3RZSA

Apis mellifera obp14 in complex with ta6br14
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 43
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3rzsA00
2P70A 3R1PA 2QEBA 3NHTA 3PJIA 3S0DA 3R1OA 3V2LA 1DQEA 4OZDA 3B7AA 3S0EA 2QEVA 2QEHA 3BJHA 3B86A 3B88A 1OOGA 3RZSA 2WC5A 2H8VA 3BFBA 1XFRA 3FE9A 3R72A 3CABA 3N7HA 3CYZA 4JD9A 3DY9A 2KPHA 1ORGA 3Q8IA 2WCHA 3NHIA 2P71A 1C3YA 2WCLA 3CZ1A 1OOFA 2PQLA 3CZ2A 3L4AA 3D75A 1QWVA 2WC6A 3CDNA 3QMEA 2WCJA 1T14A 3S0FA 5EL2A 3D76A 1GM0A 2WCKA 3S0AA 3DXLA 5DICA 3FE8A 3CZ0A 3D77A 3OGNA 1LS8A 3D73A 2FJYA 3DYEA 1TWOA 3D74A 3DZTA 2JPOA 4F7FA 2WCMA 3S0BA 1OW4A 2QDIA 1TUJA 3S0GA 1OOIX 1OOHA 2ERBA 2L2CA 3K1EA 2GTEA 3FE6A 3BFAA 3B6XA 2QEOA 3R1VA 4INWA 3L47A 4FQTA 1C3ZA 3VB1A 3NGVA 3B87A 4INXA 4PT1A 3BFHA 1P28A 3L4LA 3D78A
chains in the Genus database with same CATH superfamily
1CNPA 2P70A 4OR9B 4MLWA 1YX7A 2QEBA 1LINA 2K2FA 2QACA 1IJ5A 1MQ1A 3OHMB 1SCMC 3R1OA 2JWWA 2K61A 3PN7B 4L9MA 2JXCA 4OZDA 1JFJA 2HETA 1N2DA 3B7AA 1BMOA 1NWDA 1DGVA 1DJZA 3OX5A 2BCXA 3EK7A 2Y1NA 3BJHA 3B88A 3GK1A 3CR2A 4PHNA 4PALA 3SS3A 1DMOA 5CSFA 3VRRA 5KTYA 3TUYC 1K9UA 1IRJA 5HKZA 1Y0VH 2KFHA 2OS8C 4YI8A 5HLVA 1SY9A 4ORCB 1SYMA 4M2OA 1MUXA 1XK4C 1CDPA 2LLSA 1C07A 1F55A 1SR6C 3DY9A 1SK6D 3BOWA 1AK8A 1QS7A 1MHOA 3Q8IA 2HQ8A 2M49B 2NCPA 2O60A 1SL9A 4C0JA 3DVJA 1S5GY 1H8BA 1XVJA 1C3YA 1F54A 2M29A 2WCFA 1K90D 1FBVA 3FWBA 2ZKMX 1LA3A 3CZ1A 2LLTA 5FI2A 1YUTA 2PQLA 3L4AA 4PE0A 2M7LA 4I5KA 2SCPA 1B1GA 2CT9A 1MXEA 1QX7A 3D0YB 1QVIY 1HQVA 2JNFA 1M46A 4N1GA 4OKHA 1T14A 4P5OE 5AERA 1NCZA 1CM4A 4GFTA 4WRIA 1M39A 3CS1A 2KGRA 4GNKB 1CB1A 2LP2A 3D76A 3CLNA 1PVBA 3DF0B 1RJVA 1QV0A 3S0AA 2CCMA 1DT7B 1ODBA 1GGWA 1S1EA 1YVLA 2G2BA 3WHTB 2KDHA 1V1GA 3LK1A 2PMYA 4PE1A 5I2QA 3EVRA 2LVKA 5DKNA 3SG5A 1SRAA 4DIRA 5I2OA 1IIOA 3LL8B 2BBNA 3DYEA 2EGDA 3O78A 3FS7A 3WHUB 2BE4A 1YRUB 1XFWO 1KFXS 1C7VA 2JPOA 2KLDA 1KQVA 1SMGA 4M2QA 2LMUA 1MXLC 2JOJA 2M7NA 1PSRA 3CZTX 1BF5A 4C0LA 1CFPA 4BY4A 3S0GA 1OZSA 2COLB 4DCKA 1CDMA 4PHKA 3D10A 3C1VA 1Y6WA 2KBMA 1CKKA 1NYAA 3VRPA 2L2CA 2O5GA 2PYQA 4ZCUA 3I5FB 3EKHA 2AUCA 2L5XB 3I5IC 1FPWA 1Y1UA 3L47A 1W7JB 1C3ZA 2KAXA 1DJYA 1L2OB 2Q91A 3HCMA 3OX6A 3D78A 1A03A 2LM5A 4C0KA 1NSHA 3NGVA 4I5JA 1SSEB 2EC6B 4INXA 2KI4C 1KQMC 1CMFA 3BFHA 2L51A 3QRXA 3SIAA 1JF0A 3A8RA 2GV5A 4MZJA 1K93D 1P28A 1JFKA 2IS9A 4YGCB 4A4CA 3BQ3A 2E6WA 2WORA 1S36A 2F2PA 3FIAA 1JF2A 1OE9B 2H61C 1Y1AA 1TNPA 3BUOB 3SG7A 3DVKA 1TNXA 1BJFA 1QLSA 5DKRA 2JU0A 1N0YA 1XFVO 1EH2A 2HQWA 1DJGA 2KSPA 2LAPA 2QPTA 3I5GC 3OB2B 3PFVA 3ZNIA 1CMGA 1H4BA 1BR1B 5CSNA 2BBMA 3S0EA 1WRLA 4NQGA 4DRWA 2BE6A 3JVTC 3GOFA 1OOGA 5D3OA 2G9BA 3VROA 3RZSA 1FF1A 1J1EA 2LCPA 2H8VA 4YGDB 4YRUA 2B1UA 1J7QA 2I18A 3I5HB 3FE9A 1WDCB 3AAKA 2TN4A 2KGBC 2PSRA 3PM2A 2GGMA 3IF7A 3N7HA 1G8IA 1PRWA 2KPHA 3TS5C 2KI6C 4AQIA 1DF0A 1XO5A 1PSBA 1CFCA 2OTGB 1KCYA 2Y4QA 4YBHB 4CFRA 1RTP1 2P71A 1KSOA 2WCLA 1ALVA 1ZMZA 2LUCA 1OOFA 4MN0A 4HRHA 1XFYO 2ZN9A 5IBWA 5B8IB 3OBVA 2AAOA 4FTGA 1D1OA 1J1DA 1QWVA 1IWQA 5FYXA 2ZN8A 3TZ1A 1OZOA 2WC6A 4JPZB 2LANA 1A4PA 2JPTA 3PN7C 1TTXA 3QMEA 4DS7A 2JC2A 1B7TY 4MEWA 5G08A 5JOLA 1UHIA 1AVSA 5EL2A 1S6IA 1UUSA 2DOQA 1GM0A 1QIWA 4QJ4B 1M45A 5TNCA 2LNKA 1JC2A 1S6JA 3HX4A 1NCXA 1F4OA 3EK8A 2JZIA 1NX3A 3DXLA 3FE8A 1NX1A 1AJ5A 1SL8A 1U5IB 5I8NA 2Y1MA 1WRZA 1CFDA 3D77A 2LV7A 3GK4X 5D69A 1QASA 2H61A 3SS4A 5FI7A 2WC8A 1L7ZA 1KK8B 1IQ5A 3PALA 1BOCA 1SR6B 2CBLA 2K2AA 3OP0A 4OCIA 1YRTB 4CIDA 1EXRA 4IJ7A 1B4CA 1OQPA 1DTLA 1EL4A 3BXKA 5CSJA 1TWOA 1SPYA 3D74A 1DJIA 3NSIA 1CLLA 2KQ6A 1A75B 1DVIA 1LA0A 1RK9A 3CTNA 1QIVA 1QVIZ 2GGZA 3AKAA 4XJKB 2WCEA 3SJSA 2BCAA 2JT3A 3TDIA 1PVAA 3DVMA 4NDDA 1OOIX 3BUNB 1OOHA 1F70A 1OOJA 2LUXA 1LVCD 3LLEA 3VRNA 3K1EA 1YUSA 2GTEA 3TDZA 1MR8A 1JWDA 1W7IB 4P2YB 3CR4X 1KFXL 4MVFA 2EHBA 1B9AA 1QXPA 3VB1A 2LE9B 1S26D 4PT1A 1ZUZA 1CLMA 1UHJA 4GAOA 1QATA 1CDNA 1SKTA 3GK2A 2K7DA 2ZNEA 2JTZA 2NCOA 2KYFA 3KF9A 5JJGA 3L4LA 3DD4A 1CM1A 3PM8A 4YI9A 4QJ3B 1A2XA 3VGOA 1SNLA 1JSAA 1YX8A 2MLFC 4N5XA 2ZNDA 3FWCA 1EG3A 3R1PA 1BU3A 1CTRA 1CFFA 1DF0B 1J7RA 3NHTA 3LCPC 3PJIA 3S0DA 1DJXA 3H4SE 4GGFC 1SW8A 1SBJA 1XYDA 1S3PA 3V2LA 2HPSA 2ZRSA 2M8UA 2L4HA 3TDUA 4Q04A 3SG4A 1RWYA 2MJWB 1KK7Y 2QEHA 1M63B 1KFUS 1TCOB 3KHEA 2PASA 1UWOA 1X02A 3BFBA 3I5FC 4MBEA 1B8CA 1DJWA 1V1FA 2L50A 1CLBA 3I5IB 2NZ0A 2JXLA 5FI6A 4GBAA 3CABA 2PVBA 5HYDA 3LK0A 4NDBA 3CYZA 2FOTA 2L2EA 2HF5A 1RECA 5HLOA 5CPVA 1NX2A 4R1EA 3O4XA 4PE7A 1TIZA 1KQMB 3BOWB 2MBXA 2RGIA 1GJYA 1K96A 4YGEB 2LVVA 1UURA 1RFJA 1TOPA 3WXAA 2BAPA 2BCBA 3NXAA 3CZ2A 2K60A 3D75A 2KBIA 3K21A 1PALA 3SG3A 3CDNA 4HREE 1F4QA 4UPGA 2LVJA 1UHHA 1AUIB 1UHKA 1Z4HA 1J7PA 3DF0A 4PE4A 1ZOTB 5GQQC 3UNWA 2K7BA 3S0FA 3PSRA 4ZCVA 5ER4X 2K7CA 2M97A 1XFZO 2I7AA 2JTTA 1UP5A 3EVUA 1A29A 5DICA 3JTDC 2L4IA 4ORBB 1WDCC 3KO0A 4I5LB 5AFPA 3OGNA 3ZWHA 1Z2CB 1S6CA 1BT6A 4MRXA 1GGZA 1KWOC 1LS8A 2BECA 4ICBA 4E68A 1DEKA 2JT0A 2K8MB 2LMVA 3D73A 3CR5X 4MSPA 2JQ6A 2FJYA 4OVNF 4ORAB 3TS5B 1AJ4A 1FI6A 1AHRA 2BL0B 3WNXB 2KFGA 4WQ3A 2KLEA 4AQJA 1F71A 4GGFA 2JRFA 2JULA 1J7OA 3IQOA 1GQMA 1K9PA 5D7FA 1K95A 1FW4A 2MRDA 1IGVA 1SCMB 1TUZA 3DZTA 2WCMA 5ER5A 1NCYA 1N65A 1YVHA 2PRUA 2VRGA 3S0BA 5J3XA 1OW4A 2QDIA 1TUJA 1K9KA 1KSMA 1B8RA 3EG5B 3CGAA 4HSZA 1PULA 1R2UA 2YGUA 3TUYB 4QJ5B 2BKIB 1IG5A 4GPLB 3IQQA 3FE6A 2MLEC 3BFAA 5KU1A 1LKJA 2OS8B 1UHNA 4INWA 4FQTA 1S5GZ 2FJUB 4PHJA 1JBAA 1NUBA 4F0ZB 3OB1B 3B87A 5HKYA 1MF8B 1YTZC 1QJTA 1DC1A 2D8NA 5BPJA 3EVVA 5HL1A 1WRKA 1RROA 2JNXA 2PALA 4YGAA 2CNPA 4NDCA 4N1FA 4DUQA 1KK8C 2K7OA 5AANA 2FCEA 1F8HA 4KYNA 1ALWA 1TN4A 1TNWA 1DQEA 4TNCA 2Y5IA 4JWQA 2JT8A 2QEVA 3BUWB 3B86A 1QLKA 2L5YA 1EJ3A 2WC5A 5KSZA 1K8UA 3SG2A 1J55A 1IQ3A 1VRKA 1C7WA 1DGUA 1G33A 1TRFA 1OMDA 2KYCA 4M2PA 4D1EA 1WLZA 1XFRA 2M3WA 3EK4A 4FQOA 2WOSA 3R72A 1QV1A 4PDZA 4JD9A 3SG6A 2WCBA 2MHHA 3BUXB 4MRYA 4PCWA 3MSEB 3SS5A 1ORGA 4HRGA 1OMRA 2WCHA 3NHIA 1XFXO 2I2RE 1KFUL 3O6BA 1XA5A 1W9ZA 2M1KB 5HKWA 1K2HA 3RLZA 1IH0A 2F33A 2L98A 2MAZA 5I94A 1DELA 1QTXA 2Q4UA 1KK7Z 3E3RA 4JQ0D 4OV2A 1QX2A 2CTNA 2KFFA 1IJ6A 4U8DA 1YUUA 1Y1XA 2KOTA 3KPXA 2MA2A 2KHNA 2LC5A 2E30A 2WCJA 2KI6D 3VRQA 5AXIA 4MZKA 2LVIA 1LXFC 2SASA 2ZFDA 1L2OC 3DVEA 3CWGA 1SCVA 1FI5A 1WLMA 2F2OA 1TCFA 2F8PA 1DJHA 1SL7A 2V53A 2EC6C 1U5IA 1M31A 2WCKA 4BY5A 4XYNA 1CDLA 2KI4B 1Q80A 3PATA 2K0JA 1YURA 2WNDA 1QX5B 3CZ0A 2BNXA 1XK4A 3ICBA 1ZFSA 4GUKA 3RM1A 4AOMA 1BG1A 2KNEA 3NSLA 1R6PA 1TNQA 2KAVA 2L0PA 4YGBB 5I2LA 4ETOA 5DKQA 1EG4A 3EKJA 1NPQA 2M9GA 3A4UB 3D0YA 2CXJA 2M0RA 1A75A 1NIWA 2OPOA 2KQYA 1B47A 4WQ2A 2R2IA 4XJKA 5AEQA 2ZRTA 2P6BB 1E8AA 1YR5A 2ISDA 4F7FA 2M1UA 3I5GB 1BODA 1OSAA 3AAJA 3NSKA 3SIBA 4I5NB 1G4YR 1MWNA 3IVTA 1AP4A 2KAYA 2BKHB 3AKBA 2F3YA 3BUMB 1HT9A 3JVTB 4PHMA 2H2KA 4USLA 5F6TA 4GGNA 2ERBA 2FCDA 1NP8A 5PALA 2AMIA 2NXQA 1K94A 3O4YA 4JKTA 2F3ZA 3B6XA 3F45A 3I5HC 2QEOA 1B8LA 3R1VA 4IL1A 1WY9A 5K89A 1IKUA 1PK0D 2LP3A 3O2PA 4CPVA 1JUOA 4A4BA 2LMTA 1BLQA 1ZACA 2A4JA 2OTGC 1NX0A 4MZLA 5CSIA 2LHIA 2NLNA 1BR4B 3JTDB 3PLFB 2LLUA 3KEVA 3UO9A 1XFUO 1KWOB 4CLNA 4CFQA 1OMVA 3NSOA 2LHLA 3M0WA 2I94A 3BYAA 1B7TZ 2BL0C
chains in the Genus database with same CATH topology
2P70A 3R1PA 2QEBA 3NHTA 3PJIA 3S0DA 3R1OA 3V2LA 1DQEA 4OZDA 3B7AA 3S0EA 2QEVA 2QEHA 3BJHA 3B86A 3B88A 1OOGA 3RZSA 2WC5A 2H8VA 3BFBA 1XFRA 3FE9A 3R72A 3CABA 3N7HA 3CYZA 4JD9A 3DY9A 2KPHA 1ORGA 3Q8IA 2WCHA 3NHIA 2P71A 1C3YA 2WCLA 3CZ1A 1OOFA 2PQLA 3CZ2A 3L4AA 3D75A 1QWVA 2WC6A 3CDNA 3QMEA 2WCJA 1T14A 3S0FA 5EL2A 3D76A 1GM0A 2WCKA 3S0AA 3DXLA 5DICA 3FE8A 3CZ0A 3D77A 3OGNA 1LS8A 3D73A 2FJYA 3DYEA 1TWOA 3D74A 3DZTA 2JPOA 4F7FA 2WCMA 3S0BA 1OW4A 2QDIA 1TUJA 3S0GA 1OOIX 1OOHA 2ERBA 2L2CA 3K1EA 2GTEA 3FE6A 3BFAA 3B6XA 2QEOA 3R1VA 4INWA 3L47A 4FQTA 1C3ZA 3VB1A 3NGVA 3B87A 4INXA 4PT1A 3BFHA 1P28A 3L4LA 3D78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P70 A;  3R1P A;  2QEB A;  3NHT A;  3PJI A;  3S0D A;  3R1O A;  3V2L A;  1DQE A;  4OZD A;  3B7A A;  3S0E A;  2QEV A;  2QEH A;  3BJH A;  3B86 A;  3B88 A;  1OOG A;  3RZS A;  2WC5 A;  2H8V A;  3BFB A;  1XFR A;  3FE9 A;  3R72 A;  3CAB A;  3N7H A;  3CYZ A;  4JD9 A;  3DY9 A;  2KPH A;  1ORG A;  3Q8I A;  2WCH A;  3NHI A;  2P71 A;  1C3Y A;  2WCL A;  3CZ1 A;  1OOF A;  2PQL A;  3CZ2 A;  3L4A A;  3D75 A;  1QWV A;  2WC6 A;  3CDN A;  3QME A;  2WCJ A;  1T14 A;  3S0F A;  5EL2 A;  3D76 A;  1GM0 A;  2WCK A;  3S0A A;  3DXL A;  5DIC A;  3FE8 A;  3CZ0 A;  3D77 A;  3OGN A;  1LS8 A;  3D73 A;  2FJY A;  3DYE A;  1TWO A;  3D74 A;  3DZT A;  2JPO A;  4F7F A;  2WCM A;  3S0B A;  1OW4 A;  2QDI A;  1TUJ A;  3S0G A;  1OOI X;  1OOH A;  2ERB A;  2L2C A;  3K1E A;  2GTE A;  3FE6 A;  3BFA A;  3B6X A;  2QEO A;  3R1V A;  4INW A;  3L47 A;  4FQT A;  1C3Z A;  3VB1 A;  3NGV A;  3B87 A;  4INX A;  4PT1 A;  3BFH A;  1P28 A;  3L4L A;  3D78 A; 
#chains in the Genus database with same CATH topology
 1CNP A;  2P70 A;  4OR9 B;  4MLW A;  1YX7 A;  2QEB A;  1LIN A;  2K2F A;  2QAC A;  1IJ5 A;  1MQ1 A;  3OHM B;  1SCM C;  3R1O A;  2JWW A;  2K61 A;  3PN7 B;  4L9M A;  2JXC A;  4OZD A;  1JFJ A;  2HET A;  1N2D A;  3B7A A;  1BMO A;  1NWD A;  1DGV A;  1DJZ A;  3OX5 A;  2BCX A;  3EK7 A;  2Y1N A;  3BJH A;  3B88 A;  3GK1 A;  3CR2 A;  4PHN A;  4PAL A;  3SS3 A;  1DMO A;  5CSF A;  3VRR A;  5KTY A;  3TUY C;  1K9U A;  1IRJ A;  5HKZ A;  1Y0V H;  2KFH A;  2OS8 C;  4YI8 A;  5HLV A;  1SY9 A;  4ORC B;  1SYM A;  4M2O A;  1MUX A;  1XK4 C;  1CDP A;  2LLS A;  1C07 A;  1F55 A;  1SR6 C;  3DY9 A;  1SK6 D;  3BOW A;  1AK8 A;  1QS7 A;  1MHO A;  3Q8I A;  2HQ8 A;  2M49 B;  2NCP A;  2O60 A;  1SL9 A;  4C0J A;  3DVJ A;  1S5G Y;  1H8B A;  1XVJ A;  1C3Y A;  1F54 A;  2M29 A;  2WCF A;  1K90 D;  1FBV A;  3FWB A;  2ZKM X;  1LA3 A;  3CZ1 A;  2LLT A;  5FI2 A;  1YUT A;  2PQL A;  3L4A A;  4PE0 A;  2M7L A;  4I5K A;  2SCP A;  1B1G A;  2CT9 A;  1MXE A;  1QX7 A;  3D0Y B;  1QVI Y;  1HQV A;  2JNF A;  1M46 A;  4N1G A;  4OKH A;  1T14 A;  4P5O E;  5AER A;  1NCZ A;  1CM4 A;  4GFT A;  4WRI A;  1M39 A;  3CS1 A;  2KGR A;  4GNK B;  1CB1 A;  2LP2 A;  3D76 A;  3CLN A;  1PVB A;  3DF0 B;  1RJV A;  1QV0 A;  3S0A A;  2CCM A;  1DT7 B;  1ODB A;  1GGW A;  1S1E A;  1YVL A;  2G2B A;  3WHT B;  2KDH A;  1V1G A;  3LK1 A;  2PMY A;  4PE1 A;  5I2Q A;  3EVR A;  2LVK A;  5DKN A;  3SG5 A;  1SRA A;  4DIR A;  5I2O A;  1IIO A;  3LL8 B;  2BBN A;  3DYE A;  2EGD A;  3O78 A;  3FS7 A;  3WHU B;  2BE4 A;  1YRU B;  1XFW O;  1KFX S;  1C7V A;  2JPO A;  2KLD A;  1KQV A;  1SMG A;  4M2Q A;  2LMU A;  1MXL C;  2JOJ A;  2M7N A;  1PSR A;  3CZT X;  1BF5 A;  4C0L A;  1CFP A;  4BY4 A;  3S0G A;  1OZS A;  2COL B;  4DCK A;  1CDM A;  4PHK A;  3D10 A;  3C1V A;  1Y6W A;  2KBM A;  1CKK A;  1NYA A;  3VRP A;  2L2C A;  2O5G A;  2PYQ A;  4ZCU A;  3I5F B;  3EKH A;  2AUC A;  2L5X B;  3I5I C;  1FPW A;  1Y1U A;  3L47 A;  1W7J B;  1C3Z A;  2KAX A;  1DJY A;  1L2O B;  2Q91 A;  3HCM A;  3OX6 A;  3D78 A;  1A03 A;  2LM5 A;  4C0K A;  1NSH A;  3NGV A;  4I5J A;  1SSE B;  2EC6 B;  4INX A;  2KI4 C;  1KQM C;  1CMF A;  3BFH A;  2L51 A;  3QRX A;  3SIA A;  1JF0 A;  3A8R A;  2GV5 A;  4MZJ A;  1K93 D;  1P28 A;  1JFK A;  2IS9 A;  4YGC B;  4A4C A;  3BQ3 A;  2E6W A;  2WOR A;  1S36 A;  2F2P A;  3FIA A;  1JF2 A;  1OE9 B;  2H61 C;  1Y1A A;  1TNP A;  3BUO B;  3SG7 A;  3DVK A;  1TNX A;  1BJF A;  1QLS A;  5DKR A;  2JU0 A;  1N0Y A;  1XFV O;  1EH2 A;  2HQW A;  1DJG A;  2KSP A;  2LAP A;  2QPT A;  3I5G C;  3OB2 B;  3PFV A;  3ZNI A;  1CMG A;  1H4B A;  1BR1 B;  5CSN A;  2BBM A;  3S0E A;  1WRL A;  4NQG A;  4DRW A;  2BE6 A;  3JVT C;  3GOF A;  1OOG A;  5D3O A;  2G9B A;  3VRO A;  3RZS A;  1FF1 A;  1J1E A;  2LCP A;  2H8V A;  4YGD B;  4YRU A;  2B1U A;  1J7Q A;  2I18 A;  3I5H B;  3FE9 A;  1WDC B;  3AAK A;  2TN4 A;  2KGB C;  2PSR A;  3PM2 A;  2GGM A;  3IF7 A;  3N7H A;  1G8I A;  1PRW A;  2KPH A;  3TS5 C;  2KI6 C;  4AQI A;  1DF0 A;  1XO5 A;  1PSB A;  1CFC A;  2OTG B;  1KCY A;  2Y4Q A;  4YBH B;  4CFR A;  1RTP 1;  2P71 A;  1KSO A;  2WCL A;  1ALV A;  1ZMZ A;  2LUC A;  1OOF A;  4MN0 A;  4HRH A;  1XFY O;  2ZN9 A;  5IBW A;  5B8I B;  3OBV A;  2AAO A;  4FTG A;  1D1O A;  1J1D A;  1QWV A;  1IWQ A;  5FYX A;  2ZN8 A;  3TZ1 A;  1OZO A;  2WC6 A;  4JPZ B;  2LAN A;  1A4P A;  2JPT A;  3PN7 C;  1TTX A;  3QME A;  4DS7 A;  2JC2 A;  1B7T Y;  4MEW A;  5G08 A;  5JOL A;  1UHI A;  1AVS A;  5EL2 A;  1S6I A;  1UUS A;  2DOQ A;  1GM0 A;  1QIW A;  4QJ4 B;  1M45 A;  5TNC A;  2LNK A;  1JC2 A;  1S6J A;  3HX4 A;  1NCX A;  1F4O A;  3EK8 A;  2JZI A;  1NX3 A;  3DXL A;  3FE8 A;  1NX1 A;  1AJ5 A;  1SL8 A;  1U5I B;  5I8N A;  2Y1M A;  1WRZ A;  1CFD A;  3D77 A;  2LV7 A;  3GK4 X;  5D69 A;  1QAS A;  2H61 A;  3SS4 A;  5FI7 A;  2WC8 A;  1L7Z A;  1KK8 B;  1IQ5 A;  3PAL A;  1BOC A;  1SR6 B;  2CBL A;  2K2A A;  3OP0 A;  4OCI A;  1YRT B;  4CID A;  1EXR A;  4IJ7 A;  1B4C A;  1OQP A;  1DTL A;  1EL4 A;  3BXK A;  5CSJ A;  1TWO A;  1SPY A;  3D74 A;  1DJI A;  3NSI A;  1CLL A;  2KQ6 A;  1A75 B;  1DVI A;  1LA0 A;  1RK9 A;  3CTN A;  1QIV A;  1QVI Z;  2GGZ A;  3AKA A;  4XJK B;  2WCE A;  3SJS A;  2BCA A;  2JT3 A;  3TDI A;  1PVA A;  3DVM A;  4NDD A;  1OOI X;  3BUN B;  1OOH A;  1F70 A;  1OOJ A;  2LUX A;  1LVC D;  3LLE A;  3VRN A;  3K1E A;  1YUS A;  2GTE A;  3TDZ A;  1MR8 A;  1JWD A;  1W7I B;  4P2Y B;  3CR4 X;  1KFX L;  4MVF A;  2EHB A;  1B9A A;  1QXP A;  3VB1 A;  2LE9 B;  1S26 D;  4PT1 A;  1ZUZ A;  1CLM A;  1UHJ A;  4GAO A;  1QAT A;  1CDN A;  1SKT A;  3GK2 A;  2K7D A;  2ZNE A;  2JTZ A;  2NCO A;  2KYF A;  3KF9 A;  5JJG A;  3L4L A;  3DD4 A;  1CM1 A;  3PM8 A;  4YI9 A;  4QJ3 B;  1A2X A;  3VGO A;  1SNL A;  1JSA A;  1YX8 A;  2MLF C;  4N5X A;  2ZND A;  3FWC A;  1EG3 A;  3R1P A;  1BU3 A;  1CTR A;  1CFF A;  1DF0 B;  1J7R A;  3NHT A;  3LCP C;  3PJI A;  3S0D A;  1DJX A;  3H4S E;  4GGF C;  1SW8 A;  1SBJ A;  1XYD A;  1S3P A;  3V2L A;  2HPS A;  2ZRS A;  2M8U A;  2L4H A;  3TDU A;  4Q04 A;  3SG4 A;  1RWY A;  2MJW B;  1KK7 Y;  2QEH A;  1M63 B;  1KFU S;  1TCO B;  3KHE A;  2PAS A;  1UWO A;  1X02 A;  3BFB A;  3I5F C;  4MBE A;  1B8C A;  1DJW A;  1V1F A;  2L50 A;  1CLB A;  3I5I B;  2NZ0 A;  2JXL A;  5FI6 A;  4GBA A;  3CAB A;  2PVB A;  5HYD A;  3LK0 A;  4NDB A;  3CYZ A;  2FOT A;  2L2E A;  2HF5 A;  1REC A;  5HLO A;  5CPV A;  1NX2 A;  4R1E A;  3O4X A;  4PE7 A;  1TIZ A;  1KQM B;  3BOW B;  2MBX A;  2RGI A;  1GJY A;  1K96 A;  4YGE B;  2LVV A;  1UUR A;  1RFJ A;  1TOP A;  3WXA A;  2BAP A;  2BCB A;  3NXA A;  3CZ2 A;  2K60 A;  3D75 A;  2KBI A;  3K21 A;  1PAL A;  3SG3 A;  3CDN A;  4HRE E;  1F4Q A;  4UPG A;  2LVJ A;  1UHH A;  1AUI B;  1UHK A;  1Z4H A;  1J7P A;  3DF0 A;  4PE4 A;  1ZOT B;  5GQQ C;  3UNW A;  2K7B A;  3S0F A;  3PSR A;  4ZCV A;  5ER4 X;  2K7C A;  2M97 A;  1XFZ O;  2I7A A;  2JTT A;  1UP5 A;  3EVU A;  1A29 A;  5DIC A;  3JTD C;  2L4I A;  4ORB B;  1WDC C;  3KO0 A;  4I5L B;  5AFP A;  3OGN A;  3ZWH A;  1Z2C B;  1S6C A;  1BT6 A;  4MRX A;  1GGZ A;  1KWO C;  1LS8 A;  2BEC A;  4ICB A;  4E68 A;  1DEK A;  2JT0 A;  2K8M B;  2LMV A;  3D73 A;  3CR5 X;  4MSP A;  2JQ6 A;  2FJY A;  4OVN F;  4ORA B;  3TS5 B;  1AJ4 A;  1FI6 A;  1AHR A;  2BL0 B;  3WNX B;  2KFG A;  4WQ3 A;  2KLE A;  4AQJ A;  1F71 A;  4GGF A;  2JRF A;  2JUL A;  1J7O A;  3IQO A;  1GQM A;  1K9P A;  5D7F A;  1K95 A;  1FW4 A;  2MRD A;  1IGV A;  1SCM B;  1TUZ A;  3DZT A;  2WCM A;  5ER5 A;  1NCY A;  1N65 A;  1YVH A;  2PRU A;  2VRG A;  3S0B A;  5J3X A;  1OW4 A;  2QDI A;  1TUJ A;  1K9K A;  1KSM A;  1B8R A;  3EG5 B;  3CGA A;  4HSZ A;  1PUL A;  1R2U A;  2YGU A;  3TUY B;  4QJ5 B;  2BKI B;  1IG5 A;  4GPL B;  3IQQ A;  3FE6 A;  2MLE C;  3BFA A;  5KU1 A;  1LKJ A;  2OS8 B;  1UHN A;  4INW A;  4FQT A;  1S5G Z;  2FJU B;  4PHJ A;  1JBA A;  1NUB A;  4F0Z B;  3OB1 B;  3B87 A;  5HKY A;  1MF8 B;  1YTZ C;  1QJT A;  1DC1 A;  2D8N A;  5BPJ A;  3EVV A;  5HL1 A;  1WRK A;  1RRO A;  2JNX A;  2PAL A;  4YGA A;  2CNP A;  4NDC A;  4N1F A;  4DUQ A;  1KK8 C;  2K7O A;  5AAN A;  2FCE A;  1F8H A;  4KYN A;  1ALW A;  1TN4 A;  1TNW A;  1DQE A;  4TNC A;  2Y5I A;  4JWQ A;  2JT8 A;  2QEV A;  3BUW B;  3B86 A;  1QLK A;  2L5Y A;  1EJ3 A;  2WC5 A;  5KSZ A;  1K8U A;  3SG2 A;  1J55 A;  1IQ3 A;  1VRK A;  1C7W A;  1DGU A;  1G33 A;  1TRF A;  1OMD A;  2KYC A;  4M2P A;  4D1E A;  1WLZ A;  1XFR A;  2M3W A;  3EK4 A;  4FQO A;  2WOS A;  3R72 A;  1QV1 A;  4PDZ A;  4JD9 A;  3SG6 A;  2WCB A;  2MHH A;  3BUX B;  4MRY A;  4PCW A;  3MSE B;  3SS5 A;  1ORG A;  4HRG A;  1OMR A;  2WCH A;  3NHI A;  1XFX O;  2I2R E;  1KFU L;  3O6B A;  1XA5 A;  1W9Z A;  2M1K B;  5HKW A;  1K2H A;  3RLZ A;  1IH0 A;  2F33 A;  2L98 A;  2MAZ A;  5I94 A;  1DEL A;  1QTX A;  2Q4U A;  1KK7 Z;  3E3R A;  4JQ0 D;  4OV2 A;  1QX2 A;  2CTN A;  2KFF A;  1IJ6 A;  4U8D A;  1YUU A;  1Y1X A;  2KOT A;  3KPX A;  2MA2 A;  2KHN A;  2LC5 A;  2E30 A;  2WCJ A;  2KI6 D;  3VRQ A;  5AXI A;  4MZK A;  2LVI A;  1LXF C;  2SAS A;  2ZFD A;  1L2O C;  3DVE A;  3CWG A;  1SCV A;  1FI5 A;  1WLM A;  2F2O A;  1TCF A;  2F8P A;  1DJH A;  1SL7 A;  2V53 A;  2EC6 C;  1U5I A;  1M31 A;  2WCK A;  4BY5 A;  4XYN A;  1CDL A;  2KI4 B;  1Q80 A;  3PAT A;  2K0J A;  1YUR A;  2WND A;  1QX5 B;  3CZ0 A;  2BNX A;  1XK4 A;  3ICB A;  1ZFS A;  4GUK A;  3RM1 A;  4AOM A;  1BG1 A;  2KNE A;  3NSL A;  1R6P A;  1TNQ A;  2KAV A;  2L0P A;  4YGB B;  5I2L A;  4ETO A;  5DKQ A;  1EG4 A;  3EKJ A;  1NPQ A;  2M9G A;  3A4U B;  3D0Y A;  2CXJ A;  2M0R A;  1A75 A;  1NIW A;  2OPO A;  2KQY A;  1B47 A;  4WQ2 A;  2R2I A;  4XJK A;  5AEQ A;  2ZRT A;  2P6B B;  1E8A A;  1YR5 A;  2ISD A;  4F7F A;  2M1U A;  3I5G B;  1BOD A;  1OSA A;  3AAJ A;  3NSK A;  3SIB A;  4I5N B;  1G4Y R;  1MWN A;  3IVT A;  1AP4 A;  2KAY A;  2BKH B;  3AKB A;  2F3Y A;  3BUM B;  1HT9 A;  3JVT B;  4PHM A;  2H2K A;  4USL A;  5F6T A;  4GGN A;  2ERB A;  2FCD A;  1NP8 A;  5PAL A;  2AMI A;  2NXQ A;  1K94 A;  3O4Y A;  4JKT A;  2F3Z A;  3B6X A;  3F45 A;  3I5H C;  2QEO A;  1B8L A;  3R1V A;  4IL1 A;  1WY9 A;  5K89 A;  1IKU A;  1PK0 D;  2LP3 A;  3O2P A;  4CPV A;  1JUO A;  4A4B A;  2LMT A;  1BLQ A;  1ZAC A;  2A4J A;  2OTG C;  1NX0 A;  4MZL A;  5CSI A;  2LHI A;  2NLN A;  1BR4 B;  3JTD B;  3PLF B;  2LLU A;  3KEV A;  3UO9 A;  1XFU O;  1KWO B;  4CLN A;  4CFQ A;  1OMV A;  3NSO A;  2LHL A;  3M0W A;  2I94 A;  3BYA A;  1B7T Z;  2BL0 C; 
#chains in the Genus database with same CATH homology
 2P70 A;  3R1P A;  2QEB A;  3NHT A;  3PJI A;  3S0D A;  3R1O A;  3V2L A;  1DQE A;  4OZD A;  3B7A A;  3S0E A;  2QEV A;  2QEH A;  3BJH A;  3B86 A;  3B88 A;  1OOG A;  3RZS A;  2WC5 A;  2H8V A;  3BFB A;  1XFR A;  3FE9 A;  3R72 A;  3CAB A;  3N7H A;  3CYZ A;  4JD9 A;  3DY9 A;  2KPH A;  1ORG A;  3Q8I A;  2WCH A;  3NHI A;  2P71 A;  1C3Y A;  2WCL A;  3CZ1 A;  1OOF A;  2PQL A;  3CZ2 A;  3L4A A;  3D75 A;  1QWV A;  2WC6 A;  3CDN A;  3QME A;  2WCJ A;  1T14 A;  3S0F A;  5EL2 A;  3D76 A;  1GM0 A;  2WCK A;  3S0A A;  3DXL A;  5DIC A;  3FE8 A;  3CZ0 A;  3D77 A;  3OGN A;  1LS8 A;  3D73 A;  2FJY A;  3DYE A;  1TWO A;  3D74 A;  3DZT A;  2JPO A;  4F7F A;  2WCM A;  3S0B A;  1OW4 A;  2QDI A;  1TUJ A;  3S0G A;  1OOI X;  1OOH A;  2ERB A;  2L2C A;  3K1E A;  2GTE A;  3FE6 A;  3BFA A;  3B6X A;  2QEO A;  3R1V A;  4INW A;  3L47 A;  4FQT A;  1C3Z A;  3VB1 A;  3NGV A;  3B87 A;  4INX A;  4PT1 A;  3BFH A;  1P28 A;  3L4L A;  3D78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...