3CS1A

Flagellar calcium-binding protein (fcabp) from t. cruzi
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
192
structure length
191
Chain Sequence
SDKDGKKAKDRKEAWERIRQAIPREKTAEAKQRRIELFKKFDKNETGKLYDEVYSGCLEVLKLDEFTSRVRDITKRAFDKSRTLGSKLENKGSEDFVEFLEFRLMLCYIYDFFELTVMFDEIDASGNMLVDEEEFKRAVPKLEAWGAKVEDPAALFKELDKNGTGSVTFDEFAAWASAVKLDADGDPDNVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Membrane Targeting by the Flagellar Calcium-binding Protein (FCaBP), a Myristoylated and Palmitoylated Calcium Sensor in Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Metal binding protein
molecule keywords Flagellar calcium-binding protein
total genus 74
structure length 191
sequence length 192
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cs1A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cs1A02
4CLNA 1G8IA 2MHHA 3ZNIA 2PASA 3HX4A 2LHLA 1TNPA 3TDZA 1KFXS 3E3RA 1BMOA 4WQ3A 3VRRA 1B7TY 1DMOA 1B9AA 1CNPA 2EHBA 2JOJA 1DJXA 2EGDA 3O4YA 1AJ4A 1QLKA 1BG1A 3I5HB 1QVIY 2NCOA 3TS5C 1CLBA 3SG4A 1EJ3A 2JTZA 1QLSA 4WQ2A 2M9GA 3TZ1A 4GUKA 4CPVA 1H4BA 1YURA 4GPLB 3I5GC 2LMUA 2L98A 1QS7A 1XFYO 1UHKA 3A4UB 1K94A 1BF5A 3NSKA 2ZN8A 4NQGA 1K9KA 4YBHB 2M7LA 1X02A 2M8UA 1S5GY 3PSRA 2FOTA 1C07A 4AQJA 2SASA 1IKUA 5AFPA 1QATA 3BUNB 2F2OA 3NSOA 1G4YR 1DT7B 1YR5A 2LLTA 5D69A 4ZCUA 5FYXA 3TUYB 2K7BA 2NCPA 1RK9A 3BUMB 5KSZA 1JFJA 2EC6B 3CR2A 1RECA 4D1EA 2LUCA 2B1UA 1SCMB 4PE7A 4C0KA 2JTTA 1A2XA 2M49B 4FTGA 2LAPA 1LINA 2CNPA 1KFXL 1LKJA 1UHJA 3SG2A 2LLSA 1MUXA 1NX2A 2MRDA 5DKRA 5HKZA 4NDBA 3M0WA 1F4OA 1TTXA 2F2PA 1RJVA 2PALA 3I5FB 1J1EA 4TNCA 1JSAA 2HF5A 5DKQA 2RGIA 4F0ZB 1YRUB 2KYFA 3EK8A 1SPYA 1S36A 2M29A 1RFJA 1B8LA 1NYAA 4CIDA 2M3WA 3OP0A 2IS9A 4HRHA 1W7IB 4NDCA 2PRUA 4GBAA 4QJ3B 1NCYA 1HQVA 3QRXA 4HSZA 5I2LA 2L2EA 4MZKA 3RM1A 3BUOB 4OCIA 2L4HA 5AANA 2LE9B 1G33A 1JUOA 1PULA 1SR6B 1SY9A 1LA3A 1OE9B 3OB1B 1SMGA 3BUWB 4DS7A 2K7DA 5CSIA 1KCYA 2KQYA 1YX8A 1XFZO 1QJTA 4GFTA 2D8NA 1OOJA 3VRQA 1DGVA 3TDUA 2Y1NA 1YX7A 1OZSA 1WRKA 2LC5A 3PN7C 3SJSA 5CPVA 3EK4A 2LP2A 1KWOC 2KBIA 1FW4A 1TN4A 1TNQA 1TNXA 2HPSA 2KDHA 2MLFC 1VRKA 3O78A 2AUCA 2LNKA 4IL1A 4ETOA 4QJ4B 2KFHA 3CR4X 1PK0D 3GK4X 2K7CA 2K0JA 3VROA 4A4BA 1SCVA 1XFUO 1KQMB 3IQOA 1FBVA 3CZTX 3MSEB 2PVBA 2KAVA 1AJ5A 4FQOA 1IRJA 3CLNA 5KTYA 1SL7A 4DRWA 1TIZA 2KI4C 1XFXO 1K8UA 2OS8C 3PLFB 2KNEA 1BT6A 1DJZA 1C7VA 1WRZA 1K90D 4I5KA 1TCOB 1PSRA 3LL8B 4C0LA 1OSAA 4ORCB 4HREE 2SCPA 1NX0A 2LVIA 1XA5A 1EH2A 2MJWB 5TNCA 4CFQA 1KFUS 1QVIZ 1EL4A 2BKIB 5G08A 3ZWHA 3LCPC 2LHIA 1S1EA 3D0YB 2Y5IA 4YGEB 3NXAA 4QJ5B 1NX1A 2LANA 2L50A 3SG3A 4CFRA 4ICBA 3EK7A 1M63B 5D7FA 3AKAA 2BCBA 1SL9A 4OVNF 2GGMA 5CSFA 5JOLA 3KEVA 3I5HC 3AKBA 5HKWA 1F8HA 2KGRA 5JJGA 1JC2A 4MZLA 2FCEA 3NSLA 5IBWA 3OB2B 3PM8A 2JQ6A 3AAKA 1NSHA 1U5IB 2LVJA 4PE1A 2L4IA 1ALVA 1OQPA 2F3YA 4R1EA 1S26D 1A4PA 2BL0B 1LA0A 4M2PA 1RWYA 1PVBA 2LV7A 1BOCA 2KI6C 3C1VA 1XFVO 1F71A 1CB1A 1OMDA 4YGDB 2PMYA 5ER5A 1QV1A 3OX5A 2Y4QA 1PSBA 1DVIA 1A75A 1XVJA 2MA2A 3ICBA 2KOTA 2KAYA 2F33A 4U8DA 2CBLA 1KFUL 2K2FA 2ZKMX 4UPGA 1FI5A 1DJHA 1B1GA 1TOPA 1SYMA 3CGAA 4PDZA 3I5IC 1KK8B 1Y0VH 4PE4A 1QV0A 2HQ8A 2BL0C 1Y1AA 4PCWA 5I8NA 1Q80A 2WNDA 1CDPA 3BOWA 3EVVA 1CMFA 3DVEA 1DJWA 2I7AA 1N65A 2MBXA 1K2HA 2M1KB 4P5OE 5ER4X 1ZACA 1AVSA 1KQVA 1QXPA 1BODA 2BCXA 1JBAA 2K7OA 2A4JA 2EC6C 1C7WA 1DJYA 1KK7Y 2AAOA 3RLZA 1U5IA 2BKHB 3JTDB 2O5GA 2DOQA 1W7JB 3SG5A 4PHMA 1ODBA 2R2IA 1WLMA 2JULA 2HQWA 2JWWA 3DVJA 2BE6A 3VGOA 2L51A 4DIRA 3IQQA 2WCEA 4OKHA 4M2OA 2Q4UA 1M45A 1SK6D 2JT0A 1S3PA 3KF9A 5B8IB 1IH0A 2P6BB 1B8CA 1BR1B 1WLZA 1Y1UA 2GGZA 1L7ZA 1B8RA 3GOFA 1KWOB 3FIAA 1YUSA 1J7QA 1SBJA 2KQ6A 4GGFA 4WRIA 1KK8C 3A8RA 4DUQA 4N1GA 1NUBA 2M97A 4YGCB 2FJUB 2QPTA 1EG3A 1IQ3A 1CLLA 5CSJA 1DJIA 1IGVA 1E8AA 1EXRA 1YVHA 1F70A 5F6TA 3PATA 4MRYA 1OMRA 1UHIA 1PRWA 1DGUA 1OZOA 2NXQA 1PVAA 1AHRA 1MR8A 1SCMC 1FI6A 1UUSA 1BR4B 1S5GZ 2JPTA 2GV5A 2LUXA 4NDDA 1SR6C 1FPWA 2LMVA 2FCDA 1JFKA 1ZMZA 2JT8A 2WC8A 1YUTA 4A4CA 4PHNA 4N5XA 5DKNA 1SKTA 1R2UA 4OV2A 1SNLA 3NSIA 4ORBB 3K21A 2Y1MA 2L5XB 3DD4A 1CDLA 3EVUA 1PALA 3H4SE 4YRUA 1GGZA 2ZRTA 2CTNA 3TDIA 3TS5B 1CM1A 1AP4A 2JRFA 1S6CA 2BBMA 3JTDC 2BCAA 4MLWA 1ZOTB 1F4QA 3CS1A 5K89A 3JVTB 3SG7A 4ZCVA 4N1FA 3I5IB 3WNXB 3FWBA 1Y1XA 4JPZB 2CXJA 4PHKA 5PALA 1TRFA 5AXIA 2KAXA 4USLA 2G2BA 4XJKB 1GJYA 1IG5A 1UURA 1NCXA 3EVRA 1MXLC 3PFVA 2JT3A 2I2RE 4C0JA 2WOSA 1GQMA 2JNXA 2WCBA 5I2QA 1UHNA 2HETA 4MEWA 2BBNA 1KSMA 1M46A 2KI4B 1XFWO 4YGAA 1QX2A 4OR9B 4JQ0D 3FWCA 2KFGA 1SW8A 2KBMA 5CSNA 1YUUA 1HT9A 1J7PA 2VRGA 2I18A 2ISDA 3SIBA 1DF0B 2G9BA 1CKKA 2F8PA 1MF8B 5GQQC 2LMTA 2E6WA 1AUIB 1QX7A 1SRAA 2LCPA 3TUYC 1IWQA 1MHOA 1F54A 1L2OB 1TCFA 2F3ZA 1CFPA 2COLB 4PALA 3BXKA 1CMGA 1NCZA 1CM4A 2WORA 4MN0A 2ZN9A 1EG4A 2K2AA 2M1UA 1V1FA 2NLNA 1B4CA 2LP3A 2KI6D 4XJKA 3F45A 4AOMA 1CDMA 1RTP1 1N2DA 3O6BA 1CTRA 1MQ1A 3GK1A 4DCKA 1GGWA 1NX3A 4I5JA 3KO0A 1M31A 3DF0B 3PN7B 1ZFSA 3KHEA 4MVFA 1N0YA 3I5GB 1CDNA 1B47A 2BE4A 4L9MA 3WXAA 2MAZA 3HCMA 5HKYA 1DF0A 3GK2A 1NP8A 2I94A 1JF0A 1FF1A 1K95A 4MBEA 2JXCA 1UWOA 4PHJA 1MWNA 4AQIA 2JNFA 1DTLA 2OTGB 1DJGA 1KQMC 1ALWA 1R6PA 1XYDA 3SG6A 1S6JA 1XO5A 4PE0A 3DVMA 3VRNA 1IJ5A 3LK0A 1B7TZ 1IJ6A 4ORAB 1D1OA 2OS8B 1SL8A 2KGBC 1J55A 2ZNEA 3VRPA 3I5FC 3IF7A 3CR5X 1NPQA 3O2PA 2NZ0A 2L0PA 2ZRSA 3CTNA 2JZIA 1L2OC 3BUXB 3D0YA 3BQ3A 1JF2A 3KPXA 1CFCA 2LLUA 1J1DA 1F55A 5HLVA 2OPOA 1ZUZA 2MLEC 1S6IA 1QX5B 1WDCB 3D10A 1H8BA 2CCMA 1K9UA 1K93D 1A03A 5AERA 1K9PA 2M0RA 4Q04A 2K8MB 4GGNA 2LVVA 4P2YB 3FS7A 1WRLA 2KHNA 4YGBB 5J3XA 2LVKA 2ZFDA 1UP5A 5HYDA 4JWQA 3SIAA 3OX6A 4M2QA 3DF0A 1OMVA 2M7NA 4BY4A 4MRXA 5HLOA 4GNKB 2KSPA 1XK4A 2K61A 2ZNDA 1TNWA 1QASA 1KSOA 1NWDA 2H61A 1MXEA 4YI9A 2JU0A 1A75B 1CFFA 4I5NB 2KYCA 4GAOA 2JXLA 1YVLA 3AAJA 4E68A 1CLMA 1M39A 1BJFA 2JC2A 3EKHA 2H2KA 3LK1A 3WHUB 3WHTB 3BOWB 2O60A 1CFDA 2BECA 1RROA 1J7RA 1QTXA 2V53A 2H61C 5AEQA 3PALA 1K96A 1AK8A 1XK4C 1KK7Z 4XYNA 5BPJA 1YRTB 3BYAA 1QIWA 3OHMB 1WDCC 2TN4A 5I2OA 3DVKA 3JVTC 2E30A 3CWGA 1LVCD 2KFFA 1NIWA 2PSRA 1V1GA 2AMIA 2LM5A 4HRGA 3EKJA 4YI8A 4BY5A 1BLQA 4MZJA 4MSPA 1A29A 2CT9A 1UHHA 2Q91A 4GGFC 2WCFA 1Y6WA 4I5LB 1YTZC 2OTGC 1WY9A 1J7OA 1BU3A 1QIVA 5KU1A 1IQ5A 3LLEA 1LXFC 2QACA 1JWDA
chains in the Genus database with same CATH superfamily
5FI7A 2L2CA 4CLNA 1G8IA 2MHHA 3ZNIA 2PASA 3HX4A 2LHLA 1TNPA 5FI2A 3TDZA 1KFXS 3E3RA 1BMOA 4WQ3A 3VRRA 1B7TY 1DMOA 1B9AA 1CNPA 2EHBA 2QEVA 2JOJA 1DJXA 2EGDA 3EG5B 3O4YA 1OOIX 2WCLA 1AJ4A 3CZ1A 2K60A 1QLKA 3L4LA 1BG1A 3I5HB 1QVIY 2NCOA 3TS5C 5HL1A 1CLBA 3SG4A 1EJ3A 3SS3A 2JTZA 1QLSA 1P28A 4WQ2A 2M9GA 3TZ1A 3FE9A 4GUKA 4CPVA 5D3OA 1H4BA 1YURA 3D76A 4GPLB 3I5GC 2LMUA 1DELA 2L98A 1QS7A 1XFYO 1UHKA 3A4UB 1K94A 1BF5A 3NSKA 2ZN8A 4NQGA 1K9KA 4YBHB 2M7LA 1X02A 2M8UA 1S5GY 3PSRA 2FOTA 1C07A 4AQJA 2SASA 3CABA 1IKUA 5AFPA 1QATA 3BUNB 2F2OA 3NSOA 1G4YR 1DT7B 1YR5A 2LLTA 5D69A 4ZCUA 5FYXA 3TUYB 2K7BA 2NCPA 1RK9A 3BUMB 5KSZA 1JFJA 2EC6B 3CR2A 1RECA 4D1EA 2LUCA 1OOFA 2B1UA 1SCMB 4PE7A 4C0KA 2JTTA 1A2XA 2M49B 3CZ2A 2LAPA 1LINA 3R72A 4FTGA 2CNPA 1KFXL 1LKJA 1UHJA 3SG2A 2LLSA 1MUXA 1NX2A 2MRDA 5DKRA 5HKZA 4NDBA 3M0WA 1F4OA 1TTXA 2F2PA 1RJVA 2PALA 3I5FB 2QEBA 4OZDA 3PM2A 3L4AA 1J1EA 3SS4A 4TNCA 1JSAA 2HF5A 5DKQA 2RGIA 4F0ZB 1YRUB 2KYFA 3EK8A 1SPYA 1S36A 2M29A 1RFJA 1B8LA 1NYAA 4CIDA 2M3WA 3OP0A 2IS9A 4HRHA 1W7IB 4NDCA 2WCMA 2PRUA 3CZ0A 4GBAA 4QJ3B 1NCYA 1HQVA 3QRXA 4HSZA 5I2LA 2L2EA 3V2LA 4MZKA 3RM1A 3BUOB 4OCIA 2L4HA 1TUJA 5AANA 2LE9B 1G33A 1JUOA 1PULA 1SR6B 1SY9A 1LA3A 1OE9B 2P70A 3OB1B 3DXLA 2WC6A 1SMGA 3BUWB 4DS7A 2K7DA 5CSIA 1KCYA 2KQYA 1YX8A 1XFZO 1QJTA 4GFTA 2D8NA 1OOJA 3VRQA 1DGVA 3TDUA 2Y1NA 1YX7A 1OZSA 1WRKA 4PT1A 2LC5A 3PN7C 3SJSA 5CPVA 1Z4HA 3EK4A 2LP2A 1KWOC 2KBIA 1FW4A 1GM0A 1TN4A 1TNQA 1TNXA 2QEOA 2HPSA 2KDHA 2MLFC 3S0AA 1VRKA 3FE6A 3O78A 1OOHA 2AUCA 2LNKA 4IL1A 4ETOA 4QJ4B 3NHTA 2KFHA 3CR4X 1PK0D 3GK4X 2K7CA 2K0JA 3VROA 4A4BA 1SCVA 1XFUO 1KQMB 3IQOA 1FBVA 3CZTX 3MSEB 2PVBA 4JKTA 2KAVA 1AJ5A 3R1OA 1IRJA 3CLNA 4FQOA 1SL7A 4DRWA 5KTYA 1TIZA 2KI4C 1XFXO 1K8UA 2OS8C 2PYQA 2KNEA 3D78A 3PLFB 1BT6A 1DJZA 1C7VA 1WRZA 5DICA 1K90D 4I5KA 1TCOB 1PSRA 3LL8B 2KLEA 4C0LA 1OSAA 4INXA 4ORCB 4HREE 2SCPA 1NX0A 2LVIA 1XA5A 1EH2A 2MJWB 5TNCA 4CFQA 1KFUS 1QVIZ 1EL4A 2BKIB 5G08A 3ZWHA 3LCPC 2LHIA 1S1EA 3D0YB 2Y5IA 4YGEB 3NXAA 4QJ5B 1NX1A 2LANA 2L50A 3SG3A 2KLDA 4CFRA 4ICBA 3EK7A 1M63B 5D7FA 3AKAA 2BCBA 1SL9A 4OVNF 2GGMA 5CSFA 5JOLA 3KEVA 3I5HC 3AKBA 5HKWA 1F8HA 2KGRA 5JJGA 1JC2A 4MZLA 2FCEA 3NSLA 5IBWA 3OB2B 3PM8A 2JQ6A 3AAKA 1NSHA 1U5IB 2LVJA 4PE1A 2L4IA 1ALVA 1OQPA 2F3YA 4R1EA 1S26D 1A4PA 2BL0B 5EL2A 1LA0A 3SS5A 3S0DA 4M2PA 1RWYA 1PVBA 2LV7A 1BOCA 2KI6C 3C1VA 1XFVO 3D75A 3UNWA 1F71A 1CB1A 1OMDA 4YGDB 2PMYA 5ER5A 1QV1A 3OX5A 2Y4QA 3PJIA 1PSBA 1DVIA 1A75A 1XVJA 2MA2A 3ICBA 2KOTA 2KAYA 2F33A 4U8DA 2CBLA 1KFUL 4JD9A 2K2FA 2ZKMX 4UPGA 1FI5A 2BNXA 1DJHA 1B1GA 1TOPA 1SYMA 3CGAA 4PDZA 3I5IC 1KK8B 1Y0VH 4PE4A 1QV0A 2HQ8A 2BL0C 1Y1AA 4PCWA 5I8NA 1Q80A 2WNDA 1CDPA 3BOWA 3EVVA 1CMFA 3DVEA 1DJWA 2I7AA 1N65A 2MBXA 1K2HA 2M1KB 4P5OE 5ER4X 1ZACA 2KPHA 1AVSA 1KQVA 1QXPA 1BODA 2BCXA 1JBAA 2K7OA 2A4JA 2EC6C 1C7WA 1DJYA 1KK7Y 2AAOA 2L5YA 3RLZA 1U5IA 2BKHB 3JTDB 2O5GA 2DOQA 3DY9A 1W7JB 3SG5A 3CDNA 4PHMA 3QMEA 1ODBA 2R2IA 1WLMA 2JULA 2HQWA 2JWWA 3DVJA 3R1VA 2BE6A 3VGOA 2L51A 4INWA 4DIRA 3D74A 3IQQA 2WCEA 1OOGA 4OKHA 4M2OA 2Q4UA 1M45A 1SK6D 2JT0A 1S3PA 3KF9A 5B8IB 1IH0A 2P6BB 1B8CA 5I94A 1BR1B 1WLZA 1Y1UA 3O4XA 2GGZA 2WCHA 1L7ZA 1OW4A 1B8RA 3BFBA 3GOFA 1KWOB 3FIAA 1YUSA 1J7QA 1SBJA 2KQ6A 4GGFA 4WRIA 4IJ7A 1KK8C 3A8RA 4DUQA 4N1GA 1NUBA 2M97A 2QDIA 2JPOA 4YGCB 2FJUB 2QPTA 1EG3A 1IQ3A 1CLLA 5CSJA 1DJIA 1IGVA 1E8AA 1EXRA 1YVHA 1F70A 5F6TA 3NHIA 3PATA 4MRYA 1OMRA 1UHIA 1PRWA 1DGUA 1OZOA 2NXQA 1PVAA 1AHRA 1MR8A 1SCMC 1FI6A 2FJYA 1UUSA 1BR4B 1S5GZ 2JPTA 2GV5A 2LUXA 4NDDA 1SR6C 1FPWA 2LMVA 2FCDA 1JFKA 1ZMZA 2JT8A 2WC8A 2QEHA 1YUTA 3S0EA 4A4CA 4PHNA 4KYNA 1IIOA 3IVTA 4N5XA 1SKTA 1R2UA 4OV2A 5DKNA 1SNLA 2ERBA 3NSIA 4ORBB 3K21A 2Y1MA 2L5XB 3DD4A 1CDLA 3EVUA 1PALA 3H4SE 4YRUA 1GGZA 2ZRTA 2CTNA 3TDIA 3TS5B 1CM1A 1AP4A 2JRFA 3CYZA 1S6CA 2BBMA 3JTDC 2BCAA 4MLWA 1XFRA 1ZOTB 3R1PA 1F4QA 3CS1A 5K89A 3JVTB 3SG7A 1T14A 4ZCVA 4N1FA 3I5IB 3WNXB 3FWBA 1Y1XA 4JPZB 2CXJA 4PHKA 5PALA 3S0FA 1TRFA 5AXIA 2KAXA 4USLA 1C3ZA 2G2BA 4XJKB 1GJYA 1IG5A 2P71A 1UURA 1NCXA 3B6XA 1MXLC 3EVRA 3PFVA 1DQEA 2JT3A 3Q8IA 2I2RE 4C0JA 2WC5A 2WOSA 1GQMA 2JNXA 2WCBA 5I2QA 1LS8A 1UHNA 2HETA 4MEWA 2BBNA 1KSMA 1QWVA 1M46A 2KI4B 1XFWO 4YGAA 1C3YA 1QX2A 4OR9B 4JQ0D 2WCJA 3FWCA 2KFGA 1SW8A 2KBMA 5CSNA 1YUUA 1DC1A 3RZSA 1HT9A 1J7PA 2GTEA 2VRGA 2I18A 3S0GA 2ISDA 3SIBA 1DF0B 2G9BA 1CKKA 2F8PA 1MF8B 5GQQC 2LMTA 2E6WA 1AUIB 1QX7A 1SRAA 2LCPA 3TUYC 1IWQA 1MHOA 1F54A 1L2OB 1TCFA 2F3ZA 1CFPA 2COLB 4PALA 3BXKA 1CMGA 1NCZA 1CM4A 2WORA 4MN0A 2ZN9A 1EG4A 3BJHA 2K2AA 3NGVA 2M1UA 3VB1A 1V1FA 3S0BA 2NLNA 3B7AA 1B4CA 2LP3A 3DYEA 2KI6D 4XJKA 3F45A 4AOMA 1CDMA 1RTP1 1N2DA 3O6BA 1CTRA 1MQ1A 3GK1A 4DCKA 1GGWA 1NX3A 4I5JA 3KO0A 1SSEB 1M31A 3DF0B 3PN7B 1ZFSA 3KHEA 4MVFA 1N0YA 1W9ZA 2PQLA 3I5GB 1CDNA 1B47A 1DEKA 2BE4A 4L9MA 3WXAA 2MAZA 3HCMA 5HKYA 1DF0A 3GK2A 1NP8A 2I94A 3L47A 1JF0A 1FF1A 4F7FA 1K95A 4MBEA 2JXCA 3D77A 1UWOA 4PHJA 3UO9A 3N7HA 1MWNA 4AQIA 2JNFA 1DTLA 2OTGB 1DJGA 1KQMC 1ALWA 1R6PA 3BFAA 1XYDA 3SG6A 1S6JA 1XO5A 2H8VA 4PE0A 3DVMA 3VRNA 1IJ5A 3LK0A 1B7TZ 1IJ6A 4ORAB 1D1OA 2OS8B 1SL8A 2KGBC 1J55A 3OGNA 2ZNEA 3VRPA 3I5FC 3IF7A 3CR5X 1NPQA 3O2PA 2NZ0A 2L0PA 2ZRSA 3B87A 1ORGA 3CTNA 2JZIA 1L2OC 3BUXB 3D0YA 3K1EA 3BQ3A 1JF2A 3KPXA 1CFCA 2LLUA 1J1DA 1F55A 2YGUA 5HLVA 2OPOA 1ZUZA 2MLEC 3OBVA 1S6IA 1QX5B 1WDCB 3D10A 1H8BA 2CCMA 1K9UA 3B88A 1K93D 1A03A 5AERA 1K9PA 3BFHA 2M0RA 4Q04A 2K8MB 4GGNA 2BAPA 2LVVA 4P2YB 3FS7A 1WRLA 2KHNA 4YGBB 5J3XA 5FI6A 2LVKA 2ZFDA 1UP5A 5HYDA 4JWQA 3SIAA 2WCKA 3OX6A 4M2QA 1TWOA 1TUZA 4FQTA 3DF0A 1OMVA 2M7NA 3FE8A 4BY4A 4MRXA 5HLOA 4GNKB 2KSPA 3B86A 1XK4A 2K61A 2ZNDA 1TNWA 1QASA 1KSOA 1NWDA 2H61A 1MXEA 4YI9A 2JU0A 1A75B 1CFFA 4I5NB 1Z2CB 2KYCA 3D73A 2JXLA 1YVLA 3AAJA 4GAOA 4E68A 1CLMA 1M39A 1BJFA 2JC2A 3EKHA 2H2KA 3LK1A 3WHUB 3WHTB 3BOWB 2O60A 1CFDA 2BECA 1RROA 1J7RA 1QTXA 2V53A 2H61C 5AEQA 3PALA 1K96A 1AK8A 1XK4C 1KK7Z 4XYNA 5BPJA 1YRTB 3BYAA 1QIWA 3OHMB 1WDCC 2TN4A 5I2OA 3DVKA 3JVTC 2E30A 3CWGA 1LVCD 2KFFA 1NIWA 2PSRA 1V1GA 2AMIA 2LM5A 4HRGA 3EKJA 4YI8A 4BY5A 1BLQA 4MZJA 4MSPA 1A29A 2CT9A 1UHHA 2Q91A 4GGFC 2WCFA 1Y6WA 4I5LB 1YTZC 3DZTA 2OTGC 1WY9A 1J7OA 1BU3A 1QIVA 5KU1A 1IQ5A 3LLEA 1LXFC 2QACA 1JWDA
chains in the Genus database with same CATH topology
4CLNA 1G8IA 2MHHA 3ZNIA 2PASA 3HX4A 2LHLA 1TNPA 3TDZA 1KFXS 3E3RA 1BMOA 4WQ3A 3VRRA 1B7TY 1DMOA 1B9AA 1CNPA 2EHBA 2JOJA 1DJXA 2EGDA 3O4YA 1AJ4A 1QLKA 1BG1A 3I5HB 1QVIY 2NCOA 3TS5C 1CLBA 3SG4A 1EJ3A 2JTZA 1QLSA 4WQ2A 2M9GA 3TZ1A 4GUKA 4CPVA 1H4BA 1YURA 4GPLB 3I5GC 2LMUA 2L98A 1QS7A 1XFYO 1UHKA 3A4UB 1K94A 1BF5A 3NSKA 2ZN8A 4NQGA 1K9KA 4YBHB 2M7LA 1X02A 2M8UA 1S5GY 3PSRA 2FOTA 1C07A 4AQJA 2SASA 1IKUA 5AFPA 1QATA 3BUNB 2F2OA 3NSOA 1G4YR 1DT7B 1YR5A 2LLTA 5D69A 4ZCUA 5FYXA 3TUYB 2K7BA 2NCPA 1RK9A 3BUMB 5KSZA 1JFJA 2EC6B 3CR2A 1RECA 4D1EA 2LUCA 2B1UA 1SCMB 4PE7A 4C0KA 2JTTA 1A2XA 2M49B 4FTGA 2LAPA 1LINA 2CNPA 1KFXL 1LKJA 1UHJA 3SG2A 2LLSA 1MUXA 1NX2A 2MRDA 5DKRA 5HKZA 4NDBA 3M0WA 1F4OA 1TTXA 2F2PA 1RJVA 2PALA 3I5FB 1J1EA 4TNCA 1JSAA 2HF5A 5DKQA 2RGIA 4F0ZB 1YRUB 2KYFA 3EK8A 1SPYA 1S36A 2M29A 1RFJA 1B8LA 1NYAA 4CIDA 2M3WA 3OP0A 2IS9A 4HRHA 1W7IB 4NDCA 2PRUA 4GBAA 4QJ3B 1NCYA 1HQVA 3QRXA 4HSZA 5I2LA 2L2EA 4MZKA 3RM1A 3BUOB 4OCIA 2L4HA 5AANA 2LE9B 1G33A 1JUOA 1PULA 1SR6B 1SY9A 1LA3A 1OE9B 3OB1B 1SMGA 3BUWB 4DS7A 2K7DA 5CSIA 1KCYA 2KQYA 1YX8A 1XFZO 1QJTA 4GFTA 2D8NA 1OOJA 3VRQA 1DGVA 3TDUA 2Y1NA 1YX7A 1OZSA 1WRKA 2LC5A 3PN7C 3SJSA 5CPVA 3EK4A 2LP2A 1KWOC 2KBIA 1FW4A 1TN4A 1TNQA 1TNXA 2HPSA 2KDHA 2MLFC 1VRKA 3O78A 2AUCA 2LNKA 4IL1A 4ETOA 4QJ4B 2KFHA 3CR4X 1PK0D 3GK4X 2K7CA 2K0JA 3VROA 4A4BA 1SCVA 1XFUO 1KQMB 3IQOA 1FBVA 3CZTX 3MSEB 2PVBA 2KAVA 1AJ5A 4FQOA 1IRJA 3CLNA 5KTYA 1SL7A 4DRWA 1TIZA 2KI4C 1XFXO 1K8UA 2OS8C 3PLFB 2KNEA 1BT6A 1DJZA 1C7VA 1WRZA 1K90D 4I5KA 1TCOB 1PSRA 3LL8B 4C0LA 1OSAA 4ORCB 4HREE 2SCPA 1NX0A 2LVIA 1XA5A 1EH2A 2MJWB 5TNCA 4CFQA 1KFUS 1QVIZ 1EL4A 2BKIB 5G08A 3ZWHA 3LCPC 2LHIA 1S1EA 3D0YB 2Y5IA 4YGEB 3NXAA 4QJ5B 1NX1A 2LANA 2L50A 3SG3A 4CFRA 4ICBA 3EK7A 1M63B 5D7FA 3AKAA 2BCBA 1SL9A 4OVNF 2GGMA 5CSFA 5JOLA 3KEVA 3I5HC 3AKBA 5HKWA 1F8HA 2KGRA 5JJGA 1JC2A 4MZLA 2FCEA 3NSLA 5IBWA 3OB2B 3PM8A 2JQ6A 3AAKA 1NSHA 1U5IB 2LVJA 4PE1A 2L4IA 1ALVA 1OQPA 2F3YA 4R1EA 1S26D 1A4PA 2BL0B 1LA0A 4M2PA 1RWYA 1PVBA 2LV7A 1BOCA 2KI6C 3C1VA 1XFVO 1F71A 1CB1A 1OMDA 4YGDB 2PMYA 5ER5A 1QV1A 3OX5A 2Y4QA 1PSBA 1DVIA 1A75A 1XVJA 2MA2A 3ICBA 2KOTA 2KAYA 2F33A 4U8DA 2CBLA 1KFUL 2K2FA 2ZKMX 4UPGA 1FI5A 1DJHA 1B1GA 1TOPA 1SYMA 3CGAA 4PDZA 3I5IC 1KK8B 1Y0VH 4PE4A 1QV0A 2HQ8A 2BL0C 1Y1AA 4PCWA 5I8NA 1Q80A 2WNDA 1CDPA 3BOWA 3EVVA 1CMFA 3DVEA 1DJWA 2I7AA 1N65A 2MBXA 1K2HA 2M1KB 4P5OE 5ER4X 1ZACA 1AVSA 1KQVA 1QXPA 1BODA 2BCXA 1JBAA 2K7OA 2A4JA 2EC6C 1C7WA 1DJYA 1KK7Y 2AAOA 3RLZA 1U5IA 2BKHB 3JTDB 2O5GA 2DOQA 1W7JB 3SG5A 4PHMA 1ODBA 2R2IA 1WLMA 2JULA 2HQWA 2JWWA 3DVJA 2BE6A 3VGOA 2L51A 4DIRA 3IQQA 2WCEA 4OKHA 4M2OA 2Q4UA 1M45A 1SK6D 2JT0A 1S3PA 3KF9A 5B8IB 1IH0A 2P6BB 1B8CA 1BR1B 1WLZA 1Y1UA 2GGZA 1L7ZA 1B8RA 3GOFA 1KWOB 3FIAA 1YUSA 1J7QA 1SBJA 2KQ6A 4GGFA 4WRIA 1KK8C 3A8RA 4DUQA 4N1GA 1NUBA 2M97A 4YGCB 2FJUB 2QPTA 1EG3A 1IQ3A 1CLLA 5CSJA 1DJIA 1IGVA 1E8AA 1EXRA 1YVHA 1F70A 5F6TA 3PATA 4MRYA 1OMRA 1UHIA 1PRWA 1DGUA 1OZOA 2NXQA 1PVAA 1AHRA 1MR8A 1SCMC 1FI6A 1UUSA 1BR4B 1S5GZ 2JPTA 2GV5A 2LUXA 4NDDA 1SR6C 1FPWA 2LMVA 2FCDA 1JFKA 1ZMZA 2JT8A 2WC8A 1YUTA 4A4CA 4PHNA 4N5XA 5DKNA 1SKTA 1R2UA 4OV2A 1SNLA 3NSIA 4ORBB 3K21A 2Y1MA 2L5XB 3DD4A 1CDLA 3EVUA 1PALA 3H4SE 4YRUA 1GGZA 2ZRTA 2CTNA 3TDIA 3TS5B 1CM1A 1AP4A 2JRFA 1S6CA 2BBMA 3JTDC 2BCAA 4MLWA 1ZOTB 1F4QA 3CS1A 5K89A 3JVTB 3SG7A 4ZCVA 4N1FA 3I5IB 3WNXB 3FWBA 1Y1XA 4JPZB 2CXJA 4PHKA 5PALA 1TRFA 5AXIA 2KAXA 4USLA 2G2BA 4XJKB 1GJYA 1IG5A 1UURA 1NCXA 3EVRA 1MXLC 3PFVA 2JT3A 2I2RE 4C0JA 2WOSA 1GQMA 2JNXA 2WCBA 5I2QA 1UHNA 2HETA 4MEWA 2BBNA 1KSMA 1M46A 2KI4B 1XFWO 4YGAA 1QX2A 4OR9B 4JQ0D 3FWCA 2KFGA 1SW8A 2KBMA 5CSNA 1YUUA 1HT9A 1J7PA 2VRGA 2I18A 2ISDA 3SIBA 1DF0B 2G9BA 1CKKA 2F8PA 1MF8B 5GQQC 2LMTA 2E6WA 1AUIB 1QX7A 1SRAA 2LCPA 3TUYC 1IWQA 1MHOA 1F54A 1L2OB 1TCFA 2F3ZA 1CFPA 2COLB 4PALA 3BXKA 1CMGA 1NCZA 1CM4A 2WORA 4MN0A 2ZN9A 1EG4A 2K2AA 2M1UA 1V1FA 2NLNA 1B4CA 2LP3A 2KI6D 4XJKA 3F45A 4AOMA 1CDMA 1RTP1 1N2DA 3O6BA 1CTRA 1MQ1A 3GK1A 4DCKA 1GGWA 1NX3A 4I5JA 3KO0A 1M31A 3DF0B 3PN7B 1ZFSA 3KHEA 4MVFA 1N0YA 3I5GB 1CDNA 1B47A 2BE4A 4L9MA 3WXAA 2MAZA 3HCMA 5HKYA 1DF0A 3GK2A 1NP8A 2I94A 1JF0A 1FF1A 1K95A 4MBEA 2JXCA 1UWOA 4PHJA 1MWNA 4AQIA 2JNFA 1DTLA 2OTGB 1DJGA 1KQMC 1ALWA 1R6PA 1XYDA 3SG6A 1S6JA 1XO5A 4PE0A 3DVMA 3VRNA 1IJ5A 3LK0A 1B7TZ 1IJ6A 4ORAB 1D1OA 2OS8B 1SL8A 2KGBC 1J55A 2ZNEA 3VRPA 3I5FC 3IF7A 3CR5X 1NPQA 3O2PA 2NZ0A 2L0PA 2ZRSA 3CTNA 2JZIA 1L2OC 3BUXB 3D0YA 3BQ3A 1JF2A 3KPXA 1CFCA 2LLUA 1J1DA 1F55A 5HLVA 2OPOA 1ZUZA 2MLEC 1S6IA 1QX5B 1WDCB 3D10A 1H8BA 2CCMA 1K9UA 1K93D 1A03A 5AERA 1K9PA 2M0RA 4Q04A 2K8MB 4GGNA 2LVVA 4P2YB 3FS7A 1WRLA 2KHNA 4YGBB 5J3XA 2LVKA 2ZFDA 1UP5A 5HYDA 4JWQA 3SIAA 3OX6A 4M2QA 3DF0A 1OMVA 2M7NA 4BY4A 4MRXA 5HLOA 4GNKB 2KSPA 1XK4A 2K61A 2ZNDA 1TNWA 1QASA 1KSOA 1NWDA 2H61A 1MXEA 4YI9A 2JU0A 1A75B 1CFFA 4I5NB 2KYCA 4GAOA 2JXLA 1YVLA 3AAJA 4E68A 1CLMA 1M39A 1BJFA 2JC2A 3EKHA 2H2KA 3LK1A 3WHUB 3WHTB 3BOWB 2O60A 1CFDA 2BECA 1RROA 1J7RA 1QTXA 2V53A 2H61C 5AEQA 3PALA 1K96A 1AK8A 1XK4C 1KK7Z 4XYNA 5BPJA 1YRTB 3BYAA 1QIWA 3OHMB 1WDCC 2TN4A 5I2OA 3DVKA 3JVTC 2E30A 3CWGA 1LVCD 2KFFA 1NIWA 2PSRA 1V1GA 2AMIA 2LM5A 4HRGA 3EKJA 4YI8A 4BY5A 1BLQA 4MZJA 4MSPA 1A29A 2CT9A 1UHHA 2Q91A 4GGFC 2WCFA 1Y6WA 4I5LB 1YTZC 2OTGC 1WY9A 1J7OA 1BU3A 1QIVA 5KU1A 1IQ5A 3LLEA 1LXFC 2QACA 1JWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLN A;  1G8I A;  2MHH A;  3ZNI A;  2PAS A;  3HX4 A;  2LHL A;  1TNP A;  3TDZ A;  1KFX S;  3E3R A;  1BMO A;  4WQ3 A;  3VRR A;  1B7T Y;  1DMO A;  1B9A A;  1CNP A;  2EHB A;  2JOJ A;  1DJX A;  2EGD A;  3O4Y A;  1AJ4 A;  1QLK A;  1BG1 A;  3I5H B;  1QVI Y;  2NCO A;  3TS5 C;  1CLB A;  3SG4 A;  1EJ3 A;  2JTZ A;  1QLS A;  4WQ2 A;  2M9G A;  3TZ1 A;  4GUK A;  4CPV A;  1H4B A;  1YUR A;  4GPL B;  3I5G C;  2LMU A;  2L98 A;  1QS7 A;  1XFY O;  1UHK A;  3A4U B;  1K94 A;  1BF5 A;  3NSK A;  2ZN8 A;  4NQG A;  1K9K A;  4YBH B;  2M7L A;  1X02 A;  2M8U A;  1S5G Y;  3PSR A;  2FOT A;  1C07 A;  4AQJ A;  2SAS A;  1IKU A;  5AFP A;  1QAT A;  3BUN B;  2F2O A;  3NSO A;  1G4Y R;  1DT7 B;  1YR5 A;  2LLT A;  5D69 A;  4ZCU A;  5FYX A;  3TUY B;  2K7B A;  2NCP A;  1RK9 A;  3BUM B;  5KSZ A;  1JFJ A;  2EC6 B;  3CR2 A;  1REC A;  4D1E A;  2LUC A;  2B1U A;  1SCM B;  4PE7 A;  4C0K A;  2JTT A;  1A2X A;  2M49 B;  4FTG A;  2LAP A;  1LIN A;  2CNP A;  1KFX L;  1LKJ A;  1UHJ A;  3SG2 A;  2LLS A;  1MUX A;  1NX2 A;  2MRD A;  5DKR A;  5HKZ A;  4NDB A;  3M0W A;  1F4O A;  1TTX A;  2F2P A;  1RJV A;  2PAL A;  3I5F B;  1J1E A;  4TNC A;  1JSA A;  2HF5 A;  5DKQ A;  2RGI A;  4F0Z B;  1YRU B;  2KYF A;  3EK8 A;  1SPY A;  1S36 A;  2M29 A;  1RFJ A;  1B8L A;  1NYA A;  4CID A;  2M3W A;  3OP0 A;  2IS9 A;  4HRH A;  1W7I B;  4NDC A;  2PRU A;  4GBA A;  4QJ3 B;  1NCY A;  1HQV A;  3QRX A;  4HSZ A;  5I2L A;  2L2E A;  4MZK A;  3RM1 A;  3BUO B;  4OCI A;  2L4H A;  5AAN A;  2LE9 B;  1G33 A;  1JUO A;  1PUL A;  1SR6 B;  1SY9 A;  1LA3 A;  1OE9 B;  3OB1 B;  1SMG A;  3BUW B;  4DS7 A;  2K7D A;  5CSI A;  1KCY A;  2KQY A;  1YX8 A;  1XFZ O;  1QJT A;  4GFT A;  2D8N A;  1OOJ A;  3VRQ A;  1DGV A;  3TDU A;  2Y1N A;  1YX7 A;  1OZS A;  1WRK A;  2LC5 A;  3PN7 C;  3SJS A;  5CPV A;  3EK4 A;  2LP2 A;  1KWO C;  2KBI A;  1FW4 A;  1TN4 A;  1TNQ A;  1TNX A;  2HPS A;  2KDH A;  2MLF C;  1VRK A;  3O78 A;  2AUC A;  2LNK A;  4IL1 A;  4ETO A;  4QJ4 B;  2KFH A;  3CR4 X;  1PK0 D;  3GK4 X;  2K7C A;  2K0J A;  3VRO A;  4A4B A;  1SCV A;  1XFU O;  1KQM B;  3IQO A;  1FBV A;  3CZT X;  3MSE B;  2PVB A;  2KAV A;  1AJ5 A;  4FQO A;  1IRJ A;  3CLN A;  5KTY A;  1SL7 A;  4DRW A;  1TIZ A;  2KI4 C;  1XFX O;  1K8U A;  2OS8 C;  3PLF B;  2KNE A;  1BT6 A;  1DJZ A;  1C7V A;  1WRZ A;  1K90 D;  4I5K A;  1TCO B;  1PSR A;  3LL8 B;  4C0L A;  1OSA A;  4ORC B;  4HRE E;  2SCP A;  1NX0 A;  2LVI A;  1XA5 A;  1EH2 A;  2MJW B;  5TNC A;  4CFQ A;  1KFU S;  1QVI Z;  1EL4 A;  2BKI B;  5G08 A;  3ZWH A;  3LCP C;  2LHI A;  1S1E A;  3D0Y B;  2Y5I A;  4YGE B;  3NXA A;  4QJ5 B;  1NX1 A;  2LAN A;  2L50 A;  3SG3 A;  4CFR A;  4ICB A;  3EK7 A;  1M63 B;  5D7F A;  3AKA A;  2BCB A;  1SL9 A;  4OVN F;  2GGM A;  5CSF A;  5JOL A;  3KEV A;  3I5H C;  3AKB A;  5HKW A;  1F8H A;  2KGR A;  5JJG A;  1JC2 A;  4MZL A;  2FCE A;  3NSL A;  5IBW A;  3OB2 B;  3PM8 A;  2JQ6 A;  3AAK A;  1NSH A;  1U5I B;  2LVJ A;  4PE1 A;  2L4I A;  1ALV A;  1OQP A;  2F3Y A;  4R1E A;  1S26 D;  1A4P A;  2BL0 B;  1LA0 A;  4M2P A;  1RWY A;  1PVB A;  2LV7 A;  1BOC A;  2KI6 C;  3C1V A;  1XFV O;  1F71 A;  1CB1 A;  1OMD A;  4YGD B;  2PMY A;  5ER5 A;  1QV1 A;  3OX5 A;  2Y4Q A;  1PSB A;  1DVI A;  1A75 A;  1XVJ A;  2MA2 A;  3ICB A;  2KOT A;  2KAY A;  2F33 A;  4U8D A;  2CBL A;  1KFU L;  2K2F A;  2ZKM X;  4UPG A;  1FI5 A;  1DJH A;  1B1G A;  1TOP A;  1SYM A;  3CGA A;  4PDZ A;  3I5I C;  1KK8 B;  1Y0V H;  4PE4 A;  1QV0 A;  2HQ8 A;  2BL0 C;  1Y1A A;  4PCW A;  5I8N A;  1Q80 A;  2WND A;  1CDP A;  3BOW A;  3EVV A;  1CMF A;  3DVE A;  1DJW A;  2I7A A;  1N65 A;  2MBX A;  1K2H A;  2M1K B;  4P5O E;  5ER4 X;  1ZAC A;  1AVS A;  1KQV A;  1QXP A;  1BOD A;  2BCX A;  1JBA A;  2K7O A;  2A4J A;  2EC6 C;  1C7W A;  1DJY A;  1KK7 Y;  2AAO A;  3RLZ A;  1U5I A;  2BKH B;  3JTD B;  2O5G A;  2DOQ A;  1W7J B;  3SG5 A;  4PHM A;  1ODB A;  2R2I A;  1WLM A;  2JUL A;  2HQW A;  2JWW A;  3DVJ A;  2BE6 A;  3VGO A;  2L51 A;  4DIR A;  3IQQ A;  2WCE A;  4OKH A;  4M2O A;  2Q4U A;  1M45 A;  1SK6 D;  2JT0 A;  1S3P A;  3KF9 A;  5B8I B;  1IH0 A;  2P6B B;  1B8C A;  1BR1 B;  1WLZ A;  1Y1U A;  2GGZ A;  1L7Z A;  1B8R A;  3GOF A;  1KWO B;  3FIA A;  1YUS A;  1J7Q A;  1SBJ A;  2KQ6 A;  4GGF A;  4WRI A;  1KK8 C;  3A8R A;  4DUQ A;  4N1G A;  1NUB A;  2M97 A;  4YGC B;  2FJU B;  2QPT A;  1EG3 A;  1IQ3 A;  1CLL A;  5CSJ A;  1DJI A;  1IGV A;  1E8A A;  1EXR A;  1YVH A;  1F70 A;  5F6T A;  3PAT A;  4MRY A;  1OMR A;  1UHI A;  1PRW A;  1DGU A;  1OZO A;  2NXQ A;  1PVA A;  1AHR A;  1MR8 A;  1SCM C;  1FI6 A;  1UUS A;  1BR4 B;  1S5G Z;  2JPT A;  2GV5 A;  2LUX A;  4NDD A;  1SR6 C;  1FPW A;  2LMV A;  2FCD A;  1JFK A;  1ZMZ A;  2JT8 A;  2WC8 A;  1YUT A;  4A4C A;  4PHN A;  4N5X A;  5DKN A;  1SKT A;  1R2U A;  4OV2 A;  1SNL A;  3NSI A;  4ORB B;  3K21 A;  2Y1M A;  2L5X B;  3DD4 A;  1CDL A;  3EVU A;  1PAL A;  3H4S E;  4YRU A;  1GGZ A;  2ZRT A;  2CTN A;  3TDI A;  3TS5 B;  1CM1 A;  1AP4 A;  2JRF A;  1S6C A;  2BBM A;  3JTD C;  2BCA A;  4MLW A;  1ZOT B;  1F4Q A;  3CS1 A;  5K89 A;  3JVT B;  3SG7 A;  4ZCV A;  4N1F A;  3I5I B;  3WNX B;  3FWB A;  1Y1X A;  4JPZ B;  2CXJ A;  4PHK A;  5PAL A;  1TRF A;  5AXI A;  2KAX A;  4USL A;  2G2B A;  4XJK B;  1GJY A;  1IG5 A;  1UUR A;  1NCX A;  3EVR A;  1MXL C;  3PFV A;  2JT3 A;  2I2R E;  4C0J A;  2WOS A;  1GQM A;  2JNX A;  2WCB A;  5I2Q A;  1UHN A;  2HET A;  4MEW A;  2BBN A;  1KSM A;  1M46 A;  2KI4 B;  1XFW O;  4YGA A;  1QX2 A;  4OR9 B;  4JQ0 D;  3FWC A;  2KFG A;  1SW8 A;  2KBM A;  5CSN A;  1YUU A;  1HT9 A;  1J7P A;  2VRG A;  2I18 A;  2ISD A;  3SIB A;  1DF0 B;  2G9B A;  1CKK A;  2F8P A;  1MF8 B;  5GQQ C;  2LMT A;  2E6W A;  1AUI B;  1QX7 A;  1SRA A;  2LCP A;  3TUY C;  1IWQ A;  1MHO A;  1F54 A;  1L2O B;  1TCF A;  2F3Z A;  1CFP A;  2COL B;  4PAL A;  3BXK A;  1CMG A;  1NCZ A;  1CM4 A;  2WOR A;  4MN0 A;  2ZN9 A;  1EG4 A;  2K2A A;  2M1U A;  1V1F A;  2NLN A;  1B4C A;  2LP3 A;  2KI6 D;  4XJK A;  3F45 A;  4AOM A;  1CDM A;  1RTP 1;  1N2D A;  3O6B A;  1CTR A;  1MQ1 A;  3GK1 A;  4DCK A;  1GGW A;  1NX3 A;  4I5J A;  3KO0 A;  1M31 A;  3DF0 B;  3PN7 B;  1ZFS A;  3KHE A;  4MVF A;  1N0Y A;  3I5G B;  1CDN A;  1B47 A;  2BE4 A;  4L9M A;  3WXA A;  2MAZ A;  3HCM A;  5HKY A;  1DF0 A;  3GK2 A;  1NP8 A;  2I94 A;  1JF0 A;  1FF1 A;  1K95 A;  4MBE A;  2JXC A;  1UWO A;  4PHJ A;  1MWN A;  4AQI A;  2JNF A;  1DTL A;  2OTG B;  1DJG A;  1KQM C;  1ALW A;  1R6P A;  1XYD A;  3SG6 A;  1S6J A;  1XO5 A;  4PE0 A;  3DVM A;  3VRN A;  1IJ5 A;  3LK0 A;  1B7T Z;  1IJ6 A;  4ORA B;  1D1O A;  2OS8 B;  1SL8 A;  2KGB C;  1J55 A;  2ZNE A;  3VRP A;  3I5F C;  3IF7 A;  3CR5 X;  1NPQ A;  3O2P A;  2NZ0 A;  2L0P A;  2ZRS A;  3CTN A;  2JZI A;  1L2O C;  3BUX B;  3D0Y A;  3BQ3 A;  1JF2 A;  3KPX A;  1CFC A;  2LLU A;  1J1D A;  1F55 A;  5HLV A;  2OPO A;  1ZUZ A;  2MLE C;  1S6I A;  1QX5 B;  1WDC B;  3D10 A;  1H8B A;  2CCM A;  1K9U A;  1K93 D;  1A03 A;  5AER A;  1K9P A;  2M0R A;  4Q04 A;  2K8M B;  4GGN A;  2LVV A;  4P2Y B;  3FS7 A;  1WRL A;  2KHN A;  4YGB B;  5J3X A;  2LVK A;  2ZFD A;  1UP5 A;  5HYD A;  4JWQ A;  3SIA A;  3OX6 A;  4M2Q A;  3DF0 A;  1OMV A;  2M7N A;  4BY4 A;  4MRX A;  5HLO A;  4GNK B;  2KSP A;  1XK4 A;  2K61 A;  2ZND A;  1TNW A;  1QAS A;  1KSO A;  1NWD A;  2H61 A;  1MXE A;  4YI9 A;  2JU0 A;  1A75 B;  1CFF A;  4I5N B;  2KYC A;  4GAO A;  2JXL A;  1YVL A;  3AAJ A;  4E68 A;  1CLM A;  1M39 A;  1BJF A;  2JC2 A;  3EKH A;  2H2K A;  3LK1 A;  3WHU B;  3WHT B;  3BOW B;  2O60 A;  1CFD A;  2BEC A;  1RRO A;  1J7R A;  1QTX A;  2V53 A;  2H61 C;  5AEQ A;  3PAL A;  1K96 A;  1AK8 A;  1XK4 C;  1KK7 Z;  4XYN A;  5BPJ A;  1YRT B;  3BYA A;  1QIW A;  3OHM B;  1WDC C;  2TN4 A;  5I2O A;  3DVK A;  3JVT C;  2E30 A;  3CWG A;  1LVC D;  2KFF A;  1NIW A;  2PSR A;  1V1G A;  2AMI A;  2LM5 A;  4HRG A;  3EKJ A;  4YI8 A;  4BY5 A;  1BLQ A;  4MZJ A;  4MSP A;  1A29 A;  2CT9 A;  1UHH A;  2Q91 A;  4GGF C;  2WCF A;  1Y6W A;  4I5L B;  1YTZ C;  2OTG C;  1WY9 A;  1J7O A;  1BU3 A;  1QIV A;  5KU1 A;  1IQ5 A;  3LLE A;  1LXF C;  2QAC A;  1JWD A; 
#chains in the Genus database with same CATH topology
 5FI7 A;  2L2C A;  4CLN A;  1G8I A;  2MHH A;  3ZNI A;  2PAS A;  3HX4 A;  2LHL A;  1TNP A;  5FI2 A;  3TDZ A;  1KFX S;  3E3R A;  1BMO A;  4WQ3 A;  3VRR A;  1B7T Y;  1DMO A;  1B9A A;  1CNP A;  2EHB A;  2QEV A;  2JOJ A;  1DJX A;  2EGD A;  3EG5 B;  3O4Y A;  1OOI X;  2WCL A;  1AJ4 A;  3CZ1 A;  2K60 A;  1QLK A;  3L4L A;  1BG1 A;  3I5H B;  1QVI Y;  2NCO A;  3TS5 C;  5HL1 A;  1CLB A;  3SG4 A;  1EJ3 A;  3SS3 A;  2JTZ A;  1QLS A;  1P28 A;  4WQ2 A;  2M9G A;  3TZ1 A;  3FE9 A;  4GUK A;  4CPV A;  5D3O A;  1H4B A;  1YUR A;  3D76 A;  4GPL B;  3I5G C;  2LMU A;  1DEL A;  2L98 A;  1QS7 A;  1XFY O;  1UHK A;  3A4U B;  1K94 A;  1BF5 A;  3NSK A;  2ZN8 A;  4NQG A;  1K9K A;  4YBH B;  2M7L A;  1X02 A;  2M8U A;  1S5G Y;  3PSR A;  2FOT A;  1C07 A;  4AQJ A;  2SAS A;  3CAB A;  1IKU A;  5AFP A;  1QAT A;  3BUN B;  2F2O A;  3NSO A;  1G4Y R;  1DT7 B;  1YR5 A;  2LLT A;  5D69 A;  4ZCU A;  5FYX A;  3TUY B;  2K7B A;  2NCP A;  1RK9 A;  3BUM B;  5KSZ A;  1JFJ A;  2EC6 B;  3CR2 A;  1REC A;  4D1E A;  2LUC A;  1OOF A;  2B1U A;  1SCM B;  4PE7 A;  4C0K A;  2JTT A;  1A2X A;  2M49 B;  3CZ2 A;  2LAP A;  1LIN A;  3R72 A;  4FTG A;  2CNP A;  1KFX L;  1LKJ A;  1UHJ A;  3SG2 A;  2LLS A;  1MUX A;  1NX2 A;  2MRD A;  5DKR A;  5HKZ A;  4NDB A;  3M0W A;  1F4O A;  1TTX A;  2F2P A;  1RJV A;  2PAL A;  3I5F B;  2QEB A;  4OZD A;  3PM2 A;  3L4A A;  1J1E A;  3SS4 A;  4TNC A;  1JSA A;  2HF5 A;  5DKQ A;  2RGI A;  4F0Z B;  1YRU B;  2KYF A;  3EK8 A;  1SPY A;  1S36 A;  2M29 A;  1RFJ A;  1B8L A;  1NYA A;  4CID A;  2M3W A;  3OP0 A;  2IS9 A;  4HRH A;  1W7I B;  4NDC A;  2WCM A;  2PRU A;  3CZ0 A;  4GBA A;  4QJ3 B;  1NCY A;  1HQV A;  3QRX A;  4HSZ A;  5I2L A;  2L2E A;  3V2L A;  4MZK A;  3RM1 A;  3BUO B;  4OCI A;  2L4H A;  1TUJ A;  5AAN A;  2LE9 B;  1G33 A;  1JUO A;  1PUL A;  1SR6 B;  1SY9 A;  1LA3 A;  1OE9 B;  2P70 A;  3OB1 B;  3DXL A;  2WC6 A;  1SMG A;  3BUW B;  4DS7 A;  2K7D A;  5CSI A;  1KCY A;  2KQY A;  1YX8 A;  1XFZ O;  1QJT A;  4GFT A;  2D8N A;  1OOJ A;  3VRQ A;  1DGV A;  3TDU A;  2Y1N A;  1YX7 A;  1OZS A;  1WRK A;  4PT1 A;  2LC5 A;  3PN7 C;  3SJS A;  5CPV A;  1Z4H A;  3EK4 A;  2LP2 A;  1KWO C;  2KBI A;  1FW4 A;  1GM0 A;  1TN4 A;  1TNQ A;  1TNX A;  2QEO A;  2HPS A;  2KDH A;  2MLF C;  3S0A A;  1VRK A;  3FE6 A;  3O78 A;  1OOH A;  2AUC A;  2LNK A;  4IL1 A;  4ETO A;  4QJ4 B;  3NHT A;  2KFH A;  3CR4 X;  1PK0 D;  3GK4 X;  2K7C A;  2K0J A;  3VRO A;  4A4B A;  1SCV A;  1XFU O;  1KQM B;  3IQO A;  1FBV A;  3CZT X;  3MSE B;  2PVB A;  4JKT A;  2KAV A;  1AJ5 A;  3R1O A;  1IRJ A;  3CLN A;  4FQO A;  1SL7 A;  4DRW A;  5KTY A;  1TIZ A;  2KI4 C;  1XFX O;  1K8U A;  2OS8 C;  2PYQ A;  2KNE A;  3D78 A;  3PLF B;  1BT6 A;  1DJZ A;  1C7V A;  1WRZ A;  5DIC A;  1K90 D;  4I5K A;  1TCO B;  1PSR A;  3LL8 B;  2KLE A;  4C0L A;  1OSA A;  4INX A;  4ORC B;  4HRE E;  2SCP A;  1NX0 A;  2LVI A;  1XA5 A;  1EH2 A;  2MJW B;  5TNC A;  4CFQ A;  1KFU S;  1QVI Z;  1EL4 A;  2BKI B;  5G08 A;  3ZWH A;  3LCP C;  2LHI A;  1S1E A;  3D0Y B;  2Y5I A;  4YGE B;  3NXA A;  4QJ5 B;  1NX1 A;  2LAN A;  2L50 A;  3SG3 A;  2KLD A;  4CFR A;  4ICB A;  3EK7 A;  1M63 B;  5D7F A;  3AKA A;  2BCB A;  1SL9 A;  4OVN F;  2GGM A;  5CSF A;  5JOL A;  3KEV A;  3I5H C;  3AKB A;  5HKW A;  1F8H A;  2KGR A;  5JJG A;  1JC2 A;  4MZL A;  2FCE A;  3NSL A;  5IBW A;  3OB2 B;  3PM8 A;  2JQ6 A;  3AAK A;  1NSH A;  1U5I B;  2LVJ A;  4PE1 A;  2L4I A;  1ALV A;  1OQP A;  2F3Y A;  4R1E A;  1S26 D;  1A4P A;  2BL0 B;  5EL2 A;  1LA0 A;  3SS5 A;  3S0D A;  4M2P A;  1RWY A;  1PVB A;  2LV7 A;  1BOC A;  2KI6 C;  3C1V A;  1XFV O;  3D75 A;  3UNW A;  1F71 A;  1CB1 A;  1OMD A;  4YGD B;  2PMY A;  5ER5 A;  1QV1 A;  3OX5 A;  2Y4Q A;  3PJI A;  1PSB A;  1DVI A;  1A75 A;  1XVJ A;  2MA2 A;  3ICB A;  2KOT A;  2KAY A;  2F33 A;  4U8D A;  2CBL A;  1KFU L;  4JD9 A;  2K2F A;  2ZKM X;  4UPG A;  1FI5 A;  2BNX A;  1DJH A;  1B1G A;  1TOP A;  1SYM A;  3CGA A;  4PDZ A;  3I5I C;  1KK8 B;  1Y0V H;  4PE4 A;  1QV0 A;  2HQ8 A;  2BL0 C;  1Y1A A;  4PCW A;  5I8N A;  1Q80 A;  2WND A;  1CDP A;  3BOW A;  3EVV A;  1CMF A;  3DVE A;  1DJW A;  2I7A A;  1N65 A;  2MBX A;  1K2H A;  2M1K B;  4P5O E;  5ER4 X;  1ZAC A;  2KPH A;  1AVS A;  1KQV A;  1QXP A;  1BOD A;  2BCX A;  1JBA A;  2K7O A;  2A4J A;  2EC6 C;  1C7W A;  1DJY A;  1KK7 Y;  2AAO A;  2L5Y A;  3RLZ A;  1U5I A;  2BKH B;  3JTD B;  2O5G A;  2DOQ A;  3DY9 A;  1W7J B;  3SG5 A;  3CDN A;  4PHM A;  3QME A;  1ODB A;  2R2I A;  1WLM A;  2JUL A;  2HQW A;  2JWW A;  3DVJ A;  3R1V A;  2BE6 A;  3VGO A;  2L51 A;  4INW A;  4DIR A;  3D74 A;  3IQQ A;  2WCE A;  1OOG A;  4OKH A;  4M2O A;  2Q4U A;  1M45 A;  1SK6 D;  2JT0 A;  1S3P A;  3KF9 A;  5B8I B;  1IH0 A;  2P6B B;  1B8C A;  5I94 A;  1BR1 B;  1WLZ A;  1Y1U A;  3O4X A;  2GGZ A;  2WCH A;  1L7Z A;  1OW4 A;  1B8R A;  3BFB A;  3GOF A;  1KWO B;  3FIA A;  1YUS A;  1J7Q A;  1SBJ A;  2KQ6 A;  4GGF A;  4WRI A;  4IJ7 A;  1KK8 C;  3A8R A;  4DUQ A;  4N1G A;  1NUB A;  2M97 A;  2QDI A;  2JPO A;  4YGC B;  2FJU B;  2QPT A;  1EG3 A;  1IQ3 A;  1CLL A;  5CSJ A;  1DJI A;  1IGV A;  1E8A A;  1EXR A;  1YVH A;  1F70 A;  5F6T A;  3NHI A;  3PAT A;  4MRY A;  1OMR A;  1UHI A;  1PRW A;  1DGU A;  1OZO A;  2NXQ A;  1PVA A;  1AHR A;  1MR8 A;  1SCM C;  1FI6 A;  2FJY A;  1UUS A;  1BR4 B;  1S5G Z;  2JPT A;  2GV5 A;  2LUX A;  4NDD A;  1SR6 C;  1FPW A;  2LMV A;  2FCD A;  1JFK A;  1ZMZ A;  2JT8 A;  2WC8 A;  2QEH A;  1YUT A;  3S0E A;  4A4C A;  4PHN A;  4KYN A;  1IIO A;  3IVT A;  4N5X A;  1SKT A;  1R2U A;  4OV2 A;  5DKN A;  1SNL A;  2ERB A;  3NSI A;  4ORB B;  3K21 A;  2Y1M A;  2L5X B;  3DD4 A;  1CDL A;  3EVU A;  1PAL A;  3H4S E;  4YRU A;  1GGZ A;  2ZRT A;  2CTN A;  3TDI A;  3TS5 B;  1CM1 A;  1AP4 A;  2JRF A;  3CYZ A;  1S6C A;  2BBM A;  3JTD C;  2BCA A;  4MLW A;  1XFR A;  1ZOT B;  3R1P A;  1F4Q A;  3CS1 A;  5K89 A;  3JVT B;  3SG7 A;  1T14 A;  4ZCV A;  4N1F A;  3I5I B;  3WNX B;  3FWB A;  1Y1X A;  4JPZ B;  2CXJ A;  4PHK A;  5PAL A;  3S0F A;  1TRF A;  5AXI A;  2KAX A;  4USL A;  1C3Z A;  2G2B A;  4XJK B;  1GJY A;  1IG5 A;  2P71 A;  1UUR A;  1NCX A;  3B6X A;  1MXL C;  3EVR A;  3PFV A;  1DQE A;  2JT3 A;  3Q8I A;  2I2R E;  4C0J A;  2WC5 A;  2WOS A;  1GQM A;  2JNX A;  2WCB A;  5I2Q A;  1LS8 A;  1UHN A;  2HET A;  4MEW A;  2BBN A;  1KSM A;  1QWV A;  1M46 A;  2KI4 B;  1XFW O;  4YGA A;  1C3Y A;  1QX2 A;  4OR9 B;  4JQ0 D;  2WCJ A;  3FWC A;  2KFG A;  1SW8 A;  2KBM A;  5CSN A;  1YUU A;  1DC1 A;  3RZS A;  1HT9 A;  1J7P A;  2GTE A;  2VRG A;  2I18 A;  3S0G A;  2ISD A;  3SIB A;  1DF0 B;  2G9B A;  1CKK A;  2F8P A;  1MF8 B;  5GQQ C;  2LMT A;  2E6W A;  1AUI B;  1QX7 A;  1SRA A;  2LCP A;  3TUY C;  1IWQ A;  1MHO A;  1F54 A;  1L2O B;  1TCF A;  2F3Z A;  1CFP A;  2COL B;  4PAL A;  3BXK A;  1CMG A;  1NCZ A;  1CM4 A;  2WOR A;  4MN0 A;  2ZN9 A;  1EG4 A;  3BJH A;  2K2A A;  3NGV A;  2M1U A;  3VB1 A;  1V1F A;  3S0B A;  2NLN A;  3B7A A;  1B4C A;  2LP3 A;  3DYE A;  2KI6 D;  4XJK A;  3F45 A;  4AOM A;  1CDM A;  1RTP 1;  1N2D A;  3O6B A;  1CTR A;  1MQ1 A;  3GK1 A;  4DCK A;  1GGW A;  1NX3 A;  4I5J A;  3KO0 A;  1SSE B;  1M31 A;  3DF0 B;  3PN7 B;  1ZFS A;  3KHE A;  4MVF A;  1N0Y A;  1W9Z A;  2PQL A;  3I5G B;  1CDN A;  1B47 A;  1DEK A;  2BE4 A;  4L9M A;  3WXA A;  2MAZ A;  3HCM A;  5HKY A;  1DF0 A;  3GK2 A;  1NP8 A;  2I94 A;  3L47 A;  1JF0 A;  1FF1 A;  4F7F A;  1K95 A;  4MBE A;  2JXC A;  3D77 A;  1UWO A;  4PHJ A;  3UO9 A;  3N7H A;  1MWN A;  4AQI A;  2JNF A;  1DTL A;  2OTG B;  1DJG A;  1KQM C;  1ALW A;  1R6P A;  3BFA A;  1XYD A;  3SG6 A;  1S6J A;  1XO5 A;  2H8V A;  4PE0 A;  3DVM A;  3VRN A;  1IJ5 A;  3LK0 A;  1B7T Z;  1IJ6 A;  4ORA B;  1D1O A;  2OS8 B;  1SL8 A;  2KGB C;  1J55 A;  3OGN A;  2ZNE A;  3VRP A;  3I5F C;  3IF7 A;  3CR5 X;  1NPQ A;  3O2P A;  2NZ0 A;  2L0P A;  2ZRS A;  3B87 A;  1ORG A;  3CTN A;  2JZI A;  1L2O C;  3BUX B;  3D0Y A;  3K1E A;  3BQ3 A;  1JF2 A;  3KPX A;  1CFC A;  2LLU A;  1J1D A;  1F55 A;  2YGU A;  5HLV A;  2OPO A;  1ZUZ A;  2MLE C;  3OBV A;  1S6I A;  1QX5 B;  1WDC B;  3D10 A;  1H8B A;  2CCM A;  1K9U A;  3B88 A;  1K93 D;  1A03 A;  5AER A;  1K9P A;  3BFH A;  2M0R A;  4Q04 A;  2K8M B;  4GGN A;  2BAP A;  2LVV A;  4P2Y B;  3FS7 A;  1WRL A;  2KHN A;  4YGB B;  5J3X A;  5FI6 A;  2LVK A;  2ZFD A;  1UP5 A;  5HYD A;  4JWQ A;  3SIA A;  2WCK A;  3OX6 A;  4M2Q A;  1TWO A;  1TUZ A;  4FQT A;  3DF0 A;  1OMV A;  2M7N A;  3FE8 A;  4BY4 A;  4MRX A;  5HLO A;  4GNK B;  2KSP A;  3B86 A;  1XK4 A;  2K61 A;  2ZND A;  1TNW A;  1QAS A;  1KSO A;  1NWD A;  2H61 A;  1MXE A;  4YI9 A;  2JU0 A;  1A75 B;  1CFF A;  4I5N B;  1Z2C B;  2KYC A;  3D73 A;  2JXL A;  1YVL A;  3AAJ A;  4GAO A;  4E68 A;  1CLM A;  1M39 A;  1BJF A;  2JC2 A;  3EKH A;  2H2K A;  3LK1 A;  3WHU B;  3WHT B;  3BOW B;  2O60 A;  1CFD A;  2BEC A;  1RRO A;  1J7R A;  1QTX A;  2V53 A;  2H61 C;  5AEQ A;  3PAL A;  1K96 A;  1AK8 A;  1XK4 C;  1KK7 Z;  4XYN A;  5BPJ A;  1YRT B;  3BYA A;  1QIW A;  3OHM B;  1WDC C;  2TN4 A;  5I2O A;  3DVK A;  3JVT C;  2E30 A;  3CWG A;  1LVC D;  2KFF A;  1NIW A;  2PSR A;  1V1G A;  2AMI A;  2LM5 A;  4HRG A;  3EKJ A;  4YI8 A;  4BY5 A;  1BLQ A;  4MZJ A;  4MSP A;  1A29 A;  2CT9 A;  1UHH A;  2Q91 A;  4GGF C;  2WCF A;  1Y6W A;  4I5L B;  1YTZ C;  3DZT A;  2OTG C;  1WY9 A;  1J7O A;  1BU3 A;  1QIV A;  5KU1 A;  1IQ5 A;  3LLE A;  1LXF C;  2QAC A;  1JWD A; 
#chains in the Genus database with same CATH homology
 4CLN A;  1G8I A;  2MHH A;  3ZNI A;  2PAS A;  3HX4 A;  2LHL A;  1TNP A;  3TDZ A;  1KFX S;  3E3R A;  1BMO A;  4WQ3 A;  3VRR A;  1B7T Y;  1DMO A;  1B9A A;  1CNP A;  2EHB A;  2JOJ A;  1DJX A;  2EGD A;  3O4Y A;  1AJ4 A;  1QLK A;  1BG1 A;  3I5H B;  1QVI Y;  2NCO A;  3TS5 C;  1CLB A;  3SG4 A;  1EJ3 A;  2JTZ A;  1QLS A;  4WQ2 A;  2M9G A;  3TZ1 A;  4GUK A;  4CPV A;  1H4B A;  1YUR A;  4GPL B;  3I5G C;  2LMU A;  2L98 A;  1QS7 A;  1XFY O;  1UHK A;  3A4U B;  1K94 A;  1BF5 A;  3NSK A;  2ZN8 A;  4NQG A;  1K9K A;  4YBH B;  2M7L A;  1X02 A;  2M8U A;  1S5G Y;  3PSR A;  2FOT A;  1C07 A;  4AQJ A;  2SAS A;  1IKU A;  5AFP A;  1QAT A;  3BUN B;  2F2O A;  3NSO A;  1G4Y R;  1DT7 B;  1YR5 A;  2LLT A;  5D69 A;  4ZCU A;  5FYX A;  3TUY B;  2K7B A;  2NCP A;  1RK9 A;  3BUM B;  5KSZ A;  1JFJ A;  2EC6 B;  3CR2 A;  1REC A;  4D1E A;  2LUC A;  2B1U A;  1SCM B;  4PE7 A;  4C0K A;  2JTT A;  1A2X A;  2M49 B;  4FTG A;  2LAP A;  1LIN A;  2CNP A;  1KFX L;  1LKJ A;  1UHJ A;  3SG2 A;  2LLS A;  1MUX A;  1NX2 A;  2MRD A;  5DKR A;  5HKZ A;  4NDB A;  3M0W A;  1F4O A;  1TTX A;  2F2P A;  1RJV A;  2PAL A;  3I5F B;  1J1E A;  4TNC A;  1JSA A;  2HF5 A;  5DKQ A;  2RGI A;  4F0Z B;  1YRU B;  2KYF A;  3EK8 A;  1SPY A;  1S36 A;  2M29 A;  1RFJ A;  1B8L A;  1NYA A;  4CID A;  2M3W A;  3OP0 A;  2IS9 A;  4HRH A;  1W7I B;  4NDC A;  2PRU A;  4GBA A;  4QJ3 B;  1NCY A;  1HQV A;  3QRX A;  4HSZ A;  5I2L A;  2L2E A;  4MZK A;  3RM1 A;  3BUO B;  4OCI A;  2L4H A;  5AAN A;  2LE9 B;  1G33 A;  1JUO A;  1PUL A;  1SR6 B;  1SY9 A;  1LA3 A;  1OE9 B;  3OB1 B;  1SMG A;  3BUW B;  4DS7 A;  2K7D A;  5CSI A;  1KCY A;  2KQY A;  1YX8 A;  1XFZ O;  1QJT A;  4GFT A;  2D8N A;  1OOJ A;  3VRQ A;  1DGV A;  3TDU A;  2Y1N A;  1YX7 A;  1OZS A;  1WRK A;  2LC5 A;  3PN7 C;  3SJS A;  5CPV A;  3EK4 A;  2LP2 A;  1KWO C;  2KBI A;  1FW4 A;  1TN4 A;  1TNQ A;  1TNX A;  2HPS A;  2KDH A;  2MLF C;  1VRK A;  3O78 A;  2AUC A;  2LNK A;  4IL1 A;  4ETO A;  4QJ4 B;  2KFH A;  3CR4 X;  1PK0 D;  3GK4 X;  2K7C A;  2K0J A;  3VRO A;  4A4B A;  1SCV A;  1XFU O;  1KQM B;  3IQO A;  1FBV A;  3CZT X;  3MSE B;  2PVB A;  2KAV A;  1AJ5 A;  4FQO A;  1IRJ A;  3CLN A;  5KTY A;  1SL7 A;  4DRW A;  1TIZ A;  2KI4 C;  1XFX O;  1K8U A;  2OS8 C;  3PLF B;  2KNE A;  1BT6 A;  1DJZ A;  1C7V A;  1WRZ A;  1K90 D;  4I5K A;  1TCO B;  1PSR A;  3LL8 B;  4C0L A;  1OSA A;  4ORC B;  4HRE E;  2SCP A;  1NX0 A;  2LVI A;  1XA5 A;  1EH2 A;  2MJW B;  5TNC A;  4CFQ A;  1KFU S;  1QVI Z;  1EL4 A;  2BKI B;  5G08 A;  3ZWH A;  3LCP C;  2LHI A;  1S1E A;  3D0Y B;  2Y5I A;  4YGE B;  3NXA A;  4QJ5 B;  1NX1 A;  2LAN A;  2L50 A;  3SG3 A;  4CFR A;  4ICB A;  3EK7 A;  1M63 B;  5D7F A;  3AKA A;  2BCB A;  1SL9 A;  4OVN F;  2GGM A;  5CSF A;  5JOL A;  3KEV A;  3I5H C;  3AKB A;  5HKW A;  1F8H A;  2KGR A;  5JJG A;  1JC2 A;  4MZL A;  2FCE A;  3NSL A;  5IBW A;  3OB2 B;  3PM8 A;  2JQ6 A;  3AAK A;  1NSH A;  1U5I B;  2LVJ A;  4PE1 A;  2L4I A;  1ALV A;  1OQP A;  2F3Y A;  4R1E A;  1S26 D;  1A4P A;  2BL0 B;  1LA0 A;  4M2P A;  1RWY A;  1PVB A;  2LV7 A;  1BOC A;  2KI6 C;  3C1V A;  1XFV O;  1F71 A;  1CB1 A;  1OMD A;  4YGD B;  2PMY A;  5ER5 A;  1QV1 A;  3OX5 A;  2Y4Q A;  1PSB A;  1DVI A;  1A75 A;  1XVJ A;  2MA2 A;  3ICB A;  2KOT A;  2KAY A;  2F33 A;  4U8D A;  2CBL A;  1KFU L;  2K2F A;  2ZKM X;  4UPG A;  1FI5 A;  1DJH A;  1B1G A;  1TOP A;  1SYM A;  3CGA A;  4PDZ A;  3I5I C;  1KK8 B;  1Y0V H;  4PE4 A;  1QV0 A;  2HQ8 A;  2BL0 C;  1Y1A A;  4PCW A;  5I8N A;  1Q80 A;  2WND A;  1CDP A;  3BOW A;  3EVV A;  1CMF A;  3DVE A;  1DJW A;  2I7A A;  1N65 A;  2MBX A;  1K2H A;  2M1K B;  4P5O E;  5ER4 X;  1ZAC A;  1AVS A;  1KQV A;  1QXP A;  1BOD A;  2BCX A;  1JBA A;  2K7O A;  2A4J A;  2EC6 C;  1C7W A;  1DJY A;  1KK7 Y;  2AAO A;  3RLZ A;  1U5I A;  2BKH B;  3JTD B;  2O5G A;  2DOQ A;  1W7J B;  3SG5 A;  4PHM A;  1ODB A;  2R2I A;  1WLM A;  2JUL A;  2HQW A;  2JWW A;  3DVJ A;  2BE6 A;  3VGO A;  2L51 A;  4DIR A;  3IQQ A;  2WCE A;  4OKH A;  4M2O A;  2Q4U A;  1M45 A;  1SK6 D;  2JT0 A;  1S3P A;  3KF9 A;  5B8I B;  1IH0 A;  2P6B B;  1B8C A;  1BR1 B;  1WLZ A;  1Y1U A;  2GGZ A;  1L7Z A;  1B8R A;  3GOF A;  1KWO B;  3FIA A;  1YUS A;  1J7Q A;  1SBJ A;  2KQ6 A;  4GGF A;  4WRI A;  1KK8 C;  3A8R A;  4DUQ A;  4N1G A;  1NUB A;  2M97 A;  4YGC B;  2FJU B;  2QPT A;  1EG3 A;  1IQ3 A;  1CLL A;  5CSJ A;  1DJI A;  1IGV A;  1E8A A;  1EXR A;  1YVH A;  1F70 A;  5F6T A;  3PAT A;  4MRY A;  1OMR A;  1UHI A;  1PRW A;  1DGU A;  1OZO A;  2NXQ A;  1PVA A;  1AHR A;  1MR8 A;  1SCM C;  1FI6 A;  1UUS A;  1BR4 B;  1S5G Z;  2JPT A;  2GV5 A;  2LUX A;  4NDD A;  1SR6 C;  1FPW A;  2LMV A;  2FCD A;  1JFK A;  1ZMZ A;  2JT8 A;  2WC8 A;  1YUT A;  4A4C A;  4PHN A;  4N5X A;  5DKN A;  1SKT A;  1R2U A;  4OV2 A;  1SNL A;  3NSI A;  4ORB B;  3K21 A;  2Y1M A;  2L5X B;  3DD4 A;  1CDL A;  3EVU A;  1PAL A;  3H4S E;  4YRU A;  1GGZ A;  2ZRT A;  2CTN A;  3TDI A;  3TS5 B;  1CM1 A;  1AP4 A;  2JRF A;  1S6C A;  2BBM A;  3JTD C;  2BCA A;  4MLW A;  1ZOT B;  1F4Q A;  3CS1 A;  5K89 A;  3JVT B;  3SG7 A;  4ZCV A;  4N1F A;  3I5I B;  3WNX B;  3FWB A;  1Y1X A;  4JPZ B;  2CXJ A;  4PHK A;  5PAL A;  1TRF A;  5AXI A;  2KAX A;  4USL A;  2G2B A;  4XJK B;  1GJY A;  1IG5 A;  1UUR A;  1NCX A;  3EVR A;  1MXL C;  3PFV A;  2JT3 A;  2I2R E;  4C0J A;  2WOS A;  1GQM A;  2JNX A;  2WCB A;  5I2Q A;  1UHN A;  2HET A;  4MEW A;  2BBN A;  1KSM A;  1M46 A;  2KI4 B;  1XFW O;  4YGA A;  1QX2 A;  4OR9 B;  4JQ0 D;  3FWC A;  2KFG A;  1SW8 A;  2KBM A;  5CSN A;  1YUU A;  1HT9 A;  1J7P A;  2VRG A;  2I18 A;  2ISD A;  3SIB A;  1DF0 B;  2G9B A;  1CKK A;  2F8P A;  1MF8 B;  5GQQ C;  2LMT A;  2E6W A;  1AUI B;  1QX7 A;  1SRA A;  2LCP A;  3TUY C;  1IWQ A;  1MHO A;  1F54 A;  1L2O B;  1TCF A;  2F3Z A;  1CFP A;  2COL B;  4PAL A;  3BXK A;  1CMG A;  1NCZ A;  1CM4 A;  2WOR A;  4MN0 A;  2ZN9 A;  1EG4 A;  2K2A A;  2M1U A;  1V1F A;  2NLN A;  1B4C A;  2LP3 A;  2KI6 D;  4XJK A;  3F45 A;  4AOM A;  1CDM A;  1RTP 1;  1N2D A;  3O6B A;  1CTR A;  1MQ1 A;  3GK1 A;  4DCK A;  1GGW A;  1NX3 A;  4I5J A;  3KO0 A;  1M31 A;  3DF0 B;  3PN7 B;  1ZFS A;  3KHE A;  4MVF A;  1N0Y A;  3I5G B;  1CDN A;  1B47 A;  2BE4 A;  4L9M A;  3WXA A;  2MAZ A;  3HCM A;  5HKY A;  1DF0 A;  3GK2 A;  1NP8 A;  2I94 A;  1JF0 A;  1FF1 A;  1K95 A;  4MBE A;  2JXC A;  1UWO A;  4PHJ A;  1MWN A;  4AQI A;  2JNF A;  1DTL A;  2OTG B;  1DJG A;  1KQM C;  1ALW A;  1R6P A;  1XYD A;  3SG6 A;  1S6J A;  1XO5 A;  4PE0 A;  3DVM A;  3VRN A;  1IJ5 A;  3LK0 A;  1B7T Z;  1IJ6 A;  4ORA B;  1D1O A;  2OS8 B;  1SL8 A;  2KGB C;  1J55 A;  2ZNE A;  3VRP A;  3I5F C;  3IF7 A;  3CR5 X;  1NPQ A;  3O2P A;  2NZ0 A;  2L0P A;  2ZRS A;  3CTN A;  2JZI A;  1L2O C;  3BUX B;  3D0Y A;  3BQ3 A;  1JF2 A;  3KPX A;  1CFC A;  2LLU A;  1J1D A;  1F55 A;  5HLV A;  2OPO A;  1ZUZ A;  2MLE C;  1S6I A;  1QX5 B;  1WDC B;  3D10 A;  1H8B A;  2CCM A;  1K9U A;  1K93 D;  1A03 A;  5AER A;  1K9P A;  2M0R A;  4Q04 A;  2K8M B;  4GGN A;  2LVV A;  4P2Y B;  3FS7 A;  1WRL A;  2KHN A;  4YGB B;  5J3X A;  2LVK A;  2ZFD A;  1UP5 A;  5HYD A;  4JWQ A;  3SIA A;  3OX6 A;  4M2Q A;  3DF0 A;  1OMV A;  2M7N A;  4BY4 A;  4MRX A;  5HLO A;  4GNK B;  2KSP A;  1XK4 A;  2K61 A;  2ZND A;  1TNW A;  1QAS A;  1KSO A;  1NWD A;  2H61 A;  1MXE A;  4YI9 A;  2JU0 A;  1A75 B;  1CFF A;  4I5N B;  2KYC A;  4GAO A;  2JXL A;  1YVL A;  3AAJ A;  4E68 A;  1CLM A;  1M39 A;  1BJF A;  2JC2 A;  3EKH A;  2H2K A;  3LK1 A;  3WHU B;  3WHT B;  3BOW B;  2O60 A;  1CFD A;  2BEC A;  1RRO A;  1J7R A;  1QTX A;  2V53 A;  2H61 C;  5AEQ A;  3PAL A;  1K96 A;  1AK8 A;  1XK4 C;  1KK7 Z;  4XYN A;  5BPJ A;  1YRT B;  3BYA A;  1QIW A;  3OHM B;  1WDC C;  2TN4 A;  5I2O A;  3DVK A;  3JVT C;  2E30 A;  3CWG A;  1LVC D;  2KFF A;  1NIW A;  2PSR A;  1V1G A;  2AMI A;  2LM5 A;  4HRG A;  3EKJ A;  4YI8 A;  4BY5 A;  1BLQ A;  4MZJ A;  4MSP A;  1A29 A;  2CT9 A;  1UHH A;  2Q91 A;  4GGF C;  2WCF A;  1Y6W A;  4I5L B;  1YTZ C;  2OTG C;  1WY9 A;  1J7O A;  1BU3 A;  1QIV A;  5KU1 A;  1IQ5 A;  3LLE A;  1LXF C;  2QAC A;  1JWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...