3CS1A

Flagellar calcium-binding protein (fcabp) from t. cruzi
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
192
structure length
191
Chain Sequence
SDKDGKKAKDRKEAWERIRQAIPREKTAEAKQRRIELFKKFDKNETGKLYDEVYSGCLEVLKLDEFTSRVRDITKRAFDKSRTLGSKLENKGSEDFVEFLEFRLMLCYIYDFFELTVMFDEIDASGNMLVDEEEFKRAVPKLEAWGAKVEDPAALFKELDKNGTGSVTFDEFAAWASAVKLDADGDPDNVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar calcium-binding protein
publication title Structural Insights into Membrane Targeting by the Flagellar Calcium-binding Protein (FCaBP), a Myristoylated and Palmitoylated Calcium Sensor in Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Metal binding protein
total genus 74
structure length 191
sequence length 192
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cs1A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cs1A02
1DJYA 1R6PA 1HT9A 1EH2A 2K8MB 1QTXA 3QRXA 4XYNA 1K8UA 2ZNEA 3WHTB 1CMGA 2LUCA 2MRDA 1SK6D 3E3RA 3NSLA 2LHLA 3RLZA 3CS1A 1A29A 1JBAA 2GGZA 1BT6A 1WRKA 2BBMA 3JVTC 4MVFA 2I2RE 1S5GY 1G8IA 2HQ8A 2Y5IA 1N0YA 4NDCA 1UP5A 2F2OA 4GNKB 1XFWO 2AAOA 2BBNA 1CLLA 1TNWA 5F6TA 1DVIA 4YGEB 2R2IA 1J1DA 5ER5A 3AKAA 2LLUA 4GAOA 1QLSA 5DKNA 5ER4X 1M45A 1Y1XA 2NXQA 3A4UB 3DD4A 4PE7A 1VRKA 2CT9A 1KCYA 2GGMA 1F8HA 4D1EA 2BKIB 3HX4A 2M49B 1KWOB 1UURA 2LC5A 3KHEA 5KU1A 1J7PA 2B1UA 1DGUA 2QACA 2ZFDA 3VRRA 2JU0A 3EVRA 2QPTA 1NP8A 2LLSA 4U8DA 4MN0A 1KSOA 1KK8C 4PHKA 1CFCA 5GQQC 2LP2A 1FI6A 2JZIA 1NX2A 3FWCA 1V1GA 2PSRA 1KQVA 5DKRA 1FI5A 1K95A 2JT8A 2M7NA 3KF9A 1QV0A 2LE9B 1DF0B 5I2QA 1QJTA 4TNCA 5CPVA 2E6WA 4M2QA 3DF0B 2F33A 2K0JA 1S1EA 5AERA 1X02A 2Q91A 3EK7A 4WRIA 1DJZA 3WHUB 3TDZA 2LP3A 2JWWA 3IQQA 4XJKB 3WNXB 1JF2A 1YRTB 4BY5A 1NSHA 1RK9A 1Y1UA 1WLZA 1MF8B 1SBJA 2BE4A 2RGIA 4MRYA 1IH0A 1QLKA 1TNQA 5HYDA 4ETOA 1FW4A 1SR6C 1XFYO 2Y1MA 2PRUA 1ZUZA 4I5NB 5HLOA 1DJIA 1RECA 1IJ5A 2KSPA 3SG6A 3JTDB 2JRFA 2OTGC 1CFPA 3DVJA 1BMOA 4MZLA 1OZOA 1YX7A 2L4HA 2Q4UA 1NX1A 3H4SE 1DJXA 1KQMB 1S3PA 2CXJA 4N1FA 1B8CA 4ORBB 1YVLA 2ZN8A 1B8LA 4JPZB 1DJGA 1TN4A 1D1OA 1A4PA 1YURA 2KBIA 1S6IA 2BCXA 1XK4C 2KI6D 2L50A 1AJ5A 2JT3A 1NUBA 2O60A 2OS8C 1HQVA 3VGOA 2CCMA 2ZRSA 4OV2A 1GGWA 3CR4X 2NLNA 1J55A 5CSJA 1YUTA 2ZRTA 4OKHA 4JQ0D 5PALA 4QJ3B 3OHMB 1RROA 1F4QA 1CDLA 2KYCA 1GJYA 3EK4A 1KSMA 2H2KA 1J7QA 2M1UA 3D0YA 2JULA 4I5LB 4NQGA 1SNLA 2NCOA 1WDCC 2LUXA 2LMVA 2F3ZA 4OR9B 1CTRA 4CIDA 4Q04A 3C1VA 1IG5A 1K96A 1TRFA 1PVAA 1BR1B 2KYFA 2PMYA 2L98A 3BOWB 3TS5C 1SKTA 1AP4A 2LVIA 2SASA 1NX0A 2MA2A 3TDIA 2CNPA 3EKHA 3TZ1A 5BPJA 4A4BA 1XA5A 3I5HB 3I5FB 1NX3A 3VRQA 1BODA 3PN7B 1M39A 2HPSA 2L2EA 1NCYA 2KI6C 3TUYB 2O5GA 4FTGA 4MZJA 3KO0A 4QJ5B 1ODBA 4PE1A 2KI4C 3I5GB 1SYMA 1JF0A 4IL1A 2F3YA 5AXIA 1CDNA 1G33A 2M7LA 3NSIA 1C7WA 1BF5A 2K7DA 2PVBA 1NWDA 1J1EA 1L2OB 2COLB 2BL0C 3I5IB 1IRJA 3EKJA 4MEWA 4MLWA 1DGVA 1SL8A 2HETA 3FIAA 2PASA 1ALWA 4CFRA 1XFXO 2LAPA 5FYXA 1XFVO 4R1EA 3SG7A 2JC2A 1UUSA 4WQ3A 1DTLA 1LA3A 1K9PA 2JQ6A 3DVKA 1XYDA 1IQ5A 1KFXL 1K90D 4YI9A 1EL4A 1OQPA 3NXAA 2KDHA 3LK0A 1CKKA 4AQIA 1BG1A 3KEVA 2OPOA 2A4JA 4CFQA 1PK0D 2K7OA 1WLMA 2KGRA 1YX8A 2L5XB 4C0LA 2FCDA 2L4IA 3BUXB 1CB1A 1K9KA 4F0ZB 3EK8A 1PSRA 1DMOA 3CR2A 3O6BA 3SIBA 1EG3A 1OSAA 3ZNIA 3LK1A 1SCVA 4PCWA 1YRUB 4UPGA 1F55A 3BQ3A 2ZNDA 1QASA 5AEQA 2M97A 1A75B 3GOFA 1A03A 1R2UA 4GGNA 1QX7A 4JWQA 2P6BB 1NYAA 2WOSA 2KFFA 1CM4A 1SCMC 3BOWA 1QIVA 2ISDA 2M8UA 1ZFSA 1N2DA 1L7ZA 1B8RA 1SY9A 2KNEA 1QX2A 2Y4QA 3RM1A 4E68A 3JVTB 3PATA 2KQ6A 3GK2A 1RTP1 2HF5A 1OOJA 3SG2A 1K93D 2WC8A 1B9AA 3NSOA 1W7IB 2EC6C 3AAJA 1CMFA 4CLNA 1C7VA 4DCKA 3WXAA 3MSEB 3CZTX 2G2BA 2M3WA 1B1GA 1JFJA 2F8PA 5DKQA 1W7JB 1YR5A 5JJGA 2JPTA 4GUKA 3PSRA 3D10A 2LVVA 3BUMB 5IBWA 2LMUA 2MHHA 1MHOA 2WORA 5K89A 1AJ4A 1CLBA 4DS7A 3SG5A 2MLEC 1RWYA 4QJ4B 1QIWA 1KK8B 2LV7A 2K61A 2ZN9A 4P2YB 2G9BA 4DUQA 2LNKA 4PE0A 3SG4A 1XFUO 1F70A 4YRUA 1SRAA 2LLTA 1CLMA 1LA0A 4PHJA 4YGBB 1H8BA 1EJ3A 1NCZA 3EVVA 4PALA 5I2OA 2KGBC 2Y1NA 1M63B 1QVIY 1SPYA 1KWOC 2M29A 3PM8A 1BR4B 2FJUB 1SL9A 2L0PA 2MAZA 2K7BA 4YGAA 1B47A 2E30A 1UHHA 2K2FA 3IQOA 1YUSA 1RJVA 2AMIA 4OCIA 4YI8A 5CSFA 1WRZA 2LM5A 4USLA 1QX5B 1BU3A 1XFZO 5HLVA 1K9UA 2LANA 4MBEA 2NCPA 3CTNA 2KAYA 1DF0A 3LL8B 3O4YA 1SMGA 4L9MA 5CSNA 2BE6A 1M31A 2VRGA 1TCOB 1OMRA 1KK7Y 1YUUA 3VRPA 1AK8A 1PRWA 3DF0A 1QVIZ 1SR6B 2WNDA 4AQJA 2V53A 3O2PA 1AUIB 2JNXA 1A75A 5AANA 4DIRA 2OTGB 3DVEA 4XJKA 1A2XA 4M2PA 5B8IB 3ICBA 1OMDA 1TNXA 2WCEA 3CWGA 1MXLC 1ALVA 4HRHA 4N1GA 4ORCB 1JUOA 4PHMA 1UHJA 4FQOA 3ZWHA 2NZ0A 3LLEA 1JFKA 2JXLA 5I2LA 4AOMA 1V1FA 1U5IB 4GPLB 3AAKA 1DJHA 1KK7Z 1IWQA 1KFUS 3AKBA 3TDUA 5KSZA 4PDZA 1DJWA 2OS8B 2MJWB 3CR5X 1FPWA 3PFVA 3BYAA 1DT7B 1CDPA 2I94A 1PALA 3JTDC 2M1KB 4DRWA 4HSZA 2EGDA 2BCBA 2PALA 5I8NA 4P5OE 3GK1A 2WCBA 1S36A 1UHKA 3BUWB 1Y0VH 1E8AA 1F4OA 1KQMC 4GFTA 1OMVA 1WDCB 1AHRA 3EVUA 1LINA 3IF7A 1IQ3A 3TS5B 2JTTA 3D0YB 4NDDA 2WCFA 1NPQA 2JXCA 1UHIA 1K94A 2BKHB 5JOLA 4C0KA 1S5GZ 1J7RA 1NIWA 2CTNA 2SCPA 1GQMA 1SL7A 2AUCA 2M0RA 2L51A 4ZCVA 1MXEA 1WRLA 3DVMA 3OB1B 1JSAA 2KFHA 1UHNA 2JNFA 3SIAA 1BJFA 1K2HA 1WY9A 3HCMA 2ZKMX 2H61A 4MZKA 4YGDB 4I5JA 2K2AA 2LVJA 1OE9B 3BUNB 2KI4B 2JT0A 4NDBA 5TNCA 1JC2A 3CGAA 2F2PA 1S6CA 4ZCUA 3SG3A 1LVCD 2H61C 2KFGA 3OB2B 1J7OA 2BL0B 1CFDA 4C0JA 5D69A 3I5HC 3I5FC 1M46A 1F71A 1CFFA 3PN7C 1ZOTB 1KFUL 1B4CA 4OVNF 1QXPA 3O78A 3VRNA 2BCAA 3TUYC 4HREE 2LCPA 3FWBA 4PHNA 1FF1A 2TN4A 4YBHB 3OX6A 1SW8A 1QV1A 1MWNA 2KAXA 1BLQA 3NSKA 1F54A 3I5GC 4GBAA 3VROA 5HKYA 3CLNA 3BUOB 5G08A 2KBMA 2CBLA 3F45A 3OP0A 1B7TY 1TNPA 4WQ2A 2LHIA 4A4CA 2D8NA 1S26D 1YTZC 3FS7A 3PLFB 1IKUA 1MUXA 1L2OC 1Y6WA 1Y1AA 2KHNA 3I5IC 4MRXA 4N5XA 1C07A 4I5KA 5KTYA 2M9GA 1JWDA 3M0WA 3LCPC 1S6JA 1U5IA 2BECA 1IGVA 1NCXA 1QS7A 1OZSA 4MSPA 1GGZA 4CPVA 2IS9A 1TCFA 1FBVA 1XK4A 5HKWA 5J3XA 2JTZA 5AFPA 1XO5A 2FCEA 1N65A 4PE4A 1BOCA 3SJSA 2I18A 2LVKA 4HRGA 1TTXA 1PULA 5D7FA 3GK4X 2GV5A 3BXKA 1MR8A 1B7TZ 2KAVA 2KOTA 4GGFA 3A8RA 1LKJA 2HQWA 1CM1A 3K21A 1Q80A 2MBXA 1YVHA 1TOPA 1KFXS 2K7CA 2LMTA 3OX5A 1ZMZA 1PVBA 4ICBA 4GGFC 3KPXA 1AVSA 1SCMB 1QATA 4ORAB 5CSIA 1PSBA 1EXRA 1TIZA 2I7AA 2KQYA 1UWOA 2EHBA 1RFJA 1EG4A 1MQ1A 2JOJA 4BY4A 5HKZA 1XVJA 1H4BA 1LXFC 1ZACA 2DOQA 2MLFC 4YGCB 1CNPA 1IJ6A 3PALA 2FOTA 1CDMA 4M2OA 1G4YR 2EC6B
chains in the Genus database with same CATH superfamily
1DJYA 3FE6A 1R6PA 1HT9A 1EH2A 2K8MB 1QTXA 3QRXA 4XYNA 1K8UA 2ZNEA 3WHTB 1CMGA 2LUCA 2MRDA 1SK6D 3E3RA 3NSLA 2LHLA 3RLZA 3CS1A 3IVTA 1A29A 1JBAA 2GGZA 1BT6A 1WRKA 2BBMA 3JVTC 4MVFA 2QDIA 2I2RE 1S5GY 1G8IA 2HQ8A 2Y5IA 1N0YA 4NDCA 1UP5A 2F2OA 4GNKB 1XFWO 2AAOA 2GTEA 5DICA 2BBNA 1CLLA 1TNWA 5F6TA 1DVIA 4YGEB 2R2IA 1J1DA 5ER5A 1Z2CB 3AKAA 2LLUA 4GAOA 1QLSA 5DKNA 5ER4X 1M45A 1Y1XA 2NXQA 3A4UB 3DD4A 4PE7A 1VRKA 2CT9A 1KCYA 2GGMA 1F8HA 4D1EA 2BKIB 3HX4A 2M49B 1KWOB 1UURA 2LC5A 3KHEA 5KU1A 1J7PA 2B1UA 1DGUA 2QACA 2ZFDA 3VRRA 3DZTA 2JU0A 3BFBA 3EVRA 2QPTA 1NP8A 2LLSA 2JPOA 4U8DA 3UO9A 4MN0A 1KSOA 1KK8C 4PHKA 3SS4A 2BAPA 2QEBA 3B7AA 3R1OA 1CFCA 3NHIA 5GQQC 2LP2A 1FI6A 2JZIA 1NX2A 3FWCA 1V1GA 2PSRA 1KQVA 5DKRA 1FI5A 1K95A 2JT8A 2M7NA 3D77A 3KF9A 1QV0A 2LE9B 1DF0B 2KPHA 5I2QA 1QJTA 4TNCA 5CPVA 2YGUA 2E6WA 3CABA 4M2QA 3DF0B 2F33A 2K0JA 1S1EA 5AERA 1X02A 2Q91A 3EK7A 4WRIA 1DJZA 3WHUB 3DXLA 3TDZA 2PQLA 1DC1A 2LP3A 2JWWA 3IQQA 4XJKB 3WNXB 1JF2A 1YRTB 4BY5A 1NSHA 1RK9A 1Y1UA 2L2CA 1WLZA 1MF8B 1SBJA 2BE4A 2RGIA 4MRYA 1IH0A 1QLKA 1TNQA 5HYDA 4ETOA 1FW4A 1SR6C 1XFYO 2Y1MA 2PRUA 1ZUZA 4I5NB 5HLOA 1DJIA 1RECA 1IJ5A 2KSPA 2WCMA 3SG6A 3JTDB 2JRFA 2OTGC 1CFPA 3DVJA 1BMOA 4MZLA 1OZOA 1YX7A 2L4HA 2Q4UA 1NX1A 4IJ7A 3H4SE 3K1EA 1DJXA 1KQMB 1S3PA 2CXJA 4N1FA 1B8CA 4ORBB 1YVLA 2ZN8A 1B8LA 4JPZB 1DJGA 1TN4A 3UNWA 1D1OA 1A4PA 1YURA 2KBIA 4INWA 1S6IA 2BCXA 1XK4C 2KI6D 2L50A 1AJ5A 2JT3A 1NUBA 2O60A 2OS8C 1HQVA 3VGOA 2CCMA 2ZRSA 4OV2A 1GGWA 2QEVA 3R72A 3CR4X 2NLNA 1J55A 5CSJA 1YUTA 2ZRTA 4OKHA 4OZDA 4JQ0D 5PALA 1W9ZA 3EG5B 4QJ3B 3OHMB 1RROA 2WCKA 1F4QA 1CDLA 2KYCA 1GJYA 3EK4A 1KSMA 2H2KA 1J7QA 3B6XA 1OOIX 2M1UA 3CZ0A 3D0YA 2JULA 2QEHA 4I5LB 4JKTA 1SNLA 4NQGA 2NCOA 5EL2A 1WDCC 2LUXA 2LMVA 2F3ZA 4OR9B 1CTRA 4CIDA 4Q04A 3C1VA 1IG5A 1K96A 1TRFA 1PVAA 1BR1B 2KYFA 2PMYA 2L98A 3BOWB 3TS5C 1SKTA 1AP4A 2LVIA 2SASA 1NX0A 2MA2A 3TDIA 2CNPA 3EKHA 3TZ1A 5BPJA 4A4BA 1XA5A 3I5HB 3I5FB 1NX3A 3VRQA 1BODA 2P71A 3PN7B 1TUZA 1M39A 2HPSA 2L2EA 1NCYA 2KI6C 3TUYB 2O5GA 4FTGA 4MZJA 3KO0A 4QJ5B 3V2LA 1ODBA 4PE1A 2PYQA 2KI4C 3S0GA 3I5GB 1SYMA 1JF0A 4IL1A 2F3YA 5AXIA 3S0DA 1CDNA 1G33A 2M7LA 3NSIA 4F7FA 1C7WA 1BF5A 2WCLA 2K7DA 2L5YA 1NWDA 2PVBA 1J1EA 1L2OB 2COLB 2BL0C 3I5IB 1IRJA 3EKJA 4MEWA 4MLWA 1DGVA 1SL8A 2HETA 3FIAA 2PASA 1ALWA 4CFRA 1XFXO 2LAPA 5FYXA 3VB1A 1XFVO 4R1EA 3SG7A 2JC2A 1UUSA 4WQ3A 5I94A 1DTLA 1LA3A 1K9PA 3FE8A 2JQ6A 3DVKA 1XYDA 1IQ5A 3NHTA 1KFXL 1K90D 4YI9A 1EL4A 1OQPA 3NXAA 3CZ1A 2KDHA 3LK0A 1CKKA 4AQIA 1BG1A 3KEVA 2OPOA 1DELA 2A4JA 4CFQA 1PK0D 2K7OA 1WLMA 3L4LA 2KGRA 2H8VA 1YX8A 2L5XB 4C0LA 2FCDA 2L4IA 1IIOA 3BUXB 1CB1A 1K9KA 4F0ZB 1C3YA 3EK8A 1PSRA 1DMOA 3CR2A 3O6BA 3SIBA 1EG3A 1OSAA 3ZNIA 3LK1A 1SCVA 1DQEA 4PCWA 3N7HA 1YRUB 4UPGA 1F55A 3BQ3A 2ZNDA 1QASA 5AEQA 2M97A 1A75B 3GOFA 1A03A 1R2UA 4GGNA 1QX7A 4JWQA 3S0FA 2P6BB 1NYAA 2WOSA 3O4XA 2KFFA 1CM4A 1SCMC 3BOWA 1QIVA 2ISDA 2M8UA 1ZFSA 1N2DA 1L7ZA 1B8RA 1SY9A 5FI7A 3R1PA 2KNEA 1QX2A 2Y4QA 3RM1A 4E68A 3CYZA 3JVTB 3PATA 2KQ6A 3GK2A 1RTP1 2HF5A 1OOJA 3SG2A 1K93D 2WC8A 1B9AA 3NSOA 1W7IB 2EC6C 3AAJA 3CZ2A 4CLNA 1DEKA 3DY9A 1CMFA 1C7VA 3BFAA 4DCKA 3WXAA 3MSEB 3CZTX 2G2BA 2KLEA 2M3WA 1B1GA 1JFJA 2F8PA 5DKQA 1W7JB 1YR5A 5JJGA 2JPTA 4GUKA 3PSRA 3D10A 2LVVA 3BUMB 5IBWA 2LMUA 2MHHA 1MHOA 2WORA 3L47A 5K89A 1AJ4A 1CLBA 4DS7A 3SG5A 1TUJA 2MLEC 1RWYA 4QJ4B 2QEOA 1OOGA 1QIWA 1KK8B 2LV7A 2K61A 3S0BA 2ZN9A 4P2YB 2G9BA 4DUQA 2LNKA 4PE0A 3SG4A 1XFUO 1F70A 3CDNA 4YRUA 1QWVA 1SRAA 1CLMA 1LA0A 2LLTA 4PHJA 4YGBB 1H8BA 1EJ3A 1NCZA 3EVVA 4PALA 5I2OA 2KGBC 2Y1NA 3B88A 5FI6A 1M63B 1QVIY 1SPYA 3D74A 1KWOC 2M29A 3PM8A 1BR4B 2FJUB 1SL9A 2L0PA 2MAZA 2K7BA 1P28A 4YGAA 1B47A 2E30A 1UHHA 2K2FA 3IQOA 1YUSA 1RJVA 2AMIA 4OCIA 2BNXA 4YI8A 5CSFA 1WRZA 2LM5A 4USLA 1QX5B 1BU3A 1XFZO 5HLVA 1K9UA 2LANA 4MBEA 2NCPA 3CTNA 2KAYA 1DF0A 3LL8B 3O4YA 1SMGA 3PJIA 4L9MA 5CSNA 1M31A 2BE6A 2VRGA 1TCOB 1OMRA 1KK7Y 1YUUA 3FE9A 3VRPA 1AK8A 1PRWA 3DF0A 3D76A 3QMEA 1QVIZ 1SR6B 2WNDA 4AQJA 2V53A 4JD9A 3R1VA 3O2PA 1AUIB 2JNXA 1A75A 5AANA 1OOHA 4DIRA 2OTGB 3DVEA 4PT1A 4XJKA 1A2XA 4M2PA 3DYEA 3ICBA 1OMDA 1TNXA 2WCEA 3CWGA 1MXLC 5B8IB 3S0AA 1ALVA 4HRHA 4N1GA 4ORCB 1JUOA 4FQTA 1UHJA 4PHMA 4FQOA 2ERBA 3ZWHA 2NZ0A 3SS3A 3LLEA 1JFKA 2JXLA 3SS5A 5I2LA 4AOMA 1V1FA 1U5IB 4GPLB 3AAKA 1DJHA 1KK7Z 1IWQA 1KFUS 3AKBA 3TDUA 5KSZA 1T14A 4PDZA 1DJWA 2FJYA 2OS8B 2MJWB 3CR5X 3OGNA 1FPWA 3PFVA 3BYAA 1XFRA 1DT7B 1CDPA 2I94A 1PALA 3JTDC 2M1KB 1OOFA 4DRWA 4HSZA 2EGDA 2BCBA 2PALA 1ORGA 5I8NA 4P5OE 3GK1A 2WCBA 1S36A 1UHKA 3BUWB 1Y0VH 1E8AA 1F4OA 1KQMC 3B86A 3L4AA 4GFTA 1OMVA 1WDCB 1AHRA 3EVUA 1GM0A 1LINA 3IF7A 1IQ3A 3TS5B 2JTTA 3D0YB 4NDDA 2WCFA 1NPQA 2JXCA 1Z4HA 3D73A 1UHIA 1K94A 2BKHB 5JOLA 4C0KA 1S5GZ 3S0EA 1J7RA 1NIWA 2CTNA 2SCPA 1GQMA 1SL7A 5HL1A 2AUCA 2M0RA 2L51A 4ZCVA 1MXEA 3OBVA 1WRLA 3DVMA 3OB1B 1JSAA 3RZSA 2KFHA 1UHNA 2JNFA 3SIAA 2P70A 1BJFA 1K2HA 1WY9A 3HCMA 2ZKMX 2H61A 4MZKA 4YGDB 4I5JA 2K2AA 2LVJA 1OE9B 3BUNB 2KI4B 2JT0A 4NDBA 5TNCA 4KYNA 1JC2A 3CGAA 2F2PA 1S6CA 4ZCUA 1OW4A 1LVCD 3SG3A 2H61C 2KFGA 2WCJA 3OB2B 1J7OA 2BL0B 1CFDA 4C0JA 5D69A 3I5HC 3I5FC 1M46A 1F71A 1CFFA 5FI2A 2WC5A 3PN7C 1ZOTB 4INXA 1KFUL 1B4CA 4OVNF 1QXPA 3O78A 3VRNA 2BCAA 3TUYC 4HREE 2LCPA 3FWBA 4PHNA 1FF1A 2TN4A 4YBHB 3OX6A 1SW8A 1QV1A 1MWNA 2KAXA 3D75A 1BLQA 5D3OA 3NSKA 1F54A 1SSEB 3I5GC 4GBAA 3VROA 5HKYA 3CLNA 3BUOB 5G08A 3BFHA 2KBMA 2CBLA 3F45A 3BJHA 3OP0A 1B7TY 1TNPA 4WQ2A 2LHIA 4A4CA 2D8NA 1S26D 1YTZC 3FS7A 3PLFB 1IKUA 1MUXA 1L2OC 1Y6WA 1Y1AA 2KHNA 3I5IC 4MRXA 4N5XA 1C07A 4I5KA 5KTYA 2M9GA 1JWDA 3M0WA 3LCPC 1S6JA 1U5IA 1IGVA 2BECA 1NCXA 1QS7A 1OZSA 4MSPA 1GGZA 2WC6A 4CPVA 2IS9A 1TCFA 1C3ZA 1FBVA 1XK4A 3PM2A 5HKWA 2JTZA 5J3XA 5AFPA 1XO5A 2FCEA 3D78A 1N65A 4PE4A 1BOCA 3SJSA 2I18A 2LVKA 4HRGA 1TTXA 1PULA 5D7FA 3GK4X 2GV5A 3BXKA 1MR8A 2KLDA 1B7TZ 2KAVA 2KOTA 4GGFA 3A8RA 1LKJA 2HQWA 1CM1A 1TWOA 1Q80A 3K21A 1YVHA 2MBXA 3Q8IA 1TOPA 1KFXS 2K7CA 2LMTA 3OX5A 1ZMZA 1PVBA 4ICBA 4GGFC 3KPXA 1AVSA 1SCMB 1QATA 4ORAB 5CSIA 1PSBA 1EXRA 1TIZA 2I7AA 2KQYA 2WCHA 1UWOA 2EHBA 1RFJA 1EG4A 1MQ1A 2JOJA 4BY4A 5HKZA 1XVJA 1H4BA 1LXFC 3NGVA 1ZACA 1LS8A 2DOQA 3B87A 2MLFC 2K60A 4YGCB 1CNPA 1IJ6A 3PALA 2FOTA 1CDMA 4M2OA 1G4YR 2EC6B
chains in the Genus database with same CATH topology
1DJYA 1R6PA 1HT9A 1EH2A 2K8MB 1QTXA 3QRXA 4XYNA 1K8UA 2ZNEA 3WHTB 1CMGA 2LUCA 2MRDA 1SK6D 3E3RA 3NSLA 2LHLA 3RLZA 3CS1A 1A29A 1JBAA 2GGZA 1BT6A 1WRKA 2BBMA 3JVTC 4MVFA 2I2RE 1S5GY 1G8IA 2HQ8A 2Y5IA 1N0YA 4NDCA 1UP5A 2F2OA 4GNKB 1XFWO 2AAOA 2BBNA 1CLLA 1TNWA 5F6TA 1DVIA 4YGEB 2R2IA 1J1DA 5ER5A 3AKAA 2LLUA 4GAOA 1QLSA 5DKNA 5ER4X 1M45A 1Y1XA 2NXQA 3A4UB 3DD4A 4PE7A 1VRKA 2CT9A 1KCYA 2GGMA 1F8HA 4D1EA 2BKIB 3HX4A 2M49B 1KWOB 1UURA 2LC5A 3KHEA 5KU1A 1J7PA 2B1UA 1DGUA 2QACA 2ZFDA 3VRRA 2JU0A 3EVRA 2QPTA 1NP8A 2LLSA 4U8DA 4MN0A 1KSOA 1KK8C 4PHKA 1CFCA 5GQQC 2LP2A 1FI6A 2JZIA 1NX2A 3FWCA 1V1GA 2PSRA 1KQVA 5DKRA 1FI5A 1K95A 2JT8A 2M7NA 3KF9A 1QV0A 2LE9B 1DF0B 5I2QA 1QJTA 4TNCA 5CPVA 2E6WA 4M2QA 3DF0B 2F33A 2K0JA 1S1EA 5AERA 1X02A 2Q91A 3EK7A 4WRIA 1DJZA 3WHUB 3TDZA 2LP3A 2JWWA 3IQQA 4XJKB 3WNXB 1JF2A 1YRTB 4BY5A 1NSHA 1RK9A 1Y1UA 1WLZA 1MF8B 1SBJA 2BE4A 2RGIA 4MRYA 1IH0A 1QLKA 1TNQA 5HYDA 4ETOA 1FW4A 1SR6C 1XFYO 2Y1MA 2PRUA 1ZUZA 4I5NB 5HLOA 1DJIA 1RECA 1IJ5A 2KSPA 3SG6A 3JTDB 2JRFA 2OTGC 1CFPA 3DVJA 1BMOA 4MZLA 1OZOA 1YX7A 2L4HA 2Q4UA 1NX1A 3H4SE 1DJXA 1KQMB 1S3PA 2CXJA 4N1FA 1B8CA 4ORBB 1YVLA 2ZN8A 1B8LA 4JPZB 1DJGA 1TN4A 1D1OA 1A4PA 1YURA 2KBIA 1S6IA 2BCXA 1XK4C 2KI6D 2L50A 1AJ5A 2JT3A 1NUBA 2O60A 2OS8C 1HQVA 3VGOA 2CCMA 2ZRSA 4OV2A 1GGWA 3CR4X 2NLNA 1J55A 5CSJA 1YUTA 2ZRTA 4OKHA 4JQ0D 5PALA 4QJ3B 3OHMB 1RROA 1F4QA 1CDLA 2KYCA 1GJYA 3EK4A 1KSMA 2H2KA 1J7QA 2M1UA 3D0YA 2JULA 4I5LB 4NQGA 1SNLA 2NCOA 1WDCC 2LUXA 2LMVA 2F3ZA 4OR9B 1CTRA 4CIDA 4Q04A 3C1VA 1IG5A 1K96A 1TRFA 1PVAA 1BR1B 2KYFA 2PMYA 2L98A 3BOWB 3TS5C 1SKTA 1AP4A 2LVIA 2SASA 1NX0A 2MA2A 3TDIA 2CNPA 3EKHA 3TZ1A 5BPJA 4A4BA 1XA5A 3I5HB 3I5FB 1NX3A 3VRQA 1BODA 3PN7B 1M39A 2HPSA 2L2EA 1NCYA 2KI6C 3TUYB 2O5GA 4FTGA 4MZJA 3KO0A 4QJ5B 1ODBA 4PE1A 2KI4C 3I5GB 1SYMA 1JF0A 4IL1A 2F3YA 5AXIA 1CDNA 1G33A 2M7LA 3NSIA 1C7WA 1BF5A 2K7DA 2PVBA 1NWDA 1J1EA 1L2OB 2COLB 2BL0C 3I5IB 1IRJA 3EKJA 4MEWA 4MLWA 1DGVA 1SL8A 2HETA 3FIAA 2PASA 1ALWA 4CFRA 1XFXO 2LAPA 5FYXA 1XFVO 4R1EA 3SG7A 2JC2A 1UUSA 4WQ3A 1DTLA 1LA3A 1K9PA 2JQ6A 3DVKA 1XYDA 1IQ5A 1KFXL 1K90D 4YI9A 1EL4A 1OQPA 3NXAA 2KDHA 3LK0A 1CKKA 4AQIA 1BG1A 3KEVA 2OPOA 2A4JA 4CFQA 1PK0D 2K7OA 1WLMA 2KGRA 1YX8A 2L5XB 4C0LA 2FCDA 2L4IA 3BUXB 1CB1A 1K9KA 4F0ZB 3EK8A 1PSRA 1DMOA 3CR2A 3O6BA 3SIBA 1EG3A 1OSAA 3ZNIA 3LK1A 1SCVA 4PCWA 1YRUB 4UPGA 1F55A 3BQ3A 2ZNDA 1QASA 5AEQA 2M97A 1A75B 3GOFA 1A03A 1R2UA 4GGNA 1QX7A 4JWQA 2P6BB 1NYAA 2WOSA 2KFFA 1CM4A 1SCMC 3BOWA 1QIVA 2ISDA 2M8UA 1ZFSA 1N2DA 1L7ZA 1B8RA 1SY9A 2KNEA 1QX2A 2Y4QA 3RM1A 4E68A 3JVTB 3PATA 2KQ6A 3GK2A 1RTP1 2HF5A 1OOJA 3SG2A 1K93D 2WC8A 1B9AA 3NSOA 1W7IB 2EC6C 3AAJA 1CMFA 4CLNA 1C7VA 4DCKA 3WXAA 3MSEB 3CZTX 2G2BA 2M3WA 1B1GA 1JFJA 2F8PA 5DKQA 1W7JB 1YR5A 5JJGA 2JPTA 4GUKA 3PSRA 3D10A 2LVVA 3BUMB 5IBWA 2LMUA 2MHHA 1MHOA 2WORA 5K89A 1AJ4A 1CLBA 4DS7A 3SG5A 2MLEC 1RWYA 4QJ4B 1QIWA 1KK8B 2LV7A 2K61A 2ZN9A 4P2YB 2G9BA 4DUQA 2LNKA 4PE0A 3SG4A 1XFUO 1F70A 4YRUA 1SRAA 2LLTA 1CLMA 1LA0A 4PHJA 4YGBB 1H8BA 1EJ3A 1NCZA 3EVVA 4PALA 5I2OA 2KGBC 2Y1NA 1M63B 1QVIY 1SPYA 1KWOC 2M29A 3PM8A 1BR4B 2FJUB 1SL9A 2L0PA 2MAZA 2K7BA 4YGAA 1B47A 2E30A 1UHHA 2K2FA 3IQOA 1YUSA 1RJVA 2AMIA 4OCIA 4YI8A 5CSFA 1WRZA 2LM5A 4USLA 1QX5B 1BU3A 1XFZO 5HLVA 1K9UA 2LANA 4MBEA 2NCPA 3CTNA 2KAYA 1DF0A 3LL8B 3O4YA 1SMGA 4L9MA 5CSNA 2BE6A 1M31A 2VRGA 1TCOB 1OMRA 1KK7Y 1YUUA 3VRPA 1AK8A 1PRWA 3DF0A 1QVIZ 1SR6B 2WNDA 4AQJA 2V53A 3O2PA 1AUIB 2JNXA 1A75A 5AANA 4DIRA 2OTGB 3DVEA 4XJKA 1A2XA 4M2PA 5B8IB 3ICBA 1OMDA 1TNXA 2WCEA 3CWGA 1MXLC 1ALVA 4HRHA 4N1GA 4ORCB 1JUOA 4PHMA 1UHJA 4FQOA 3ZWHA 2NZ0A 3LLEA 1JFKA 2JXLA 5I2LA 4AOMA 1V1FA 1U5IB 4GPLB 3AAKA 1DJHA 1KK7Z 1IWQA 1KFUS 3AKBA 3TDUA 5KSZA 4PDZA 1DJWA 2OS8B 2MJWB 3CR5X 1FPWA 3PFVA 3BYAA 1DT7B 1CDPA 2I94A 1PALA 3JTDC 2M1KB 4DRWA 4HSZA 2EGDA 2BCBA 2PALA 5I8NA 4P5OE 3GK1A 2WCBA 1S36A 1UHKA 3BUWB 1Y0VH 1E8AA 1F4OA 1KQMC 4GFTA 1OMVA 1WDCB 1AHRA 3EVUA 1LINA 3IF7A 1IQ3A 3TS5B 2JTTA 3D0YB 4NDDA 2WCFA 1NPQA 2JXCA 1UHIA 1K94A 2BKHB 5JOLA 4C0KA 1S5GZ 1J7RA 1NIWA 2CTNA 2SCPA 1GQMA 1SL7A 2AUCA 2M0RA 2L51A 4ZCVA 1MXEA 1WRLA 3DVMA 3OB1B 1JSAA 2KFHA 1UHNA 2JNFA 3SIAA 1BJFA 1K2HA 1WY9A 3HCMA 2ZKMX 2H61A 4MZKA 4YGDB 4I5JA 2K2AA 2LVJA 1OE9B 3BUNB 2KI4B 2JT0A 4NDBA 5TNCA 1JC2A 3CGAA 2F2PA 1S6CA 4ZCUA 3SG3A 1LVCD 2H61C 2KFGA 3OB2B 1J7OA 2BL0B 1CFDA 4C0JA 5D69A 3I5HC 3I5FC 1M46A 1F71A 1CFFA 3PN7C 1ZOTB 1KFUL 1B4CA 4OVNF 1QXPA 3O78A 3VRNA 2BCAA 3TUYC 4HREE 2LCPA 3FWBA 4PHNA 1FF1A 2TN4A 4YBHB 3OX6A 1SW8A 1QV1A 1MWNA 2KAXA 1BLQA 3NSKA 1F54A 3I5GC 4GBAA 3VROA 5HKYA 3CLNA 3BUOB 5G08A 2KBMA 2CBLA 3F45A 3OP0A 1B7TY 1TNPA 4WQ2A 2LHIA 4A4CA 2D8NA 1S26D 1YTZC 3FS7A 3PLFB 1IKUA 1MUXA 1L2OC 1Y6WA 1Y1AA 2KHNA 3I5IC 4MRXA 4N5XA 1C07A 4I5KA 5KTYA 2M9GA 1JWDA 3M0WA 3LCPC 1S6JA 1U5IA 2BECA 1IGVA 1NCXA 1QS7A 1OZSA 4MSPA 1GGZA 4CPVA 2IS9A 1TCFA 1FBVA 1XK4A 5HKWA 5J3XA 2JTZA 5AFPA 1XO5A 2FCEA 1N65A 4PE4A 1BOCA 3SJSA 2I18A 2LVKA 4HRGA 1TTXA 1PULA 5D7FA 3GK4X 2GV5A 3BXKA 1MR8A 1B7TZ 2KAVA 2KOTA 4GGFA 3A8RA 1LKJA 2HQWA 1CM1A 3K21A 1Q80A 2MBXA 1YVHA 1TOPA 1KFXS 2K7CA 2LMTA 3OX5A 1ZMZA 1PVBA 4ICBA 4GGFC 3KPXA 1AVSA 1SCMB 1QATA 4ORAB 5CSIA 1PSBA 1EXRA 1TIZA 2I7AA 2KQYA 1UWOA 2EHBA 1RFJA 1EG4A 1MQ1A 2JOJA 4BY4A 5HKZA 1XVJA 1H4BA 1LXFC 1ZACA 2DOQA 2MLFC 4YGCB 1CNPA 1IJ6A 3PALA 2FOTA 1CDMA 4M2OA 1G4YR 2EC6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJY A;  1R6P A;  1HT9 A;  1EH2 A;  2K8M B;  1QTX A;  3QRX A;  4XYN A;  1K8U A;  2ZNE A;  3WHT B;  1CMG A;  2LUC A;  2MRD A;  1SK6 D;  3E3R A;  3NSL A;  2LHL A;  3RLZ A;  3CS1 A;  1A29 A;  1JBA A;  2GGZ A;  1BT6 A;  1WRK A;  2BBM A;  3JVT C;  4MVF A;  2I2R E;  1S5G Y;  1G8I A;  2HQ8 A;  2Y5I A;  1N0Y A;  4NDC A;  1UP5 A;  2F2O A;  4GNK B;  1XFW O;  2AAO A;  2BBN A;  1CLL A;  1TNW A;  5F6T A;  1DVI A;  4YGE B;  2R2I A;  1J1D A;  5ER5 A;  3AKA A;  2LLU A;  4GAO A;  1QLS A;  5DKN A;  5ER4 X;  1M45 A;  1Y1X A;  2NXQ A;  3A4U B;  3DD4 A;  4PE7 A;  1VRK A;  2CT9 A;  1KCY A;  2GGM A;  1F8H A;  4D1E A;  2BKI B;  3HX4 A;  2M49 B;  1KWO B;  1UUR A;  2LC5 A;  3KHE A;  5KU1 A;  1J7P A;  2B1U A;  1DGU A;  2QAC A;  2ZFD A;  3VRR A;  2JU0 A;  3EVR A;  2QPT A;  1NP8 A;  2LLS A;  4U8D A;  4MN0 A;  1KSO A;  1KK8 C;  4PHK A;  1CFC A;  5GQQ C;  2LP2 A;  1FI6 A;  2JZI A;  1NX2 A;  3FWC A;  1V1G A;  2PSR A;  1KQV A;  5DKR A;  1FI5 A;  1K95 A;  2JT8 A;  2M7N A;  3KF9 A;  1QV0 A;  2LE9 B;  1DF0 B;  5I2Q A;  1QJT A;  4TNC A;  5CPV A;  2E6W A;  4M2Q A;  3DF0 B;  2F33 A;  2K0J A;  1S1E A;  5AER A;  1X02 A;  2Q91 A;  3EK7 A;  4WRI A;  1DJZ A;  3WHU B;  3TDZ A;  2LP3 A;  2JWW A;  3IQQ A;  4XJK B;  3WNX B;  1JF2 A;  1YRT B;  4BY5 A;  1NSH A;  1RK9 A;  1Y1U A;  1WLZ A;  1MF8 B;  1SBJ A;  2BE4 A;  2RGI A;  4MRY A;  1IH0 A;  1QLK A;  1TNQ A;  5HYD A;  4ETO A;  1FW4 A;  1SR6 C;  1XFY O;  2Y1M A;  2PRU A;  1ZUZ A;  4I5N B;  5HLO A;  1DJI A;  1REC A;  1IJ5 A;  2KSP A;  3SG6 A;  3JTD B;  2JRF A;  2OTG C;  1CFP A;  3DVJ A;  1BMO A;  4MZL A;  1OZO A;  1YX7 A;  2L4H A;  2Q4U A;  1NX1 A;  3H4S E;  1DJX A;  1KQM B;  1S3P A;  2CXJ A;  4N1F A;  1B8C A;  4ORB B;  1YVL A;  2ZN8 A;  1B8L A;  4JPZ B;  1DJG A;  1TN4 A;  1D1O A;  1A4P A;  1YUR A;  2KBI A;  1S6I A;  2BCX A;  1XK4 C;  2KI6 D;  2L50 A;  1AJ5 A;  2JT3 A;  1NUB A;  2O60 A;  2OS8 C;  1HQV A;  3VGO A;  2CCM A;  2ZRS A;  4OV2 A;  1GGW A;  3CR4 X;  2NLN A;  1J55 A;  5CSJ A;  1YUT A;  2ZRT A;  4OKH A;  4JQ0 D;  5PAL A;  4QJ3 B;  3OHM B;  1RRO A;  1F4Q A;  1CDL A;  2KYC A;  1GJY A;  3EK4 A;  1KSM A;  2H2K A;  1J7Q A;  2M1U A;  3D0Y A;  2JUL A;  4I5L B;  4NQG A;  1SNL A;  2NCO A;  1WDC C;  2LUX A;  2LMV A;  2F3Z A;  4OR9 B;  1CTR A;  4CID A;  4Q04 A;  3C1V A;  1IG5 A;  1K96 A;  1TRF A;  1PVA A;  1BR1 B;  2KYF A;  2PMY A;  2L98 A;  3BOW B;  3TS5 C;  1SKT A;  1AP4 A;  2LVI A;  2SAS A;  1NX0 A;  2MA2 A;  3TDI A;  2CNP A;  3EKH A;  3TZ1 A;  5BPJ A;  4A4B A;  1XA5 A;  3I5H B;  3I5F B;  1NX3 A;  3VRQ A;  1BOD A;  3PN7 B;  1M39 A;  2HPS A;  2L2E A;  1NCY A;  2KI6 C;  3TUY B;  2O5G A;  4FTG A;  4MZJ A;  3KO0 A;  4QJ5 B;  1ODB A;  4PE1 A;  2KI4 C;  3I5G B;  1SYM A;  1JF0 A;  4IL1 A;  2F3Y A;  5AXI A;  1CDN A;  1G33 A;  2M7L A;  3NSI A;  1C7W A;  1BF5 A;  2K7D A;  2PVB A;  1NWD A;  1J1E A;  1L2O B;  2COL B;  2BL0 C;  3I5I B;  1IRJ A;  3EKJ A;  4MEW A;  4MLW A;  1DGV A;  1SL8 A;  2HET A;  3FIA A;  2PAS A;  1ALW A;  4CFR A;  1XFX O;  2LAP A;  5FYX A;  1XFV O;  4R1E A;  3SG7 A;  2JC2 A;  1UUS A;  4WQ3 A;  1DTL A;  1LA3 A;  1K9P A;  2JQ6 A;  3DVK A;  1XYD A;  1IQ5 A;  1KFX L;  1K90 D;  4YI9 A;  1EL4 A;  1OQP A;  3NXA A;  2KDH A;  3LK0 A;  1CKK A;  4AQI A;  1BG1 A;  3KEV A;  2OPO A;  2A4J A;  4CFQ A;  1PK0 D;  2K7O A;  1WLM A;  2KGR A;  1YX8 A;  2L5X B;  4C0L A;  2FCD A;  2L4I A;  3BUX B;  1CB1 A;  1K9K A;  4F0Z B;  3EK8 A;  1PSR A;  1DMO A;  3CR2 A;  3O6B A;  3SIB A;  1EG3 A;  1OSA A;  3ZNI A;  3LK1 A;  1SCV A;  4PCW A;  1YRU B;  4UPG A;  1F55 A;  3BQ3 A;  2ZND A;  1QAS A;  5AEQ A;  2M97 A;  1A75 B;  3GOF A;  1A03 A;  1R2U A;  4GGN A;  1QX7 A;  4JWQ A;  2P6B B;  1NYA A;  2WOS A;  2KFF A;  1CM4 A;  1SCM C;  3BOW A;  1QIV A;  2ISD A;  2M8U A;  1ZFS A;  1N2D A;  1L7Z A;  1B8R A;  1SY9 A;  2KNE A;  1QX2 A;  2Y4Q A;  3RM1 A;  4E68 A;  3JVT B;  3PAT A;  2KQ6 A;  3GK2 A;  1RTP 1;  2HF5 A;  1OOJ A;  3SG2 A;  1K93 D;  2WC8 A;  1B9A A;  3NSO A;  1W7I B;  2EC6 C;  3AAJ A;  1CMF A;  4CLN A;  1C7V A;  4DCK A;  3WXA A;  3MSE B;  3CZT X;  2G2B A;  2M3W A;  1B1G A;  1JFJ A;  2F8P A;  5DKQ A;  1W7J B;  1YR5 A;  5JJG A;  2JPT A;  4GUK A;  3PSR A;  3D10 A;  2LVV A;  3BUM B;  5IBW A;  2LMU A;  2MHH A;  1MHO A;  2WOR A;  5K89 A;  1AJ4 A;  1CLB A;  4DS7 A;  3SG5 A;  2MLE C;  1RWY A;  4QJ4 B;  1QIW A;  1KK8 B;  2LV7 A;  2K61 A;  2ZN9 A;  4P2Y B;  2G9B A;  4DUQ A;  2LNK A;  4PE0 A;  3SG4 A;  1XFU O;  1F70 A;  4YRU A;  1SRA A;  2LLT A;  1CLM A;  1LA0 A;  4PHJ A;  4YGB B;  1H8B A;  1EJ3 A;  1NCZ A;  3EVV A;  4PAL A;  5I2O A;  2KGB C;  2Y1N A;  1M63 B;  1QVI Y;  1SPY A;  1KWO C;  2M29 A;  3PM8 A;  1BR4 B;  2FJU B;  1SL9 A;  2L0P A;  2MAZ A;  2K7B A;  4YGA A;  1B47 A;  2E30 A;  1UHH A;  2K2F A;  3IQO A;  1YUS A;  1RJV A;  2AMI A;  4OCI A;  4YI8 A;  5CSF A;  1WRZ A;  2LM5 A;  4USL A;  1QX5 B;  1BU3 A;  1XFZ O;  5HLV A;  1K9U A;  2LAN A;  4MBE A;  2NCP A;  3CTN A;  2KAY A;  1DF0 A;  3LL8 B;  3O4Y A;  1SMG A;  4L9M A;  5CSN A;  2BE6 A;  1M31 A;  2VRG A;  1TCO B;  1OMR A;  1KK7 Y;  1YUU A;  3VRP A;  1AK8 A;  1PRW A;  3DF0 A;  1QVI Z;  1SR6 B;  2WND A;  4AQJ A;  2V53 A;  3O2P A;  1AUI B;  2JNX A;  1A75 A;  5AAN A;  4DIR A;  2OTG B;  3DVE A;  4XJK A;  1A2X A;  4M2P A;  5B8I B;  3ICB A;  1OMD A;  1TNX A;  2WCE A;  3CWG A;  1MXL C;  1ALV A;  4HRH A;  4N1G A;  4ORC B;  1JUO A;  4PHM A;  1UHJ A;  4FQO A;  3ZWH A;  2NZ0 A;  3LLE A;  1JFK A;  2JXL A;  5I2L A;  4AOM A;  1V1F A;  1U5I B;  4GPL B;  3AAK A;  1DJH A;  1KK7 Z;  1IWQ A;  1KFU S;  3AKB A;  3TDU A;  5KSZ A;  4PDZ A;  1DJW A;  2OS8 B;  2MJW B;  3CR5 X;  1FPW A;  3PFV A;  3BYA A;  1DT7 B;  1CDP A;  2I94 A;  1PAL A;  3JTD C;  2M1K B;  4DRW A;  4HSZ A;  2EGD A;  2BCB A;  2PAL A;  5I8N A;  4P5O E;  3GK1 A;  2WCB A;  1S36 A;  1UHK A;  3BUW B;  1Y0V H;  1E8A A;  1F4O A;  1KQM C;  4GFT A;  1OMV A;  1WDC B;  1AHR A;  3EVU A;  1LIN A;  3IF7 A;  1IQ3 A;  3TS5 B;  2JTT A;  3D0Y B;  4NDD A;  2WCF A;  1NPQ A;  2JXC A;  1UHI A;  1K94 A;  2BKH B;  5JOL A;  4C0K A;  1S5G Z;  1J7R A;  1NIW A;  2CTN A;  2SCP A;  1GQM A;  1SL7 A;  2AUC A;  2M0R A;  2L51 A;  4ZCV A;  1MXE A;  1WRL A;  3DVM A;  3OB1 B;  1JSA A;  2KFH A;  1UHN A;  2JNF A;  3SIA A;  1BJF A;  1K2H A;  1WY9 A;  3HCM A;  2ZKM X;  2H61 A;  4MZK A;  4YGD B;  4I5J A;  2K2A A;  2LVJ A;  1OE9 B;  3BUN B;  2KI4 B;  2JT0 A;  4NDB A;  5TNC A;  1JC2 A;  3CGA A;  2F2P A;  1S6C A;  4ZCU A;  3SG3 A;  1LVC D;  2H61 C;  2KFG A;  3OB2 B;  1J7O A;  2BL0 B;  1CFD A;  4C0J A;  5D69 A;  3I5H C;  3I5F C;  1M46 A;  1F71 A;  1CFF A;  3PN7 C;  1ZOT B;  1KFU L;  1B4C A;  4OVN F;  1QXP A;  3O78 A;  3VRN A;  2BCA A;  3TUY C;  4HRE E;  2LCP A;  3FWB A;  4PHN A;  1FF1 A;  2TN4 A;  4YBH B;  3OX6 A;  1SW8 A;  1QV1 A;  1MWN A;  2KAX A;  1BLQ A;  3NSK A;  1F54 A;  3I5G C;  4GBA A;  3VRO A;  5HKY A;  3CLN A;  3BUO B;  5G08 A;  2KBM A;  2CBL A;  3F45 A;  3OP0 A;  1B7T Y;  1TNP A;  4WQ2 A;  2LHI A;  4A4C A;  2D8N A;  1S26 D;  1YTZ C;  3FS7 A;  3PLF B;  1IKU A;  1MUX A;  1L2O C;  1Y6W A;  1Y1A A;  2KHN A;  3I5I C;  4MRX A;  4N5X A;  1C07 A;  4I5K A;  5KTY A;  2M9G A;  1JWD A;  3M0W A;  3LCP C;  1S6J A;  1U5I A;  2BEC A;  1IGV A;  1NCX A;  1QS7 A;  1OZS A;  4MSP A;  1GGZ A;  4CPV A;  2IS9 A;  1TCF A;  1FBV A;  1XK4 A;  5HKW A;  5J3X A;  2JTZ A;  5AFP A;  1XO5 A;  2FCE A;  1N65 A;  4PE4 A;  1BOC A;  3SJS A;  2I18 A;  2LVK A;  4HRG A;  1TTX A;  1PUL A;  5D7F A;  3GK4 X;  2GV5 A;  3BXK A;  1MR8 A;  1B7T Z;  2KAV A;  2KOT A;  4GGF A;  3A8R A;  1LKJ A;  2HQW A;  1CM1 A;  3K21 A;  1Q80 A;  2MBX A;  1YVH A;  1TOP A;  1KFX S;  2K7C A;  2LMT A;  3OX5 A;  1ZMZ A;  1PVB A;  4ICB A;  4GGF C;  3KPX A;  1AVS A;  1SCM B;  1QAT A;  4ORA B;  5CSI A;  1PSB A;  1EXR A;  1TIZ A;  2I7A A;  2KQY A;  1UWO A;  2EHB A;  1RFJ A;  1EG4 A;  1MQ1 A;  2JOJ A;  4BY4 A;  5HKZ A;  1XVJ A;  1H4B A;  1LXF C;  1ZAC A;  2DOQ A;  2MLF C;  4YGC B;  1CNP A;  1IJ6 A;  3PAL A;  2FOT A;  1CDM A;  4M2O A;  1G4Y R;  2EC6 B; 
#chains in the Genus database with same CATH topology
 1DJY A;  3FE6 A;  1R6P A;  1HT9 A;  1EH2 A;  2K8M B;  1QTX A;  3QRX A;  4XYN A;  1K8U A;  2ZNE A;  3WHT B;  1CMG A;  2LUC A;  2MRD A;  1SK6 D;  3E3R A;  3NSL A;  2LHL A;  3RLZ A;  3CS1 A;  3IVT A;  1A29 A;  1JBA A;  2GGZ A;  1BT6 A;  1WRK A;  2BBM A;  3JVT C;  4MVF A;  2QDI A;  2I2R E;  1S5G Y;  1G8I A;  2HQ8 A;  2Y5I A;  1N0Y A;  4NDC A;  1UP5 A;  2F2O A;  4GNK B;  1XFW O;  2AAO A;  2GTE A;  5DIC A;  2BBN A;  1CLL A;  1TNW A;  5F6T A;  1DVI A;  4YGE B;  2R2I A;  1J1D A;  5ER5 A;  1Z2C B;  3AKA A;  2LLU A;  4GAO A;  1QLS A;  5DKN A;  5ER4 X;  1M45 A;  1Y1X A;  2NXQ A;  3A4U B;  3DD4 A;  4PE7 A;  1VRK A;  2CT9 A;  1KCY A;  2GGM A;  1F8H A;  4D1E A;  2BKI B;  3HX4 A;  2M49 B;  1KWO B;  1UUR A;  2LC5 A;  3KHE A;  5KU1 A;  1J7P A;  2B1U A;  1DGU A;  2QAC A;  2ZFD A;  3VRR A;  3DZT A;  2JU0 A;  3BFB A;  3EVR A;  2QPT A;  1NP8 A;  2LLS A;  2JPO A;  4U8D A;  3UO9 A;  4MN0 A;  1KSO A;  1KK8 C;  4PHK A;  3SS4 A;  2BAP A;  2QEB A;  3B7A A;  3R1O A;  1CFC A;  3NHI A;  5GQQ C;  2LP2 A;  1FI6 A;  2JZI A;  1NX2 A;  3FWC A;  1V1G A;  2PSR A;  1KQV A;  5DKR A;  1FI5 A;  1K95 A;  2JT8 A;  2M7N A;  3D77 A;  3KF9 A;  1QV0 A;  2LE9 B;  1DF0 B;  2KPH A;  5I2Q A;  1QJT A;  4TNC A;  5CPV A;  2YGU A;  2E6W A;  3CAB A;  4M2Q A;  3DF0 B;  2F33 A;  2K0J A;  1S1E A;  5AER A;  1X02 A;  2Q91 A;  3EK7 A;  4WRI A;  1DJZ A;  3WHU B;  3DXL A;  3TDZ A;  2PQL A;  1DC1 A;  2LP3 A;  2JWW A;  3IQQ A;  4XJK B;  3WNX B;  1JF2 A;  1YRT B;  4BY5 A;  1NSH A;  1RK9 A;  1Y1U A;  2L2C A;  1WLZ A;  1MF8 B;  1SBJ A;  2BE4 A;  2RGI A;  4MRY A;  1IH0 A;  1QLK A;  1TNQ A;  5HYD A;  4ETO A;  1FW4 A;  1SR6 C;  1XFY O;  2Y1M A;  2PRU A;  1ZUZ A;  4I5N B;  5HLO A;  1DJI A;  1REC A;  1IJ5 A;  2KSP A;  2WCM A;  3SG6 A;  3JTD B;  2JRF A;  2OTG C;  1CFP A;  3DVJ A;  1BMO A;  4MZL A;  1OZO A;  1YX7 A;  2L4H A;  2Q4U A;  1NX1 A;  4IJ7 A;  3H4S E;  3K1E A;  1DJX A;  1KQM B;  1S3P A;  2CXJ A;  4N1F A;  1B8C A;  4ORB B;  1YVL A;  2ZN8 A;  1B8L A;  4JPZ B;  1DJG A;  1TN4 A;  3UNW A;  1D1O A;  1A4P A;  1YUR A;  2KBI A;  4INW A;  1S6I A;  2BCX A;  1XK4 C;  2KI6 D;  2L50 A;  1AJ5 A;  2JT3 A;  1NUB A;  2O60 A;  2OS8 C;  1HQV A;  3VGO A;  2CCM A;  2ZRS A;  4OV2 A;  1GGW A;  2QEV A;  3R72 A;  3CR4 X;  2NLN A;  1J55 A;  5CSJ A;  1YUT A;  2ZRT A;  4OKH A;  4OZD A;  4JQ0 D;  5PAL A;  1W9Z A;  3EG5 B;  4QJ3 B;  3OHM B;  1RRO A;  2WCK A;  1F4Q A;  1CDL A;  2KYC A;  1GJY A;  3EK4 A;  1KSM A;  2H2K A;  1J7Q A;  3B6X A;  1OOI X;  2M1U A;  3CZ0 A;  3D0Y A;  2JUL A;  2QEH A;  4I5L B;  4JKT A;  1SNL A;  4NQG A;  2NCO A;  5EL2 A;  1WDC C;  2LUX A;  2LMV A;  2F3Z A;  4OR9 B;  1CTR A;  4CID A;  4Q04 A;  3C1V A;  1IG5 A;  1K96 A;  1TRF A;  1PVA A;  1BR1 B;  2KYF A;  2PMY A;  2L98 A;  3BOW B;  3TS5 C;  1SKT A;  1AP4 A;  2LVI A;  2SAS A;  1NX0 A;  2MA2 A;  3TDI A;  2CNP A;  3EKH A;  3TZ1 A;  5BPJ A;  4A4B A;  1XA5 A;  3I5H B;  3I5F B;  1NX3 A;  3VRQ A;  1BOD A;  2P71 A;  3PN7 B;  1TUZ A;  1M39 A;  2HPS A;  2L2E A;  1NCY A;  2KI6 C;  3TUY B;  2O5G A;  4FTG A;  4MZJ A;  3KO0 A;  4QJ5 B;  3V2L A;  1ODB A;  4PE1 A;  2PYQ A;  2KI4 C;  3S0G A;  3I5G B;  1SYM A;  1JF0 A;  4IL1 A;  2F3Y A;  5AXI A;  3S0D A;  1CDN A;  1G33 A;  2M7L A;  3NSI A;  4F7F A;  1C7W A;  1BF5 A;  2WCL A;  2K7D A;  2L5Y A;  1NWD A;  2PVB A;  1J1E A;  1L2O B;  2COL B;  2BL0 C;  3I5I B;  1IRJ A;  3EKJ A;  4MEW A;  4MLW A;  1DGV A;  1SL8 A;  2HET A;  3FIA A;  2PAS A;  1ALW A;  4CFR A;  1XFX O;  2LAP A;  5FYX A;  3VB1 A;  1XFV O;  4R1E A;  3SG7 A;  2JC2 A;  1UUS A;  4WQ3 A;  5I94 A;  1DTL A;  1LA3 A;  1K9P A;  3FE8 A;  2JQ6 A;  3DVK A;  1XYD A;  1IQ5 A;  3NHT A;  1KFX L;  1K90 D;  4YI9 A;  1EL4 A;  1OQP A;  3NXA A;  3CZ1 A;  2KDH A;  3LK0 A;  1CKK A;  4AQI A;  1BG1 A;  3KEV A;  2OPO A;  1DEL A;  2A4J A;  4CFQ A;  1PK0 D;  2K7O A;  1WLM A;  3L4L A;  2KGR A;  2H8V A;  1YX8 A;  2L5X B;  4C0L A;  2FCD A;  2L4I A;  1IIO A;  3BUX B;  1CB1 A;  1K9K A;  4F0Z B;  1C3Y A;  3EK8 A;  1PSR A;  1DMO A;  3CR2 A;  3O6B A;  3SIB A;  1EG3 A;  1OSA A;  3ZNI A;  3LK1 A;  1SCV A;  1DQE A;  4PCW A;  3N7H A;  1YRU B;  4UPG A;  1F55 A;  3BQ3 A;  2ZND A;  1QAS A;  5AEQ A;  2M97 A;  1A75 B;  3GOF A;  1A03 A;  1R2U A;  4GGN A;  1QX7 A;  4JWQ A;  3S0F A;  2P6B B;  1NYA A;  2WOS A;  3O4X A;  2KFF A;  1CM4 A;  1SCM C;  3BOW A;  1QIV A;  2ISD A;  2M8U A;  1ZFS A;  1N2D A;  1L7Z A;  1B8R A;  1SY9 A;  5FI7 A;  3R1P A;  2KNE A;  1QX2 A;  2Y4Q A;  3RM1 A;  4E68 A;  3CYZ A;  3JVT B;  3PAT A;  2KQ6 A;  3GK2 A;  1RTP 1;  2HF5 A;  1OOJ A;  3SG2 A;  1K93 D;  2WC8 A;  1B9A A;  3NSO A;  1W7I B;  2EC6 C;  3AAJ A;  3CZ2 A;  4CLN A;  1DEK A;  3DY9 A;  1CMF A;  1C7V A;  3BFA A;  4DCK A;  3WXA A;  3MSE B;  3CZT X;  2G2B A;  2KLE A;  2M3W A;  1B1G A;  1JFJ A;  2F8P A;  5DKQ A;  1W7J B;  1YR5 A;  5JJG A;  2JPT A;  4GUK A;  3PSR A;  3D10 A;  2LVV A;  3BUM B;  5IBW A;  2LMU A;  2MHH A;  1MHO A;  2WOR A;  3L47 A;  5K89 A;  1AJ4 A;  1CLB A;  4DS7 A;  3SG5 A;  1TUJ A;  2MLE C;  1RWY A;  4QJ4 B;  2QEO A;  1OOG A;  1QIW A;  1KK8 B;  2LV7 A;  2K61 A;  3S0B A;  2ZN9 A;  4P2Y B;  2G9B A;  4DUQ A;  2LNK A;  4PE0 A;  3SG4 A;  1XFU O;  1F70 A;  3CDN A;  4YRU A;  1QWV A;  1SRA A;  1CLM A;  1LA0 A;  2LLT A;  4PHJ A;  4YGB B;  1H8B A;  1EJ3 A;  1NCZ A;  3EVV A;  4PAL A;  5I2O A;  2KGB C;  2Y1N A;  3B88 A;  5FI6 A;  1M63 B;  1QVI Y;  1SPY A;  3D74 A;  1KWO C;  2M29 A;  3PM8 A;  1BR4 B;  2FJU B;  1SL9 A;  2L0P A;  2MAZ A;  2K7B A;  1P28 A;  4YGA A;  1B47 A;  2E30 A;  1UHH A;  2K2F A;  3IQO A;  1YUS A;  1RJV A;  2AMI A;  4OCI A;  2BNX A;  4YI8 A;  5CSF A;  1WRZ A;  2LM5 A;  4USL A;  1QX5 B;  1BU3 A;  1XFZ O;  5HLV A;  1K9U A;  2LAN A;  4MBE A;  2NCP A;  3CTN A;  2KAY A;  1DF0 A;  3LL8 B;  3O4Y A;  1SMG A;  3PJI A;  4L9M A;  5CSN A;  1M31 A;  2BE6 A;  2VRG A;  1TCO B;  1OMR A;  1KK7 Y;  1YUU A;  3FE9 A;  3VRP A;  1AK8 A;  1PRW A;  3DF0 A;  3D76 A;  3QME A;  1QVI Z;  1SR6 B;  2WND A;  4AQJ A;  2V53 A;  4JD9 A;  3R1V A;  3O2P A;  1AUI B;  2JNX A;  1A75 A;  5AAN A;  1OOH A;  4DIR A;  2OTG B;  3DVE A;  4PT1 A;  4XJK A;  1A2X A;  4M2P A;  3DYE A;  3ICB A;  1OMD A;  1TNX A;  2WCE A;  3CWG A;  1MXL C;  5B8I B;  3S0A A;  1ALV A;  4HRH A;  4N1G A;  4ORC B;  1JUO A;  4FQT A;  1UHJ A;  4PHM A;  4FQO A;  2ERB A;  3ZWH A;  2NZ0 A;  3SS3 A;  3LLE A;  1JFK A;  2JXL A;  3SS5 A;  5I2L A;  4AOM A;  1V1F A;  1U5I B;  4GPL B;  3AAK A;  1DJH A;  1KK7 Z;  1IWQ A;  1KFU S;  3AKB A;  3TDU A;  5KSZ A;  1T14 A;  4PDZ A;  1DJW A;  2FJY A;  2OS8 B;  2MJW B;  3CR5 X;  3OGN A;  1FPW A;  3PFV A;  3BYA A;  1XFR A;  1DT7 B;  1CDP A;  2I94 A;  1PAL A;  3JTD C;  2M1K B;  1OOF A;  4DRW A;  4HSZ A;  2EGD A;  2BCB A;  2PAL A;  1ORG A;  5I8N A;  4P5O E;  3GK1 A;  2WCB A;  1S36 A;  1UHK A;  3BUW B;  1Y0V H;  1E8A A;  1F4O A;  1KQM C;  3B86 A;  3L4A A;  4GFT A;  1OMV A;  1WDC B;  1AHR A;  3EVU A;  1GM0 A;  1LIN A;  3IF7 A;  1IQ3 A;  3TS5 B;  2JTT A;  3D0Y B;  4NDD A;  2WCF A;  1NPQ A;  2JXC A;  1Z4H A;  3D73 A;  1UHI A;  1K94 A;  2BKH B;  5JOL A;  4C0K A;  1S5G Z;  3S0E A;  1J7R A;  1NIW A;  2CTN A;  2SCP A;  1GQM A;  1SL7 A;  5HL1 A;  2AUC A;  2M0R A;  2L51 A;  4ZCV A;  1MXE A;  3OBV A;  1WRL A;  3DVM A;  3OB1 B;  1JSA A;  3RZS A;  2KFH A;  1UHN A;  2JNF A;  3SIA A;  2P70 A;  1BJF A;  1K2H A;  1WY9 A;  3HCM A;  2ZKM X;  2H61 A;  4MZK A;  4YGD B;  4I5J A;  2K2A A;  2LVJ A;  1OE9 B;  3BUN B;  2KI4 B;  2JT0 A;  4NDB A;  5TNC A;  4KYN A;  1JC2 A;  3CGA A;  2F2P A;  1S6C A;  4ZCU A;  1OW4 A;  1LVC D;  3SG3 A;  2H61 C;  2KFG A;  2WCJ A;  3OB2 B;  1J7O A;  2BL0 B;  1CFD A;  4C0J A;  5D69 A;  3I5H C;  3I5F C;  1M46 A;  1F71 A;  1CFF A;  5FI2 A;  2WC5 A;  3PN7 C;  1ZOT B;  4INX A;  1KFU L;  1B4C A;  4OVN F;  1QXP A;  3O78 A;  3VRN A;  2BCA A;  3TUY C;  4HRE E;  2LCP A;  3FWB A;  4PHN A;  1FF1 A;  2TN4 A;  4YBH B;  3OX6 A;  1SW8 A;  1QV1 A;  1MWN A;  2KAX A;  3D75 A;  1BLQ A;  5D3O A;  3NSK A;  1F54 A;  1SSE B;  3I5G C;  4GBA A;  3VRO A;  5HKY A;  3CLN A;  3BUO B;  5G08 A;  3BFH A;  2KBM A;  2CBL A;  3F45 A;  3BJH A;  3OP0 A;  1B7T Y;  1TNP A;  4WQ2 A;  2LHI A;  4A4C A;  2D8N A;  1S26 D;  1YTZ C;  3FS7 A;  3PLF B;  1IKU A;  1MUX A;  1L2O C;  1Y6W A;  1Y1A A;  2KHN A;  3I5I C;  4MRX A;  4N5X A;  1C07 A;  4I5K A;  5KTY A;  2M9G A;  1JWD A;  3M0W A;  3LCP C;  1S6J A;  1U5I A;  1IGV A;  2BEC A;  1NCX A;  1QS7 A;  1OZS A;  4MSP A;  1GGZ A;  2WC6 A;  4CPV A;  2IS9 A;  1TCF A;  1C3Z A;  1FBV A;  1XK4 A;  3PM2 A;  5HKW A;  2JTZ A;  5J3X A;  5AFP A;  1XO5 A;  2FCE A;  3D78 A;  1N65 A;  4PE4 A;  1BOC A;  3SJS A;  2I18 A;  2LVK A;  4HRG A;  1TTX A;  1PUL A;  5D7F A;  3GK4 X;  2GV5 A;  3BXK A;  1MR8 A;  2KLD A;  1B7T Z;  2KAV A;  2KOT A;  4GGF A;  3A8R A;  1LKJ A;  2HQW A;  1CM1 A;  1TWO A;  1Q80 A;  3K21 A;  1YVH A;  2MBX A;  3Q8I A;  1TOP A;  1KFX S;  2K7C A;  2LMT A;  3OX5 A;  1ZMZ A;  1PVB A;  4ICB A;  4GGF C;  3KPX A;  1AVS A;  1SCM B;  1QAT A;  4ORA B;  5CSI A;  1PSB A;  1EXR A;  1TIZ A;  2I7A A;  2KQY A;  2WCH A;  1UWO A;  2EHB A;  1RFJ A;  1EG4 A;  1MQ1 A;  2JOJ A;  4BY4 A;  5HKZ A;  1XVJ A;  1H4B A;  1LXF C;  3NGV A;  1ZAC A;  1LS8 A;  2DOQ A;  3B87 A;  2MLF C;  2K60 A;  4YGC B;  1CNP A;  1IJ6 A;  3PAL A;  2FOT A;  1CDM A;  4M2O A;  1G4Y R;  2EC6 B; 
#chains in the Genus database with same CATH homology
 1DJY A;  1R6P A;  1HT9 A;  1EH2 A;  2K8M B;  1QTX A;  3QRX A;  4XYN A;  1K8U A;  2ZNE A;  3WHT B;  1CMG A;  2LUC A;  2MRD A;  1SK6 D;  3E3R A;  3NSL A;  2LHL A;  3RLZ A;  3CS1 A;  1A29 A;  1JBA A;  2GGZ A;  1BT6 A;  1WRK A;  2BBM A;  3JVT C;  4MVF A;  2I2R E;  1S5G Y;  1G8I A;  2HQ8 A;  2Y5I A;  1N0Y A;  4NDC A;  1UP5 A;  2F2O A;  4GNK B;  1XFW O;  2AAO A;  2BBN A;  1CLL A;  1TNW A;  5F6T A;  1DVI A;  4YGE B;  2R2I A;  1J1D A;  5ER5 A;  3AKA A;  2LLU A;  4GAO A;  1QLS A;  5DKN A;  5ER4 X;  1M45 A;  1Y1X A;  2NXQ A;  3A4U B;  3DD4 A;  4PE7 A;  1VRK A;  2CT9 A;  1KCY A;  2GGM A;  1F8H A;  4D1E A;  2BKI B;  3HX4 A;  2M49 B;  1KWO B;  1UUR A;  2LC5 A;  3KHE A;  5KU1 A;  1J7P A;  2B1U A;  1DGU A;  2QAC A;  2ZFD A;  3VRR A;  2JU0 A;  3EVR A;  2QPT A;  1NP8 A;  2LLS A;  4U8D A;  4MN0 A;  1KSO A;  1KK8 C;  4PHK A;  1CFC A;  5GQQ C;  2LP2 A;  1FI6 A;  2JZI A;  1NX2 A;  3FWC A;  1V1G A;  2PSR A;  1KQV A;  5DKR A;  1FI5 A;  1K95 A;  2JT8 A;  2M7N A;  3KF9 A;  1QV0 A;  2LE9 B;  1DF0 B;  5I2Q A;  1QJT A;  4TNC A;  5CPV A;  2E6W A;  4M2Q A;  3DF0 B;  2F33 A;  2K0J A;  1S1E A;  5AER A;  1X02 A;  2Q91 A;  3EK7 A;  4WRI A;  1DJZ A;  3WHU B;  3TDZ A;  2LP3 A;  2JWW A;  3IQQ A;  4XJK B;  3WNX B;  1JF2 A;  1YRT B;  4BY5 A;  1NSH A;  1RK9 A;  1Y1U A;  1WLZ A;  1MF8 B;  1SBJ A;  2BE4 A;  2RGI A;  4MRY A;  1IH0 A;  1QLK A;  1TNQ A;  5HYD A;  4ETO A;  1FW4 A;  1SR6 C;  1XFY O;  2Y1M A;  2PRU A;  1ZUZ A;  4I5N B;  5HLO A;  1DJI A;  1REC A;  1IJ5 A;  2KSP A;  3SG6 A;  3JTD B;  2JRF A;  2OTG C;  1CFP A;  3DVJ A;  1BMO A;  4MZL A;  1OZO A;  1YX7 A;  2L4H A;  2Q4U A;  1NX1 A;  3H4S E;  1DJX A;  1KQM B;  1S3P A;  2CXJ A;  4N1F A;  1B8C A;  4ORB B;  1YVL A;  2ZN8 A;  1B8L A;  4JPZ B;  1DJG A;  1TN4 A;  1D1O A;  1A4P A;  1YUR A;  2KBI A;  1S6I A;  2BCX A;  1XK4 C;  2KI6 D;  2L50 A;  1AJ5 A;  2JT3 A;  1NUB A;  2O60 A;  2OS8 C;  1HQV A;  3VGO A;  2CCM A;  2ZRS A;  4OV2 A;  1GGW A;  3CR4 X;  2NLN A;  1J55 A;  5CSJ A;  1YUT A;  2ZRT A;  4OKH A;  4JQ0 D;  5PAL A;  4QJ3 B;  3OHM B;  1RRO A;  1F4Q A;  1CDL A;  2KYC A;  1GJY A;  3EK4 A;  1KSM A;  2H2K A;  1J7Q A;  2M1U A;  3D0Y A;  2JUL A;  4I5L B;  4NQG A;  1SNL A;  2NCO A;  1WDC C;  2LUX A;  2LMV A;  2F3Z A;  4OR9 B;  1CTR A;  4CID A;  4Q04 A;  3C1V A;  1IG5 A;  1K96 A;  1TRF A;  1PVA A;  1BR1 B;  2KYF A;  2PMY A;  2L98 A;  3BOW B;  3TS5 C;  1SKT A;  1AP4 A;  2LVI A;  2SAS A;  1NX0 A;  2MA2 A;  3TDI A;  2CNP A;  3EKH A;  3TZ1 A;  5BPJ A;  4A4B A;  1XA5 A;  3I5H B;  3I5F B;  1NX3 A;  3VRQ A;  1BOD A;  3PN7 B;  1M39 A;  2HPS A;  2L2E A;  1NCY A;  2KI6 C;  3TUY B;  2O5G A;  4FTG A;  4MZJ A;  3KO0 A;  4QJ5 B;  1ODB A;  4PE1 A;  2KI4 C;  3I5G B;  1SYM A;  1JF0 A;  4IL1 A;  2F3Y A;  5AXI A;  1CDN A;  1G33 A;  2M7L A;  3NSI A;  1C7W A;  1BF5 A;  2K7D A;  2PVB A;  1NWD A;  1J1E A;  1L2O B;  2COL B;  2BL0 C;  3I5I B;  1IRJ A;  3EKJ A;  4MEW A;  4MLW A;  1DGV A;  1SL8 A;  2HET A;  3FIA A;  2PAS A;  1ALW A;  4CFR A;  1XFX O;  2LAP A;  5FYX A;  1XFV O;  4R1E A;  3SG7 A;  2JC2 A;  1UUS A;  4WQ3 A;  1DTL A;  1LA3 A;  1K9P A;  2JQ6 A;  3DVK A;  1XYD A;  1IQ5 A;  1KFX L;  1K90 D;  4YI9 A;  1EL4 A;  1OQP A;  3NXA A;  2KDH A;  3LK0 A;  1CKK A;  4AQI A;  1BG1 A;  3KEV A;  2OPO A;  2A4J A;  4CFQ A;  1PK0 D;  2K7O A;  1WLM A;  2KGR A;  1YX8 A;  2L5X B;  4C0L A;  2FCD A;  2L4I A;  3BUX B;  1CB1 A;  1K9K A;  4F0Z B;  3EK8 A;  1PSR A;  1DMO A;  3CR2 A;  3O6B A;  3SIB A;  1EG3 A;  1OSA A;  3ZNI A;  3LK1 A;  1SCV A;  4PCW A;  1YRU B;  4UPG A;  1F55 A;  3BQ3 A;  2ZND A;  1QAS A;  5AEQ A;  2M97 A;  1A75 B;  3GOF A;  1A03 A;  1R2U A;  4GGN A;  1QX7 A;  4JWQ A;  2P6B B;  1NYA A;  2WOS A;  2KFF A;  1CM4 A;  1SCM C;  3BOW A;  1QIV A;  2ISD A;  2M8U A;  1ZFS A;  1N2D A;  1L7Z A;  1B8R A;  1SY9 A;  2KNE A;  1QX2 A;  2Y4Q A;  3RM1 A;  4E68 A;  3JVT B;  3PAT A;  2KQ6 A;  3GK2 A;  1RTP 1;  2HF5 A;  1OOJ A;  3SG2 A;  1K93 D;  2WC8 A;  1B9A A;  3NSO A;  1W7I B;  2EC6 C;  3AAJ A;  1CMF A;  4CLN A;  1C7V A;  4DCK A;  3WXA A;  3MSE B;  3CZT X;  2G2B A;  2M3W A;  1B1G A;  1JFJ A;  2F8P A;  5DKQ A;  1W7J B;  1YR5 A;  5JJG A;  2JPT A;  4GUK A;  3PSR A;  3D10 A;  2LVV A;  3BUM B;  5IBW A;  2LMU A;  2MHH A;  1MHO A;  2WOR A;  5K89 A;  1AJ4 A;  1CLB A;  4DS7 A;  3SG5 A;  2MLE C;  1RWY A;  4QJ4 B;  1QIW A;  1KK8 B;  2LV7 A;  2K61 A;  2ZN9 A;  4P2Y B;  2G9B A;  4DUQ A;  2LNK A;  4PE0 A;  3SG4 A;  1XFU O;  1F70 A;  4YRU A;  1SRA A;  2LLT A;  1CLM A;  1LA0 A;  4PHJ A;  4YGB B;  1H8B A;  1EJ3 A;  1NCZ A;  3EVV A;  4PAL A;  5I2O A;  2KGB C;  2Y1N A;  1M63 B;  1QVI Y;  1SPY A;  1KWO C;  2M29 A;  3PM8 A;  1BR4 B;  2FJU B;  1SL9 A;  2L0P A;  2MAZ A;  2K7B A;  4YGA A;  1B47 A;  2E30 A;  1UHH A;  2K2F A;  3IQO A;  1YUS A;  1RJV A;  2AMI A;  4OCI A;  4YI8 A;  5CSF A;  1WRZ A;  2LM5 A;  4USL A;  1QX5 B;  1BU3 A;  1XFZ O;  5HLV A;  1K9U A;  2LAN A;  4MBE A;  2NCP A;  3CTN A;  2KAY A;  1DF0 A;  3LL8 B;  3O4Y A;  1SMG A;  4L9M A;  5CSN A;  2BE6 A;  1M31 A;  2VRG A;  1TCO B;  1OMR A;  1KK7 Y;  1YUU A;  3VRP A;  1AK8 A;  1PRW A;  3DF0 A;  1QVI Z;  1SR6 B;  2WND A;  4AQJ A;  2V53 A;  3O2P A;  1AUI B;  2JNX A;  1A75 A;  5AAN A;  4DIR A;  2OTG B;  3DVE A;  4XJK A;  1A2X A;  4M2P A;  5B8I B;  3ICB A;  1OMD A;  1TNX A;  2WCE A;  3CWG A;  1MXL C;  1ALV A;  4HRH A;  4N1G A;  4ORC B;  1JUO A;  4PHM A;  1UHJ A;  4FQO A;  3ZWH A;  2NZ0 A;  3LLE A;  1JFK A;  2JXL A;  5I2L A;  4AOM A;  1V1F A;  1U5I B;  4GPL B;  3AAK A;  1DJH A;  1KK7 Z;  1IWQ A;  1KFU S;  3AKB A;  3TDU A;  5KSZ A;  4PDZ A;  1DJW A;  2OS8 B;  2MJW B;  3CR5 X;  1FPW A;  3PFV A;  3BYA A;  1DT7 B;  1CDP A;  2I94 A;  1PAL A;  3JTD C;  2M1K B;  4DRW A;  4HSZ A;  2EGD A;  2BCB A;  2PAL A;  5I8N A;  4P5O E;  3GK1 A;  2WCB A;  1S36 A;  1UHK A;  3BUW B;  1Y0V H;  1E8A A;  1F4O A;  1KQM C;  4GFT A;  1OMV A;  1WDC B;  1AHR A;  3EVU A;  1LIN A;  3IF7 A;  1IQ3 A;  3TS5 B;  2JTT A;  3D0Y B;  4NDD A;  2WCF A;  1NPQ A;  2JXC A;  1UHI A;  1K94 A;  2BKH B;  5JOL A;  4C0K A;  1S5G Z;  1J7R A;  1NIW A;  2CTN A;  2SCP A;  1GQM A;  1SL7 A;  2AUC A;  2M0R A;  2L51 A;  4ZCV A;  1MXE A;  1WRL A;  3DVM A;  3OB1 B;  1JSA A;  2KFH A;  1UHN A;  2JNF A;  3SIA A;  1BJF A;  1K2H A;  1WY9 A;  3HCM A;  2ZKM X;  2H61 A;  4MZK A;  4YGD B;  4I5J A;  2K2A A;  2LVJ A;  1OE9 B;  3BUN B;  2KI4 B;  2JT0 A;  4NDB A;  5TNC A;  1JC2 A;  3CGA A;  2F2P A;  1S6C A;  4ZCU A;  3SG3 A;  1LVC D;  2H61 C;  2KFG A;  3OB2 B;  1J7O A;  2BL0 B;  1CFD A;  4C0J A;  5D69 A;  3I5H C;  3I5F C;  1M46 A;  1F71 A;  1CFF A;  3PN7 C;  1ZOT B;  1KFU L;  1B4C A;  4OVN F;  1QXP A;  3O78 A;  3VRN A;  2BCA A;  3TUY C;  4HRE E;  2LCP A;  3FWB A;  4PHN A;  1FF1 A;  2TN4 A;  4YBH B;  3OX6 A;  1SW8 A;  1QV1 A;  1MWN A;  2KAX A;  1BLQ A;  3NSK A;  1F54 A;  3I5G C;  4GBA A;  3VRO A;  5HKY A;  3CLN A;  3BUO B;  5G08 A;  2KBM A;  2CBL A;  3F45 A;  3OP0 A;  1B7T Y;  1TNP A;  4WQ2 A;  2LHI A;  4A4C A;  2D8N A;  1S26 D;  1YTZ C;  3FS7 A;  3PLF B;  1IKU A;  1MUX A;  1L2O C;  1Y6W A;  1Y1A A;  2KHN A;  3I5I C;  4MRX A;  4N5X A;  1C07 A;  4I5K A;  5KTY A;  2M9G A;  1JWD A;  3M0W A;  3LCP C;  1S6J A;  1U5I A;  2BEC A;  1IGV A;  1NCX A;  1QS7 A;  1OZS A;  4MSP A;  1GGZ A;  4CPV A;  2IS9 A;  1TCF A;  1FBV A;  1XK4 A;  5HKW A;  5J3X A;  2JTZ A;  5AFP A;  1XO5 A;  2FCE A;  1N65 A;  4PE4 A;  1BOC A;  3SJS A;  2I18 A;  2LVK A;  4HRG A;  1TTX A;  1PUL A;  5D7F A;  3GK4 X;  2GV5 A;  3BXK A;  1MR8 A;  1B7T Z;  2KAV A;  2KOT A;  4GGF A;  3A8R A;  1LKJ A;  2HQW A;  1CM1 A;  3K21 A;  1Q80 A;  2MBX A;  1YVH A;  1TOP A;  1KFX S;  2K7C A;  2LMT A;  3OX5 A;  1ZMZ A;  1PVB A;  4ICB A;  4GGF C;  3KPX A;  1AVS A;  1SCM B;  1QAT A;  4ORA B;  5CSI A;  1PSB A;  1EXR A;  1TIZ A;  2I7A A;  2KQY A;  1UWO A;  2EHB A;  1RFJ A;  1EG4 A;  1MQ1 A;  2JOJ A;  4BY4 A;  5HKZ A;  1XVJ A;  1H4B A;  1LXF C;  1ZAC A;  2DOQ A;  2MLF C;  4YGC B;  1CNP A;  1IJ6 A;  3PAL A;  2FOT A;  1CDM A;  4M2O A;  1G4Y R;  2EC6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...