1A4PA

P11 (s100a10), ligand of annexin ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A10
publication title The crystal structure of a complex of p11 with the annexin II N-terminal peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium/phospholipid binding protein
total genus 34
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1a4pA00
3HCMA 2AAOA 3EK4A 1YTZC 1CTRA 2ISDA 1RTP1 2COLB 1BF5A 1CFCA 2KSPA 3F45A 4IL1A 1B8LA 4MEWA 3AAKA 5HKWA 1WRKA 2JU0A 2KAXA 3I5GC 1LA0A 3GK1A 5D7FA 2JNFA 3EVRA 3BXKA 1KWOC 4PE0A 2KBMA 2KHNA 2NCOA 2H61C 3JVTB 1S36A 1TNWA 1NYAA 2L51A 3BUXB 1DJZA 4ORCB 3I5FB 5CPVA 5ER4X 3VRRA 1GGZA 1KFXS 2I94A 3DVJA 3WXAA 1CLLA 1S26D 1TOPA 1ALWA 2RGIA 5DKRA 3I5IB 3BYAA 1PK0D 4N5XA 1XFWO 4GUKA 1LVCD 1WY9A 4PDZA 3C1VA 3OP0A 3VROA 1N65A 4JPZB 4MLWA 2M7NA 1RECA 1NSHA 5BPJA 3BQ3A 4JQ0D 4PE7A 2MA2A 1SKTA 1Y1UA 3D0YB 1B7TZ 1Y6WA 1B9AA 1CLMA 1HT9A 2Y4QA 3CR5X 3I5HB 1SL7A 1DJIA 2EC6C 1ZACA 1YUSA 4C0KA 2M7LA 1KK8C 3OHMB 4FTGA 4PALA 3JTDB 2O5GA 1DMOA 1QX2A 4C0LA 2KFGA 2LUXA 5HKYA 1OE9B 1SCMC 1SBJA 1SR6C 2JNXA 2WNDA 3NSKA 4CFRA 2ZN9A 1F4QA 5CSJA 4ZCVA 2PSRA 1MUXA 2HQ8A 2OTGB 3WHUB 4PHNA 3SIBA 5HLVA 1JF0A 2V53A 3SG3A 1J1EA 1TCOB 4PCWA 2ZNEA 1AK8A 1F55A 1S6CA 2JRFA 4ZCUA 4CLNA 1KQVA 1KSOA 2KI4B 1TRFA 2I18A 1A75B 2KAYA 3CS1A 4HRGA 2JTZA 5CSFA 3SJSA 3GK4X 1KK7Z 2AMIA 2BBMA 3LK0A 1K96A 2LV7A 2GV5A 3TUYC 1M39A 2MJWB 1XFZO 1YX8A 2BCBA 1CFDA 4NDBA 4I5KA 1B8RA 1K95A 1OMRA 1V1FA 1ZFSA 4PHMA 2PVBA 1IG5A 1BLQA 2L4HA 3EVVA 4PHKA 4P5OE 1NX2A 1MR8A 1DF0B 1KFUL 2JT3A 4I5LB 3PLFB 1QX7A 2CNPA 4MZKA 3K21A 2LVIA 1QLSA 1M31A 1MXEA 1TCFA 1CB1A 2NZ0A 2NLNA 2P6BB 4HRHA 2FJUB 2WCBA 2BL0C 2KGBC 3D10A 3SG6A 1DTLA 1OSAA 1SNLA 2BCAA 3NSLA 3KPXA 1QIVA 2LVVA 2LMTA 1UHKA 1EH2A 4MSPA 1WLZA 1K93D 1Y0VH 1ZMZA 2ZRTA 4P2YB 1M46A 4GBAA 1JUOA 1MXLC 1NIWA 1OMDA 3DVMA 3IF7A 4A4CA 1JC2A 2JXLA 3NSOA 5AERA 1DVIA 1B8CA 3KEVA 3OX6A 4QJ5B 2K7DA 1QX5B 3NXAA 2BCXA 2CCMA 2WCEA 3DVKA 4YGBB 5J3XA 4M2QA 3KO0A 1CKKA 3TDIA 2KYFA 1L2OC 3EK8A 2O60A 2K2FA 5K89A 1A03A 1YURA 3AKBA 2DOQA 1PSBA 2LANA 2HF5A 3VRNA 3LL8B 1G8IA 1B47A 2LC5A 5I2OA 1AVSA 2GGMA 1UHJA 4TNCA 3OB2B 4DUQA 2L5XB 1Y1XA 1RFJA 2LM5A 1C7VA 1IJ5A 1SL8A 1TNPA 4E68A 2L50A 1DJHA 2LHLA 1CDPA 1S6IA 1CDNA 2B1UA 1FW4A 3RLZA 2M9GA 3PM8A 1J55A 3GOFA 1IQ3A 2CT9A 4OV2A 1UHIA 1XVJA 3CR4X 3BUWB 1SCVA 1NCYA 2K2AA 5JOLA 1LINA 1KFXL 4NDDA 1QXPA 1PRWA 3AAJA 2MLEC 2ZKMX 4PE4A 1DJWA 4YBHB 1A75A 1NCXA 1XK4A 2WC8A 3TS5B 4MVFA 1S5GZ 1QV1A 4DCKA 1SRAA 2KYCA 1IQ5A 2LUCA 5KU1A 5B8IB 1EG3A 1XYDA 1A29A 3PN7B 2MLFC 4HREE 3LLEA 2EC6B 1J7OA 2K7OA 1J7RA 3BOWB 3CZTX 1J7QA 1NP8A 4DIRA 2CXJA 5HKZA 4FQOA 1DF0A 1N0YA 2ZN8A 1QLKA 2TN4A 1F70A 3AKAA 4JWQA 1BMOA 1TN4A 3DVEA 1A4PA 5KTYA 1WDCB 1QVIY 1M63B 2LMUA 2QACA 1F54A 3E3RA 2M3WA 4M2PA 4C0JA 1IH0A 2NXQA 1R6PA 1TTXA 1PSRA 1K9UA 1EG4A 1LXFC 1K94A 3O78A 1GGWA 2IS9A 1JFKA 2GGZA 2JXCA 3I5HC 4XJKB 2CBLA 1FF1A 1SY9A 1FI5A 2L0PA 1EL4A 1R2UA 2E6WA 4ETOA 3DF0A 2L2EA 4N1GA 3SIAA 1OMVA 1D1OA 2LHIA 2KQ6A 2WOSA 2M1UA 1S6JA 3TUYB 2JOJA 2OS8C 1B1GA 4PHJA 4NDCA 1XFYO 2BKIB 1CFFA 1H8BA 1OZOA 5CSIA 4I5JA 2F2PA 1JWDA 1UP5A 1SPYA 2OTGC 2KDHA 4DS7A 3ICBA 1QTXA 1YUUA 3SG5A 3FWCA 2Y1MA 1NPQA 5JJGA 4MZJA 2M49B 1CMFA 3EKJA 1KQMB 1LKJA 2JZIA 2JQ6A 4D1EA 1EXRA 1A2XA 4AQIA 1JSAA 1XK4C 2EGDA 2LE9B 4A4BA 1K8UA 1IJ6A 2JT0A 2LVKA 2M29A 2F33A 1F4OA 4DRWA 1Y1AA 2KOTA 2MBXA 1B7TY 1TIZA 5CSNA 1HQVA 1B4CA 3TDUA 2I7AA 1K2HA 2M1KB 4ORAB 3A8RA 4YI9A 1DJXA 2E30A 1X02A 3EKHA 1F8HA 5D69A 2PRUA 1W7IB 3QRXA 2JC2A 1BJFA 5AXIA 1ZUZA 1YUTA 1PALA 1KSMA 3O6BA 4ICBA 1DJYA 4YRUA 1CMGA 2OPOA 1MWNA 4YGEB 2BECA 1JF2A 1DGVA 1QJTA 1L2OB 4F0ZB 4YGAA 1NWDA 2A4JA 1UHNA 2F2OA 2PMYA 1BODA 1MF8B 3VRQA 3D0YA 1XO5A 2M0RA 1YVHA 2L4IA 1NX1A 2K0JA 4Q04A 2LP2A 1Q80A 2M8UA 1QIWA 2F3ZA 2K8MB 3TDZA 4GNKB 1H4BA 3BOWA 3I5GB 3VGOA 1UWOA 4OVNF 1KK7Y 4GFTA 2BBNA 1BT6A 2JULA 3WHTB 2D8NA 1SW8A 3VRPA 4L9MA 4BY5A 1DT7B 1JBAA 1W7JB 1KWOB 1KCYA 4OR9B 2F3YA 5PALA 1UURA 3RM1A 2HQWA 1S1EA 2G9BA 3O2PA 3HX4A 1U5IB 3FIAA 5I8NA 2KGRA 2JTTA 3ZWHA 2F8PA 1CM4A 1RJVA 4XJKA 3SG4A 1FPWA 1IWQA 1OQPA 2JT8A 2LP3A 3OX5A 1N2DA 1UUSA 4GGFA 1K9KA 4AQJA 5GQQC 1MQ1A 4GGNA 1NX0A 1QS7A 1K90D 3GK2A 1SYMA 3CLNA 5I2QA 2FCDA 2HPSA 4GPLB 2K61A 1XFXO 3JVTC 2BE6A 2LVJA 3I5FC 1BR4B 4GAOA 5G08A 3DD4A 4U8DA 4WQ2A 1KK8B 2KFHA 3TZ1A 3I5IC 1UHHA 4MN0A 1L7ZA 2LNKA 2BKHB 3FWBA 2WORA 4ORBB 5KSZA 1SCMB 1SR6B 1IKUA 1MHOA 3EVUA 5F6TA 1TNQA 4HSZA 3TS5C 1OOJA 1AJ4A 1QATA 1FBVA 4UPGA 1YVLA 4OCIA 4MBEA 2JPTA 2LMVA 2KI6C 3NSIA 2FOTA 3EK7A 5ER5A 1PULA 2SCPA 2KBIA 2PASA 3LCPC 2FCEA 1AP4A 2AUCA 2K7BA 4CPVA 4OKHA 3LK1A 3PN7C 2Y1NA 4QJ4B 1IGVA 3CR2A 4USLA 1XFUO 1AUIB 3JTDC 4PE1A 1GQMA 2KAVA 1ZOTB 4YGDB 1CDLA 3FS7A 2M97A 1NUBA 1ODBA 2OS8B 2ZRSA 2Q4UA 1WDCC 1CNPA 1YRUB 3PATA 2MHHA 2QPTA 3IQOA 1SL9A 5IBWA 1CDMA 1E8AA 1K9PA 1PVAA 2Y5IA 4WQ3A 5DKQA 1RWYA 1WLMA 1TNXA 3ZNIA 3O4YA 1WRZA 1GJYA 1RK9A 3CWGA 3IQQA 2KFFA 2Q91A 4MRXA 1G4YR 3PALA 4GGFC 4CFQA 2G2BA 2KI4C 1XFVO 2VRGA 5TNCA 1AHRA 1S5GY 2KQYA 3PFVA 3SG7A 1YR5A 1JFJA 4XYNA 2LLSA 1V1GA 3MSEB 4AOMA 2BL0B 5AFPA 1EJ3A 4NQGA 2WCFA 1CFPA 2HETA 2JWWA 4MRYA 5HLOA 1SMGA 2H61A 5AEQA 1QV0A 1J1DA 1KFUS 1U5IA 2L98A 2K7CA 2MRDA 1C7WA 3WNXB 2MAZA 1RROA 2ZNDA 3PSRA 1C07A 1S3PA 1SK6D 1DJGA 4BY4A 1YRTB 1KQMC 2EHBA 3BUMB 4QJ3B 5FYXA 1YX7A 1QASA 3M0WA 5AANA 2ZFDA 1WRLA 2BE4A 3KHEA 4N1FA 1ALVA 1M45A 2LCPA 1XA5A 4MZLA 1VRKA 2LLUA 1BOCA 3A4UB 4YI8A 3OB1B 1NX3A 3BUOB 1G33A 1F71A 4I5NB 4R1EA 1AJ5A 3CTNA 1BG1A 5I2LA 1IRJA 1DGUA 2H2KA 2LAPA 3H4SE 4M2OA 1OZSA 4YGCB 3DF0B 3KF9A 2I2RE 1J7PA 5HYDA 5DKNA 1BU3A 1PVBA 2SASA 3CGAA 2CTNA 1NCZA 3SG2A 1LA3A 2KI6D 1QVIZ 1BR1B 4WRIA 2LLTA 3BUNB 1FI6A 2NCPA 1CM1A 4CIDA 1CLBA 2KNEA 2PALA 2R2IA
chains in the Genus database with same CATH superfamily
3HCMA 2AAOA 3EK4A 1YTZC 1CTRA 3B88A 2ISDA 1RTP1 2COLB 1BF5A 1CFCA 2KSPA 3F45A 2ERBA 4IL1A 1B8LA 4MEWA 3AAKA 5HKWA 1WRKA 2JU0A 3RZSA 2KAXA 3I5GC 3QMEA 3D77A 1LA0A 3GK1A 5D7FA 2JNFA 3EVRA 3BXKA 1KWOC 4PE0A 3S0EA 2KBMA 3SS5A 2KHNA 2NCOA 2H61C 3JVTB 1S36A 1TNWA 1NYAA 2L51A 3BUXB 1DJZA 4ORCB 3I5FB 5CPVA 4INXA 5ER4X 3VRRA 1GGZA 1KFXS 2I94A 3DVJA 3WXAA 1CLLA 1OW4A 1S26D 1TOPA 1ALWA 2RGIA 5DKRA 3I5IB 3BYAA 1PK0D 4N5XA 1XFWO 4GUKA 4F7FA 1LVCD 1WY9A 4PDZA 3C1VA 3OP0A 3VROA 1N65A 4JPZB 4MLWA 2M7NA 1RECA 1NSHA 3UO9A 5BPJA 3BQ3A 4JQ0D 4PE7A 2MA2A 1SKTA 1Y1UA 3D0YB 1QWVA 1B7TZ 1Y6WA 1B9AA 4PT1A 1CLMA 3FE9A 1HT9A 2Y4QA 3CR5X 3I5HB 3D76A 1SL7A 1DJIA 2EC6C 1ZACA 1YUSA 4C0KA 2M7LA 1KK8C 3OHMB 4FTGA 4PALA 3JTDB 2O5GA 1DMOA 1QX2A 4C0LA 2KFGA 2LUXA 5HKYA 1OE9B 1SCMC 1SBJA 1SR6C 2JNXA 3EG5B 2WNDA 3NSKA 1TUZA 4CFRA 2ZN9A 1F4QA 5CSJA 4ZCVA 2PSRA 1MUXA 1C3YA 2HQ8A 2OTGB 3D74A 3WHUB 4PHNA 3SIBA 5HLVA 1JF0A 2V53A 3SG3A 1J1EA 2K60A 5I94A 1TCOB 4PCWA 2ZNEA 1AK8A 1F55A 1S6CA 2JRFA 4ZCUA 4CLNA 1KQVA 1KSOA 2KI4B 1TRFA 2I18A 1A75B 2KAYA 3CS1A 3D75A 2JTZA 4HRGA 5CSFA 3GK4X 3SJSA 4FQTA 1KK7Z 2AMIA 2BBMA 3LK0A 3BFBA 1K96A 2LV7A 2GV5A 3TUYC 1M39A 2MJWB 3D78A 1XFZO 1YX8A 2BCBA 1CFDA 3FE6A 4I5KA 1B8RA 1K95A 4NDBA 3B86A 1OMRA 1V1FA 1ZFSA 4PHMA 2PVBA 1IG5A 2WC5A 2KLDA 4IJ7A 1BLQA 2L4HA 3EVVA 4PHKA 4P5OE 5HL1A 1NX2A 1MR8A 3CYZA 2PQLA 1DF0B 1KFUL 2JT3A 4I5LB 3PLFB 1QX7A 2CNPA 4MZKA 3K21A 2LVIA 1QLSA 5FI6A 1M31A 1MXEA 1TCFA 1CB1A 2L2CA 2NZ0A 2NLNA 2P6BB 4HRHA 2FJUB 2WCBA 2BL0C 2KGBC 5EL2A 3D10A 3SG6A 1DTLA 1OSAA 1SNLA 2BCAA 3R1OA 3NSLA 3KPXA 1QIVA 2LVVA 2QEHA 2LMTA 1UHKA 1GM0A 1EH2A 4MSPA 1WLZA 1K93D 1Y0VH 1ZMZA 2ZRTA 4P2YB 1M46A 4GBAA 1JUOA 1MXLC 1NIWA 1OMDA 3DVMA 3IF7A 4A4CA 1JC2A 2JXLA 3NSOA 5AERA 1DVIA 1B8CA 3Q8IA 3KEVA 3OX6A 4QJ5B 2K7DA 1QX5B 3NXAA 2BCXA 2CCMA 2WCEA 3DVKA 4YGBB 5J3XA 3VB1A 4M2QA 3B6XA 3KO0A 2QEVA 3TDIA 2KYFA 1CKKA 1L2OC 3EK8A 2O60A 2K2FA 5K89A 1A03A 1YURA 3SS3A 3AKBA 3CZ2A 2QDIA 2DOQA 3S0DA 1PSBA 2LANA 2HF5A 3VRNA 3LL8B 1G8IA 1B47A 2LC5A 5I2OA 1AVSA 2GGMA 1UHJA 4TNCA 3OB2B 4DUQA 2L5XB 1Y1XA 3OBVA 3IVTA 1RFJA 2LM5A 1C7VA 1IJ5A 3V2LA 1SL8A 1TNPA 4E68A 2L50A 1DJHA 2LHLA 2WCHA 4JD9A 1CDPA 1S6IA 1CDNA 2B1UA 1FW4A 3RLZA 2M9GA 3PM8A 1J55A 3GOFA 1IQ3A 2CT9A 1Z4HA 4OV2A 1UHIA 1XVJA 3DY9A 3CR4X 3BUWB 1DQEA 1SCVA 1NCYA 2WCJA 2K2AA 5JOLA 3S0FA 1LINA 1KFXL 4NDDA 1QXPA 1PRWA 3AAJA 2MLEC 2ZKMX 4PE4A 1DJWA 4YBHB 1A75A 1NCXA 1XK4A 2WC8A 3TS5B 3PJIA 4MVFA 1S5GZ 2BAPA 3NGVA 1QV1A 4DCKA 1SRAA 2KYCA 1IQ5A 2LUCA 5KU1A 5B8IB 1EG3A 1XYDA 1A29A 2KPHA 3PN7B 3CZ1A 1TUJA 2MLFC 3LLEA 2EC6B 4HREE 1J7OA 2K7OA 1J7RA 3BOWB 3CZTX 1J7QA 1NP8A 4DIRA 2CXJA 5HKZA 4FQOA 1DF0A 1N0YA 1OOHA 1QLKA 2TN4A 2ZN8A 3AKAA 1F70A 4JWQA 1BMOA 1TN4A 3DVEA 1A4PA 5KTYA 1WDCB 1QVIY 1M63B 2LMUA 3DYEA 2QACA 1F54A 3E3RA 2M3WA 4M2PA 4C0JA 1IH0A 2NXQA 1R6PA 1TTXA 1PSRA 1K9UA 1EG4A 1LXFC 1K94A 3O78A 3S0BA 1GGWA 2IS9A 1JFKA 2GGZA 2JXCA 3I5HC 4XJKB 2CBLA 1OOGA 1FF1A 1SY9A 1FI5A 2L0PA 2P71A 1EL4A 1R2UA 2YGUA 2E6WA 4ETOA 3DF0A 2L2EA 4N1GA 3SIAA 1OMVA 1D1OA 2LHIA 3PM2A 2KQ6A 2WOSA 2M1UA 1S6JA 3TUYB 2JOJA 2OS8C 1B1GA 4PHJA 4NDCA 1XFYO 2BKIB 1CFFA 3L4AA 1H8BA 1OZOA 1XFRA 1LS8A 5CSIA 4I5JA 2F2PA 1JWDA 1UP5A 1SPYA 2OTGC 2KDHA 4DS7A 1C3ZA 3ICBA 1QTXA 1YUUA 3SG5A 3FWCA 1TWOA 1NPQA 2Y1MA 3L47A 5JJGA 4MZJA 2M49B 1CMFA 3EKJA 1KQMB 1LKJA 3K1EA 2JZIA 2JQ6A 4D1EA 1EXRA 1A2XA 4AQIA 1JSAA 1XK4C 2EGDA 2LE9B 4A4BA 1K8UA 1IJ6A 2JT0A 2LVKA 2M29A 2F33A 1F4OA 4DRWA 1Y1AA 2KOTA 1ORGA 2MBXA 1B7TY 1TIZA 5CSNA 3SS4A 1HQVA 3CABA 1B4CA 3R1PA 1SSEB 3TDUA 2I7AA 1K2HA 2M1KB 4ORAB 3A8RA 4YI9A 1DJXA 2E30A 1X02A 3DXLA 3EKHA 5D69A 1F8HA 2PRUA 1W7IB 3QRXA 2JC2A 1BJFA 5AXIA 1ZUZA 1YUTA 1PALA 1KSMA 3O6BA 4ICBA 1DJYA 4YRUA 1CMGA 2OPOA 1MWNA 4YGEB 2BECA 1JF2A 1DGVA 1QJTA 3FE8A 3S0AA 1L2OB 4F0ZB 3N7HA 1NWDA 2A4JA 4YGAA 1UHNA 2F2OA 2PMYA 1BODA 1MF8B 3CDNA 3VRQA 3D0YA 1XO5A 2M0RA 2P70A 1YVHA 2L4IA 1NX1A 2K0JA 4Q04A 2LP2A 1Q80A 2M8UA 1QIWA 2F3ZA 2K8MB 3TDZA 4GNKB 1H4BA 3BOWA 3I5GB 3VGOA 1UWOA 4OVNF 1KK7Y 4GFTA 2BBNA 1BT6A 2JULA 5D3OA 2D8NA 3WHTB 3OGNA 1SW8A 3VRPA 4L9MA 2WCMA 4BY5A 1DT7B 1W7JB 1KWOB 1JBAA 1KCYA 4OR9B 1Z2CB 2F3YA 5PALA 1UURA 2BNXA 3RM1A 2FJYA 2HQWA 1S1EA 2G9BA 3O2PA 3HX4A 1U5IB 4JKTA 3FIAA 5I8NA 1DEKA 2KGRA 2JTTA 3ZWHA 2F8PA 1CM4A 1RJVA 4XJKA 3SG4A 1FPWA 1IWQA 1OQPA 2JT8A 2LP3A 3OX5A 1N2DA 1UUSA 4GGFA 1K9KA 4AQJA 5GQQC 2GTEA 1MQ1A 4GGNA 2L5YA 4OZDA 1NX0A 2QEOA 1QS7A 1K90D 2WCLA 3GK2A 1SYMA 3CLNA 5I2QA 2FCDA 2HPSA 3L4LA 4GPLB 3NHTA 2K61A 1XFXO 3JVTC 2BE6A 2LVJA 3I5FC 1BR4B 4GAOA 5G08A 2PYQA 3DD4A 4U8DA 4WQ2A 1KK8B 2KFHA 3TZ1A 3I5IC 1UHHA 4MN0A 1L7ZA 2LNKA 2BKHB 3FWBA 2WORA 4ORBB 5KSZA 1SCMB 1SR6B 1IKUA 1MHOA 3EVUA 5F6TA 1TNQA 4HSZA 3TS5C 1OOJA 1AJ4A 1QATA 1FBVA 4UPGA 1YVLA 4OCIA 4MBEA 2JPTA 2LMVA 2KI6C 3NSIA 3DZTA 2FOTA 1W9ZA 3EK7A 5ER5A 1PULA 2SCPA 3R72A 2KBIA 2PASA 3LCPC 1DC1A 2FCEA 1AP4A 2AUCA 2K7BA 4CPVA 4OKHA 3LK1A 3PN7C 2Y1NA 4QJ4B 1IGVA 3CR2A 4USLA 1P28A 1XFUO 1AUIB 2WCKA 3JTDC 4PE1A 1DELA 1GQMA 2KAVA 1ZOTB 4YGDB 1CDLA 3FS7A 3S0GA 2JPOA 1NUBA 1ODBA 2M97A 2OS8B 2ZRSA 2Q4UA 1WDCC 3B7AA 1CNPA 1YRUB 3PATA 2MHHA 3BFHA 2QPTA 3IQOA 1SL9A 5IBWA 1CDMA 1E8AA 1K9PA 1PVAA 2Y5IA 4WQ3A 5DKQA 1RWYA 1WLMA 1TNXA 3ZNIA 3O4YA 1WRZA 2KLEA 1GJYA 1RK9A 4KYNA 3CWGA 3IQQA 2KFFA 2Q91A 4INWA 4MRXA 1IIOA 1G4YR 2QEBA 2WC6A 3PALA 4GGFC 4CFQA 2G2BA 2KI4C 3D73A 1XFVO 2VRGA 5TNCA 1AHRA 1S5GY 2KQYA 3PFVA 3SG7A 1YR5A 1JFJA 4XYNA 3UNWA 2LLSA 1V1GA 3MSEB 4AOMA 2BL0B 5AFPA 1EJ3A 4NQGA 2WCFA 1CFPA 1OOIX 2HETA 2JWWA 3BFAA 4MRYA 5HLOA 5FI2A 1SMGA 2H61A 5AEQA 1QV0A 1J1DA 1KFUS 1U5IA 2L98A 3R1VA 2K7CA 2MRDA 1C7WA 3WNXB 2MAZA 3NHIA 1OOFA 1RROA 2ZNDA 3PSRA 1C07A 1S3PA 1SK6D 1DJGA 4BY4A 1YRTB 1KQMC 2EHBA 3BUMB 4QJ3B 5FYXA 1YX7A 1QASA 3M0WA 2H8VA 5AANA 2ZFDA 1WRLA 2BE4A 3O4XA 3KHEA 4N1FA 1ALVA 1M45A 2LCPA 1XA5A 4MZLA 1VRKA 2LLUA 1BOCA 3A4UB 1T14A 4YI8A 3OB1B 1NX3A 3BUOB 1G33A 1F71A 4I5NB 4R1EA 1AJ5A 3CTNA 1BG1A 5I2LA 1IRJA 1DGUA 2H2KA 2LAPA 3H4SE 4M2OA 1OZSA 3BJHA 4YGCB 3DF0B 3KF9A 5DICA 2I2RE 3B87A 1J7PA 5HYDA 3CZ0A 5DKNA 1BU3A 1PVBA 2SASA 3CGAA 2CTNA 1NCZA 3SG2A 1LA3A 2KI6D 1QVIZ 1BR1B 4WRIA 2LLTA 3BUNB 1FI6A 2NCPA 5FI7A 1CM1A 4CIDA 1CLBA 2KNEA 2PALA 2R2IA
chains in the Genus database with same CATH topology
3HCMA 2AAOA 3EK4A 1YTZC 1CTRA 2ISDA 1RTP1 2COLB 1BF5A 1CFCA 2KSPA 3F45A 4IL1A 1B8LA 4MEWA 3AAKA 5HKWA 1WRKA 2JU0A 2KAXA 3I5GC 1LA0A 3GK1A 5D7FA 2JNFA 3EVRA 3BXKA 1KWOC 4PE0A 2KBMA 2KHNA 2NCOA 2H61C 3JVTB 1S36A 1TNWA 1NYAA 2L51A 3BUXB 1DJZA 4ORCB 3I5FB 5CPVA 5ER4X 3VRRA 1GGZA 1KFXS 2I94A 3DVJA 3WXAA 1CLLA 1S26D 1TOPA 1ALWA 2RGIA 5DKRA 3I5IB 3BYAA 1PK0D 4N5XA 1XFWO 4GUKA 1LVCD 1WY9A 4PDZA 3C1VA 3OP0A 3VROA 1N65A 4JPZB 4MLWA 2M7NA 1RECA 1NSHA 5BPJA 3BQ3A 4JQ0D 4PE7A 2MA2A 1SKTA 1Y1UA 3D0YB 1B7TZ 1Y6WA 1B9AA 1CLMA 1HT9A 2Y4QA 3CR5X 3I5HB 1SL7A 1DJIA 2EC6C 1ZACA 1YUSA 4C0KA 2M7LA 1KK8C 3OHMB 4FTGA 4PALA 3JTDB 2O5GA 1DMOA 1QX2A 4C0LA 2KFGA 2LUXA 5HKYA 1OE9B 1SCMC 1SBJA 1SR6C 2JNXA 2WNDA 3NSKA 4CFRA 2ZN9A 1F4QA 5CSJA 4ZCVA 2PSRA 1MUXA 2HQ8A 2OTGB 3WHUB 4PHNA 3SIBA 5HLVA 1JF0A 2V53A 3SG3A 1J1EA 1TCOB 4PCWA 2ZNEA 1AK8A 1F55A 1S6CA 2JRFA 4ZCUA 4CLNA 1KQVA 1KSOA 2KI4B 1TRFA 2I18A 1A75B 2KAYA 3CS1A 4HRGA 2JTZA 5CSFA 3SJSA 3GK4X 1KK7Z 2AMIA 2BBMA 3LK0A 1K96A 2LV7A 2GV5A 3TUYC 1M39A 2MJWB 1XFZO 1YX8A 2BCBA 1CFDA 4NDBA 4I5KA 1B8RA 1K95A 1OMRA 1V1FA 1ZFSA 4PHMA 2PVBA 1IG5A 1BLQA 2L4HA 3EVVA 4PHKA 4P5OE 1NX2A 1MR8A 1DF0B 1KFUL 2JT3A 4I5LB 3PLFB 1QX7A 2CNPA 4MZKA 3K21A 2LVIA 1QLSA 1M31A 1MXEA 1TCFA 1CB1A 2NZ0A 2NLNA 2P6BB 4HRHA 2FJUB 2WCBA 2BL0C 2KGBC 3D10A 3SG6A 1DTLA 1OSAA 1SNLA 2BCAA 3NSLA 3KPXA 1QIVA 2LVVA 2LMTA 1UHKA 1EH2A 4MSPA 1WLZA 1K93D 1Y0VH 1ZMZA 2ZRTA 4P2YB 1M46A 4GBAA 1JUOA 1MXLC 1NIWA 1OMDA 3DVMA 3IF7A 4A4CA 1JC2A 2JXLA 3NSOA 5AERA 1DVIA 1B8CA 3KEVA 3OX6A 4QJ5B 2K7DA 1QX5B 3NXAA 2BCXA 2CCMA 2WCEA 3DVKA 4YGBB 5J3XA 4M2QA 3KO0A 1CKKA 3TDIA 2KYFA 1L2OC 3EK8A 2O60A 2K2FA 5K89A 1A03A 1YURA 3AKBA 2DOQA 1PSBA 2LANA 2HF5A 3VRNA 3LL8B 1G8IA 1B47A 2LC5A 5I2OA 1AVSA 2GGMA 1UHJA 4TNCA 3OB2B 4DUQA 2L5XB 1Y1XA 1RFJA 2LM5A 1C7VA 1IJ5A 1SL8A 1TNPA 4E68A 2L50A 1DJHA 2LHLA 1CDPA 1S6IA 1CDNA 2B1UA 1FW4A 3RLZA 2M9GA 3PM8A 1J55A 3GOFA 1IQ3A 2CT9A 4OV2A 1UHIA 1XVJA 3CR4X 3BUWB 1SCVA 1NCYA 2K2AA 5JOLA 1LINA 1KFXL 4NDDA 1QXPA 1PRWA 3AAJA 2MLEC 2ZKMX 4PE4A 1DJWA 4YBHB 1A75A 1NCXA 1XK4A 2WC8A 3TS5B 4MVFA 1S5GZ 1QV1A 4DCKA 1SRAA 2KYCA 1IQ5A 2LUCA 5KU1A 5B8IB 1EG3A 1XYDA 1A29A 3PN7B 2MLFC 4HREE 3LLEA 2EC6B 1J7OA 2K7OA 1J7RA 3BOWB 3CZTX 1J7QA 1NP8A 4DIRA 2CXJA 5HKZA 4FQOA 1DF0A 1N0YA 2ZN8A 1QLKA 2TN4A 1F70A 3AKAA 4JWQA 1BMOA 1TN4A 3DVEA 1A4PA 5KTYA 1WDCB 1QVIY 1M63B 2LMUA 2QACA 1F54A 3E3RA 2M3WA 4M2PA 4C0JA 1IH0A 2NXQA 1R6PA 1TTXA 1PSRA 1K9UA 1EG4A 1LXFC 1K94A 3O78A 1GGWA 2IS9A 1JFKA 2GGZA 2JXCA 3I5HC 4XJKB 2CBLA 1FF1A 1SY9A 1FI5A 2L0PA 1EL4A 1R2UA 2E6WA 4ETOA 3DF0A 2L2EA 4N1GA 3SIAA 1OMVA 1D1OA 2LHIA 2KQ6A 2WOSA 2M1UA 1S6JA 3TUYB 2JOJA 2OS8C 1B1GA 4PHJA 4NDCA 1XFYO 2BKIB 1CFFA 1H8BA 1OZOA 5CSIA 4I5JA 2F2PA 1JWDA 1UP5A 1SPYA 2OTGC 2KDHA 4DS7A 3ICBA 1QTXA 1YUUA 3SG5A 3FWCA 2Y1MA 1NPQA 5JJGA 4MZJA 2M49B 1CMFA 3EKJA 1KQMB 1LKJA 2JZIA 2JQ6A 4D1EA 1EXRA 1A2XA 4AQIA 1JSAA 1XK4C 2EGDA 2LE9B 4A4BA 1K8UA 1IJ6A 2JT0A 2LVKA 2M29A 2F33A 1F4OA 4DRWA 1Y1AA 2KOTA 2MBXA 1B7TY 1TIZA 5CSNA 1HQVA 1B4CA 3TDUA 2I7AA 1K2HA 2M1KB 4ORAB 3A8RA 4YI9A 1DJXA 2E30A 1X02A 3EKHA 1F8HA 5D69A 2PRUA 1W7IB 3QRXA 2JC2A 1BJFA 5AXIA 1ZUZA 1YUTA 1PALA 1KSMA 3O6BA 4ICBA 1DJYA 4YRUA 1CMGA 2OPOA 1MWNA 4YGEB 2BECA 1JF2A 1DGVA 1QJTA 1L2OB 4F0ZB 4YGAA 1NWDA 2A4JA 1UHNA 2F2OA 2PMYA 1BODA 1MF8B 3VRQA 3D0YA 1XO5A 2M0RA 1YVHA 2L4IA 1NX1A 2K0JA 4Q04A 2LP2A 1Q80A 2M8UA 1QIWA 2F3ZA 2K8MB 3TDZA 4GNKB 1H4BA 3BOWA 3I5GB 3VGOA 1UWOA 4OVNF 1KK7Y 4GFTA 2BBNA 1BT6A 2JULA 3WHTB 2D8NA 1SW8A 3VRPA 4L9MA 4BY5A 1DT7B 1JBAA 1W7JB 1KWOB 1KCYA 4OR9B 2F3YA 5PALA 1UURA 3RM1A 2HQWA 1S1EA 2G9BA 3O2PA 3HX4A 1U5IB 3FIAA 5I8NA 2KGRA 2JTTA 3ZWHA 2F8PA 1CM4A 1RJVA 4XJKA 3SG4A 1FPWA 1IWQA 1OQPA 2JT8A 2LP3A 3OX5A 1N2DA 1UUSA 4GGFA 1K9KA 4AQJA 5GQQC 1MQ1A 4GGNA 1NX0A 1QS7A 1K90D 3GK2A 1SYMA 3CLNA 5I2QA 2FCDA 2HPSA 4GPLB 2K61A 1XFXO 3JVTC 2BE6A 2LVJA 3I5FC 1BR4B 4GAOA 5G08A 3DD4A 4U8DA 4WQ2A 1KK8B 2KFHA 3TZ1A 3I5IC 1UHHA 4MN0A 1L7ZA 2LNKA 2BKHB 3FWBA 2WORA 4ORBB 5KSZA 1SCMB 1SR6B 1IKUA 1MHOA 3EVUA 5F6TA 1TNQA 4HSZA 3TS5C 1OOJA 1AJ4A 1QATA 1FBVA 4UPGA 1YVLA 4OCIA 4MBEA 2JPTA 2LMVA 2KI6C 3NSIA 2FOTA 3EK7A 5ER5A 1PULA 2SCPA 2KBIA 2PASA 3LCPC 2FCEA 1AP4A 2AUCA 2K7BA 4CPVA 4OKHA 3LK1A 3PN7C 2Y1NA 4QJ4B 1IGVA 3CR2A 4USLA 1XFUO 1AUIB 3JTDC 4PE1A 1GQMA 2KAVA 1ZOTB 4YGDB 1CDLA 3FS7A 2M97A 1NUBA 1ODBA 2OS8B 2ZRSA 2Q4UA 1WDCC 1CNPA 1YRUB 3PATA 2MHHA 2QPTA 3IQOA 1SL9A 5IBWA 1CDMA 1E8AA 1K9PA 1PVAA 2Y5IA 4WQ3A 5DKQA 1RWYA 1WLMA 1TNXA 3ZNIA 3O4YA 1WRZA 1GJYA 1RK9A 3CWGA 3IQQA 2KFFA 2Q91A 4MRXA 1G4YR 3PALA 4GGFC 4CFQA 2G2BA 2KI4C 1XFVO 2VRGA 5TNCA 1AHRA 1S5GY 2KQYA 3PFVA 3SG7A 1YR5A 1JFJA 4XYNA 2LLSA 1V1GA 3MSEB 4AOMA 2BL0B 5AFPA 1EJ3A 4NQGA 2WCFA 1CFPA 2HETA 2JWWA 4MRYA 5HLOA 1SMGA 2H61A 5AEQA 1QV0A 1J1DA 1KFUS 1U5IA 2L98A 2K7CA 2MRDA 1C7WA 3WNXB 2MAZA 1RROA 2ZNDA 3PSRA 1C07A 1S3PA 1SK6D 1DJGA 4BY4A 1YRTB 1KQMC 2EHBA 3BUMB 4QJ3B 5FYXA 1YX7A 1QASA 3M0WA 5AANA 2ZFDA 1WRLA 2BE4A 3KHEA 4N1FA 1ALVA 1M45A 2LCPA 1XA5A 4MZLA 1VRKA 2LLUA 1BOCA 3A4UB 4YI8A 3OB1B 1NX3A 3BUOB 1G33A 1F71A 4I5NB 4R1EA 1AJ5A 3CTNA 1BG1A 5I2LA 1IRJA 1DGUA 2H2KA 2LAPA 3H4SE 4M2OA 1OZSA 4YGCB 3DF0B 3KF9A 2I2RE 1J7PA 5HYDA 5DKNA 1BU3A 1PVBA 2SASA 3CGAA 2CTNA 1NCZA 3SG2A 1LA3A 2KI6D 1QVIZ 1BR1B 4WRIA 2LLTA 3BUNB 1FI6A 2NCPA 1CM1A 4CIDA 1CLBA 2KNEA 2PALA 2R2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCM A;  2AAO A;  3EK4 A;  1YTZ C;  1CTR A;  2ISD A;  1RTP 1;  2COL B;  1BF5 A;  1CFC A;  2KSP A;  3F45 A;  4IL1 A;  1B8L A;  4MEW A;  3AAK A;  5HKW A;  1WRK A;  2JU0 A;  2KAX A;  3I5G C;  1LA0 A;  3GK1 A;  5D7F A;  2JNF A;  3EVR A;  3BXK A;  1KWO C;  4PE0 A;  2KBM A;  2KHN A;  2NCO A;  2H61 C;  3JVT B;  1S36 A;  1TNW A;  1NYA A;  2L51 A;  3BUX B;  1DJZ A;  4ORC B;  3I5F B;  5CPV A;  5ER4 X;  3VRR A;  1GGZ A;  1KFX S;  2I94 A;  3DVJ A;  3WXA A;  1CLL A;  1S26 D;  1TOP A;  1ALW A;  2RGI A;  5DKR A;  3I5I B;  3BYA A;  1PK0 D;  4N5X A;  1XFW O;  4GUK A;  1LVC D;  1WY9 A;  4PDZ A;  3C1V A;  3OP0 A;  3VRO A;  1N65 A;  4JPZ B;  4MLW A;  2M7N A;  1REC A;  1NSH A;  5BPJ A;  3BQ3 A;  4JQ0 D;  4PE7 A;  2MA2 A;  1SKT A;  1Y1U A;  3D0Y B;  1B7T Z;  1Y6W A;  1B9A A;  1CLM A;  1HT9 A;  2Y4Q A;  3CR5 X;  3I5H B;  1SL7 A;  1DJI A;  2EC6 C;  1ZAC A;  1YUS A;  4C0K A;  2M7L A;  1KK8 C;  3OHM B;  4FTG A;  4PAL A;  3JTD B;  2O5G A;  1DMO A;  1QX2 A;  4C0L A;  2KFG A;  2LUX A;  5HKY A;  1OE9 B;  1SCM C;  1SBJ A;  1SR6 C;  2JNX A;  2WND A;  3NSK A;  4CFR A;  2ZN9 A;  1F4Q A;  5CSJ A;  4ZCV A;  2PSR A;  1MUX A;  2HQ8 A;  2OTG B;  3WHU B;  4PHN A;  3SIB A;  5HLV A;  1JF0 A;  2V53 A;  3SG3 A;  1J1E A;  1TCO B;  4PCW A;  2ZNE A;  1AK8 A;  1F55 A;  1S6C A;  2JRF A;  4ZCU A;  4CLN A;  1KQV A;  1KSO A;  2KI4 B;  1TRF A;  2I18 A;  1A75 B;  2KAY A;  3CS1 A;  4HRG A;  2JTZ A;  5CSF A;  3SJS A;  3GK4 X;  1KK7 Z;  2AMI A;  2BBM A;  3LK0 A;  1K96 A;  2LV7 A;  2GV5 A;  3TUY C;  1M39 A;  2MJW B;  1XFZ O;  1YX8 A;  2BCB A;  1CFD A;  4NDB A;  4I5K A;  1B8R A;  1K95 A;  1OMR A;  1V1F A;  1ZFS A;  4PHM A;  2PVB A;  1IG5 A;  1BLQ A;  2L4H A;  3EVV A;  4PHK A;  4P5O E;  1NX2 A;  1MR8 A;  1DF0 B;  1KFU L;  2JT3 A;  4I5L B;  3PLF B;  1QX7 A;  2CNP A;  4MZK A;  3K21 A;  2LVI A;  1QLS A;  1M31 A;  1MXE A;  1TCF A;  1CB1 A;  2NZ0 A;  2NLN A;  2P6B B;  4HRH A;  2FJU B;  2WCB A;  2BL0 C;  2KGB C;  3D10 A;  3SG6 A;  1DTL A;  1OSA A;  1SNL A;  2BCA A;  3NSL A;  3KPX A;  1QIV A;  2LVV A;  2LMT A;  1UHK A;  1EH2 A;  4MSP A;  1WLZ A;  1K93 D;  1Y0V H;  1ZMZ A;  2ZRT A;  4P2Y B;  1M46 A;  4GBA A;  1JUO A;  1MXL C;  1NIW A;  1OMD A;  3DVM A;  3IF7 A;  4A4C A;  1JC2 A;  2JXL A;  3NSO A;  5AER A;  1DVI A;  1B8C A;  3KEV A;  3OX6 A;  4QJ5 B;  2K7D A;  1QX5 B;  3NXA A;  2BCX A;  2CCM A;  2WCE A;  3DVK A;  4YGB B;  5J3X A;  4M2Q A;  3KO0 A;  1CKK A;  3TDI A;  2KYF A;  1L2O C;  3EK8 A;  2O60 A;  2K2F A;  5K89 A;  1A03 A;  1YUR A;  3AKB A;  2DOQ A;  1PSB A;  2LAN A;  2HF5 A;  3VRN A;  3LL8 B;  1G8I A;  1B47 A;  2LC5 A;  5I2O A;  1AVS A;  2GGM A;  1UHJ A;  4TNC A;  3OB2 B;  4DUQ A;  2L5X B;  1Y1X A;  1RFJ A;  2LM5 A;  1C7V A;  1IJ5 A;  1SL8 A;  1TNP A;  4E68 A;  2L50 A;  1DJH A;  2LHL A;  1CDP A;  1S6I A;  1CDN A;  2B1U A;  1FW4 A;  3RLZ A;  2M9G A;  3PM8 A;  1J55 A;  3GOF A;  1IQ3 A;  2CT9 A;  4OV2 A;  1UHI A;  1XVJ A;  3CR4 X;  3BUW B;  1SCV A;  1NCY A;  2K2A A;  5JOL A;  1LIN A;  1KFX L;  4NDD A;  1QXP A;  1PRW A;  3AAJ A;  2MLE C;  2ZKM X;  4PE4 A;  1DJW A;  4YBH B;  1A75 A;  1NCX A;  1XK4 A;  2WC8 A;  3TS5 B;  4MVF A;  1S5G Z;  1QV1 A;  4DCK A;  1SRA A;  2KYC A;  1IQ5 A;  2LUC A;  5KU1 A;  5B8I B;  1EG3 A;  1XYD A;  1A29 A;  3PN7 B;  2MLF C;  4HRE E;  3LLE A;  2EC6 B;  1J7O A;  2K7O A;  1J7R A;  3BOW B;  3CZT X;  1J7Q A;  1NP8 A;  4DIR A;  2CXJ A;  5HKZ A;  4FQO A;  1DF0 A;  1N0Y A;  2ZN8 A;  1QLK A;  2TN4 A;  1F70 A;  3AKA A;  4JWQ A;  1BMO A;  1TN4 A;  3DVE A;  1A4P A;  5KTY A;  1WDC B;  1QVI Y;  1M63 B;  2LMU A;  2QAC A;  1F54 A;  3E3R A;  2M3W A;  4M2P A;  4C0J A;  1IH0 A;  2NXQ A;  1R6P A;  1TTX A;  1PSR A;  1K9U A;  1EG4 A;  1LXF C;  1K94 A;  3O78 A;  1GGW A;  2IS9 A;  1JFK A;  2GGZ A;  2JXC A;  3I5H C;  4XJK B;  2CBL A;  1FF1 A;  1SY9 A;  1FI5 A;  2L0P A;  1EL4 A;  1R2U A;  2E6W A;  4ETO A;  3DF0 A;  2L2E A;  4N1G A;  3SIA A;  1OMV A;  1D1O A;  2LHI A;  2KQ6 A;  2WOS A;  2M1U A;  1S6J A;  3TUY B;  2JOJ A;  2OS8 C;  1B1G A;  4PHJ A;  4NDC A;  1XFY O;  2BKI B;  1CFF A;  1H8B A;  1OZO A;  5CSI A;  4I5J A;  2F2P A;  1JWD A;  1UP5 A;  1SPY A;  2OTG C;  2KDH A;  4DS7 A;  3ICB A;  1QTX A;  1YUU A;  3SG5 A;  3FWC A;  2Y1M A;  1NPQ A;  5JJG A;  4MZJ A;  2M49 B;  1CMF A;  3EKJ A;  1KQM B;  1LKJ A;  2JZI A;  2JQ6 A;  4D1E A;  1EXR A;  1A2X A;  4AQI A;  1JSA A;  1XK4 C;  2EGD A;  2LE9 B;  4A4B A;  1K8U A;  1IJ6 A;  2JT0 A;  2LVK A;  2M29 A;  2F33 A;  1F4O A;  4DRW A;  1Y1A A;  2KOT A;  2MBX A;  1B7T Y;  1TIZ A;  5CSN A;  1HQV A;  1B4C A;  3TDU A;  2I7A A;  1K2H A;  2M1K B;  4ORA B;  3A8R A;  4YI9 A;  1DJX A;  2E30 A;  1X02 A;  3EKH A;  1F8H A;  5D69 A;  2PRU A;  1W7I B;  3QRX A;  2JC2 A;  1BJF A;  5AXI A;  1ZUZ A;  1YUT A;  1PAL A;  1KSM A;  3O6B A;  4ICB A;  1DJY A;  4YRU A;  1CMG A;  2OPO A;  1MWN A;  4YGE B;  2BEC A;  1JF2 A;  1DGV A;  1QJT A;  1L2O B;  4F0Z B;  4YGA A;  1NWD A;  2A4J A;  1UHN A;  2F2O A;  2PMY A;  1BOD A;  1MF8 B;  3VRQ A;  3D0Y A;  1XO5 A;  2M0R A;  1YVH A;  2L4I A;  1NX1 A;  2K0J A;  4Q04 A;  2LP2 A;  1Q80 A;  2M8U A;  1QIW A;  2F3Z A;  2K8M B;  3TDZ A;  4GNK B;  1H4B A;  3BOW A;  3I5G B;  3VGO A;  1UWO A;  4OVN F;  1KK7 Y;  4GFT A;  2BBN A;  1BT6 A;  2JUL A;  3WHT B;  2D8N A;  1SW8 A;  3VRP A;  4L9M A;  4BY5 A;  1DT7 B;  1JBA A;  1W7J B;  1KWO B;  1KCY A;  4OR9 B;  2F3Y A;  5PAL A;  1UUR A;  3RM1 A;  2HQW A;  1S1E A;  2G9B A;  3O2P A;  3HX4 A;  1U5I B;  3FIA A;  5I8N A;  2KGR A;  2JTT A;  3ZWH A;  2F8P A;  1CM4 A;  1RJV A;  4XJK A;  3SG4 A;  1FPW A;  1IWQ A;  1OQP A;  2JT8 A;  2LP3 A;  3OX5 A;  1N2D A;  1UUS A;  4GGF A;  1K9K A;  4AQJ A;  5GQQ C;  1MQ1 A;  4GGN A;  1NX0 A;  1QS7 A;  1K90 D;  3GK2 A;  1SYM A;  3CLN A;  5I2Q A;  2FCD A;  2HPS A;  4GPL B;  2K61 A;  1XFX O;  3JVT C;  2BE6 A;  2LVJ A;  3I5F C;  1BR4 B;  4GAO A;  5G08 A;  3DD4 A;  4U8D A;  4WQ2 A;  1KK8 B;  2KFH A;  3TZ1 A;  3I5I C;  1UHH A;  4MN0 A;  1L7Z A;  2LNK A;  2BKH B;  3FWB A;  2WOR A;  4ORB B;  5KSZ A;  1SCM B;  1SR6 B;  1IKU A;  1MHO A;  3EVU A;  5F6T A;  1TNQ A;  4HSZ A;  3TS5 C;  1OOJ A;  1AJ4 A;  1QAT A;  1FBV A;  4UPG A;  1YVL A;  4OCI A;  4MBE A;  2JPT A;  2LMV A;  2KI6 C;  3NSI A;  2FOT A;  3EK7 A;  5ER5 A;  1PUL A;  2SCP A;  2KBI A;  2PAS A;  3LCP C;  2FCE A;  1AP4 A;  2AUC A;  2K7B A;  4CPV A;  4OKH A;  3LK1 A;  3PN7 C;  2Y1N A;  4QJ4 B;  1IGV A;  3CR2 A;  4USL A;  1XFU O;  1AUI B;  3JTD C;  4PE1 A;  1GQM A;  2KAV A;  1ZOT B;  4YGD B;  1CDL A;  3FS7 A;  2M97 A;  1NUB A;  1ODB A;  2OS8 B;  2ZRS A;  2Q4U A;  1WDC C;  1CNP A;  1YRU B;  3PAT A;  2MHH A;  2QPT A;  3IQO A;  1SL9 A;  5IBW A;  1CDM A;  1E8A A;  1K9P A;  1PVA A;  2Y5I A;  4WQ3 A;  5DKQ A;  1RWY A;  1WLM A;  1TNX A;  3ZNI A;  3O4Y A;  1WRZ A;  1GJY A;  1RK9 A;  3CWG A;  3IQQ A;  2KFF A;  2Q91 A;  4MRX A;  1G4Y R;  3PAL A;  4GGF C;  4CFQ A;  2G2B A;  2KI4 C;  1XFV O;  2VRG A;  5TNC A;  1AHR A;  1S5G Y;  2KQY A;  3PFV A;  3SG7 A;  1YR5 A;  1JFJ A;  4XYN A;  2LLS A;  1V1G A;  3MSE B;  4AOM A;  2BL0 B;  5AFP A;  1EJ3 A;  4NQG A;  2WCF A;  1CFP A;  2HET A;  2JWW A;  4MRY A;  5HLO A;  1SMG A;  2H61 A;  5AEQ A;  1QV0 A;  1J1D A;  1KFU S;  1U5I A;  2L98 A;  2K7C A;  2MRD A;  1C7W A;  3WNX B;  2MAZ A;  1RRO A;  2ZND A;  3PSR A;  1C07 A;  1S3P A;  1SK6 D;  1DJG A;  4BY4 A;  1YRT B;  1KQM C;  2EHB A;  3BUM B;  4QJ3 B;  5FYX A;  1YX7 A;  1QAS A;  3M0W A;  5AAN A;  2ZFD A;  1WRL A;  2BE4 A;  3KHE A;  4N1F A;  1ALV A;  1M45 A;  2LCP A;  1XA5 A;  4MZL A;  1VRK A;  2LLU A;  1BOC A;  3A4U B;  4YI8 A;  3OB1 B;  1NX3 A;  3BUO B;  1G33 A;  1F71 A;  4I5N B;  4R1E A;  1AJ5 A;  3CTN A;  1BG1 A;  5I2L A;  1IRJ A;  1DGU A;  2H2K A;  2LAP A;  3H4S E;  4M2O A;  1OZS A;  4YGC B;  3DF0 B;  3KF9 A;  2I2R E;  1J7P A;  5HYD A;  5DKN A;  1BU3 A;  1PVB A;  2SAS A;  3CGA A;  2CTN A;  1NCZ A;  3SG2 A;  1LA3 A;  2KI6 D;  1QVI Z;  1BR1 B;  4WRI A;  2LLT A;  3BUN B;  1FI6 A;  2NCP A;  1CM1 A;  4CID A;  1CLB A;  2KNE A;  2PAL A;  2R2I A; 
#chains in the Genus database with same CATH topology
 3HCM A;  2AAO A;  3EK4 A;  1YTZ C;  1CTR A;  3B88 A;  2ISD A;  1RTP 1;  2COL B;  1BF5 A;  1CFC A;  2KSP A;  3F45 A;  2ERB A;  4IL1 A;  1B8L A;  4MEW A;  3AAK A;  5HKW A;  1WRK A;  2JU0 A;  3RZS A;  2KAX A;  3I5G C;  3QME A;  3D77 A;  1LA0 A;  3GK1 A;  5D7F A;  2JNF A;  3EVR A;  3BXK A;  1KWO C;  4PE0 A;  3S0E A;  2KBM A;  3SS5 A;  2KHN A;  2NCO A;  2H61 C;  3JVT B;  1S36 A;  1TNW A;  1NYA A;  2L51 A;  3BUX B;  1DJZ A;  4ORC B;  3I5F B;  5CPV A;  4INX A;  5ER4 X;  3VRR A;  1GGZ A;  1KFX S;  2I94 A;  3DVJ A;  3WXA A;  1CLL A;  1OW4 A;  1S26 D;  1TOP A;  1ALW A;  2RGI A;  5DKR A;  3I5I B;  3BYA A;  1PK0 D;  4N5X A;  1XFW O;  4GUK A;  4F7F A;  1LVC D;  1WY9 A;  4PDZ A;  3C1V A;  3OP0 A;  3VRO A;  1N65 A;  4JPZ B;  4MLW A;  2M7N A;  1REC A;  1NSH A;  3UO9 A;  5BPJ A;  3BQ3 A;  4JQ0 D;  4PE7 A;  2MA2 A;  1SKT A;  1Y1U A;  3D0Y B;  1QWV A;  1B7T Z;  1Y6W A;  1B9A A;  4PT1 A;  1CLM A;  3FE9 A;  1HT9 A;  2Y4Q A;  3CR5 X;  3I5H B;  3D76 A;  1SL7 A;  1DJI A;  2EC6 C;  1ZAC A;  1YUS A;  4C0K A;  2M7L A;  1KK8 C;  3OHM B;  4FTG A;  4PAL A;  3JTD B;  2O5G A;  1DMO A;  1QX2 A;  4C0L A;  2KFG A;  2LUX A;  5HKY A;  1OE9 B;  1SCM C;  1SBJ A;  1SR6 C;  2JNX A;  3EG5 B;  2WND A;  3NSK A;  1TUZ A;  4CFR A;  2ZN9 A;  1F4Q A;  5CSJ A;  4ZCV A;  2PSR A;  1MUX A;  1C3Y A;  2HQ8 A;  2OTG B;  3D74 A;  3WHU B;  4PHN A;  3SIB A;  5HLV A;  1JF0 A;  2V53 A;  3SG3 A;  1J1E A;  2K60 A;  5I94 A;  1TCO B;  4PCW A;  2ZNE A;  1AK8 A;  1F55 A;  1S6C A;  2JRF A;  4ZCU A;  4CLN A;  1KQV A;  1KSO A;  2KI4 B;  1TRF A;  2I18 A;  1A75 B;  2KAY A;  3CS1 A;  3D75 A;  2JTZ A;  4HRG A;  5CSF A;  3GK4 X;  3SJS A;  4FQT A;  1KK7 Z;  2AMI A;  2BBM A;  3LK0 A;  3BFB A;  1K96 A;  2LV7 A;  2GV5 A;  3TUY C;  1M39 A;  2MJW B;  3D78 A;  1XFZ O;  1YX8 A;  2BCB A;  1CFD A;  3FE6 A;  4I5K A;  1B8R A;  1K95 A;  4NDB A;  3B86 A;  1OMR A;  1V1F A;  1ZFS A;  4PHM A;  2PVB A;  1IG5 A;  2WC5 A;  2KLD A;  4IJ7 A;  1BLQ A;  2L4H A;  3EVV A;  4PHK A;  4P5O E;  5HL1 A;  1NX2 A;  1MR8 A;  3CYZ A;  2PQL A;  1DF0 B;  1KFU L;  2JT3 A;  4I5L B;  3PLF B;  1QX7 A;  2CNP A;  4MZK A;  3K21 A;  2LVI A;  1QLS A;  5FI6 A;  1M31 A;  1MXE A;  1TCF A;  1CB1 A;  2L2C A;  2NZ0 A;  2NLN A;  2P6B B;  4HRH A;  2FJU B;  2WCB A;  2BL0 C;  2KGB C;  5EL2 A;  3D10 A;  3SG6 A;  1DTL A;  1OSA A;  1SNL A;  2BCA A;  3R1O A;  3NSL A;  3KPX A;  1QIV A;  2LVV A;  2QEH A;  2LMT A;  1UHK A;  1GM0 A;  1EH2 A;  4MSP A;  1WLZ A;  1K93 D;  1Y0V H;  1ZMZ A;  2ZRT A;  4P2Y B;  1M46 A;  4GBA A;  1JUO A;  1MXL C;  1NIW A;  1OMD A;  3DVM A;  3IF7 A;  4A4C A;  1JC2 A;  2JXL A;  3NSO A;  5AER A;  1DVI A;  1B8C A;  3Q8I A;  3KEV A;  3OX6 A;  4QJ5 B;  2K7D A;  1QX5 B;  3NXA A;  2BCX A;  2CCM A;  2WCE A;  3DVK A;  4YGB B;  5J3X A;  3VB1 A;  4M2Q A;  3B6X A;  3KO0 A;  2QEV A;  3TDI A;  2KYF A;  1CKK A;  1L2O C;  3EK8 A;  2O60 A;  2K2F A;  5K89 A;  1A03 A;  1YUR A;  3SS3 A;  3AKB A;  3CZ2 A;  2QDI A;  2DOQ A;  3S0D A;  1PSB A;  2LAN A;  2HF5 A;  3VRN A;  3LL8 B;  1G8I A;  1B47 A;  2LC5 A;  5I2O A;  1AVS A;  2GGM A;  1UHJ A;  4TNC A;  3OB2 B;  4DUQ A;  2L5X B;  1Y1X A;  3OBV A;  3IVT A;  1RFJ A;  2LM5 A;  1C7V A;  1IJ5 A;  3V2L A;  1SL8 A;  1TNP A;  4E68 A;  2L50 A;  1DJH A;  2LHL A;  2WCH A;  4JD9 A;  1CDP A;  1S6I A;  1CDN A;  2B1U A;  1FW4 A;  3RLZ A;  2M9G A;  3PM8 A;  1J55 A;  3GOF A;  1IQ3 A;  2CT9 A;  1Z4H A;  4OV2 A;  1UHI A;  1XVJ A;  3DY9 A;  3CR4 X;  3BUW B;  1DQE A;  1SCV A;  1NCY A;  2WCJ A;  2K2A A;  5JOL A;  3S0F A;  1LIN A;  1KFX L;  4NDD A;  1QXP A;  1PRW A;  3AAJ A;  2MLE C;  2ZKM X;  4PE4 A;  1DJW A;  4YBH B;  1A75 A;  1NCX A;  1XK4 A;  2WC8 A;  3TS5 B;  3PJI A;  4MVF A;  1S5G Z;  2BAP A;  3NGV A;  1QV1 A;  4DCK A;  1SRA A;  2KYC A;  1IQ5 A;  2LUC A;  5KU1 A;  5B8I B;  1EG3 A;  1XYD A;  1A29 A;  2KPH A;  3PN7 B;  3CZ1 A;  1TUJ A;  2MLF C;  3LLE A;  2EC6 B;  4HRE E;  1J7O A;  2K7O A;  1J7R A;  3BOW B;  3CZT X;  1J7Q A;  1NP8 A;  4DIR A;  2CXJ A;  5HKZ A;  4FQO A;  1DF0 A;  1N0Y A;  1OOH A;  1QLK A;  2TN4 A;  2ZN8 A;  3AKA A;  1F70 A;  4JWQ A;  1BMO A;  1TN4 A;  3DVE A;  1A4P A;  5KTY A;  1WDC B;  1QVI Y;  1M63 B;  2LMU A;  3DYE A;  2QAC A;  1F54 A;  3E3R A;  2M3W A;  4M2P A;  4C0J A;  1IH0 A;  2NXQ A;  1R6P A;  1TTX A;  1PSR A;  1K9U A;  1EG4 A;  1LXF C;  1K94 A;  3O78 A;  3S0B A;  1GGW A;  2IS9 A;  1JFK A;  2GGZ A;  2JXC A;  3I5H C;  4XJK B;  2CBL A;  1OOG A;  1FF1 A;  1SY9 A;  1FI5 A;  2L0P A;  2P71 A;  1EL4 A;  1R2U A;  2YGU A;  2E6W A;  4ETO A;  3DF0 A;  2L2E A;  4N1G A;  3SIA A;  1OMV A;  1D1O A;  2LHI A;  3PM2 A;  2KQ6 A;  2WOS A;  2M1U A;  1S6J A;  3TUY B;  2JOJ A;  2OS8 C;  1B1G A;  4PHJ A;  4NDC A;  1XFY O;  2BKI B;  1CFF A;  3L4A A;  1H8B A;  1OZO A;  1XFR A;  1LS8 A;  5CSI A;  4I5J A;  2F2P A;  1JWD A;  1UP5 A;  1SPY A;  2OTG C;  2KDH A;  4DS7 A;  1C3Z A;  3ICB A;  1QTX A;  1YUU A;  3SG5 A;  3FWC A;  1TWO A;  1NPQ A;  2Y1M A;  3L47 A;  5JJG A;  4MZJ A;  2M49 B;  1CMF A;  3EKJ A;  1KQM B;  1LKJ A;  3K1E A;  2JZI A;  2JQ6 A;  4D1E A;  1EXR A;  1A2X A;  4AQI A;  1JSA A;  1XK4 C;  2EGD A;  2LE9 B;  4A4B A;  1K8U A;  1IJ6 A;  2JT0 A;  2LVK A;  2M29 A;  2F33 A;  1F4O A;  4DRW A;  1Y1A A;  2KOT A;  1ORG A;  2MBX A;  1B7T Y;  1TIZ A;  5CSN A;  3SS4 A;  1HQV A;  3CAB A;  1B4C A;  3R1P A;  1SSE B;  3TDU A;  2I7A A;  1K2H A;  2M1K B;  4ORA B;  3A8R A;  4YI9 A;  1DJX A;  2E30 A;  1X02 A;  3DXL A;  3EKH A;  5D69 A;  1F8H A;  2PRU A;  1W7I B;  3QRX A;  2JC2 A;  1BJF A;  5AXI A;  1ZUZ A;  1YUT A;  1PAL A;  1KSM A;  3O6B A;  4ICB A;  1DJY A;  4YRU A;  1CMG A;  2OPO A;  1MWN A;  4YGE B;  2BEC A;  1JF2 A;  1DGV A;  1QJT A;  3FE8 A;  3S0A A;  1L2O B;  4F0Z B;  3N7H A;  1NWD A;  2A4J A;  4YGA A;  1UHN A;  2F2O A;  2PMY A;  1BOD A;  1MF8 B;  3CDN A;  3VRQ A;  3D0Y A;  1XO5 A;  2M0R A;  2P70 A;  1YVH A;  2L4I A;  1NX1 A;  2K0J A;  4Q04 A;  2LP2 A;  1Q80 A;  2M8U A;  1QIW A;  2F3Z A;  2K8M B;  3TDZ A;  4GNK B;  1H4B A;  3BOW A;  3I5G B;  3VGO A;  1UWO A;  4OVN F;  1KK7 Y;  4GFT A;  2BBN A;  1BT6 A;  2JUL A;  5D3O A;  2D8N A;  3WHT B;  3OGN A;  1SW8 A;  3VRP A;  4L9M A;  2WCM A;  4BY5 A;  1DT7 B;  1W7J B;  1KWO B;  1JBA A;  1KCY A;  4OR9 B;  1Z2C B;  2F3Y A;  5PAL A;  1UUR A;  2BNX A;  3RM1 A;  2FJY A;  2HQW A;  1S1E A;  2G9B A;  3O2P A;  3HX4 A;  1U5I B;  4JKT A;  3FIA A;  5I8N A;  1DEK A;  2KGR A;  2JTT A;  3ZWH A;  2F8P A;  1CM4 A;  1RJV A;  4XJK A;  3SG4 A;  1FPW A;  1IWQ A;  1OQP A;  2JT8 A;  2LP3 A;  3OX5 A;  1N2D A;  1UUS A;  4GGF A;  1K9K A;  4AQJ A;  5GQQ C;  2GTE A;  1MQ1 A;  4GGN A;  2L5Y A;  4OZD A;  1NX0 A;  2QEO A;  1QS7 A;  1K90 D;  2WCL A;  3GK2 A;  1SYM A;  3CLN A;  5I2Q A;  2FCD A;  2HPS A;  3L4L A;  4GPL B;  3NHT A;  2K61 A;  1XFX O;  3JVT C;  2BE6 A;  2LVJ A;  3I5F C;  1BR4 B;  4GAO A;  5G08 A;  2PYQ A;  3DD4 A;  4U8D A;  4WQ2 A;  1KK8 B;  2KFH A;  3TZ1 A;  3I5I C;  1UHH A;  4MN0 A;  1L7Z A;  2LNK A;  2BKH B;  3FWB A;  2WOR A;  4ORB B;  5KSZ A;  1SCM B;  1SR6 B;  1IKU A;  1MHO A;  3EVU A;  5F6T A;  1TNQ A;  4HSZ A;  3TS5 C;  1OOJ A;  1AJ4 A;  1QAT A;  1FBV A;  4UPG A;  1YVL A;  4OCI A;  4MBE A;  2JPT A;  2LMV A;  2KI6 C;  3NSI A;  3DZT A;  2FOT A;  1W9Z A;  3EK7 A;  5ER5 A;  1PUL A;  2SCP A;  3R72 A;  2KBI A;  2PAS A;  3LCP C;  1DC1 A;  2FCE A;  1AP4 A;  2AUC A;  2K7B A;  4CPV A;  4OKH A;  3LK1 A;  3PN7 C;  2Y1N A;  4QJ4 B;  1IGV A;  3CR2 A;  4USL A;  1P28 A;  1XFU O;  1AUI B;  2WCK A;  3JTD C;  4PE1 A;  1DEL A;  1GQM A;  2KAV A;  1ZOT B;  4YGD B;  1CDL A;  3FS7 A;  3S0G A;  2JPO A;  1NUB A;  1ODB A;  2M97 A;  2OS8 B;  2ZRS A;  2Q4U A;  1WDC C;  3B7A A;  1CNP A;  1YRU B;  3PAT A;  2MHH A;  3BFH A;  2QPT A;  3IQO A;  1SL9 A;  5IBW A;  1CDM A;  1E8A A;  1K9P A;  1PVA A;  2Y5I A;  4WQ3 A;  5DKQ A;  1RWY A;  1WLM A;  1TNX A;  3ZNI A;  3O4Y A;  1WRZ A;  2KLE A;  1GJY A;  1RK9 A;  4KYN A;  3CWG A;  3IQQ A;  2KFF A;  2Q91 A;  4INW A;  4MRX A;  1IIO A;  1G4Y R;  2QEB A;  2WC6 A;  3PAL A;  4GGF C;  4CFQ A;  2G2B A;  2KI4 C;  3D73 A;  1XFV O;  2VRG A;  5TNC A;  1AHR A;  1S5G Y;  2KQY A;  3PFV A;  3SG7 A;  1YR5 A;  1JFJ A;  4XYN A;  3UNW A;  2LLS A;  1V1G A;  3MSE B;  4AOM A;  2BL0 B;  5AFP A;  1EJ3 A;  4NQG A;  2WCF A;  1CFP A;  1OOI X;  2HET A;  2JWW A;  3BFA A;  4MRY A;  5HLO A;  5FI2 A;  1SMG A;  2H61 A;  5AEQ A;  1QV0 A;  1J1D A;  1KFU S;  1U5I A;  2L98 A;  3R1V A;  2K7C A;  2MRD A;  1C7W A;  3WNX B;  2MAZ A;  3NHI A;  1OOF A;  1RRO A;  2ZND A;  3PSR A;  1C07 A;  1S3P A;  1SK6 D;  1DJG A;  4BY4 A;  1YRT B;  1KQM C;  2EHB A;  3BUM B;  4QJ3 B;  5FYX A;  1YX7 A;  1QAS A;  3M0W A;  2H8V A;  5AAN A;  2ZFD A;  1WRL A;  2BE4 A;  3O4X A;  3KHE A;  4N1F A;  1ALV A;  1M45 A;  2LCP A;  1XA5 A;  4MZL A;  1VRK A;  2LLU A;  1BOC A;  3A4U B;  1T14 A;  4YI8 A;  3OB1 B;  1NX3 A;  3BUO B;  1G33 A;  1F71 A;  4I5N B;  4R1E A;  1AJ5 A;  3CTN A;  1BG1 A;  5I2L A;  1IRJ A;  1DGU A;  2H2K A;  2LAP A;  3H4S E;  4M2O A;  1OZS A;  3BJH A;  4YGC B;  3DF0 B;  3KF9 A;  5DIC A;  2I2R E;  3B87 A;  1J7P A;  5HYD A;  3CZ0 A;  5DKN A;  1BU3 A;  1PVB A;  2SAS A;  3CGA A;  2CTN A;  1NCZ A;  3SG2 A;  1LA3 A;  2KI6 D;  1QVI Z;  1BR1 B;  4WRI A;  2LLT A;  3BUN B;  1FI6 A;  2NCP A;  5FI7 A;  1CM1 A;  4CID A;  1CLB A;  2KNE A;  2PAL A;  2R2I A; 
#chains in the Genus database with same CATH homology
 3HCM A;  2AAO A;  3EK4 A;  1YTZ C;  1CTR A;  2ISD A;  1RTP 1;  2COL B;  1BF5 A;  1CFC A;  2KSP A;  3F45 A;  4IL1 A;  1B8L A;  4MEW A;  3AAK A;  5HKW A;  1WRK A;  2JU0 A;  2KAX A;  3I5G C;  1LA0 A;  3GK1 A;  5D7F A;  2JNF A;  3EVR A;  3BXK A;  1KWO C;  4PE0 A;  2KBM A;  2KHN A;  2NCO A;  2H61 C;  3JVT B;  1S36 A;  1TNW A;  1NYA A;  2L51 A;  3BUX B;  1DJZ A;  4ORC B;  3I5F B;  5CPV A;  5ER4 X;  3VRR A;  1GGZ A;  1KFX S;  2I94 A;  3DVJ A;  3WXA A;  1CLL A;  1S26 D;  1TOP A;  1ALW A;  2RGI A;  5DKR A;  3I5I B;  3BYA A;  1PK0 D;  4N5X A;  1XFW O;  4GUK A;  1LVC D;  1WY9 A;  4PDZ A;  3C1V A;  3OP0 A;  3VRO A;  1N65 A;  4JPZ B;  4MLW A;  2M7N A;  1REC A;  1NSH A;  5BPJ A;  3BQ3 A;  4JQ0 D;  4PE7 A;  2MA2 A;  1SKT A;  1Y1U A;  3D0Y B;  1B7T Z;  1Y6W A;  1B9A A;  1CLM A;  1HT9 A;  2Y4Q A;  3CR5 X;  3I5H B;  1SL7 A;  1DJI A;  2EC6 C;  1ZAC A;  1YUS A;  4C0K A;  2M7L A;  1KK8 C;  3OHM B;  4FTG A;  4PAL A;  3JTD B;  2O5G A;  1DMO A;  1QX2 A;  4C0L A;  2KFG A;  2LUX A;  5HKY A;  1OE9 B;  1SCM C;  1SBJ A;  1SR6 C;  2JNX A;  2WND A;  3NSK A;  4CFR A;  2ZN9 A;  1F4Q A;  5CSJ A;  4ZCV A;  2PSR A;  1MUX A;  2HQ8 A;  2OTG B;  3WHU B;  4PHN A;  3SIB A;  5HLV A;  1JF0 A;  2V53 A;  3SG3 A;  1J1E A;  1TCO B;  4PCW A;  2ZNE A;  1AK8 A;  1F55 A;  1S6C A;  2JRF A;  4ZCU A;  4CLN A;  1KQV A;  1KSO A;  2KI4 B;  1TRF A;  2I18 A;  1A75 B;  2KAY A;  3CS1 A;  4HRG A;  2JTZ A;  5CSF A;  3SJS A;  3GK4 X;  1KK7 Z;  2AMI A;  2BBM A;  3LK0 A;  1K96 A;  2LV7 A;  2GV5 A;  3TUY C;  1M39 A;  2MJW B;  1XFZ O;  1YX8 A;  2BCB A;  1CFD A;  4NDB A;  4I5K A;  1B8R A;  1K95 A;  1OMR A;  1V1F A;  1ZFS A;  4PHM A;  2PVB A;  1IG5 A;  1BLQ A;  2L4H A;  3EVV A;  4PHK A;  4P5O E;  1NX2 A;  1MR8 A;  1DF0 B;  1KFU L;  2JT3 A;  4I5L B;  3PLF B;  1QX7 A;  2CNP A;  4MZK A;  3K21 A;  2LVI A;  1QLS A;  1M31 A;  1MXE A;  1TCF A;  1CB1 A;  2NZ0 A;  2NLN A;  2P6B B;  4HRH A;  2FJU B;  2WCB A;  2BL0 C;  2KGB C;  3D10 A;  3SG6 A;  1DTL A;  1OSA A;  1SNL A;  2BCA A;  3NSL A;  3KPX A;  1QIV A;  2LVV A;  2LMT A;  1UHK A;  1EH2 A;  4MSP A;  1WLZ A;  1K93 D;  1Y0V H;  1ZMZ A;  2ZRT A;  4P2Y B;  1M46 A;  4GBA A;  1JUO A;  1MXL C;  1NIW A;  1OMD A;  3DVM A;  3IF7 A;  4A4C A;  1JC2 A;  2JXL A;  3NSO A;  5AER A;  1DVI A;  1B8C A;  3KEV A;  3OX6 A;  4QJ5 B;  2K7D A;  1QX5 B;  3NXA A;  2BCX A;  2CCM A;  2WCE A;  3DVK A;  4YGB B;  5J3X A;  4M2Q A;  3KO0 A;  1CKK A;  3TDI A;  2KYF A;  1L2O C;  3EK8 A;  2O60 A;  2K2F A;  5K89 A;  1A03 A;  1YUR A;  3AKB A;  2DOQ A;  1PSB A;  2LAN A;  2HF5 A;  3VRN A;  3LL8 B;  1G8I A;  1B47 A;  2LC5 A;  5I2O A;  1AVS A;  2GGM A;  1UHJ A;  4TNC A;  3OB2 B;  4DUQ A;  2L5X B;  1Y1X A;  1RFJ A;  2LM5 A;  1C7V A;  1IJ5 A;  1SL8 A;  1TNP A;  4E68 A;  2L50 A;  1DJH A;  2LHL A;  1CDP A;  1S6I A;  1CDN A;  2B1U A;  1FW4 A;  3RLZ A;  2M9G A;  3PM8 A;  1J55 A;  3GOF A;  1IQ3 A;  2CT9 A;  4OV2 A;  1UHI A;  1XVJ A;  3CR4 X;  3BUW B;  1SCV A;  1NCY A;  2K2A A;  5JOL A;  1LIN A;  1KFX L;  4NDD A;  1QXP A;  1PRW A;  3AAJ A;  2MLE C;  2ZKM X;  4PE4 A;  1DJW A;  4YBH B;  1A75 A;  1NCX A;  1XK4 A;  2WC8 A;  3TS5 B;  4MVF A;  1S5G Z;  1QV1 A;  4DCK A;  1SRA A;  2KYC A;  1IQ5 A;  2LUC A;  5KU1 A;  5B8I B;  1EG3 A;  1XYD A;  1A29 A;  3PN7 B;  2MLF C;  4HRE E;  3LLE A;  2EC6 B;  1J7O A;  2K7O A;  1J7R A;  3BOW B;  3CZT X;  1J7Q A;  1NP8 A;  4DIR A;  2CXJ A;  5HKZ A;  4FQO A;  1DF0 A;  1N0Y A;  2ZN8 A;  1QLK A;  2TN4 A;  1F70 A;  3AKA A;  4JWQ A;  1BMO A;  1TN4 A;  3DVE A;  1A4P A;  5KTY A;  1WDC B;  1QVI Y;  1M63 B;  2LMU A;  2QAC A;  1F54 A;  3E3R A;  2M3W A;  4M2P A;  4C0J A;  1IH0 A;  2NXQ A;  1R6P A;  1TTX A;  1PSR A;  1K9U A;  1EG4 A;  1LXF C;  1K94 A;  3O78 A;  1GGW A;  2IS9 A;  1JFK A;  2GGZ A;  2JXC A;  3I5H C;  4XJK B;  2CBL A;  1FF1 A;  1SY9 A;  1FI5 A;  2L0P A;  1EL4 A;  1R2U A;  2E6W A;  4ETO A;  3DF0 A;  2L2E A;  4N1G A;  3SIA A;  1OMV A;  1D1O A;  2LHI A;  2KQ6 A;  2WOS A;  2M1U A;  1S6J A;  3TUY B;  2JOJ A;  2OS8 C;  1B1G A;  4PHJ A;  4NDC A;  1XFY O;  2BKI B;  1CFF A;  1H8B A;  1OZO A;  5CSI A;  4I5J A;  2F2P A;  1JWD A;  1UP5 A;  1SPY A;  2OTG C;  2KDH A;  4DS7 A;  3ICB A;  1QTX A;  1YUU A;  3SG5 A;  3FWC A;  2Y1M A;  1NPQ A;  5JJG A;  4MZJ A;  2M49 B;  1CMF A;  3EKJ A;  1KQM B;  1LKJ A;  2JZI A;  2JQ6 A;  4D1E A;  1EXR A;  1A2X A;  4AQI A;  1JSA A;  1XK4 C;  2EGD A;  2LE9 B;  4A4B A;  1K8U A;  1IJ6 A;  2JT0 A;  2LVK A;  2M29 A;  2F33 A;  1F4O A;  4DRW A;  1Y1A A;  2KOT A;  2MBX A;  1B7T Y;  1TIZ A;  5CSN A;  1HQV A;  1B4C A;  3TDU A;  2I7A A;  1K2H A;  2M1K B;  4ORA B;  3A8R A;  4YI9 A;  1DJX A;  2E30 A;  1X02 A;  3EKH A;  1F8H A;  5D69 A;  2PRU A;  1W7I B;  3QRX A;  2JC2 A;  1BJF A;  5AXI A;  1ZUZ A;  1YUT A;  1PAL A;  1KSM A;  3O6B A;  4ICB A;  1DJY A;  4YRU A;  1CMG A;  2OPO A;  1MWN A;  4YGE B;  2BEC A;  1JF2 A;  1DGV A;  1QJT A;  1L2O B;  4F0Z B;  4YGA A;  1NWD A;  2A4J A;  1UHN A;  2F2O A;  2PMY A;  1BOD A;  1MF8 B;  3VRQ A;  3D0Y A;  1XO5 A;  2M0R A;  1YVH A;  2L4I A;  1NX1 A;  2K0J A;  4Q04 A;  2LP2 A;  1Q80 A;  2M8U A;  1QIW A;  2F3Z A;  2K8M B;  3TDZ A;  4GNK B;  1H4B A;  3BOW A;  3I5G B;  3VGO A;  1UWO A;  4OVN F;  1KK7 Y;  4GFT A;  2BBN A;  1BT6 A;  2JUL A;  3WHT B;  2D8N A;  1SW8 A;  3VRP A;  4L9M A;  4BY5 A;  1DT7 B;  1JBA A;  1W7J B;  1KWO B;  1KCY A;  4OR9 B;  2F3Y A;  5PAL A;  1UUR A;  3RM1 A;  2HQW A;  1S1E A;  2G9B A;  3O2P A;  3HX4 A;  1U5I B;  3FIA A;  5I8N A;  2KGR A;  2JTT A;  3ZWH A;  2F8P A;  1CM4 A;  1RJV A;  4XJK A;  3SG4 A;  1FPW A;  1IWQ A;  1OQP A;  2JT8 A;  2LP3 A;  3OX5 A;  1N2D A;  1UUS A;  4GGF A;  1K9K A;  4AQJ A;  5GQQ C;  1MQ1 A;  4GGN A;  1NX0 A;  1QS7 A;  1K90 D;  3GK2 A;  1SYM A;  3CLN A;  5I2Q A;  2FCD A;  2HPS A;  4GPL B;  2K61 A;  1XFX O;  3JVT C;  2BE6 A;  2LVJ A;  3I5F C;  1BR4 B;  4GAO A;  5G08 A;  3DD4 A;  4U8D A;  4WQ2 A;  1KK8 B;  2KFH A;  3TZ1 A;  3I5I C;  1UHH A;  4MN0 A;  1L7Z A;  2LNK A;  2BKH B;  3FWB A;  2WOR A;  4ORB B;  5KSZ A;  1SCM B;  1SR6 B;  1IKU A;  1MHO A;  3EVU A;  5F6T A;  1TNQ A;  4HSZ A;  3TS5 C;  1OOJ A;  1AJ4 A;  1QAT A;  1FBV A;  4UPG A;  1YVL A;  4OCI A;  4MBE A;  2JPT A;  2LMV A;  2KI6 C;  3NSI A;  2FOT A;  3EK7 A;  5ER5 A;  1PUL A;  2SCP A;  2KBI A;  2PAS A;  3LCP C;  2FCE A;  1AP4 A;  2AUC A;  2K7B A;  4CPV A;  4OKH A;  3LK1 A;  3PN7 C;  2Y1N A;  4QJ4 B;  1IGV A;  3CR2 A;  4USL A;  1XFU O;  1AUI B;  3JTD C;  4PE1 A;  1GQM A;  2KAV A;  1ZOT B;  4YGD B;  1CDL A;  3FS7 A;  2M97 A;  1NUB A;  1ODB A;  2OS8 B;  2ZRS A;  2Q4U A;  1WDC C;  1CNP A;  1YRU B;  3PAT A;  2MHH A;  2QPT A;  3IQO A;  1SL9 A;  5IBW A;  1CDM A;  1E8A A;  1K9P A;  1PVA A;  2Y5I A;  4WQ3 A;  5DKQ A;  1RWY A;  1WLM A;  1TNX A;  3ZNI A;  3O4Y A;  1WRZ A;  1GJY A;  1RK9 A;  3CWG A;  3IQQ A;  2KFF A;  2Q91 A;  4MRX A;  1G4Y R;  3PAL A;  4GGF C;  4CFQ A;  2G2B A;  2KI4 C;  1XFV O;  2VRG A;  5TNC A;  1AHR A;  1S5G Y;  2KQY A;  3PFV A;  3SG7 A;  1YR5 A;  1JFJ A;  4XYN A;  2LLS A;  1V1G A;  3MSE B;  4AOM A;  2BL0 B;  5AFP A;  1EJ3 A;  4NQG A;  2WCF A;  1CFP A;  2HET A;  2JWW A;  4MRY A;  5HLO A;  1SMG A;  2H61 A;  5AEQ A;  1QV0 A;  1J1D A;  1KFU S;  1U5I A;  2L98 A;  2K7C A;  2MRD A;  1C7W A;  3WNX B;  2MAZ A;  1RRO A;  2ZND A;  3PSR A;  1C07 A;  1S3P A;  1SK6 D;  1DJG A;  4BY4 A;  1YRT B;  1KQM C;  2EHB A;  3BUM B;  4QJ3 B;  5FYX A;  1YX7 A;  1QAS A;  3M0W A;  5AAN A;  2ZFD A;  1WRL A;  2BE4 A;  3KHE A;  4N1F A;  1ALV A;  1M45 A;  2LCP A;  1XA5 A;  4MZL A;  1VRK A;  2LLU A;  1BOC A;  3A4U B;  4YI8 A;  3OB1 B;  1NX3 A;  3BUO B;  1G33 A;  1F71 A;  4I5N B;  4R1E A;  1AJ5 A;  3CTN A;  1BG1 A;  5I2L A;  1IRJ A;  1DGU A;  2H2K A;  2LAP A;  3H4S E;  4M2O A;  1OZS A;  4YGC B;  3DF0 B;  3KF9 A;  2I2R E;  1J7P A;  5HYD A;  5DKN A;  1BU3 A;  1PVB A;  2SAS A;  3CGA A;  2CTN A;  1NCZ A;  3SG2 A;  1LA3 A;  2KI6 D;  1QVI Z;  1BR1 B;  4WRI A;  2LLT A;  3BUN B;  1FI6 A;  2NCP A;  1CM1 A;  4CID A;  1CLB A;  2KNE A;  2PAL A;  2R2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...