1A4PA

P11 (s100a10), ligand of annexin ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A10
publication title The crystal structure of a complex of p11 with the annexin II N-terminal peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium/phospholipid binding protein
total genus 34
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1a4pA00
1DJXA 1YRTB 1FW4A 2LVJA 1SK6D 3H4SE 4YGAA 5F6TA 1DJGA 1F4OA 2ZN9A 1EJ3A 4M2QA 4ICBA 4MZKA 1LA3A 1OOJA 2CT9A 2OTGC 1CLLA 2L4IA 2Y1NA 2PASA 4MSPA 4GAOA 1S26D 3O6BA 2M1UA 1B1GA 3PATA 1SKTA 5I2OA 4ETOA 1QX2A 1SPYA 1M31A 3EVUA 1SCMC 2LHLA 2M97A 2TN4A 1BG1A 3DVMA 1JC2A 4MEWA 1C7VA 3IQQA 3IF7A 3O2PA 3OX6A 1J7QA 1PALA 2Q4UA 3BOWA 1S6IA 2AUCA 2JTZA 2NLNA 1CDMA 4OVNF 2KAYA 2JXCA 3HCMA 3VRRA 5DKNA 3JVTB 5AXIA 1W7JB 2LHIA 3BUMB 1UHHA 5J3XA 1PRWA 1QIWA 1DTLA 4P2YB 4GNKB 5HKYA 1YVLA 3TUYC 3CGAA 2L98A 1VRKA 4TNCA 1S3PA 1XK4A 2OS8C 3SJSA 1AHRA 1YR5A 2KYCA 2KI6C 1OZOA 3BUWB 5PALA 1OMVA 1SMGA 3AKBA 3TS5B 3EK8A 1EG3A 1G4YR 1WRKA 1ZMZA 4JPZB 4F0ZB 2OPOA 3ZWHA 2JTTA 2NCOA 1KSOA 1SL7A 1TRFA 1KK8C 3EVRA 1CTRA 4NQGA 3O78A 1JUOA 2L5XB 2LUCA 1CFPA 2AMIA 2WCFA 2ZN8A 2KGRA 1UP5A 1XFWO 1W7IB 1AUIB 1K93D 3E3RA 1S36A 1S6JA 1EG4A 2P6BB 3EKHA 2M0RA 5CSNA 2PALA 3I5GB 2K7OA 2K2FA 3DF0B 2JRFA 2CCMA 5G08A 5AEQA 1DGVA 1KQMB 1L2OB 2FJUB 4PHNA 1XVJA 1QX5B 1TNWA 1BU3A 2CTNA 1GGZA 1B8CA 3OHMB 1F4QA 1N0YA 3LLEA 3NSKA 3SG5A 4PHKA 4D1EA 1U5IB 3FIAA 2F8PA 4BY4A 2K0JA 2WOSA 1TNXA 1QS7A 1YURA 4DCKA 1NWDA 4XJKA 3D0YB 1EH2A 1XFUO 2BCXA 2SASA 1TNQA 1KFXL 3JVTC 3A4UB 3JTDB 1MXLC 1YUSA 1K9KA 1N65A 1S1EA 2DOQA 1UHNA 2NXQA 1PVBA 2LAPA 1KWOC 1V1GA 1DJYA 2HQ8A 1OQPA 5I8NA 1ZOTB 2NCPA 1X02A 5I2LA 4YGDB 1ALVA 2Y5IA 1RTP1 1CLBA 1OMDA 1YRUB 2Y4QA 2LP3A 2L4HA 5JJGA 1NX3A 1QIVA 1XFXO 4NDDA 1J7RA 2EHBA 1TCFA 4PHMA 1NX0A 4MBEA 5K89A 1DMOA 4PCWA 1CDNA 1KFUS 2KQ6A 1NSHA 2F2PA 1ALWA 4GPLB 1K8UA 4OV2A 1DJHA 2LV7A 3K21A 2O60A 4AQJA 1CDPA 4PE7A 4QJ4B 1QX7A 4YI9A 2BKIB 2M1KB 2FOTA 4A4CA 4N1GA 1QASA 2LMUA 2BCBA 1IQ3A 1MHOA 3VROA 1IKUA 3ZNIA 1NPQA 3PN7B 4PE1A 1WRZA 3WHUB 4NDCA 4MLWA 1DF0A 5FYXA 1KQMC 1CM1A 1UHIA 4R1EA 4MN0A 2I2RE 2LP2A 3GK2A 1BMOA 4L9MA 1NCYA 1YX8A 1MUXA 1DVIA 1WRLA 1NCZA 5GQQC 1L7ZA 1XO5A 2K7CA 2MHHA 1PULA 1M63B 3WXAA 2F2OA 2JPTA 3LK0A 1RWYA 2HF5A 4C0KA 4C0JA 2CBLA 2WC8A 3JTDC 1CKKA 4UPGA 1RROA 4AQIA 1JSAA 1WY9A 1M39A 2I18A 1AJ4A 3I5IB 1BF5A 3I5HB 3KHEA 2MLEC 1ODBA 3AKAA 4CFRA 2JT3A 1S6CA 3QRXA 2M29A 4OKHA 2M9GA 3SG2A 1K96A 1YTZC 1B4CA 1TOPA 2KAXA 2KI6D 2O5GA 2JNFA 2JU0A 2M49B 2K61A 1NX1A 2BBNA 4PALA 4M2PA 2A4JA 1JBAA 1GJYA 4WRIA 1KWOB 3PALA 3OB1B 2QPTA 3OP0A 3I5FB 1EXRA 2Q91A 2ZNDA 4FTGA 1SCVA 4I5LB 2KGBC 2LVIA 3EK7A 1C7WA 1LKJA 2ZFDA 1NCXA 4DS7A 2E30A 1F55A 4YGCB 1EL4A 1K95A 2Y1MA 1IQ5A 3PN7C 1A4PA 4BY5A 2ZRSA 4PHJA 1OSAA 1NP8A 4ORAB 2SCPA 2M8UA 1QV0A 2LLSA 3BYAA 1YX7A 2EGDA 3RLZA 3OX5A 1SNLA 3TDUA 3A8RA 1UWOA 1XFVO 2LVKA 5I2QA 3PLFB 1BOCA 3D10A 2ZNEA 1SY9A 1ZUZA 5CPVA 1E8AA 1F70A 4PE0A 3CTNA 3F45A 1R2UA 2COLB 2L50A 2HETA 3CLNA 1KSMA 1SL9A 1MF8B 4MZJA 5B8IB 2MRDA 3WHTB 2LC5A 4OCIA 3VGOA 1CFDA 4I5JA 2BE6A 2MAZA 3I5IC 4N1FA 4AOMA 1Y1XA 5D7FA 4YGBB 3I5HC 3KEVA 4CIDA 2JT0A 1J7OA 1CM4A 4P5OE 1HT9A 3HX4A 4HRHA 1AJ5A 3DF0A 2GV5A 1K9UA 3OB2B 2JWWA 4HSZA 3GOFA 1MR8A 5BPJA 2M7NA 3SIBA 3AAJA 2LLUA 1JF0A 1SRAA 1A75B 3NSIA 5ER4X 4YRUA 1JFJA 1FI6A 3KF9A 1J7PA 3LCPC 1FI5A 2KDHA 5HKWA 1IH0A 1PSBA 2FCDA 2BKHB 4MRXA 1XYDA 3I5FC 3PFVA 3FS7A 2HPSA 1LINA 2M3WA 3FWCA 4PDZA 3NXAA 4GGNA 1QTXA 1CFFA 1XK4C 4IL1A 2ZRTA 4ZCUA 1BLQA 1GGWA 4GFTA 1AVSA 1JFKA 2M7LA 1IJ5A 1SBJA 3MSEB 5KTYA 1PVAA 1CMFA 3KO0A 5KSZA 3AAKA 1UURA 2IS9A 4DRWA 5KU1A 2NZ0A 1UHKA 2I7AA 2MBXA 4WQ3A 4M2OA 2PVBA 2KOTA 2JNXA 2WCBA 1LXFC 1SYMA 1RJVA 4I5KA 1K9PA 2BL0B 2LMVA 5AANA 3EK4A 4XYNA 5HKZA 1YUTA 4QJ3B 2JZIA 3BUXB 3CWGA 4U8DA 1XFZO 4HRGA 1MQ1A 3ICBA 3SG7A 1PSRA 1TN4A 3TDZA 1QVIZ 1F71A 4E68A 1AK8A 2KYFA 4USLA 3EVVA 2WORA 2EC6B 1G33A 1M46A 1H8BA 4QJ5B 2ZKMX 2KFGA 3DVKA 3GK1A 4CLNA 2KAVA 1GQMA 2JQ6A 1G8IA 2K7BA 3CR2A 5TNCA 1WLZA 1R6PA 2K8MB 1CFCA 1QLKA 3IQOA 4GUKA 1FBVA 3C1VA 1XA5A 1QVIY 1Y1AA 2KBMA 4YI8A 1RECA 1DT7B 2LNKA 3BOWB 2F3YA 1QJTA 2JOJA 1K90D 2L2EA 2BE4A 2R2IA 2WCEA 1K94A 1UUSA 3TDIA 2JT8A 2FCEA 3BUOB 5CSFA 2KSPA 1KFXS 5CSIA 2B1UA 2HQWA 3LL8B 1F54A 4CFQA 1PK0D 3SG3A 1QV1A 5DKQA 1AP4A 1WDCB 2MJWB 2CXJA 3EKJA 4MVFA 1FF1A 2K7DA 1MWNA 1QLSA 2PSRA 3PSRA 2H61C 1UHJA 2LUXA 2MA2A 1KFUL 4JQ0D 1J55A 2BL0C 1A03A 1IGVA 1RFJA 3DVEA 1CLMA 1BODA 2G9BA 2GGZA 1NYAA 1B8RA 4A4BA 1B7TZ 1NIWA 4GGFC 4N5XA 3KPXA 1CB1A 1H4BA 1QXPA 1KK7Z 1SL8A 1BR1B 1QATA 3CZTX 4I5NB 2H2KA 1OE9B 2BBMA 1B9AA 3CR4X 2D8NA 1S5GZ 3SG4A 2GGMA 2EC6C 1Q80A 3VRPA 4JWQA 1JWDA 1B7TY 3DD4A 4ZCVA 5HLVA 1KK7Y 2CNPA 2LLTA 5HYDA 1TIZA 3RM1A 2KI4B 5D69A 1DJIA 2KNEA 1HQVA 1DJWA 1S5GY 2F3ZA 3LK1A 4YBHB 2LM5A 3NSLA 4Q04A 4ORBB 1MXEA 1N2DA 3SG6A 1SR6B 4WQ2A 1DGUA 4XJKB 2WNDA 3SIAA 3BXKA 2G2BA 3WNXB 1LA0A 1Y1UA 3VRNA 1YUUA 3BUNB 1U5IA 1OMRA 1C07A 2KHNA 3CR5X 4FQOA 1JF2A 3O4YA 2L51A 2OTGB 1A29A 3CS1A 1WDCC 2AAOA 3M0WA 1F8HA 2QACA 3D0YA 2PRUA 4OR9B 1YVHA 1D1OA 1LVCD 1B8LA 1A75A 1KCYA 2KFHA 2MLFC 1XFYO 1SCMB 3NSOA 2LE9B 2BECA 4C0LA 1TCOB 4DIRA 2K2AA 1WLMA 2KQYA 2JULA 2I94A 2LMTA 1TNPA 3GK4X 3PM8A 1CDLA 5ER5A 2ISDA 1M45A 1SW8A 1Y6WA 5JOLA 1DJZA 4MZLA 4PE4A 3FWBA 1NX2A 2L0PA 1IRJA 1BR4B 5CSJA 1IWQA 4HREE 1K2HA 4MRYA 3BQ3A 2BCAA 3TS5C 3VRQA 1B47A 4DUQA 1KQVA 4GBAA 3DVJA 4YGEB 3TUYB 1DF0B 2LVVA 1V1FA 1IJ6A 1CMGA 2JC2A 4CPVA 2VRGA 1Y0VH 2JXLA 2OS8B 1CNPA 1A2XA 1RK9A 2KFFA 1NUBA 1BT6A 4NDBA 2PMYA 2V53A 5AERA 1IG5A 1TTXA 2H61A 4ORCB 1BJFA 2KI4C 3TZ1A 5AFPA 1FPWA 2E6WA 2LCPA 2RGIA 5DKRA 2KBIA 1SR6C 2LANA 1J1DA 3I5GC 2F33A 1KK8B 5HLOA 1ZFSA 4GGFA 1OZSA 1ZACA 5IBWA 1L2OC 1J1EA
chains in the Genus database with same CATH superfamily
1DJXA 1OOHA 1FW4A 1YRTB 1SK6D 2LVJA 3H4SE 4YGAA 5F6TA 1DJGA 1F4OA 2ZN9A 1EJ3A 4M2QA 4ICBA 4MZKA 1LA3A 1OOJA 2CT9A 2OTGC 1CLLA 2L4IA 2Y1NA 2PASA 4MSPA 4GAOA 1S26D 3O6BA 2M1UA 1B1GA 3PATA 1SKTA 5I2OA 4ETOA 3L4LA 1QX2A 1SPYA 3CZ0A 1M31A 3EVUA 1SCMC 1QWVA 2LHLA 2M97A 2TN4A 3DVMA 1BG1A 4MEWA 1C7VA 3S0GA 3IQQA 3IF7A 3O2PA 3OX6A 1J7QA 1PALA 2Q4UA 3BOWA 1S6IA 2AUCA 2JTZA 2NLNA 1CDMA 4OVNF 2KAYA 2JXCA 3HCMA 3VRRA 5DKNA 3JVTB 5AXIA 3Q8IA 1DQEA 1W7JB 2LHIA 1UHHA 3BUMB 5J3XA 1PRWA 1QIWA 3EG5B 1DTLA 2JPOA 4GNKB 4P2YB 5HKYA 1YVLA 3TUYC 3CGAA 2L98A 3BFHA 1VRKA 4TNCA 1S3PA 1XK4A 2OS8C 3SJSA 1AHRA 1YR5A 4JD9A 2KYCA 2KI6C 1OZOA 3BUWB 5PALA 1OMVA 1SMGA 3AKBA 3TS5B 3EK8A 3B86A 1EG3A 1G4YR 1WRKA 1ZMZA 4JPZB 4F0ZB 2OPOA 3ZWHA 2JTTA 2BNXA 1KSOA 2NCOA 1SL7A 1TRFA 1KK8C 3EVRA 4FQTA 1CTRA 4NQGA 3O78A 1JUOA 2L5XB 2LUCA 1CFPA 2AMIA 2WCFA 2ZN8A 3S0FA 2KGRA 1UP5A 5FI7A 1XFWO 1W7IB 1AUIB 1K93D 2KPHA 3E3RA 1S36A 1S6JA 1EG4A 2P6BB 3EKHA 2QEVA 2M0RA 5CSNA 2PALA 3I5GB 2K7OA 2K2FA 3DF0B 2JRFA 2CCMA 5G08A 5AEQA 1DGVA 1P28A 2PQLA 1KQMB 4INXA 1L2OB 2FJUB 4PHNA 1XVJA 1QX5B 1TNWA 1BU3A 2CTNA 1GGZA 1B8CA 3OHMB 1F4QA 1N0YA 3LLEA 3NSKA 3SG5A 4PHKA 4D1EA 1U5IB 3FIAA 2F8PA 4BY4A 2K0JA 2WCJA 2WOSA 1TNXA 1QS7A 1YURA 2WCKA 1NWDA 3CZ1A 3D0YB 4XJKA 4DCKA 1EH2A 1XFUO 2BCXA 2SASA 1TNQA 1KFXL 3JVTC 3A4UB 3D75A 3JTDB 1MXLC 1YUSA 1K9KA 1N65A 1S1EA 2DOQA 2WCMA 1UHNA 2NXQA 1PVBA 2LAPA 1KWOC 3OGNA 5DICA 1V1GA 1DJYA 2HQ8A 1OQPA 5I8NA 1ZOTB 2NCPA 1X02A 5I2LA 4YGDB 1ALVA 2Y5IA 1RTP1 1CLBA 1OMDA 1YRUB 2Y4QA 2LP3A 3NGVA 3S0DA 2L4HA 5JJGA 1NX3A 1QIVA 1XFXO 4NDDA 1J7RA 2EHBA 1TCFA 4PHMA 1NX0A 4MBEA 5K89A 1DMOA 4PCWA 1CDNA 1KFUS 2KQ6A 3NHIA 1NSHA 2F2PA 1ALWA 4GPLB 1K8UA 4OV2A 1DJHA 2LV7A 3K21A 2O60A 1SSEB 4AQJA 1CDPA 3IVTA 4PE7A 1OOFA 5D3OA 1QX7A 4YI9A 4QJ4B 2BKIB 2M1KB 2FOTA 4A4CA 4N1GA 1QASA 2LMUA 2BCBA 1IQ3A 1MHOA 3VROA 1IKUA 3ZNIA 1NPQA 3PN7B 4PE1A 1WRZA 3WHUB 4NDCA 4MLWA 1DF0A 5FYXA 3SS4A 1KQMC 1CM1A 1UHIA 4R1EA 4MN0A 2I2RE 2LP2A 3GK2A 1BMOA 4L9MA 1NCYA 1YX8A 3D73A 1JC2A 1MUXA 1DVIA 1WRLA 1NCZA 4JKTA 1L7ZA 5GQQC 1XO5A 2K7CA 2MHHA 1PULA 1M63B 2WC5A 2F2OA 3BFBA 3WXAA 2JPTA 3CDNA 3LK0A 1RWYA 2HF5A 4C0KA 4C0JA 1C3YA 2CBLA 2WC8A 3JTDC 1CKKA 4UPGA 1TUJA 1RROA 4AQIA 1JSAA 1WY9A 1M39A 2I18A 1AJ4A 3I5IB 1BF5A 3I5HB 3B88A 3K1EA 3KHEA 3S0EA 1Z2CB 2MLEC 1ODBA 3AKAA 4CFRA 2JT3A 3UNWA 1S6CA 3QRXA 3NHTA 2M29A 4OKHA 2M9GA 3OBVA 3SG2A 1K96A 1YTZC 1B4CA 1TOPA 2KAXA 2KI6D 2O5GA 3D77A 2JNFA 2JU0A 2M49B 2K61A 1NX1A 2BBNA 2P71A 4PALA 4M2PA 2A4JA 1JBAA 1GJYA 4WRIA 1KWOB 3PALA 3PJIA 2ERBA 3OB1B 2QPTA 3OP0A 3V2LA 3I5FB 1EXRA 2Q91A 2ZNDA 4FTGA 1SCVA 4I5LB 2KGBC 1ORGA 2LVIA 1XFRA 2QEBA 3EK7A 1C7WA 1LKJA 2WCHA 1NCXA 2ZFDA 2E30A 4DS7A 1F55A 4YGCB 1EL4A 1K95A 2Y1MA 1IQ5A 3PN7C 1A4PA 4BY5A 2ZRSA 1DELA 1OSAA 1NP8A 4PHJA 4ORAB 2SCPA 2M8UA 1QV0A 2LLSA 3BYAA 1YX7A 2EGDA 3RLZA 3CYZA 3OX5A 3BFAA 1SNLA 3TDUA 3A8RA 1UWOA 1XFVO 2LVKA 5I2QA 3PLFB 1BOCA 3D10A 2ZNEA 1SY9A 1ZUZA 5CPVA 1E8AA 1F70A 4PE0A 3CTNA 3F45A 1R2UA 2COLB 4IJ7A 2L50A 2HETA 3CLNA 1KSMA 1SL9A 1MF8B 4MZJA 5B8IB 2MRDA 3WHTB 1DC1A 2LC5A 4OCIA 3VGOA 1CFDA 1TWOA 4I5JA 2BE6A 2MAZA 3I5IC 4N1FA 4AOMA 1Y1XA 5D7FA 4YGBB 3I5HC 3KEVA 3B6XA 4CIDA 2JT0A 1J7OA 1CM4A 4P5OE 1HT9A 3HX4A 4HRHA 1AJ5A 3DF0A 2GV5A 1K9UA 3OB2B 2JWWA 3DY9A 3GOFA 4HSZA 1MR8A 5BPJA 2M7NA 3SIBA 3AAJA 2LLUA 1JF0A 1SRAA 1A75B 3NSIA 5ER4X 4YRUA 3FE9A 1JFJA 5EL2A 1FI6A 3KF9A 1J7PA 3LCPC 1FI5A 2KDHA 5HKWA 1IH0A 1PSBA 2FCDA 2BKHB 4MRXA 1TUZA 1XYDA 1W9ZA 3I5FC 3PFVA 3FS7A 2HPSA 1LINA 2M3WA 3FWCA 4PDZA 2P70A 3NXAA 4GGNA 1QTXA 1CFFA 1XK4C 4IL1A 2ZRTA 4ZCUA 1BLQA 1GGWA 2H8VA 4GFTA 2L2CA 3BJHA 5I94A 1AVSA 1JFKA 2WC6A 1IJ5A 2M7LA 1SBJA 3MSEB 3PM2A 3S0AA 5KTYA 1PVAA 3QMEA 1CMFA 3KO0A 2WCLA 5KSZA 3AAKA 1UURA 2IS9A 4DRWA 5KU1A 2NZ0A 2GTEA 1UHKA 2I7AA 2KLDA 5FI2A 4WQ3A 2MBXA 4M2OA 2PVBA 2KOTA 2QEHA 2JNXA 2WCBA 1LXFC 1SYMA 3L47A 1RJVA 4I5KA 1K9PA 2BL0B 2LMVA 5AANA 3EK4A 4XYNA 5HKZA 1YUTA 4QJ3B 2JZIA 3BUXB 3CWGA 3CZ2A 1XFZO 4U8DA 1GM0A 4HRGA 1MQ1A 3ICBA 3SG7A 1PSRA 1TN4A 4KYNA 3L4AA 3TDZA 1QVIZ 1F71A 4E68A 1AK8A 1IIOA 2KYFA 4USLA 3EVVA 2WORA 2EC6B 1G33A 1M46A 1H8BA 4QJ5B 2ZKMX 2KFGA 3DVKA 3GK1A 3SS3A 4CLNA 2KAVA 1GQMA 2JQ6A 1G8IA 2K7BA 3CR2A 3SS5A 5TNCA 1WLZA 1R6PA 2K8MB 1CFCA 1QLKA 3IQOA 4GUKA 1FBVA 3C1VA 1XA5A 1QVIY 1Y1AA 2KBMA 4YI8A 1RECA 1DT7B 2LNKA 3BOWB 2F3YA 1QJTA 2JOJA 1K90D 2L2EA 2BE4A 2R2IA 2WCEA 1OOGA 1K94A 3B87A 1UUSA 3TDIA 2JT8A 2FCEA 3BUOB 5CSFA 3R72A 2KSPA 1KFXS 4INWA 1LS8A 5CSIA 2B1UA 2HQWA 3LL8B 4OZDA 1OW4A 4CFQA 1PK0D 3SG3A 1F54A 3R1OA 1QV1A 1C3ZA 5DKQA 1AP4A 1WDCB 2MJWB 2CXJA 3EKJA 4MVFA 1FF1A 2YGUA 2K7DA 1MWNA 1QLSA 2PSRA 3PSRA 2H61C 1UHJA 2LUXA 2MA2A 1KFUL 4JQ0D 1J55A 2BL0C 3DXLA 1A03A 1IGVA 1RFJA 3DVEA 1CLMA 1BODA 2G9BA 2GGZA 1NYAA 1B8RA 4A4BA 1B7TZ 1NIWA 4GGFC 4N5XA 3KPXA 1CB1A 1H4BA 1QXPA 1KK7Z 1SL8A 1BR1B 1QATA 3CZTX 4I5NB 2H2KA 1OE9B 3N7HA 2BBMA 5HL1A 1B9AA 3CR4X 1T14A 2D8NA 3S0BA 1S5GZ 3D74A 3SG4A 2GGMA 2QDIA 2EC6C 1Q80A 1DEKA 3VRPA 3D78A 4JWQA 1JWDA 1B7TY 3DD4A 4ZCVA 5HLVA 2KLEA 1KK7Y 1Z4HA 2CNPA 2LLTA 3R1VA 2FJYA 4PT1A 5HYDA 1TIZA 3D76A 3RM1A 2KI4B 5D69A 1DJIA 2KNEA 1HQVA 1DJWA 1S5GY 2F3ZA 3LK1A 3O4XA 4YBHB 2LM5A 3NSLA 2BAPA 4ORBB 4Q04A 1MXEA 1N2DA 3SG6A 1SR6B 4WQ2A 3VB1A 1DGUA 4XJKB 2WNDA 3SIAA 3BXKA 2G2BA 3WNXB 1LA0A 1Y1UA 3VRNA 1YUUA 3BUNB 3DYEA 3UO9A 1U5IA 1OMRA 2QEOA 1C07A 2L5YA 2KHNA 3CR5X 4FQOA 1JF2A 3FE8A 3O4YA 2L51A 2OTGB 1A29A 3CS1A 1WDCC 2AAOA 3M0WA 1F8HA 2QACA 3D0YA 2PRUA 4OR9B 1YVHA 1D1OA 4F7FA 1LVCD 1B8LA 2PYQA 1A75A 1KCYA 2KFHA 2MLFC 1XFYO 1OOIX 1SCMB 3NSOA 2LE9B 2BECA 3R1PA 4C0LA 1TCOB 4DIRA 2K2AA 1WLMA 2KQYA 2JULA 2I94A 2LMTA 3CABA 1TNPA 3GK4X 3PM8A 1CDLA 5ER5A 2ISDA 3DZTA 1M45A 1SW8A 1Y6WA 5JOLA 1DJZA 4MZLA 4PE4A 3FWBA 3FE6A 1NX2A 2L0PA 1IRJA 1BR4B 5CSJA 1IWQA 4HREE 1K2HA 4MRYA 3BQ3A 2K60A 5FI6A 2BCAA 3TS5C 3VRQA 1B47A 4DUQA 1KQVA 4GBAA 3DVJA 4YGEB 3TUYB 1DF0B 2LVVA 1V1FA 1IJ6A 3B7AA 1CMGA 2JC2A 4CPVA 2VRGA 1Y0VH 2JXLA 2OS8B 1CNPA 1A2XA 1RK9A 2KFFA 1NUBA 1BT6A 4NDBA 2PMYA 2V53A 5AERA 1IG5A 1TTXA 2H61A 4ORCB 1BJFA 2KI4C 3TZ1A 5AFPA 1FPWA 2E6WA 2LCPA 2RGIA 5DKRA 2KBIA 1SR6C 2LANA 1J1DA 3I5GC 2F33A 3RZSA 1KK8B 5HLOA 1ZFSA 4GGFA 1OZSA 1ZACA 5IBWA 1L2OC 1J1EA
chains in the Genus database with same CATH topology
1DJXA 1YRTB 1FW4A 2LVJA 1SK6D 3H4SE 4YGAA 5F6TA 1DJGA 1F4OA 2ZN9A 1EJ3A 4M2QA 4ICBA 4MZKA 1LA3A 1OOJA 2CT9A 2OTGC 1CLLA 2L4IA 2Y1NA 2PASA 4MSPA 4GAOA 1S26D 3O6BA 2M1UA 1B1GA 3PATA 1SKTA 5I2OA 4ETOA 1QX2A 1SPYA 1M31A 3EVUA 1SCMC 2LHLA 2M97A 2TN4A 1BG1A 3DVMA 1JC2A 4MEWA 1C7VA 3IQQA 3IF7A 3O2PA 3OX6A 1J7QA 1PALA 2Q4UA 3BOWA 1S6IA 2AUCA 2JTZA 2NLNA 1CDMA 4OVNF 2KAYA 2JXCA 3HCMA 3VRRA 5DKNA 3JVTB 5AXIA 1W7JB 2LHIA 3BUMB 1UHHA 5J3XA 1PRWA 1QIWA 1DTLA 4P2YB 4GNKB 5HKYA 1YVLA 3TUYC 3CGAA 2L98A 1VRKA 4TNCA 1S3PA 1XK4A 2OS8C 3SJSA 1AHRA 1YR5A 2KYCA 2KI6C 1OZOA 3BUWB 5PALA 1OMVA 1SMGA 3AKBA 3TS5B 3EK8A 1EG3A 1G4YR 1WRKA 1ZMZA 4JPZB 4F0ZB 2OPOA 3ZWHA 2JTTA 2NCOA 1KSOA 1SL7A 1TRFA 1KK8C 3EVRA 1CTRA 4NQGA 3O78A 1JUOA 2L5XB 2LUCA 1CFPA 2AMIA 2WCFA 2ZN8A 2KGRA 1UP5A 1XFWO 1W7IB 1AUIB 1K93D 3E3RA 1S36A 1S6JA 1EG4A 2P6BB 3EKHA 2M0RA 5CSNA 2PALA 3I5GB 2K7OA 2K2FA 3DF0B 2JRFA 2CCMA 5G08A 5AEQA 1DGVA 1KQMB 1L2OB 2FJUB 4PHNA 1XVJA 1QX5B 1TNWA 1BU3A 2CTNA 1GGZA 1B8CA 3OHMB 1F4QA 1N0YA 3LLEA 3NSKA 3SG5A 4PHKA 4D1EA 1U5IB 3FIAA 2F8PA 4BY4A 2K0JA 2WOSA 1TNXA 1QS7A 1YURA 4DCKA 1NWDA 4XJKA 3D0YB 1EH2A 1XFUO 2BCXA 2SASA 1TNQA 1KFXL 3JVTC 3A4UB 3JTDB 1MXLC 1YUSA 1K9KA 1N65A 1S1EA 2DOQA 1UHNA 2NXQA 1PVBA 2LAPA 1KWOC 1V1GA 1DJYA 2HQ8A 1OQPA 5I8NA 1ZOTB 2NCPA 1X02A 5I2LA 4YGDB 1ALVA 2Y5IA 1RTP1 1CLBA 1OMDA 1YRUB 2Y4QA 2LP3A 2L4HA 5JJGA 1NX3A 1QIVA 1XFXO 4NDDA 1J7RA 2EHBA 1TCFA 4PHMA 1NX0A 4MBEA 5K89A 1DMOA 4PCWA 1CDNA 1KFUS 2KQ6A 1NSHA 2F2PA 1ALWA 4GPLB 1K8UA 4OV2A 1DJHA 2LV7A 3K21A 2O60A 4AQJA 1CDPA 4PE7A 4QJ4B 1QX7A 4YI9A 2BKIB 2M1KB 2FOTA 4A4CA 4N1GA 1QASA 2LMUA 2BCBA 1IQ3A 1MHOA 3VROA 1IKUA 3ZNIA 1NPQA 3PN7B 4PE1A 1WRZA 3WHUB 4NDCA 4MLWA 1DF0A 5FYXA 1KQMC 1CM1A 1UHIA 4R1EA 4MN0A 2I2RE 2LP2A 3GK2A 1BMOA 4L9MA 1NCYA 1YX8A 1MUXA 1DVIA 1WRLA 1NCZA 5GQQC 1L7ZA 1XO5A 2K7CA 2MHHA 1PULA 1M63B 3WXAA 2F2OA 2JPTA 3LK0A 1RWYA 2HF5A 4C0KA 4C0JA 2CBLA 2WC8A 3JTDC 1CKKA 4UPGA 1RROA 4AQIA 1JSAA 1WY9A 1M39A 2I18A 1AJ4A 3I5IB 1BF5A 3I5HB 3KHEA 2MLEC 1ODBA 3AKAA 4CFRA 2JT3A 1S6CA 3QRXA 2M29A 4OKHA 2M9GA 3SG2A 1K96A 1YTZC 1B4CA 1TOPA 2KAXA 2KI6D 2O5GA 2JNFA 2JU0A 2M49B 2K61A 1NX1A 2BBNA 4PALA 4M2PA 2A4JA 1JBAA 1GJYA 4WRIA 1KWOB 3PALA 3OB1B 2QPTA 3OP0A 3I5FB 1EXRA 2Q91A 2ZNDA 4FTGA 1SCVA 4I5LB 2KGBC 2LVIA 3EK7A 1C7WA 1LKJA 2ZFDA 1NCXA 4DS7A 2E30A 1F55A 4YGCB 1EL4A 1K95A 2Y1MA 1IQ5A 3PN7C 1A4PA 4BY5A 2ZRSA 4PHJA 1OSAA 1NP8A 4ORAB 2SCPA 2M8UA 1QV0A 2LLSA 3BYAA 1YX7A 2EGDA 3RLZA 3OX5A 1SNLA 3TDUA 3A8RA 1UWOA 1XFVO 2LVKA 5I2QA 3PLFB 1BOCA 3D10A 2ZNEA 1SY9A 1ZUZA 5CPVA 1E8AA 1F70A 4PE0A 3CTNA 3F45A 1R2UA 2COLB 2L50A 2HETA 3CLNA 1KSMA 1SL9A 1MF8B 4MZJA 5B8IB 2MRDA 3WHTB 2LC5A 4OCIA 3VGOA 1CFDA 4I5JA 2BE6A 2MAZA 3I5IC 4N1FA 4AOMA 1Y1XA 5D7FA 4YGBB 3I5HC 3KEVA 4CIDA 2JT0A 1J7OA 1CM4A 4P5OE 1HT9A 3HX4A 4HRHA 1AJ5A 3DF0A 2GV5A 1K9UA 3OB2B 2JWWA 4HSZA 3GOFA 1MR8A 5BPJA 2M7NA 3SIBA 3AAJA 2LLUA 1JF0A 1SRAA 1A75B 3NSIA 5ER4X 4YRUA 1JFJA 1FI6A 3KF9A 1J7PA 3LCPC 1FI5A 2KDHA 5HKWA 1IH0A 1PSBA 2FCDA 2BKHB 4MRXA 1XYDA 3I5FC 3PFVA 3FS7A 2HPSA 1LINA 2M3WA 3FWCA 4PDZA 3NXAA 4GGNA 1QTXA 1CFFA 1XK4C 4IL1A 2ZRTA 4ZCUA 1BLQA 1GGWA 4GFTA 1AVSA 1JFKA 2M7LA 1IJ5A 1SBJA 3MSEB 5KTYA 1PVAA 1CMFA 3KO0A 5KSZA 3AAKA 1UURA 2IS9A 4DRWA 5KU1A 2NZ0A 1UHKA 2I7AA 2MBXA 4WQ3A 4M2OA 2PVBA 2KOTA 2JNXA 2WCBA 1LXFC 1SYMA 1RJVA 4I5KA 1K9PA 2BL0B 2LMVA 5AANA 3EK4A 4XYNA 5HKZA 1YUTA 4QJ3B 2JZIA 3BUXB 3CWGA 4U8DA 1XFZO 4HRGA 1MQ1A 3ICBA 3SG7A 1PSRA 1TN4A 3TDZA 1QVIZ 1F71A 4E68A 1AK8A 2KYFA 4USLA 3EVVA 2WORA 2EC6B 1G33A 1M46A 1H8BA 4QJ5B 2ZKMX 2KFGA 3DVKA 3GK1A 4CLNA 2KAVA 1GQMA 2JQ6A 1G8IA 2K7BA 3CR2A 5TNCA 1WLZA 1R6PA 2K8MB 1CFCA 1QLKA 3IQOA 4GUKA 1FBVA 3C1VA 1XA5A 1QVIY 1Y1AA 2KBMA 4YI8A 1RECA 1DT7B 2LNKA 3BOWB 2F3YA 1QJTA 2JOJA 1K90D 2L2EA 2BE4A 2R2IA 2WCEA 1K94A 1UUSA 3TDIA 2JT8A 2FCEA 3BUOB 5CSFA 2KSPA 1KFXS 5CSIA 2B1UA 2HQWA 3LL8B 1F54A 4CFQA 1PK0D 3SG3A 1QV1A 5DKQA 1AP4A 1WDCB 2MJWB 2CXJA 3EKJA 4MVFA 1FF1A 2K7DA 1MWNA 1QLSA 2PSRA 3PSRA 2H61C 1UHJA 2LUXA 2MA2A 1KFUL 4JQ0D 1J55A 2BL0C 1A03A 1IGVA 1RFJA 3DVEA 1CLMA 1BODA 2G9BA 2GGZA 1NYAA 1B8RA 4A4BA 1B7TZ 1NIWA 4GGFC 4N5XA 3KPXA 1CB1A 1H4BA 1QXPA 1KK7Z 1SL8A 1BR1B 1QATA 3CZTX 4I5NB 2H2KA 1OE9B 2BBMA 1B9AA 3CR4X 2D8NA 1S5GZ 3SG4A 2GGMA 2EC6C 1Q80A 3VRPA 4JWQA 1JWDA 1B7TY 3DD4A 4ZCVA 5HLVA 1KK7Y 2CNPA 2LLTA 5HYDA 1TIZA 3RM1A 2KI4B 5D69A 1DJIA 2KNEA 1HQVA 1DJWA 1S5GY 2F3ZA 3LK1A 4YBHB 2LM5A 3NSLA 4Q04A 4ORBB 1MXEA 1N2DA 3SG6A 1SR6B 4WQ2A 1DGUA 4XJKB 2WNDA 3SIAA 3BXKA 2G2BA 3WNXB 1LA0A 1Y1UA 3VRNA 1YUUA 3BUNB 1U5IA 1OMRA 1C07A 2KHNA 3CR5X 4FQOA 1JF2A 3O4YA 2L51A 2OTGB 1A29A 3CS1A 1WDCC 2AAOA 3M0WA 1F8HA 2QACA 3D0YA 2PRUA 4OR9B 1YVHA 1D1OA 1LVCD 1B8LA 1A75A 1KCYA 2KFHA 2MLFC 1XFYO 1SCMB 3NSOA 2LE9B 2BECA 4C0LA 1TCOB 4DIRA 2K2AA 1WLMA 2KQYA 2JULA 2I94A 2LMTA 1TNPA 3GK4X 3PM8A 1CDLA 5ER5A 2ISDA 1M45A 1SW8A 1Y6WA 5JOLA 1DJZA 4MZLA 4PE4A 3FWBA 1NX2A 2L0PA 1IRJA 1BR4B 5CSJA 1IWQA 4HREE 1K2HA 4MRYA 3BQ3A 2BCAA 3TS5C 3VRQA 1B47A 4DUQA 1KQVA 4GBAA 3DVJA 4YGEB 3TUYB 1DF0B 2LVVA 1V1FA 1IJ6A 1CMGA 2JC2A 4CPVA 2VRGA 1Y0VH 2JXLA 2OS8B 1CNPA 1A2XA 1RK9A 2KFFA 1NUBA 1BT6A 4NDBA 2PMYA 2V53A 5AERA 1IG5A 1TTXA 2H61A 4ORCB 1BJFA 2KI4C 3TZ1A 5AFPA 1FPWA 2E6WA 2LCPA 2RGIA 5DKRA 2KBIA 1SR6C 2LANA 1J1DA 3I5GC 2F33A 1KK8B 5HLOA 1ZFSA 4GGFA 1OZSA 1ZACA 5IBWA 1L2OC 1J1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJX A;  1YRT B;  1FW4 A;  2LVJ A;  1SK6 D;  3H4S E;  4YGA A;  5F6T A;  1DJG A;  1F4O A;  2ZN9 A;  1EJ3 A;  4M2Q A;  4ICB A;  4MZK A;  1LA3 A;  1OOJ A;  2CT9 A;  2OTG C;  1CLL A;  2L4I A;  2Y1N A;  2PAS A;  4MSP A;  4GAO A;  1S26 D;  3O6B A;  2M1U A;  1B1G A;  3PAT A;  1SKT A;  5I2O A;  4ETO A;  1QX2 A;  1SPY A;  1M31 A;  3EVU A;  1SCM C;  2LHL A;  2M97 A;  2TN4 A;  1BG1 A;  3DVM A;  1JC2 A;  4MEW A;  1C7V A;  3IQQ A;  3IF7 A;  3O2P A;  3OX6 A;  1J7Q A;  1PAL A;  2Q4U A;  3BOW A;  1S6I A;  2AUC A;  2JTZ A;  2NLN A;  1CDM A;  4OVN F;  2KAY A;  2JXC A;  3HCM A;  3VRR A;  5DKN A;  3JVT B;  5AXI A;  1W7J B;  2LHI A;  3BUM B;  1UHH A;  5J3X A;  1PRW A;  1QIW A;  1DTL A;  4P2Y B;  4GNK B;  5HKY A;  1YVL A;  3TUY C;  3CGA A;  2L98 A;  1VRK A;  4TNC A;  1S3P A;  1XK4 A;  2OS8 C;  3SJS A;  1AHR A;  1YR5 A;  2KYC A;  2KI6 C;  1OZO A;  3BUW B;  5PAL A;  1OMV A;  1SMG A;  3AKB A;  3TS5 B;  3EK8 A;  1EG3 A;  1G4Y R;  1WRK A;  1ZMZ A;  4JPZ B;  4F0Z B;  2OPO A;  3ZWH A;  2JTT A;  2NCO A;  1KSO A;  1SL7 A;  1TRF A;  1KK8 C;  3EVR A;  1CTR A;  4NQG A;  3O78 A;  1JUO A;  2L5X B;  2LUC A;  1CFP A;  2AMI A;  2WCF A;  2ZN8 A;  2KGR A;  1UP5 A;  1XFW O;  1W7I B;  1AUI B;  1K93 D;  3E3R A;  1S36 A;  1S6J A;  1EG4 A;  2P6B B;  3EKH A;  2M0R A;  5CSN A;  2PAL A;  3I5G B;  2K7O A;  2K2F A;  3DF0 B;  2JRF A;  2CCM A;  5G08 A;  5AEQ A;  1DGV A;  1KQM B;  1L2O B;  2FJU B;  4PHN A;  1XVJ A;  1QX5 B;  1TNW A;  1BU3 A;  2CTN A;  1GGZ A;  1B8C A;  3OHM B;  1F4Q A;  1N0Y A;  3LLE A;  3NSK A;  3SG5 A;  4PHK A;  4D1E A;  1U5I B;  3FIA A;  2F8P A;  4BY4 A;  2K0J A;  2WOS A;  1TNX A;  1QS7 A;  1YUR A;  4DCK A;  1NWD A;  4XJK A;  3D0Y B;  1EH2 A;  1XFU O;  2BCX A;  2SAS A;  1TNQ A;  1KFX L;  3JVT C;  3A4U B;  3JTD B;  1MXL C;  1YUS A;  1K9K A;  1N65 A;  1S1E A;  2DOQ A;  1UHN A;  2NXQ A;  1PVB A;  2LAP A;  1KWO C;  1V1G A;  1DJY A;  2HQ8 A;  1OQP A;  5I8N A;  1ZOT B;  2NCP A;  1X02 A;  5I2L A;  4YGD B;  1ALV A;  2Y5I A;  1RTP 1;  1CLB A;  1OMD A;  1YRU B;  2Y4Q A;  2LP3 A;  2L4H A;  5JJG A;  1NX3 A;  1QIV A;  1XFX O;  4NDD A;  1J7R A;  2EHB A;  1TCF A;  4PHM A;  1NX0 A;  4MBE A;  5K89 A;  1DMO A;  4PCW A;  1CDN A;  1KFU S;  2KQ6 A;  1NSH A;  2F2P A;  1ALW A;  4GPL B;  1K8U A;  4OV2 A;  1DJH A;  2LV7 A;  3K21 A;  2O60 A;  4AQJ A;  1CDP A;  4PE7 A;  4QJ4 B;  1QX7 A;  4YI9 A;  2BKI B;  2M1K B;  2FOT A;  4A4C A;  4N1G A;  1QAS A;  2LMU A;  2BCB A;  1IQ3 A;  1MHO A;  3VRO A;  1IKU A;  3ZNI A;  1NPQ A;  3PN7 B;  4PE1 A;  1WRZ A;  3WHU B;  4NDC A;  4MLW A;  1DF0 A;  5FYX A;  1KQM C;  1CM1 A;  1UHI A;  4R1E A;  4MN0 A;  2I2R E;  2LP2 A;  3GK2 A;  1BMO A;  4L9M A;  1NCY A;  1YX8 A;  1MUX A;  1DVI A;  1WRL A;  1NCZ A;  5GQQ C;  1L7Z A;  1XO5 A;  2K7C A;  2MHH A;  1PUL A;  1M63 B;  3WXA A;  2F2O A;  2JPT A;  3LK0 A;  1RWY A;  2HF5 A;  4C0K A;  4C0J A;  2CBL A;  2WC8 A;  3JTD C;  1CKK A;  4UPG A;  1RRO A;  4AQI A;  1JSA A;  1WY9 A;  1M39 A;  2I18 A;  1AJ4 A;  3I5I B;  1BF5 A;  3I5H B;  3KHE A;  2MLE C;  1ODB A;  3AKA A;  4CFR A;  2JT3 A;  1S6C A;  3QRX A;  2M29 A;  4OKH A;  2M9G A;  3SG2 A;  1K96 A;  1YTZ C;  1B4C A;  1TOP A;  2KAX A;  2KI6 D;  2O5G A;  2JNF A;  2JU0 A;  2M49 B;  2K61 A;  1NX1 A;  2BBN A;  4PAL A;  4M2P A;  2A4J A;  1JBA A;  1GJY A;  4WRI A;  1KWO B;  3PAL A;  3OB1 B;  2QPT A;  3OP0 A;  3I5F B;  1EXR A;  2Q91 A;  2ZND A;  4FTG A;  1SCV A;  4I5L B;  2KGB C;  2LVI A;  3EK7 A;  1C7W A;  1LKJ A;  2ZFD A;  1NCX A;  4DS7 A;  2E30 A;  1F55 A;  4YGC B;  1EL4 A;  1K95 A;  2Y1M A;  1IQ5 A;  3PN7 C;  1A4P A;  4BY5 A;  2ZRS A;  4PHJ A;  1OSA A;  1NP8 A;  4ORA B;  2SCP A;  2M8U A;  1QV0 A;  2LLS A;  3BYA A;  1YX7 A;  2EGD A;  3RLZ A;  3OX5 A;  1SNL A;  3TDU A;  3A8R A;  1UWO A;  1XFV O;  2LVK A;  5I2Q A;  3PLF B;  1BOC A;  3D10 A;  2ZNE A;  1SY9 A;  1ZUZ A;  5CPV A;  1E8A A;  1F70 A;  4PE0 A;  3CTN A;  3F45 A;  1R2U A;  2COL B;  2L50 A;  2HET A;  3CLN A;  1KSM A;  1SL9 A;  1MF8 B;  4MZJ A;  5B8I B;  2MRD A;  3WHT B;  2LC5 A;  4OCI A;  3VGO A;  1CFD A;  4I5J A;  2BE6 A;  2MAZ A;  3I5I C;  4N1F A;  4AOM A;  1Y1X A;  5D7F A;  4YGB B;  3I5H C;  3KEV A;  4CID A;  2JT0 A;  1J7O A;  1CM4 A;  4P5O E;  1HT9 A;  3HX4 A;  4HRH A;  1AJ5 A;  3DF0 A;  2GV5 A;  1K9U A;  3OB2 B;  2JWW A;  4HSZ A;  3GOF A;  1MR8 A;  5BPJ A;  2M7N A;  3SIB A;  3AAJ A;  2LLU A;  1JF0 A;  1SRA A;  1A75 B;  3NSI A;  5ER4 X;  4YRU A;  1JFJ A;  1FI6 A;  3KF9 A;  1J7P A;  3LCP C;  1FI5 A;  2KDH A;  5HKW A;  1IH0 A;  1PSB A;  2FCD A;  2BKH B;  4MRX A;  1XYD A;  3I5F C;  3PFV A;  3FS7 A;  2HPS A;  1LIN A;  2M3W A;  3FWC A;  4PDZ A;  3NXA A;  4GGN A;  1QTX A;  1CFF A;  1XK4 C;  4IL1 A;  2ZRT A;  4ZCU A;  1BLQ A;  1GGW A;  4GFT A;  1AVS A;  1JFK A;  2M7L A;  1IJ5 A;  1SBJ A;  3MSE B;  5KTY A;  1PVA A;  1CMF A;  3KO0 A;  5KSZ A;  3AAK A;  1UUR A;  2IS9 A;  4DRW A;  5KU1 A;  2NZ0 A;  1UHK A;  2I7A A;  2MBX A;  4WQ3 A;  4M2O A;  2PVB A;  2KOT A;  2JNX A;  2WCB A;  1LXF C;  1SYM A;  1RJV A;  4I5K A;  1K9P A;  2BL0 B;  2LMV A;  5AAN A;  3EK4 A;  4XYN A;  5HKZ A;  1YUT A;  4QJ3 B;  2JZI A;  3BUX B;  3CWG A;  4U8D A;  1XFZ O;  4HRG A;  1MQ1 A;  3ICB A;  3SG7 A;  1PSR A;  1TN4 A;  3TDZ A;  1QVI Z;  1F71 A;  4E68 A;  1AK8 A;  2KYF A;  4USL A;  3EVV A;  2WOR A;  2EC6 B;  1G33 A;  1M46 A;  1H8B A;  4QJ5 B;  2ZKM X;  2KFG A;  3DVK A;  3GK1 A;  4CLN A;  2KAV A;  1GQM A;  2JQ6 A;  1G8I A;  2K7B A;  3CR2 A;  5TNC A;  1WLZ A;  1R6P A;  2K8M B;  1CFC A;  1QLK A;  3IQO A;  4GUK A;  1FBV A;  3C1V A;  1XA5 A;  1QVI Y;  1Y1A A;  2KBM A;  4YI8 A;  1REC A;  1DT7 B;  2LNK A;  3BOW B;  2F3Y A;  1QJT A;  2JOJ A;  1K90 D;  2L2E A;  2BE4 A;  2R2I A;  2WCE A;  1K94 A;  1UUS A;  3TDI A;  2JT8 A;  2FCE A;  3BUO B;  5CSF A;  2KSP A;  1KFX S;  5CSI A;  2B1U A;  2HQW A;  3LL8 B;  1F54 A;  4CFQ A;  1PK0 D;  3SG3 A;  1QV1 A;  5DKQ A;  1AP4 A;  1WDC B;  2MJW B;  2CXJ A;  3EKJ A;  4MVF A;  1FF1 A;  2K7D A;  1MWN A;  1QLS A;  2PSR A;  3PSR A;  2H61 C;  1UHJ A;  2LUX A;  2MA2 A;  1KFU L;  4JQ0 D;  1J55 A;  2BL0 C;  1A03 A;  1IGV A;  1RFJ A;  3DVE A;  1CLM A;  1BOD A;  2G9B A;  2GGZ A;  1NYA A;  1B8R A;  4A4B A;  1B7T Z;  1NIW A;  4GGF C;  4N5X A;  3KPX A;  1CB1 A;  1H4B A;  1QXP A;  1KK7 Z;  1SL8 A;  1BR1 B;  1QAT A;  3CZT X;  4I5N B;  2H2K A;  1OE9 B;  2BBM A;  1B9A A;  3CR4 X;  2D8N A;  1S5G Z;  3SG4 A;  2GGM A;  2EC6 C;  1Q80 A;  3VRP A;  4JWQ A;  1JWD A;  1B7T Y;  3DD4 A;  4ZCV A;  5HLV A;  1KK7 Y;  2CNP A;  2LLT A;  5HYD A;  1TIZ A;  3RM1 A;  2KI4 B;  5D69 A;  1DJI A;  2KNE A;  1HQV A;  1DJW A;  1S5G Y;  2F3Z A;  3LK1 A;  4YBH B;  2LM5 A;  3NSL A;  4Q04 A;  4ORB B;  1MXE A;  1N2D A;  3SG6 A;  1SR6 B;  4WQ2 A;  1DGU A;  4XJK B;  2WND A;  3SIA A;  3BXK A;  2G2B A;  3WNX B;  1LA0 A;  1Y1U A;  3VRN A;  1YUU A;  3BUN B;  1U5I A;  1OMR A;  1C07 A;  2KHN A;  3CR5 X;  4FQO A;  1JF2 A;  3O4Y A;  2L51 A;  2OTG B;  1A29 A;  3CS1 A;  1WDC C;  2AAO A;  3M0W A;  1F8H A;  2QAC A;  3D0Y A;  2PRU A;  4OR9 B;  1YVH A;  1D1O A;  1LVC D;  1B8L A;  1A75 A;  1KCY A;  2KFH A;  2MLF C;  1XFY O;  1SCM B;  3NSO A;  2LE9 B;  2BEC A;  4C0L A;  1TCO B;  4DIR A;  2K2A A;  1WLM A;  2KQY A;  2JUL A;  2I94 A;  2LMT A;  1TNP A;  3GK4 X;  3PM8 A;  1CDL A;  5ER5 A;  2ISD A;  1M45 A;  1SW8 A;  1Y6W A;  5JOL A;  1DJZ A;  4MZL A;  4PE4 A;  3FWB A;  1NX2 A;  2L0P A;  1IRJ A;  1BR4 B;  5CSJ A;  1IWQ A;  4HRE E;  1K2H A;  4MRY A;  3BQ3 A;  2BCA A;  3TS5 C;  3VRQ A;  1B47 A;  4DUQ A;  1KQV A;  4GBA A;  3DVJ A;  4YGE B;  3TUY B;  1DF0 B;  2LVV A;  1V1F A;  1IJ6 A;  1CMG A;  2JC2 A;  4CPV A;  2VRG A;  1Y0V H;  2JXL A;  2OS8 B;  1CNP A;  1A2X A;  1RK9 A;  2KFF A;  1NUB A;  1BT6 A;  4NDB A;  2PMY A;  2V53 A;  5AER A;  1IG5 A;  1TTX A;  2H61 A;  4ORC B;  1BJF A;  2KI4 C;  3TZ1 A;  5AFP A;  1FPW A;  2E6W A;  2LCP A;  2RGI A;  5DKR A;  2KBI A;  1SR6 C;  2LAN A;  1J1D A;  3I5G C;  2F33 A;  1KK8 B;  5HLO A;  1ZFS A;  4GGF A;  1OZS A;  1ZAC A;  5IBW A;  1L2O C;  1J1E A; 
#chains in the Genus database with same CATH topology
 1DJX A;  1OOH A;  1FW4 A;  1YRT B;  1SK6 D;  2LVJ A;  3H4S E;  4YGA A;  5F6T A;  1DJG A;  1F4O A;  2ZN9 A;  1EJ3 A;  4M2Q A;  4ICB A;  4MZK A;  1LA3 A;  1OOJ A;  2CT9 A;  2OTG C;  1CLL A;  2L4I A;  2Y1N A;  2PAS A;  4MSP A;  4GAO A;  1S26 D;  3O6B A;  2M1U A;  1B1G A;  3PAT A;  1SKT A;  5I2O A;  4ETO A;  3L4L A;  1QX2 A;  1SPY A;  3CZ0 A;  1M31 A;  3EVU A;  1SCM C;  1QWV A;  2LHL A;  2M97 A;  2TN4 A;  3DVM A;  1BG1 A;  4MEW A;  1C7V A;  3S0G A;  3IQQ A;  3IF7 A;  3O2P A;  3OX6 A;  1J7Q A;  1PAL A;  2Q4U A;  3BOW A;  1S6I A;  2AUC A;  2JTZ A;  2NLN A;  1CDM A;  4OVN F;  2KAY A;  2JXC A;  3HCM A;  3VRR A;  5DKN A;  3JVT B;  5AXI A;  3Q8I A;  1DQE A;  1W7J B;  2LHI A;  1UHH A;  3BUM B;  5J3X A;  1PRW A;  1QIW A;  3EG5 B;  1DTL A;  2JPO A;  4GNK B;  4P2Y B;  5HKY A;  1YVL A;  3TUY C;  3CGA A;  2L98 A;  3BFH A;  1VRK A;  4TNC A;  1S3P A;  1XK4 A;  2OS8 C;  3SJS A;  1AHR A;  1YR5 A;  4JD9 A;  2KYC A;  2KI6 C;  1OZO A;  3BUW B;  5PAL A;  1OMV A;  1SMG A;  3AKB A;  3TS5 B;  3EK8 A;  3B86 A;  1EG3 A;  1G4Y R;  1WRK A;  1ZMZ A;  4JPZ B;  4F0Z B;  2OPO A;  3ZWH A;  2JTT A;  2BNX A;  1KSO A;  2NCO A;  1SL7 A;  1TRF A;  1KK8 C;  3EVR A;  4FQT A;  1CTR A;  4NQG A;  3O78 A;  1JUO A;  2L5X B;  2LUC A;  1CFP A;  2AMI A;  2WCF A;  2ZN8 A;  3S0F A;  2KGR A;  1UP5 A;  5FI7 A;  1XFW O;  1W7I B;  1AUI B;  1K93 D;  2KPH A;  3E3R A;  1S36 A;  1S6J A;  1EG4 A;  2P6B B;  3EKH A;  2QEV A;  2M0R A;  5CSN A;  2PAL A;  3I5G B;  2K7O A;  2K2F A;  3DF0 B;  2JRF A;  2CCM A;  5G08 A;  5AEQ A;  1DGV A;  1P28 A;  2PQL A;  1KQM B;  4INX A;  1L2O B;  2FJU B;  4PHN A;  1XVJ A;  1QX5 B;  1TNW A;  1BU3 A;  2CTN A;  1GGZ A;  1B8C A;  3OHM B;  1F4Q A;  1N0Y A;  3LLE A;  3NSK A;  3SG5 A;  4PHK A;  4D1E A;  1U5I B;  3FIA A;  2F8P A;  4BY4 A;  2K0J A;  2WCJ A;  2WOS A;  1TNX A;  1QS7 A;  1YUR A;  2WCK A;  1NWD A;  3CZ1 A;  3D0Y B;  4XJK A;  4DCK A;  1EH2 A;  1XFU O;  2BCX A;  2SAS A;  1TNQ A;  1KFX L;  3JVT C;  3A4U B;  3D75 A;  3JTD B;  1MXL C;  1YUS A;  1K9K A;  1N65 A;  1S1E A;  2DOQ A;  2WCM A;  1UHN A;  2NXQ A;  1PVB A;  2LAP A;  1KWO C;  3OGN A;  5DIC A;  1V1G A;  1DJY A;  2HQ8 A;  1OQP A;  5I8N A;  1ZOT B;  2NCP A;  1X02 A;  5I2L A;  4YGD B;  1ALV A;  2Y5I A;  1RTP 1;  1CLB A;  1OMD A;  1YRU B;  2Y4Q A;  2LP3 A;  3NGV A;  3S0D A;  2L4H A;  5JJG A;  1NX3 A;  1QIV A;  1XFX O;  4NDD A;  1J7R A;  2EHB A;  1TCF A;  4PHM A;  1NX0 A;  4MBE A;  5K89 A;  1DMO A;  4PCW A;  1CDN A;  1KFU S;  2KQ6 A;  3NHI A;  1NSH A;  2F2P A;  1ALW A;  4GPL B;  1K8U A;  4OV2 A;  1DJH A;  2LV7 A;  3K21 A;  2O60 A;  1SSE B;  4AQJ A;  1CDP A;  3IVT A;  4PE7 A;  1OOF A;  5D3O A;  1QX7 A;  4YI9 A;  4QJ4 B;  2BKI B;  2M1K B;  2FOT A;  4A4C A;  4N1G A;  1QAS A;  2LMU A;  2BCB A;  1IQ3 A;  1MHO A;  3VRO A;  1IKU A;  3ZNI A;  1NPQ A;  3PN7 B;  4PE1 A;  1WRZ A;  3WHU B;  4NDC A;  4MLW A;  1DF0 A;  5FYX A;  3SS4 A;  1KQM C;  1CM1 A;  1UHI A;  4R1E A;  4MN0 A;  2I2R E;  2LP2 A;  3GK2 A;  1BMO A;  4L9M A;  1NCY A;  1YX8 A;  3D73 A;  1JC2 A;  1MUX A;  1DVI A;  1WRL A;  1NCZ A;  4JKT A;  1L7Z A;  5GQQ C;  1XO5 A;  2K7C A;  2MHH A;  1PUL A;  1M63 B;  2WC5 A;  2F2O A;  3BFB A;  3WXA A;  2JPT A;  3CDN A;  3LK0 A;  1RWY A;  2HF5 A;  4C0K A;  4C0J A;  1C3Y A;  2CBL A;  2WC8 A;  3JTD C;  1CKK A;  4UPG A;  1TUJ A;  1RRO A;  4AQI A;  1JSA A;  1WY9 A;  1M39 A;  2I18 A;  1AJ4 A;  3I5I B;  1BF5 A;  3I5H B;  3B88 A;  3K1E A;  3KHE A;  3S0E A;  1Z2C B;  2MLE C;  1ODB A;  3AKA A;  4CFR A;  2JT3 A;  3UNW A;  1S6C A;  3QRX A;  3NHT A;  2M29 A;  4OKH A;  2M9G A;  3OBV A;  3SG2 A;  1K96 A;  1YTZ C;  1B4C A;  1TOP A;  2KAX A;  2KI6 D;  2O5G A;  3D77 A;  2JNF A;  2JU0 A;  2M49 B;  2K61 A;  1NX1 A;  2BBN A;  2P71 A;  4PAL A;  4M2P A;  2A4J A;  1JBA A;  1GJY A;  4WRI A;  1KWO B;  3PAL A;  3PJI A;  2ERB A;  3OB1 B;  2QPT A;  3OP0 A;  3V2L A;  3I5F B;  1EXR A;  2Q91 A;  2ZND A;  4FTG A;  1SCV A;  4I5L B;  2KGB C;  1ORG A;  2LVI A;  1XFR A;  2QEB A;  3EK7 A;  1C7W A;  1LKJ A;  2WCH A;  1NCX A;  2ZFD A;  2E30 A;  4DS7 A;  1F55 A;  4YGC B;  1EL4 A;  1K95 A;  2Y1M A;  1IQ5 A;  3PN7 C;  1A4P A;  4BY5 A;  2ZRS A;  1DEL A;  1OSA A;  1NP8 A;  4PHJ A;  4ORA B;  2SCP A;  2M8U A;  1QV0 A;  2LLS A;  3BYA A;  1YX7 A;  2EGD A;  3RLZ A;  3CYZ A;  3OX5 A;  3BFA A;  1SNL A;  3TDU A;  3A8R A;  1UWO A;  1XFV O;  2LVK A;  5I2Q A;  3PLF B;  1BOC A;  3D10 A;  2ZNE A;  1SY9 A;  1ZUZ A;  5CPV A;  1E8A A;  1F70 A;  4PE0 A;  3CTN A;  3F45 A;  1R2U A;  2COL B;  4IJ7 A;  2L50 A;  2HET A;  3CLN A;  1KSM A;  1SL9 A;  1MF8 B;  4MZJ A;  5B8I B;  2MRD A;  3WHT B;  1DC1 A;  2LC5 A;  4OCI A;  3VGO A;  1CFD A;  1TWO A;  4I5J A;  2BE6 A;  2MAZ A;  3I5I C;  4N1F A;  4AOM A;  1Y1X A;  5D7F A;  4YGB B;  3I5H C;  3KEV A;  3B6X A;  4CID A;  2JT0 A;  1J7O A;  1CM4 A;  4P5O E;  1HT9 A;  3HX4 A;  4HRH A;  1AJ5 A;  3DF0 A;  2GV5 A;  1K9U A;  3OB2 B;  2JWW A;  3DY9 A;  3GOF A;  4HSZ A;  1MR8 A;  5BPJ A;  2M7N A;  3SIB A;  3AAJ A;  2LLU A;  1JF0 A;  1SRA A;  1A75 B;  3NSI A;  5ER4 X;  4YRU A;  3FE9 A;  1JFJ A;  5EL2 A;  1FI6 A;  3KF9 A;  1J7P A;  3LCP C;  1FI5 A;  2KDH A;  5HKW A;  1IH0 A;  1PSB A;  2FCD A;  2BKH B;  4MRX A;  1TUZ A;  1XYD A;  1W9Z A;  3I5F C;  3PFV A;  3FS7 A;  2HPS A;  1LIN A;  2M3W A;  3FWC A;  4PDZ A;  2P70 A;  3NXA A;  4GGN A;  1QTX A;  1CFF A;  1XK4 C;  4IL1 A;  2ZRT A;  4ZCU A;  1BLQ A;  1GGW A;  2H8V A;  4GFT A;  2L2C A;  3BJH A;  5I94 A;  1AVS A;  1JFK A;  2WC6 A;  1IJ5 A;  2M7L A;  1SBJ A;  3MSE B;  3PM2 A;  3S0A A;  5KTY A;  1PVA A;  3QME A;  1CMF A;  3KO0 A;  2WCL A;  5KSZ A;  3AAK A;  1UUR A;  2IS9 A;  4DRW A;  5KU1 A;  2NZ0 A;  2GTE A;  1UHK A;  2I7A A;  2KLD A;  5FI2 A;  4WQ3 A;  2MBX A;  4M2O A;  2PVB A;  2KOT A;  2QEH A;  2JNX A;  2WCB A;  1LXF C;  1SYM A;  3L47 A;  1RJV A;  4I5K A;  1K9P A;  2BL0 B;  2LMV A;  5AAN A;  3EK4 A;  4XYN A;  5HKZ A;  1YUT A;  4QJ3 B;  2JZI A;  3BUX B;  3CWG A;  3CZ2 A;  1XFZ O;  4U8D A;  1GM0 A;  4HRG A;  1MQ1 A;  3ICB A;  3SG7 A;  1PSR A;  1TN4 A;  4KYN A;  3L4A A;  3TDZ A;  1QVI Z;  1F71 A;  4E68 A;  1AK8 A;  1IIO A;  2KYF A;  4USL A;  3EVV A;  2WOR A;  2EC6 B;  1G33 A;  1M46 A;  1H8B A;  4QJ5 B;  2ZKM X;  2KFG A;  3DVK A;  3GK1 A;  3SS3 A;  4CLN A;  2KAV A;  1GQM A;  2JQ6 A;  1G8I A;  2K7B A;  3CR2 A;  3SS5 A;  5TNC A;  1WLZ A;  1R6P A;  2K8M B;  1CFC A;  1QLK A;  3IQO A;  4GUK A;  1FBV A;  3C1V A;  1XA5 A;  1QVI Y;  1Y1A A;  2KBM A;  4YI8 A;  1REC A;  1DT7 B;  2LNK A;  3BOW B;  2F3Y A;  1QJT A;  2JOJ A;  1K90 D;  2L2E A;  2BE4 A;  2R2I A;  2WCE A;  1OOG A;  1K94 A;  3B87 A;  1UUS A;  3TDI A;  2JT8 A;  2FCE A;  3BUO B;  5CSF A;  3R72 A;  2KSP A;  1KFX S;  4INW A;  1LS8 A;  5CSI A;  2B1U A;  2HQW A;  3LL8 B;  4OZD A;  1OW4 A;  4CFQ A;  1PK0 D;  3SG3 A;  1F54 A;  3R1O A;  1QV1 A;  1C3Z A;  5DKQ A;  1AP4 A;  1WDC B;  2MJW B;  2CXJ A;  3EKJ A;  4MVF A;  1FF1 A;  2YGU A;  2K7D A;  1MWN A;  1QLS A;  2PSR A;  3PSR A;  2H61 C;  1UHJ A;  2LUX A;  2MA2 A;  1KFU L;  4JQ0 D;  1J55 A;  2BL0 C;  3DXL A;  1A03 A;  1IGV A;  1RFJ A;  3DVE A;  1CLM A;  1BOD A;  2G9B A;  2GGZ A;  1NYA A;  1B8R A;  4A4B A;  1B7T Z;  1NIW A;  4GGF C;  4N5X A;  3KPX A;  1CB1 A;  1H4B A;  1QXP A;  1KK7 Z;  1SL8 A;  1BR1 B;  1QAT A;  3CZT X;  4I5N B;  2H2K A;  1OE9 B;  3N7H A;  2BBM A;  5HL1 A;  1B9A A;  3CR4 X;  1T14 A;  2D8N A;  3S0B A;  1S5G Z;  3D74 A;  3SG4 A;  2GGM A;  2QDI A;  2EC6 C;  1Q80 A;  1DEK A;  3VRP A;  3D78 A;  4JWQ A;  1JWD A;  1B7T Y;  3DD4 A;  4ZCV A;  5HLV A;  2KLE A;  1KK7 Y;  1Z4H A;  2CNP A;  2LLT A;  3R1V A;  2FJY A;  4PT1 A;  5HYD A;  1TIZ A;  3D76 A;  3RM1 A;  2KI4 B;  5D69 A;  1DJI A;  2KNE A;  1HQV A;  1DJW A;  1S5G Y;  2F3Z A;  3LK1 A;  3O4X A;  4YBH B;  2LM5 A;  3NSL A;  2BAP A;  4ORB B;  4Q04 A;  1MXE A;  1N2D A;  3SG6 A;  1SR6 B;  4WQ2 A;  3VB1 A;  1DGU A;  4XJK B;  2WND A;  3SIA A;  3BXK A;  2G2B A;  3WNX B;  1LA0 A;  1Y1U A;  3VRN A;  1YUU A;  3BUN B;  3DYE A;  3UO9 A;  1U5I A;  1OMR A;  2QEO A;  1C07 A;  2L5Y A;  2KHN A;  3CR5 X;  4FQO A;  1JF2 A;  3FE8 A;  3O4Y A;  2L51 A;  2OTG B;  1A29 A;  3CS1 A;  1WDC C;  2AAO A;  3M0W A;  1F8H A;  2QAC A;  3D0Y A;  2PRU A;  4OR9 B;  1YVH A;  1D1O A;  4F7F A;  1LVC D;  1B8L A;  2PYQ A;  1A75 A;  1KCY A;  2KFH A;  2MLF C;  1XFY O;  1OOI X;  1SCM B;  3NSO A;  2LE9 B;  2BEC A;  3R1P A;  4C0L A;  1TCO B;  4DIR A;  2K2A A;  1WLM A;  2KQY A;  2JUL A;  2I94 A;  2LMT A;  3CAB A;  1TNP A;  3GK4 X;  3PM8 A;  1CDL A;  5ER5 A;  2ISD A;  3DZT A;  1M45 A;  1SW8 A;  1Y6W A;  5JOL A;  1DJZ A;  4MZL A;  4PE4 A;  3FWB A;  3FE6 A;  1NX2 A;  2L0P A;  1IRJ A;  1BR4 B;  5CSJ A;  1IWQ A;  4HRE E;  1K2H A;  4MRY A;  3BQ3 A;  2K60 A;  5FI6 A;  2BCA A;  3TS5 C;  3VRQ A;  1B47 A;  4DUQ A;  1KQV A;  4GBA A;  3DVJ A;  4YGE B;  3TUY B;  1DF0 B;  2LVV A;  1V1F A;  1IJ6 A;  3B7A A;  1CMG A;  2JC2 A;  4CPV A;  2VRG A;  1Y0V H;  2JXL A;  2OS8 B;  1CNP A;  1A2X A;  1RK9 A;  2KFF A;  1NUB A;  1BT6 A;  4NDB A;  2PMY A;  2V53 A;  5AER A;  1IG5 A;  1TTX A;  2H61 A;  4ORC B;  1BJF A;  2KI4 C;  3TZ1 A;  5AFP A;  1FPW A;  2E6W A;  2LCP A;  2RGI A;  5DKR A;  2KBI A;  1SR6 C;  2LAN A;  1J1D A;  3I5G C;  2F33 A;  3RZS A;  1KK8 B;  5HLO A;  1ZFS A;  4GGF A;  1OZS A;  1ZAC A;  5IBW A;  1L2O C;  1J1E A; 
#chains in the Genus database with same CATH homology
 1DJX A;  1YRT B;  1FW4 A;  2LVJ A;  1SK6 D;  3H4S E;  4YGA A;  5F6T A;  1DJG A;  1F4O A;  2ZN9 A;  1EJ3 A;  4M2Q A;  4ICB A;  4MZK A;  1LA3 A;  1OOJ A;  2CT9 A;  2OTG C;  1CLL A;  2L4I A;  2Y1N A;  2PAS A;  4MSP A;  4GAO A;  1S26 D;  3O6B A;  2M1U A;  1B1G A;  3PAT A;  1SKT A;  5I2O A;  4ETO A;  1QX2 A;  1SPY A;  1M31 A;  3EVU A;  1SCM C;  2LHL A;  2M97 A;  2TN4 A;  1BG1 A;  3DVM A;  1JC2 A;  4MEW A;  1C7V A;  3IQQ A;  3IF7 A;  3O2P A;  3OX6 A;  1J7Q A;  1PAL A;  2Q4U A;  3BOW A;  1S6I A;  2AUC A;  2JTZ A;  2NLN A;  1CDM A;  4OVN F;  2KAY A;  2JXC A;  3HCM A;  3VRR A;  5DKN A;  3JVT B;  5AXI A;  1W7J B;  2LHI A;  3BUM B;  1UHH A;  5J3X A;  1PRW A;  1QIW A;  1DTL A;  4P2Y B;  4GNK B;  5HKY A;  1YVL A;  3TUY C;  3CGA A;  2L98 A;  1VRK A;  4TNC A;  1S3P A;  1XK4 A;  2OS8 C;  3SJS A;  1AHR A;  1YR5 A;  2KYC A;  2KI6 C;  1OZO A;  3BUW B;  5PAL A;  1OMV A;  1SMG A;  3AKB A;  3TS5 B;  3EK8 A;  1EG3 A;  1G4Y R;  1WRK A;  1ZMZ A;  4JPZ B;  4F0Z B;  2OPO A;  3ZWH A;  2JTT A;  2NCO A;  1KSO A;  1SL7 A;  1TRF A;  1KK8 C;  3EVR A;  1CTR A;  4NQG A;  3O78 A;  1JUO A;  2L5X B;  2LUC A;  1CFP A;  2AMI A;  2WCF A;  2ZN8 A;  2KGR A;  1UP5 A;  1XFW O;  1W7I B;  1AUI B;  1K93 D;  3E3R A;  1S36 A;  1S6J A;  1EG4 A;  2P6B B;  3EKH A;  2M0R A;  5CSN A;  2PAL A;  3I5G B;  2K7O A;  2K2F A;  3DF0 B;  2JRF A;  2CCM A;  5G08 A;  5AEQ A;  1DGV A;  1KQM B;  1L2O B;  2FJU B;  4PHN A;  1XVJ A;  1QX5 B;  1TNW A;  1BU3 A;  2CTN A;  1GGZ A;  1B8C A;  3OHM B;  1F4Q A;  1N0Y A;  3LLE A;  3NSK A;  3SG5 A;  4PHK A;  4D1E A;  1U5I B;  3FIA A;  2F8P A;  4BY4 A;  2K0J A;  2WOS A;  1TNX A;  1QS7 A;  1YUR A;  4DCK A;  1NWD A;  4XJK A;  3D0Y B;  1EH2 A;  1XFU O;  2BCX A;  2SAS A;  1TNQ A;  1KFX L;  3JVT C;  3A4U B;  3JTD B;  1MXL C;  1YUS A;  1K9K A;  1N65 A;  1S1E A;  2DOQ A;  1UHN A;  2NXQ A;  1PVB A;  2LAP A;  1KWO C;  1V1G A;  1DJY A;  2HQ8 A;  1OQP A;  5I8N A;  1ZOT B;  2NCP A;  1X02 A;  5I2L A;  4YGD B;  1ALV A;  2Y5I A;  1RTP 1;  1CLB A;  1OMD A;  1YRU B;  2Y4Q A;  2LP3 A;  2L4H A;  5JJG A;  1NX3 A;  1QIV A;  1XFX O;  4NDD A;  1J7R A;  2EHB A;  1TCF A;  4PHM A;  1NX0 A;  4MBE A;  5K89 A;  1DMO A;  4PCW A;  1CDN A;  1KFU S;  2KQ6 A;  1NSH A;  2F2P A;  1ALW A;  4GPL B;  1K8U A;  4OV2 A;  1DJH A;  2LV7 A;  3K21 A;  2O60 A;  4AQJ A;  1CDP A;  4PE7 A;  4QJ4 B;  1QX7 A;  4YI9 A;  2BKI B;  2M1K B;  2FOT A;  4A4C A;  4N1G A;  1QAS A;  2LMU A;  2BCB A;  1IQ3 A;  1MHO A;  3VRO A;  1IKU A;  3ZNI A;  1NPQ A;  3PN7 B;  4PE1 A;  1WRZ A;  3WHU B;  4NDC A;  4MLW A;  1DF0 A;  5FYX A;  1KQM C;  1CM1 A;  1UHI A;  4R1E A;  4MN0 A;  2I2R E;  2LP2 A;  3GK2 A;  1BMO A;  4L9M A;  1NCY A;  1YX8 A;  1MUX A;  1DVI A;  1WRL A;  1NCZ A;  5GQQ C;  1L7Z A;  1XO5 A;  2K7C A;  2MHH A;  1PUL A;  1M63 B;  3WXA A;  2F2O A;  2JPT A;  3LK0 A;  1RWY A;  2HF5 A;  4C0K A;  4C0J A;  2CBL A;  2WC8 A;  3JTD C;  1CKK A;  4UPG A;  1RRO A;  4AQI A;  1JSA A;  1WY9 A;  1M39 A;  2I18 A;  1AJ4 A;  3I5I B;  1BF5 A;  3I5H B;  3KHE A;  2MLE C;  1ODB A;  3AKA A;  4CFR A;  2JT3 A;  1S6C A;  3QRX A;  2M29 A;  4OKH A;  2M9G A;  3SG2 A;  1K96 A;  1YTZ C;  1B4C A;  1TOP A;  2KAX A;  2KI6 D;  2O5G A;  2JNF A;  2JU0 A;  2M49 B;  2K61 A;  1NX1 A;  2BBN A;  4PAL A;  4M2P A;  2A4J A;  1JBA A;  1GJY A;  4WRI A;  1KWO B;  3PAL A;  3OB1 B;  2QPT A;  3OP0 A;  3I5F B;  1EXR A;  2Q91 A;  2ZND A;  4FTG A;  1SCV A;  4I5L B;  2KGB C;  2LVI A;  3EK7 A;  1C7W A;  1LKJ A;  2ZFD A;  1NCX A;  4DS7 A;  2E30 A;  1F55 A;  4YGC B;  1EL4 A;  1K95 A;  2Y1M A;  1IQ5 A;  3PN7 C;  1A4P A;  4BY5 A;  2ZRS A;  4PHJ A;  1OSA A;  1NP8 A;  4ORA B;  2SCP A;  2M8U A;  1QV0 A;  2LLS A;  3BYA A;  1YX7 A;  2EGD A;  3RLZ A;  3OX5 A;  1SNL A;  3TDU A;  3A8R A;  1UWO A;  1XFV O;  2LVK A;  5I2Q A;  3PLF B;  1BOC A;  3D10 A;  2ZNE A;  1SY9 A;  1ZUZ A;  5CPV A;  1E8A A;  1F70 A;  4PE0 A;  3CTN A;  3F45 A;  1R2U A;  2COL B;  2L50 A;  2HET A;  3CLN A;  1KSM A;  1SL9 A;  1MF8 B;  4MZJ A;  5B8I B;  2MRD A;  3WHT B;  2LC5 A;  4OCI A;  3VGO A;  1CFD A;  4I5J A;  2BE6 A;  2MAZ A;  3I5I C;  4N1F A;  4AOM A;  1Y1X A;  5D7F A;  4YGB B;  3I5H C;  3KEV A;  4CID A;  2JT0 A;  1J7O A;  1CM4 A;  4P5O E;  1HT9 A;  3HX4 A;  4HRH A;  1AJ5 A;  3DF0 A;  2GV5 A;  1K9U A;  3OB2 B;  2JWW A;  4HSZ A;  3GOF A;  1MR8 A;  5BPJ A;  2M7N A;  3SIB A;  3AAJ A;  2LLU A;  1JF0 A;  1SRA A;  1A75 B;  3NSI A;  5ER4 X;  4YRU A;  1JFJ A;  1FI6 A;  3KF9 A;  1J7P A;  3LCP C;  1FI5 A;  2KDH A;  5HKW A;  1IH0 A;  1PSB A;  2FCD A;  2BKH B;  4MRX A;  1XYD A;  3I5F C;  3PFV A;  3FS7 A;  2HPS A;  1LIN A;  2M3W A;  3FWC A;  4PDZ A;  3NXA A;  4GGN A;  1QTX A;  1CFF A;  1XK4 C;  4IL1 A;  2ZRT A;  4ZCU A;  1BLQ A;  1GGW A;  4GFT A;  1AVS A;  1JFK A;  2M7L A;  1IJ5 A;  1SBJ A;  3MSE B;  5KTY A;  1PVA A;  1CMF A;  3KO0 A;  5KSZ A;  3AAK A;  1UUR A;  2IS9 A;  4DRW A;  5KU1 A;  2NZ0 A;  1UHK A;  2I7A A;  2MBX A;  4WQ3 A;  4M2O A;  2PVB A;  2KOT A;  2JNX A;  2WCB A;  1LXF C;  1SYM A;  1RJV A;  4I5K A;  1K9P A;  2BL0 B;  2LMV A;  5AAN A;  3EK4 A;  4XYN A;  5HKZ A;  1YUT A;  4QJ3 B;  2JZI A;  3BUX B;  3CWG A;  4U8D A;  1XFZ O;  4HRG A;  1MQ1 A;  3ICB A;  3SG7 A;  1PSR A;  1TN4 A;  3TDZ A;  1QVI Z;  1F71 A;  4E68 A;  1AK8 A;  2KYF A;  4USL A;  3EVV A;  2WOR A;  2EC6 B;  1G33 A;  1M46 A;  1H8B A;  4QJ5 B;  2ZKM X;  2KFG A;  3DVK A;  3GK1 A;  4CLN A;  2KAV A;  1GQM A;  2JQ6 A;  1G8I A;  2K7B A;  3CR2 A;  5TNC A;  1WLZ A;  1R6P A;  2K8M B;  1CFC A;  1QLK A;  3IQO A;  4GUK A;  1FBV A;  3C1V A;  1XA5 A;  1QVI Y;  1Y1A A;  2KBM A;  4YI8 A;  1REC A;  1DT7 B;  2LNK A;  3BOW B;  2F3Y A;  1QJT A;  2JOJ A;  1K90 D;  2L2E A;  2BE4 A;  2R2I A;  2WCE A;  1K94 A;  1UUS A;  3TDI A;  2JT8 A;  2FCE A;  3BUO B;  5CSF A;  2KSP A;  1KFX S;  5CSI A;  2B1U A;  2HQW A;  3LL8 B;  1F54 A;  4CFQ A;  1PK0 D;  3SG3 A;  1QV1 A;  5DKQ A;  1AP4 A;  1WDC B;  2MJW B;  2CXJ A;  3EKJ A;  4MVF A;  1FF1 A;  2K7D A;  1MWN A;  1QLS A;  2PSR A;  3PSR A;  2H61 C;  1UHJ A;  2LUX A;  2MA2 A;  1KFU L;  4JQ0 D;  1J55 A;  2BL0 C;  1A03 A;  1IGV A;  1RFJ A;  3DVE A;  1CLM A;  1BOD A;  2G9B A;  2GGZ A;  1NYA A;  1B8R A;  4A4B A;  1B7T Z;  1NIW A;  4GGF C;  4N5X A;  3KPX A;  1CB1 A;  1H4B A;  1QXP A;  1KK7 Z;  1SL8 A;  1BR1 B;  1QAT A;  3CZT X;  4I5N B;  2H2K A;  1OE9 B;  2BBM A;  1B9A A;  3CR4 X;  2D8N A;  1S5G Z;  3SG4 A;  2GGM A;  2EC6 C;  1Q80 A;  3VRP A;  4JWQ A;  1JWD A;  1B7T Y;  3DD4 A;  4ZCV A;  5HLV A;  1KK7 Y;  2CNP A;  2LLT A;  5HYD A;  1TIZ A;  3RM1 A;  2KI4 B;  5D69 A;  1DJI A;  2KNE A;  1HQV A;  1DJW A;  1S5G Y;  2F3Z A;  3LK1 A;  4YBH B;  2LM5 A;  3NSL A;  4Q04 A;  4ORB B;  1MXE A;  1N2D A;  3SG6 A;  1SR6 B;  4WQ2 A;  1DGU A;  4XJK B;  2WND A;  3SIA A;  3BXK A;  2G2B A;  3WNX B;  1LA0 A;  1Y1U A;  3VRN A;  1YUU A;  3BUN B;  1U5I A;  1OMR A;  1C07 A;  2KHN A;  3CR5 X;  4FQO A;  1JF2 A;  3O4Y A;  2L51 A;  2OTG B;  1A29 A;  3CS1 A;  1WDC C;  2AAO A;  3M0W A;  1F8H A;  2QAC A;  3D0Y A;  2PRU A;  4OR9 B;  1YVH A;  1D1O A;  1LVC D;  1B8L A;  1A75 A;  1KCY A;  2KFH A;  2MLF C;  1XFY O;  1SCM B;  3NSO A;  2LE9 B;  2BEC A;  4C0L A;  1TCO B;  4DIR A;  2K2A A;  1WLM A;  2KQY A;  2JUL A;  2I94 A;  2LMT A;  1TNP A;  3GK4 X;  3PM8 A;  1CDL A;  5ER5 A;  2ISD A;  1M45 A;  1SW8 A;  1Y6W A;  5JOL A;  1DJZ A;  4MZL A;  4PE4 A;  3FWB A;  1NX2 A;  2L0P A;  1IRJ A;  1BR4 B;  5CSJ A;  1IWQ A;  4HRE E;  1K2H A;  4MRY A;  3BQ3 A;  2BCA A;  3TS5 C;  3VRQ A;  1B47 A;  4DUQ A;  1KQV A;  4GBA A;  3DVJ A;  4YGE B;  3TUY B;  1DF0 B;  2LVV A;  1V1F A;  1IJ6 A;  1CMG A;  2JC2 A;  4CPV A;  2VRG A;  1Y0V H;  2JXL A;  2OS8 B;  1CNP A;  1A2X A;  1RK9 A;  2KFF A;  1NUB A;  1BT6 A;  4NDB A;  2PMY A;  2V53 A;  5AER A;  1IG5 A;  1TTX A;  2H61 A;  4ORC B;  1BJF A;  2KI4 C;  3TZ1 A;  5AFP A;  1FPW A;  2E6W A;  2LCP A;  2RGI A;  5DKR A;  2KBI A;  1SR6 C;  2LAN A;  1J1D A;  3I5G C;  2F33 A;  1KK8 B;  5HLO A;  1ZFS A;  4GGF A;  1OZS A;  1ZAC A;  5IBW A;  1L2O C;  1J1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...