3CS1A

Flagellar calcium-binding protein (fcabp) from t. cruzi
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
192
structure length
191
Chain Sequence
b'SDKDGKKAKDRKEAWERIRQAIPREKTAEAKQRRIELFKKFDKNETGKLYDEVYSGCLEVLKLDEFTSRVRDITKRAFDKSRTLGSKLENKGSEDFVEFLEFRLMLCYIYDFFELTVMFDEIDASGNMLVDEEEFKRAVPKLEAWGAKVEDPAALFKELDKNGTGSVTFDEFAAWASAVKLDADGDPDNVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar calcium-binding protein
publication title Structural Insights into Membrane Targeting by the Flagellar Calcium-binding Protein (FCaBP), a Myristoylated and Palmitoylated Calcium Sensor in Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Metal binding protein
total genus 74
structure length 191
sequence length 192
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cs1A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cs1A02
1M31A 2TN4A 1GQMA 1LKJA 1B1GA 2M1UA 1EG3A 1QJTA 2CTNA 1TNWA 4WQ2A 1SCVA 2V53A 5B8IB 1NX0A 5J3XA 1HQVA 3FWBA 2OTGC 3ZNIA 1JFKA 3EVUA 2I94A 2K61A 4DRWA 5KSZA 1F70A 2GGMA 5CSFA 3QRXA 1K8UA 1ZOTB 4QJ5B 1XA5A 3PN7C 2LMVA 1KFUL 2R2IA 1WLZA 4HRGA 4N5XA 1B4CA 3I5HB 1AK8A 2IS9A 3BUMB 1S6IA 1SL7A 2LP3A 3OHMB 1CLMA 5AXIA 1KQMB 1CM4A 2M7NA 2M9GA 1EL4A 2LMTA 2LLSA 1MUXA 1SL9A 1QVIZ 1YX7A 3NSOA 5AEQA 5HKWA 2M0RA 4CLNA 1A29A 1S26D 3BUOB 5DKNA 2L2EA 3VRRA 2ZN8A 3CZTX 1SBJA 4R1EA 4PE1A 4FTGA 2JTZA 1EH2A 2AUCA 1YUSA 3ICBA 1K90D 3H4SE 1AVSA 1RWYA 1NIWA 1NYAA 1M45A 3O6BA 1B8LA 2BE4A 4C0LA 4YGAA 1IQ3A 5JOLA 2M7LA 4JWQA 2KBIA 2G9BA 3GOFA 1F55A 3BXKA 5AFPA 2Q4UA 1GGZA 5D69A 2ZFDA 1KWOB 1DF0A 1RJVA 2BL0C 1S5GZ 2KNEA 2LVKA 1CMFA 2P6BB 1IH0A 2ISDA 1YVLA 1S1EA 1UP5A 1CNPA 1DVIA 1QS7A 1A03A 4Q04A 2KFFA 2KI6D 2LE9B 3DVMA 1YX8A 3KF9A 4OCIA 1B47A 2WCBA 2E30A 2KDHA 3DVJA 3M0WA 2FOTA 1PVAA 4MRXA 1IJ5A 1K2HA 4GGFC 2LHLA 2ZNDA 1DJYA 1W7IB 4AOMA 1NCZA 3C1VA 5AANA 1QX7A 2B1UA 1ZACA 1UHHA 2LV7A 3EK7A 4GGNA 1TOPA 1K9KA 1Y1AA 1LA0A 3I5IB 4GNKB 1XK4A 2L4IA 1FF1A 1YRTB 4PHMA 1F71A 1J7RA 1ODBA 1ALWA 1K93D 2PALA 2F8PA 1UHNA 2MBXA 1F8HA 1HT9A 1TCOB 5HLVA 4E68A 2LCPA 3DF0A 2BECA 5FYXA 4GFTA 1ALVA 3EKHA 3OX6A 2LAPA 3CTNA 4N1FA 1QLSA 3EVVA 2KAYA 4OVNF 1C7VA 2JXLA 4HREE 1CDNA 2BBNA 2NCPA 3LK1A 4XJKA 3BOWA 3PLFB 3VRPA 1NSHA 1SCMC 2JULA 4USLA 3CGAA 3EVRA 3SG7A 2D8NA 2LMUA 2SCPA 5CSJA 1F4OA 3E3RA 3GK1A 5ER4X 3I5GC 2JNFA 2ZN9A 1LVCD 2KAXA 2GGZA 1MQ1A 1CDMA 5BPJA 2MRDA 1CLLA 5HKYA 4MZJA 1N2DA 2LVIA 2Y4QA 1OSAA 2WCEA 3TZ1A 1GGWA 1RROA 4HSZA 5DKQA 1CLBA 5ER5A 4ZCVA 4DS7A 1XFUO 2JC2A 2OPOA 3FIAA 2QPTA 1R6PA 2LP2A 1XO5A 1WRLA 2JTTA 3IQOA 1J1EA 1N65A 2KGBC 1XFWO 4DUQA 2KYFA 3D0YA 4NDCA 2LHIA 3DD4A 2G2BA 3VROA 2FCDA 2NLNA 1M39A 3JTDB 5HYDA 3TS5C 5TNCA 2O5GA 4I5JA 1IWQA 1WDCB 2Y1NA 2DOQA 2EC6B 2K7OA 1L2OC 1DTLA 2MAZA 1M46A 1FPWA 4YGDB 3IF7A 1PSBA 1EG4A 1KFUS 1J7QA 1ZMZA 2FJUB 1G4YR 3AKAA 3O78A 4WRIA 1QTXA 1KFXL 1B8CA 2MJWB 1QLKA 1Y0VH 3O4YA 2Y1MA 4DCKA 1JBAA 3PATA 2KBMA 2PSRA 3NSIA 3I5HC 3FWCA 5PALA 2GV5A 2K7CA 4FQOA 1JF0A 1RK9A 1SL8A 1AJ5A 2HETA 3WNXB 4A4CA 4OR9B 1TNPA 2OS8B 3PFVA 2KI4B 5D7FA 2CCMA 3SIBA 3VRQA 1KSMA 4YGCB 4IL1A 3BUXB 1YUTA 2ZKMX 3GK2A 2SASA 1VRKA 3GK4X 4MN0A 3SG5A 1OQPA 4NDDA 1GJYA 5JJGA 3TUYC 1NCXA 2K8MB 2OTGB 1PVBA 1WY9A 1XK4C 3SJSA 2BBMA 2K2FA 3KEVA 4JPZB 3VGOA 1KSOA 1WRZA 4PDZA 2NZ0A 1SMGA 1DJZA 1OMDA 2WCFA 1JC2A 4ORCB 1EXRA 3PM8A 1NCYA 2L4HA 4I5KA 1H4BA 4MLWA 2LUCA 1YURA 1CMGA 1UHJA 2KYCA 1NX1A 2JNXA 1IKUA 1W7JB 4ETOA 2E6WA 5CSNA 2JXCA 1J7PA 2MLEC 2LUXA 2I2RE 4GAOA 2MHHA 3WHTB 2CNPA 1BLQA 2BKIB 3JVTC 2HF5A 1PULA 3AAJA 4BY4A 4CIDA 4ICBA 1J55A 2I7AA 3CS1A 3RM1A 3RLZA 2M1KB 3I5IC 1AUIB 2BL0B 1A75B 4XJKB 1TIZA 4D1EA 1FBVA 2AAOA 1XFVO 3BYAA 1SRAA 1KK7Z 2PASA 4OV2A 2KFHA 2O60A 1X02A 3LCPC 2LNKA 5IBWA 3PSRA 3CLNA 4M2QA 1MXLC 1ZFSA 1JSAA 1DJWA 1K94A 1XFYO 3WXAA 1CDLA 3AKBA 4MRYA 4MSPA 1CFPA 1BODA 1QX5B 3CR5X 2PMYA 5I8NA 2JT3A 2KFGA 2KHNA 1TNQA 1NWDA 1U5IA 2MA2A 3KO0A 4L9MA 4MVFA 1QV1A 1YRUB 1K9UA 3LK0A 2M3WA 2NCOA 5I2LA 1CDPA 1JWDA 1KK8C 1MWNA 2F33A 2JPTA 1S36A 3D0YB 4PE0A 1DGUA 1LINA 5CSIA 1BR1B 1OMVA 5AERA 2JT8A 1AJ4A 1C7WA 3EKJA 2F3ZA 4MBEA 4C0KA 1IQ5A 1CTRA 1QATA 1CM1A 2L0PA 1F4QA 2NXQA 1NPQA 4DIRA 1SCMB 3HCMA 4MZKA 1SR6C 3HX4A 2M49B 2JWWA 3I5GB 2COLB 3I5FB 2CBLA 1NP8A 1G33A 4OKHA 5DKRA 1RTP1 1NX3A 1AHRA 1CKKA 2CXJA 2EC6C 5GQQC 2HPSA 3OB1B 4AQJA 2KOTA 2KSPA 3AAKA 3TDUA 1XFZO 1DJIA 1UWOA 2JZIA 1R2UA 2WORA 4N1GA 2CT9A 3D10A 1QXPA 3NSLA 1SYMA 2LVJA 3MSEB 2LLTA 2ZRSA 1RECA 4M2PA 1KK7Y 1PRWA 4QJ3B 1NX2A 1G8IA 4P5OE 4JQ0D 1MF8B 1OE9B 3TS5B 1DMOA 1A2XA 4U8DA 4UPGA 1KQMC 2KGRA 4NQGA 1B7TY 1MHOA 4XYNA 2KQ6A 1QIWA 1L2OB 1XYDA 1YUUA 3SG6A 1SKTA 2BE6A 1CFCA 4ORBB 1DJGA 1S3PA 1C07A 3CR2A 2K2AA 3O2PA 1UUSA 3TDZA 1DF0B 1PALA 3DVEA 1KQVA 1AP4A 5KTYA 1Y6WA 1E8AA 1TTXA 4AQIA 2F2PA 1YVHA 3SG4A 1LXFC 4CFQA 3PN7B 1ZUZA 1JUOA 4GPLB 4PHKA 1LA3A 2M97A 5I2OA 2M29A 4I5NB 4YI8A 5KU1A 1IG5A 3OX5A 4ZCUA 1WLMA 3FS7A 1KWOC 2Y5IA 3OB2B 4YI9A 4I5LB 1RFJA 1BU3A 1BG1A 4GUKA 2L5XB 2HQ8A 1DT7B 3EK8A 1J7OA 5I2QA 1XFXO 1FI5A 1B9AA 4C0JA 2EHBA 1H8BA 2H2KA 3TUYB 1TNXA 1EJ3A 1UURA 2ZRTA 1S6JA 2PVBA 3LL8B 2LANA 4ORAB 1YR5A 2K7BA 2WOSA 4PALA 4PHNA 1QX2A 3DF0B 3KHEA 2JT0A 2EGDA 1NUBA 1IJ6A 2K0JA 3BUNB 4PE7A 1K95A 1L7ZA 4MZLA 3BOWB 2LM5A 3DVKA 1QV0A 4MEWA 3SG2A 1WRKA 3CWGA 3BUWB 1U5IB 2JQ6A 2L98A 2BCBA 1OMRA 1JF2A 3A8RA 1SNLA 1V1GA 4PCWA 2L50A 4TNCA 2HQWA 1OZOA 2BCAA 4GBAA 3A4UB 3PALA 1N0YA 2F3YA 3OP0A 1B7TZ 1K96A 1UHIA 3LLEA 3NXAA 2KQYA 4WQ3A 1JFJA 4P2YB 2JRFA 1FW4A 3JVTB 1QASA 4PHJA 2L51A 3SG3A 1DJHA 1SPYA 1V1FA 2BKHB 5HKZA 1BT6A 1SW8A 2JU0A 1S6CA 4YGEB 4PE4A 5K89A 1QIVA 4CFRA 2MLFC 2LVVA 3NSKA 4QJ4B 1KCYA 4NDBA 1DGVA 2A4JA 1CFFA 1Y1XA 1BOCA 3VRNA 1YTZC 1D1OA 2H61C 3CR4X 1PSRA 2KAVA 1SK6D 1IRJA 2KI6C 3IQQA 3KPXA 3TDIA 4CPVA 5F6TA 1TRFA 2RGIA 1OZSA 1TCFA 3F45A 1A75A 4HRHA 5G08A 3K21A 1SY9A 1QVIY 1J1DA 1MXEA 2VRGA 5CPVA 4M2OA 4YBHB 1BJFA 1PK0D 3SIAA 3I5FC 4F0ZB 1DJXA 3JTDC 1F54A 1KK8B 1A4PA 1MR8A 1BF5A 4GGFA 5HLOA 1WDCC 2LLUA 4BY5A 4YRUA 1KFXS 1XVJA 2JOJA 2QACA 2K7DA 3BQ3A 1CB1A 2AMIA 1BR4B 1Q80A 1CFDA 2WNDA 3ZWHA 4YGBB 1S5GY 2BCXA 2ZNEA 1M63B 2I18A 1TN4A 1SR6B 2F2OA 1OOJA 1Y1UA 4A4BA 1K9PA 2H61A 3EK4A 3WHUB 1FI6A 2M8UA 1IGVA 2Q91A 1UHKA 1B8RA 2PRUA 2FCEA 2LC5A 2WC8A 2OS8C 2KI4C 1BMOA
chains in the Genus database with same CATH superfamily
1M31A 3D73A 2TN4A 1GQMA 1LKJA 1B1GA 2M1UA 1EG3A 1QJTA 2CTNA 1TNWA 3D77A 4WQ2A 1SCVA 2V53A 5B8IB 1NX0A 5J3XA 1HQVA 3FWBA 2OTGC 3ZNIA 1JFKA 3EVUA 2I94A 2K61A 4DRWA 5KSZA 1F70A 2GGMA 3B87A 5CSFA 3QRXA 1K8UA 1ZOTB 4QJ5B 1XA5A 3PN7C 2LMVA 1KFUL 2R2IA 2WC6A 1WLZA 4HRGA 4N5XA 1B4CA 3I5HB 1AK8A 1GM0A 2IS9A 1XFRA 3BUMB 1S6IA 1SL7A 2LP3A 3OHMB 1CLMA 5FI7A 5AXIA 1KQMB 1CM4A 3B7AA 2H8VA 2M7NA 2M9GA 1W9ZA 1EL4A 2LMTA 2LLSA 1MUXA 1SL9A 1QVIZ 3B88A 1YX7A 2KLEA 3NSOA 5AEQA 5HKWA 2M0RA 4CLNA 1A29A 1S26D 3BUOB 5DKNA 2L2EA 3R72A 3VRRA 2ZN8A 3CZTX 1SBJA 4R1EA 4PE1A 4FTGA 2JTZA 1EH2A 2AUCA 1YUSA 3ICBA 1K90D 3H4SE 1AVSA 1RWYA 1NIWA 1NYAA 1M45A 3O6BA 1B8LA 2BE4A 4C0LA 4YGAA 1IQ3A 5JOLA 2M7LA 4JWQA 2KBIA 2G9BA 3GOFA 3S0EA 1F55A 3BXKA 5AFPA 2Q4UA 1GGZA 3OBVA 5D69A 2ZFDA 1KWOB 1DF0A 1TWOA 1RJVA 2BL0C 1S5GZ 2KNEA 2LVKA 1CMFA 2P6BB 1IH0A 2ISDA 1YVLA 1S1EA 1UP5A 1CNPA 1DVIA 1QS7A 3DY9A 4INXA 4Q04A 1A03A 3VB1A 2KFFA 2KI6D 2LE9B 2PQLA 3DVMA 3D76A 1YX8A 3KF9A 4OCIA 1B47A 2WCBA 2E30A 2KDHA 3DVJA 3M0WA 2FOTA 1PVAA 4MRXA 1IJ5A 1K2HA 4GGFC 2LHLA 2ZNDA 1DJYA 1W7IB 1C3ZA 4AOMA 2P70A 3UNWA 1NCZA 3C1VA 5AANA 1QX7A 2B1UA 1ZACA 1UHHA 2LV7A 3EK7A 4GGNA 3S0GA 1TOPA 1K9KA 1Y1AA 1LA0A 3I5IB 3IVTA 4GNKB 1XK4A 2L4IA 1FF1A 4INWA 1YRTB 4PHMA 2QEVA 1F71A 1J7RA 1ODBA 1ALWA 1K93D 2PALA 2F8PA 1UHNA 3PM2A 2MBXA 1HT9A 1F8HA 1TCOB 3CABA 5HLVA 4E68A 1Z4HA 2KLDA 2LCPA 3FE6A 3DF0A 2BECA 5FYXA 4GFTA 1ALVA 3EKHA 3OX6A 2LAPA 3CTNA 4N1FA 1QLSA 3EVVA 2KAYA 4OVNF 4PT1A 2JXLA 4HREE 1C7VA 2BBNA 2NCPA 3LK1A 1CDNA 4XJKA 3BOWA 2FJYA 3PLFB 3QMEA 3VRPA 1NSHA 1SCMC 2JULA 4USLA 3CGAA 3EVRA 3FE8A 3DZTA 2D8NA 2LMUA 2SCPA 5CSJA 3SG7A 1F4OA 3E3RA 3GK1A 1T14A 5ER4X 1P28A 3I5GC 2JNFA 2ZN9A 1LVCD 2KAXA 2GGZA 1MQ1A 1CDMA 5BPJA 2MRDA 1CLLA 5HKYA 2L2CA 4MZJA 1N2DA 2LVIA 2Y4QA 1OSAA 2WCEA 3TZ1A 1GGWA 1RROA 4HSZA 5DKQA 2QEOA 5ER5A 4ZCVA 1CLBA 4DS7A 1XFUO 2JC2A 2OPOA 3FIAA 2QPTA 1R6PA 2LP2A 1XO5A 1WRLA 2JTTA 3IQOA 1J1EA 1N65A 2KGBC 1XFWO 4DUQA 2KYFA 3D0YA 4NDCA 2LHIA 3DD4A 2G2BA 3VROA 2FCDA 4KYNA 2NLNA 1M39A 3JTDB 5HYDA 1LS8A 3TS5C 2WC5A 5TNCA 2O5GA 4I5JA 1IWQA 1WDCB 2Y1NA 2DOQA 2EC6B 2K7OA 3D74A 1L2OC 1DTLA 2MAZA 1M46A 1FPWA 4YGDB 3IF7A 1OOFA 1PSBA 1EG4A 1KFUS 1J7QA 1ZMZA 2FJUB 3R1PA 5HL1A 1G4YR 3AKAA 3O78A 4WRIA 1QTXA 1KFXL 1B8CA 2MJWB 1QLKA 1Y0VH 3O4YA 2Y1MA 4DCKA 1JBAA 3Q8IA 3PATA 2KBMA 2PSRA 3NSIA 3I5HC 3FWCA 5PALA 2GV5A 2K7CA 3B86A 4FQOA 1JF0A 1RK9A 1SL8A 1AJ5A 2HETA 3OGNA 3WNXB 4OR9B 4A4CA 1TNPA 2OS8B 3PFVA 2KI4B 5D7FA 2CCMA 3SIBA 3VRQA 1KSMA 4YGCB 4IL1A 3BUXB 1YUTA 2ZKMX 3GK2A 2SASA 1VRKA 3GK4X 4MN0A 1OOGA 3SG5A 1OQPA 4NDDA 1GJYA 2YGUA 5JJGA 3TUYC 1NCXA 2K8MB 2OTGB 1PVBA 1WY9A 1XK4C 3SJSA 2BBMA 3RZSA 2K2FA 3KEVA 4JPZB 3VGOA 1KSOA 1WRZA 4PDZA 2NZ0A 1SMGA 1DJZA 1OMDA 2WCFA 3CZ0A 1JC2A 4ORCB 1EXRA 3PM8A 1NCYA 3R1VA 2L4HA 4I5KA 1H4BA 4MLWA 2LUCA 1YURA 1CMGA 1UHJA 1OW4A 2KYCA 1NX1A 2WCJA 2JNXA 1IKUA 1W7JB 4ETOA 2E6WA 2QEHA 5CSNA 2JXCA 1J7PA 2MLEC 2LUXA 3SS3A 2I2RE 2ERBA 4GAOA 2MHHA 3WHTB 2CNPA 1BLQA 2BKIB 3S0AA 3JVTC 2HF5A 1PULA 3AAJA 4BY4A 1DELA 4CIDA 4ICBA 1J55A 2I7AA 3CYZA 3CS1A 3RM1A 3RLZA 2M1KB 3I5IC 1AUIB 2BL0B 1A75B 4XJKB 1TIZA 4D1EA 1FBVA 2AAOA 1XFVO 3BYAA 1SRAA 1KK7Z 2PASA 4OV2A 3UO9A 2KFHA 2O60A 1X02A 3LCPC 4OZDA 2LNKA 5IBWA 3PSRA 3CLNA 4M2QA 5D3OA 1MXLC 1ZFSA 1JSAA 1DJWA 1K94A 1XFYO 4JKTA 3WXAA 1CDLA 3V2LA 3L4AA 3AKBA 4MRYA 4MSPA 1CFPA 3S0DA 1BODA 1QX5B 3CR5X 2PMYA 5I8NA 2JT3A 2KFGA 2KHNA 1TNQA 1DEKA 1NWDA 1U5IA 2MA2A 3KO0A 4L9MA 4MVFA 1QV1A 3SS4A 2KPHA 1YRUB 1K9UA 3LK0A 2M3WA 2NCOA 5I2LA 1CDPA 2WCMA 3S0FA 1QWVA 5FI6A 1JWDA 1KK8C 1MWNA 2F33A 2JPTA 1S36A 3D0YB 4PE0A 5I94A 1DGUA 1LINA 5CSIA 1BR1B 1OMVA 2K60A 5AERA 2JT8A 1AJ4A 1C7WA 3EKJA 2F3ZA 4MBEA 2BNXA 4C0KA 1IQ5A 1CTRA 1QATA 1CM1A 2GTEA 2L0PA 1F4QA 2NXQA 1NPQA 4DIRA 1SCMB 3HCMA 4MZKA 1SR6C 3HX4A 2M49B 2JWWA 3I5GB 2COLB 3I5FB 2CBLA 1NP8A 1G33A 3FE9A 4JD9A 1RTP1 4OKHA 5DKRA 1NX3A 1AHRA 3PJIA 1CKKA 2CXJA 2EC6C 5GQQC 2HPSA 3OB1B 4AQJA 2KOTA 2KSPA 3AAKA 3TDUA 1XFZO 1DJIA 1UWOA 2JZIA 1R2UA 2WORA 4N1GA 2CT9A 5EL2A 3D10A 3B6XA 1QXPA 3R1OA 3NSLA 1SYMA 2LVJA 3DYEA 3MSEB 2LLTA 2ZRSA 1RECA 4M2PA 1KK7Y 1PRWA 4QJ3B 1NX2A 1G8IA 4P5OE 4JQ0D 1MF8B 1OE9B 3BJHA 3TS5B 1DMOA 1A2XA 4U8DA 4UPGA 1KQMC 2KGRA 4NQGA 1B7TY 1MHOA 4XYNA 2KQ6A 1QIWA 1L2OB 1XYDA 1YUUA 2QEBA 1SKTA 3SG6A 2BE6A 2WCHA 4ORBB 5DICA 1CFCA 1DJGA 3CZ2A 1S3PA 1C07A 3CR2A 2K2AA 3O2PA 1UUSA 4F7FA 3TDZA 1DF0B 1PALA 3DVEA 1KQVA 1AP4A 5KTYA 1Y6WA 1E8AA 1TTXA 4AQIA 2F2PA 1YVHA 3SG4A 1LXFC 4CFQA 2PYQA 3PN7B 3N7HA 1ZUZA 3K1EA 1JUOA 4GPLB 4PHKA 1LA3A 2M97A 3DXLA 5I2OA 2M29A 3NHTA 4I5NB 4YI8A 5KU1A 1IG5A 3OX5A 4ZCUA 1WLMA 3FS7A 1KWOC 2Y5IA 3OB2B 4YI9A 4I5LB 1RFJA 1BU3A 3D78A 4GUKA 2L5XB 1BG1A 2HQ8A 1DT7B 3EK8A 1J7OA 5I2QA 1XFXO 1FI5A 1B9AA 4C0JA 3BFAA 2EHBA 1H8BA 2H2KA 3TUYB 1TNXA 1EJ3A 1UURA 2ZRTA 1S6JA 2PVBA 5FI2A 2WCLA 3LL8B 2LANA 4ORAB 1YR5A 2BAPA 2K7BA 2WOSA 4PALA 4PHNA 1QX2A 3DF0B 1TUJA 3KHEA 2JT0A 2EGDA 1NUBA 1IJ6A 2K0JA 3BUNB 4PE7A 1K95A 1L7ZA 4MZLA 3BOWB 2LM5A 3DVKA 1QV0A 4MEWA 3SG2A 1WRKA 3CWGA 3BUWB 1U5IB 2JQ6A 2L98A 2BCBA 1OMRA 1JF2A 3A8RA 1SNLA 1V1GA 4PCWA 3NHIA 2L50A 3S0BA 4TNCA 2HQWA 1OZOA 2BCAA 4GBAA 3A4UB 3D75A 1N0YA 2F3YA 3PALA 1DQEA 1B7TZ 1K96A 1UHIA 3LLEA 3NXAA 3OP0A 2KQYA 4WQ3A 2P71A 4P2YB 1JFJA 2JRFA 1FW4A 3JVTB 1QASA 4PHJA 2L51A 1TUZA 3SG3A 1IIOA 3NGVA 1DJHA 1SPYA 1ORGA 1V1FA 2BKHB 5HKZA 1BT6A 1SW8A 1OOIX 1S6CA 2JU0A 4YGEB 4IJ7A 4PE4A 5K89A 1QIVA 4CFRA 2MLFC 2LVVA 3NSKA 4QJ4B 1KCYA 4NDBA 1DGVA 2A4JA 3SS5A 1Y1XA 1CFFA 1BOCA 3VRNA 1YTZC 1D1OA 2H61C 2WCKA 3CR4X 1PSRA 2KAVA 1SK6D 1IRJA 2KI6C 3IQQA 3KPXA 3TDIA 4CPVA 3CDNA 5F6TA 1TRFA 2RGIA 1OZSA 1TCFA 3L4LA 3F45A 1A75A 4HRHA 5G08A 3K21A 1SY9A 1QVIY 3CZ1A 1J1DA 2L5YA 1MXEA 2JPOA 2VRGA 5CPVA 4M2OA 4YBHB 1BJFA 1SSEB 1PK0D 3SIAA 3O4XA 3I5FC 4F0ZB 3EG5B 1DJXA 3JTDC 1F54A 1KK8B 1A4PA 1MR8A 1BF5A 1C3YA 4GGFA 5HLOA 1WDCC 2LLUA 4BY5A 1Z2CB 4YRUA 1KFXS 2QDIA 1XVJA 2JOJA 2QACA 2K7DA 3BQ3A 1CB1A 2AMIA 1BR4B 1Q80A 1CFDA 2WNDA 3ZWHA 4YGBB 1S5GY 2BCXA 2ZNEA 1M63B 2I18A 1TN4A 1SR6B 2F2OA 1OOJA 1Y1UA 4A4BA 1K9PA 3L47A 2H61A 4FQTA 3EK4A 3BFBA 3WHUB 1OOHA 2M8UA 1IGVA 2Q91A 1FI6A 1UHKA 1B8RA 2PRUA 2FCEA 2LC5A 2WC8A 1DC1A 2OS8C 2KI4C 3BFHA 1BMOA
chains in the Genus database with same CATH topology
1M31A 2TN4A 1GQMA 1LKJA 1B1GA 2M1UA 1EG3A 1QJTA 2CTNA 1TNWA 4WQ2A 1SCVA 2V53A 5B8IB 1NX0A 5J3XA 1HQVA 3FWBA 2OTGC 3ZNIA 1JFKA 3EVUA 2I94A 2K61A 4DRWA 5KSZA 1F70A 2GGMA 5CSFA 3QRXA 1K8UA 1ZOTB 4QJ5B 1XA5A 3PN7C 2LMVA 1KFUL 2R2IA 1WLZA 4HRGA 4N5XA 1B4CA 3I5HB 1AK8A 2IS9A 3BUMB 1S6IA 1SL7A 2LP3A 3OHMB 1CLMA 5AXIA 1KQMB 1CM4A 2M7NA 2M9GA 1EL4A 2LMTA 2LLSA 1MUXA 1SL9A 1QVIZ 1YX7A 3NSOA 5AEQA 5HKWA 2M0RA 4CLNA 1A29A 1S26D 3BUOB 5DKNA 2L2EA 3VRRA 2ZN8A 3CZTX 1SBJA 4R1EA 4PE1A 4FTGA 2JTZA 1EH2A 2AUCA 1YUSA 3ICBA 1K90D 3H4SE 1AVSA 1RWYA 1NIWA 1NYAA 1M45A 3O6BA 1B8LA 2BE4A 4C0LA 4YGAA 1IQ3A 5JOLA 2M7LA 4JWQA 2KBIA 2G9BA 3GOFA 1F55A 3BXKA 5AFPA 2Q4UA 1GGZA 5D69A 2ZFDA 1KWOB 1DF0A 1RJVA 2BL0C 1S5GZ 2KNEA 2LVKA 1CMFA 2P6BB 1IH0A 2ISDA 1YVLA 1S1EA 1UP5A 1CNPA 1DVIA 1QS7A 1A03A 4Q04A 2KFFA 2KI6D 2LE9B 3DVMA 1YX8A 3KF9A 4OCIA 1B47A 2WCBA 2E30A 2KDHA 3DVJA 3M0WA 2FOTA 1PVAA 4MRXA 1IJ5A 1K2HA 4GGFC 2LHLA 2ZNDA 1DJYA 1W7IB 4AOMA 1NCZA 3C1VA 5AANA 1QX7A 2B1UA 1ZACA 1UHHA 2LV7A 3EK7A 4GGNA 1TOPA 1K9KA 1Y1AA 1LA0A 3I5IB 4GNKB 1XK4A 2L4IA 1FF1A 1YRTB 4PHMA 1F71A 1J7RA 1ODBA 1ALWA 1K93D 2PALA 2F8PA 1UHNA 2MBXA 1F8HA 1HT9A 1TCOB 5HLVA 4E68A 2LCPA 3DF0A 2BECA 5FYXA 4GFTA 1ALVA 3EKHA 3OX6A 2LAPA 3CTNA 4N1FA 1QLSA 3EVVA 2KAYA 4OVNF 1C7VA 2JXLA 4HREE 1CDNA 2BBNA 2NCPA 3LK1A 4XJKA 3BOWA 3PLFB 3VRPA 1NSHA 1SCMC 2JULA 4USLA 3CGAA 3EVRA 3SG7A 2D8NA 2LMUA 2SCPA 5CSJA 1F4OA 3E3RA 3GK1A 5ER4X 3I5GC 2JNFA 2ZN9A 1LVCD 2KAXA 2GGZA 1MQ1A 1CDMA 5BPJA 2MRDA 1CLLA 5HKYA 4MZJA 1N2DA 2LVIA 2Y4QA 1OSAA 2WCEA 3TZ1A 1GGWA 1RROA 4HSZA 5DKQA 1CLBA 5ER5A 4ZCVA 4DS7A 1XFUO 2JC2A 2OPOA 3FIAA 2QPTA 1R6PA 2LP2A 1XO5A 1WRLA 2JTTA 3IQOA 1J1EA 1N65A 2KGBC 1XFWO 4DUQA 2KYFA 3D0YA 4NDCA 2LHIA 3DD4A 2G2BA 3VROA 2FCDA 2NLNA 1M39A 3JTDB 5HYDA 3TS5C 5TNCA 2O5GA 4I5JA 1IWQA 1WDCB 2Y1NA 2DOQA 2EC6B 2K7OA 1L2OC 1DTLA 2MAZA 1M46A 1FPWA 4YGDB 3IF7A 1PSBA 1EG4A 1KFUS 1J7QA 1ZMZA 2FJUB 1G4YR 3AKAA 3O78A 4WRIA 1QTXA 1KFXL 1B8CA 2MJWB 1QLKA 1Y0VH 3O4YA 2Y1MA 4DCKA 1JBAA 3PATA 2KBMA 2PSRA 3NSIA 3I5HC 3FWCA 5PALA 2GV5A 2K7CA 4FQOA 1JF0A 1RK9A 1SL8A 1AJ5A 2HETA 3WNXB 4A4CA 4OR9B 1TNPA 2OS8B 3PFVA 2KI4B 5D7FA 2CCMA 3SIBA 3VRQA 1KSMA 4YGCB 4IL1A 3BUXB 1YUTA 2ZKMX 3GK2A 2SASA 1VRKA 3GK4X 4MN0A 3SG5A 1OQPA 4NDDA 1GJYA 5JJGA 3TUYC 1NCXA 2K8MB 2OTGB 1PVBA 1WY9A 1XK4C 3SJSA 2BBMA 2K2FA 3KEVA 4JPZB 3VGOA 1KSOA 1WRZA 4PDZA 2NZ0A 1SMGA 1DJZA 1OMDA 2WCFA 1JC2A 4ORCB 1EXRA 3PM8A 1NCYA 2L4HA 4I5KA 1H4BA 4MLWA 2LUCA 1YURA 1CMGA 1UHJA 2KYCA 1NX1A 2JNXA 1IKUA 1W7JB 4ETOA 2E6WA 5CSNA 2JXCA 1J7PA 2MLEC 2LUXA 2I2RE 4GAOA 2MHHA 3WHTB 2CNPA 1BLQA 2BKIB 3JVTC 2HF5A 1PULA 3AAJA 4BY4A 4CIDA 4ICBA 1J55A 2I7AA 3CS1A 3RM1A 3RLZA 2M1KB 3I5IC 1AUIB 2BL0B 1A75B 4XJKB 1TIZA 4D1EA 1FBVA 2AAOA 1XFVO 3BYAA 1SRAA 1KK7Z 2PASA 4OV2A 2KFHA 2O60A 1X02A 3LCPC 2LNKA 5IBWA 3PSRA 3CLNA 4M2QA 1MXLC 1ZFSA 1JSAA 1DJWA 1K94A 1XFYO 3WXAA 1CDLA 3AKBA 4MRYA 4MSPA 1CFPA 1BODA 1QX5B 3CR5X 2PMYA 5I8NA 2JT3A 2KFGA 2KHNA 1TNQA 1NWDA 1U5IA 2MA2A 3KO0A 4L9MA 4MVFA 1QV1A 1YRUB 1K9UA 3LK0A 2M3WA 2NCOA 5I2LA 1CDPA 1JWDA 1KK8C 1MWNA 2F33A 2JPTA 1S36A 3D0YB 4PE0A 1DGUA 1LINA 5CSIA 1BR1B 1OMVA 5AERA 2JT8A 1AJ4A 1C7WA 3EKJA 2F3ZA 4MBEA 4C0KA 1IQ5A 1CTRA 1QATA 1CM1A 2L0PA 1F4QA 2NXQA 1NPQA 4DIRA 1SCMB 3HCMA 4MZKA 1SR6C 3HX4A 2M49B 2JWWA 3I5GB 2COLB 3I5FB 2CBLA 1NP8A 1G33A 4OKHA 5DKRA 1RTP1 1NX3A 1AHRA 1CKKA 2CXJA 2EC6C 5GQQC 2HPSA 3OB1B 4AQJA 2KOTA 2KSPA 3AAKA 3TDUA 1XFZO 1DJIA 1UWOA 2JZIA 1R2UA 2WORA 4N1GA 2CT9A 3D10A 1QXPA 3NSLA 1SYMA 2LVJA 3MSEB 2LLTA 2ZRSA 1RECA 4M2PA 1KK7Y 1PRWA 4QJ3B 1NX2A 1G8IA 4P5OE 4JQ0D 1MF8B 1OE9B 3TS5B 1DMOA 1A2XA 4U8DA 4UPGA 1KQMC 2KGRA 4NQGA 1B7TY 1MHOA 4XYNA 2KQ6A 1QIWA 1L2OB 1XYDA 1YUUA 3SG6A 1SKTA 2BE6A 1CFCA 4ORBB 1DJGA 1S3PA 1C07A 3CR2A 2K2AA 3O2PA 1UUSA 3TDZA 1DF0B 1PALA 3DVEA 1KQVA 1AP4A 5KTYA 1Y6WA 1E8AA 1TTXA 4AQIA 2F2PA 1YVHA 3SG4A 1LXFC 4CFQA 3PN7B 1ZUZA 1JUOA 4GPLB 4PHKA 1LA3A 2M97A 5I2OA 2M29A 4I5NB 4YI8A 5KU1A 1IG5A 3OX5A 4ZCUA 1WLMA 3FS7A 1KWOC 2Y5IA 3OB2B 4YI9A 4I5LB 1RFJA 1BU3A 1BG1A 4GUKA 2L5XB 2HQ8A 1DT7B 3EK8A 1J7OA 5I2QA 1XFXO 1FI5A 1B9AA 4C0JA 2EHBA 1H8BA 2H2KA 3TUYB 1TNXA 1EJ3A 1UURA 2ZRTA 1S6JA 2PVBA 3LL8B 2LANA 4ORAB 1YR5A 2K7BA 2WOSA 4PALA 4PHNA 1QX2A 3DF0B 3KHEA 2JT0A 2EGDA 1NUBA 1IJ6A 2K0JA 3BUNB 4PE7A 1K95A 1L7ZA 4MZLA 3BOWB 2LM5A 3DVKA 1QV0A 4MEWA 3SG2A 1WRKA 3CWGA 3BUWB 1U5IB 2JQ6A 2L98A 2BCBA 1OMRA 1JF2A 3A8RA 1SNLA 1V1GA 4PCWA 2L50A 4TNCA 2HQWA 1OZOA 2BCAA 4GBAA 3A4UB 3PALA 1N0YA 2F3YA 3OP0A 1B7TZ 1K96A 1UHIA 3LLEA 3NXAA 2KQYA 4WQ3A 1JFJA 4P2YB 2JRFA 1FW4A 3JVTB 1QASA 4PHJA 2L51A 3SG3A 1DJHA 1SPYA 1V1FA 2BKHB 5HKZA 1BT6A 1SW8A 2JU0A 1S6CA 4YGEB 4PE4A 5K89A 1QIVA 4CFRA 2MLFC 2LVVA 3NSKA 4QJ4B 1KCYA 4NDBA 1DGVA 2A4JA 1CFFA 1Y1XA 1BOCA 3VRNA 1YTZC 1D1OA 2H61C 3CR4X 1PSRA 2KAVA 1SK6D 1IRJA 2KI6C 3IQQA 3KPXA 3TDIA 4CPVA 5F6TA 1TRFA 2RGIA 1OZSA 1TCFA 3F45A 1A75A 4HRHA 5G08A 3K21A 1SY9A 1QVIY 1J1DA 1MXEA 2VRGA 5CPVA 4M2OA 4YBHB 1BJFA 1PK0D 3SIAA 3I5FC 4F0ZB 1DJXA 3JTDC 1F54A 1KK8B 1A4PA 1MR8A 1BF5A 4GGFA 5HLOA 1WDCC 2LLUA 4BY5A 4YRUA 1KFXS 1XVJA 2JOJA 2QACA 2K7DA 3BQ3A 1CB1A 2AMIA 1BR4B 1Q80A 1CFDA 2WNDA 3ZWHA 4YGBB 1S5GY 2BCXA 2ZNEA 1M63B 2I18A 1TN4A 1SR6B 2F2OA 1OOJA 1Y1UA 4A4BA 1K9PA 2H61A 3EK4A 3WHUB 1FI6A 2M8UA 1IGVA 2Q91A 1UHKA 1B8RA 2PRUA 2FCEA 2LC5A 2WC8A 2OS8C 2KI4C 1BMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M31 A;  2TN4 A;  1GQM A;  1LKJ A;  1B1G A;  2M1U A;  1EG3 A;  1QJT A;  2CTN A;  1TNW A;  4WQ2 A;  1SCV A;  2V53 A;  5B8I B;  1NX0 A;  5J3X A;  1HQV A;  3FWB A;  2OTG C;  3ZNI A;  1JFK A;  3EVU A;  2I94 A;  2K61 A;  4DRW A;  5KSZ A;  1F70 A;  2GGM A;  5CSF A;  3QRX A;  1K8U A;  1ZOT B;  4QJ5 B;  1XA5 A;  3PN7 C;  2LMV A;  1KFU L;  2R2I A;  1WLZ A;  4HRG A;  4N5X A;  1B4C A;  3I5H B;  1AK8 A;  2IS9 A;  3BUM B;  1S6I A;  1SL7 A;  2LP3 A;  3OHM B;  1CLM A;  5AXI A;  1KQM B;  1CM4 A;  2M7N A;  2M9G A;  1EL4 A;  2LMT A;  2LLS A;  1MUX A;  1SL9 A;  1QVI Z;  1YX7 A;  3NSO A;  5AEQ A;  5HKW A;  2M0R A;  4CLN A;  1A29 A;  1S26 D;  3BUO B;  5DKN A;  2L2E A;  3VRR A;  2ZN8 A;  3CZT X;  1SBJ A;  4R1E A;  4PE1 A;  4FTG A;  2JTZ A;  1EH2 A;  2AUC A;  1YUS A;  3ICB A;  1K90 D;  3H4S E;  1AVS A;  1RWY A;  1NIW A;  1NYA A;  1M45 A;  3O6B A;  1B8L A;  2BE4 A;  4C0L A;  4YGA A;  1IQ3 A;  5JOL A;  2M7L A;  4JWQ A;  2KBI A;  2G9B A;  3GOF A;  1F55 A;  3BXK A;  5AFP A;  2Q4U A;  1GGZ A;  5D69 A;  2ZFD A;  1KWO B;  1DF0 A;  1RJV A;  2BL0 C;  1S5G Z;  2KNE A;  2LVK A;  1CMF A;  2P6B B;  1IH0 A;  2ISD A;  1YVL A;  1S1E A;  1UP5 A;  1CNP A;  1DVI A;  1QS7 A;  1A03 A;  4Q04 A;  2KFF A;  2KI6 D;  2LE9 B;  3DVM A;  1YX8 A;  3KF9 A;  4OCI A;  1B47 A;  2WCB A;  2E30 A;  2KDH A;  3DVJ A;  3M0W A;  2FOT A;  1PVA A;  4MRX A;  1IJ5 A;  1K2H A;  4GGF C;  2LHL A;  2ZND A;  1DJY A;  1W7I B;  4AOM A;  1NCZ A;  3C1V A;  5AAN A;  1QX7 A;  2B1U A;  1ZAC A;  1UHH A;  2LV7 A;  3EK7 A;  4GGN A;  1TOP A;  1K9K A;  1Y1A A;  1LA0 A;  3I5I B;  4GNK B;  1XK4 A;  2L4I A;  1FF1 A;  1YRT B;  4PHM A;  1F71 A;  1J7R A;  1ODB A;  1ALW A;  1K93 D;  2PAL A;  2F8P A;  1UHN A;  2MBX A;  1F8H A;  1HT9 A;  1TCO B;  5HLV A;  4E68 A;  2LCP A;  3DF0 A;  2BEC A;  5FYX A;  4GFT A;  1ALV A;  3EKH A;  3OX6 A;  2LAP A;  3CTN A;  4N1F A;  1QLS A;  3EVV A;  2KAY A;  4OVN F;  1C7V A;  2JXL A;  4HRE E;  1CDN A;  2BBN A;  2NCP A;  3LK1 A;  4XJK A;  3BOW A;  3PLF B;  3VRP A;  1NSH A;  1SCM C;  2JUL A;  4USL A;  3CGA A;  3EVR A;  3SG7 A;  2D8N A;  2LMU A;  2SCP A;  5CSJ A;  1F4O A;  3E3R A;  3GK1 A;  5ER4 X;  3I5G C;  2JNF A;  2ZN9 A;  1LVC D;  2KAX A;  2GGZ A;  1MQ1 A;  1CDM A;  5BPJ A;  2MRD A;  1CLL A;  5HKY A;  4MZJ A;  1N2D A;  2LVI A;  2Y4Q A;  1OSA A;  2WCE A;  3TZ1 A;  1GGW A;  1RRO A;  4HSZ A;  5DKQ A;  1CLB A;  5ER5 A;  4ZCV A;  4DS7 A;  1XFU O;  2JC2 A;  2OPO A;  3FIA A;  2QPT A;  1R6P A;  2LP2 A;  1XO5 A;  1WRL A;  2JTT A;  3IQO A;  1J1E A;  1N65 A;  2KGB C;  1XFW O;  4DUQ A;  2KYF A;  3D0Y A;  4NDC A;  2LHI A;  3DD4 A;  2G2B A;  3VRO A;  2FCD A;  2NLN A;  1M39 A;  3JTD B;  5HYD A;  3TS5 C;  5TNC A;  2O5G A;  4I5J A;  1IWQ A;  1WDC B;  2Y1N A;  2DOQ A;  2EC6 B;  2K7O A;  1L2O C;  1DTL A;  2MAZ A;  1M46 A;  1FPW A;  4YGD B;  3IF7 A;  1PSB A;  1EG4 A;  1KFU S;  1J7Q A;  1ZMZ A;  2FJU B;  1G4Y R;  3AKA A;  3O78 A;  4WRI A;  1QTX A;  1KFX L;  1B8C A;  2MJW B;  1QLK A;  1Y0V H;  3O4Y A;  2Y1M A;  4DCK A;  1JBA A;  3PAT A;  2KBM A;  2PSR A;  3NSI A;  3I5H C;  3FWC A;  5PAL A;  2GV5 A;  2K7C A;  4FQO A;  1JF0 A;  1RK9 A;  1SL8 A;  1AJ5 A;  2HET A;  3WNX B;  4A4C A;  4OR9 B;  1TNP A;  2OS8 B;  3PFV A;  2KI4 B;  5D7F A;  2CCM A;  3SIB A;  3VRQ A;  1KSM A;  4YGC B;  4IL1 A;  3BUX B;  1YUT A;  2ZKM X;  3GK2 A;  2SAS A;  1VRK A;  3GK4 X;  4MN0 A;  3SG5 A;  1OQP A;  4NDD A;  1GJY A;  5JJG A;  3TUY C;  1NCX A;  2K8M B;  2OTG B;  1PVB A;  1WY9 A;  1XK4 C;  3SJS A;  2BBM A;  2K2F A;  3KEV A;  4JPZ B;  3VGO A;  1KSO A;  1WRZ A;  4PDZ A;  2NZ0 A;  1SMG A;  1DJZ A;  1OMD A;  2WCF A;  1JC2 A;  4ORC B;  1EXR A;  3PM8 A;  1NCY A;  2L4H A;  4I5K A;  1H4B A;  4MLW A;  2LUC A;  1YUR A;  1CMG A;  1UHJ A;  2KYC A;  1NX1 A;  2JNX A;  1IKU A;  1W7J B;  4ETO A;  2E6W A;  5CSN A;  2JXC A;  1J7P A;  2MLE C;  2LUX A;  2I2R E;  4GAO A;  2MHH A;  3WHT B;  2CNP A;  1BLQ A;  2BKI B;  3JVT C;  2HF5 A;  1PUL A;  3AAJ A;  4BY4 A;  4CID A;  4ICB A;  1J55 A;  2I7A A;  3CS1 A;  3RM1 A;  3RLZ A;  2M1K B;  3I5I C;  1AUI B;  2BL0 B;  1A75 B;  4XJK B;  1TIZ A;  4D1E A;  1FBV A;  2AAO A;  1XFV O;  3BYA A;  1SRA A;  1KK7 Z;  2PAS A;  4OV2 A;  2KFH A;  2O60 A;  1X02 A;  3LCP C;  2LNK A;  5IBW A;  3PSR A;  3CLN A;  4M2Q A;  1MXL C;  1ZFS A;  1JSA A;  1DJW A;  1K94 A;  1XFY O;  3WXA A;  1CDL A;  3AKB A;  4MRY A;  4MSP A;  1CFP A;  1BOD A;  1QX5 B;  3CR5 X;  2PMY A;  5I8N A;  2JT3 A;  2KFG A;  2KHN A;  1TNQ A;  1NWD A;  1U5I A;  2MA2 A;  3KO0 A;  4L9M A;  4MVF A;  1QV1 A;  1YRU B;  1K9U A;  3LK0 A;  2M3W A;  2NCO A;  5I2L A;  1CDP A;  1JWD A;  1KK8 C;  1MWN A;  2F33 A;  2JPT A;  1S36 A;  3D0Y B;  4PE0 A;  1DGU A;  1LIN A;  5CSI A;  1BR1 B;  1OMV A;  5AER A;  2JT8 A;  1AJ4 A;  1C7W A;  3EKJ A;  2F3Z A;  4MBE A;  4C0K A;  1IQ5 A;  1CTR A;  1QAT A;  1CM1 A;  2L0P A;  1F4Q A;  2NXQ A;  1NPQ A;  4DIR A;  1SCM B;  3HCM A;  4MZK A;  1SR6 C;  3HX4 A;  2M49 B;  2JWW A;  3I5G B;  2COL B;  3I5F B;  2CBL A;  1NP8 A;  1G33 A;  4OKH A;  5DKR A;  1RTP 1;  1NX3 A;  1AHR A;  1CKK A;  2CXJ A;  2EC6 C;  5GQQ C;  2HPS A;  3OB1 B;  4AQJ A;  2KOT A;  2KSP A;  3AAK A;  3TDU A;  1XFZ O;  1DJI A;  1UWO A;  2JZI A;  1R2U A;  2WOR A;  4N1G A;  2CT9 A;  3D10 A;  1QXP A;  3NSL A;  1SYM A;  2LVJ A;  3MSE B;  2LLT A;  2ZRS A;  1REC A;  4M2P A;  1KK7 Y;  1PRW A;  4QJ3 B;  1NX2 A;  1G8I A;  4P5O E;  4JQ0 D;  1MF8 B;  1OE9 B;  3TS5 B;  1DMO A;  1A2X A;  4U8D A;  4UPG A;  1KQM C;  2KGR A;  4NQG A;  1B7T Y;  1MHO A;  4XYN A;  2KQ6 A;  1QIW A;  1L2O B;  1XYD A;  1YUU A;  3SG6 A;  1SKT A;  2BE6 A;  1CFC A;  4ORB B;  1DJG A;  1S3P A;  1C07 A;  3CR2 A;  2K2A A;  3O2P A;  1UUS A;  3TDZ A;  1DF0 B;  1PAL A;  3DVE A;  1KQV A;  1AP4 A;  5KTY A;  1Y6W A;  1E8A A;  1TTX A;  4AQI A;  2F2P A;  1YVH A;  3SG4 A;  1LXF C;  4CFQ A;  3PN7 B;  1ZUZ A;  1JUO A;  4GPL B;  4PHK A;  1LA3 A;  2M97 A;  5I2O A;  2M29 A;  4I5N B;  4YI8 A;  5KU1 A;  1IG5 A;  3OX5 A;  4ZCU A;  1WLM A;  3FS7 A;  1KWO C;  2Y5I A;  3OB2 B;  4YI9 A;  4I5L B;  1RFJ A;  1BU3 A;  1BG1 A;  4GUK A;  2L5X B;  2HQ8 A;  1DT7 B;  3EK8 A;  1J7O A;  5I2Q A;  1XFX O;  1FI5 A;  1B9A A;  4C0J A;  2EHB A;  1H8B A;  2H2K A;  3TUY B;  1TNX A;  1EJ3 A;  1UUR A;  2ZRT A;  1S6J A;  2PVB A;  3LL8 B;  2LAN A;  4ORA B;  1YR5 A;  2K7B A;  2WOS A;  4PAL A;  4PHN A;  1QX2 A;  3DF0 B;  3KHE A;  2JT0 A;  2EGD A;  1NUB A;  1IJ6 A;  2K0J A;  3BUN B;  4PE7 A;  1K95 A;  1L7Z A;  4MZL A;  3BOW B;  2LM5 A;  3DVK A;  1QV0 A;  4MEW A;  3SG2 A;  1WRK A;  3CWG A;  3BUW B;  1U5I B;  2JQ6 A;  2L98 A;  2BCB A;  1OMR A;  1JF2 A;  3A8R A;  1SNL A;  1V1G A;  4PCW A;  2L50 A;  4TNC A;  2HQW A;  1OZO A;  2BCA A;  4GBA A;  3A4U B;  3PAL A;  1N0Y A;  2F3Y A;  3OP0 A;  1B7T Z;  1K96 A;  1UHI A;  3LLE A;  3NXA A;  2KQY A;  4WQ3 A;  1JFJ A;  4P2Y B;  2JRF A;  1FW4 A;  3JVT B;  1QAS A;  4PHJ A;  2L51 A;  3SG3 A;  1DJH A;  1SPY A;  1V1F A;  2BKH B;  5HKZ A;  1BT6 A;  1SW8 A;  2JU0 A;  1S6C A;  4YGE B;  4PE4 A;  5K89 A;  1QIV A;  4CFR A;  2MLF C;  2LVV A;  3NSK A;  4QJ4 B;  1KCY A;  4NDB A;  1DGV A;  2A4J A;  1CFF A;  1Y1X A;  1BOC A;  3VRN A;  1YTZ C;  1D1O A;  2H61 C;  3CR4 X;  1PSR A;  2KAV A;  1SK6 D;  1IRJ A;  2KI6 C;  3IQQ A;  3KPX A;  3TDI A;  4CPV A;  5F6T A;  1TRF A;  2RGI A;  1OZS A;  1TCF A;  3F45 A;  1A75 A;  4HRH A;  5G08 A;  3K21 A;  1SY9 A;  1QVI Y;  1J1D A;  1MXE A;  2VRG A;  5CPV A;  4M2O A;  4YBH B;  1BJF A;  1PK0 D;  3SIA A;  3I5F C;  4F0Z B;  1DJX A;  3JTD C;  1F54 A;  1KK8 B;  1A4P A;  1MR8 A;  1BF5 A;  4GGF A;  5HLO A;  1WDC C;  2LLU A;  4BY5 A;  4YRU A;  1KFX S;  1XVJ A;  2JOJ A;  2QAC A;  2K7D A;  3BQ3 A;  1CB1 A;  2AMI A;  1BR4 B;  1Q80 A;  1CFD A;  2WND A;  3ZWH A;  4YGB B;  1S5G Y;  2BCX A;  2ZNE A;  1M63 B;  2I18 A;  1TN4 A;  1SR6 B;  2F2O A;  1OOJ A;  1Y1U A;  4A4B A;  1K9P A;  2H61 A;  3EK4 A;  3WHU B;  1FI6 A;  2M8U A;  1IGV A;  2Q91 A;  1UHK A;  1B8R A;  2PRU A;  2FCE A;  2LC5 A;  2WC8 A;  2OS8 C;  2KI4 C;  1BMO A; 
#chains in the Genus database with same CATH topology
 1M31 A;  3D73 A;  2TN4 A;  1GQM A;  1LKJ A;  1B1G A;  2M1U A;  1EG3 A;  1QJT A;  2CTN A;  1TNW A;  3D77 A;  4WQ2 A;  1SCV A;  2V53 A;  5B8I B;  1NX0 A;  5J3X A;  1HQV A;  3FWB A;  2OTG C;  3ZNI A;  1JFK A;  3EVU A;  2I94 A;  2K61 A;  4DRW A;  5KSZ A;  1F70 A;  2GGM A;  3B87 A;  5CSF A;  3QRX A;  1K8U A;  1ZOT B;  4QJ5 B;  1XA5 A;  3PN7 C;  2LMV A;  1KFU L;  2R2I A;  2WC6 A;  1WLZ A;  4HRG A;  4N5X A;  1B4C A;  3I5H B;  1AK8 A;  1GM0 A;  2IS9 A;  1XFR A;  3BUM B;  1S6I A;  1SL7 A;  2LP3 A;  3OHM B;  1CLM A;  5FI7 A;  5AXI A;  1KQM B;  1CM4 A;  3B7A A;  2H8V A;  2M7N A;  2M9G A;  1W9Z A;  1EL4 A;  2LMT A;  2LLS A;  1MUX A;  1SL9 A;  1QVI Z;  3B88 A;  1YX7 A;  2KLE A;  3NSO A;  5AEQ A;  5HKW A;  2M0R A;  4CLN A;  1A29 A;  1S26 D;  3BUO B;  5DKN A;  2L2E A;  3R72 A;  3VRR A;  2ZN8 A;  3CZT X;  1SBJ A;  4R1E A;  4PE1 A;  4FTG A;  2JTZ A;  1EH2 A;  2AUC A;  1YUS A;  3ICB A;  1K90 D;  3H4S E;  1AVS A;  1RWY A;  1NIW A;  1NYA A;  1M45 A;  3O6B A;  1B8L A;  2BE4 A;  4C0L A;  4YGA A;  1IQ3 A;  5JOL A;  2M7L A;  4JWQ A;  2KBI A;  2G9B A;  3GOF A;  3S0E A;  1F55 A;  3BXK A;  5AFP A;  2Q4U A;  1GGZ A;  3OBV A;  5D69 A;  2ZFD A;  1KWO B;  1DF0 A;  1TWO A;  1RJV A;  2BL0 C;  1S5G Z;  2KNE A;  2LVK A;  1CMF A;  2P6B B;  1IH0 A;  2ISD A;  1YVL A;  1S1E A;  1UP5 A;  1CNP A;  1DVI A;  1QS7 A;  3DY9 A;  4INX A;  4Q04 A;  1A03 A;  3VB1 A;  2KFF A;  2KI6 D;  2LE9 B;  2PQL A;  3DVM A;  3D76 A;  1YX8 A;  3KF9 A;  4OCI A;  1B47 A;  2WCB A;  2E30 A;  2KDH A;  3DVJ A;  3M0W A;  2FOT A;  1PVA A;  4MRX A;  1IJ5 A;  1K2H A;  4GGF C;  2LHL A;  2ZND A;  1DJY A;  1W7I B;  1C3Z A;  4AOM A;  2P70 A;  3UNW A;  1NCZ A;  3C1V A;  5AAN A;  1QX7 A;  2B1U A;  1ZAC A;  1UHH A;  2LV7 A;  3EK7 A;  4GGN A;  3S0G A;  1TOP A;  1K9K A;  1Y1A A;  1LA0 A;  3I5I B;  3IVT A;  4GNK B;  1XK4 A;  2L4I A;  1FF1 A;  4INW A;  1YRT B;  4PHM A;  2QEV A;  1F71 A;  1J7R A;  1ODB A;  1ALW A;  1K93 D;  2PAL A;  2F8P A;  1UHN A;  3PM2 A;  2MBX A;  1HT9 A;  1F8H A;  1TCO B;  3CAB A;  5HLV A;  4E68 A;  1Z4H A;  2KLD A;  2LCP A;  3FE6 A;  3DF0 A;  2BEC A;  5FYX A;  4GFT A;  1ALV A;  3EKH A;  3OX6 A;  2LAP A;  3CTN A;  4N1F A;  1QLS A;  3EVV A;  2KAY A;  4OVN F;  4PT1 A;  2JXL A;  4HRE E;  1C7V A;  2BBN A;  2NCP A;  3LK1 A;  1CDN A;  4XJK A;  3BOW A;  2FJY A;  3PLF B;  3QME A;  3VRP A;  1NSH A;  1SCM C;  2JUL A;  4USL A;  3CGA A;  3EVR A;  3FE8 A;  3DZT A;  2D8N A;  2LMU A;  2SCP A;  5CSJ A;  3SG7 A;  1F4O A;  3E3R A;  3GK1 A;  1T14 A;  5ER4 X;  1P28 A;  3I5G C;  2JNF A;  2ZN9 A;  1LVC D;  2KAX A;  2GGZ A;  1MQ1 A;  1CDM A;  5BPJ A;  2MRD A;  1CLL A;  5HKY A;  2L2C A;  4MZJ A;  1N2D A;  2LVI A;  2Y4Q A;  1OSA A;  2WCE A;  3TZ1 A;  1GGW A;  1RRO A;  4HSZ A;  5DKQ A;  2QEO A;  5ER5 A;  4ZCV A;  1CLB A;  4DS7 A;  1XFU O;  2JC2 A;  2OPO A;  3FIA A;  2QPT A;  1R6P A;  2LP2 A;  1XO5 A;  1WRL A;  2JTT A;  3IQO A;  1J1E A;  1N65 A;  2KGB C;  1XFW O;  4DUQ A;  2KYF A;  3D0Y A;  4NDC A;  2LHI A;  3DD4 A;  2G2B A;  3VRO A;  2FCD A;  4KYN A;  2NLN A;  1M39 A;  3JTD B;  5HYD A;  1LS8 A;  3TS5 C;  2WC5 A;  5TNC A;  2O5G A;  4I5J A;  1IWQ A;  1WDC B;  2Y1N A;  2DOQ A;  2EC6 B;  2K7O A;  3D74 A;  1L2O C;  1DTL A;  2MAZ A;  1M46 A;  1FPW A;  4YGD B;  3IF7 A;  1OOF A;  1PSB A;  1EG4 A;  1KFU S;  1J7Q A;  1ZMZ A;  2FJU B;  3R1P A;  5HL1 A;  1G4Y R;  3AKA A;  3O78 A;  4WRI A;  1QTX A;  1KFX L;  1B8C A;  2MJW B;  1QLK A;  1Y0V H;  3O4Y A;  2Y1M A;  4DCK A;  1JBA A;  3Q8I A;  3PAT A;  2KBM A;  2PSR A;  3NSI A;  3I5H C;  3FWC A;  5PAL A;  2GV5 A;  2K7C A;  3B86 A;  4FQO A;  1JF0 A;  1RK9 A;  1SL8 A;  1AJ5 A;  2HET A;  3OGN A;  3WNX B;  4OR9 B;  4A4C A;  1TNP A;  2OS8 B;  3PFV A;  2KI4 B;  5D7F A;  2CCM A;  3SIB A;  3VRQ A;  1KSM A;  4YGC B;  4IL1 A;  3BUX B;  1YUT A;  2ZKM X;  3GK2 A;  2SAS A;  1VRK A;  3GK4 X;  4MN0 A;  1OOG A;  3SG5 A;  1OQP A;  4NDD A;  1GJY A;  2YGU A;  5JJG A;  3TUY C;  1NCX A;  2K8M B;  2OTG B;  1PVB A;  1WY9 A;  1XK4 C;  3SJS A;  2BBM A;  3RZS A;  2K2F A;  3KEV A;  4JPZ B;  3VGO A;  1KSO A;  1WRZ A;  4PDZ A;  2NZ0 A;  1SMG A;  1DJZ A;  1OMD A;  2WCF A;  3CZ0 A;  1JC2 A;  4ORC B;  1EXR A;  3PM8 A;  1NCY A;  3R1V A;  2L4H A;  4I5K A;  1H4B A;  4MLW A;  2LUC A;  1YUR A;  1CMG A;  1UHJ A;  1OW4 A;  2KYC A;  1NX1 A;  2WCJ A;  2JNX A;  1IKU A;  1W7J B;  4ETO A;  2E6W A;  2QEH A;  5CSN A;  2JXC A;  1J7P A;  2MLE C;  2LUX A;  3SS3 A;  2I2R E;  2ERB A;  4GAO A;  2MHH A;  3WHT B;  2CNP A;  1BLQ A;  2BKI B;  3S0A A;  3JVT C;  2HF5 A;  1PUL A;  3AAJ A;  4BY4 A;  1DEL A;  4CID A;  4ICB A;  1J55 A;  2I7A A;  3CYZ A;  3CS1 A;  3RM1 A;  3RLZ A;  2M1K B;  3I5I C;  1AUI B;  2BL0 B;  1A75 B;  4XJK B;  1TIZ A;  4D1E A;  1FBV A;  2AAO A;  1XFV O;  3BYA A;  1SRA A;  1KK7 Z;  2PAS A;  4OV2 A;  3UO9 A;  2KFH A;  2O60 A;  1X02 A;  3LCP C;  4OZD A;  2LNK A;  5IBW A;  3PSR A;  3CLN A;  4M2Q A;  5D3O A;  1MXL C;  1ZFS A;  1JSA A;  1DJW A;  1K94 A;  1XFY O;  4JKT A;  3WXA A;  1CDL A;  3V2L A;  3L4A A;  3AKB A;  4MRY A;  4MSP A;  1CFP A;  3S0D A;  1BOD A;  1QX5 B;  3CR5 X;  2PMY A;  5I8N A;  2JT3 A;  2KFG A;  2KHN A;  1TNQ A;  1DEK A;  1NWD A;  1U5I A;  2MA2 A;  3KO0 A;  4L9M A;  4MVF A;  1QV1 A;  3SS4 A;  2KPH A;  1YRU B;  1K9U A;  3LK0 A;  2M3W A;  2NCO A;  5I2L A;  1CDP A;  2WCM A;  3S0F A;  1QWV A;  5FI6 A;  1JWD A;  1KK8 C;  1MWN A;  2F33 A;  2JPT A;  1S36 A;  3D0Y B;  4PE0 A;  5I94 A;  1DGU A;  1LIN A;  5CSI A;  1BR1 B;  1OMV A;  2K60 A;  5AER A;  2JT8 A;  1AJ4 A;  1C7W A;  3EKJ A;  2F3Z A;  4MBE A;  2BNX A;  4C0K A;  1IQ5 A;  1CTR A;  1QAT A;  1CM1 A;  2GTE A;  2L0P A;  1F4Q A;  2NXQ A;  1NPQ A;  4DIR A;  1SCM B;  3HCM A;  4MZK A;  1SR6 C;  3HX4 A;  2M49 B;  2JWW A;  3I5G B;  2COL B;  3I5F B;  2CBL A;  1NP8 A;  1G33 A;  3FE9 A;  4JD9 A;  1RTP 1;  4OKH A;  5DKR A;  1NX3 A;  1AHR A;  3PJI A;  1CKK A;  2CXJ A;  2EC6 C;  5GQQ C;  2HPS A;  3OB1 B;  4AQJ A;  2KOT A;  2KSP A;  3AAK A;  3TDU A;  1XFZ O;  1DJI A;  1UWO A;  2JZI A;  1R2U A;  2WOR A;  4N1G A;  2CT9 A;  5EL2 A;  3D10 A;  3B6X A;  1QXP A;  3R1O A;  3NSL A;  1SYM A;  2LVJ A;  3DYE A;  3MSE B;  2LLT A;  2ZRS A;  1REC A;  4M2P A;  1KK7 Y;  1PRW A;  4QJ3 B;  1NX2 A;  1G8I A;  4P5O E;  4JQ0 D;  1MF8 B;  1OE9 B;  3BJH A;  3TS5 B;  1DMO A;  1A2X A;  4U8D A;  4UPG A;  1KQM C;  2KGR A;  4NQG A;  1B7T Y;  1MHO A;  4XYN A;  2KQ6 A;  1QIW A;  1L2O B;  1XYD A;  1YUU A;  2QEB A;  1SKT A;  3SG6 A;  2BE6 A;  2WCH A;  4ORB B;  5DIC A;  1CFC A;  1DJG A;  3CZ2 A;  1S3P A;  1C07 A;  3CR2 A;  2K2A A;  3O2P A;  1UUS A;  4F7F A;  3TDZ A;  1DF0 B;  1PAL A;  3DVE A;  1KQV A;  1AP4 A;  5KTY A;  1Y6W A;  1E8A A;  1TTX A;  4AQI A;  2F2P A;  1YVH A;  3SG4 A;  1LXF C;  4CFQ A;  2PYQ A;  3PN7 B;  3N7H A;  1ZUZ A;  3K1E A;  1JUO A;  4GPL B;  4PHK A;  1LA3 A;  2M97 A;  3DXL A;  5I2O A;  2M29 A;  3NHT A;  4I5N B;  4YI8 A;  5KU1 A;  1IG5 A;  3OX5 A;  4ZCU A;  1WLM A;  3FS7 A;  1KWO C;  2Y5I A;  3OB2 B;  4YI9 A;  4I5L B;  1RFJ A;  1BU3 A;  3D78 A;  4GUK A;  2L5X B;  1BG1 A;  2HQ8 A;  1DT7 B;  3EK8 A;  1J7O A;  5I2Q A;  1XFX O;  1FI5 A;  1B9A A;  4C0J A;  3BFA A;  2EHB A;  1H8B A;  2H2K A;  3TUY B;  1TNX A;  1EJ3 A;  1UUR A;  2ZRT A;  1S6J A;  2PVB A;  5FI2 A;  2WCL A;  3LL8 B;  2LAN A;  4ORA B;  1YR5 A;  2BAP A;  2K7B A;  2WOS A;  4PAL A;  4PHN A;  1QX2 A;  3DF0 B;  1TUJ A;  3KHE A;  2JT0 A;  2EGD A;  1NUB A;  1IJ6 A;  2K0J A;  3BUN B;  4PE7 A;  1K95 A;  1L7Z A;  4MZL A;  3BOW B;  2LM5 A;  3DVK A;  1QV0 A;  4MEW A;  3SG2 A;  1WRK A;  3CWG A;  3BUW B;  1U5I B;  2JQ6 A;  2L98 A;  2BCB A;  1OMR A;  1JF2 A;  3A8R A;  1SNL A;  1V1G A;  4PCW A;  3NHI A;  2L50 A;  3S0B A;  4TNC A;  2HQW A;  1OZO A;  2BCA A;  4GBA A;  3A4U B;  3D75 A;  1N0Y A;  2F3Y A;  3PAL A;  1DQE A;  1B7T Z;  1K96 A;  1UHI A;  3LLE A;  3NXA A;  3OP0 A;  2KQY A;  4WQ3 A;  2P71 A;  4P2Y B;  1JFJ A;  2JRF A;  1FW4 A;  3JVT B;  1QAS A;  4PHJ A;  2L51 A;  1TUZ A;  3SG3 A;  1IIO A;  3NGV A;  1DJH A;  1SPY A;  1ORG A;  1V1F A;  2BKH B;  5HKZ A;  1BT6 A;  1SW8 A;  1OOI X;  1S6C A;  2JU0 A;  4YGE B;  4IJ7 A;  4PE4 A;  5K89 A;  1QIV A;  4CFR A;  2MLF C;  2LVV A;  3NSK A;  4QJ4 B;  1KCY A;  4NDB A;  1DGV A;  2A4J A;  3SS5 A;  1Y1X A;  1CFF A;  1BOC A;  3VRN A;  1YTZ C;  1D1O A;  2H61 C;  2WCK A;  3CR4 X;  1PSR A;  2KAV A;  1SK6 D;  1IRJ A;  2KI6 C;  3IQQ A;  3KPX A;  3TDI A;  4CPV A;  3CDN A;  5F6T A;  1TRF A;  2RGI A;  1OZS A;  1TCF A;  3L4L A;  3F45 A;  1A75 A;  4HRH A;  5G08 A;  3K21 A;  1SY9 A;  1QVI Y;  3CZ1 A;  1J1D A;  2L5Y A;  1MXE A;  2JPO A;  2VRG A;  5CPV A;  4M2O A;  4YBH B;  1BJF A;  1SSE B;  1PK0 D;  3SIA A;  3O4X A;  3I5F C;  4F0Z B;  3EG5 B;  1DJX A;  3JTD C;  1F54 A;  1KK8 B;  1A4P A;  1MR8 A;  1BF5 A;  1C3Y A;  4GGF A;  5HLO A;  1WDC C;  2LLU A;  4BY5 A;  1Z2C B;  4YRU A;  1KFX S;  2QDI A;  1XVJ A;  2JOJ A;  2QAC A;  2K7D A;  3BQ3 A;  1CB1 A;  2AMI A;  1BR4 B;  1Q80 A;  1CFD A;  2WND A;  3ZWH A;  4YGB B;  1S5G Y;  2BCX A;  2ZNE A;  1M63 B;  2I18 A;  1TN4 A;  1SR6 B;  2F2O A;  1OOJ A;  1Y1U A;  4A4B A;  1K9P A;  3L47 A;  2H61 A;  4FQT A;  3EK4 A;  3BFB A;  3WHU B;  1OOH A;  2M8U A;  1IGV A;  2Q91 A;  1FI6 A;  1UHK A;  1B8R A;  2PRU A;  2FCE A;  2LC5 A;  2WC8 A;  1DC1 A;  2OS8 C;  2KI4 C;  3BFH A;  1BMO A; 
#chains in the Genus database with same CATH homology
 1M31 A;  2TN4 A;  1GQM A;  1LKJ A;  1B1G A;  2M1U A;  1EG3 A;  1QJT A;  2CTN A;  1TNW A;  4WQ2 A;  1SCV A;  2V53 A;  5B8I B;  1NX0 A;  5J3X A;  1HQV A;  3FWB A;  2OTG C;  3ZNI A;  1JFK A;  3EVU A;  2I94 A;  2K61 A;  4DRW A;  5KSZ A;  1F70 A;  2GGM A;  5CSF A;  3QRX A;  1K8U A;  1ZOT B;  4QJ5 B;  1XA5 A;  3PN7 C;  2LMV A;  1KFU L;  2R2I A;  1WLZ A;  4HRG A;  4N5X A;  1B4C A;  3I5H B;  1AK8 A;  2IS9 A;  3BUM B;  1S6I A;  1SL7 A;  2LP3 A;  3OHM B;  1CLM A;  5AXI A;  1KQM B;  1CM4 A;  2M7N A;  2M9G A;  1EL4 A;  2LMT A;  2LLS A;  1MUX A;  1SL9 A;  1QVI Z;  1YX7 A;  3NSO A;  5AEQ A;  5HKW A;  2M0R A;  4CLN A;  1A29 A;  1S26 D;  3BUO B;  5DKN A;  2L2E A;  3VRR A;  2ZN8 A;  3CZT X;  1SBJ A;  4R1E A;  4PE1 A;  4FTG A;  2JTZ A;  1EH2 A;  2AUC A;  1YUS A;  3ICB A;  1K90 D;  3H4S E;  1AVS A;  1RWY A;  1NIW A;  1NYA A;  1M45 A;  3O6B A;  1B8L A;  2BE4 A;  4C0L A;  4YGA A;  1IQ3 A;  5JOL A;  2M7L A;  4JWQ A;  2KBI A;  2G9B A;  3GOF A;  1F55 A;  3BXK A;  5AFP A;  2Q4U A;  1GGZ A;  5D69 A;  2ZFD A;  1KWO B;  1DF0 A;  1RJV A;  2BL0 C;  1S5G Z;  2KNE A;  2LVK A;  1CMF A;  2P6B B;  1IH0 A;  2ISD A;  1YVL A;  1S1E A;  1UP5 A;  1CNP A;  1DVI A;  1QS7 A;  1A03 A;  4Q04 A;  2KFF A;  2KI6 D;  2LE9 B;  3DVM A;  1YX8 A;  3KF9 A;  4OCI A;  1B47 A;  2WCB A;  2E30 A;  2KDH A;  3DVJ A;  3M0W A;  2FOT A;  1PVA A;  4MRX A;  1IJ5 A;  1K2H A;  4GGF C;  2LHL A;  2ZND A;  1DJY A;  1W7I B;  4AOM A;  1NCZ A;  3C1V A;  5AAN A;  1QX7 A;  2B1U A;  1ZAC A;  1UHH A;  2LV7 A;  3EK7 A;  4GGN A;  1TOP A;  1K9K A;  1Y1A A;  1LA0 A;  3I5I B;  4GNK B;  1XK4 A;  2L4I A;  1FF1 A;  1YRT B;  4PHM A;  1F71 A;  1J7R A;  1ODB A;  1ALW A;  1K93 D;  2PAL A;  2F8P A;  1UHN A;  2MBX A;  1F8H A;  1HT9 A;  1TCO B;  5HLV A;  4E68 A;  2LCP A;  3DF0 A;  2BEC A;  5FYX A;  4GFT A;  1ALV A;  3EKH A;  3OX6 A;  2LAP A;  3CTN A;  4N1F A;  1QLS A;  3EVV A;  2KAY A;  4OVN F;  1C7V A;  2JXL A;  4HRE E;  1CDN A;  2BBN A;  2NCP A;  3LK1 A;  4XJK A;  3BOW A;  3PLF B;  3VRP A;  1NSH A;  1SCM C;  2JUL A;  4USL A;  3CGA A;  3EVR A;  3SG7 A;  2D8N A;  2LMU A;  2SCP A;  5CSJ A;  1F4O A;  3E3R A;  3GK1 A;  5ER4 X;  3I5G C;  2JNF A;  2ZN9 A;  1LVC D;  2KAX A;  2GGZ A;  1MQ1 A;  1CDM A;  5BPJ A;  2MRD A;  1CLL A;  5HKY A;  4MZJ A;  1N2D A;  2LVI A;  2Y4Q A;  1OSA A;  2WCE A;  3TZ1 A;  1GGW A;  1RRO A;  4HSZ A;  5DKQ A;  1CLB A;  5ER5 A;  4ZCV A;  4DS7 A;  1XFU O;  2JC2 A;  2OPO A;  3FIA A;  2QPT A;  1R6P A;  2LP2 A;  1XO5 A;  1WRL A;  2JTT A;  3IQO A;  1J1E A;  1N65 A;  2KGB C;  1XFW O;  4DUQ A;  2KYF A;  3D0Y A;  4NDC A;  2LHI A;  3DD4 A;  2G2B A;  3VRO A;  2FCD A;  2NLN A;  1M39 A;  3JTD B;  5HYD A;  3TS5 C;  5TNC A;  2O5G A;  4I5J A;  1IWQ A;  1WDC B;  2Y1N A;  2DOQ A;  2EC6 B;  2K7O A;  1L2O C;  1DTL A;  2MAZ A;  1M46 A;  1FPW A;  4YGD B;  3IF7 A;  1PSB A;  1EG4 A;  1KFU S;  1J7Q A;  1ZMZ A;  2FJU B;  1G4Y R;  3AKA A;  3O78 A;  4WRI A;  1QTX A;  1KFX L;  1B8C A;  2MJW B;  1QLK A;  1Y0V H;  3O4Y A;  2Y1M A;  4DCK A;  1JBA A;  3PAT A;  2KBM A;  2PSR A;  3NSI A;  3I5H C;  3FWC A;  5PAL A;  2GV5 A;  2K7C A;  4FQO A;  1JF0 A;  1RK9 A;  1SL8 A;  1AJ5 A;  2HET A;  3WNX B;  4A4C A;  4OR9 B;  1TNP A;  2OS8 B;  3PFV A;  2KI4 B;  5D7F A;  2CCM A;  3SIB A;  3VRQ A;  1KSM A;  4YGC B;  4IL1 A;  3BUX B;  1YUT A;  2ZKM X;  3GK2 A;  2SAS A;  1VRK A;  3GK4 X;  4MN0 A;  3SG5 A;  1OQP A;  4NDD A;  1GJY A;  5JJG A;  3TUY C;  1NCX A;  2K8M B;  2OTG B;  1PVB A;  1WY9 A;  1XK4 C;  3SJS A;  2BBM A;  2K2F A;  3KEV A;  4JPZ B;  3VGO A;  1KSO A;  1WRZ A;  4PDZ A;  2NZ0 A;  1SMG A;  1DJZ A;  1OMD A;  2WCF A;  1JC2 A;  4ORC B;  1EXR A;  3PM8 A;  1NCY A;  2L4H A;  4I5K A;  1H4B A;  4MLW A;  2LUC A;  1YUR A;  1CMG A;  1UHJ A;  2KYC A;  1NX1 A;  2JNX A;  1IKU A;  1W7J B;  4ETO A;  2E6W A;  5CSN A;  2JXC A;  1J7P A;  2MLE C;  2LUX A;  2I2R E;  4GAO A;  2MHH A;  3WHT B;  2CNP A;  1BLQ A;  2BKI B;  3JVT C;  2HF5 A;  1PUL A;  3AAJ A;  4BY4 A;  4CID A;  4ICB A;  1J55 A;  2I7A A;  3CS1 A;  3RM1 A;  3RLZ A;  2M1K B;  3I5I C;  1AUI B;  2BL0 B;  1A75 B;  4XJK B;  1TIZ A;  4D1E A;  1FBV A;  2AAO A;  1XFV O;  3BYA A;  1SRA A;  1KK7 Z;  2PAS A;  4OV2 A;  2KFH A;  2O60 A;  1X02 A;  3LCP C;  2LNK A;  5IBW A;  3PSR A;  3CLN A;  4M2Q A;  1MXL C;  1ZFS A;  1JSA A;  1DJW A;  1K94 A;  1XFY O;  3WXA A;  1CDL A;  3AKB A;  4MRY A;  4MSP A;  1CFP A;  1BOD A;  1QX5 B;  3CR5 X;  2PMY A;  5I8N A;  2JT3 A;  2KFG A;  2KHN A;  1TNQ A;  1NWD A;  1U5I A;  2MA2 A;  3KO0 A;  4L9M A;  4MVF A;  1QV1 A;  1YRU B;  1K9U A;  3LK0 A;  2M3W A;  2NCO A;  5I2L A;  1CDP A;  1JWD A;  1KK8 C;  1MWN A;  2F33 A;  2JPT A;  1S36 A;  3D0Y B;  4PE0 A;  1DGU A;  1LIN A;  5CSI A;  1BR1 B;  1OMV A;  5AER A;  2JT8 A;  1AJ4 A;  1C7W A;  3EKJ A;  2F3Z A;  4MBE A;  4C0K A;  1IQ5 A;  1CTR A;  1QAT A;  1CM1 A;  2L0P A;  1F4Q A;  2NXQ A;  1NPQ A;  4DIR A;  1SCM B;  3HCM A;  4MZK A;  1SR6 C;  3HX4 A;  2M49 B;  2JWW A;  3I5G B;  2COL B;  3I5F B;  2CBL A;  1NP8 A;  1G33 A;  4OKH A;  5DKR A;  1RTP 1;  1NX3 A;  1AHR A;  1CKK A;  2CXJ A;  2EC6 C;  5GQQ C;  2HPS A;  3OB1 B;  4AQJ A;  2KOT A;  2KSP A;  3AAK A;  3TDU A;  1XFZ O;  1DJI A;  1UWO A;  2JZI A;  1R2U A;  2WOR A;  4N1G A;  2CT9 A;  3D10 A;  1QXP A;  3NSL A;  1SYM A;  2LVJ A;  3MSE B;  2LLT A;  2ZRS A;  1REC A;  4M2P A;  1KK7 Y;  1PRW A;  4QJ3 B;  1NX2 A;  1G8I A;  4P5O E;  4JQ0 D;  1MF8 B;  1OE9 B;  3TS5 B;  1DMO A;  1A2X A;  4U8D A;  4UPG A;  1KQM C;  2KGR A;  4NQG A;  1B7T Y;  1MHO A;  4XYN A;  2KQ6 A;  1QIW A;  1L2O B;  1XYD A;  1YUU A;  3SG6 A;  1SKT A;  2BE6 A;  1CFC A;  4ORB B;  1DJG A;  1S3P A;  1C07 A;  3CR2 A;  2K2A A;  3O2P A;  1UUS A;  3TDZ A;  1DF0 B;  1PAL A;  3DVE A;  1KQV A;  1AP4 A;  5KTY A;  1Y6W A;  1E8A A;  1TTX A;  4AQI A;  2F2P A;  1YVH A;  3SG4 A;  1LXF C;  4CFQ A;  3PN7 B;  1ZUZ A;  1JUO A;  4GPL B;  4PHK A;  1LA3 A;  2M97 A;  5I2O A;  2M29 A;  4I5N B;  4YI8 A;  5KU1 A;  1IG5 A;  3OX5 A;  4ZCU A;  1WLM A;  3FS7 A;  1KWO C;  2Y5I A;  3OB2 B;  4YI9 A;  4I5L B;  1RFJ A;  1BU3 A;  1BG1 A;  4GUK A;  2L5X B;  2HQ8 A;  1DT7 B;  3EK8 A;  1J7O A;  5I2Q A;  1XFX O;  1FI5 A;  1B9A A;  4C0J A;  2EHB A;  1H8B A;  2H2K A;  3TUY B;  1TNX A;  1EJ3 A;  1UUR A;  2ZRT A;  1S6J A;  2PVB A;  3LL8 B;  2LAN A;  4ORA B;  1YR5 A;  2K7B A;  2WOS A;  4PAL A;  4PHN A;  1QX2 A;  3DF0 B;  3KHE A;  2JT0 A;  2EGD A;  1NUB A;  1IJ6 A;  2K0J A;  3BUN B;  4PE7 A;  1K95 A;  1L7Z A;  4MZL A;  3BOW B;  2LM5 A;  3DVK A;  1QV0 A;  4MEW A;  3SG2 A;  1WRK A;  3CWG A;  3BUW B;  1U5I B;  2JQ6 A;  2L98 A;  2BCB A;  1OMR A;  1JF2 A;  3A8R A;  1SNL A;  1V1G A;  4PCW A;  2L50 A;  4TNC A;  2HQW A;  1OZO A;  2BCA A;  4GBA A;  3A4U B;  3PAL A;  1N0Y A;  2F3Y A;  3OP0 A;  1B7T Z;  1K96 A;  1UHI A;  3LLE A;  3NXA A;  2KQY A;  4WQ3 A;  1JFJ A;  4P2Y B;  2JRF A;  1FW4 A;  3JVT B;  1QAS A;  4PHJ A;  2L51 A;  3SG3 A;  1DJH A;  1SPY A;  1V1F A;  2BKH B;  5HKZ A;  1BT6 A;  1SW8 A;  2JU0 A;  1S6C A;  4YGE B;  4PE4 A;  5K89 A;  1QIV A;  4CFR A;  2MLF C;  2LVV A;  3NSK A;  4QJ4 B;  1KCY A;  4NDB A;  1DGV A;  2A4J A;  1CFF A;  1Y1X A;  1BOC A;  3VRN A;  1YTZ C;  1D1O A;  2H61 C;  3CR4 X;  1PSR A;  2KAV A;  1SK6 D;  1IRJ A;  2KI6 C;  3IQQ A;  3KPX A;  3TDI A;  4CPV A;  5F6T A;  1TRF A;  2RGI A;  1OZS A;  1TCF A;  3F45 A;  1A75 A;  4HRH A;  5G08 A;  3K21 A;  1SY9 A;  1QVI Y;  1J1D A;  1MXE A;  2VRG A;  5CPV A;  4M2O A;  4YBH B;  1BJF A;  1PK0 D;  3SIA A;  3I5F C;  4F0Z B;  1DJX A;  3JTD C;  1F54 A;  1KK8 B;  1A4P A;  1MR8 A;  1BF5 A;  4GGF A;  5HLO A;  1WDC C;  2LLU A;  4BY5 A;  4YRU A;  1KFX S;  1XVJ A;  2JOJ A;  2QAC A;  2K7D A;  3BQ3 A;  1CB1 A;  2AMI A;  1BR4 B;  1Q80 A;  1CFD A;  2WND A;  3ZWH A;  4YGB B;  1S5G Y;  2BCX A;  2ZNE A;  1M63 B;  2I18 A;  1TN4 A;  1SR6 B;  2F2O A;  1OOJ A;  1Y1U A;  4A4B A;  1K9P A;  2H61 A;  3EK4 A;  3WHU B;  1FI6 A;  2M8U A;  1IGV A;  2Q91 A;  1UHK A;  1B8R A;  2PRU A;  2FCE A;  2LC5 A;  2WC8 A;  2OS8 C;  2KI4 C;  1BMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...