3CS1A

Flagellar calcium-binding protein (fcabp) from t. cruzi
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
192
structure length
191
Chain Sequence
b'SDKDGKKAKDRKEAWERIRQAIPREKTAEAKQRRIELFKKFDKNETGKLYDEVYSGCLEVLKLDEFTSRVRDITKRAFDKSRTLGSKLENKGSEDFVEFLEFRLMLCYIYDFFELTVMFDEIDASGNMLVDEEEFKRAVPKLEAWGAKVEDPAALFKELDKNGTGSVTFDEFAAWASAVKLDADGDPDNVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar calcium-binding protein
publication title Structural Insights into Membrane Targeting by the Flagellar Calcium-binding Protein (FCaBP), a Myristoylated and Palmitoylated Calcium Sensor in Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Metal binding protein
total genus 74
structure length 191
sequence length 192
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cs1A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cs1A02
3VRQA 3CTNA 1DJYA 1SK6D 3VRRA 1MWNA 4PHNA 2K2AA 1CM4A 1XO5A 2L51A 1NPQA 2PASA 1EL4A 2CTNA 1QLSA 3OX5A 2MJWB 1TCFA 2K0JA 1BMOA 4PHMA 1B8LA 4GGNA 1SL7A 1YUUA 2ZNDA 5AANA 5TNCA 2AUCA 3BYAA 1CFFA 2PMYA 1ZOTB 2M1KB 2MLFC 1TNWA 3EVUA 1CDMA 2K2FA 2RGIA 1SR6B 2GV5A 4ICBA 1BR4B 5DKNA 1F54A 3AAJA 2ZNEA 2F8PA 2Q91A 3SG4A 1WLMA 2WCFA 1UHNA 4USLA 5G08A 4ORCB 3BUWB 1N65A 2KFFA 4GGFC 2KI4C 1AVSA 1J1EA 2EHBA 1CFPA 1QV0A 1A03A 1KCYA 1TNXA 2PALA 2BKHB 1PK0D 1PULA 2BCAA 2LVIA 1NIWA 3KHEA 2LVJA 4MSPA 2I18A 2JWWA 3FS7A 2KAXA 2H61A 5ER5A 1K96A 1YVHA 3DVKA 4MZLA 1LA0A 4QJ4B 1PSBA 1SCMC 4XJKA 1F71A 1CTRA 4WQ2A 1UHKA 1U5IB 1FI5A 2M1UA 1DJWA 2JTZA 5HYDA 2O5GA 1SL9A 3OB1B 1EH2A 1CB1A 2KYFA 5HKYA 4GUKA 1KFUS 1YVLA 1L7ZA 1DT7B 1KWOC 4MN0A 2LUCA 3TUYB 3RLZA 2LVKA 1V1FA 1QV1A 2BBNA 3A4UB 5ER4X 1CLBA 2L4HA 1K9KA 1DJXA 1S6JA 1IQ3A 4F0ZB 1JSAA 1QVIZ 2KBIA 3ZNIA 4P5OE 1WDCB 1YTZC 4GBAA 3TS5C 2KI6C 2D8NA 2KHNA 2LP3A 3BUMB 4M2QA 1LA3A 5D7FA 1UHJA 2OPOA 1GJYA 2GGMA 2KFGA 2F3ZA 1NYAA 1E8AA 2NCOA 4DRWA 2KDHA 4CIDA 2JQ6A 1AHRA 2M0RA 2G9BA 2BCXA 2COLB 4GAOA 5I8NA 2JNFA 2NLNA 4PHKA 1RK9A 4C0KA 2CNPA 1S1EA 2QACA 1D1OA 1EG4A 1DGUA 3JVTB 1KSMA 2K7DA 2F2PA 5JJGA 5I2LA 2ZFDA 5CSIA 1FPWA 4DS7A 1R6PA 2K7CA 3SG5A 2ZRSA 2HETA 2M3WA 1NWDA 2LVVA 2NZ0A 1MR8A 1OMRA 4Q04A 1WRZA 1V1GA 1YUSA 3PATA 1Y1XA 3TDUA 1ZUZA 1AUIB 2BE6A 4N1FA 1MF8B 1LINA 1YRUB 2BL0B 3VRPA 5D69A 2IS9A 4MVFA 1ZMZA 2Y1MA 1B8RA 1LXFC 4ORBB 3PSRA 2OTGB 3HX4A 1TOPA 1LKJA 1NX1A 4L9MA 2OS8B 2WORA 2BE4A 2HPSA 1DGVA 4GPLB 2JXLA 1ZFSA 1PVBA 1M39A 1KQMB 1CFDA 3PN7B 1JF2A 5JOLA 3LL8B 2PRUA 3SIBA 2JRFA 4C0LA 5I2QA 1IKUA 1QASA 3E3RA 4MEWA 3CR2A 1W7IB 5PALA 3PM8A 4M2OA 2WC8A 4QJ5B 1NCYA 4YRUA 2K61A 1L2OB 5CSJA 2K8MB 2HQWA 2EGDA 3GK1A 1XK4A 2ZRTA 3CGAA 4WQ3A 4CPVA 3VRNA 4DUQA 2B1UA 1FW4A 1K95A 3I5IB 1DJGA 1KK7Z 1PVAA 2LHLA 1H8BA 1SNLA 2FCDA 4FTGA 2EC6B 4YGDB 1A4PA 1MXLC 2BECA 2FOTA 2KYCA 5HLVA 2G2BA 1OQPA 2KSPA 1BT6A 2MA2A 1S5GZ 3AAKA 1B8CA 1WLZA 2KQ6A 3EKHA 2H61C 2JXCA 2JNXA 3OHMB 1B4CA 1WY9A 2ZKMX 4PE7A 4DIRA 1YURA 2F3YA 3DF0B 2LP2A 2TN4A 1DF0B 4C0JA 1A29A 4XYNA 3GOFA 3I5GC 2NXQA 4R1EA 4CFRA 4YBHB 1OE9B 2P6BB 3QRXA 1S6CA 4MZJA 3TDIA 1DJHA 1YUTA 1J7OA 3JTDC 5CSNA 2L0PA 1TTXA 3K21A 2CT9A 2JT0A 2KFHA 1QATA 3NSKA 1IWQA 4MBEA 1A2XA 1U5IA 1KK8B 2VRGA 1QTXA 1UWOA 1PSRA 1X02A 1NCZA 1BODA 2HF5A 1M46A 3BQ3A 4JQ0D 1SBJA 2LMTA 3BOWB 5J3XA 2GGZA 1S3PA 2M97A 1YX8A 1N2DA 3CWGA 2F2OA 4I5NB 1HT9A 1SW8A 2ZN8A 3I5FC 1FF1A 2LUXA 2E30A 1J7RA 1MUXA 1OOJA 1SCVA 4JPZB 2MBXA 3I5HC 2PSRA 2M29A 3KEVA 3EVVA 1C07A 1Y0VH 3DVMA 2QPTA 1MQ1A 4HRGA 4PE0A 1G4YR 1K9PA 5GQQC 3BUNB 1F4QA 1RROA 4MZKA 1MXEA 2KOTA 3TDZA 2KI4B 2JC2A 2WCBA 3WHTB 2I94A 1CKKA 1C7VA 2I7AA 5AXIA 3CZTX 2ISDA 3NSLA 2M9GA 4PE4A 2WOSA 3NSIA 4MLWA 1AJ4A 4YGCB 1AK8A 3EK8A 1NSHA 5I2OA 4AQIA 1QX7A 2KBMA 3SIAA 1CLMA 1SL8A 1NCXA 1SCMB 1HQVA 4CFQA 4AQJA 1JWDA 4PDZA 1OSAA 1F8HA 1TN4A 2LM5A 2MRDA 1ZACA 3DD4A 1XFWO 1JFKA 1XFZO 1GGWA 1B47A 1B7TZ 1J55A 1PRWA 1QIVA 1S36A 3EKJA 3PN7C 1DMOA 2WCEA 1CM1A 1KWOB 4GNKB 1CFCA 1NX2A 3O78A 5K89A 4D1EA 2M7LA 2LANA 3D0YB 2K7OA 4A4BA 1OZSA 3VGOA 4PCWA 1KK7Y 3FWCA 1QX2A 1XYDA 1KFXL 4AOMA 2A4JA 1A75B 2KGBC 3SG7A 4UPGA 1JUOA 3TS5B 5AERA 1AJ5A 4I5LB 4YGEB 1S5GY 2LHIA 1BU3A 4FQOA 1JC2A 3IQOA 4IL1A 1K8UA 3D10A 4CLNA 5KU1A 3I5IC 1XK4C 4OKHA 4ZCVA 3CS1A 1OMDA 1R2UA 3DVEA 2BBMA 4ZCUA 1W7JB 1C7WA 1AP4A 2PVBA 1IH0A 1ALVA 2LLSA 1SR6C 3H4SE 1QX5B 4M2PA 1G8IA 1JBAA 4NDDA 3IQQA 2V53A 4HRHA 2L5XB 5AEQA 2F33A 1CNPA 3LK0A 2SASA 1SY9A 3EK7A 1RWYA 1CDLA 3SJSA 2KAVA 4YI9A 1B1GA 3SG6A 1NX0A 2LLUA 3LLEA 3BXKA 3IF7A 2DOQA 1K93D 5B8IB 5CSFA 1K90D 1XVJA 1UHIA 2L98A 3OX6A 3GK2A 3DF0A 4HSZA 1EXRA 1DJIA 1DF0A 1S26D 1J7PA 3EK4A 1BR1B 1KK8C 1EJ3A 2M7NA 3CLNA 4MRXA 1CLLA 2HQ8A 1WRKA 2K7BA 1SPYA 1KSOA 1QVIY 2L2EA 5F6TA 1EG3A 1XFVO 3KPXA 1OZOA 1Y1UA 1DJZA 2LC5A 5HKWA 2BKIB 3TUYC 4DCKA 3O4YA 1N0YA 4ORAB 1G33A 1ALWA 2CCMA 1J7QA 4OR9B 1J1DA 1WDCC 3RM1A 3BOWA 1NX3A 2KQYA 4WRIA 2LV7A 5HKZA 3CR4X 1M31A 4NQGA 3HCMA 3PFVA 1TIZA 1JF0A 3WXAA 3PALA 4OVNF 1SRAA 1F55A 3C1VA 2CBLA 2JT3A 2CXJA 2L50A 3GK4X 3FWBA 1B7TY 3ICBA 3NSOA 1KFXS 3DVJA 1DVIA 4NDCA 2E6WA 3M0WA 2Q4UA 1XFXO 1Y6WA 2O60A 2R2IA 5CPVA 1SYMA 1XFYO 2LMUA 4GGFA 5BPJA 3JVTC 4XJKB 1FBVA 5DKRA 1CMFA 1IJ5A 2MAZA 2JU0A 5AFPA 5IBWA 1NUBA 4MRYA 3I5GB 3KF9A 5FYXA 1KQVA 1VRKA 2ZN9A 2LAPA 3AKAA 1MHOA 1RECA 1TRFA 3JTDB 2BL0C 1UHHA 1TNQA 1QJTA 4OV2A 4N5XA 2H2KA 1BLQA 2Y5IA 4YI8A 3LK1A 4PALA 4E68A 3VROA 1F4OA 2OTGC 3WNXB 2KNEA 1PALA 1TCOB 2OS8C 4A4CA 1QS7A 3NXAA 1ODBA 5DKQA 1BOCA 1Y1AA 4TNCA 4BY5A 1DTLA 2MHHA 1BG1A 1KQMC 3BUOB 1UURA 3A8RA 3OP0A 1IJ6A 3D0YA 2KI6D 1M45A 1SMGA 2M49B 3I5FB 4P2YB 1XFUO 1S6IA 4PE1A 4QJ3B 1JFJA 1F70A 1A75A 3OB2B 1IG5A 3I5HB 1BF5A 2AMIA 4I5KA 1TNPA 1Q80A 3KO0A 4N1GA 1L2OC 4JWQA 1YX7A 3MSEB 3O6BA 4YGAA 2LLTA 2WNDA 2KAYA 1YR5A 1IRJA 3AKBA 1NP8A 4I5JA 1UP5A 2LNKA 4HREE 1RTP1 1K9UA 4PHJA 2JOJA 2JZIA 3WHUB 3BUXB 1CMGA 1QLKA 1RJVA 1CDNA 2M8UA 3F45A 1KFUL 1QIWA 2EC6C 2MLEC 2NCPA 2Y1NA 1WRLA 3CR5X 4U8DA 3ZWHA 4ETOA 2JULA 1M63B 5KSZA 4OCIA 2AAOA 1UUSA 1K94A 1RFJA 3PLFB 2BCBA 3TZ1A 1QXPA 1LVCD 2LCPA 2SCPA 1H4BA 2JPTA 3O2PA 3SG3A 3SG2A 2JT8A 1SKTA 1YRTB 2JTTA 2KGRA 1OMVA 1GQMA 3LCPC 2I2RE 4YGBB 2Y4QA 1K2HA 4GFTA 3FIAA 4NDBA 2L4IA 1B9AA 1XA5A 1IQ5A 1CDPA 1BJFA 5HLOA 2FCEA 1GGZA 2FJUB 1FI6A 3EVRA 1IGVA 2LE9B 5KTYA 2LMVA 4BY4A
chains in the Genus database with same CATH superfamily
3VRQA 3CTNA 1DJYA 1SK6D 3VRRA 1MWNA 4PHNA 2K2AA 1CM4A 1XO5A 2L51A 1IIOA 1NPQA 2PASA 3B7AA 3DYEA 1EL4A 2CTNA 2KLEA 1QLSA 2P70A 3OX5A 2MJWB 1TCFA 2K0JA 1BMOA 4PHMA 1B8LA 4GGNA 1SL7A 1SSEB 1YUUA 2ZNDA 3D75A 3DXLA 2AUCA 5AANA 3BYAA 5TNCA 1CFFA 2PMYA 1ZOTB 2M1KB 1B4CA 2MLFC 1TNWA 3EVUA 1CDMA 2K2FA 2RGIA 1SR6B 2GV5A 3CABA 4ICBA 1BR4B 5DKNA 1F54A 3AAJA 2ZNEA 2F8PA 2Q91A 3SG4A 1WLMA 2WCFA 1UHNA 5FI6A 2BAPA 4USLA 5G08A 4ORCB 3BUWB 1N65A 2KFFA 3S0EA 4GGFC 2KI4C 1AVSA 1J1EA 2EHBA 1CFPA 1QV0A 2WC5A 1A03A 1KCYA 1TNXA 2PALA 2BKHB 1PK0D 1PULA 2BCAA 2LVIA 1NIWA 3KHEA 2LVJA 4MSPA 3R1VA 2I18A 2JWWA 3FS7A 2KAXA 2H61A 5ER5A 3OGNA 1K96A 1YVHA 3DVKA 4MZLA 1LA0A 4QJ4B 1PSBA 1SCMC 4XJKA 1F71A 1CTRA 4WQ2A 1TWOA 1UHKA 1U5IB 1FI5A 2M1UA 1DJWA 2JTZA 5HYDA 2O5GA 1SL9A 3OB1B 1EH2A 2L2CA 1CB1A 2KYFA 5HKYA 4GUKA 1KFUS 1YVLA 3N7HA 1L7ZA 1DT7B 1KWOC 1P28A 2LUCA 4MN0A 3TUYB 3RLZA 2LVKA 3L4LA 1V1FA 1QV1A 2BBNA 3A4UB 5ER4X 1CLBA 4INWA 2L4HA 3R72A 1K9KA 1DEKA 1DJXA 1S6JA 1IQ3A 4F0ZB 1JSAA 1QVIZ 2KBIA 3ZNIA 4FQTA 4P5OE 1WDCB 1YTZC 4GBAA 3TS5C 2KI6C 2D8NA 3B88A 2KHNA 2LP3A 1W9ZA 3BUMB 4M2QA 1LA3A 5D7FA 1UHJA 2OPOA 1GJYA 2GGMA 2KFGA 2F3ZA 1NYAA 1E8AA 2NCOA 2WCMA 4DRWA 2KDHA 4CIDA 2JQ6A 1AHRA 2M0RA 2G9BA 2BCXA 2COLB 4GAOA 5I8NA 2JNFA 2NLNA 4PHKA 1RK9A 4C0KA 2CNPA 1S1EA 2QACA 1D1OA 1EG4A 1DGUA 3JVTB 1KSMA 1XFRA 2K7DA 2F2PA 5JJGA 2YGUA 5I2LA 2ZFDA 5CSIA 1FPWA 4DS7A 1R6PA 2K7CA 3SG5A 2ZRSA 2HETA 1Z4HA 2M3WA 1NWDA 2LVVA 2NZ0A 1MR8A 1OMRA 4Q04A 1WRZA 1V1GA 1YUSA 3PATA 1Y1XA 3TDUA 5I94A 1ZUZA 1AUIB 2BE6A 4N1FA 1MF8B 1LINA 1YRUB 2BL0B 3VRPA 5D69A 2IS9A 5D3OA 1C3YA 4MVFA 1ZMZA 2Y1MA 1B8RA 3DZTA 1LXFC 4ORBB 3PSRA 2OTGB 3HX4A 1TOPA 2WCKA 1LKJA 3S0GA 1NX1A 4L9MA 2OS8B 2WORA 2BE4A 2HPSA 1DGVA 4GPLB 2JXLA 1ZFSA 1PVBA 1M39A 1KQMB 1CFDA 3PN7B 1JF2A 5JOLA 3LL8B 2PRUA 3SIBA 2JRFA 4C0LA 5I2QA 1IKUA 1QASA 3E3RA 4MEWA 3CR2A 1W7IB 5PALA 3PM8A 4M2OA 2WC8A 4QJ5B 1NCYA 4YRUA 2K61A 3PJIA 1L2OB 5CSJA 2P71A 2K8MB 2HQWA 3NHIA 2EGDA 3GK1A 1C3ZA 1XK4A 2ZRTA 3CGAA 3SS5A 4WQ3A 4CPVA 3VRNA 4DUQA 3L47A 2B1UA 1FW4A 1K95A 3I5IB 1DJGA 1KK7Z 1PVAA 2LHLA 1H8BA 1SNLA 2FCDA 4FTGA 2EC6B 4YGDB 1A4PA 1MXLC 2BECA 1OOGA 2FOTA 2KYCA 5HLVA 2G2BA 3NGVA 1OQPA 2KSPA 1BT6A 2MA2A 1S5GZ 3AAKA 1B8CA 1WLZA 2KQ6A 3EKHA 2H61C 2JXCA 2JNXA 3OHMB 3OBVA 1WY9A 2ZKMX 4PE7A 4DIRA 1YURA 2F3YA 2WCLA 3DF0B 2LP2A 2TN4A 2KLDA 3K1EA 1DF0B 4C0JA 1A29A 3D78A 4XYNA 1T14A 3GOFA 3I5GC 2NXQA 2GTEA 4R1EA 4F7FA 4CFRA 4YBHB 1OE9B 1ORGA 2P6BB 3QRXA 1S6CA 5DICA 4MZJA 3TDIA 1DJHA 1YUTA 1J7OA 3RZSA 3JTDC 5CSNA 2L0PA 2QDIA 1Z2CB 1TTXA 3D77A 3K21A 2CT9A 2JT0A 2KFHA 1QATA 3NSKA 1IWQA 4MBEA 1A2XA 1U5IA 1KK8B 2VRGA 1QTXA 3ZWHA 1UWOA 1PSRA 1X02A 1NCZA 1BODA 2HF5A 1M46A 3BQ3A 4JQ0D 1SBJA 2LMTA 3BOWB 5J3XA 2GGZA 3Q8IA 1S3PA 2M97A 1YX8A 1N2DA 3CWGA 2F2OA 4I5NB 1HT9A 1SW8A 2ZN8A 3I5FC 1FF1A 3SS3A 2LUXA 2E30A 1QWVA 1J7RA 1MUXA 1OOJA 1SCVA 4JPZB 2MBXA 3I5HC 2PSRA 2M29A 3D74A 3KEVA 3EVVA 1C07A 1Y0VH 3DVMA 2QPTA 1MQ1A 4HRGA 4PE0A 1G4YR 1OW4A 1K9PA 3BFAA 5GQQC 1OOIX 1F4QA 3BUNB 1RROA 4MZKA 1MXEA 2KOTA 3TDZA 2KI4B 2JC2A 2WCBA 3WHTB 2I94A 1CKKA 1TUJA 1C7VA 2I7AA 5AXIA 3CZTX 2ISDA 3NSLA 2M9GA 4PE4A 2H8VA 2WOSA 3NSIA 4MLWA 1AJ4A 4YGCB 3S0AA 3EK8A 1AK8A 1NSHA 5I2OA 4AQIA 1DC1A 1QX7A 2KBMA 3SIAA 1CLMA 1SL8A 1NCXA 1SCMB 1HQVA 4CFQA 4AQJA 1JWDA 4PDZA 1OSAA 1F8HA 1TN4A 2LM5A 2MRDA 2KPHA 1ZACA 3DD4A 1XFWO 1JFKA 1XFZO 1GGWA 1B47A 1B7TZ 1J55A 1PRWA 1QIVA 1S36A 3EKJA 3PN7C 1DMOA 2WCEA 1CM1A 1KWOB 4GNKB 1CFCA 3V2LA 1NX2A 3O78A 5K89A 4D1EA 2M7LA 2LANA 3D0YB 2K7OA 4A4BA 1OZSA 3VGOA 4PCWA 1KK7Y 2WCHA 3S0BA 3FWCA 1QX2A 1XYDA 1KFXL 4AOMA 3NHTA 2A4JA 1A75B 2KGBC 3SG7A 4UPGA 1JUOA 3TS5B 5AERA 1AJ5A 4I5LB 4YGEB 1S5GY 2LHIA 1BU3A 3L4AA 4FQOA 1JC2A 3IQOA 3DY9A 4IL1A 1K8UA 3D10A 4CLNA 5KU1A 3I5IC 1XK4C 4OKHA 4ZCVA 3CS1A 1OMDA 1R2UA 3DVEA 2BBMA 4ZCUA 1W7JB 1C7WA 1AP4A 2PVBA 3FE8A 1IH0A 5HL1A 1ALVA 2LLSA 1SR6C 3H4SE 3PM2A 1QX5B 4M2PA 1G8IA 1JBAA 4NDDA 3IQQA 2V53A 4HRHA 2L5XB 5AEQA 2F33A 3CZ1A 1CNPA 3LK0A 2SASA 1SY9A 3EK7A 1RWYA 1CDLA 1DQEA 3CZ0A 3CYZA 3IVTA 3SJSA 2KAVA 4YI9A 1B1GA 3SS4A 3SG6A 1NX0A 2LLUA 3LLEA 3BXKA 3FE6A 3IF7A 2DOQA 1K93D 5B8IB 5CSFA 1K90D 1XVJA 1UHIA 2L98A 3OX6A 3GK2A 3DF0A 4HSZA 1EXRA 1DJIA 1DF0A 1S26D 3B87A 3EK4A 1J7PA 1BR1B 1KK8C 1EJ3A 2M7NA 3CLNA 3R1PA 1CLLA 4MRXA 2HQ8A 1WRKA 2K7BA 1SPYA 1KSOA 1QVIY 2L2EA 5F6TA 1EG3A 1XFVO 3KPXA 1OZOA 1Y1UA 1DJZA 2LC5A 5HKWA 2BKIB 3UNWA 3TUYC 4DCKA 3O4YA 1N0YA 4JKTA 4ORAB 1G33A 1ALWA 2CCMA 1J7QA 4OR9B 1J1DA 1WDCC 3RM1A 3B86A 3BOWA 1NX3A 1LS8A 2KQYA 4WRIA 2LV7A 5HKZA 3CR4X 1M31A 4NQGA 3HCMA 3PFVA 2K60A 4IJ7A 1TIZA 1JF0A 3CDNA 3PALA 4JD9A 3WXAA 4OVNF 1SRAA 1F55A 3C1VA 2CBLA 2JT3A 2CXJA 2L50A 3BFBA 3FWBA 3GK4X 1B7TY 3ICBA 3NSOA 1KFXS 3DVJA 5EL2A 1DVIA 4NDCA 2E6WA 3M0WA 2Q4UA 1XFXO 1Y6WA 2O60A 2R2IA 5CPVA 1SYMA 1XFYO 2LMUA 4GGFA 5FI2A 5BPJA 3JVTC 3FE9A 4XJKB 1FBVA 5DKRA 1CMFA 1IJ5A 2MAZA 2JU0A 5AFPA 5IBWA 2WCJA 1NUBA 4MRYA 3I5GB 3KF9A 5FYXA 1KQVA 1VRKA 2ZN9A 3R1OA 2LAPA 3AKAA 1MHOA 4INXA 2BNXA 1RECA 1TRFA 3JTDB 2BL0C 1TUZA 1TNQA 1QJTA 1UHHA 2ERBA 4N5XA 2H2KA 4OV2A 1BLQA 2Y5IA 4YI8A 3LK1A 4PALA 4E68A 3VROA 1F4OA 2OTGC 3WNXB 2KNEA 1PALA 1TCOB 2OS8C 4A4CA 1QS7A 3S0DA 3NXAA 1ODBA 5DKQA 1BOCA 1Y1AA 2PYQA 4TNCA 4BY5A 1DTLA 2MHHA 1BG1A 1KQMC 2JPOA 3BUOB 1UURA 3A8RA 3OP0A 1IJ6A 3D0YA 2L5YA 2KI6D 1M45A 1SMGA 2M49B 3I5FB 3CZ2A 4P2YB 1XFUO 1S6IA 4KYNA 4PE1A 4QJ3B 1JFJA 1A75A 3OB2B 1F70A 1IG5A 3I5HB 1BF5A 2AMIA 2WC6A 3BFHA 4I5KA 1TNPA 1Q80A 3KO0A 3BJHA 4N1GA 1L2OC 4JWQA 1YX7A 3MSEB 3O6BA 4YGAA 2LLTA 2WNDA 2KAYA 1YR5A 1IRJA 3AKBA 1NP8A 4I5JA 1UP5A 2LNKA 4HREE 1RTP1 1K9UA 4PHJA 2JOJA 2JZIA 3WHUB 3BUXB 1CMGA 1QLKA 1RJVA 1CDNA 2M8UA 3F45A 3QMEA 1KFUL 1QIWA 2EC6C 2MLEC 2NCPA 2Y1NA 1WRLA 2QEHA 3CR5X 3EG5B 4U8DA 2JULA 4ETOA 1OOFA 1M63B 3UO9A 5KSZA 3D76A 4OCIA 2AAOA 4PT1A 3S0FA 1UUSA 1K94A 1RFJA 2FJYA 3PLFB 4OZDA 2BCBA 3O4XA 3TZ1A 1QXPA 5FI7A 1LVCD 1GM0A 2LCPA 2SCPA 3VB1A 1H4BA 2JPTA 3O2PA 3SG3A 3SG2A 2JT8A 2QEBA 1SKTA 1YRTB 2JTTA 1DELA 2KGRA 1OMVA 1GQMA 3B6XA 3LCPC 2I2RE 4YGBB 2QEVA 2Y4QA 1K2HA 4GFTA 3D73A 3FIAA 4NDBA 2L4IA 1B9AA 1XA5A 1OOHA 1IQ5A 1CDPA 1BJFA 5HLOA 2FCEA 1GGZA 2FJUB 2PQLA 1FI6A 3EVRA 2QEOA 1IGVA 2LE9B 5KTYA 2LMVA 4BY4A
chains in the Genus database with same CATH topology
3VRQA 3CTNA 1DJYA 1SK6D 3VRRA 1MWNA 4PHNA 2K2AA 1CM4A 1XO5A 2L51A 1NPQA 2PASA 1EL4A 2CTNA 1QLSA 3OX5A 2MJWB 1TCFA 2K0JA 1BMOA 4PHMA 1B8LA 4GGNA 1SL7A 1YUUA 2ZNDA 5AANA 5TNCA 2AUCA 3BYAA 1CFFA 2PMYA 1ZOTB 2M1KB 2MLFC 1TNWA 3EVUA 1CDMA 2K2FA 2RGIA 1SR6B 2GV5A 4ICBA 1BR4B 5DKNA 1F54A 3AAJA 2ZNEA 2F8PA 2Q91A 3SG4A 1WLMA 2WCFA 1UHNA 4USLA 5G08A 4ORCB 3BUWB 1N65A 2KFFA 4GGFC 2KI4C 1AVSA 1J1EA 2EHBA 1CFPA 1QV0A 1A03A 1KCYA 1TNXA 2PALA 2BKHB 1PK0D 1PULA 2BCAA 2LVIA 1NIWA 3KHEA 2LVJA 4MSPA 2I18A 2JWWA 3FS7A 2KAXA 2H61A 5ER5A 1K96A 1YVHA 3DVKA 4MZLA 1LA0A 4QJ4B 1PSBA 1SCMC 4XJKA 1F71A 1CTRA 4WQ2A 1UHKA 1U5IB 1FI5A 2M1UA 1DJWA 2JTZA 5HYDA 2O5GA 1SL9A 3OB1B 1EH2A 1CB1A 2KYFA 5HKYA 4GUKA 1KFUS 1YVLA 1L7ZA 1DT7B 1KWOC 4MN0A 2LUCA 3TUYB 3RLZA 2LVKA 1V1FA 1QV1A 2BBNA 3A4UB 5ER4X 1CLBA 2L4HA 1K9KA 1DJXA 1S6JA 1IQ3A 4F0ZB 1JSAA 1QVIZ 2KBIA 3ZNIA 4P5OE 1WDCB 1YTZC 4GBAA 3TS5C 2KI6C 2D8NA 2KHNA 2LP3A 3BUMB 4M2QA 1LA3A 5D7FA 1UHJA 2OPOA 1GJYA 2GGMA 2KFGA 2F3ZA 1NYAA 1E8AA 2NCOA 4DRWA 2KDHA 4CIDA 2JQ6A 1AHRA 2M0RA 2G9BA 2BCXA 2COLB 4GAOA 5I8NA 2JNFA 2NLNA 4PHKA 1RK9A 4C0KA 2CNPA 1S1EA 2QACA 1D1OA 1EG4A 1DGUA 3JVTB 1KSMA 2K7DA 2F2PA 5JJGA 5I2LA 2ZFDA 5CSIA 1FPWA 4DS7A 1R6PA 2K7CA 3SG5A 2ZRSA 2HETA 2M3WA 1NWDA 2LVVA 2NZ0A 1MR8A 1OMRA 4Q04A 1WRZA 1V1GA 1YUSA 3PATA 1Y1XA 3TDUA 1ZUZA 1AUIB 2BE6A 4N1FA 1MF8B 1LINA 1YRUB 2BL0B 3VRPA 5D69A 2IS9A 4MVFA 1ZMZA 2Y1MA 1B8RA 1LXFC 4ORBB 3PSRA 2OTGB 3HX4A 1TOPA 1LKJA 1NX1A 4L9MA 2OS8B 2WORA 2BE4A 2HPSA 1DGVA 4GPLB 2JXLA 1ZFSA 1PVBA 1M39A 1KQMB 1CFDA 3PN7B 1JF2A 5JOLA 3LL8B 2PRUA 3SIBA 2JRFA 4C0LA 5I2QA 1IKUA 1QASA 3E3RA 4MEWA 3CR2A 1W7IB 5PALA 3PM8A 4M2OA 2WC8A 4QJ5B 1NCYA 4YRUA 2K61A 1L2OB 5CSJA 2K8MB 2HQWA 2EGDA 3GK1A 1XK4A 2ZRTA 3CGAA 4WQ3A 4CPVA 3VRNA 4DUQA 2B1UA 1FW4A 1K95A 3I5IB 1DJGA 1KK7Z 1PVAA 2LHLA 1H8BA 1SNLA 2FCDA 4FTGA 2EC6B 4YGDB 1A4PA 1MXLC 2BECA 2FOTA 2KYCA 5HLVA 2G2BA 1OQPA 2KSPA 1BT6A 2MA2A 1S5GZ 3AAKA 1B8CA 1WLZA 2KQ6A 3EKHA 2H61C 2JXCA 2JNXA 3OHMB 1B4CA 1WY9A 2ZKMX 4PE7A 4DIRA 1YURA 2F3YA 3DF0B 2LP2A 2TN4A 1DF0B 4C0JA 1A29A 4XYNA 3GOFA 3I5GC 2NXQA 4R1EA 4CFRA 4YBHB 1OE9B 2P6BB 3QRXA 1S6CA 4MZJA 3TDIA 1DJHA 1YUTA 1J7OA 3JTDC 5CSNA 2L0PA 1TTXA 3K21A 2CT9A 2JT0A 2KFHA 1QATA 3NSKA 1IWQA 4MBEA 1A2XA 1U5IA 1KK8B 2VRGA 1QTXA 1UWOA 1PSRA 1X02A 1NCZA 1BODA 2HF5A 1M46A 3BQ3A 4JQ0D 1SBJA 2LMTA 3BOWB 5J3XA 2GGZA 1S3PA 2M97A 1YX8A 1N2DA 3CWGA 2F2OA 4I5NB 1HT9A 1SW8A 2ZN8A 3I5FC 1FF1A 2LUXA 2E30A 1J7RA 1MUXA 1OOJA 1SCVA 4JPZB 2MBXA 3I5HC 2PSRA 2M29A 3KEVA 3EVVA 1C07A 1Y0VH 3DVMA 2QPTA 1MQ1A 4HRGA 4PE0A 1G4YR 1K9PA 5GQQC 3BUNB 1F4QA 1RROA 4MZKA 1MXEA 2KOTA 3TDZA 2KI4B 2JC2A 2WCBA 3WHTB 2I94A 1CKKA 1C7VA 2I7AA 5AXIA 3CZTX 2ISDA 3NSLA 2M9GA 4PE4A 2WOSA 3NSIA 4MLWA 1AJ4A 4YGCB 1AK8A 3EK8A 1NSHA 5I2OA 4AQIA 1QX7A 2KBMA 3SIAA 1CLMA 1SL8A 1NCXA 1SCMB 1HQVA 4CFQA 4AQJA 1JWDA 4PDZA 1OSAA 1F8HA 1TN4A 2LM5A 2MRDA 1ZACA 3DD4A 1XFWO 1JFKA 1XFZO 1GGWA 1B47A 1B7TZ 1J55A 1PRWA 1QIVA 1S36A 3EKJA 3PN7C 1DMOA 2WCEA 1CM1A 1KWOB 4GNKB 1CFCA 1NX2A 3O78A 5K89A 4D1EA 2M7LA 2LANA 3D0YB 2K7OA 4A4BA 1OZSA 3VGOA 4PCWA 1KK7Y 3FWCA 1QX2A 1XYDA 1KFXL 4AOMA 2A4JA 1A75B 2KGBC 3SG7A 4UPGA 1JUOA 3TS5B 5AERA 1AJ5A 4I5LB 4YGEB 1S5GY 2LHIA 1BU3A 4FQOA 1JC2A 3IQOA 4IL1A 1K8UA 3D10A 4CLNA 5KU1A 3I5IC 1XK4C 4OKHA 4ZCVA 3CS1A 1OMDA 1R2UA 3DVEA 2BBMA 4ZCUA 1W7JB 1C7WA 1AP4A 2PVBA 1IH0A 1ALVA 2LLSA 1SR6C 3H4SE 1QX5B 4M2PA 1G8IA 1JBAA 4NDDA 3IQQA 2V53A 4HRHA 2L5XB 5AEQA 2F33A 1CNPA 3LK0A 2SASA 1SY9A 3EK7A 1RWYA 1CDLA 3SJSA 2KAVA 4YI9A 1B1GA 3SG6A 1NX0A 2LLUA 3LLEA 3BXKA 3IF7A 2DOQA 1K93D 5B8IB 5CSFA 1K90D 1XVJA 1UHIA 2L98A 3OX6A 3GK2A 3DF0A 4HSZA 1EXRA 1DJIA 1DF0A 1S26D 1J7PA 3EK4A 1BR1B 1KK8C 1EJ3A 2M7NA 3CLNA 4MRXA 1CLLA 2HQ8A 1WRKA 2K7BA 1SPYA 1KSOA 1QVIY 2L2EA 5F6TA 1EG3A 1XFVO 3KPXA 1OZOA 1Y1UA 1DJZA 2LC5A 5HKWA 2BKIB 3TUYC 4DCKA 3O4YA 1N0YA 4ORAB 1G33A 1ALWA 2CCMA 1J7QA 4OR9B 1J1DA 1WDCC 3RM1A 3BOWA 1NX3A 2KQYA 4WRIA 2LV7A 5HKZA 3CR4X 1M31A 4NQGA 3HCMA 3PFVA 1TIZA 1JF0A 3WXAA 3PALA 4OVNF 1SRAA 1F55A 3C1VA 2CBLA 2JT3A 2CXJA 2L50A 3GK4X 3FWBA 1B7TY 3ICBA 3NSOA 1KFXS 3DVJA 1DVIA 4NDCA 2E6WA 3M0WA 2Q4UA 1XFXO 1Y6WA 2O60A 2R2IA 5CPVA 1SYMA 1XFYO 2LMUA 4GGFA 5BPJA 3JVTC 4XJKB 1FBVA 5DKRA 1CMFA 1IJ5A 2MAZA 2JU0A 5AFPA 5IBWA 1NUBA 4MRYA 3I5GB 3KF9A 5FYXA 1KQVA 1VRKA 2ZN9A 2LAPA 3AKAA 1MHOA 1RECA 1TRFA 3JTDB 2BL0C 1UHHA 1TNQA 1QJTA 4OV2A 4N5XA 2H2KA 1BLQA 2Y5IA 4YI8A 3LK1A 4PALA 4E68A 3VROA 1F4OA 2OTGC 3WNXB 2KNEA 1PALA 1TCOB 2OS8C 4A4CA 1QS7A 3NXAA 1ODBA 5DKQA 1BOCA 1Y1AA 4TNCA 4BY5A 1DTLA 2MHHA 1BG1A 1KQMC 3BUOB 1UURA 3A8RA 3OP0A 1IJ6A 3D0YA 2KI6D 1M45A 1SMGA 2M49B 3I5FB 4P2YB 1XFUO 1S6IA 4PE1A 4QJ3B 1JFJA 1F70A 1A75A 3OB2B 1IG5A 3I5HB 1BF5A 2AMIA 4I5KA 1TNPA 1Q80A 3KO0A 4N1GA 1L2OC 4JWQA 1YX7A 3MSEB 3O6BA 4YGAA 2LLTA 2WNDA 2KAYA 1YR5A 1IRJA 3AKBA 1NP8A 4I5JA 1UP5A 2LNKA 4HREE 1RTP1 1K9UA 4PHJA 2JOJA 2JZIA 3WHUB 3BUXB 1CMGA 1QLKA 1RJVA 1CDNA 2M8UA 3F45A 1KFUL 1QIWA 2EC6C 2MLEC 2NCPA 2Y1NA 1WRLA 3CR5X 4U8DA 3ZWHA 4ETOA 2JULA 1M63B 5KSZA 4OCIA 2AAOA 1UUSA 1K94A 1RFJA 3PLFB 2BCBA 3TZ1A 1QXPA 1LVCD 2LCPA 2SCPA 1H4BA 2JPTA 3O2PA 3SG3A 3SG2A 2JT8A 1SKTA 1YRTB 2JTTA 2KGRA 1OMVA 1GQMA 3LCPC 2I2RE 4YGBB 2Y4QA 1K2HA 4GFTA 3FIAA 4NDBA 2L4IA 1B9AA 1XA5A 1IQ5A 1CDPA 1BJFA 5HLOA 2FCEA 1GGZA 2FJUB 1FI6A 3EVRA 1IGVA 2LE9B 5KTYA 2LMVA 4BY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRQ A;  3CTN A;  1DJY A;  1SK6 D;  3VRR A;  1MWN A;  4PHN A;  2K2A A;  1CM4 A;  1XO5 A;  2L51 A;  1NPQ A;  2PAS A;  1EL4 A;  2CTN A;  1QLS A;  3OX5 A;  2MJW B;  1TCF A;  2K0J A;  1BMO A;  4PHM A;  1B8L A;  4GGN A;  1SL7 A;  1YUU A;  2ZND A;  5AAN A;  5TNC A;  2AUC A;  3BYA A;  1CFF A;  2PMY A;  1ZOT B;  2M1K B;  2MLF C;  1TNW A;  3EVU A;  1CDM A;  2K2F A;  2RGI A;  1SR6 B;  2GV5 A;  4ICB A;  1BR4 B;  5DKN A;  1F54 A;  3AAJ A;  2ZNE A;  2F8P A;  2Q91 A;  3SG4 A;  1WLM A;  2WCF A;  1UHN A;  4USL A;  5G08 A;  4ORC B;  3BUW B;  1N65 A;  2KFF A;  4GGF C;  2KI4 C;  1AVS A;  1J1E A;  2EHB A;  1CFP A;  1QV0 A;  1A03 A;  1KCY A;  1TNX A;  2PAL A;  2BKH B;  1PK0 D;  1PUL A;  2BCA A;  2LVI A;  1NIW A;  3KHE A;  2LVJ A;  4MSP A;  2I18 A;  2JWW A;  3FS7 A;  2KAX A;  2H61 A;  5ER5 A;  1K96 A;  1YVH A;  3DVK A;  4MZL A;  1LA0 A;  4QJ4 B;  1PSB A;  1SCM C;  4XJK A;  1F71 A;  1CTR A;  4WQ2 A;  1UHK A;  1U5I B;  1FI5 A;  2M1U A;  1DJW A;  2JTZ A;  5HYD A;  2O5G A;  1SL9 A;  3OB1 B;  1EH2 A;  1CB1 A;  2KYF A;  5HKY A;  4GUK A;  1KFU S;  1YVL A;  1L7Z A;  1DT7 B;  1KWO C;  4MN0 A;  2LUC A;  3TUY B;  3RLZ A;  2LVK A;  1V1F A;  1QV1 A;  2BBN A;  3A4U B;  5ER4 X;  1CLB A;  2L4H A;  1K9K A;  1DJX A;  1S6J A;  1IQ3 A;  4F0Z B;  1JSA A;  1QVI Z;  2KBI A;  3ZNI A;  4P5O E;  1WDC B;  1YTZ C;  4GBA A;  3TS5 C;  2KI6 C;  2D8N A;  2KHN A;  2LP3 A;  3BUM B;  4M2Q A;  1LA3 A;  5D7F A;  1UHJ A;  2OPO A;  1GJY A;  2GGM A;  2KFG A;  2F3Z A;  1NYA A;  1E8A A;  2NCO A;  4DRW A;  2KDH A;  4CID A;  2JQ6 A;  1AHR A;  2M0R A;  2G9B A;  2BCX A;  2COL B;  4GAO A;  5I8N A;  2JNF A;  2NLN A;  4PHK A;  1RK9 A;  4C0K A;  2CNP A;  1S1E A;  2QAC A;  1D1O A;  1EG4 A;  1DGU A;  3JVT B;  1KSM A;  2K7D A;  2F2P A;  5JJG A;  5I2L A;  2ZFD A;  5CSI A;  1FPW A;  4DS7 A;  1R6P A;  2K7C A;  3SG5 A;  2ZRS A;  2HET A;  2M3W A;  1NWD A;  2LVV A;  2NZ0 A;  1MR8 A;  1OMR A;  4Q04 A;  1WRZ A;  1V1G A;  1YUS A;  3PAT A;  1Y1X A;  3TDU A;  1ZUZ A;  1AUI B;  2BE6 A;  4N1F A;  1MF8 B;  1LIN A;  1YRU B;  2BL0 B;  3VRP A;  5D69 A;  2IS9 A;  4MVF A;  1ZMZ A;  2Y1M A;  1B8R A;  1LXF C;  4ORB B;  3PSR A;  2OTG B;  3HX4 A;  1TOP A;  1LKJ A;  1NX1 A;  4L9M A;  2OS8 B;  2WOR A;  2BE4 A;  2HPS A;  1DGV A;  4GPL B;  2JXL A;  1ZFS A;  1PVB A;  1M39 A;  1KQM B;  1CFD A;  3PN7 B;  1JF2 A;  5JOL A;  3LL8 B;  2PRU A;  3SIB A;  2JRF A;  4C0L A;  5I2Q A;  1IKU A;  1QAS A;  3E3R A;  4MEW A;  3CR2 A;  1W7I B;  5PAL A;  3PM8 A;  4M2O A;  2WC8 A;  4QJ5 B;  1NCY A;  4YRU A;  2K61 A;  1L2O B;  5CSJ A;  2K8M B;  2HQW A;  2EGD A;  3GK1 A;  1XK4 A;  2ZRT A;  3CGA A;  4WQ3 A;  4CPV A;  3VRN A;  4DUQ A;  2B1U A;  1FW4 A;  1K95 A;  3I5I B;  1DJG A;  1KK7 Z;  1PVA A;  2LHL A;  1H8B A;  1SNL A;  2FCD A;  4FTG A;  2EC6 B;  4YGD B;  1A4P A;  1MXL C;  2BEC A;  2FOT A;  2KYC A;  5HLV A;  2G2B A;  1OQP A;  2KSP A;  1BT6 A;  2MA2 A;  1S5G Z;  3AAK A;  1B8C A;  1WLZ A;  2KQ6 A;  3EKH A;  2H61 C;  2JXC A;  2JNX A;  3OHM B;  1B4C A;  1WY9 A;  2ZKM X;  4PE7 A;  4DIR A;  1YUR A;  2F3Y A;  3DF0 B;  2LP2 A;  2TN4 A;  1DF0 B;  4C0J A;  1A29 A;  4XYN A;  3GOF A;  3I5G C;  2NXQ A;  4R1E A;  4CFR A;  4YBH B;  1OE9 B;  2P6B B;  3QRX A;  1S6C A;  4MZJ A;  3TDI A;  1DJH A;  1YUT A;  1J7O A;  3JTD C;  5CSN A;  2L0P A;  1TTX A;  3K21 A;  2CT9 A;  2JT0 A;  2KFH A;  1QAT A;  3NSK A;  1IWQ A;  4MBE A;  1A2X A;  1U5I A;  1KK8 B;  2VRG A;  1QTX A;  1UWO A;  1PSR A;  1X02 A;  1NCZ A;  1BOD A;  2HF5 A;  1M46 A;  3BQ3 A;  4JQ0 D;  1SBJ A;  2LMT A;  3BOW B;  5J3X A;  2GGZ A;  1S3P A;  2M97 A;  1YX8 A;  1N2D A;  3CWG A;  2F2O A;  4I5N B;  1HT9 A;  1SW8 A;  2ZN8 A;  3I5F C;  1FF1 A;  2LUX A;  2E30 A;  1J7R A;  1MUX A;  1OOJ A;  1SCV A;  4JPZ B;  2MBX A;  3I5H C;  2PSR A;  2M29 A;  3KEV A;  3EVV A;  1C07 A;  1Y0V H;  3DVM A;  2QPT A;  1MQ1 A;  4HRG A;  4PE0 A;  1G4Y R;  1K9P A;  5GQQ C;  3BUN B;  1F4Q A;  1RRO A;  4MZK A;  1MXE A;  2KOT A;  3TDZ A;  2KI4 B;  2JC2 A;  2WCB A;  3WHT B;  2I94 A;  1CKK A;  1C7V A;  2I7A A;  5AXI A;  3CZT X;  2ISD A;  3NSL A;  2M9G A;  4PE4 A;  2WOS A;  3NSI A;  4MLW A;  1AJ4 A;  4YGC B;  1AK8 A;  3EK8 A;  1NSH A;  5I2O A;  4AQI A;  1QX7 A;  2KBM A;  3SIA A;  1CLM A;  1SL8 A;  1NCX A;  1SCM B;  1HQV A;  4CFQ A;  4AQJ A;  1JWD A;  4PDZ A;  1OSA A;  1F8H A;  1TN4 A;  2LM5 A;  2MRD A;  1ZAC A;  3DD4 A;  1XFW O;  1JFK A;  1XFZ O;  1GGW A;  1B47 A;  1B7T Z;  1J55 A;  1PRW A;  1QIV A;  1S36 A;  3EKJ A;  3PN7 C;  1DMO A;  2WCE A;  1CM1 A;  1KWO B;  4GNK B;  1CFC A;  1NX2 A;  3O78 A;  5K89 A;  4D1E A;  2M7L A;  2LAN A;  3D0Y B;  2K7O A;  4A4B A;  1OZS A;  3VGO A;  4PCW A;  1KK7 Y;  3FWC A;  1QX2 A;  1XYD A;  1KFX L;  4AOM A;  2A4J A;  1A75 B;  2KGB C;  3SG7 A;  4UPG A;  1JUO A;  3TS5 B;  5AER A;  1AJ5 A;  4I5L B;  4YGE B;  1S5G Y;  2LHI A;  1BU3 A;  4FQO A;  1JC2 A;  3IQO A;  4IL1 A;  1K8U A;  3D10 A;  4CLN A;  5KU1 A;  3I5I C;  1XK4 C;  4OKH A;  4ZCV A;  3CS1 A;  1OMD A;  1R2U A;  3DVE A;  2BBM A;  4ZCU A;  1W7J B;  1C7W A;  1AP4 A;  2PVB A;  1IH0 A;  1ALV A;  2LLS A;  1SR6 C;  3H4S E;  1QX5 B;  4M2P A;  1G8I A;  1JBA A;  4NDD A;  3IQQ A;  2V53 A;  4HRH A;  2L5X B;  5AEQ A;  2F33 A;  1CNP A;  3LK0 A;  2SAS A;  1SY9 A;  3EK7 A;  1RWY A;  1CDL A;  3SJS A;  2KAV A;  4YI9 A;  1B1G A;  3SG6 A;  1NX0 A;  2LLU A;  3LLE A;  3BXK A;  3IF7 A;  2DOQ A;  1K93 D;  5B8I B;  5CSF A;  1K90 D;  1XVJ A;  1UHI A;  2L98 A;  3OX6 A;  3GK2 A;  3DF0 A;  4HSZ A;  1EXR A;  1DJI A;  1DF0 A;  1S26 D;  1J7P A;  3EK4 A;  1BR1 B;  1KK8 C;  1EJ3 A;  2M7N A;  3CLN A;  4MRX A;  1CLL A;  2HQ8 A;  1WRK A;  2K7B A;  1SPY A;  1KSO A;  1QVI Y;  2L2E A;  5F6T A;  1EG3 A;  1XFV O;  3KPX A;  1OZO A;  1Y1U A;  1DJZ A;  2LC5 A;  5HKW A;  2BKI B;  3TUY C;  4DCK A;  3O4Y A;  1N0Y A;  4ORA B;  1G33 A;  1ALW A;  2CCM A;  1J7Q A;  4OR9 B;  1J1D A;  1WDC C;  3RM1 A;  3BOW A;  1NX3 A;  2KQY A;  4WRI A;  2LV7 A;  5HKZ A;  3CR4 X;  1M31 A;  4NQG A;  3HCM A;  3PFV A;  1TIZ A;  1JF0 A;  3WXA A;  3PAL A;  4OVN F;  1SRA A;  1F55 A;  3C1V A;  2CBL A;  2JT3 A;  2CXJ A;  2L50 A;  3GK4 X;  3FWB A;  1B7T Y;  3ICB A;  3NSO A;  1KFX S;  3DVJ A;  1DVI A;  4NDC A;  2E6W A;  3M0W A;  2Q4U A;  1XFX O;  1Y6W A;  2O60 A;  2R2I A;  5CPV A;  1SYM A;  1XFY O;  2LMU A;  4GGF A;  5BPJ A;  3JVT C;  4XJK B;  1FBV A;  5DKR A;  1CMF A;  1IJ5 A;  2MAZ A;  2JU0 A;  5AFP A;  5IBW A;  1NUB A;  4MRY A;  3I5G B;  3KF9 A;  5FYX A;  1KQV A;  1VRK A;  2ZN9 A;  2LAP A;  3AKA A;  1MHO A;  1REC A;  1TRF A;  3JTD B;  2BL0 C;  1UHH A;  1TNQ A;  1QJT A;  4OV2 A;  4N5X A;  2H2K A;  1BLQ A;  2Y5I A;  4YI8 A;  3LK1 A;  4PAL A;  4E68 A;  3VRO A;  1F4O A;  2OTG C;  3WNX B;  2KNE A;  1PAL A;  1TCO B;  2OS8 C;  4A4C A;  1QS7 A;  3NXA A;  1ODB A;  5DKQ A;  1BOC A;  1Y1A A;  4TNC A;  4BY5 A;  1DTL A;  2MHH A;  1BG1 A;  1KQM C;  3BUO B;  1UUR A;  3A8R A;  3OP0 A;  1IJ6 A;  3D0Y A;  2KI6 D;  1M45 A;  1SMG A;  2M49 B;  3I5F B;  4P2Y B;  1XFU O;  1S6I A;  4PE1 A;  4QJ3 B;  1JFJ A;  1F70 A;  1A75 A;  3OB2 B;  1IG5 A;  3I5H B;  1BF5 A;  2AMI A;  4I5K A;  1TNP A;  1Q80 A;  3KO0 A;  4N1G A;  1L2O C;  4JWQ A;  1YX7 A;  3MSE B;  3O6B A;  4YGA A;  2LLT A;  2WND A;  2KAY A;  1YR5 A;  1IRJ A;  3AKB A;  1NP8 A;  4I5J A;  1UP5 A;  2LNK A;  4HRE E;  1RTP 1;  1K9U A;  4PHJ A;  2JOJ A;  2JZI A;  3WHU B;  3BUX B;  1CMG A;  1QLK A;  1RJV A;  1CDN A;  2M8U A;  3F45 A;  1KFU L;  1QIW A;  2EC6 C;  2MLE C;  2NCP A;  2Y1N A;  1WRL A;  3CR5 X;  4U8D A;  3ZWH A;  4ETO A;  2JUL A;  1M63 B;  5KSZ A;  4OCI A;  2AAO A;  1UUS A;  1K94 A;  1RFJ A;  3PLF B;  2BCB A;  3TZ1 A;  1QXP A;  1LVC D;  2LCP A;  2SCP A;  1H4B A;  2JPT A;  3O2P A;  3SG3 A;  3SG2 A;  2JT8 A;  1SKT A;  1YRT B;  2JTT A;  2KGR A;  1OMV A;  1GQM A;  3LCP C;  2I2R E;  4YGB B;  2Y4Q A;  1K2H A;  4GFT A;  3FIA A;  4NDB A;  2L4I A;  1B9A A;  1XA5 A;  1IQ5 A;  1CDP A;  1BJF A;  5HLO A;  2FCE A;  1GGZ A;  2FJU B;  1FI6 A;  3EVR A;  1IGV A;  2LE9 B;  5KTY A;  2LMV A;  4BY4 A; 
#chains in the Genus database with same CATH topology
 3VRQ A;  3CTN A;  1DJY A;  1SK6 D;  3VRR A;  1MWN A;  4PHN A;  2K2A A;  1CM4 A;  1XO5 A;  2L51 A;  1IIO A;  1NPQ A;  2PAS A;  3B7A A;  3DYE A;  1EL4 A;  2CTN A;  2KLE A;  1QLS A;  2P70 A;  3OX5 A;  2MJW B;  1TCF A;  2K0J A;  1BMO A;  4PHM A;  1B8L A;  4GGN A;  1SL7 A;  1SSE B;  1YUU A;  2ZND A;  3D75 A;  3DXL A;  2AUC A;  5AAN A;  3BYA A;  5TNC A;  1CFF A;  2PMY A;  1ZOT B;  2M1K B;  1B4C A;  2MLF C;  1TNW A;  3EVU A;  1CDM A;  2K2F A;  2RGI A;  1SR6 B;  2GV5 A;  3CAB A;  4ICB A;  1BR4 B;  5DKN A;  1F54 A;  3AAJ A;  2ZNE A;  2F8P A;  2Q91 A;  3SG4 A;  1WLM A;  2WCF A;  1UHN A;  5FI6 A;  2BAP A;  4USL A;  5G08 A;  4ORC B;  3BUW B;  1N65 A;  2KFF A;  3S0E A;  4GGF C;  2KI4 C;  1AVS A;  1J1E A;  2EHB A;  1CFP A;  1QV0 A;  2WC5 A;  1A03 A;  1KCY A;  1TNX A;  2PAL A;  2BKH B;  1PK0 D;  1PUL A;  2BCA A;  2LVI A;  1NIW A;  3KHE A;  2LVJ A;  4MSP A;  3R1V A;  2I18 A;  2JWW A;  3FS7 A;  2KAX A;  2H61 A;  5ER5 A;  3OGN A;  1K96 A;  1YVH A;  3DVK A;  4MZL A;  1LA0 A;  4QJ4 B;  1PSB A;  1SCM C;  4XJK A;  1F71 A;  1CTR A;  4WQ2 A;  1TWO A;  1UHK A;  1U5I B;  1FI5 A;  2M1U A;  1DJW A;  2JTZ A;  5HYD A;  2O5G A;  1SL9 A;  3OB1 B;  1EH2 A;  2L2C A;  1CB1 A;  2KYF A;  5HKY A;  4GUK A;  1KFU S;  1YVL A;  3N7H A;  1L7Z A;  1DT7 B;  1KWO C;  1P28 A;  2LUC A;  4MN0 A;  3TUY B;  3RLZ A;  2LVK A;  3L4L A;  1V1F A;  1QV1 A;  2BBN A;  3A4U B;  5ER4 X;  1CLB A;  4INW A;  2L4H A;  3R72 A;  1K9K A;  1DEK A;  1DJX A;  1S6J A;  1IQ3 A;  4F0Z B;  1JSA A;  1QVI Z;  2KBI A;  3ZNI A;  4FQT A;  4P5O E;  1WDC B;  1YTZ C;  4GBA A;  3TS5 C;  2KI6 C;  2D8N A;  3B88 A;  2KHN A;  2LP3 A;  1W9Z A;  3BUM B;  4M2Q A;  1LA3 A;  5D7F A;  1UHJ A;  2OPO A;  1GJY A;  2GGM A;  2KFG A;  2F3Z A;  1NYA A;  1E8A A;  2NCO A;  2WCM A;  4DRW A;  2KDH A;  4CID A;  2JQ6 A;  1AHR A;  2M0R A;  2G9B A;  2BCX A;  2COL B;  4GAO A;  5I8N A;  2JNF A;  2NLN A;  4PHK A;  1RK9 A;  4C0K A;  2CNP A;  1S1E A;  2QAC A;  1D1O A;  1EG4 A;  1DGU A;  3JVT B;  1KSM A;  1XFR A;  2K7D A;  2F2P A;  5JJG A;  2YGU A;  5I2L A;  2ZFD A;  5CSI A;  1FPW A;  4DS7 A;  1R6P A;  2K7C A;  3SG5 A;  2ZRS A;  2HET A;  1Z4H A;  2M3W A;  1NWD A;  2LVV A;  2NZ0 A;  1MR8 A;  1OMR A;  4Q04 A;  1WRZ A;  1V1G A;  1YUS A;  3PAT A;  1Y1X A;  3TDU A;  5I94 A;  1ZUZ A;  1AUI B;  2BE6 A;  4N1F A;  1MF8 B;  1LIN A;  1YRU B;  2BL0 B;  3VRP A;  5D69 A;  2IS9 A;  5D3O A;  1C3Y A;  4MVF A;  1ZMZ A;  2Y1M A;  1B8R A;  3DZT A;  1LXF C;  4ORB B;  3PSR A;  2OTG B;  3HX4 A;  1TOP A;  2WCK A;  1LKJ A;  3S0G A;  1NX1 A;  4L9M A;  2OS8 B;  2WOR A;  2BE4 A;  2HPS A;  1DGV A;  4GPL B;  2JXL A;  1ZFS A;  1PVB A;  1M39 A;  1KQM B;  1CFD A;  3PN7 B;  1JF2 A;  5JOL A;  3LL8 B;  2PRU A;  3SIB A;  2JRF A;  4C0L A;  5I2Q A;  1IKU A;  1QAS A;  3E3R A;  4MEW A;  3CR2 A;  1W7I B;  5PAL A;  3PM8 A;  4M2O A;  2WC8 A;  4QJ5 B;  1NCY A;  4YRU A;  2K61 A;  3PJI A;  1L2O B;  5CSJ A;  2P71 A;  2K8M B;  2HQW A;  3NHI A;  2EGD A;  3GK1 A;  1C3Z A;  1XK4 A;  2ZRT A;  3CGA A;  3SS5 A;  4WQ3 A;  4CPV A;  3VRN A;  4DUQ A;  3L47 A;  2B1U A;  1FW4 A;  1K95 A;  3I5I B;  1DJG A;  1KK7 Z;  1PVA A;  2LHL A;  1H8B A;  1SNL A;  2FCD A;  4FTG A;  2EC6 B;  4YGD B;  1A4P A;  1MXL C;  2BEC A;  1OOG A;  2FOT A;  2KYC A;  5HLV A;  2G2B A;  3NGV A;  1OQP A;  2KSP A;  1BT6 A;  2MA2 A;  1S5G Z;  3AAK A;  1B8C A;  1WLZ A;  2KQ6 A;  3EKH A;  2H61 C;  2JXC A;  2JNX A;  3OHM B;  3OBV A;  1WY9 A;  2ZKM X;  4PE7 A;  4DIR A;  1YUR A;  2F3Y A;  2WCL A;  3DF0 B;  2LP2 A;  2TN4 A;  2KLD A;  3K1E A;  1DF0 B;  4C0J A;  1A29 A;  3D78 A;  4XYN A;  1T14 A;  3GOF A;  3I5G C;  2NXQ A;  2GTE A;  4R1E A;  4F7F A;  4CFR A;  4YBH B;  1OE9 B;  1ORG A;  2P6B B;  3QRX A;  1S6C A;  5DIC A;  4MZJ A;  3TDI A;  1DJH A;  1YUT A;  1J7O A;  3RZS A;  3JTD C;  5CSN A;  2L0P A;  2QDI A;  1Z2C B;  1TTX A;  3D77 A;  3K21 A;  2CT9 A;  2JT0 A;  2KFH A;  1QAT A;  3NSK A;  1IWQ A;  4MBE A;  1A2X A;  1U5I A;  1KK8 B;  2VRG A;  1QTX A;  3ZWH A;  1UWO A;  1PSR A;  1X02 A;  1NCZ A;  1BOD A;  2HF5 A;  1M46 A;  3BQ3 A;  4JQ0 D;  1SBJ A;  2LMT A;  3BOW B;  5J3X A;  2GGZ A;  3Q8I A;  1S3P A;  2M97 A;  1YX8 A;  1N2D A;  3CWG A;  2F2O A;  4I5N B;  1HT9 A;  1SW8 A;  2ZN8 A;  3I5F C;  1FF1 A;  3SS3 A;  2LUX A;  2E30 A;  1QWV A;  1J7R A;  1MUX A;  1OOJ A;  1SCV A;  4JPZ B;  2MBX A;  3I5H C;  2PSR A;  2M29 A;  3D74 A;  3KEV A;  3EVV A;  1C07 A;  1Y0V H;  3DVM A;  2QPT A;  1MQ1 A;  4HRG A;  4PE0 A;  1G4Y R;  1OW4 A;  1K9P A;  3BFA A;  5GQQ C;  1OOI X;  1F4Q A;  3BUN B;  1RRO A;  4MZK A;  1MXE A;  2KOT A;  3TDZ A;  2KI4 B;  2JC2 A;  2WCB A;  3WHT B;  2I94 A;  1CKK A;  1TUJ A;  1C7V A;  2I7A A;  5AXI A;  3CZT X;  2ISD A;  3NSL A;  2M9G A;  4PE4 A;  2H8V A;  2WOS A;  3NSI A;  4MLW A;  1AJ4 A;  4YGC B;  3S0A A;  3EK8 A;  1AK8 A;  1NSH A;  5I2O A;  4AQI A;  1DC1 A;  1QX7 A;  2KBM A;  3SIA A;  1CLM A;  1SL8 A;  1NCX A;  1SCM B;  1HQV A;  4CFQ A;  4AQJ A;  1JWD A;  4PDZ A;  1OSA A;  1F8H A;  1TN4 A;  2LM5 A;  2MRD A;  2KPH A;  1ZAC A;  3DD4 A;  1XFW O;  1JFK A;  1XFZ O;  1GGW A;  1B47 A;  1B7T Z;  1J55 A;  1PRW A;  1QIV A;  1S36 A;  3EKJ A;  3PN7 C;  1DMO A;  2WCE A;  1CM1 A;  1KWO B;  4GNK B;  1CFC A;  3V2L A;  1NX2 A;  3O78 A;  5K89 A;  4D1E A;  2M7L A;  2LAN A;  3D0Y B;  2K7O A;  4A4B A;  1OZS A;  3VGO A;  4PCW A;  1KK7 Y;  2WCH A;  3S0B A;  3FWC A;  1QX2 A;  1XYD A;  1KFX L;  4AOM A;  3NHT A;  2A4J A;  1A75 B;  2KGB C;  3SG7 A;  4UPG A;  1JUO A;  3TS5 B;  5AER A;  1AJ5 A;  4I5L B;  4YGE B;  1S5G Y;  2LHI A;  1BU3 A;  3L4A A;  4FQO A;  1JC2 A;  3IQO A;  3DY9 A;  4IL1 A;  1K8U A;  3D10 A;  4CLN A;  5KU1 A;  3I5I C;  1XK4 C;  4OKH A;  4ZCV A;  3CS1 A;  1OMD A;  1R2U A;  3DVE A;  2BBM A;  4ZCU A;  1W7J B;  1C7W A;  1AP4 A;  2PVB A;  3FE8 A;  1IH0 A;  5HL1 A;  1ALV A;  2LLS A;  1SR6 C;  3H4S E;  3PM2 A;  1QX5 B;  4M2P A;  1G8I A;  1JBA A;  4NDD A;  3IQQ A;  2V53 A;  4HRH A;  2L5X B;  5AEQ A;  2F33 A;  3CZ1 A;  1CNP A;  3LK0 A;  2SAS A;  1SY9 A;  3EK7 A;  1RWY A;  1CDL A;  1DQE A;  3CZ0 A;  3CYZ A;  3IVT A;  3SJS A;  2KAV A;  4YI9 A;  1B1G A;  3SS4 A;  3SG6 A;  1NX0 A;  2LLU A;  3LLE A;  3BXK A;  3FE6 A;  3IF7 A;  2DOQ A;  1K93 D;  5B8I B;  5CSF A;  1K90 D;  1XVJ A;  1UHI A;  2L98 A;  3OX6 A;  3GK2 A;  3DF0 A;  4HSZ A;  1EXR A;  1DJI A;  1DF0 A;  1S26 D;  3B87 A;  3EK4 A;  1J7P A;  1BR1 B;  1KK8 C;  1EJ3 A;  2M7N A;  3CLN A;  3R1P A;  1CLL A;  4MRX A;  2HQ8 A;  1WRK A;  2K7B A;  1SPY A;  1KSO A;  1QVI Y;  2L2E A;  5F6T A;  1EG3 A;  1XFV O;  3KPX A;  1OZO A;  1Y1U A;  1DJZ A;  2LC5 A;  5HKW A;  2BKI B;  3UNW A;  3TUY C;  4DCK A;  3O4Y A;  1N0Y A;  4JKT A;  4ORA B;  1G33 A;  1ALW A;  2CCM A;  1J7Q A;  4OR9 B;  1J1D A;  1WDC C;  3RM1 A;  3B86 A;  3BOW A;  1NX3 A;  1LS8 A;  2KQY A;  4WRI A;  2LV7 A;  5HKZ A;  3CR4 X;  1M31 A;  4NQG A;  3HCM A;  3PFV A;  2K60 A;  4IJ7 A;  1TIZ A;  1JF0 A;  3CDN A;  3PAL A;  4JD9 A;  3WXA A;  4OVN F;  1SRA A;  1F55 A;  3C1V A;  2CBL A;  2JT3 A;  2CXJ A;  2L50 A;  3BFB A;  3FWB A;  3GK4 X;  1B7T Y;  3ICB A;  3NSO A;  1KFX S;  3DVJ A;  5EL2 A;  1DVI A;  4NDC A;  2E6W A;  3M0W A;  2Q4U A;  1XFX O;  1Y6W A;  2O60 A;  2R2I A;  5CPV A;  1SYM A;  1XFY O;  2LMU A;  4GGF A;  5FI2 A;  5BPJ A;  3JVT C;  3FE9 A;  4XJK B;  1FBV A;  5DKR A;  1CMF A;  1IJ5 A;  2MAZ A;  2JU0 A;  5AFP A;  5IBW A;  2WCJ A;  1NUB A;  4MRY A;  3I5G B;  3KF9 A;  5FYX A;  1KQV A;  1VRK A;  2ZN9 A;  3R1O A;  2LAP A;  3AKA A;  1MHO A;  4INX A;  2BNX A;  1REC A;  1TRF A;  3JTD B;  2BL0 C;  1TUZ A;  1TNQ A;  1QJT A;  1UHH A;  2ERB A;  4N5X A;  2H2K A;  4OV2 A;  1BLQ A;  2Y5I A;  4YI8 A;  3LK1 A;  4PAL A;  4E68 A;  3VRO A;  1F4O A;  2OTG C;  3WNX B;  2KNE A;  1PAL A;  1TCO B;  2OS8 C;  4A4C A;  1QS7 A;  3S0D A;  3NXA A;  1ODB A;  5DKQ A;  1BOC A;  1Y1A A;  2PYQ A;  4TNC A;  4BY5 A;  1DTL A;  2MHH A;  1BG1 A;  1KQM C;  2JPO A;  3BUO B;  1UUR A;  3A8R A;  3OP0 A;  1IJ6 A;  3D0Y A;  2L5Y A;  2KI6 D;  1M45 A;  1SMG A;  2M49 B;  3I5F B;  3CZ2 A;  4P2Y B;  1XFU O;  1S6I A;  4KYN A;  4PE1 A;  4QJ3 B;  1JFJ A;  1A75 A;  3OB2 B;  1F70 A;  1IG5 A;  3I5H B;  1BF5 A;  2AMI A;  2WC6 A;  3BFH A;  4I5K A;  1TNP A;  1Q80 A;  3KO0 A;  3BJH A;  4N1G A;  1L2O C;  4JWQ A;  1YX7 A;  3MSE B;  3O6B A;  4YGA A;  2LLT A;  2WND A;  2KAY A;  1YR5 A;  1IRJ A;  3AKB A;  1NP8 A;  4I5J A;  1UP5 A;  2LNK A;  4HRE E;  1RTP 1;  1K9U A;  4PHJ A;  2JOJ A;  2JZI A;  3WHU B;  3BUX B;  1CMG A;  1QLK A;  1RJV A;  1CDN A;  2M8U A;  3F45 A;  3QME A;  1KFU L;  1QIW A;  2EC6 C;  2MLE C;  2NCP A;  2Y1N A;  1WRL A;  2QEH A;  3CR5 X;  3EG5 B;  4U8D A;  2JUL A;  4ETO A;  1OOF A;  1M63 B;  3UO9 A;  5KSZ A;  3D76 A;  4OCI A;  2AAO A;  4PT1 A;  3S0F A;  1UUS A;  1K94 A;  1RFJ A;  2FJY A;  3PLF B;  4OZD A;  2BCB A;  3O4X A;  3TZ1 A;  1QXP A;  5FI7 A;  1LVC D;  1GM0 A;  2LCP A;  2SCP A;  3VB1 A;  1H4B A;  2JPT A;  3O2P A;  3SG3 A;  3SG2 A;  2JT8 A;  2QEB A;  1SKT A;  1YRT B;  2JTT A;  1DEL A;  2KGR A;  1OMV A;  1GQM A;  3B6X A;  3LCP C;  2I2R E;  4YGB B;  2QEV A;  2Y4Q A;  1K2H A;  4GFT A;  3D73 A;  3FIA A;  4NDB A;  2L4I A;  1B9A A;  1XA5 A;  1OOH A;  1IQ5 A;  1CDP A;  1BJF A;  5HLO A;  2FCE A;  1GGZ A;  2FJU B;  2PQL A;  1FI6 A;  3EVR A;  2QEO A;  1IGV A;  2LE9 B;  5KTY A;  2LMV A;  4BY4 A; 
#chains in the Genus database with same CATH homology
 3VRQ A;  3CTN A;  1DJY A;  1SK6 D;  3VRR A;  1MWN A;  4PHN A;  2K2A A;  1CM4 A;  1XO5 A;  2L51 A;  1NPQ A;  2PAS A;  1EL4 A;  2CTN A;  1QLS A;  3OX5 A;  2MJW B;  1TCF A;  2K0J A;  1BMO A;  4PHM A;  1B8L A;  4GGN A;  1SL7 A;  1YUU A;  2ZND A;  5AAN A;  5TNC A;  2AUC A;  3BYA A;  1CFF A;  2PMY A;  1ZOT B;  2M1K B;  2MLF C;  1TNW A;  3EVU A;  1CDM A;  2K2F A;  2RGI A;  1SR6 B;  2GV5 A;  4ICB A;  1BR4 B;  5DKN A;  1F54 A;  3AAJ A;  2ZNE A;  2F8P A;  2Q91 A;  3SG4 A;  1WLM A;  2WCF A;  1UHN A;  4USL A;  5G08 A;  4ORC B;  3BUW B;  1N65 A;  2KFF A;  4GGF C;  2KI4 C;  1AVS A;  1J1E A;  2EHB A;  1CFP A;  1QV0 A;  1A03 A;  1KCY A;  1TNX A;  2PAL A;  2BKH B;  1PK0 D;  1PUL A;  2BCA A;  2LVI A;  1NIW A;  3KHE A;  2LVJ A;  4MSP A;  2I18 A;  2JWW A;  3FS7 A;  2KAX A;  2H61 A;  5ER5 A;  1K96 A;  1YVH A;  3DVK A;  4MZL A;  1LA0 A;  4QJ4 B;  1PSB A;  1SCM C;  4XJK A;  1F71 A;  1CTR A;  4WQ2 A;  1UHK A;  1U5I B;  1FI5 A;  2M1U A;  1DJW A;  2JTZ A;  5HYD A;  2O5G A;  1SL9 A;  3OB1 B;  1EH2 A;  1CB1 A;  2KYF A;  5HKY A;  4GUK A;  1KFU S;  1YVL A;  1L7Z A;  1DT7 B;  1KWO C;  4MN0 A;  2LUC A;  3TUY B;  3RLZ A;  2LVK A;  1V1F A;  1QV1 A;  2BBN A;  3A4U B;  5ER4 X;  1CLB A;  2L4H A;  1K9K A;  1DJX A;  1S6J A;  1IQ3 A;  4F0Z B;  1JSA A;  1QVI Z;  2KBI A;  3ZNI A;  4P5O E;  1WDC B;  1YTZ C;  4GBA A;  3TS5 C;  2KI6 C;  2D8N A;  2KHN A;  2LP3 A;  3BUM B;  4M2Q A;  1LA3 A;  5D7F A;  1UHJ A;  2OPO A;  1GJY A;  2GGM A;  2KFG A;  2F3Z A;  1NYA A;  1E8A A;  2NCO A;  4DRW A;  2KDH A;  4CID A;  2JQ6 A;  1AHR A;  2M0R A;  2G9B A;  2BCX A;  2COL B;  4GAO A;  5I8N A;  2JNF A;  2NLN A;  4PHK A;  1RK9 A;  4C0K A;  2CNP A;  1S1E A;  2QAC A;  1D1O A;  1EG4 A;  1DGU A;  3JVT B;  1KSM A;  2K7D A;  2F2P A;  5JJG A;  5I2L A;  2ZFD A;  5CSI A;  1FPW A;  4DS7 A;  1R6P A;  2K7C A;  3SG5 A;  2ZRS A;  2HET A;  2M3W A;  1NWD A;  2LVV A;  2NZ0 A;  1MR8 A;  1OMR A;  4Q04 A;  1WRZ A;  1V1G A;  1YUS A;  3PAT A;  1Y1X A;  3TDU A;  1ZUZ A;  1AUI B;  2BE6 A;  4N1F A;  1MF8 B;  1LIN A;  1YRU B;  2BL0 B;  3VRP A;  5D69 A;  2IS9 A;  4MVF A;  1ZMZ A;  2Y1M A;  1B8R A;  1LXF C;  4ORB B;  3PSR A;  2OTG B;  3HX4 A;  1TOP A;  1LKJ A;  1NX1 A;  4L9M A;  2OS8 B;  2WOR A;  2BE4 A;  2HPS A;  1DGV A;  4GPL B;  2JXL A;  1ZFS A;  1PVB A;  1M39 A;  1KQM B;  1CFD A;  3PN7 B;  1JF2 A;  5JOL A;  3LL8 B;  2PRU A;  3SIB A;  2JRF A;  4C0L A;  5I2Q A;  1IKU A;  1QAS A;  3E3R A;  4MEW A;  3CR2 A;  1W7I B;  5PAL A;  3PM8 A;  4M2O A;  2WC8 A;  4QJ5 B;  1NCY A;  4YRU A;  2K61 A;  1L2O B;  5CSJ A;  2K8M B;  2HQW A;  2EGD A;  3GK1 A;  1XK4 A;  2ZRT A;  3CGA A;  4WQ3 A;  4CPV A;  3VRN A;  4DUQ A;  2B1U A;  1FW4 A;  1K95 A;  3I5I B;  1DJG A;  1KK7 Z;  1PVA A;  2LHL A;  1H8B A;  1SNL A;  2FCD A;  4FTG A;  2EC6 B;  4YGD B;  1A4P A;  1MXL C;  2BEC A;  2FOT A;  2KYC A;  5HLV A;  2G2B A;  1OQP A;  2KSP A;  1BT6 A;  2MA2 A;  1S5G Z;  3AAK A;  1B8C A;  1WLZ A;  2KQ6 A;  3EKH A;  2H61 C;  2JXC A;  2JNX A;  3OHM B;  1B4C A;  1WY9 A;  2ZKM X;  4PE7 A;  4DIR A;  1YUR A;  2F3Y A;  3DF0 B;  2LP2 A;  2TN4 A;  1DF0 B;  4C0J A;  1A29 A;  4XYN A;  3GOF A;  3I5G C;  2NXQ A;  4R1E A;  4CFR A;  4YBH B;  1OE9 B;  2P6B B;  3QRX A;  1S6C A;  4MZJ A;  3TDI A;  1DJH A;  1YUT A;  1J7O A;  3JTD C;  5CSN A;  2L0P A;  1TTX A;  3K21 A;  2CT9 A;  2JT0 A;  2KFH A;  1QAT A;  3NSK A;  1IWQ A;  4MBE A;  1A2X A;  1U5I A;  1KK8 B;  2VRG A;  1QTX A;  1UWO A;  1PSR A;  1X02 A;  1NCZ A;  1BOD A;  2HF5 A;  1M46 A;  3BQ3 A;  4JQ0 D;  1SBJ A;  2LMT A;  3BOW B;  5J3X A;  2GGZ A;  1S3P A;  2M97 A;  1YX8 A;  1N2D A;  3CWG A;  2F2O A;  4I5N B;  1HT9 A;  1SW8 A;  2ZN8 A;  3I5F C;  1FF1 A;  2LUX A;  2E30 A;  1J7R A;  1MUX A;  1OOJ A;  1SCV A;  4JPZ B;  2MBX A;  3I5H C;  2PSR A;  2M29 A;  3KEV A;  3EVV A;  1C07 A;  1Y0V H;  3DVM A;  2QPT A;  1MQ1 A;  4HRG A;  4PE0 A;  1G4Y R;  1K9P A;  5GQQ C;  3BUN B;  1F4Q A;  1RRO A;  4MZK A;  1MXE A;  2KOT A;  3TDZ A;  2KI4 B;  2JC2 A;  2WCB A;  3WHT B;  2I94 A;  1CKK A;  1C7V A;  2I7A A;  5AXI A;  3CZT X;  2ISD A;  3NSL A;  2M9G A;  4PE4 A;  2WOS A;  3NSI A;  4MLW A;  1AJ4 A;  4YGC B;  1AK8 A;  3EK8 A;  1NSH A;  5I2O A;  4AQI A;  1QX7 A;  2KBM A;  3SIA A;  1CLM A;  1SL8 A;  1NCX A;  1SCM B;  1HQV A;  4CFQ A;  4AQJ A;  1JWD A;  4PDZ A;  1OSA A;  1F8H A;  1TN4 A;  2LM5 A;  2MRD A;  1ZAC A;  3DD4 A;  1XFW O;  1JFK A;  1XFZ O;  1GGW A;  1B47 A;  1B7T Z;  1J55 A;  1PRW A;  1QIV A;  1S36 A;  3EKJ A;  3PN7 C;  1DMO A;  2WCE A;  1CM1 A;  1KWO B;  4GNK B;  1CFC A;  1NX2 A;  3O78 A;  5K89 A;  4D1E A;  2M7L A;  2LAN A;  3D0Y B;  2K7O A;  4A4B A;  1OZS A;  3VGO A;  4PCW A;  1KK7 Y;  3FWC A;  1QX2 A;  1XYD A;  1KFX L;  4AOM A;  2A4J A;  1A75 B;  2KGB C;  3SG7 A;  4UPG A;  1JUO A;  3TS5 B;  5AER A;  1AJ5 A;  4I5L B;  4YGE B;  1S5G Y;  2LHI A;  1BU3 A;  4FQO A;  1JC2 A;  3IQO A;  4IL1 A;  1K8U A;  3D10 A;  4CLN A;  5KU1 A;  3I5I C;  1XK4 C;  4OKH A;  4ZCV A;  3CS1 A;  1OMD A;  1R2U A;  3DVE A;  2BBM A;  4ZCU A;  1W7J B;  1C7W A;  1AP4 A;  2PVB A;  1IH0 A;  1ALV A;  2LLS A;  1SR6 C;  3H4S E;  1QX5 B;  4M2P A;  1G8I A;  1JBA A;  4NDD A;  3IQQ A;  2V53 A;  4HRH A;  2L5X B;  5AEQ A;  2F33 A;  1CNP A;  3LK0 A;  2SAS A;  1SY9 A;  3EK7 A;  1RWY A;  1CDL A;  3SJS A;  2KAV A;  4YI9 A;  1B1G A;  3SG6 A;  1NX0 A;  2LLU A;  3LLE A;  3BXK A;  3IF7 A;  2DOQ A;  1K93 D;  5B8I B;  5CSF A;  1K90 D;  1XVJ A;  1UHI A;  2L98 A;  3OX6 A;  3GK2 A;  3DF0 A;  4HSZ A;  1EXR A;  1DJI A;  1DF0 A;  1S26 D;  1J7P A;  3EK4 A;  1BR1 B;  1KK8 C;  1EJ3 A;  2M7N A;  3CLN A;  4MRX A;  1CLL A;  2HQ8 A;  1WRK A;  2K7B A;  1SPY A;  1KSO A;  1QVI Y;  2L2E A;  5F6T A;  1EG3 A;  1XFV O;  3KPX A;  1OZO A;  1Y1U A;  1DJZ A;  2LC5 A;  5HKW A;  2BKI B;  3TUY C;  4DCK A;  3O4Y A;  1N0Y A;  4ORA B;  1G33 A;  1ALW A;  2CCM A;  1J7Q A;  4OR9 B;  1J1D A;  1WDC C;  3RM1 A;  3BOW A;  1NX3 A;  2KQY A;  4WRI A;  2LV7 A;  5HKZ A;  3CR4 X;  1M31 A;  4NQG A;  3HCM A;  3PFV A;  1TIZ A;  1JF0 A;  3WXA A;  3PAL A;  4OVN F;  1SRA A;  1F55 A;  3C1V A;  2CBL A;  2JT3 A;  2CXJ A;  2L50 A;  3GK4 X;  3FWB A;  1B7T Y;  3ICB A;  3NSO A;  1KFX S;  3DVJ A;  1DVI A;  4NDC A;  2E6W A;  3M0W A;  2Q4U A;  1XFX O;  1Y6W A;  2O60 A;  2R2I A;  5CPV A;  1SYM A;  1XFY O;  2LMU A;  4GGF A;  5BPJ A;  3JVT C;  4XJK B;  1FBV A;  5DKR A;  1CMF A;  1IJ5 A;  2MAZ A;  2JU0 A;  5AFP A;  5IBW A;  1NUB A;  4MRY A;  3I5G B;  3KF9 A;  5FYX A;  1KQV A;  1VRK A;  2ZN9 A;  2LAP A;  3AKA A;  1MHO A;  1REC A;  1TRF A;  3JTD B;  2BL0 C;  1UHH A;  1TNQ A;  1QJT A;  4OV2 A;  4N5X A;  2H2K A;  1BLQ A;  2Y5I A;  4YI8 A;  3LK1 A;  4PAL A;  4E68 A;  3VRO A;  1F4O A;  2OTG C;  3WNX B;  2KNE A;  1PAL A;  1TCO B;  2OS8 C;  4A4C A;  1QS7 A;  3NXA A;  1ODB A;  5DKQ A;  1BOC A;  1Y1A A;  4TNC A;  4BY5 A;  1DTL A;  2MHH A;  1BG1 A;  1KQM C;  3BUO B;  1UUR A;  3A8R A;  3OP0 A;  1IJ6 A;  3D0Y A;  2KI6 D;  1M45 A;  1SMG A;  2M49 B;  3I5F B;  4P2Y B;  1XFU O;  1S6I A;  4PE1 A;  4QJ3 B;  1JFJ A;  1F70 A;  1A75 A;  3OB2 B;  1IG5 A;  3I5H B;  1BF5 A;  2AMI A;  4I5K A;  1TNP A;  1Q80 A;  3KO0 A;  4N1G A;  1L2O C;  4JWQ A;  1YX7 A;  3MSE B;  3O6B A;  4YGA A;  2LLT A;  2WND A;  2KAY A;  1YR5 A;  1IRJ A;  3AKB A;  1NP8 A;  4I5J A;  1UP5 A;  2LNK A;  4HRE E;  1RTP 1;  1K9U A;  4PHJ A;  2JOJ A;  2JZI A;  3WHU B;  3BUX B;  1CMG A;  1QLK A;  1RJV A;  1CDN A;  2M8U A;  3F45 A;  1KFU L;  1QIW A;  2EC6 C;  2MLE C;  2NCP A;  2Y1N A;  1WRL A;  3CR5 X;  4U8D A;  3ZWH A;  4ETO A;  2JUL A;  1M63 B;  5KSZ A;  4OCI A;  2AAO A;  1UUS A;  1K94 A;  1RFJ A;  3PLF B;  2BCB A;  3TZ1 A;  1QXP A;  1LVC D;  2LCP A;  2SCP A;  1H4B A;  2JPT A;  3O2P A;  3SG3 A;  3SG2 A;  2JT8 A;  1SKT A;  1YRT B;  2JTT A;  2KGR A;  1OMV A;  1GQM A;  3LCP C;  2I2R E;  4YGB B;  2Y4Q A;  1K2H A;  4GFT A;  3FIA A;  4NDB A;  2L4I A;  1B9A A;  1XA5 A;  1IQ5 A;  1CDP A;  1BJF A;  5HLO A;  2FCE A;  1GGZ A;  2FJU B;  1FI6 A;  3EVR A;  1IGV A;  2LE9 B;  5KTY A;  2LMV A;  4BY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...