3RZSA

Apis mellifera obp14 in complex with ta6br14
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 43
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3rzsA00
2P71A 3DYEA 3S0EA 3BFAA 3S0AA 4FQTA 3BJHA 1P28A 3L47A 1OOFA 3N7HA 2FJYA 1LS8A 3QMEA 2QDIA 1GM0A 2WCHA 1TWOA 3PJIA 3VB1A 3CABA 3DZTA 1OOGA 3B86A 3NHTA 3V2LA 1C3ZA 1OW4A 1DQEA 3DY9A 3R1VA 3R1OA 2WCLA 4PT1A 3S0DA 2QEOA 3BFBA 3L4AA 2QEHA 2GTEA 4OZDA 2PQLA 3OGNA 2P70A 1QWVA 3D78A 2QEBA 4INWA 2WCKA 3S0BA 1TUJA 3CYZA 1OOHA 4F7FA 2WCMA 3FE9A 3B7AA 2WC6A 2H8VA 3B6XA 3FE6A 3NHIA 3D73A 3S0GA 2ERBA 3B87A 3CDNA 3DXLA 2L2CA 2KPHA 3Q8IA 1T14A 1OOIX 1ORGA 3L4LA 3FE8A 1XFRA 1C3YA 3S0FA 3CZ1A 3B88A 3BFHA 3CZ2A 2WC5A 5EL2A 3CZ0A 3NGVA 3R72A 3D75A 5DICA 3K1EA 2WCJA 3RZSA 3R1PA 3D74A 3D76A 4JD9A 2JPOA 3D77A 4INXA 2QEVA
chains in the Genus database with same CATH superfamily
1YVLA 3I5FC 1J1EA 1UHKA 1XK4C 1M45A 2L4IA 1LKJA 2H61C 1C7WA 2JC2A 1XFWO 1QJTA 1WRZA 2L5YA 3D10A 4XJKA 2EHBA 2AUCA 1EH2A 3IVTA 1S6CA 1WLZA 2LP2A 2PASA 4U8DA 1MHOA 5I2LA 3S0AA 1J7OA 2KAXA 2LVIA 1DJXA 5KTYA 5AANA 2F3YA 1K94A 5D3OA 1GGWA 3EVVA 5CPVA 2PYQA 3WNXB 2O5GA 3N7HA 4P5OE 2MLEC 3VRNA 2NXQA 3VROA 1J7RA 1SYMA 2BCBA 3AAJA 1YURA 2M49B 3D0YA 3OX6A 4I5LB 4WQ3A 2WCFA 3LLEA 1R2UA 1PVAA 3EKJA 1L2OC 1QATA 3M0WA 4DUQA 4F0ZB 1QX2A 2OS8B 3CABA 2LMVA 3DZTA 1CB1A 1DGUA 3AKBA 3PM2A 1SR6B 2YGUA 5AERA 1BMOA 3B86A 2O60A 1NCXA 5I2QA 1MF8B 3V2LA 4NDBA 2LNKA 1RFJA 1DQEA 5JOLA 1XFXO 2M3WA 3DY9A 5TNCA 1G4YR 1RK9A 1OQPA 1EG3A 1DJWA 1OMDA 2BE6A 3SJSA 1SL9A 1BJFA 1X02A 3BFBA 3RM1A 3BQ3A 1K9UA 2V53A 2JT0A 2LE9B 3A4UB 4GGFC 2EC6C 3I5GC 3EK7A 1ZUZA 3SIBA 2BL0C 2JTZA 4M2QA 1AHRA 3I5IB 2COLB 2KLDA 3UNWA 4BY5A 1DJIA 2MHHA 2ZFDA 5AXIA 1W7IB 2JZIA 1A29A 3GK4X 1W9ZA 1A2XA 2E6WA 1E8AA 1J55A 2I94A 2Y1MA 3O4XA 4IJ7A 1HQVA 1MXEA 1QIVA 1UURA 2KNEA 2WCBA 1ZMZA 2ZN8A 1RWYA 3BYAA 2L50A 1XVJA 4OKHA 3ZWHA 2H8VA 3JTDB 4JQ0D 1SSEB 3FE6A 2KI4C 1KCYA 5DKNA 1BR1B 2ZNDA 3VRPA 1IH0A 3B87A 2KOTA 1OMRA 2KPHA 2D8NA 4I5JA 2JPTA 2K61A 1KK8C 1MWNA 2GGMA 1CM1A 1WDCB 1WLMA 3L4LA 1GGZA 2L0PA 2B1UA 1QTXA 2FCEA 1CLMA 1NX3A 4AOMA 5PALA 2LMTA 1C3YA 1PK0D 2KAVA 2MLFC 3CZ1A 1XFVO 4ZCVA 4CPVA 1H8BA 1SMGA 1KFXS 3CZ2A 3PN7C 1MXLC 2OTGC 2WC5A 2LHIA 4JWQA 1KFUS 5FI2A 1IQ3A 1SW8A 3NGVA 4ORBB 1OZOA 1NX1A 2KGRA 2BE4A 1R6PA 2L5XB 1WRLA 2HF5A 3SG3A 4DIRA 4XYNA 2R2IA 1S3PA 1WY9A 5J3XA 1CFPA 1CMGA 3DVMA 1WRKA 2WCJA 2BKHB 4YRUA 2FJUB 1KQMC 1S5GZ 3D74A 4YGCB 2LLSA 3OX5A 4OV2A 4JD9A 1QX7A 2JT3A 1NX0A 3TUYB 3BUNB 1XYDA 4INXA 2P71A 2ISDA 1B7TZ 3S0EA 1YR5A 1UP5A 2JQ6A 4MLWA 4YGBB 1N0YA 2E30A 2LVKA 2KQYA 1YRUB 3BUWB 3KO0A 4WQ2A 3I5HC 1N65A 4FQTA 1KWOB 4MRYA 3BJHA 2M1UA 1KSMA 3ICBA 4YI9A 1SCMB 3FWBA 1P28A 3TS5C 1OOFA 2Q4UA 3VGOA 1G33A 1CDPA 4ORAB 1M39A 1NCZA 4PALA 4R1EA 4OR9B 1UHJA 3C1VA 1LS8A 5HLOA 1BLQA 2BBMA 3QMEA 3KF9A 1AK8A 3NSOA 5F6TA 2HPSA 2K7DA 1SPYA 2F33A 2LANA 3VRRA 1FI5A 5HKYA 1OOGA 4JKTA 5K89A 1AJ5A 1J7PA 2LUCA 3AKAA 3CWGA 3EKHA 1F55A 3BUMB 3LK0A 2Y4QA 1IWQA 2LVJA 1B4CA 4WRIA 4PT1A 1K90D 2K8MB 4HSZA 1JFKA 1Y1UA 1EG4A 1CFFA 2GTEA 3OGNA 1BU3A 1M31A 1QWVA 4YGAA 5D69A 3QRXA 3SS5A 4YI8A 1IKUA 1K96A 1J1DA 1BR4B 3DVEA 3CGAA 3PSRA 3UO9A 1K8UA 2HETA 3S0BA 3NXAA 5FI6A 1IJ6A 1K2HA 1M63B 2ZRTA 1OOHA 1V1GA 4YGDB 2LVVA 1DJZA 2K0JA 1MR8A 2GGZA 3FE9A 3PFVA 3BUOB 2I18A 4PE0A 5CSFA 1IJ5A 1C7VA 2KBIA 2L51A 2Y5IA 1EJ3A 2ERBA 1M46A 1VRKA 1YX8A 4I5KA 1PULA 4YBHB 1RROA 4CFQA 1Z2CB 1QIWA 1A75B 2LLTA 3PM8A 4AQJA 2SCPA 1OOIX 2KFGA 2WC8A 4E68A 4KYNA 2KQ6A 2ZKMX 2LAPA 1KQVA 1F4OA 4USLA 1NP8A 1SL7A 1FW4A 1BOCA 1SKTA 2M97A 1BODA 4N5XA 1A75A 1Y1AA 3JVTC 3OB2B 2JNFA 5HKWA 1D1OA 1QVIZ 1NX2A 2AMIA 2LLUA 1SR6C 4FTGA 3R72A 4HREE 2PVBA 4UPGA 2BECA 1GQMA 2LMUA 1LA3A 3CR5X 2KLEA 2ZNEA 3RZSA 1Y1XA 2OTGB 3R1PA 4QJ3B 3FS7A 1ODBA 1W7JB 2KYCA 1IG5A 3DVKA 3D77A 3O78A 5DICA 2QEVA 4PHMA 3FIAA 2G2BA 3GOFA 1CLLA 1QLKA 1EL4A 3DYEA 3KEVA 3LL8B 4A4BA 4OCIA 3BFAA 2QPTA 2MAZA 1F4QA 1YUUA 4C0LA 2QACA 5CSIA 4C0KA 2CXJA 1A03A 1AP4A 1KQMB 4ICBA 3I5IC 1BF5A 1NSHA 1J7QA 1DVIA 3KPXA 2G9BA 4GGNA 4Q04A 1RTP1 1K9KA 3LK1A 1OE9B 3O4YA 5HYDA 3PLFB 2KFHA 4MN0A 5GQQC 1LVCD 2VRGA 1QS7A 2EGDA 3H4SE 1SBJA 2Q91A 1ZOTB 2M1KB 3SS3A 2QDIA 1XFZO 1DT7B 1GM0A 2M8UA 1S5GY 2WCHA 1NWDA 3PJIA 3JTDC 3VB1A 2L4HA 2KDHA 2KHNA 1PSRA 3F45A 4MZJA 2KGBC 1JF2A 2P6BB 1B7TY 1KSOA 3NHTA 4PE7A 1CFCA 3DF0B 1B1GA 2F2OA 2KI6C 1QLSA 1XA5A 2ZRSA 3R1VA 4NDDA 1IIOA 2K2AA 1TCFA 1Z4HA 1JBAA 1F8HA 1TUZA 2LUXA 1MUXA 1WDCC 1AJ4A 1DJHA 1TOPA 2DOQA 2WCLA 1TTXA 3S0DA 4ETOA 1NIWA 2KFFA 1H4BA 3L4AA 1TNQA 3I5FB 1TRFA 4PHNA 1TN4A 5CSJA 5I94A 2H2KA 2LHLA 4M2PA 1YX7A 4GFTA 2CBLA 1OSAA 2QEBA 1OZSA 3EK8A 2Y1NA 4TNCA 1NUBA 2IS9A 1CKKA 1FPWA 2L2EA 5I8NA 2NCOA 1UWOA 1ALWA 2WCKA 3DD4A 3RLZA 3CR4X 1XK4A 2CTNA 3GK1A 3CYZA 1B8CA 2H61A 2M9GA 2K7BA 1DF0B 1IGVA 1OOJA 2WCMA 5IBWA 1DGVA 1CMFA 3TUYC 1L2OB 5ER4X 4DCKA 3B7AA 2WC6A 3CS1A 1NCYA 1U5IB 4YGEB 1DEKA 1DMOA 2JOJA 4XJKB 1CNPA 3PALA 3NHIA 2JULA 3D73A 3MSEB 4ZCUA 3CLNA 3SG4A 5KSZA 3CDNA 3DXLA 2L2CA 1DF0A 3GK2A 1KWOC 1PALA 2MA2A 1SY9A 1T14A 2BBNA 5FI7A 1SCMC 4PDZA 5DKQA 1RJVA 1Y6WA 4N1GA 4A4CA 1XFUO 3ZNIA 3NSIA 1U5IA 3VRQA 3D0YB 4M2OA 1F70A 1XFRA 1NYAA 1CDNA 5HKZA 1PSBA 2EC6B 4PHKA 3B88A 2WCEA 1TNWA 3I5GB 4QJ5B 2KBMA 2KI6D 1YUTA 1S1EA 2WORA 2I7AA 2JU0A 2K7CA 2BL0B 2M29A 4DS7A 2RGIA 1FI6A 4MSPA 1CTRA 2NLNA 1C07A 1SL8A 1IQ5A 1F54A 4HRHA 2WOSA 3TDZA 3EVRA 4GGFA 1KFXL 1FBVA 2CT9A 3K1EA 4MZKA 3BUXB 1KFUL 2LCPA 3TZ1A 4D1EA 2JNXA 2JXLA 3D76A 3JVTB 5G08A 4JPZB 2I2RE 3SS4A 4AQIA 2KYFA 1ALVA 2JXCA 2M7NA 4CIDA 3E3RA 2CCMA 4MBEA 1LA0A 1SK6D 2A4JA 2KSPA 1K9PA 3CZTX 4MVFA 5D7FA 1JC2A 2KI4B 1F71A 5BPJA 1RECA 2CNPA 2LP3A 4GAOA 4MRXA 1AUIB 1DJGA 1S6IA 1UHHA 1KK8B 2OS8C 1DJYA 3SG6A 4GPLB 3L47A 1GJYA 1QVIY 1UHIA 2BNXA 4C0JA 1L7ZA 1YRTB 2FJYA 1DTLA 3TDUA 1IRJA 3OHMB 5I2OA 1TNXA 1S36A 3BOWB 3PN7B 2K60A 3OBVA 1ZFSA 1JUOA 3EK4A 3NSKA 1TWOA 1TNPA 2K2FA 3IF7A 1LXFC 3CR2A 1CDLA 1QX5B 1XO5A 1OMVA 2LV7A 3WHUB 2ZN9A 2SASA 1C3ZA 1OW4A 1S6JA 4DRWA 1YUSA 2JWWA 1JFJA 2LC5A 3R1OA 1CLBA 3BOWA 2HQWA 3CTNA 2NZ0A 4NDCA 2BAPA 1EXRA 1PVBA 5AEQA 3TDIA 2QEOA 3LCPC 1CDMA 2PRUA 4N1FA 5DKRA 1BT6A 2QEHA 1CFDA 1K95A 1QV1A 4OZDA 2PQLA 2P70A 4GUKA 3SG5A 1K93D 3D78A 2JRFA 1N2DA 1QXPA 2PMYA 5B8IB 4BY4A 2BKIB 1PRWA 2PSRA 3I5HB 1JWDA 4INWA 4FQOA 1UUSA 4CLNA 4MZLA 1ZACA 4ORCB 1SNLA 4PCWA 3PATA 1A4PA 3FWCA 3BXKA 1TUJA 3TS5B 4QJ4B 2AAOA 2WNDA 3A8RA 1KK7Z 1KK7Y 4OVNF 5FYXA 1LINA 1DC1A 2JTTA 3SG2A 4F7FA 1B9AA 2M0RA 4MEWA 2BCXA 4GNKB 3O2PA 3SG7A 2F3ZA 2HQ8A 2LM5A 4L9MA 2MRDA 2MJWB 1Q80A 2F2PA 1BG1A 2L98A 4PE1A 4PHJA 3B6XA 5AFPA 5HL1A 2NCPA 2JT8A 1G8IA 3S0GA 1Y0VH 2OPOA 3EVUA 2FCDA 1YVHA 3SIAA 3DF0A 1S26D 3Q8IA 2FOTA 4PE4A 1TIZA 2MBXA 4CFRA 1XFYO 5JJGA 1ORGA 4IL1A 3NSLA 1DELA 1HT9A 1QV0A 2KAYA 3DVJA 3FE8A 3HX4A 3OB1B 4I5NB 1JSAA 2F8PA 5KU1A 3OP0A 3S0FA 4NQGA 1MQ1A 3WHTB 2GV5A 3BFHA 1B8LA 1UHNA 2PALA 1V1FA 1B8RA 4P2YB 5ER5A 1B47A 5EL2A 2K7OA 5CSNA 1NPQA 1YTZC 1SRAA 3CZ0A 3HCMA 3KHEA 2TN4A 2M7LA 4HRGA 3D75A 3O6BA 3WXAA 2BCAA 1JF0A 3IQOA 3AAKA 5HLVA 1AVSA 1CM4A 3K21A 4GBAA 1QASA 3EG5B 1FF1A 1TCOB 3IQQA 2JPOA 1SCVA
chains in the Genus database with same CATH topology
2P71A 3DYEA 3S0EA 3BFAA 3S0AA 4FQTA 3BJHA 1P28A 3L47A 1OOFA 3N7HA 2FJYA 1LS8A 3QMEA 2QDIA 1GM0A 2WCHA 1TWOA 3PJIA 3VB1A 3CABA 3DZTA 1OOGA 3B86A 3NHTA 3V2LA 1C3ZA 1OW4A 1DQEA 3DY9A 3R1VA 3R1OA 2WCLA 4PT1A 3S0DA 2QEOA 3BFBA 3L4AA 2QEHA 2GTEA 4OZDA 2PQLA 3OGNA 2P70A 1QWVA 3D78A 2QEBA 4INWA 2WCKA 3S0BA 1TUJA 3CYZA 1OOHA 4F7FA 2WCMA 3FE9A 3B7AA 2WC6A 2H8VA 3B6XA 3FE6A 3NHIA 3D73A 3S0GA 2ERBA 3B87A 3CDNA 3DXLA 2L2CA 2KPHA 3Q8IA 1T14A 1OOIX 1ORGA 3L4LA 3FE8A 1XFRA 1C3YA 3S0FA 3CZ1A 3B88A 3BFHA 3CZ2A 2WC5A 5EL2A 3CZ0A 3NGVA 3R72A 3D75A 5DICA 3K1EA 2WCJA 3RZSA 3R1PA 3D74A 3D76A 4JD9A 2JPOA 3D77A 4INXA 2QEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P71 A;  3DYE A;  3S0E A;  3BFA A;  3S0A A;  4FQT A;  3BJH A;  1P28 A;  3L47 A;  1OOF A;  3N7H A;  2FJY A;  1LS8 A;  3QME A;  2QDI A;  1GM0 A;  2WCH A;  1TWO A;  3PJI A;  3VB1 A;  3CAB A;  3DZT A;  1OOG A;  3B86 A;  3NHT A;  3V2L A;  1C3Z A;  1OW4 A;  1DQE A;  3DY9 A;  3R1V A;  3R1O A;  2WCL A;  4PT1 A;  3S0D A;  2QEO A;  3BFB A;  3L4A A;  2QEH A;  2GTE A;  4OZD A;  2PQL A;  3OGN A;  2P70 A;  1QWV A;  3D78 A;  2QEB A;  4INW A;  2WCK A;  3S0B A;  1TUJ A;  3CYZ A;  1OOH A;  4F7F A;  2WCM A;  3FE9 A;  3B7A A;  2WC6 A;  2H8V A;  3B6X A;  3FE6 A;  3NHI A;  3D73 A;  3S0G A;  2ERB A;  3B87 A;  3CDN A;  3DXL A;  2L2C A;  2KPH A;  3Q8I A;  1T14 A;  1OOI X;  1ORG A;  3L4L A;  3FE8 A;  1XFR A;  1C3Y A;  3S0F A;  3CZ1 A;  3B88 A;  3BFH A;  3CZ2 A;  2WC5 A;  5EL2 A;  3CZ0 A;  3NGV A;  3R72 A;  3D75 A;  5DIC A;  3K1E A;  2WCJ A;  3RZS A;  3R1P A;  3D74 A;  3D76 A;  4JD9 A;  2JPO A;  3D77 A;  4INX A;  2QEV A; 
#chains in the Genus database with same CATH topology
 1YVL A;  3I5F C;  1J1E A;  1UHK A;  1XK4 C;  1M45 A;  2L4I A;  1LKJ A;  2H61 C;  1C7W A;  2JC2 A;  1XFW O;  1QJT A;  1WRZ A;  2L5Y A;  3D10 A;  4XJK A;  2EHB A;  2AUC A;  1EH2 A;  3IVT A;  1S6C A;  1WLZ A;  2LP2 A;  2PAS A;  4U8D A;  1MHO A;  5I2L A;  3S0A A;  1J7O A;  2KAX A;  2LVI A;  1DJX A;  5KTY A;  5AAN A;  2F3Y A;  1K94 A;  5D3O A;  1GGW A;  3EVV A;  5CPV A;  2PYQ A;  3WNX B;  2O5G A;  3N7H A;  4P5O E;  2MLE C;  3VRN A;  2NXQ A;  3VRO A;  1J7R A;  1SYM A;  2BCB A;  3AAJ A;  1YUR A;  2M49 B;  3D0Y A;  3OX6 A;  4I5L B;  4WQ3 A;  2WCF A;  3LLE A;  1R2U A;  1PVA A;  3EKJ A;  1L2O C;  1QAT A;  3M0W A;  4DUQ A;  4F0Z B;  1QX2 A;  2OS8 B;  3CAB A;  2LMV A;  3DZT A;  1CB1 A;  1DGU A;  3AKB A;  3PM2 A;  1SR6 B;  2YGU A;  5AER A;  1BMO A;  3B86 A;  2O60 A;  1NCX A;  5I2Q A;  1MF8 B;  3V2L A;  4NDB A;  2LNK A;  1RFJ A;  1DQE A;  5JOL A;  1XFX O;  2M3W A;  3DY9 A;  5TNC A;  1G4Y R;  1RK9 A;  1OQP A;  1EG3 A;  1DJW A;  1OMD A;  2BE6 A;  3SJS A;  1SL9 A;  1BJF A;  1X02 A;  3BFB A;  3RM1 A;  3BQ3 A;  1K9U A;  2V53 A;  2JT0 A;  2LE9 B;  3A4U B;  4GGF C;  2EC6 C;  3I5G C;  3EK7 A;  1ZUZ A;  3SIB A;  2BL0 C;  2JTZ A;  4M2Q A;  1AHR A;  3I5I B;  2COL B;  2KLD A;  3UNW A;  4BY5 A;  1DJI A;  2MHH A;  2ZFD A;  5AXI A;  1W7I B;  2JZI A;  1A29 A;  3GK4 X;  1W9Z A;  1A2X A;  2E6W A;  1E8A A;  1J55 A;  2I94 A;  2Y1M A;  3O4X A;  4IJ7 A;  1HQV A;  1MXE A;  1QIV A;  1UUR A;  2KNE A;  2WCB A;  1ZMZ A;  2ZN8 A;  1RWY A;  3BYA A;  2L50 A;  1XVJ A;  4OKH A;  3ZWH A;  2H8V A;  3JTD B;  4JQ0 D;  1SSE B;  3FE6 A;  2KI4 C;  1KCY A;  5DKN A;  1BR1 B;  2ZND A;  3VRP A;  1IH0 A;  3B87 A;  2KOT A;  1OMR A;  2KPH A;  2D8N A;  4I5J A;  2JPT A;  2K61 A;  1KK8 C;  1MWN A;  2GGM A;  1CM1 A;  1WDC B;  1WLM A;  3L4L A;  1GGZ A;  2L0P A;  2B1U A;  1QTX A;  2FCE A;  1CLM A;  1NX3 A;  4AOM A;  5PAL A;  2LMT A;  1C3Y A;  1PK0 D;  2KAV A;  2MLF C;  3CZ1 A;  1XFV O;  4ZCV A;  4CPV A;  1H8B A;  1SMG A;  1KFX S;  3CZ2 A;  3PN7 C;  1MXL C;  2OTG C;  2WC5 A;  2LHI A;  4JWQ A;  1KFU S;  5FI2 A;  1IQ3 A;  1SW8 A;  3NGV A;  4ORB B;  1OZO A;  1NX1 A;  2KGR A;  2BE4 A;  1R6P A;  2L5X B;  1WRL A;  2HF5 A;  3SG3 A;  4DIR A;  4XYN A;  2R2I A;  1S3P A;  1WY9 A;  5J3X A;  1CFP A;  1CMG A;  3DVM A;  1WRK A;  2WCJ A;  2BKH B;  4YRU A;  2FJU B;  1KQM C;  1S5G Z;  3D74 A;  4YGC B;  2LLS A;  3OX5 A;  4OV2 A;  4JD9 A;  1QX7 A;  2JT3 A;  1NX0 A;  3TUY B;  3BUN B;  1XYD A;  4INX A;  2P71 A;  2ISD A;  1B7T Z;  3S0E A;  1YR5 A;  1UP5 A;  2JQ6 A;  4MLW A;  4YGB B;  1N0Y A;  2E30 A;  2LVK A;  2KQY A;  1YRU B;  3BUW B;  3KO0 A;  4WQ2 A;  3I5H C;  1N65 A;  4FQT A;  1KWO B;  4MRY A;  3BJH A;  2M1U A;  1KSM A;  3ICB A;  4YI9 A;  1SCM B;  3FWB A;  1P28 A;  3TS5 C;  1OOF A;  2Q4U A;  3VGO A;  1G33 A;  1CDP A;  4ORA B;  1M39 A;  1NCZ A;  4PAL A;  4R1E A;  4OR9 B;  1UHJ A;  3C1V A;  1LS8 A;  5HLO A;  1BLQ A;  2BBM A;  3QME A;  3KF9 A;  1AK8 A;  3NSO A;  5F6T A;  2HPS A;  2K7D A;  1SPY A;  2F33 A;  2LAN A;  3VRR A;  1FI5 A;  5HKY A;  1OOG A;  4JKT A;  5K89 A;  1AJ5 A;  1J7P A;  2LUC A;  3AKA A;  3CWG A;  3EKH A;  1F55 A;  3BUM B;  3LK0 A;  2Y4Q A;  1IWQ A;  2LVJ A;  1B4C A;  4WRI A;  4PT1 A;  1K90 D;  2K8M B;  4HSZ A;  1JFK A;  1Y1U A;  1EG4 A;  1CFF A;  2GTE A;  3OGN A;  1BU3 A;  1M31 A;  1QWV A;  4YGA A;  5D69 A;  3QRX A;  3SS5 A;  4YI8 A;  1IKU A;  1K96 A;  1J1D A;  1BR4 B;  3DVE A;  3CGA A;  3PSR A;  3UO9 A;  1K8U A;  2HET A;  3S0B A;  3NXA A;  5FI6 A;  1IJ6 A;  1K2H A;  1M63 B;  2ZRT A;  1OOH A;  1V1G A;  4YGD B;  2LVV A;  1DJZ A;  2K0J A;  1MR8 A;  2GGZ A;  3FE9 A;  3PFV A;  3BUO B;  2I18 A;  4PE0 A;  5CSF A;  1IJ5 A;  1C7V A;  2KBI A;  2L51 A;  2Y5I A;  1EJ3 A;  2ERB A;  1M46 A;  1VRK A;  1YX8 A;  4I5K A;  1PUL A;  4YBH B;  1RRO A;  4CFQ A;  1Z2C B;  1QIW A;  1A75 B;  2LLT A;  3PM8 A;  4AQJ A;  2SCP A;  1OOI X;  2KFG A;  2WC8 A;  4E68 A;  4KYN A;  2KQ6 A;  2ZKM X;  2LAP A;  1KQV A;  1F4O A;  4USL A;  1NP8 A;  1SL7 A;  1FW4 A;  1BOC A;  1SKT A;  2M97 A;  1BOD A;  4N5X A;  1A75 A;  1Y1A A;  3JVT C;  3OB2 B;  2JNF A;  5HKW A;  1D1O A;  1QVI Z;  1NX2 A;  2AMI A;  2LLU A;  1SR6 C;  4FTG A;  3R72 A;  4HRE E;  2PVB A;  4UPG A;  2BEC A;  1GQM A;  2LMU A;  1LA3 A;  3CR5 X;  2KLE A;  2ZNE A;  3RZS A;  1Y1X A;  2OTG B;  3R1P A;  4QJ3 B;  3FS7 A;  1ODB A;  1W7J B;  2KYC A;  1IG5 A;  3DVK A;  3D77 A;  3O78 A;  5DIC A;  2QEV A;  4PHM A;  3FIA A;  2G2B A;  3GOF A;  1CLL A;  1QLK A;  1EL4 A;  3DYE A;  3KEV A;  3LL8 B;  4A4B A;  4OCI A;  3BFA A;  2QPT A;  2MAZ A;  1F4Q A;  1YUU A;  4C0L A;  2QAC A;  5CSI A;  4C0K A;  2CXJ A;  1A03 A;  1AP4 A;  1KQM B;  4ICB A;  3I5I C;  1BF5 A;  1NSH A;  1J7Q A;  1DVI A;  3KPX A;  2G9B A;  4GGN A;  4Q04 A;  1RTP 1;  1K9K A;  3LK1 A;  1OE9 B;  3O4Y A;  5HYD A;  3PLF B;  2KFH A;  4MN0 A;  5GQQ C;  1LVC D;  2VRG A;  1QS7 A;  2EGD A;  3H4S E;  1SBJ A;  2Q91 A;  1ZOT B;  2M1K B;  3SS3 A;  2QDI A;  1XFZ O;  1DT7 B;  1GM0 A;  2M8U A;  1S5G Y;  2WCH A;  1NWD A;  3PJI A;  3JTD C;  3VB1 A;  2L4H A;  2KDH A;  2KHN A;  1PSR A;  3F45 A;  4MZJ A;  2KGB C;  1JF2 A;  2P6B B;  1B7T Y;  1KSO A;  3NHT A;  4PE7 A;  1CFC A;  3DF0 B;  1B1G A;  2F2O A;  2KI6 C;  1QLS A;  1XA5 A;  2ZRS A;  3R1V A;  4NDD A;  1IIO A;  2K2A A;  1TCF A;  1Z4H A;  1JBA A;  1F8H A;  1TUZ A;  2LUX A;  1MUX A;  1WDC C;  1AJ4 A;  1DJH A;  1TOP A;  2DOQ A;  2WCL A;  1TTX A;  3S0D A;  4ETO A;  1NIW A;  2KFF A;  1H4B A;  3L4A A;  1TNQ A;  3I5F B;  1TRF A;  4PHN A;  1TN4 A;  5CSJ A;  5I94 A;  2H2K A;  2LHL A;  4M2P A;  1YX7 A;  4GFT A;  2CBL A;  1OSA A;  2QEB A;  1OZS A;  3EK8 A;  2Y1N A;  4TNC A;  1NUB A;  2IS9 A;  1CKK A;  1FPW A;  2L2E A;  5I8N A;  2NCO A;  1UWO A;  1ALW A;  2WCK A;  3DD4 A;  3RLZ A;  3CR4 X;  1XK4 A;  2CTN A;  3GK1 A;  3CYZ A;  1B8C A;  2H61 A;  2M9G A;  2K7B A;  1DF0 B;  1IGV A;  1OOJ A;  2WCM A;  5IBW A;  1DGV A;  1CMF A;  3TUY C;  1L2O B;  5ER4 X;  4DCK A;  3B7A A;  2WC6 A;  3CS1 A;  1NCY A;  1U5I B;  4YGE B;  1DEK A;  1DMO A;  2JOJ A;  4XJK B;  1CNP A;  3PAL A;  3NHI A;  2JUL A;  3D73 A;  3MSE B;  4ZCU A;  3CLN A;  3SG4 A;  5KSZ A;  3CDN A;  3DXL A;  2L2C A;  1DF0 A;  3GK2 A;  1KWO C;  1PAL A;  2MA2 A;  1SY9 A;  1T14 A;  2BBN A;  5FI7 A;  1SCM C;  4PDZ A;  5DKQ A;  1RJV A;  1Y6W A;  4N1G A;  4A4C A;  1XFU O;  3ZNI A;  3NSI A;  1U5I A;  3VRQ A;  3D0Y B;  4M2O A;  1F70 A;  1XFR A;  1NYA A;  1CDN A;  5HKZ A;  1PSB A;  2EC6 B;  4PHK A;  3B88 A;  2WCE A;  1TNW A;  3I5G B;  4QJ5 B;  2KBM A;  2KI6 D;  1YUT A;  1S1E A;  2WOR A;  2I7A A;  2JU0 A;  2K7C A;  2BL0 B;  2M29 A;  4DS7 A;  2RGI A;  1FI6 A;  4MSP A;  1CTR A;  2NLN A;  1C07 A;  1SL8 A;  1IQ5 A;  1F54 A;  4HRH A;  2WOS A;  3TDZ A;  3EVR A;  4GGF A;  1KFX L;  1FBV A;  2CT9 A;  3K1E A;  4MZK A;  3BUX B;  1KFU L;  2LCP A;  3TZ1 A;  4D1E A;  2JNX A;  2JXL A;  3D76 A;  3JVT B;  5G08 A;  4JPZ B;  2I2R E;  3SS4 A;  4AQI A;  2KYF A;  1ALV A;  2JXC A;  2M7N A;  4CID A;  3E3R A;  2CCM A;  4MBE A;  1LA0 A;  1SK6 D;  2A4J A;  2KSP A;  1K9P A;  3CZT X;  4MVF A;  5D7F A;  1JC2 A;  2KI4 B;  1F71 A;  5BPJ A;  1REC A;  2CNP A;  2LP3 A;  4GAO A;  4MRX A;  1AUI B;  1DJG A;  1S6I A;  1UHH A;  1KK8 B;  2OS8 C;  1DJY A;  3SG6 A;  4GPL B;  3L47 A;  1GJY A;  1QVI Y;  1UHI A;  2BNX A;  4C0J A;  1L7Z A;  1YRT B;  2FJY A;  1DTL A;  3TDU A;  1IRJ A;  3OHM B;  5I2O A;  1TNX A;  1S36 A;  3BOW B;  3PN7 B;  2K60 A;  3OBV A;  1ZFS A;  1JUO A;  3EK4 A;  3NSK A;  1TWO A;  1TNP A;  2K2F A;  3IF7 A;  1LXF C;  3CR2 A;  1CDL A;  1QX5 B;  1XO5 A;  1OMV A;  2LV7 A;  3WHU B;  2ZN9 A;  2SAS A;  1C3Z A;  1OW4 A;  1S6J A;  4DRW A;  1YUS A;  2JWW A;  1JFJ A;  2LC5 A;  3R1O A;  1CLB A;  3BOW A;  2HQW A;  3CTN A;  2NZ0 A;  4NDC A;  2BAP A;  1EXR A;  1PVB A;  5AEQ A;  3TDI A;  2QEO A;  3LCP C;  1CDM A;  2PRU A;  4N1F A;  5DKR A;  1BT6 A;  2QEH A;  1CFD A;  1K95 A;  1QV1 A;  4OZD A;  2PQL A;  2P70 A;  4GUK A;  3SG5 A;  1K93 D;  3D78 A;  2JRF A;  1N2D A;  1QXP A;  2PMY A;  5B8I B;  4BY4 A;  2BKI B;  1PRW A;  2PSR A;  3I5H B;  1JWD A;  4INW A;  4FQO A;  1UUS A;  4CLN A;  4MZL A;  1ZAC A;  4ORC B;  1SNL A;  4PCW A;  3PAT A;  1A4P A;  3FWC A;  3BXK A;  1TUJ A;  3TS5 B;  4QJ4 B;  2AAO A;  2WND A;  3A8R A;  1KK7 Z;  1KK7 Y;  4OVN F;  5FYX A;  1LIN A;  1DC1 A;  2JTT A;  3SG2 A;  4F7F A;  1B9A A;  2M0R A;  4MEW A;  2BCX A;  4GNK B;  3O2P A;  3SG7 A;  2F3Z A;  2HQ8 A;  2LM5 A;  4L9M A;  2MRD A;  2MJW B;  1Q80 A;  2F2P A;  1BG1 A;  2L98 A;  4PE1 A;  4PHJ A;  3B6X A;  5AFP A;  5HL1 A;  2NCP A;  2JT8 A;  1G8I A;  3S0G A;  1Y0V H;  2OPO A;  3EVU A;  2FCD A;  1YVH A;  3SIA A;  3DF0 A;  1S26 D;  3Q8I A;  2FOT A;  4PE4 A;  1TIZ A;  2MBX A;  4CFR A;  1XFY O;  5JJG A;  1ORG A;  4IL1 A;  3NSL A;  1DEL A;  1HT9 A;  1QV0 A;  2KAY A;  3DVJ A;  3FE8 A;  3HX4 A;  3OB1 B;  4I5N B;  1JSA A;  2F8P A;  5KU1 A;  3OP0 A;  3S0F A;  4NQG A;  1MQ1 A;  3WHT B;  2GV5 A;  3BFH A;  1B8L A;  1UHN A;  2PAL A;  1V1F A;  1B8R A;  4P2Y B;  5ER5 A;  1B47 A;  5EL2 A;  2K7O A;  5CSN A;  1NPQ A;  1YTZ C;  1SRA A;  3CZ0 A;  3HCM A;  3KHE A;  2TN4 A;  2M7L A;  4HRG A;  3D75 A;  3O6B A;  3WXA A;  2BCA A;  1JF0 A;  3IQO A;  3AAK A;  5HLV A;  1AVS A;  1CM4 A;  3K21 A;  4GBA A;  1QAS A;  3EG5 B;  1FF1 A;  1TCO B;  3IQQ A;  2JPO A;  1SCV A; 
#chains in the Genus database with same CATH homology
 2P71 A;  3DYE A;  3S0E A;  3BFA A;  3S0A A;  4FQT A;  3BJH A;  1P28 A;  3L47 A;  1OOF A;  3N7H A;  2FJY A;  1LS8 A;  3QME A;  2QDI A;  1GM0 A;  2WCH A;  1TWO A;  3PJI A;  3VB1 A;  3CAB A;  3DZT A;  1OOG A;  3B86 A;  3NHT A;  3V2L A;  1C3Z A;  1OW4 A;  1DQE A;  3DY9 A;  3R1V A;  3R1O A;  2WCL A;  4PT1 A;  3S0D A;  2QEO A;  3BFB A;  3L4A A;  2QEH A;  2GTE A;  4OZD A;  2PQL A;  3OGN A;  2P70 A;  1QWV A;  3D78 A;  2QEB A;  4INW A;  2WCK A;  3S0B A;  1TUJ A;  3CYZ A;  1OOH A;  4F7F A;  2WCM A;  3FE9 A;  3B7A A;  2WC6 A;  2H8V A;  3B6X A;  3FE6 A;  3NHI A;  3D73 A;  3S0G A;  2ERB A;  3B87 A;  3CDN A;  3DXL A;  2L2C A;  2KPH A;  3Q8I A;  1T14 A;  1OOI X;  1ORG A;  3L4L A;  3FE8 A;  1XFR A;  1C3Y A;  3S0F A;  3CZ1 A;  3B88 A;  3BFH A;  3CZ2 A;  2WC5 A;  5EL2 A;  3CZ0 A;  3NGV A;  3R72 A;  3D75 A;  5DIC A;  3K1E A;  2WCJ A;  3RZS A;  3R1P A;  3D74 A;  3D76 A;  4JD9 A;  2JPO A;  3D77 A;  4INX A;  2QEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...