CR4 X;  3I5H C;  2PAS A;  1YUU A;  1MUX A;  2F3Y A;  4CLN A;  2ZFD A;  2ZN9 A;  3TDZ A;  1K8U A;  1TCO B;  4M2P A;  3VRQ A;  1XFY O;  4QJ5 B;  1TNQ A;  1L2O B;  5F6T A;  1CMG A;  2Q91 A;  3O2P A;  3I5F C;  4PCW A;  2OTG B;  1NUB A;  2F33 A;  2PVB A;  4WQ3 A;  2COL B;  1B4C A;  1ZAC A;  1S5G Y;  3BOW B;  3NXA A;  1WRK A;  1XFW O;  1ZOT B;  1KCY A;  1ALW A;  4C0J A;  2JTT A;  3FWC A;  1Y1A A;  3VRO A;  4JQ0 D;  1OSA A;  2KYF A;  1QXP A;  4ICB A;  1IG5 A;  1N2D A;  2L4I A;  1UHH A;  4YRU A;  1C07 A;  3KPX A;  4YBH B;  1OOJ A;  1SCM C;  1UHK A;  2WOS A;  1YVL A;  3PN7 C;  1CFD A;  3QRX A;  4P2Y B;  1CB1 A;  1DVI A;  2O60 A;  1DGU A;  1MR8 A;  1DJG A;  2ZND A;  2HET A;  3OHM B;  1ZFS A;  2FCE A;  5HLV A;  2D8N A;  4MRY A;  3LCP C;  2SAS A;  3TZ1 A;  2OS8 B;  2K2A A;  2JU0 A;  3KHE A;  1CDM A;  4MZL A;  4YGB B;  1F54 A;  2CCM A;  2EGD A;  2JUL A;  1M31 A;  2E6W A;  1RJV A;  1M39 A;  1CDL A;  1SL9 A;  2Q4U A;  3O78 A;  5DKQ A;  2BL0 B;  2LVV A;  1BT6 A;  3SIB A;  2M3W A;  1GJY A;  3CWG A;  1BG1 A;  1JUO A;  1IRJ A;  2M8U A;  3O6B A;  1AJ5 A;  1KK8 B;  2NZ0 A;  3I5I C;  1SYM A;  1EG4 A;  5J3X A;  2MJW B;  1XA5 A;  5K89 A;  3EVU A;  1J7O A;  2M9G A;  1AP4 A;  2L2E A;  1K96 A;  3DF0 B;  1WLM A;  2A4J A;  4HRH A;  1SNL A;  1QTX A;  1R2U A;  2KAX A;  1KK7 Y;  5BPJ A;  1MXL C;  1BF5 A;  2MLF C;  3BUX B;  5TNC A;  1UP5 A;  1CDN A;  1DF0 A;  1EXR A;  1KSM A;  2JC2 A;  1B8R A;  2BE4 A;  1RTP 1;  3JVT B;  2MBX A;  2CBL A;  3BYA A;  2NCP A;  1KQV A;  2LP3 A;  3A8R A;  4I5J A;  1KFX S;  4WRI A;  1RRO A;  1FI5 A;  5D69 A;  2GGM A;  1K94 A;  4OKH A;  2BKI B;  4MZK A;  4ORB B;  2OTG C;  1QVI Y;  5ER5 A;  1K9K A;  3SG4 A;  1YUS A;  4PHN A;  3EKJ A;  1RK9 A;  5HLO A;  3TDI A;  3DVM A;  2LLT A;  1S26 D;  1AK8 A;  2ZNE A;  1J55 A;  1QV0 A;  2AAO A;  1QJT A;  1DJZ A;  4YGE B;  1KWO B;  3K21 A;  2WOR A;  5DKN A;  1BOD A;  1F70 A;  4DRW A;  1PK0 D;  4MBE A;  1K93 D;  3E3R A;  1A4P A;  4PHK A;  2L5X B;  2Y5I A;  2I18 A;  2K7B A;  3JTD B;  2L4H A;  1TRF A;  1KQM B;  1XYD A;  3DVE A;  5HKZ A;  1CM1 A;  1IGV A;  3NSI A;  2KAY A;  3VRN A;  2OS8 C;  3BUW B;  1S1E A;  4MVF A;  2BBN A;  3ZNI A;  3KF9 A;  3WNX B;  2JT3 A;  3CS1 A;  1CM4 A;  2BL0 C;  2HF5 A;  3EVR A;  1NX2 A;  1OMR A;  5CSF A;  1JFJ A;  5I2L A;  1ODB A;  2KQY A;  3SG7 A;  1KK8 C;  4XJK A;  2L98 A;  1PUL A;  1CLB A;  3AAK A;  1D1O A;  3OX5 A;  2F2O A;  2LLS A;  3CTN A;  4PE0 A;  1LXF C;  1OQP A;  1Y1X A;  3FS7 A;  5AXI A;  1M63 B;  5I2O A;  1SBJ A;  2EHB A;  2JNX A;  1WDC C;  1J7P A;  2HQ8 A;  2LMT A;  3VRP A;  1ALV A;  2FOT A;  1LKJ A;  2KFF A;  1V1G A;  1FF1 A;  1NX1 A;  2B1U A;  2ISD A;  2QPT A;  3JVT C;  3RLZ A;  2M0R A;  1DJH A;  4M2O A;  2BBM A;  2HQW A;  3WXA A;  4GUK A;  2KNE A;  3WHT B;  2JQ6 A;  2CTN A;  3PAT A;  5CPV A;  1XK4 C;  3H4S E;  2GV5 A;  4D1E A;  5KU1 A;  1H4B A;  1QAS A;  2CXJ A;  2JNF A;  2LMU A;  3BXK A;  1DJX A;  4DUQ A;  2LVI A;  3TDU A;  1CNP A;  4P5O E;  1RWY A;  2ZRT A;  4MN0 A;  2ZRS A;  4A4C A;  3AAJ A;  4OCI A;  1CFP A;  4OV2 A;  1S6C A;  1ZUZ A;  2SCP A;  4YGD B;  1XFU O;  2KAV A;  1AJ4 A;  4L9M A;  1TOP A;  3PLF B;  1MWN A;  4GPL B;  1WRL A;  2WC8 A;  1KWO C;  4PDZ A;  2KGR A;  2BCX A;  2V53 A;  2KBI A;  3SJS A;  4AQJ A;  3IQQ A;  2JXC A;  3C1V A;  2WND A;  1B7T Y;  1LA3 A;  1E8A A;  1BU3 A;  2K7D A;  2LM5 A;  2LP2 A;  3GOF A;  4MEW A;  4TNC A;  1CKK A;  3D10 A;  1F8H A;  1VRK A;  3JTD C;  2KYC A;  5CSN A;  1KQM C;  1TNW A;  2IS9 A;  3AKB A;  3IF7 A;  5HYD A;  4PHM A;  3EK4 A;  1YTZ C;  2NLN A;  3HCM A;  1NCX A;  3SG2 A;  1S6I A;  2H61 C;  3NSO A;  1LA0 A;  4NDB A;  3SG5 A;  1OZS A;  1KFX L;  1WDC B;  1OZO A;  4DIR A;  3AKA A;  3EK7 A;  5AER A;  1NIW A;  1NP8 A;  2JT8 A;  1B1G A;  3SG6 A;  3HX4 A;  4BY4 A;  3BUN B;  1Y1U A;  2Y4Q A;  1NX0 A;  2WCB A;  1XFX O;  2Y1M A;  3VRR A;  3TUY B;  2P6B B;  1YVH A;  2AUC A;  2EC6 C;  3CGA A;  4ETO A;  1PVB A;  4NDC A;  3O4Y A;  2PAL A;  3VGO A;  4CFQ A;  5JOL A;  4GGF A;  1MF8 B;  1X02 A;  4ZCV A;  2TN4 A;  3RM1 A;  4FQO A;  1OE9 B;  1DGV A;  2BE6 A;  2VRG A;  2JZI A;  1J7R A;  1A2X A;  1JF0 A;  2MAZ A;  1RFJ A;  3DF0 A;  3LK1 A;  1IKU A;  5FYX A;  2I94 A;  4GGN A;  1UWO A;  5GQQ C;  3TS5 B;  1EH2 A;  1JF2 A;  1IJ5 A;  1YUT A;  3M0W A;  1TIZ A;  1K9P A;  2AMI A;  4MZJ A;  3KO0 A;  1UHN A;  2LC5 A;  3KEV A;  3SG3 A;  1SL8 A;  1L7Z A;  1U5I A;  3OB2 B;  2R2I A;  1C7V A;  3EKH A;  5KTY A;  4XYN A;  2JT0 A;  3FWB A;  4ORC B;  1NSH A;  4R1E A;  1F55 A;  1GGW A;  1K90 D;  1GGZ A;  1SW8 A;  2BCA A;  5JJG A;  1NPQ A;  2I7A A;  2LHL A;  4OVN F;  3EK8 A;  1JSA A;  3CR2 A;  4MSP A;  4UPG A;  1BLQ A;  1KFU L;  1KK7 Z;  3GK4 X;  4AQI A;  4DS7 A;  4WQ2 A;  1SK6 D;  1HQV A;  1UHJ A;  1XK4 A;  2HPS A;  1QX2 A;  1NYA A;  2KI6 C;  5D7F A;  3BUM B;  3D0Y A;  1R6P A;  1XVJ A;  2WCE A;  4NDD A;  1FPW A;  1MXE A;  2BEC A;  1CTR A;  1XFV O;  4XJK B;  1CMF A;  2KSP A;  2E30 A;  1OMV A;  1LVC D;  4N1F A;  1GQM A;  4M2Q A;  5AEQ A;  2LNK A;  2FCD A;  1YRU B;  2EC6 B;  4PE7 A;  1MQ1 A;  1SR6 B;  1TNX A;  2L0P A; 
#chains in the Genus database with same CATH topology
 1C7W A;  2P70 A;  3DVJ A;  2M1U A;  5I8N A;  5IBW A;  3PSR A;  1K2H A;  1QIV A;  3LL8 B;  1SPY A;  2QEV A;  1S6J A;  2JTZ A;  1A29 A;  1N0Y A;  2K61 A;  4I5L B;  1NWD A;  1G8I A;  1EG3 A;  1AVS A;  2F2P A;  2LAN A;  3DVK A;  1B9A A;  3TUY C;  4PE1 A;  2KBM A;  2H61 A;  1DT7 B;  1B8C A;  3A4U B;  2MA2 A;  1TCF A;  1PRW A;  1PSB A;  1UUR A;  4I5K A;  1FI6 A;  3OBV A;  2LVK A;  1PSR A;  1OOF A;  1SCV A;  1DTL A;  1TWO A;  2KPH A;  2CNP A;  2M7N A;  3B7A A;  2PQL A;  3R1V A;  4PHJ A;  1G33 A;  1UUS A;  1A75 A;  2MLE C;  3CAB A;  1UHI A;  3EG5 B;  2KI4 B;  3GK2 A;  1JC2 A;  2KDH A;  1YX7 A;  2G2B A;  2M49 B;  1F4O A;  2L50 A;  2NXQ A;  2L51 A;  1J7Q A;  1DJI A;  2DOQ A;  2PRU A;  3OX6 A;  3R72 A;  4MRX A;  1JBA A;  2KQ6 A;  3TS5 C;  2WCL A;  1QX7 A;  1KSO A;  4ZCU A;  2M97 A;  1EL4 A;  4GFT A;  5AFP A;  3BFA A;  4KYN A;  1DQE A;  1WLZ A;  1WY9 A;  4ORA B;  5AAN A;  4QJ4 B;  1XO5 A;  1JWD A;  3BQ3 A;  3D77 A;  3NSL A;  2K8M B;  1CFF A;  1QLK A;  3LK0 A;  1TUZ A;  2CT9 A;  3WHU B;  2LV7 A;  4Q04 A;  4E68 A;  2GTE A;  3BFH A;  1SMG A;  3BOW A;  3R1O A;  2H2K A;  1YUR A;  1YR5 A;  2KHN A;  1QS7 A;  2WCH A;  3CZT X;  4JWQ A;  4YGC B;  2F3Z A;  3L47 A;  1H8B A;  3D75 A;  2PMY A;  2O5G A;  4CID A;  2RGI A;  4YGA A;  1REC A;  1K9U A;  3EVV A;  4A4B A;  1QAT A;  2QEH A;  2KGB C;  1B8L A;  1SL7 A;  2WC5 A;  4C0K A;  1PVA A;  5CSI A;  4YI9 A;  5DIC A;  5KSZ A;  2K7C A;  4GAO A;  2PSR A;  3PJI A;  1YX8 A;  1BR4 B;  1QX5 B;  1CFC A;  2M29 A;  2OPO A;  2ZN8 A;  1DJY A;  1TTX A;  4DCK A;  1M46 A;  1S5G Z;  1G4Y R;  4IL1 A;  1YRT B;  1CLL A;  3ZWH A;  4PE4 A;  1BMO A;  1DF0 B;  2KI6 D;  2WCJ A;  4N5X A;  4HRG A;  1F71 A;  2BCB A;  2QAC A;  2M7L A;  3BJH A;  4FTG A;  2LAP A;  3ICB A;  2NCO A;  3PFV A;  4OR9 B;  4GBA A;  1IQ5 A;  1J1E A;  3I5G B;  1N65 A;  1AUI B;  1SR6 C;  3CZ0 A;  3DZT A;  4PAL A;  3I5H B;  1W7I B;  2JWW A;  4MLW A;  3FE9 A;  1WRZ A;  1IWQ A;  4I5N B;  1BOC A;  2GGZ A;  3K1E A;  3PAL A;  4U8D A;  1S3P A;  2K0J A;  2L2C A;  3I5F B;  1Y0V H;  5CSJ A;  2KOT A;  1W7J B;  2JOJ A;  1U5I B;  2JRF A;  2WCF A;  1QV1 A;  3DD4 A;  1EJ3 A;  1FBV A;  3CLN A;  3CZ2 A;  1K95 A;  1IJ6 A;  1CLM A;  1NX3 A;  3DY9 A;  2I2R E;  4QJ3 B;  5DKR A;  3NSK A;  1B7T Z;  2LUC A;  3UNW A;  1IH0 A;  2LMV A;  3OP0 A;  2YGU A;  4USL A;  4YI8 A;  3SIA A;  1ZMZ A;  5B8I B;  1ORG A;  1DJW A;  1XFZ O;  5PAL A;  2KI4 C;  3PM8 A;  3OB1 B;  1L2O C;  2LUX A;  4CFR A;  1LIN A;  2Y1N A;  3NHI A;  3QME A;  4F0Z B;  5G08 A;  2KFH A;  3PN7 B;  1QIW A;  1SCM B;  2LCP A;  1OW4 A;  2KFG A;  5HKW A;  1AHR A;  4AOM A;  1B47 A;  3D0Y B;  1M45 A;  1FW4 A;  2G9B A;  3IQO A;  1BJF A;  3D73 A;  5FI2 A;  2FJU B;  4NQG A;  1JFK A;  1S36 A;  2ZKM X;  3BUO B;  1V1F A;  1A03 A;  4INX A;  3PM2 A;  4HSZ A;  4N1G A;  3B88 A;  5HKY A;  4C0L A;  2JXL A;  2LHI A;  2K7O A;  1F4Q A;  1CDP A;  1NCY A;  1IQ3 A;  3S0G A;  3RZS A;  2K2F A;  1QLS A;  2M1K B;  1OMD A;  2BKH B;  3MSE B;  2LE9 B;  3FE6 A;  2LVJ A;  1HT9 A;  3F45 A;  1TN4 A;  4HRE E;  3I5I B;  1QVI Z;  1Q80 A;  5I2Q A;  1NCZ A;  4JPZ B;  2JPT A;  4CPV A;  3FIA A;  1Y6W A;  4BY5 A;  5ER4 X;  1SRA A;  2LLU A;  2MHH A;  1BR1 B;  3S0B A;  1TUJ A;  1MHO A;  3GK1 A;  2MRD A;  1KFU S;  1SKT A;  4GGF C;  1SY9 A;  1J1D A;  1TNP A;  2F8P A;  3FE8 A;  1A75 B;  4GNK B;  3LLE A;  1DMO A;  3CR5 X;  3I5G C;  1PAL A;  2QEB A;  3CR4 X;  3I5H C;  2PAS A;  1LS8 A;  1MUX A;  1YUU A;  2F3Y A;  2ZFD A;  4CLN A;  2ZN9 A;  3TDZ A;  4PT1 A;  1K8U A;  1TCO B;  4M2P A;  3VRQ A;  1XFY O;  4QJ5 B;  1TNQ A;  1L2O B;  2BNX A;  5F6T A;  1W9Z A;  1CMG A;  1GM0 A;  2Q91 A;  3O2P A;  4JD9 A;  3I5F C;  4PCW A;  2OTG B;  3N7H A;  1Z2C B;  1NUB A;  2F33 A;  2PVB A;  4WQ3 A;  2COL B;  1B4C A;  1ZAC A;  1S5G Y;  3BOW B;  3NXA A;  3S0D A;  1WRK A;  1XFW O;  1ZOT B;  1KCY A;  1ALW A;  4C0J A;  2JTT A;  2WCK A;  1Z4H A;  3FWC A;  1Y1A A;  3V2L A;  3VRO A;  4JQ0 D;  1OSA A;  2KYF A;  3S0A A;  1QXP A;  4ICB A;  1IG5 A;  1N2D A;  2L4I A;  1UHH A;  1C3Z A;  4YRU A;  1C07 A;  3KPX A;  4YBH B;  1OOJ A;  1SCM C;  1UHK A;  2WOS A;  1YVL A;  3PN7 C;  1CFD A;  3QRX A;  4P2Y B;  1CB1 A;  1DVI A;  2O60 A;  1DGU A;  1MR8 A;  1DJG A;  2ZND A;  2HET A;  3OHM B;  2PYQ A;  4FQT A;  1ZFS A;  2FCE A;  5HLV A;  2D8N A;  4MRY A;  3LCP C;  2SAS A;  3TZ1 A;  5I94 A;  2OS8 B;  2K2A A;  2KLE A;  2JU0 A;  3KHE A;  1CDM A;  4MZL A;  4YGB B;  1F54 A;  2CCM A;  2EGD A;  2JUL A;  1M31 A;  2E6W A;  3CZ1 A;  1RJV A;  1M39 A;  1CDL A;  1SL9 A;  2Q4U A;  3O78 A;  5DKQ A;  2BL0 B;  2LVV A;  1BT6 A;  3SIB A;  2M3W A;  1GJY A;  3CWG A;  1BG1 A;  1JUO A;  1IRJ A;  1DEK A;  2M8U A;  3O6B A;  1AJ5 A;  1KK8 B;  2NZ0 A;  3I5I C;  1SYM A;  1EG4 A;  5J3X A;  2MJW B;  1XA5 A;  5K89 A;  3EVU A;  1J7O A;  2M9G A;  1AP4 A;  2L2E A;  1K96 A;  3DF0 B;  1WLM A;  2A4J A;  4HRH A;  1SNL A;  1QTX A;  1R2U A;  2KAX A;  1KK7 Y;  3NGV A;  5BPJ A;  1MXL C;  1BF5 A;  2MLF C;  5D3O A;  3DYE A;  3BUX B;  3UO9 A;  5TNC A;  1UP5 A;  1CDN A;  1DF0 A;  1EXR A;  1KSM A;  2JC2 A;  1B8R A;  2BE4 A;  1RTP 1;  3JVT B;  2MBX A;  2CBL A;  3BYA A;  1IIO A;  2NCP A;  1KQV A;  2LP3 A;  3A8R A;  4I5J A;  1KFX S;  4WRI A;  3B6X A;  1RRO A;  1FI5 A;  5D69 A;  2GGM A;  1K94 A;  4OKH A;  2BKI B;  4MZK A;  4ORB B;  2OTG C;  1QVI Y;  5ER5 A;  1K9K A;  5HL1 A;  3SG4 A;  2ERB A;  1YUS A;  4PHN A;  3EKJ A;  1RK9 A;  5HLO A;  3TDI A;  3DVM A;  3D76 A;  2LLT A;  1OOI X;  1S26 D;  1AK8 A;  2ZNE A;  1J55 A;  4OZD A;  1QV0 A;  2AAO A;  1P28 A;  1QJT A;  1DJZ A;  4YGE B;  1KWO B;  3K21 A;  2WOR A;  5DKN A;  1BOD A;  1F70 A;  4DRW A;  1PK0 D;  4MBE A;  1K93 D;  3E3R A;  1A4P A;  4PHK A;  2L5Y A;  2L5X B;  2Y5I A;  2I18 A;  2K7B A;  3JTD B;  2P71 A;  2L4H A;  1TRF A;  1KQM B;  1XYD A;  3DVE A;  5HKZ A;  1CM1 A;  1IGV A;  3NSI A;  2KAY A;  3VRN A;  2OS8 C;  3BUW B;  1S1E A;  2JPO A;  4MVF A;  3DXL A;  2BBN A;  3ZNI A;  2K60 A;  3KF9 A;  2JT3 A;  3WNX B;  1OOG A;  3CS1 A;  1CM4 A;  2BL0 C;  2HF5 A;  3EVR A;  1NX2 A;  1OMR A;  5CSF A;  1JFJ A;  5I2L A;  1ODB A;  2KQY A;  3SG7 A;  1DEL A;  1KK8 C;  1OOH A;  1PUL A;  2L98 A;  3NHT A;  4XJK A;  1CLB A;  3AAK A;  1D1O A;  3OX5 A;  4JKT A;  2F2O A;  2LLS A;  3CTN A;  4PE0 A;  1LXF C;  1OQP A;  1Y1X A;  3FS7 A;  5AXI A;  1M63 B;  5I2O A;  1SBJ A;  2EHB A;  2JNX A;  1T14 A;  1WDC C;  1J7P A;  1XFR A;  2QEO A;  3OGN A;  2HQ8 A;  1SSE B;  2LMT A;  3VRP A;  1ALV A;  2FOT A;  2KLD A;  1LKJ A;  3D74 A;  2KFF A;  1V1G A;  1FF1 A;  1NX1 A;  3R1P A;  2B1U A;  3D78 A;  3IVT A;  2ISD A;  2QPT A;  2FJY A;  3JVT C;  3RLZ A;  2M0R A;  1DJH A;  4M2O A;  2BBM A;  2HQW A;  3WXA A;  4GUK A;  2KNE A;  3WHT B;  2JQ6 A;  2CTN A;  3PAT A;  5CPV A;  1XK4 C;  3H4S E;  2GV5 A;  4D1E A;  5KU1 A;  1H4B A;  1QAS A;  2CXJ A;  2JNF A;  2LMU A;  3BXK A;  1DJX A;  4DUQ A;  2LVI A;  3TDU A;  1CNP A;  3SS5 A;  4P5O E;  5FI7 A;  1RWY A;  2ZRT A;  4IJ7 A;  4MN0 A;  2ZRS A;  4A4C A;  3AAJ A;  4OCI A;  1CFP A;  3S0E A;  4OV2 A;  1S6C A;  1ZUZ A;  2SCP A;  4F7F A;  3VB1 A;  1QWV A;  4YGD B;  1XFU O;  2KAV A;  1AJ4 A;  4L9M A;  1TOP A;  3PLF B;  1MWN A;  3B87 A;  1WRL A;  4GPL B;  2WC8 A;  2WC6 A;  1KWO C;  4PDZ A;  2KGR A;  2BCX A;  2V53 A;  2KBI A;  3SJS A;  4AQJ A;  3IQQ A;  2JXC A;  3C1V A;  2WND A;  1B7T Y;  1LA3 A;  1E8A A;  1BU3 A;  2K7D A;  2LM5 A;  2LP2 A;  3GOF A;  4MEW A;  4TNC A;  1CKK A;  3D10 A;  1F8H A;  1VRK A;  3JTD C;  2KYC A;  5CSN A;  1KQM C;  1TNW A;  2IS9 A;  3AKB A;  3IF7 A;  5HYD A;  5EL2 A;  4PHM A;  3EK4 A;  1YTZ C;  2NLN A;  3CYZ A;  1NCX A;  3HCM A;  3SG2 A;  1S6I A;  2H61 C;  3NSO A;  1LA0 A;  4NDB A;  3SG5 A;  1OZS A;  1KFX L;  1WDC B;  1OZO A;  4DIR A;  3AKA A;  3EK7 A;  5AER A;  1NIW A;  1NP8 A;  2JT8 A;  1B1G A;  3SG6 A;  3HX4 A;  4BY4 A;  2BAP A;  3BUN B;  1Y1U A;  2Y4Q A;  1NX0 A;  2WCB A;  4INW A;  1XFX O;  2Y1M A;  3VRR A;  3TUY B;  2P6B B;  1YVH A;  2AUC A;  2EC6 C;  3CGA A;  4ETO A;  1PVB A;  4NDC A;  3O4Y A;  2PAL A;  3VGO A;  4CFQ A;  5JOL A;  4GGF A;  2WCM A;  1MF8 B;  1X02 A;  4ZCV A;  2TN4 A;  3RM1 A;  4FQO A;  1OE9 B;  1DGV A;  2BE6 A;  2VRG A;  3Q8I A;  2JZI A;  3S0F A;  1J7R A;  1A2X A;  1JF0 A;  2MAZ A;  1RFJ A;  3DF0 A;  3LK1 A;  1IKU A;  3B86 A;  2I94 A;  4GGN A;  1UWO A;  5FYX A;  5GQQ C;  3TS5 B;  1JF2 A;  1EH2 A;  1IJ5 A;  1YUT A;  3M0W A;  1TIZ A;  1K9P A;  2AMI A;  4MZJ A;  3KO0 A;  1UHN A;  2LC5 A;  3KEV A;  3SG3 A;  1SL8 A;  1L7Z A;  1U5I A;  3OB2 B;  2R2I A;  1C7V A;  3EKH A;  5KTY A;  4XYN A;  2JT0 A;  3L4A A;  3FWB A;  4ORC B;  1NSH A;  4R1E A;  3SS4 A;  1F55 A;  1GGW A;  1K90 D;  3O4X A;  1GGZ A;  1SW8 A;  2BCA A;  5JJG A;  1NPQ A;  2I7A A;  2LHL A;  4OVN F;  3EK8 A;  1JSA A;  3CR2 A;  4MSP A;  4UPG A;  1BLQ A;  1KFU L;  1KK7 Z;  3GK4 X;  3L4L A;  4AQI A;  4WQ2 A;  4DS7 A;  1SK6 D;  1HQV A;  3SS3 A;  1UHJ A;  1XK4 A;  1DC1 A;  2HPS A;  1QX2 A;  1NYA A;  2KI6 C;  5D7F A;  5FI6 A;  3BUM B;  3CDN A;  1R6P A;  1XVJ A;  2WCE A;  3D0Y A;  4NDD A;  1MXE A;  1FPW A;  2BEC A;  1CTR A;  3BFB A;  1XFV O;  4XJK B;  1CMF A;  2KSP A;  2E30 A;  1OMV A;  1LVC D;  4N1F A;  1GQM A;  2H8V A;  4M2Q A;  5AEQ A;  2LNK A;  2FCD A;  1YRU B;  2EC6 B;  2QDI A;  1C3Y A;  4PE7 A;  1MQ1 A;  1SR6 B;  1TNX A;  2L0P A; 
#chains in the Genus database with same CATH homology
 1C7W A;  3DVJ A;  2M1U A;  5I8N A;  5IBW A;  3PSR A;  1K2H A;  1QIV A;  3LL8 B;  1SPY A;  1S6J A;  2JTZ A;  1A29 A;  1N0Y A;  2K61 A;  4I5L B;  1NWD A;  1G8I A;  1EG3 A;  1AVS A;  2F2P A;  2LAN A;  3DVK A;  1B9A A;  3TUY C;  4PE1 A;  2KBM A;  2H61 A;  1DT7 B;  1B8C A;  3A4U B;  2MA2 A;  1TCF A;  1PRW A;  1PSB A;  1UUR A;  4I5K A;  1FI6 A;  2LVK A;  1PSR A;  1SCV A;  1DTL A;  2CNP A;  2M7N A;  4PHJ A;  1G33 A;  1UUS A;  1A75 A;  2MLE C;  3GK2 A;  1UHI A;  1JC2 A;  2KI4 B;  2KDH A;  1YX7 A;  2G2B A;  2M49 B;  1F4O A;  2L50 A;  2NXQ A;  2L51 A;  1J7Q A;  1DJI A;  2DOQ A;  2PRU A;  3OX6 A;  4MRX A;  1JBA A;  2KQ6 A;  3TS5 C;  1QX7 A;  1KSO A;  4ZCU A;  2M97 A;  1EL4 A;  4GFT A;  5AFP A;  4ORA B;  1JWD A;  1WLZ A;  1WY9 A;  5AAN A;  4QJ4 B;  1XO5 A;  3BQ3 A;  3NSL A;  2K8M B;  1CFF A;  1QLK A;  3LK0 A;  2CT9 A;  3WHU B;  2LV7 A;  4Q04 A;  4E68 A;  1SMG A;  3BOW A;  2H2K A;  1YUR A;  1YR5 A;  2KHN A;  1QS7 A;  3CZT X;  4YGC B;  4JWQ A;  2F3Z A;  1H8B A;  2PMY A;  2O5G A;  4CID A;  2RGI A;  4YGA A;  1REC A;  1K9U A;  3EVV A;  4A4B A;  1QAT A;  2KGB C;  1B8L A;  1SL7 A;  4C0K A;  1PVA A;  5CSI A;  4YI9 A;  5KSZ A;  2K7C A;  4GAO A;  2PSR A;  1YX8 A;  1BR4 B;  1QX5 B;  1CFC A;  2M29 A;  2OPO A;  2ZN8 A;  1DJY A;  1TTX A;  4DCK A;  1M46 A;  1S5G Z;  1G4Y R;  4IL1 A;  1YRT B;  1CLL A;  3ZWH A;  4PE4 A;  1BMO A;  1DF0 B;  2KI6 D;  4N5X A;  4HRG A;  1F71 A;  2BCB A;  2QAC A;  2M7L A;  4FTG A;  2LAP A;  3ICB A;  2NCO A;  3PFV A;  4OR9 B;  4GBA A;  1IQ5 A;  1J1E A;  3I5G B;  1N65 A;  1AUI B;  1SR6 C;  4PAL A;  3I5H B;  1W7I B;  2JWW A;  4MLW A;  1WRZ A;  1IWQ A;  4I5N B;  1BOC A;  2GGZ A;  3PAL A;  4U8D A;  1S3P A;  2K0J A;  3I5F B;  1Y0V H;  5CSJ A;  2KOT A;  1W7J B;  2JOJ A;  1U5I B;  2JRF A;  2WCF A;  1QV1 A;  3DD4 A;  1EJ3 A;  1FBV A;  3CLN A;  1K95 A;  1IJ6 A;  1CLM A;  1NX3 A;  2I2R E;  4QJ3 B;  5DKR A;  3NSK A;  1B7T Z;  2LUC A;  1IH0 A;  2LMV A;  3OP0 A;  4USL A;  3SIA A;  4YI8 A;  1ZMZ A;  5B8I B;  1DJW A;  1XFZ O;  5PAL A;  2KI4 C;  3PM8 A;  3OB1 B;  1L2O C;  2LUX A;  4CFR A;  1LIN A;  2Y1N A;  4F0Z B;  5G08 A;  2KFH A;  3PN7 B;  1QIW A;  1SCM B;  2LCP A;  5HKW A;  2KFG A;  4AOM A;  1AHR A;  1B47 A;  3D0Y B;  1M45 A;  1FW4 A;  2G9B A;  3IQO A;  1BJF A;  2FJU B;  4NQG A;  1JFK A;  1S36 A;  2ZKM X;  3BUO B;  1V1F A;  1A03 A;  4HSZ A;  4N1G A;  5HKY A;  4C0L A;  2JXL A;  2LHI A;  2K7O A;  1F4Q A;  1CDP A;  1NCY A;  1IQ3 A;  2K2F A;  1QLS A;  2M1K B;  1OMD A;  2BKH B;  3MSE B;  2LE9 B;  2LVJ A;  1HT9 A;  3F45 A;  1TN4 A;  4HRE E;  3I5I B;  1QVI Z;  1Q80 A;  5I2Q A;  1NCZ A;  4JPZ B;  2JPT A;  4CPV A;  3FIA A;  1Y6W A;  4BY5 A;  5ER4 X;  1SRA A;  2LLU A;  2MHH A;  1BR1 B;  1MHO A;  3GK1 A;  2MRD A;  1KFU S;  1SKT A;  4GGF C;  1SY9 A;  1J1D A;  1TNP A;  2F8P A;  1A75 B;  4GNK B;  3LLE A;  1DMO A;  3CR5 X;  3I5G C;  1PAL A;  3CR4 X;  3I5H C;  2PAS A;  1YUU A;  1MUX A;  2F3Y A;  4CLN A;  2ZFD A;  2ZN9 A;  3TDZ A;  1K8U A;  1TCO B;  4M2P A;  3VRQ A;  1XFY O;  4QJ5 B;  1TNQ A;  1L2O B;  5F6T A;  1CMG A;  2Q91 A;  3O2P A;  3I5F C;  4PCW A;  2OTG B;  1NUB A;  2F33 A;  2PVB A;  4WQ3 A;  2COL B;  1B4C A;  1ZAC A;  1S5G Y;  3BOW B;  3NXA A;  1WRK A;  1XFW O;  1ZOT B;  1KCY A;  1ALW A;  4C0J A;  2JTT A;  3FWC A;  1Y1A A;  3VRO A;  4JQ0 D;  1OSA A;  2KYF A;  1QXP A;  4ICB A;  1IG5 A;  1N2D A;  2L4I A;  1UHH A;  4YRU A;  1C07 A;  3KPX A;  4YBH B;  1OOJ A;  1SCM C;  1UHK A;  2WOS A;  1YVL A;  3PN7 C;  1CFD A;  3QRX A;  4P2Y B;  1CB1 A;  1DVI A;  2O60 A;  1DGU A;  1MR8 A;  1DJG A;  2ZND A;  2HET A;  3OHM B;  1ZFS A;  2FCE A;  5HLV A;  2D8N A;  4MRY A;  3LCP C;  2SAS A;  3TZ1 A;  2OS8 B;  2K2A A;  2JU0 A;  3KHE A;  1CDM A;  4MZL A;  4YGB B;  1F54 A;  2CCM A;  2EGD A;  2JUL A;  1M31 A;  2E6W A;  1RJV A;  1M39 A;  1CDL A;  1SL9 A;  2Q4U A;  3O78 A;  5DKQ A;  2BL0 B;  2LVV A;  1BT6 A;  3SIB A;  2M3W A;  1GJY A;  3CWG A;  1BG1 A;  1JUO A;  1IRJ A;  2M8U A;  3O6B A;  1AJ5 A;  1KK8 B;  2NZ0 A;  3I5I C;  1SYM A;  1EG4 A;  5J3X A;  2MJW B;  1XA5 A;  5K89 A;  3EVU A;  1J7O A;  2M9G A;  1AP4 A;  2L2E A;  1K96 A;  3DF0 B;  1WLM A;  2A4J A;  4HRH A;  1SNL A;  1QTX A;  1R2U A;  2KAX A;  1KK7 Y;  5BPJ A;  1MXL C;  1BF5 A;  2MLF C;  3BUX B;  5TNC A;  1UP5 A;  1CDN A;  1DF0 A;  1EXR A;  1KSM A;  2JC2 A;  1B8R A;  2BE4 A;  1RTP 1;  3JVT B;  2MBX A;  2CBL A;  3BYA A;  2NCP A;  1KQV A;  2LP3 A;  3A8R A;  4I5J A;  1KFX S;  4WRI A;  1RRO A;  1FI5 A;  5D69 A;  2GGM A;  1K94 A;  4OKH A;  2BKI B;  4MZK A;  4ORB B;  2OTG C;  1QVI Y;  5ER5 A;  1K9K A;  3SG4 A;  1YUS A;  4PHN A;  3EKJ A;  1RK9 A;  5HLO A;  3TDI A;  3DVM A;  2LLT A;  1S26 D;  1AK8 A;  2ZNE A;  1J55 A;  1QV0 A;  2AAO A;  1QJT A;  1DJZ A;  4YGE B;  1KWO B;  3K21 A;  2WOR A;  5DKN A;  1BOD A;  1F70 A;  4DRW A;  1PK0 D;  4MBE A;  1K93 D;  3E3R A;  1A4P A;  4PHK A;  2L5X B;  2Y5I A;  2I18 A;  2K7B A;  3JTD B;  2L4H A;  1TRF A;  1KQM B;  1XYD A;  3DVE A;  5HKZ A;  1CM1 A;  1IGV A;  3NSI A;  2KAY A;  3VRN A;  2OS8 C;  3BUW B;  1S1E A;  4MVF A;  2BBN A;  3ZNI A;  3KF9 A;  3WNX B;  2JT3 A;  3CS1 A;  1CM4 A;  2BL0 C;  2HF5 A;  3EVR A;  1NX2 A;  1OMR A;  5CSF A;  1JFJ A;  5I2L A;  1ODB A;  2KQY A;  3SG7 A;  1KK8 C;  4XJK A;  2L98 A;  1PUL A;  1CLB A;  3AAK A;  1D1O A;  3OX5 A;  2F2O A;  2LLS A;  3CTN A;  4PE0 A;  1LXF C;  1OQP A;  1Y1X A;  3FS7 A;  5AXI A;  1M63 B;  5I2O A;  1SBJ A;  2EHB A;  2JNX A;  1WDC C;  1J7P A;  2HQ8 A;  2LMT A;  3VRP A;  1ALV A;  2FOT A;  1LKJ A;  2KFF A;  1V1G A;  1FF1 A;  1NX1 A;  2B1U A;  2ISD A;  2QPT A;  3JVT C;  3RLZ A;  2M0R A;  1DJH A;  4M2O A;  2BBM A;  2HQW A;  3WXA A;  4GUK A;  2KNE A;  3WHT B;  2JQ6 A;  2CTN A;  3PAT A;  5CPV A;  1XK4 C;  3H4S E;  2GV5 A;  4D1E A;  5KU1 A;  1H4B A;  1QAS A;  2CXJ A;  2JNF A;  2LMU A;  3BXK A;  1DJX A;  4DUQ A;  2LVI A;  3TDU A;  1CNP A;  4P5O E;  1RWY A;  2ZRT A;  4MN0 A;  2ZRS A;  4A4C A;  3AAJ A;  4OCI A;  1CFP A;  4OV2 A;  1S6C A;  1ZUZ A;  2SCP A;  4YGD B;  1XFU O;  2KAV A;  1AJ4 A;  4L9M A;  1TOP A;  3PLF B;  1MWN A;  4GPL B;  1WRL A;  2WC8 A;  1KWO C;  4PDZ A;  2KGR A;  2BCX A;  2V53 A;  2KBI A;  3SJS A;  4AQJ A;  3IQQ A;  2JXC A;  3C1V A;  2WND A;  1B7T Y;  1LA3 A;  1E8A A;  1BU3 A;  2K7D A;  2LM5 A;  2LP2 A;  3GOF A;  4MEW A;  4TNC A;  1CKK A;  3D10 A;  1F8H A;  1VRK A;  3JTD C;  2KYC A;  5CSN A;  1KQM C;  1TNW A;  2IS9 A;  3AKB A;  3IF7 A;  5HYD A;  4PHM A;  3EK4 A;  1YTZ C;  2NLN A;  3HCM A;  1NCX A;  3SG2 A;  1S6I A;  2H61 C;  3NSO A;  1LA0 A;  4NDB A;  3SG5 A;  1OZS A;  1KFX L;  1WDC B;  1OZO A;  4DIR A;  3AKA A;  3EK7 A;  5AER A;  1NIW A;  1NP8 A;  2JT8 A;  1B1G A;  3SG6 A;  3HX4 A;  4BY4 A;  3BUN B;  1Y1U A;  2Y4Q A;  1NX0 A;  2WCB A;  1XFX O;  2Y1M A;  3VRR A;  3TUY B;  2P6B B;  1YVH A;  2AUC A;  2EC6 C;  3CGA A;  4ETO A;  1PVB A;  4NDC A;  3O4Y A;  2PAL A;  3VGO A;  4CFQ A;  5JOL A;  4GGF A;  1MF8 B;  1X02 A;  4ZCV A;  2TN4 A;  3RM1 A;  4FQO A;  1OE9 B;  1DGV A;  2BE6 A;  2VRG A;  2JZI A;  1J7R A;  1A2X A;  1JF0 A;  2MAZ A;  1RFJ A;  3DF0 A;  3LK1 A;  1IKU A;  5FYX A;  2I94 A;  4GGN A;  1UWO A;  5GQQ C;  3TS5 B;  1EH2 A;  1JF2 A;  1IJ5 A;  1YUT A;  3M0W A;  1TIZ A;  1K9P A;  2AMI A;  4MZJ A;  3KO0 A;  1UHN A;  2LC5 A;  3KEV A;  3SG3 A;  1SL8 A;  1L7Z A;  1U5I A;  3OB2 B;  2R2I A;  1C7V A;  3EKH A;  5KTY A;  4XYN A;  2JT0 A;  3FWB A;  4ORC B;  1NSH A;  4R1E A;  1F55 A;  1GGW A;  1K90 D;  1GGZ A;  1SW8 A;  2BCA A;  5JJG A;  1NPQ A;  2I7A A;  2LHL A;  4OVN F;  3EK8 A;  1JSA A;  3CR2 A;  4MSP A;  4UPG A;  1BLQ A;  1KFU L;  1KK7 Z;  3GK4 X;  4AQI A;  4DS7 A;  4WQ2 A;  1SK6 D;  1HQV A;  1UHJ A;  1XK4 A;  2HPS A;  1QX2 A;  1NYA A;  2KI6 C;  5D7F A;  3BUM B;  3D0Y A;  1R6P A;  1XVJ A;  2WCE A;  4NDD A;  1FPW A;  1MXE A;  2BEC A;  1CTR A;  1XFV O;  4XJK B;  1CMF A;  2KSP A;  2E30 A;  1OMV A;  1LVC D;  4N1F A;  1GQM A;  4M2Q A;  5AEQ A;  2LNK A;  2FCD A;  1YRU B;  2EC6 B;  4PE7 A;  1MQ1 A;  1SR6 B;  1TNX A;  2L0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...