3CS1A

Flagellar calcium-binding protein (fcabp) from t. cruzi
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
192
structure length
191
Chain Sequence
SDKDGKKAKDRKEAWERIRQAIPREKTAEAKQRRIELFKKFDKNETGKLYDEVYSGCLEVLKLDEFTSRVRDITKRAFDKSRTLGSKLENKGSEDFVEFLEFRLMLCYIYDFFELTVMFDEIDASGNMLVDEEEFKRAVPKLEAWGAKVEDPAALFKELDKNGTGSVTFDEFAAWASAVKLDADGDPDNVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Flagellar calcium-binding protein
publication title Structural Insights into Membrane Targeting by the Flagellar Calcium-binding Protein (FCaBP), a Myristoylated and Palmitoylated Calcium Sensor in Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 74
structure length 191
sequence length 192
ec nomenclature
pdb deposition date 2008-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cs1A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3cs1A02
1DGVA 1G4YR 2KBMA 1CM4A 1UHIA 1OQPA 1UHKA 2Y1NA 3MSEB 1QLSA 1YR5A 2JNXA 3EVUA 1TNQA 4MBEA 2LVIA 2JOJA 4N1GA 5AERA 1GJYA 1E8AA 4MSPA 3WXAA 1IKUA 4OKHA 1YX8A 2NLNA 5CSJA 1YTZC 2K2FA 2CTNA 1WDCB 1B4CA 1Y1UA 1S6CA 3DVKA 3PN7B 1TCFA 1QASA 1IGVA 3TUYC 1B8CA 1SYMA 2P6BB 4WQ2A 2Y5IA 3JTDB 4PHKA 3O2PA 1J7PA 1F4QA 1CDMA 4YGEB 1XK4A 4C0LA 1SKTA 2L4IA 1BG1A 4U8DA 2BE6A 3BYAA 3TZ1A 1IWQA 3CLNA 3TDUA 2LMUA 1B9AA 1OE9B 2Y4QA 1PSBA 5I8NA 2ZNEA 4HRHA 3A8RA 3GK4X 1BT6A 1SNLA 2E30A 2GV5A 1KWOC 1CMGA 1KFXL 2KGRA 2M1KB 2KBIA 1M31A 2JWWA 1QIWA 4WRIA 4YRUA 3KHEA 1CDNA 5CSIA 1F54A 2EC6C 1Y0VH 2QACA 2L4HA 3NSIA 4XJKA 5AXIA 1LA0A 5G08A 2R2IA 1QJTA 2LCPA 4OV2A 3NXAA 2JC2A 1BODA 1MXLC 1PVBA 1B8RA 2KSPA 1CDPA 2PVBA 2V53A 4I5LB 2L2EA 2M1UA 2MHHA 2RGIA 1MUXA 2LE9B 4M2QA 3IQOA 4PE0A 1WRLA 3I5HB 1SPYA 3OHMB 3ZNIA 1KK7Z 1U5IA 2HQ8A 2LMTA 3EK8A 3KEVA 1CLBA 3PATA 3PSRA 3NSLA 1S5GZ 1J1EA 1WLZA 2H61C 4DRWA 3OP0A 2I7AA 4PHMA 2MBXA 4AQJA 1QTXA 1ZFSA 1YVLA 1NX0A 1UP5A 2OPOA 1K93D 4DUQA 1YUUA 1IRJA 1L7ZA 3CTNA 4JWQA 2CBLA 1S6JA 1N65A 4TNCA 5D7FA 4CFRA 1J55A 2JQ6A 4QJ4B 3OX5A 3CGAA 3TS5C 2KNEA 3VRPA 2LVVA 3AAKA 3SG2A 1WRKA 1K96A 2AUCA 2AAOA 2LV7A 1M46A 2KFHA 3DVEA 1OMRA 4MRYA 2ZNDA 3I5IB 5AFPA 1OMVA 2CT9A 1Y1XA 4GBAA 3F45A 1DF0B 1V1FA 1OZSA 2L50A 2NCOA 2OS8B 3QRXA 4R1EA 1EH2A 2JZIA 2OTGB 3OB2B 1NP8A 2F3YA 2LANA 2SCPA 3CR2A 1YUSA 2WCBA 2D8NA 3BUOB 3SIAA 3M0WA 2BCXA 4FTGA 1NWDA 1EL4A 3SG7A 4E68A 4PCWA 1XFXO 1IJ6A 1AUIB 4GGFC 1DTLA 1NIWA 2NXQA 4NDBA 2EGDA 5I2OA 2JU0A 1NCXA 5HKYA 1W7IB 1K94A 3KF9A 4CIDA 4PALA 1JF2A 1JSAA 2M3WA 4I5NB 5HYDA 1K9PA 2MJWB 1LA3A 1NCYA 2NCPA 5IBWA 1PRWA 2L51A 5DKRA 1G33A 1KQMC 1L2OC 2LLTA 5TNCA 2FJUB 3EK7A 1DMOA 1B8LA 1CFCA 4MZKA 1NX1A 2KHNA 3I5GB 1QX5B 3BUXB 1QATA 2ZKMX 1RROA 4YBHB 4A4CA 1AK8A 1M39A 2JT8A 2K61A 1QXPA 3I5HC 2PSRA 1DT7B 1OSAA 3JVTB 4NQGA 3D0YA 2MA2A 1FF1A 2M7NA 3WNXB 5HLOA 1CLLA 1BF5A 4PHJA 2ISDA 3BOWA 1B7TZ 2AMIA 1HQVA 2M8UA 4GAOA 1C7WA 1SBJA 4OCIA 5K89A 2JULA 4MZJA 1BMOA 1C07A 1CM1A 1QVIZ 1SY9A 5JJGA 1CFDA 1UHHA 1W7JB 1RFJA 1JF0A 1S26D 1FW4A 2BL0B 1EG4A 3VROA 3VRQA 1V1GA 4HRGA 4XJKB 3CWGA 1F55A 2LC5A 2JTZA 2MLEC 5DKNA 1AJ4A 5HKWA 1KK8C 1DJYA 3EK4A 2EHBA 3AKBA 3DF0A 2JXLA 2L98A 3LLEA 3GK1A 3VRRA 2WCEA 2QPTA 1MHOA 1KCYA 1R2UA 1XFUO 2H2KA 3SIBA 2ZN9A 1YUTA 2JNFA 1ZUZA 1GGWA 1A75A 1LXFC 2KOTA 3AKAA 1RJVA 1U5IB 4MEWA 1IH0A 2WNDA 3NSOA 1SCMB 2WC8A 1EG3A 1AP4A 2H61A 1XA5A 1XFVO 3EVVA 4BY4A 2ZRSA 3TDIA 4ETOA 2JPTA 1PSRA 1Y1AA 4CFQA 1EXRA 2VRGA 2DOQA 1YX7A 1CTRA 1AVSA 3DVJA 3SG6A 1SR6C 3PFVA 4ICBA 1FPWA 2K7BA 2LMVA 5CSFA 3KPXA 5D69A 1DJIA 1AHRA 2LHLA 1B47A 1QIVA 1AJ5A 1KSOA 1J7RA 1PALA 2KYCA 4I5KA 2KGBC 2PASA 1XFZO 3SJSA 1RECA 3PM8A 4FQOA 2KI4B 1C7VA 4A4BA 2JXCA 1KQVA 3BUWB 1BR1B 1GQMA 3KO0A 1FI6A 1UURA 2COLB 3TDZA 2KAXA 2LUXA 2F8PA 1XO5A 1WDCC 2K8MB 3PN7C 2KI6C 2FCDA 2I18A 2LLSA 1CDLA 5B8IB 2CCMA 2F33A 1R6PA 4GGFA 1NCZA 2FCEA 2M49B 4XYNA 2LUCA 4MLWA 1JFKA 1H4BA 3JTDC 2KFFA 1YRUB 4YI9A 5DKQA 4YGAA 2Q4UA 5FYXA 4GFTA 1BJFA 2BCBA 4N1FA 4CLNA 1NSHA 3GOFA 4L9MA 1FI5A 3EKHA 3K21A 1MR8A 2F2PA 1NPQA 2BKIB 3CS1A 1F4OA 2K2AA 2LM5A 2KYFA 2WORA 1S36A 3HCMA 3TUYB 1J7OA 2KDHA 2KAYA 1BLQA 4NDDA 1CFFA 1EJ3A 1SCMC 1QLKA 1IG5A 5AEQA 3D0YB 5KU1A 1CNPA 1TIZA 1QS7A 4AOMA 1F70A 5HKZA 1F71A 1RTP1 4PDZA 2SASA 2K7DA 2K0JA 1NYAA 1TNWA 4QJ3B 4HSZA 4F0ZB 4M2OA 1XYDA 5GQQC 2BECA 1IQ5A 2LP2A 3BUNB 4YGCB 3BQ3A 1D1OA 1KWOB 1LVCD 1S5GY 1DVIA 4ZCUA 3RLZA 2LP3A 2KAVA 1M45A 2E6WA 2HF5A 2M0RA 1CFPA 2EC6B 5BPJA 1A29A 1VRKA 1DJWA 1MQ1A 2BBMA 3I5FB 3ICBA 1IJ5A 3OB1B 4WQ3A 1SCVA 4PE4A 1ODBA 2Y1MA 2KQYA 1KFUL 4C0KA 2G2BA 3PALA 4UPGA 1JWDA 3DF0B 3VGOA 4ORBB 4PE1A 1DGUA 1CB1A 4DS7A 2TN4A 2G9BA 1XFWO 1A75B 2M97A 4YGBB 1UHNA 2Q91A 1UWOA 1S3PA 1S1EA 4CPVA 1SL7A 3SG3A 1SL9A 4DCKA 3DD4A 2IS9A 3EVRA 3I5IC 1K2HA 1KFUS 4DIRA 1TTXA 5CPVA 2OS8C 3O6BA 1TRFA 2M7LA 2LAPA 2OTGC 5PALA 1XFYO 3SG5A 1KSMA 1ALVA 4C0JA 3CR5X 4QJ5B 2A4JA 3TS5B 3OX6A 3FWBA 2B1UA 3LK0A 1OZOA 1UHJA 1IQ3A 1YURA 1TNPA 1MXEA 3FWCA 1TOPA 4MN0A 3D10A 4P2YB 4ORAB 3BXKA 2I94A 1BOCA 2K7OA 1TCOB 3EKJA 4PHNA 1NX3A 1K9UA 2BCAA 4GGNA 1ZOTB 4AQIA 1ALWA 5I2QA 2CNPA 2ZFDA 2JT0A 3O78A 1B1GA 2CXJA 2K7CA 1FBVA 4YGDB 2JRFA 1XVJA 4OVNF 3I5GC 1RWYA 1DJHA 1TN4A 2F2OA 2HPSA 2KFGA 3FIAA 3LL8B 3IQQA 5KSZA 1CLMA 2BE4A 1H8BA 1CKKA 1WLMA 1B7TY 3BUMB 2NZ0A 3A4UB 3HX4A 2GGMA 3JVTC 4YI8A 1XK4C 5ER4X 3AAJA 1MWNA 3I5FC 1DJGA 4N5XA 5KTYA 1JBAA 5F6TA 1A2XA 3PLFB 1DJXA 1KQMB 1L2OB 1OMDA 2F3ZA 2M9GA 2PRUA 1QVIY 1J7QA 4GPLB 2GGZA 3GK2A 3NSKA 1ZMZA 2MRDA 1QV1A 3WHUB 3H4SE 1KFXS 4JQ0D 4USLA 5AANA 4ZCVA 1HT9A 1DJZA 1YRTB 2O5GA 3DVMA 1F8HA 1GGZA 2ZN8A 1Y6WA 4D1EA 1LINA 1PVAA 3C1VA 2BL0C 1Q80A 1PULA 2KI6D 2L5XB 4MRXA 5HLVA 4HREE 2L0PA 1K8UA 4OR9B 1SRAA 2LHIA 1QX2A 3E3RA 1A03A 4PE7A 4BY5A 4ORCB 2BBNA 4Q04A 4NDCA 5JOLA 1SMGA 1A4PA 1K95A 1M63B 1MF8B 1SL8A 1ZACA 1PK0D 2HETA 1S6IA 1K9KA 2I2RE 1OOJA 1RK9A 2LLUA 5ER5A 1JFJA 2WOSA 1BR4B 2WCFA 3BOWB 2HQWA 1NX2A 1KK8B 2JT3A 1BU3A 3SG4A 2O60A 3WHTB 4M2PA 2JTTA 1TNXA 3LCPC 4JPZB 1X02A 1NUBA 4GNKB 2FOTA 2LNKA 3IF7A 4I5JA 1KK7Y 5CSNA 1JC2A 2BKHB 2ZRTA 4MZLA 2M29A 1G8IA 1SW8A 3O4YA 1JUOA 1N0YA 1QV0A 3ZWHA 3CZTX 2LVKA 5J3XA 2LVJA 1WRZA 2PMYA 1CMFA 3CR4X 3VRNA 1QX7A 2KI4C 2KQ6A 4GUKA 1DF0A 4MVFA 1YVHA 5I2LA 4IL1A 3RM1A 4P5OE 1K90D 1SK6D 1WY9A 1N2DA 2MAZA 3FS7A 1SR6B 3LK1A 2PALA 1J1DA 2MLFC 1LKJA 1UUSA
chains in the Genus database with same CATH superfamily
1DGVA 3D75A 5FI6A 1G4YR 2KBMA 1CM4A 1UHIA 1OQPA 2WC6A 1UHKA 2Y1NA 3MSEB 2QEBA 1QLSA 1YR5A 2JNXA 3EVUA 1TNQA 4MBEA 3L4AA 2LVIA 3OGNA 2JOJA 4N1GA 5AERA 1GJYA 1E8AA 4MSPA 3WXAA 1IKUA 2KPHA 2WCKA 1YX8A 2NLNA 4OKHA 5CSJA 1YTZC 2K2FA 2CTNA 1WDCB 1B4CA 1Y1UA 3CZ1A 1S6CA 3DVKA 3PN7B 1TCFA 1QASA 1IGVA 3TUYC 2FJYA 1B8CA 1SYMA 2P6BB 4WQ2A 2Y5IA 3JTDB 4PHKA 3O2PA 1J7PA 1F4QA 1CDMA 3V2LA 3O4XA 4YGEB 3QMEA 1XK4A 4C0LA 1SKTA 2L4IA 1BG1A 4U8DA 2BE6A 3BYAA 3IVTA 1IWQA 3TZ1A 3CLNA 3TDUA 2LMUA 1B9AA 1OE9B 2Y4QA 1PSBA 5I8NA 3SS5A 2ZNEA 4HRHA 3A8RA 3GK4X 1BT6A 1SNLA 2E30A 2GV5A 1KWOC 1CMGA 1KFXL 1OOFA 2KGRA 2KBIA 2M1KB 1M31A 2JWWA 1QIWA 4WRIA 4YRUA 3KHEA 1CDNA 2WCHA 5CSIA 1F54A 2EC6C 1Y0VH 2QACA 3S0FA 2L4HA 3NSIA 4XJKA 5AXIA 1LA0A 5G08A 2R2IA 1QJTA 2L5YA 2LCPA 4OV2A 3NXAA 2JC2A 1BODA 1MXLC 1PVBA 1B8RA 2KSPA 1CDPA 2PVBA 2V53A 4I5LB 2L2EA 2M1UA 2MHHA 2RGIA 4IJ7A 1MUXA 2LE9B 4M2QA 3IQOA 3L47A 3D78A 4PE0A 1WRLA 3I5HB 1SPYA 3OHMB 3ZNIA 1KK7Z 1U5IA 2HQ8A 2LMTA 3EK8A 3KEVA 1CLBA 3PATA 3PSRA 3NSLA 1S5GZ 1J1EA 1WLZA 3S0EA 2H61C 4DRWA 3OP0A 1DELA 2I7AA 4PHMA 2MBXA 4AQJA 1QTXA 1ZFSA 1YVLA 1NX0A 1UP5A 2OPOA 1K93D 3S0BA 1YUUA 4DUQA 1IRJA 2L2CA 3OBVA 1L7ZA 3CTNA 4JWQA 2CBLA 1S6JA 1N65A 4TNCA 5D7FA 4CFRA 1J55A 2JQ6A 4QJ4B 3OX5A 3CGAA 3TS5C 2KNEA 3VRPA 2LVVA 3AAKA 3SG2A 1WRKA 4JKTA 1K96A 2AUCA 2AAOA 2LV7A 1M46A 2KFHA 3DVEA 1OMRA 3DY9A 2ZNDA 3I5IB 1OOIX 4MRYA 3SS3A 1OMVA 3CABA 2CT9A 1Y1XA 4GBAA 3F45A 1DF0B 1V1FA 1OZSA 2L50A 2NCOA 2OS8B 3QRXA 4R1EA 1EH2A 2JZIA 2OTGB 3OB2B 1NP8A 2F3YA 2LANA 2SCPA 3CR2A 1YUSA 2WCBA 2D8NA 3BUOB 3SIAA 3M0WA 2BCXA 4FTGA 1NWDA 1EL4A 3SG7A 4E68A 4PCWA 1TUJA 1XFXO 1IJ6A 1AUIB 4GGFC 1DTLA 1NIWA 2NXQA 4NDBA 2EGDA 5I2OA 2JU0A 1NCXA 5HKYA 1W7IB 3NHTA 1K94A 3KF9A 4CIDA 4PALA 1JF2A 1JSAA 2M3WA 4I5NB 5HYDA 1ORGA 1K9PA 2MJWB 1LA3A 1NCYA 2NCPA 5IBWA 1PRWA 2L51A 5DKRA 1G33A 1KQMC 1L2OC 3UNWA 2LLTA 5TNCA 2FJUB 3EK7A 1DMOA 1B8LA 1CFCA 4MZKA 1NX1A 2KHNA 3I5GB 3FE6A 1QX5B 3BUXB 1QATA 2ZKMX 1RROA 4YBHB 4A4CA 1AK8A 1M39A 5D3OA 2JT8A 2K61A 1QXPA 3BFHA 3I5HC 2PSRA 1DT7B 1OSAA 3JVTB 4NQGA 3D0YA 2MA2A 1FF1A 2M7NA 3R1PA 5HLOA 1CLLA 3WNXB 4PHJA 2ISDA 1BF5A 3BOWA 1B7TZ 3RZSA 1HQVA 2AMIA 2M8UA 4GAOA 1C7WA 1SBJA 4JD9A 4OCIA 5K89A 2JULA 4MZJA 3S0AA 1BMOA 1TUZA 1C07A 2H8VA 1CM1A 1QVIZ 1SY9A 3B86A 5JJGA 1CFDA 1UHHA 1W7JB 1RFJA 3DXLA 1JF0A 1S26D 1FW4A 2BL0B 1EG4A 3VROA 3VRQA 1V1GA 3D73A 4HRGA 3CWGA 4XJKB 1F55A 2LC5A 2JTZA 2MLEC 2QDIA 1AJ4A 5DKNA 5HKWA 1KK8C 1DJYA 3EK4A 2EHBA 3AKBA 3DF0A 2JXLA 2L98A 3LLEA 3R1OA 3GK1A 3VRRA 2WCEA 2QPTA 1MHOA 4INXA 1KCYA 1R2UA 1XFUO 2H2KA 3SIBA 2ZN9A 1YUTA 1DC1A 2JNFA 1ZUZA 1GGWA 1A75A 1LXFC 2KOTA 3AKAA 1RJVA 1U5IB 3BFAA 4MEWA 2WNDA 3NSOA 1SCMB 2BAPA 1LS8A 2WC8A 3R72A 1IH0A 3K1EA 1EG3A 2QEOA 1AP4A 2ERBA 1XA5A 2H61A 1XFVO 3EVVA 4BY4A 2ZRSA 3TDIA 4ETOA 2JPTA 1PSRA 1Y1AA 4CFQA 2WC5A 1EXRA 2VRGA 5AFPA 2DOQA 1YX7A 2JPOA 1CTRA 1AVSA 3DVJA 3SG6A 1SR6C 3PFVA 4ICBA 1FPWA 2K7BA 2LMVA 5CSFA 3KPXA 5D69A 1DJIA 1AHRA 1C3YA 2LHLA 1B47A 1QIVA 1AJ5A 1KSOA 1J7RA 1PALA 2KYCA 4I5KA 2KGBC 2PASA 3D74A 1XFZO 3SJSA 1RECA 3PM8A 4FQOA 2KI4B 1C7VA 5FI2A 2KLEA 3B87A 4INWA 4A4BA 2JXCA 1KQVA 3BUWB 1BR1B 1GQMA 3KO0A 1FI6A 1UURA 5EL2A 2COLB 3TDZA 2KAXA 2LUXA 2F8PA 1XO5A 1WDCC 2K8MB 3PN7C 2KI6C 2FCDA 2I18A 2LLSA 1CDLA 5B8IB 2CCMA 2F33A 1R6PA 4GGFA 1OOGA 1NCZA 1TWOA 2FCEA 2M49B 4XYNA 2LUCA 1OOHA 4MLWA 1JFKA 3L4LA 1H4BA 3JTDC 2KFFA 1YRUB 4YI9A 5DKQA 4YGAA 2Q4UA 5FYXA 4GFTA 1BJFA 3D77A 2BCBA 4N1FA 4CLNA 1NSHA 3GOFA 4L9MA 1FI5A 3EKHA 3K21A 1MR8A 2F2PA 1NPQA 2BKIB 3CS1A 1F4OA 2K2AA 2LM5A 2KYFA 2WORA 1S36A 3HCMA 3TUYB 1J7OA 2KDHA 2KAYA 1BLQA 4NDDA 1CFFA 1EJ3A 1SCMC 1QLKA 1IG5A 5AEQA 3D0YB 3CZ2A 2GTEA 5KU1A 1CNPA 1TIZA 1QS7A 4AOMA 1F70A 3DYEA 3FE8A 5HKZA 1F71A 1RTP1 4PDZA 2SASA 2K7DA 2K0JA 3B6XA 3CDNA 1NYAA 1TNWA 4QJ3B 4HSZA 4F0ZB 4M2OA 1XYDA 5GQQC 1Z2CB 2BECA 1IQ5A 2LP2A 3BUNB 4YGCB 5FI7A 3VB1A 3BQ3A 1D1OA 1KWOB 1C3ZA 1LVCD 1S5GY 1DVIA 4ZCUA 3RLZA 2LP3A 2KAVA 1M45A 2E6WA 2HF5A 2M0RA 1CFPA 2EC6B 1SSEB 2P71A 2QEHA 5BPJA 1A29A 1VRKA 1DJWA 1MQ1A 2BBMA 3I5FB 3ICBA 1IJ5A 3OB1B 4WQ3A 1SCVA 1DEKA 4PE4A 1ODBA 2Y1MA 2KQYA 1KFUL 4C0KA 1OW4A 2G2BA 3PALA 4UPGA 3DF0B 1JWDA 3VGOA 2K60A 2QEVA 4ORBB 4PE1A 1DGUA 1CB1A 4DS7A 1XFRA 2TN4A 2G9BA 1XFWO 1Z4HA 5DICA 1A75B 2M97A 4YGBB 1UHNA 2Q91A 1UWOA 1S3PA 1S1EA 4CPVA 1SL7A 3SG3A 1SL9A 4DCKA 3BJHA 3CYZA 3DD4A 2IS9A 3EVRA 3I5IC 1K2HA 1KFUS 4DIRA 1TTXA 5CPVA 2OS8C 3O6BA 1TRFA 2M7LA 2LAPA 2OTGC 5PALA 1XFYO 3SG5A 4F7FA 1KSMA 1ALVA 4C0JA 2YGUA 3CR5X 4QJ5B 2A4JA 3TS5B 3OX6A 3FWBA 3S0DA 1GM0A 2B1UA 3LK0A 1OZOA 1UHJA 1IQ3A 1YURA 1TNPA 1MXEA 2BNXA 3FWCA 1TOPA 4MN0A 3D10A 4P2YB 4ORAB 3BXKA 2I94A 1BOCA 2K7OA 1TCOB 3EKJA 4PHNA 3NGVA 3BFBA 1NX3A 4KYNA 3FE9A 1K9UA 2BCAA 3NHIA 4GGNA 1ZOTB 2PYQA 1ALWA 4AQIA 5I2QA 2CNPA 2ZFDA 2JT0A 3O78A 1B1GA 3PJIA 2CXJA 2K7CA 1FBVA 4YGDB 2JRFA 1XVJA 4OVNF 2PQLA 3I5GC 2KLDA 1RWYA 1DJHA 1TN4A 2F2OA 2HPSA 2KFGA 3FIAA 3LL8B 3IQQA 2WCJA 5KSZA 1CLMA 2BE4A 1H8BA 1CKKA 1WLMA 1B7TY 3BUMB 2NZ0A 3A4UB 3HX4A 2GGMA 3JVTC 4YI8A 1XK4C 1T14A 3AAJA 5ER4X 1MWNA 3DZTA 1DJGA 3I5FC 4N5XA 5KTYA 1JBAA 5F6TA 1A2XA 3PLFB 1DJXA 1KQMB 1L2OB 1OMDA 2F3ZA 2M9GA 2PRUA 1QVIY 1J7QA 4GPLB 2GGZA 3GK2A 3NSKA 1ZMZA 2MRDA 3Q8IA 1QV1A 3PM2A 3WHUB 3H4SE 1KFXS 4JQ0D 4USLA 2WCMA 4PT1A 5AANA 5I94A 4ZCVA 1HT9A 1DJZA 1YRTB 2O5GA 1W9ZA 3DVMA 3UO9A 1F8HA 1GGZA 2ZN8A 1Y6WA 4D1EA 1LINA 1PVAA 3C1VA 2BL0C 1Q80A 1PULA 2KI6D 2L5XB 4MRXA 5HLVA 4HREE 3EG5B 1QWVA 2L0PA 1K8UA 3B7AA 4OR9B 1SRAA 2LHIA 3R1VA 1QX2A 3E3RA 3SS4A 1A03A 4PE7A 4BY5A 4ORCB 2BBNA 4Q04A 4NDCA 5JOLA 1SMGA 1A4PA 1K95A 1M63B 1MF8B 1SL8A 1ZACA 1PK0D 2HETA 1S6IA 1K9KA 2I2RE 1OOJA 1RK9A 2LLUA 5ER5A 1JFJA 2WOSA 1BR4B 2WCFA 3BOWB 2HQWA 1NX2A 1KK8B 2JT3A 1BU3A 3SG4A 2O60A 3WHTB 4M2PA 1P28A 2JTTA 1TNXA 3LCPC 4JPZB 1X02A 1NUBA 4GNKB 2FOTA 2LNKA 3IF7A 4I5JA 1KK7Y 5CSNA 1JC2A 2BKHB 1DQEA 2ZRTA 4MZLA 2M29A 3S0GA 1G8IA 3CZ0A 1SW8A 3O4YA 4OZDA 1JUOA 1N0YA 1QV0A 3ZWHA 3CZTX 2LVKA 5J3XA 2LVJA 1WRZA 2PMYA 1CMFA 3CR4X 3VRNA 1QX7A 2P70A 2KI4C 2KQ6A 4GUKA 1DF0A 4MVFA 1YVHA 5I2LA 3N7HA 3D76A 4IL1A 4FQTA 3RM1A 4P5OE 1IIOA 1K90D 1SK6D 2WCLA 1WY9A 1N2DA 3B88A 2MAZA 3FS7A 1SR6B 3LK1A 5HL1A 2PALA 1J1DA 2MLFC 1LKJA 1UUSA
chains in the Genus database with same CATH topology
1DGVA 1G4YR 2KBMA 1CM4A 1UHIA 1OQPA 1UHKA 2Y1NA 3MSEB 1QLSA 1YR5A 2JNXA 3EVUA 1TNQA 4MBEA 2LVIA 2JOJA 4N1GA 5AERA 1GJYA 1E8AA 4MSPA 3WXAA 1IKUA 4OKHA 1YX8A 2NLNA 5CSJA 1YTZC 2K2FA 2CTNA 1WDCB 1B4CA 1Y1UA 1S6CA 3DVKA 3PN7B 1TCFA 1QASA 1IGVA 3TUYC 1B8CA 1SYMA 2P6BB 4WQ2A 2Y5IA 3JTDB 4PHKA 3O2PA 1J7PA 1F4QA 1CDMA 4YGEB 1XK4A 4C0LA 1SKTA 2L4IA 1BG1A 4U8DA 2BE6A 3BYAA 3TZ1A 1IWQA 3CLNA 3TDUA 2LMUA 1B9AA 1OE9B 2Y4QA 1PSBA 5I8NA 2ZNEA 4HRHA 3A8RA 3GK4X 1BT6A 1SNLA 2E30A 2GV5A 1KWOC 1CMGA 1KFXL 2KGRA 2M1KB 2KBIA 1M31A 2JWWA 1QIWA 4WRIA 4YRUA 3KHEA 1CDNA 5CSIA 1F54A 2EC6C 1Y0VH 2QACA 2L4HA 3NSIA 4XJKA 5AXIA 1LA0A 5G08A 2R2IA 1QJTA 2LCPA 4OV2A 3NXAA 2JC2A 1BODA 1MXLC 1PVBA 1B8RA 2KSPA 1CDPA 2PVBA 2V53A 4I5LB 2L2EA 2M1UA 2MHHA 2RGIA 1MUXA 2LE9B 4M2QA 3IQOA 4PE0A 1WRLA 3I5HB 1SPYA 3OHMB 3ZNIA 1KK7Z 1U5IA 2HQ8A 2LMTA 3EK8A 3KEVA 1CLBA 3PATA 3PSRA 3NSLA 1S5GZ 1J1EA 1WLZA 2H61C 4DRWA 3OP0A 2I7AA 4PHMA 2MBXA 4AQJA 1QTXA 1ZFSA 1YVLA 1NX0A 1UP5A 2OPOA 1K93D 4DUQA 1YUUA 1IRJA 1L7ZA 3CTNA 4JWQA 2CBLA 1S6JA 1N65A 4TNCA 5D7FA 4CFRA 1J55A 2JQ6A 4QJ4B 3OX5A 3CGAA 3TS5C 2KNEA 3VRPA 2LVVA 3AAKA 3SG2A 1WRKA 1K96A 2AUCA 2AAOA 2LV7A 1M46A 2KFHA 3DVEA 1OMRA 4MRYA 2ZNDA 3I5IB 5AFPA 1OMVA 2CT9A 1Y1XA 4GBAA 3F45A 1DF0B 1V1FA 1OZSA 2L50A 2NCOA 2OS8B 3QRXA 4R1EA 1EH2A 2JZIA 2OTGB 3OB2B 1NP8A 2F3YA 2LANA 2SCPA 3CR2A 1YUSA 2WCBA 2D8NA 3BUOB 3SIAA 3M0WA 2BCXA 4FTGA 1NWDA 1EL4A 3SG7A 4E68A 4PCWA 1XFXO 1IJ6A 1AUIB 4GGFC 1DTLA 1NIWA 2NXQA 4NDBA 2EGDA 5I2OA 2JU0A 1NCXA 5HKYA 1W7IB 1K94A 3KF9A 4CIDA 4PALA 1JF2A 1JSAA 2M3WA 4I5NB 5HYDA 1K9PA 2MJWB 1LA3A 1NCYA 2NCPA 5IBWA 1PRWA 2L51A 5DKRA 1G33A 1KQMC 1L2OC 2LLTA 5TNCA 2FJUB 3EK7A 1DMOA 1B8LA 1CFCA 4MZKA 1NX1A 2KHNA 3I5GB 1QX5B 3BUXB 1QATA 2ZKMX 1RROA 4YBHB 4A4CA 1AK8A 1M39A 2JT8A 2K61A 1QXPA 3I5HC 2PSRA 1DT7B 1OSAA 3JVTB 4NQGA 3D0YA 2MA2A 1FF1A 2M7NA 3WNXB 5HLOA 1CLLA 1BF5A 4PHJA 2ISDA 3BOWA 1B7TZ 2AMIA 1HQVA 2M8UA 4GAOA 1C7WA 1SBJA 4OCIA 5K89A 2JULA 4MZJA 1BMOA 1C07A 1CM1A 1QVIZ 1SY9A 5JJGA 1CFDA 1UHHA 1W7JB 1RFJA 1JF0A 1S26D 1FW4A 2BL0B 1EG4A 3VROA 3VRQA 1V1GA 4HRGA 4XJKB 3CWGA 1F55A 2LC5A 2JTZA 2MLEC 5DKNA 1AJ4A 5HKWA 1KK8C 1DJYA 3EK4A 2EHBA 3AKBA 3DF0A 2JXLA 2L98A 3LLEA 3GK1A 3VRRA 2WCEA 2QPTA 1MHOA 1KCYA 1R2UA 1XFUO 2H2KA 3SIBA 2ZN9A 1YUTA 2JNFA 1ZUZA 1GGWA 1A75A 1LXFC 2KOTA 3AKAA 1RJVA 1U5IB 4MEWA 1IH0A 2WNDA 3NSOA 1SCMB 2WC8A 1EG3A 1AP4A 2H61A 1XA5A 1XFVO 3EVVA 4BY4A 2ZRSA 3TDIA 4ETOA 2JPTA 1PSRA 1Y1AA 4CFQA 1EXRA 2VRGA 2DOQA 1YX7A 1CTRA 1AVSA 3DVJA 3SG6A 1SR6C 3PFVA 4ICBA 1FPWA 2K7BA 2LMVA 5CSFA 3KPXA 5D69A 1DJIA 1AHRA 2LHLA 1B47A 1QIVA 1AJ5A 1KSOA 1J7RA 1PALA 2KYCA 4I5KA 2KGBC 2PASA 1XFZO 3SJSA 1RECA 3PM8A 4FQOA 2KI4B 1C7VA 4A4BA 2JXCA 1KQVA 3BUWB 1BR1B 1GQMA 3KO0A 1FI6A 1UURA 2COLB 3TDZA 2KAXA 2LUXA 2F8PA 1XO5A 1WDCC 2K8MB 3PN7C 2KI6C 2FCDA 2I18A 2LLSA 1CDLA 5B8IB 2CCMA 2F33A 1R6PA 4GGFA 1NCZA 2FCEA 2M49B 4XYNA 2LUCA 4MLWA 1JFKA 1H4BA 3JTDC 2KFFA 1YRUB 4YI9A 5DKQA 4YGAA 2Q4UA 5FYXA 4GFTA 1BJFA 2BCBA 4N1FA 4CLNA 1NSHA 3GOFA 4L9MA 1FI5A 3EKHA 3K21A 1MR8A 2F2PA 1NPQA 2BKIB 3CS1A 1F4OA 2K2AA 2LM5A 2KYFA 2WORA 1S36A 3HCMA 3TUYB 1J7OA 2KDHA 2KAYA 1BLQA 4NDDA 1CFFA 1EJ3A 1SCMC 1QLKA 1IG5A 5AEQA 3D0YB 5KU1A 1CNPA 1TIZA 1QS7A 4AOMA 1F70A 5HKZA 1F71A 1RTP1 4PDZA 2SASA 2K7DA 2K0JA 1NYAA 1TNWA 4QJ3B 4HSZA 4F0ZB 4M2OA 1XYDA 5GQQC 2BECA 1IQ5A 2LP2A 3BUNB 4YGCB 3BQ3A 1D1OA 1KWOB 1LVCD 1S5GY 1DVIA 4ZCUA 3RLZA 2LP3A 2KAVA 1M45A 2E6WA 2HF5A 2M0RA 1CFPA 2EC6B 5BPJA 1A29A 1VRKA 1DJWA 1MQ1A 2BBMA 3I5FB 3ICBA 1IJ5A 3OB1B 4WQ3A 1SCVA 4PE4A 1ODBA 2Y1MA 2KQYA 1KFUL 4C0KA 2G2BA 3PALA 4UPGA 1JWDA 3DF0B 3VGOA 4ORBB 4PE1A 1DGUA 1CB1A 4DS7A 2TN4A 2G9BA 1XFWO 1A75B 2M97A 4YGBB 1UHNA 2Q91A 1UWOA 1S3PA 1S1EA 4CPVA 1SL7A 3SG3A 1SL9A 4DCKA 3DD4A 2IS9A 3EVRA 3I5IC 1K2HA 1KFUS 4DIRA 1TTXA 5CPVA 2OS8C 3O6BA 1TRFA 2M7LA 2LAPA 2OTGC 5PALA 1XFYO 3SG5A 1KSMA 1ALVA 4C0JA 3CR5X 4QJ5B 2A4JA 3TS5B 3OX6A 3FWBA 2B1UA 3LK0A 1OZOA 1UHJA 1IQ3A 1YURA 1TNPA 1MXEA 3FWCA 1TOPA 4MN0A 3D10A 4P2YB 4ORAB 3BXKA 2I94A 1BOCA 2K7OA 1TCOB 3EKJA 4PHNA 1NX3A 1K9UA 2BCAA 4GGNA 1ZOTB 4AQIA 1ALWA 5I2QA 2CNPA 2ZFDA 2JT0A 3O78A 1B1GA 2CXJA 2K7CA 1FBVA 4YGDB 2JRFA 1XVJA 4OVNF 3I5GC 1RWYA 1DJHA 1TN4A 2F2OA 2HPSA 2KFGA 3FIAA 3LL8B 3IQQA 5KSZA 1CLMA 2BE4A 1H8BA 1CKKA 1WLMA 1B7TY 3BUMB 2NZ0A 3A4UB 3HX4A 2GGMA 3JVTC 4YI8A 1XK4C 5ER4X 3AAJA 1MWNA 3I5FC 1DJGA 4N5XA 5KTYA 1JBAA 5F6TA 1A2XA 3PLFB 1DJXA 1KQMB 1L2OB 1OMDA 2F3ZA 2M9GA 2PRUA 1QVIY 1J7QA 4GPLB 2GGZA 3GK2A 3NSKA 1ZMZA 2MRDA 1QV1A 3WHUB 3H4SE 1KFXS 4JQ0D 4USLA 5AANA 4ZCVA 1HT9A 1DJZA 1YRTB 2O5GA 3DVMA 1F8HA 1GGZA 2ZN8A 1Y6WA 4D1EA 1LINA 1PVAA 3C1VA 2BL0C 1Q80A 1PULA 2KI6D 2L5XB 4MRXA 5HLVA 4HREE 2L0PA 1K8UA 4OR9B 1SRAA 2LHIA 1QX2A 3E3RA 1A03A 4PE7A 4BY5A 4ORCB 2BBNA 4Q04A 4NDCA 5JOLA 1SMGA 1A4PA 1K95A 1M63B 1MF8B 1SL8A 1ZACA 1PK0D 2HETA 1S6IA 1K9KA 2I2RE 1OOJA 1RK9A 2LLUA 5ER5A 1JFJA 2WOSA 1BR4B 2WCFA 3BOWB 2HQWA 1NX2A 1KK8B 2JT3A 1BU3A 3SG4A 2O60A 3WHTB 4M2PA 2JTTA 1TNXA 3LCPC 4JPZB 1X02A 1NUBA 4GNKB 2FOTA 2LNKA 3IF7A 4I5JA 1KK7Y 5CSNA 1JC2A 2BKHB 2ZRTA 4MZLA 2M29A 1G8IA 1SW8A 3O4YA 1JUOA 1N0YA 1QV0A 3ZWHA 3CZTX 2LVKA 5J3XA 2LVJA 1WRZA 2PMYA 1CMFA 3CR4X 3VRNA 1QX7A 2KI4C 2KQ6A 4GUKA 1DF0A 4MVFA 1YVHA 5I2LA 4IL1A 3RM1A 4P5OE 1K90D 1SK6D 1WY9A 1N2DA 2MAZA 3FS7A 1SR6B 3LK1A 2PALA 1J1DA 2MLFC 1LKJA 1UUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGV A;  1G4Y R;  2KBM A;  1CM4 A;  1UHI A;  1OQP A;  1UHK A;  2Y1N A;  3MSE B;  1QLS A;  1YR5 A;  2JNX A;  3EVU A;  1TNQ A;  4MBE A;  2LVI A;  2JOJ A;  4N1G A;  5AER A;  1GJY A;  1E8A A;  4MSP A;  3WXA A;  1IKU A;  4OKH A;  1YX8 A;  2NLN A;  5CSJ A;  1YTZ C;  2K2F A;  2CTN A;  1WDC B;  1B4C A;  1Y1U A;  1S6C A;  3DVK A;  3PN7 B;  1TCF A;  1QAS A;  1IGV A;  3TUY C;  1B8C A;  1SYM A;  2P6B B;  4WQ2 A;  2Y5I A;  3JTD B;  4PHK A;  3O2P A;  1J7P A;  1F4Q A;  1CDM A;  4YGE B;  1XK4 A;  4C0L A;  1SKT A;  2L4I A;  1BG1 A;  4U8D A;  2BE6 A;  3BYA A;  3TZ1 A;  1IWQ A;  3CLN A;  3TDU A;  2LMU A;  1B9A A;  1OE9 B;  2Y4Q A;  1PSB A;  5I8N A;  2ZNE A;  4HRH A;  3A8R A;  3GK4 X;  1BT6 A;  1SNL A;  2E30 A;  2GV5 A;  1KWO C;  1CMG A;  1KFX L;  2KGR A;  2M1K B;  2KBI A;  1M31 A;  2JWW A;  1QIW A;  4WRI A;  4YRU A;  3KHE A;  1CDN A;  5CSI A;  1F54 A;  2EC6 C;  1Y0V H;  2QAC A;  2L4H A;  3NSI A;  4XJK A;  5AXI A;  1LA0 A;  5G08 A;  2R2I A;  1QJT A;  2LCP A;  4OV2 A;  3NXA A;  2JC2 A;  1BOD A;  1MXL C;  1PVB A;  1B8R A;  2KSP A;  1CDP A;  2PVB A;  2V53 A;  4I5L B;  2L2E A;  2M1U A;  2MHH A;  2RGI A;  1MUX A;  2LE9 B;  4M2Q A;  3IQO A;  4PE0 A;  1WRL A;  3I5H B;  1SPY A;  3OHM B;  3ZNI A;  1KK7 Z;  1U5I A;  2HQ8 A;  2LMT A;  3EK8 A;  3KEV A;  1CLB A;  3PAT A;  3PSR A;  3NSL A;  1S5G Z;  1J1E A;  1WLZ A;  2H61 C;  4DRW A;  3OP0 A;  2I7A A;  4PHM A;  2MBX A;  4AQJ A;  1QTX A;  1ZFS A;  1YVL A;  1NX0 A;  1UP5 A;  2OPO A;  1K93 D;  4DUQ A;  1YUU A;  1IRJ A;  1L7Z A;  3CTN A;  4JWQ A;  2CBL A;  1S6J A;  1N65 A;  4TNC A;  5D7F A;  4CFR A;  1J55 A;  2JQ6 A;  4QJ4 B;  3OX5 A;  3CGA A;  3TS5 C;  2KNE A;  3VRP A;  2LVV A;  3AAK A;  3SG2 A;  1WRK A;  1K96 A;  2AUC A;  2AAO A;  2LV7 A;  1M46 A;  2KFH A;  3DVE A;  1OMR A;  4MRY A;  2ZND A;  3I5I B;  5AFP A;  1OMV A;  2CT9 A;  1Y1X A;  4GBA A;  3F45 A;  1DF0 B;  1V1F A;  1OZS A;  2L50 A;  2NCO A;  2OS8 B;  3QRX A;  4R1E A;  1EH2 A;  2JZI A;  2OTG B;  3OB2 B;  1NP8 A;  2F3Y A;  2LAN A;  2SCP A;  3CR2 A;  1YUS A;  2WCB A;  2D8N A;  3BUO B;  3SIA A;  3M0W A;  2BCX A;  4FTG A;  1NWD A;  1EL4 A;  3SG7 A;  4E68 A;  4PCW A;  1XFX O;  1IJ6 A;  1AUI B;  4GGF C;  1DTL A;  1NIW A;  2NXQ A;  4NDB A;  2EGD A;  5I2O A;  2JU0 A;  1NCX A;  5HKY A;  1W7I B;  1K94 A;  3KF9 A;  4CID A;  4PAL A;  1JF2 A;  1JSA A;  2M3W A;  4I5N B;  5HYD A;  1K9P A;  2MJW B;  1LA3 A;  1NCY A;  2NCP A;  5IBW A;  1PRW A;  2L51 A;  5DKR A;  1G33 A;  1KQM C;  1L2O C;  2LLT A;  5TNC A;  2FJU B;  3EK7 A;  1DMO A;  1B8L A;  1CFC A;  4MZK A;  1NX1 A;  2KHN A;  3I5G B;  1QX5 B;  3BUX B;  1QAT A;  2ZKM X;  1RRO A;  4YBH B;  4A4C A;  1AK8 A;  1M39 A;  2JT8 A;  2K61 A;  1QXP A;  3I5H C;  2PSR A;  1DT7 B;  1OSA A;  3JVT B;  4NQG A;  3D0Y A;  2MA2 A;  1FF1 A;  2M7N A;  3WNX B;  5HLO A;  1CLL A;  1BF5 A;  4PHJ A;  2ISD A;  3BOW A;  1B7T Z;  2AMI A;  1HQV A;  2M8U A;  4GAO A;  1C7W A;  1SBJ A;  4OCI A;  5K89 A;  2JUL A;  4MZJ A;  1BMO A;  1C07 A;  1CM1 A;  1QVI Z;  1SY9 A;  5JJG A;  1CFD A;  1UHH A;  1W7J B;  1RFJ A;  1JF0 A;  1S26 D;  1FW4 A;  2BL0 B;  1EG4 A;  3VRO A;  3VRQ A;  1V1G A;  4HRG A;  4XJK B;  3CWG A;  1F55 A;  2LC5 A;  2JTZ A;  2MLE C;  5DKN A;  1AJ4 A;  5HKW A;  1KK8 C;  1DJY A;  3EK4 A;  2EHB A;  3AKB A;  3DF0 A;  2JXL A;  2L98 A;  3LLE A;  3GK1 A;  3VRR A;  2WCE A;  2QPT A;  1MHO A;  1KCY A;  1R2U A;  1XFU O;  2H2K A;  3SIB A;  2ZN9 A;  1YUT A;  2JNF A;  1ZUZ A;  1GGW A;  1A75 A;  1LXF C;  2KOT A;  3AKA A;  1RJV A;  1U5I B;  4MEW A;  1IH0 A;  2WND A;  3NSO A;  1SCM B;  2WC8 A;  1EG3 A;  1AP4 A;  2H61 A;  1XA5 A;  1XFV O;  3EVV A;  4BY4 A;  2ZRS A;  3TDI A;  4ETO A;  2JPT A;  1PSR A;  1Y1A A;  4CFQ A;  1EXR A;  2VRG A;  2DOQ A;  1YX7 A;  1CTR A;  1AVS A;  3DVJ A;  3SG6 A;  1SR6 C;  3PFV A;  4ICB A;  1FPW A;  2K7B A;  2LMV A;  5CSF A;  3KPX A;  5D69 A;  1DJI A;  1AHR A;  2LHL A;  1B47 A;  1QIV A;  1AJ5 A;  1KSO A;  1J7R A;  1PAL A;  2KYC A;  4I5K A;  2KGB C;  2PAS A;  1XFZ O;  3SJS A;  1REC A;  3PM8 A;  4FQO A;  2KI4 B;  1C7V A;  4A4B A;  2JXC A;  1KQV A;  3BUW B;  1BR1 B;  1GQM A;  3KO0 A;  1FI6 A;  1UUR A;  2COL B;  3TDZ A;  2KAX A;  2LUX A;  2F8P A;  1XO5 A;  1WDC C;  2K8M B;  3PN7 C;  2KI6 C;  2FCD A;  2I18 A;  2LLS A;  1CDL A;  5B8I B;  2CCM A;  2F33 A;  1R6P A;  4GGF A;  1NCZ A;  2FCE A;  2M49 B;  4XYN A;  2LUC A;  4MLW A;  1JFK A;  1H4B A;  3JTD C;  2KFF A;  1YRU B;  4YI9 A;  5DKQ A;  4YGA A;  2Q4U A;  5FYX A;  4GFT A;  1BJF A;  2BCB A;  4N1F A;  4CLN A;  1NSH A;  3GOF A;  4L9M A;  1FI5 A;  3EKH A;  3K21 A;  1MR8 A;  2F2P A;  1NPQ A;  2BKI B;  3CS1 A;  1F4O A;  2K2A A;  2LM5 A;  2KYF A;  2WOR A;  1S36 A;  3HCM A;  3TUY B;  1J7O A;  2KDH A;  2KAY A;  1BLQ A;  4NDD A;  1CFF A;  1EJ3 A;  1SCM C;  1QLK A;  1IG5 A;  5AEQ A;  3D0Y B;  5KU1 A;  1CNP A;  1TIZ A;  1QS7 A;  4AOM A;  1F70 A;  5HKZ A;  1F71 A;  1RTP 1;  4PDZ A;  2SAS A;  2K7D A;  2K0J A;  1NYA A;  1TNW A;  4QJ3 B;  4HSZ A;  4F0Z B;  4M2O A;  1XYD A;  5GQQ C;  2BEC A;  1IQ5 A;  2LP2 A;  3BUN B;  4YGC B;  3BQ3 A;  1D1O A;  1KWO B;  1LVC D;  1S5G Y;  1DVI A;  4ZCU A;  3RLZ A;  2LP3 A;  2KAV A;  1M45 A;  2E6W A;  2HF5 A;  2M0R A;  1CFP A;  2EC6 B;  5BPJ A;  1A29 A;  1VRK A;  1DJW A;  1MQ1 A;  2BBM A;  3I5F B;  3ICB A;  1IJ5 A;  3OB1 B;  4WQ3 A;  1SCV A;  4PE4 A;  1ODB A;  2Y1M A;  2KQY A;  1KFU L;  4C0K A;  2G2B A;  3PAL A;  4UPG A;  1JWD A;  3DF0 B;  3VGO A;  4ORB B;  4PE1 A;  1DGU A;  1CB1 A;  4DS7 A;  2TN4 A;  2G9B A;  1XFW O;  1A75 B;  2M97 A;  4YGB B;  1UHN A;  2Q91 A;  1UWO A;  1S3P A;  1S1E A;  4CPV A;  1SL7 A;  3SG3 A;  1SL9 A;  4DCK A;  3DD4 A;  2IS9 A;  3EVR A;  3I5I C;  1K2H A;  1KFU S;  4DIR A;  1TTX A;  5CPV A;  2OS8 C;  3O6B A;  1TRF A;  2M7L A;  2LAP A;  2OTG C;  5PAL A;  1XFY O;  3SG5 A;  1KSM A;  1ALV A;  4C0J A;  3CR5 X;  4QJ5 B;  2A4J A;  3TS5 B;  3OX6 A;  3FWB A;  2B1U A;  3LK0 A;  1OZO A;  1UHJ A;  1IQ3 A;  1YUR A;  1TNP A;  1MXE A;  3FWC A;  1TOP A;  4MN0 A;  3D10 A;  4P2Y B;  4ORA B;  3BXK A;  2I94 A;  1BOC A;  2K7O A;  1TCO B;  3EKJ A;  4PHN A;  1NX3 A;  1K9U A;  2BCA A;  4GGN A;  1ZOT B;  4AQI A;  1ALW A;  5I2Q A;  2CNP A;  2ZFD A;  2JT0 A;  3O78 A;  1B1G A;  2CXJ A;  2K7C A;  1FBV A;  4YGD B;  2JRF A;  1XVJ A;  4OVN F;  3I5G C;  1RWY A;  1DJH A;  1TN4 A;  2F2O A;  2HPS A;  2KFG A;  3FIA A;  3LL8 B;  3IQQ A;  5KSZ A;  1CLM A;  2BE4 A;  1H8B A;  1CKK A;  1WLM A;  1B7T Y;  3BUM B;  2NZ0 A;  3A4U B;  3HX4 A;  2GGM A;  3JVT C;  4YI8 A;  1XK4 C;  5ER4 X;  3AAJ A;  1MWN A;  3I5F C;  1DJG A;  4N5X A;  5KTY A;  1JBA A;  5F6T A;  1A2X A;  3PLF B;  1DJX A;  1KQM B;  1L2O B;  1OMD A;  2F3Z A;  2M9G A;  2PRU A;  1QVI Y;  1J7Q A;  4GPL B;  2GGZ A;  3GK2 A;  3NSK A;  1ZMZ A;  2MRD A;  1QV1 A;  3WHU B;  3H4S E;  1KFX S;  4JQ0 D;  4USL A;  5AAN A;  4ZCV A;  1HT9 A;  1DJZ A;  1YRT B;  2O5G A;  3DVM A;  1F8H A;  1GGZ A;  2ZN8 A;  1Y6W A;  4D1E A;  1LIN A;  1PVA A;  3C1V A;  2BL0 C;  1Q80 A;  1PUL A;  2KI6 D;  2L5X B;  4MRX A;  5HLV A;  4HRE E;  2L0P A;  1K8U A;  4OR9 B;  1SRA A;  2LHI A;  1QX2 A;  3E3R A;  1A03 A;  4PE7 A;  4BY5 A;  4ORC B;  2BBN A;  4Q04 A;  4NDC A;  5JOL A;  1SMG A;  1A4P A;  1K95 A;  1M63 B;  1MF8 B;  1SL8 A;  1ZAC A;  1PK0 D;  2HET A;  1S6I A;  1K9K A;  2I2R E;  1OOJ A;  1RK9 A;  2LLU A;  5ER5 A;  1JFJ A;  2WOS A;  1BR4 B;  2WCF A;  3BOW B;  2HQW A;  1NX2 A;  1KK8 B;  2JT3 A;  1BU3 A;  3SG4 A;  2O60 A;  3WHT B;  4M2P A;  2JTT A;  1TNX A;  3LCP C;  4JPZ B;  1X02 A;  1NUB A;  4GNK B;  2FOT A;  2LNK A;  3IF7 A;  4I5J A;  1KK7 Y;  5CSN A;  1JC2 A;  2BKH B;  2ZRT A;  4MZL A;  2M29 A;  1G8I A;  1SW8 A;  3O4Y A;  1JUO A;  1N0Y A;  1QV0 A;  3ZWH A;  3CZT X;  2LVK A;  5J3X A;  2LVJ A;  1WRZ A;  2PMY A;  1CMF A;  3CR4 X;  3VRN A;  1QX7 A;  2KI4 C;  2KQ6 A;  4GUK A;  1DF0 A;  4MVF A;  1YVH A;  5I2L A;  4IL1 A;  3RM1 A;  4P5O E;  1K90 D;  1SK6 D;  1WY9 A;  1N2D A;  2MAZ A;  3FS7 A;  1SR6 B;  3LK1 A;  2PAL A;  1J1D A;  2MLF C;  1LKJ A;  1UUS A; 
#chains in the Genus database with same CATH topology
 1DGV A;  3D75 A;  5FI6 A;  1G4Y R;  2KBM A;  1CM4 A;  1UHI A;  1OQP A;  2WC6 A;  1UHK A;  2Y1N A;  3MSE B;  2QEB A;  1QLS A;  1YR5 A;  2JNX A;  3EVU A;  1TNQ A;  4MBE A;  3L4A A;  2LVI A;  3OGN A;  2JOJ A;  4N1G A;  5AER A;  1GJY A;  1E8A A;  4MSP A;  3WXA A;  1IKU A;  2KPH A;  2WCK A;  1YX8 A;  2NLN A;  4OKH A;  5CSJ A;  1YTZ C;  2K2F A;  2CTN A;  1WDC B;  1B4C A;  1Y1U A;  3CZ1 A;  1S6C A;  3DVK A;  3PN7 B;  1TCF A;  1QAS A;  1IGV A;  3TUY C;  2FJY A;  1B8C A;  1SYM A;  2P6B B;  4WQ2 A;  2Y5I A;  3JTD B;  4PHK A;  3O2P A;  1J7P A;  1F4Q A;  1CDM A;  3V2L A;  3O4X A;  4YGE B;  3QME A;  1XK4 A;  4C0L A;  1SKT A;  2L4I A;  1BG1 A;  4U8D A;  2BE6 A;  3BYA A;  3IVT A;  1IWQ A;  3TZ1 A;  3CLN A;  3TDU A;  2LMU A;  1B9A A;  1OE9 B;  2Y4Q A;  1PSB A;  5I8N A;  3SS5 A;  2ZNE A;  4HRH A;  3A8R A;  3GK4 X;  1BT6 A;  1SNL A;  2E30 A;  2GV5 A;  1KWO C;  1CMG A;  1KFX L;  1OOF A;  2KGR A;  2KBI A;  2M1K B;  1M31 A;  2JWW A;  1QIW A;  4WRI A;  4YRU A;  3KHE A;  1CDN A;  2WCH A;  5CSI A;  1F54 A;  2EC6 C;  1Y0V H;  2QAC A;  3S0F A;  2L4H A;  3NSI A;  4XJK A;  5AXI A;  1LA0 A;  5G08 A;  2R2I A;  1QJT A;  2L5Y A;  2LCP A;  4OV2 A;  3NXA A;  2JC2 A;  1BOD A;  1MXL C;  1PVB A;  1B8R A;  2KSP A;  1CDP A;  2PVB A;  2V53 A;  4I5L B;  2L2E A;  2M1U A;  2MHH A;  2RGI A;  4IJ7 A;  1MUX A;  2LE9 B;  4M2Q A;  3IQO A;  3L47 A;  3D78 A;  4PE0 A;  1WRL A;  3I5H B;  1SPY A;  3OHM B;  3ZNI A;  1KK7 Z;  1U5I A;  2HQ8 A;  2LMT A;  3EK8 A;  3KEV A;  1CLB A;  3PAT A;  3PSR A;  3NSL A;  1S5G Z;  1J1E A;  1WLZ A;  3S0E A;  2H61 C;  4DRW A;  3OP0 A;  1DEL A;  2I7A A;  4PHM A;  2MBX A;  4AQJ A;  1QTX A;  1ZFS A;  1YVL A;  1NX0 A;  1UP5 A;  2OPO A;  1K93 D;  3S0B A;  1YUU A;  4DUQ A;  1IRJ A;  2L2C A;  3OBV A;  1L7Z A;  3CTN A;  4JWQ A;  2CBL A;  1S6J A;  1N65 A;  4TNC A;  5D7F A;  4CFR A;  1J55 A;  2JQ6 A;  4QJ4 B;  3OX5 A;  3CGA A;  3TS5 C;  2KNE A;  3VRP A;  2LVV A;  3AAK A;  3SG2 A;  1WRK A;  4JKT A;  1K96 A;  2AUC A;  2AAO A;  2LV7 A;  1M46 A;  2KFH A;  3DVE A;  1OMR A;  3DY9 A;  2ZND A;  3I5I B;  1OOI X;  4MRY A;  3SS3 A;  1OMV A;  3CAB A;  2CT9 A;  1Y1X A;  4GBA A;  3F45 A;  1DF0 B;  1V1F A;  1OZS A;  2L50 A;  2NCO A;  2OS8 B;  3QRX A;  4R1E A;  1EH2 A;  2JZI A;  2OTG B;  3OB2 B;  1NP8 A;  2F3Y A;  2LAN A;  2SCP A;  3CR2 A;  1YUS A;  2WCB A;  2D8N A;  3BUO B;  3SIA A;  3M0W A;  2BCX A;  4FTG A;  1NWD A;  1EL4 A;  3SG7 A;  4E68 A;  4PCW A;  1TUJ A;  1XFX O;  1IJ6 A;  1AUI B;  4GGF C;  1DTL A;  1NIW A;  2NXQ A;  4NDB A;  2EGD A;  5I2O A;  2JU0 A;  1NCX A;  5HKY A;  1W7I B;  3NHT A;  1K94 A;  3KF9 A;  4CID A;  4PAL A;  1JF2 A;  1JSA A;  2M3W A;  4I5N B;  5HYD A;  1ORG A;  1K9P A;  2MJW B;  1LA3 A;  1NCY A;  2NCP A;  5IBW A;  1PRW A;  2L51 A;  5DKR A;  1G33 A;  1KQM C;  1L2O C;  3UNW A;  2LLT A;  5TNC A;  2FJU B;  3EK7 A;  1DMO A;  1B8L A;  1CFC A;  4MZK A;  1NX1 A;  2KHN A;  3I5G B;  3FE6 A;  1QX5 B;  3BUX B;  1QAT A;  2ZKM X;  1RRO A;  4YBH B;  4A4C A;  1AK8 A;  1M39 A;  5D3O A;  2JT8 A;  2K61 A;  1QXP A;  3BFH A;  3I5H C;  2PSR A;  1DT7 B;  1OSA A;  3JVT B;  4NQG A;  3D0Y A;  2MA2 A;  1FF1 A;  2M7N A;  3R1P A;  5HLO A;  1CLL A;  3WNX B;  4PHJ A;  2ISD A;  1BF5 A;  3BOW A;  1B7T Z;  3RZS A;  1HQV A;  2AMI A;  2M8U A;  4GAO A;  1C7W A;  1SBJ A;  4JD9 A;  4OCI A;  5K89 A;  2JUL A;  4MZJ A;  3S0A A;  1BMO A;  1TUZ A;  1C07 A;  2H8V A;  1CM1 A;  1QVI Z;  1SY9 A;  3B86 A;  5JJG A;  1CFD A;  1UHH A;  1W7J B;  1RFJ A;  3DXL A;  1JF0 A;  1S26 D;  1FW4 A;  2BL0 B;  1EG4 A;  3VRO A;  3VRQ A;  1V1G A;  3D73 A;  4HRG A;  3CWG A;  4XJK B;  1F55 A;  2LC5 A;  2JTZ A;  2MLE C;  2QDI A;  1AJ4 A;  5DKN A;  5HKW A;  1KK8 C;  1DJY A;  3EK4 A;  2EHB A;  3AKB A;  3DF0 A;  2JXL A;  2L98 A;  3LLE A;  3R1O A;  3GK1 A;  3VRR A;  2WCE A;  2QPT A;  1MHO A;  4INX A;  1KCY A;  1R2U A;  1XFU O;  2H2K A;  3SIB A;  2ZN9 A;  1YUT A;  1DC1 A;  2JNF A;  1ZUZ A;  1GGW A;  1A75 A;  1LXF C;  2KOT A;  3AKA A;  1RJV A;  1U5I B;  3BFA A;  4MEW A;  2WND A;  3NSO A;  1SCM B;  2BAP A;  1LS8 A;  2WC8 A;  3R72 A;  1IH0 A;  3K1E A;  1EG3 A;  2QEO A;  1AP4 A;  2ERB A;  1XA5 A;  2H61 A;  1XFV O;  3EVV A;  4BY4 A;  2ZRS A;  3TDI A;  4ETO A;  2JPT A;  1PSR A;  1Y1A A;  4CFQ A;  2WC5 A;  1EXR A;  2VRG A;  5AFP A;  2DOQ A;  1YX7 A;  2JPO A;  1CTR A;  1AVS A;  3DVJ A;  3SG6 A;  1SR6 C;  3PFV A;  4ICB A;  1FPW A;  2K7B A;  2LMV A;  5CSF A;  3KPX A;  5D69 A;  1DJI A;  1AHR A;  1C3Y A;  2LHL A;  1B47 A;  1QIV A;  1AJ5 A;  1KSO A;  1J7R A;  1PAL A;  2KYC A;  4I5K A;  2KGB C;  2PAS A;  3D74 A;  1XFZ O;  3SJS A;  1REC A;  3PM8 A;  4FQO A;  2KI4 B;  1C7V A;  5FI2 A;  2KLE A;  3B87 A;  4INW A;  4A4B A;  2JXC A;  1KQV A;  3BUW B;  1BR1 B;  1GQM A;  3KO0 A;  1FI6 A;  1UUR A;  5EL2 A;  2COL B;  3TDZ A;  2KAX A;  2LUX A;  2F8P A;  1XO5 A;  1WDC C;  2K8M B;  3PN7 C;  2KI6 C;  2FCD A;  2I18 A;  2LLS A;  1CDL A;  5B8I B;  2CCM A;  2F33 A;  1R6P A;  4GGF A;  1OOG A;  1NCZ A;  1TWO A;  2FCE A;  2M49 B;  4XYN A;  2LUC A;  1OOH A;  4MLW A;  1JFK A;  3L4L A;  1H4B A;  3JTD C;  2KFF A;  1YRU B;  4YI9 A;  5DKQ A;  4YGA A;  2Q4U A;  5FYX A;  4GFT A;  1BJF A;  3D77 A;  2BCB A;  4N1F A;  4CLN A;  1NSH A;  3GOF A;  4L9M A;  1FI5 A;  3EKH A;  3K21 A;  1MR8 A;  2F2P A;  1NPQ A;  2BKI B;  3CS1 A;  1F4O A;  2K2A A;  2LM5 A;  2KYF A;  2WOR A;  1S36 A;  3HCM A;  3TUY B;  1J7O A;  2KDH A;  2KAY A;  1BLQ A;  4NDD A;  1CFF A;  1EJ3 A;  1SCM C;  1QLK A;  1IG5 A;  5AEQ A;  3D0Y B;  3CZ2 A;  2GTE A;  5KU1 A;  1CNP A;  1TIZ A;  1QS7 A;  4AOM A;  1F70 A;  3DYE A;  3FE8 A;  5HKZ A;  1F71 A;  1RTP 1;  4PDZ A;  2SAS A;  2K7D A;  2K0J A;  3B6X A;  3CDN A;  1NYA A;  1TNW A;  4QJ3 B;  4HSZ A;  4F0Z B;  4M2O A;  1XYD A;  5GQQ C;  1Z2C B;  2BEC A;  1IQ5 A;  2LP2 A;  3BUN B;  4YGC B;  5FI7 A;  3VB1 A;  3BQ3 A;  1D1O A;  1KWO B;  1C3Z A;  1LVC D;  1S5G Y;  1DVI A;  4ZCU A;  3RLZ A;  2LP3 A;  2KAV A;  1M45 A;  2E6W A;  2HF5 A;  2M0R A;  1CFP A;  2EC6 B;  1SSE B;  2P71 A;  2QEH A;  5BPJ A;  1A29 A;  1VRK A;  1DJW A;  1MQ1 A;  2BBM A;  3I5F B;  3ICB A;  1IJ5 A;  3OB1 B;  4WQ3 A;  1SCV A;  1DEK A;  4PE4 A;  1ODB A;  2Y1M A;  2KQY A;  1KFU L;  4C0K A;  1OW4 A;  2G2B A;  3PAL A;  4UPG A;  3DF0 B;  1JWD A;  3VGO A;  2K60 A;  2QEV A;  4ORB B;  4PE1 A;  1DGU A;  1CB1 A;  4DS7 A;  1XFR A;  2TN4 A;  2G9B A;  1XFW O;  1Z4H A;  5DIC A;  1A75 B;  2M97 A;  4YGB B;  1UHN A;  2Q91 A;  1UWO A;  1S3P A;  1S1E A;  4CPV A;  1SL7 A;  3SG3 A;  1SL9 A;  4DCK A;  3BJH A;  3CYZ A;  3DD4 A;  2IS9 A;  3EVR A;  3I5I C;  1K2H A;  1KFU S;  4DIR A;  1TTX A;  5CPV A;  2OS8 C;  3O6B A;  1TRF A;  2M7L A;  2LAP A;  2OTG C;  5PAL A;  1XFY O;  3SG5 A;  4F7F A;  1KSM A;  1ALV A;  4C0J A;  2YGU A;  3CR5 X;  4QJ5 B;  2A4J A;  3TS5 B;  3OX6 A;  3FWB A;  3S0D A;  1GM0 A;  2B1U A;  3LK0 A;  1OZO A;  1UHJ A;  1IQ3 A;  1YUR A;  1TNP A;  1MXE A;  2BNX A;  3FWC A;  1TOP A;  4MN0 A;  3D10 A;  4P2Y B;  4ORA B;  3BXK A;  2I94 A;  1BOC A;  2K7O A;  1TCO B;  3EKJ A;  4PHN A;  3NGV A;  3BFB A;  1NX3 A;  4KYN A;  3FE9 A;  1K9U A;  2BCA A;  3NHI A;  4GGN A;  1ZOT B;  2PYQ A;  1ALW A;  4AQI A;  5I2Q A;  2CNP A;  2ZFD A;  2JT0 A;  3O78 A;  1B1G A;  3PJI A;  2CXJ A;  2K7C A;  1FBV A;  4YGD B;  2JRF A;  1XVJ A;  4OVN F;  2PQL A;  3I5G C;  2KLD A;  1RWY A;  1DJH A;  1TN4 A;  2F2O A;  2HPS A;  2KFG A;  3FIA A;  3LL8 B;  3IQQ A;  2WCJ A;  5KSZ A;  1CLM A;  2BE4 A;  1H8B A;  1CKK A;  1WLM A;  1B7T Y;  3BUM B;  2NZ0 A;  3A4U B;  3HX4 A;  2GGM A;  3JVT C;  4YI8 A;  1XK4 C;  1T14 A;  3AAJ A;  5ER4 X;  1MWN A;  3DZT A;  1DJG A;  3I5F C;  4N5X A;  5KTY A;  1JBA A;  5F6T A;  1A2X A;  3PLF B;  1DJX A;  1KQM B;  1L2O B;  1OMD A;  2F3Z A;  2M9G A;  2PRU A;  1QVI Y;  1J7Q A;  4GPL B;  2GGZ A;  3GK2 A;  3NSK A;  1ZMZ A;  2MRD A;  3Q8I A;  1QV1 A;  3PM2 A;  3WHU B;  3H4S E;  1KFX S;  4JQ0 D;  4USL A;  2WCM A;  4PT1 A;  5AAN A;  5I94 A;  4ZCV A;  1HT9 A;  1DJZ A;  1YRT B;  2O5G A;  1W9Z A;  3DVM A;  3UO9 A;  1F8H A;  1GGZ A;  2ZN8 A;  1Y6W A;  4D1E A;  1LIN A;  1PVA A;  3C1V A;  2BL0 C;  1Q80 A;  1PUL A;  2KI6 D;  2L5X B;  4MRX A;  5HLV A;  4HRE E;  3EG5 B;  1QWV A;  2L0P A;  1K8U A;  3B7A A;  4OR9 B;  1SRA A;  2LHI A;  3R1V A;  1QX2 A;  3E3R A;  3SS4 A;  1A03 A;  4PE7 A;  4BY5 A;  4ORC B;  2BBN A;  4Q04 A;  4NDC A;  5JOL A;  1SMG A;  1A4P A;  1K95 A;  1M63 B;  1MF8 B;  1SL8 A;  1ZAC A;  1PK0 D;  2HET A;  1S6I A;  1K9K A;  2I2R E;  1OOJ A;  1RK9 A;  2LLU A;  5ER5 A;  1JFJ A;  2WOS A;  1BR4 B;  2WCF A;  3BOW B;  2HQW A;  1NX2 A;  1KK8 B;  2JT3 A;  1BU3 A;  3SG4 A;  2O60 A;  3WHT B;  4M2P A;  1P28 A;  2JTT A;  1TNX A;  3LCP C;  4JPZ B;  1X02 A;  1NUB A;  4GNK B;  2FOT A;  2LNK A;  3IF7 A;  4I5J A;  1KK7 Y;  5CSN A;  1JC2 A;  2BKH B;  1DQE A;  2ZRT A;  4MZL A;  2M29 A;  3S0G A;  1G8I A;  3CZ0 A;  1SW8 A;  3O4Y A;  4OZD A;  1JUO A;  1N0Y A;  1QV0 A;  3ZWH A;  3CZT X;  2LVK A;  5J3X A;  2LVJ A;  1WRZ A;  2PMY A;  1CMF A;  3CR4 X;  3VRN A;  1QX7 A;  2P70 A;  2KI4 C;  2KQ6 A;  4GUK A;  1DF0 A;  4MVF A;  1YVH A;  5I2L A;  3N7H A;  3D76 A;  4IL1 A;  4FQT A;  3RM1 A;  4P5O E;  1IIO A;  1K90 D;  1SK6 D;  2WCL A;  1WY9 A;  1N2D A;  3B88 A;  2MAZ A;  3FS7 A;  1SR6 B;  3LK1 A;  5HL1 A;  2PAL A;  1J1D A;  2MLF C;  1LKJ A;  1UUS A; 
#chains in the Genus database with same CATH homology
 1DGV A;  1G4Y R;  2KBM A;  1CM4 A;  1UHI A;  1OQP A;  1UHK A;  2Y1N A;  3MSE B;  1QLS A;  1YR5 A;  2JNX A;  3EVU A;  1TNQ A;  4MBE A;  2LVI A;  2JOJ A;  4N1G A;  5AER A;  1GJY A;  1E8A A;  4MSP A;  3WXA A;  1IKU A;  4OKH A;  1YX8 A;  2NLN A;  5CSJ A;  1YTZ C;  2K2F A;  2CTN A;  1WDC B;  1B4C A;  1Y1U A;  1S6C A;  3DVK A;  3PN7 B;  1TCF A;  1QAS A;  1IGV A;  3TUY C;  1B8C A;  1SYM A;  2P6B B;  4WQ2 A;  2Y5I A;  3JTD B;  4PHK A;  3O2P A;  1J7P A;  1F4Q A;  1CDM A;  4YGE B;  1XK4 A;  4C0L A;  1SKT A;  2L4I A;  1BG1 A;  4U8D A;  2BE6 A;  3BYA A;  3TZ1 A;  1IWQ A;  3CLN A;  3TDU A;  2LMU A;  1B9A A;  1OE9 B;  2Y4Q A;  1PSB A;  5I8N A;  2ZNE A;  4HRH A;  3A8R A;  3GK4 X;  1BT6 A;  1SNL A;  2E30 A;  2GV5 A;  1KWO C;  1CMG A;  1KFX L;  2KGR A;  2M1K B;  2KBI A;  1M31 A;  2JWW A;  1QIW A;  4WRI A;  4YRU A;  3KHE A;  1CDN A;  5CSI A;  1F54 A;  2EC6 C;  1Y0V H;  2QAC A;  2L4H A;  3NSI A;  4XJK A;  5AXI A;  1LA0 A;  5G08 A;  2R2I A;  1QJT A;  2LCP A;  4OV2 A;  3NXA A;  2JC2 A;  1BOD A;  1MXL C;  1PVB A;  1B8R A;  2KSP A;  1CDP A;  2PVB A;  2V53 A;  4I5L B;  2L2E A;  2M1U A;  2MHH A;  2RGI A;  1MUX A;  2LE9 B;  4M2Q A;  3IQO A;  4PE0 A;  1WRL A;  3I5H B;  1SPY A;  3OHM B;  3ZNI A;  1KK7 Z;  1U5I A;  2HQ8 A;  2LMT A;  3EK8 A;  3KEV A;  1CLB A;  3PAT A;  3PSR A;  3NSL A;  1S5G Z;  1J1E A;  1WLZ A;  2H61 C;  4DRW A;  3OP0 A;  2I7A A;  4PHM A;  2MBX A;  4AQJ A;  1QTX A;  1ZFS A;  1YVL A;  1NX0 A;  1UP5 A;  2OPO A;  1K93 D;  4DUQ A;  1YUU A;  1IRJ A;  1L7Z A;  3CTN A;  4JWQ A;  2CBL A;  1S6J A;  1N65 A;  4TNC A;  5D7F A;  4CFR A;  1J55 A;  2JQ6 A;  4QJ4 B;  3OX5 A;  3CGA A;  3TS5 C;  2KNE A;  3VRP A;  2LVV A;  3AAK A;  3SG2 A;  1WRK A;  1K96 A;  2AUC A;  2AAO A;  2LV7 A;  1M46 A;  2KFH A;  3DVE A;  1OMR A;  4MRY A;  2ZND A;  3I5I B;  5AFP A;  1OMV A;  2CT9 A;  1Y1X A;  4GBA A;  3F45 A;  1DF0 B;  1V1F A;  1OZS A;  2L50 A;  2NCO A;  2OS8 B;  3QRX A;  4R1E A;  1EH2 A;  2JZI A;  2OTG B;  3OB2 B;  1NP8 A;  2F3Y A;  2LAN A;  2SCP A;  3CR2 A;  1YUS A;  2WCB A;  2D8N A;  3BUO B;  3SIA A;  3M0W A;  2BCX A;  4FTG A;  1NWD A;  1EL4 A;  3SG7 A;  4E68 A;  4PCW A;  1XFX O;  1IJ6 A;  1AUI B;  4GGF C;  1DTL A;  1NIW A;  2NXQ A;  4NDB A;  2EGD A;  5I2O A;  2JU0 A;  1NCX A;  5HKY A;  1W7I B;  1K94 A;  3KF9 A;  4CID A;  4PAL A;  1JF2 A;  1JSA A;  2M3W A;  4I5N B;  5HYD A;  1K9P A;  2MJW B;  1LA3 A;  1NCY A;  2NCP A;  5IBW A;  1PRW A;  2L51 A;  5DKR A;  1G33 A;  1KQM C;  1L2O C;  2LLT A;  5TNC A;  2FJU B;  3EK7 A;  1DMO A;  1B8L A;  1CFC A;  4MZK A;  1NX1 A;  2KHN A;  3I5G B;  1QX5 B;  3BUX B;  1QAT A;  2ZKM X;  1RRO A;  4YBH B;  4A4C A;  1AK8 A;  1M39 A;  2JT8 A;  2K61 A;  1QXP A;  3I5H C;  2PSR A;  1DT7 B;  1OSA A;  3JVT B;  4NQG A;  3D0Y A;  2MA2 A;  1FF1 A;  2M7N A;  3WNX B;  5HLO A;  1CLL A;  1BF5 A;  4PHJ A;  2ISD A;  3BOW A;  1B7T Z;  2AMI A;  1HQV A;  2M8U A;  4GAO A;  1C7W A;  1SBJ A;  4OCI A;  5K89 A;  2JUL A;  4MZJ A;  1BMO A;  1C07 A;  1CM1 A;  1QVI Z;  1SY9 A;  5JJG A;  1CFD A;  1UHH A;  1W7J B;  1RFJ A;  1JF0 A;  1S26 D;  1FW4 A;  2BL0 B;  1EG4 A;  3VRO A;  3VRQ A;  1V1G A;  4HRG A;  4XJK B;  3CWG A;  1F55 A;  2LC5 A;  2JTZ A;  2MLE C;  5DKN A;  1AJ4 A;  5HKW A;  1KK8 C;  1DJY A;  3EK4 A;  2EHB A;  3AKB A;  3DF0 A;  2JXL A;  2L98 A;  3LLE A;  3GK1 A;  3VRR A;  2WCE A;  2QPT A;  1MHO A;  1KCY A;  1R2U A;  1XFU O;  2H2K A;  3SIB A;  2ZN9 A;  1YUT A;  2JNF A;  1ZUZ A;  1GGW A;  1A75 A;  1LXF C;  2KOT A;  3AKA A;  1RJV A;  1U5I B;  4MEW A;  1IH0 A;  2WND A;  3NSO A;  1SCM B;  2WC8 A;  1EG3 A;  1AP4 A;  2H61 A;  1XA5 A;  1XFV O;  3EVV A;  4BY4 A;  2ZRS A;  3TDI A;  4ETO A;  2JPT A;  1PSR A;  1Y1A A;  4CFQ A;  1EXR A;  2VRG A;  2DOQ A;  1YX7 A;  1CTR A;  1AVS A;  3DVJ A;  3SG6 A;  1SR6 C;  3PFV A;  4ICB A;  1FPW A;  2K7B A;  2LMV A;  5CSF A;  3KPX A;  5D69 A;  1DJI A;  1AHR A;  2LHL A;  1B47 A;  1QIV A;  1AJ5 A;  1KSO A;  1J7R A;  1PAL A;  2KYC A;  4I5K A;  2KGB C;  2PAS A;  1XFZ O;  3SJS A;  1REC A;  3PM8 A;  4FQO A;  2KI4 B;  1C7V A;  4A4B A;  2JXC A;  1KQV A;  3BUW B;  1BR1 B;  1GQM A;  3KO0 A;  1FI6 A;  1UUR A;  2COL B;  3TDZ A;  2KAX A;  2LUX A;  2F8P A;  1XO5 A;  1WDC C;  2K8M B;  3PN7 C;  2KI6 C;  2FCD A;  2I18 A;  2LLS A;  1CDL A;  5B8I B;  2CCM A;  2F33 A;  1R6P A;  4GGF A;  1NCZ A;  2FCE A;  2M49 B;  4XYN A;  2LUC A;  4MLW A;  1JFK A;  1H4B A;  3JTD C;  2KFF A;  1YRU B;  4YI9 A;  5DKQ A;  4YGA A;  2Q4U A;  5FYX A;  4GFT A;  1BJF A;  2BCB A;  4N1F A;  4CLN A;  1NSH A;  3GOF A;  4L9M A;  1FI5 A;  3EKH A;  3K21 A;  1MR8 A;  2F2P A;  1NPQ A;  2BKI B;  3CS1 A;  1F4O A;  2K2A A;  2LM5 A;  2KYF A;  2WOR A;  1S36 A;  3HCM A;  3TUY B;  1J7O A;  2KDH A;  2KAY A;  1BLQ A;  4NDD A;  1CFF A;  1EJ3 A;  1SCM C;  1QLK A;  1IG5 A;  5AEQ A;  3D0Y B;  5KU1 A;  1CNP A;  1TIZ A;  1QS7 A;  4AOM A;  1F70 A;  5HKZ A;  1F71 A;  1RTP 1;  4PDZ A;  2SAS A;  2K7D A;  2K0J A;  1NYA A;  1TNW A;  4QJ3 B;  4HSZ A;  4F0Z B;  4M2O A;  1XYD A;  5GQQ C;  2BEC A;  1IQ5 A;  2LP2 A;  3BUN B;  4YGC B;  3BQ3 A;  1D1O A;  1KWO B;  1LVC D;  1S5G Y;  1DVI A;  4ZCU A;  3RLZ A;  2LP3 A;  2KAV A;  1M45 A;  2E6W A;  2HF5 A;  2M0R A;  1CFP A;  2EC6 B;  5BPJ A;  1A29 A;  1VRK A;  1DJW A;  1MQ1 A;  2BBM A;  3I5F B;  3ICB A;  1IJ5 A;  3OB1 B;  4WQ3 A;  1SCV A;  4PE4 A;  1ODB A;  2Y1M A;  2KQY A;  1KFU L;  4C0K A;  2G2B A;  3PAL A;  4UPG A;  1JWD A;  3DF0 B;  3VGO A;  4ORB B;  4PE1 A;  1DGU A;  1CB1 A;  4DS7 A;  2TN4 A;  2G9B A;  1XFW O;  1A75 B;  2M97 A;  4YGB B;  1UHN A;  2Q91 A;  1UWO A;  1S3P A;  1S1E A;  4CPV A;  1SL7 A;  3SG3 A;  1SL9 A;  4DCK A;  3DD4 A;  2IS9 A;  3EVR A;  3I5I C;  1K2H A;  1KFU S;  4DIR A;  1TTX A;  5CPV A;  2OS8 C;  3O6B A;  1TRF A;  2M7L A;  2LAP A;  2OTG C;  5PAL A;  1XFY O;  3SG5 A;  1KSM A;  1ALV A;  4C0J A;  3CR5 X;  4QJ5 B;  2A4J A;  3TS5 B;  3OX6 A;  3FWB A;  2B1U A;  3LK0 A;  1OZO A;  1UHJ A;  1IQ3 A;  1YUR A;  1TNP A;  1MXE A;  3FWC A;  1TOP A;  4MN0 A;  3D10 A;  4P2Y B;  4ORA B;  3BXK A;  2I94 A;  1BOC A;  2K7O A;  1TCO B;  3EKJ A;  4PHN A;  1NX3 A;  1K9U A;  2BCA A;  4GGN A;  1ZOT B;  4AQI A;  1ALW A;  5I2Q A;  2CNP A;  2ZFD A;  2JT0 A;  3O78 A;  1B1G A;  2CXJ A;  2K7C A;  1FBV A;  4YGD B;  2JRF A;  1XVJ A;  4OVN F;  3I5G C;  1RWY A;  1DJH A;  1TN4 A;  2F2O A;  2HPS A;  2KFG A;  3FIA A;  3LL8 B;  3IQQ A;  5KSZ A;  1CLM A;  2BE4 A;  1H8B A;  1CKK A;  1WLM A;  1B7T Y;  3BUM B;  2NZ0 A;  3A4U B;  3HX4 A;  2GGM A;  3JVT C;  4YI8 A;  1XK4 C;  5ER4 X;  3AAJ A;  1MWN A;  3I5F C;  1DJG A;  4N5X A;  5KTY A;  1JBA A;  5F6T A;  1A2X A;  3PLF B;  1DJX A;  1KQM B;  1L2O B;  1OMD A;  2F3Z A;  2M9G A;  2PRU A;  1QVI Y;  1J7Q A;  4GPL B;  2GGZ A;  3GK2 A;  3NSK A;  1ZMZ A;  2MRD A;  1QV1 A;  3WHU B;  3H4S E;  1KFX S;  4JQ0 D;  4USL A;  5AAN A;  4ZCV A;  1HT9 A;  1DJZ A;  1YRT B;  2O5G A;  3DVM A;  1F8H A;  1GGZ A;  2ZN8 A;  1Y6W A;  4D1E A;  1LIN A;  1PVA A;  3C1V A;  2BL0 C;  1Q80 A;  1PUL A;  2KI6 D;  2L5X B;  4MRX A;  5HLV A;  4HRE E;  2L0P A;  1K8U A;  4OR9 B;  1SRA A;  2LHI A;  1QX2 A;  3E3R A;  1A03 A;  4PE7 A;  4BY5 A;  4ORC B;  2BBN A;  4Q04 A;  4NDC A;  5JOL A;  1SMG A;  1A4P A;  1K95 A;  1M63 B;  1MF8 B;  1SL8 A;  1ZAC A;  1PK0 D;  2HET A;  1S6I A;  1K9K A;  2I2R E;  1OOJ A;  1RK9 A;  2LLU A;  5ER5 A;  1JFJ A;  2WOS A;  1BR4 B;  2WCF A;  3BOW B;  2HQW A;  1NX2 A;  1KK8 B;  2JT3 A;  1BU3 A;  3SG4 A;  2O60 A;  3WHT B;  4M2P A;  2JTT A;  1TNX A;  3LCP C;  4JPZ B;  1X02 A;  1NUB A;  4GNK B;  2FOT A;  2LNK A;  3IF7 A;  4I5J A;  1KK7 Y;  5CSN A;  1JC2 A;  2BKH B;  2ZRT A;  4MZL A;  2M29 A;  1G8I A;  1SW8 A;  3O4Y A;  1JUO A;  1N0Y A;  1QV0 A;  3ZWH A;  3CZT X;  2LVK A;  5J3X A;  2LVJ A;  1WRZ A;  2PMY A;  1CMF A;  3CR4 X;  3VRN A;  1QX7 A;  2KI4 C;  2KQ6 A;  4GUK A;  1DF0 A;  4MVF A;  1YVH A;  5I2L A;  4IL1 A;  3RM1 A;  4P5O E;  1K90 D;  1SK6 D;  1WY9 A;  1N2D A;  2MAZ A;  3FS7 A;  1SR6 B;  3LK1 A;  2PAL A;  1J1D A;  2MLF C;  1LKJ A;  1UUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...