1A4PA

P11 (s100a10), ligand of annexin ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
b'PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100A10
publication title The crystal structure of a complex of p11 with the annexin II N-terminal peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium/phospholipid binding protein
total genus 34
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1a4pA00
3EKHA 3LLEA 2AUCA 5HYDA 4GGNA 1LINA 1IGVA 1TOPA 2R2IA 1A2XA 1IWQA 1YR5A 2KI4C 1SL9A 4E68A 2PRUA 2BBMA 1VRKA 1FI6A 1TCFA 1B47A 5I2OA 3H4SE 2Y5IA 1J55A 1YUSA 4QJ5B 2EHBA 5HLVA 1IKUA 2BCBA 3I5HC 2WOSA 4N1GA 3GOFA 4BY4A 1KK7Z 2BBNA 4FTGA 4AOMA 1ZACA 1S5GY 2NCOA 3D0YB 1ZOTB 2PMYA 1NIWA 1NPQA 2WORA 2SCPA 2K7OA 2ZN8A 4I5NB 1ALVA 4C0JA 2WNDA 2KFGA 4ETOA 3EVVA 3K21A 2KGRA 1OMDA 3I5IB 4PE1A 5KTYA 4IL1A 3VRNA 3SG5A 2K8MB 3VROA 3TDUA 1JBAA 2LVVA 1IRJA 1JC2A 2LE9B 2I18A 1DF0B 1EH2A 2HETA 1LA3A 4MBEA 1OOJA 4PALA 2KI4B 1H4BA 3CLNA 2HPSA 2PALA 1IQ5A 4WQ2A 1MWNA 2O5GA 1F71A 1U5IA 1KFUS 3MSEB 2JOJA 3EVRA 2KDHA 1NSHA 1KCYA 1IQ3A 1NX0A 2RGIA 2Q4UA 1JWDA 3CS1A 3I5HB 4NDCA 1QVIY 2LMTA 2F3YA 4DIRA 1N65A 1BODA 2CCMA 2FOTA 1J1DA 1M45A 2LLUA 4C0LA 2MJWB 3BXKA 1UUSA 1L7ZA 2JULA 1XFUO 3BOWA 1CKKA 1J7OA 1QATA 5CPVA 1UWOA 2K7BA 3NSOA 1S26D 4QJ3B 4ZCVA 2QACA 1J7RA 1HT9A 2JT8A 3AAJA 1QIVA 3TS5C 4AQIA 1PRWA 1QJTA 1QX7A 2MAZA 1K9UA 2Q91A 4ORAB 1B1GA 2KYFA 2HQWA 3WHTB 1BF5A 4NQGA 1YVHA 4ORBB 4GGFC 3HX4A 1CB1A 2LV7A 1YTZC 2MLFC 3KPXA 4R1EA 2COLB 1EG4A 2HF5A 2MBXA 4DCKA 1FPWA 2KBIA 4UPGA 1B9AA 1CFFA 1PULA 1B8LA 1BG1A 2G9BA 2JXCA 2L51A 4P2YB 1WRKA 2OS8B 2JC2A 3OX5A 1UURA 3DD4A 1XVJA 3O4YA 2L4HA 1CMGA 1JFKA 1TN4A 4HREE 3CWGA 4XJKA 2JQ6A 1FBVA 2LUXA 2M7LA 2K61A 1OSAA 3BUWB 3OHMB 1YRTB 2JT0A 3CZTX 4MZLA 5KU1A 1SNLA 1YVLA 1C07A 1B7TY 1GGZA 2CTNA 1DJYA 3GK4X 4OKHA 1PALA 2JT3A 2NXQA 1CM1A 3I5FC 4PE7A 4WQ3A 5D69A 5PALA 1YRUB 3PLFB 2ZNDA 1BR1B 5J3XA 1H8BA 4DS7A 5HKYA 1CFPA 4MSPA 3TS5B 2KI6C 2KYCA 2BE6A 1ZMZA 3VRRA 2LNKA 2JTTA 2MRDA 3DVMA 4PCWA 4HSZA 2ZRSA 3O2PA 1TTXA 1SYMA 2IS9A 1FW4A 1SCVA 1BR4B 5D7FA 3TUYC 5GQQC 1NCZA 4WRIA 1OE9B 3NSIA 1N0YA 1YURA 1A75B 3SG6A 2JU0A 1A4PA 1IG5A 1YUTA 1YUUA 1KK8C 5CSFA 1K8UA 2FCEA 2V53A 1CLBA 1CDLA 1M63B 1RFJA 4YGEB 2L50A 1W7IB 5AXIA 3ZNIA 4YGDB 4YRUA 4PDZA 1QS7A 1QX5B 4ICBA 5KSZA 1SPYA 1SL8A 2K0JA 1QV1A 1TIZA 3I5FB 1UHKA 2A4JA 1J7PA 3RLZA 4M2PA 2LVKA 2M1UA 2K7DA 4U8DA 1DMOA 2KFHA 1BMOA 3GK1A 4MVFA 2KHNA 1PSBA 4MZKA 4QJ4B 4JPZB 5CSIA 1LKJA 1N2DA 3NXAA 1RECA 2LP2A 1RTP1 1SK6D 3DF0A 3FWCA 3LK0A 3O6BA 1K90D 2G2BA 4OCIA 1M39A 1WRLA 2M8UA 1YX7A 1XFZO 1SMGA 1Y0VH 4GNKB 4MEWA 1KFUL 1UP5A 2LCPA 1Y1UA 2LMVA 3KEVA 1FF1A 1DJGA 3BUXB 2GV5A 1AHRA 1ODBA 1KK8B 3DVKA 1W7JB 4N5XA 1M31A 1Y1AA 3EVUA 4NDDA 2F2PA 1FI5A 2BE4A 1R2UA 5B8IB 1YX8A 2PSRA 5IBWA 1RWYA 1NCXA 4L9MA 2JPTA 1TNXA 2E6WA 4GUKA 4OVNF 1RK9A 2HQ8A 5AERA 1DT7B 3FIAA 1V1FA 3O78A 4I5KA 2SASA 1B8RA 4PE0A 2E30A 1QASA 1C7WA 1GGWA 1K9KA 1S1EA 2QPTA 5CSNA 1IJ5A 1LVCD 1G33A 4MN0A 1CMFA 2LLTA 1S6JA 5JOLA 2K2FA 3PM8A 1KFXL 1TRFA 3BQ3A 2L4IA 1RJVA 2JRFA 1CM4A 3PATA 1WY9A 2KFFA 4YBHB 1AP4A 1F4OA 2KAXA 4ZCUA 2WCBA 1V1GA 2M0RA 3VGOA 2M9GA 3LK1A 2JXLA 1BU3A 2KQ6A 2M3WA 3TDZA 2I2RE 1NYAA 2JZIA 4AQJA 1S5GZ 1ZFSA 2WC8A 3LCPC 4F0ZB 1F8HA 2FCDA 2CNPA 2NCPA 4MLWA 5CSJA 1AJ4A 1NWDA 1LXFC 3TDIA 1UHIA 2B1UA 3PFVA 1PVBA 1XFWO 1WRZA 4GPLB 1CDMA 1JF0A 3SG7A 1JF2A 2I7AA 4YGCB 3BUOB 3CTNA 1KQVA 1WDCC 1QX2A 2KNEA 1J7QA 4CFQA 1GJYA 1WLMA 3JVTC 1UHHA 2KSPA 4M2OA 4NDBA 4DRWA 3C1VA 1QIWA 1EL4A 1DGUA 1PSRA 1DJHA 1TNPA 2AAOA 2MA2A 1OZOA 2L5XB 3BUNB 1U5IB 3BUMB 2LMUA 1IJ6A 3AAKA 3AKAA 3KF9A 3PSRA 4GAOA 4PHNA 3SIAA 1L2OC 1GQMA 1KK7Y 5BPJA 1K94A 2CBLA 2LANA 3VRQA 1NUBA 3IQOA 1CLLA 2Y1NA 3D0YA 5TNCA 1QVIZ 2M29A 3RM1A 1ALWA 3DVJA 1XK4A 2LVJA 4A4CA 3A8RA 1SKTA 4USLA 5AFPA 1A29A 3BOWB 1NX2A 1SR6C 1X02A 5I8NA 1S6CA 2LUCA 3OB1B 2H2KA 3KO0A 1F54A 2MHHA 3CR2A 1DTLA 2F3ZA 4A4BA 3PN7C 2ZNEA 3SG3A 3ZWHA 2KAYA 1TNQA 1QLSA 1WDCB 1QV0A 1DF0A 5JJGA 3FWBA 1MXLC 1OMRA 3JVTB 1CLMA 1NX3A 1UHNA 5ER5A 4DUQA 1M46A 3VRPA 3SIBA 4GFTA 1CNPA 1CDPA 1AUIB 1S3PA 3I5GC 2LAPA 1F70A 2CXJA 1XYDA 2BCXA 1DVIA 4JQ0D 1S36A 2F2OA 1MF8B 2BECA 2GGZA 2AMIA 4MZJA 4PHJA 4CFRA 1L2OB 1DJWA 2PASA 1LA0A 1SY9A 4XJKB 1SRAA 1Q80A 1XFYO 3WHUB 2O60A 1HQVA 1CFDA 1F4QA 1A03A 1Y1XA 1OMVA 2OPOA 5HKZA 5HLOA 1SBJA 2JNXA 2FJUB 1JSAA 1QLKA 2PVBA 2M49B 1SCMC 1BOCA 1EJ3A 2K2AA 5DKRA 2OTGC 1SR6B 2ISDA 2Y1MA 1B7TZ 1DJXA 1G8IA 3TUYB 1DJIA 3F45A 2EC6C 1IH0A 3ICBA 3KHEA 4P5OE 1S6IA 3PN7B 4MRXA 1B8CA 5ER4X 1R6PA 2H61A 2ZN9A 1J1EA 4M2QA 2JWWA 1XO5A 4TNCA 1TNWA 3EK4A 2KOTA 3PALA 5HKWA 2L2EA 2KAVA 1MXEA 5K89A 1NCYA 1TCOB 2EGDA 2M7NA 5AANA 1ZUZA 1D1OA 3LL8B 3I5GB 1DJZA 4GBAA 3IF7A 2BL0C 2VRGA 4I5JA 2H61C 1XFVO 4BY5A 3OP0A 1QTXA 1Y6WA 1CFCA 4HRGA 4D1EA 1AK8A 2ZFDA 1XFXO 1QXPA 2BKHB 2OS8C 1UHJA 1AVSA 1C7VA 3EKJA 5FYXA 1NP8A 1SCMB 4JWQA 1XA5A 3SJSA 2L98A 4YGBB 1EXRA 2CT9A 2F33A 2LM5A 2OTGB 4YI9A 2LC5A 1NX1A 3NSLA 2EC6B 3QRXA 2KI6D 1PK0D 2K7CA 4YI8A 1G4YR 3EK8A 1KWOC 4GGFA 4CPVA 5I2LA 2P6BB 2M1KB 3DF0B 2GGMA 3WXAA 1AJ5A 1OQPA 3JTDC 1SW8A 3EK7A 2WCEA 1A75A 1B4CA 3IQQA 1CDNA 2TN4A 1KQMC 5G08A 3M0WA 5AEQA 4CLNA 3CR5X 1E8AA 2F8PA 2NZ0A 4OV2A 1OZSA 2Y4QA 2BL0B 5DKQA 3D10A 1KFXS 3SG4A 1MUXA 4N1FA 2D8NA 4CIDA 1MR8A 3HCMA 3SG2A 2ZKMX 1WLZA 1DGVA 4C0KA 1MQ1A 5DKNA 2JNFA 3OX6A 2WCFA 4PE4A 2L0PA 2MLEC 2KBMA 2JTZA 3CGAA 3E3RA 2LLSA 1K93D 3FS7A 4Q04A 2M97A 2KQYA 3DVEA 5F6TA 4PHMA 4ORCB 3CR4X 1KWOB 1K96A 1JFJA 3AKBA 4YGAA 2LVIA 2ZRTA 2LP3A 2KGBC 2LHIA 4FQOA 2I94A 1PVAA 2DOQA 3JTDB 4MRYA 3BYAA 1K9PA 5I2QA 1SL7A 3GK2A 1CTRA 4HRHA 1KSOA 2BKIB 1BLQA 1F55A 1K2HA 3OB2B 1XK4C 1K95A 4OR9B 1EG3A 1KQMB 1MHOA 2NLNA 4PHKA 3I5IC 4I5LB 2BCAA 1KSMA 3TZ1A 3A4UB 4XYNA 3NSKA 3WNXB 1RROA 1JUOA 1BT6A 2LHLA 1BJFA
chains in the Genus database with same CATH superfamily
2WC6A 3EKHA 3LLEA 2AUCA 5HYDA 4GGNA 1C3ZA 1LINA 1IGVA 1TOPA 2R2IA 1A2XA 1IWQA 1YR5A 2KI4C 1SL9A 4E68A 2PRUA 2BBMA 1VRKA 1FI6A 1TCFA 1B47A 5I2OA 3H4SE 2Y5IA 1J55A 1YUSA 4QJ5B 2EHBA 5HLVA 1IKUA 1T14A 2BCBA 3I5HC 2WOSA 4N1GA 3GOFA 3CDNA 4BY4A 1KK7Z 2BBNA 4FTGA 4AOMA 1ZACA 1S5GY 1OOIX 1QWVA 2NCOA 3D0YB 1ZOTB 2K60A 1NIWA 1NPQA 2PMYA 2SCPA 2K7OA 2WORA 2ZN8A 1ALVA 4I5NB 4C0JA 2WNDA 2KFGA 4ETOA 3FE9A 3EVVA 3K21A 2KGRA 3NHTA 1OMDA 3I5IB 4PE1A 5KTYA 3CYZA 4IL1A 2P71A 3VRNA 3SG5A 2K8MB 3VROA 3TDUA 1JBAA 4PT1A 2L2CA 2LVVA 1IRJA 1JC2A 2P70A 1IIOA 2LE9B 2I18A 1ORGA 1DF0B 3SS4A 1EH2A 2HETA 1LA3A 4MBEA 1OOJA 4PALA 2KI4B 1H4BA 3BFAA 3CLNA 2HPSA 2PALA 1IQ5A 4WQ2A 1MWNA 2O5GA 1F71A 3D77A 1U5IA 1KFUS 3MSEB 2JOJA 2WCKA 3EVRA 2KDHA 2JPOA 1NSHA 1KCYA 1IQ3A 1NX0A 2RGIA 2Q4UA 1JWDA 3CS1A 3D78A 3I5HB 1QVIY 4NDCA 2LMTA 2F3YA 4DIRA 1N65A 1BODA 2CCMA 2FOTA 1J1DA 1M45A 2LLUA 4C0LA 2MJWB 3RZSA 3BXKA 1UUSA 1L7ZA 3NGVA 2JULA 1XFUO 3S0AA 3S0EA 3BOWA 1CKKA 1J7OA 1QATA 5CPVA 1UWOA 2K7BA 1OOFA 3NSOA 1S26D 4QJ3B 4ZCVA 2QACA 1J7RA 1HT9A 2JT8A 3AAJA 1GM0A 1QIVA 3TS5C 4AQIA 1PRWA 1QJTA 1QX7A 2MAZA 1K9UA 2Q91A 3FE6A 4ORAB 1B1GA 2KYFA 2HQWA 3WHTB 1BF5A 4NQGA 1YVHA 4ORBB 4GGFC 3SS5A 3HX4A 1CB1A 2LV7A 1YTZC 2MLFC 3KPXA 4R1EA 2COLB 1EG4A 2HF5A 2MBXA 4DCKA 4INXA 2KBIA 1FPWA 4UPGA 1B9AA 1CFFA 1PULA 1B8LA 1BG1A 2G9BA 2JXCA 2L51A 4P2YB 1WRKA 2OS8B 2JC2A 3OX5A 1UURA 3DD4A 1XVJA 3NHIA 3O4YA 2L4HA 4FQTA 1CMGA 1JFKA 1TN4A 4HREE 3CWGA 2H8VA 3CZ1A 4XJKA 2JQ6A 1FBVA 2LUXA 2M7LA 2K61A 1OSAA 3BUWB 3OHMB 3QMEA 5FI2A 1YRTB 2JT0A 3CZTX 4MZLA 5KU1A 1SNLA 1YVLA 1C07A 1B7TY 1GGZA 2CTNA 1DJYA 3GK4X 4OKHA 1PALA 2JT3A 2NXQA 1CM1A 3I5FC 4PE7A 4WQ3A 5D69A 5PALA 1P28A 1YRUB 2QEBA 3PLFB 2ZNDA 5FI6A 1BR1B 5J3XA 1H8BA 3UO9A 4DS7A 5HKYA 1CFPA 4JD9A 4MSPA 3B88A 3TS5B 2KI6C 2KYCA 2BE6A 2YGUA 1ZMZA 5HL1A 3VRRA 2LNKA 2JTTA 2MRDA 3DVMA 4PCWA 4HSZA 2ZRSA 3O2PA 1TTXA 1SYMA 2IS9A 1FW4A 1SCVA 1BR4B 5D7FA 3TUYC 5GQQC 1NCZA 4WRIA 1OE9B 2ERBA 3NSIA 1N0YA 1YURA 1A75B 3SG6A 2JU0A 1A4PA 1IG5A 1YUTA 1YUUA 1KK8C 2QEHA 3D75A 5CSFA 1K8UA 2FCEA 2V53A 1CLBA 1CDLA 1M63B 1OW4A 1RFJA 4YGEB 2L50A 1TUJA 1W7IB 5AXIA 3ZNIA 4YGDB 4YRUA 4PDZA 1QS7A 1QX5B 4ICBA 5KSZA 1SPYA 1SL8A 2K0JA 1QV1A 1TIZA 3I5FB 1UHKA 2A4JA 1J7PA 3RLZA 4M2PA 2LVKA 2M1UA 1TUZA 2K7DA 4U8DA 1DMOA 2KFHA 1BMOA 3GK1A 4MVFA 2KHNA 1PSBA 4MZKA 3VB1A 4QJ4B 4JPZB 5CSIA 1LKJA 1N2DA 3NXAA 1RECA 2LP2A 1RTP1 1SK6D 3DF0A 3FWCA 3LK0A 3O6BA 1K90D 3IVTA 2G2BA 4OCIA 1M39A 1WRLA 2KLDA 2M8UA 3DY9A 1YX7A 1XFZO 1SMGA 1Y0VH 1OOGA 4GNKB 4MEWA 1KFUL 3L4AA 1UP5A 2LCPA 1Y1UA 2LMVA 2PYQA 3BFBA 3KEVA 4IJ7A 1FF1A 1DJGA 3BUXB 2GV5A 1AHRA 1OOHA 1ODBA 1KK8B 3DVKA 1W7JB 4N5XA 1M31A 1Y1AA 3EVUA 4NDDA 2F2PA 1FI5A 3B87A 2BE4A 1R2UA 5B8IB 1YX8A 2PSRA 5IBWA 1RWYA 1NCXA 4L9MA 2JPTA 1TNXA 2E6WA 4GUKA 4OVNF 1RK9A 2HQ8A 5AERA 1DT7B 3FIAA 1V1FA 3O78A 3O4XA 4I5KA 2SASA 3S0DA 1B8RA 4PE0A 2E30A 1QASA 1C7WA 1GGWA 1K9KA 1S1EA 2QPTA 5CSNA 1IJ5A 1LVCD 1G33A 4MN0A 1CMFA 2LLTA 1S6JA 3D76A 5JOLA 2K2FA 3PM8A 1KFXL 3PM2A 1TRFA 3BQ3A 2L4IA 3CZ2A 1RJVA 2JRFA 1Z4HA 1CM4A 3PATA 1WY9A 2KFFA 4YBHB 1AP4A 1F4OA 2KAXA 4ZCUA 2WCBA 1V1GA 2M0RA 3VGOA 2M9GA 3LK1A 1LS8A 2JXLA 1BU3A 2KQ6A 2M3WA 3TDZA 2I2RE 2L5YA 1NYAA 2JZIA 4AQJA 1S5GZ 1ZFSA 2WC8A 3LCPC 5DICA 4F0ZB 1F8HA 2FCDA 2CNPA 1DQEA 2NCPA 4MLWA 5CSJA 4F7FA 1AJ4A 1NWDA 1LXFC 3TDIA 1UHIA 2B1UA 3CABA 3PFVA 3B7AA 1PVBA 1XFWO 1WRZA 1TWOA 5D3OA 4GPLB 1CDMA 1JF0A 3SG7A 1JF2A 2I7AA 4YGCB 3BUOB 3CTNA 1KQVA 1WDCC 1QX2A 2KNEA 1J7QA 2BNXA 4CFQA 1GJYA 1WLMA 3JVTC 1UHHA 2KSPA 4M2OA 4NDBA 4DRWA 3C1VA 1QIWA 1EL4A 1DGUA 1PSRA 1DJHA 1TNPA 2AAOA 2MA2A 1OZOA 2L5XB 3BUNB 1U5IB 3BUMB 2LMUA 1IJ6A 3AAKA 3AKAA 3KF9A 3PSRA 4GAOA 4PHNA 3SIAA 1L2OC 1GQMA 1KK7Y 5BPJA 3OBVA 1K94A 2CBLA 2LANA 3VRQA 1NUBA 3S0GA 3DXLA 3IQOA 1CLLA 2Y1NA 3D0YA 5TNCA 1QVIZ 2M29A 3RM1A 1ALWA 3DVJA 1XK4A 2LVJA 4A4CA 3A8RA 1SKTA 4USLA 5AFPA 1A29A 2WCLA 3BOWB 1NX2A 1SR6C 1X02A 5I8NA 1S6CA 2LUCA 3OB1B 2H2KA 4KYNA 3KO0A 2WCMA 1F54A 2MHHA 3CR2A 1DTLA 2F3ZA 4A4BA 2WCHA 3PN7C 2ZNEA 3SG3A 3ZWHA 2KAYA 1TNQA 1QLSA 1WDCB 1QV0A 1DF0A 5JJGA 3FWBA 1MXLC 1OMRA 3JVTB 1CLMA 1NX3A 1UHNA 5ER5A 4DUQA 1M46A 3VRPA 3SIBA 4GFTA 1CNPA 1CDPA 3FE8A 1AUIB 1S3PA 3I5GC 2LAPA 1F70A 2CXJA 1XYDA 2BCXA 1DVIA 4JQ0D 1S36A 2F2OA 1MF8B 2BECA 2GGZA 2AMIA 4MZJA 4PHJA 4CFRA 1L2OB 3R1VA 1DJWA 2PASA 3BFHA 1LA0A 1SY9A 4XJKB 1SRAA 1Q80A 1XFYO 3WHUB 2O60A 1HQVA 1CFDA 1F4QA 1A03A 1Y1XA 3S0BA 1OMVA 2OPOA 5HKZA 5HLOA 1SBJA 2JNXA 1XFRA 2FJUB 1JSAA 1QLKA 2PVBA 3DYEA 2M49B 1SCMC 1BOCA 3L4LA 3R1OA 1EJ3A 2K2AA 5DKRA 3B6XA 2OTGC 1SR6B 3D74A 2ISDA 2Y1MA 1B7TZ 3CZ0A 1DJXA 1G8IA 3TUYB 1DJIA 2KLEA 3F45A 2EC6C 3R1PA 1IH0A 3ICBA 3KHEA 4P5OE 1S6IA 2WC5A 3PN7B 4MRXA 1B8CA 5ER4X 1R6PA 2H61A 2ZN9A 1J1EA 4M2QA 2JWWA 1XO5A 2QEOA 3D73A 3EG5B 4JKTA 4TNCA 3SS3A 1TNWA 3EK4A 2KOTA 3PALA 5HKWA 2L2EA 2KAVA 1MXEA 5K89A 1NCYA 3PJIA 1TCOB 3B86A 2EGDA 2M7NA 5AANA 2KPHA 1ZUZA 1D1OA 3LL8B 2FJYA 3I5GB 1DJZA 4GBAA 3IF7A 2BL0C 2VRGA 4I5JA 2H61C 1XFVO 3Q8IA 3UNWA 3OP0A 1QTXA 1Y6WA 4BY5A 1CFCA 4HRGA 4D1EA 1AK8A 2ZFDA 1XFXO 1QXPA 5EL2A 2BKHB 2OS8C 1UHJA 1AVSA 1SSEB 3OGNA 1C7VA 3EKJA 5FYXA 1NP8A 1SCMB 4JWQA 1XA5A 3SJSA 2L98A 4YGBB 1EXRA 2CT9A 2F33A 2LM5A 2OTGB 3S0FA 4YI9A 2LC5A 1NX1A 3N7HA 3NSLA 2EC6B 3QRXA 1C3YA 2KI6D 1PK0D 2K7CA 4YI8A 1G4YR 3EK8A 1KWOC 4GGFA 4CPVA 5I2LA 2P6BB 2M1KB 3DF0B 2GGMA 3WXAA 4OZDA 1AJ5A 1OQPA 3JTDC 1SW8A 3K1EA 3EK7A 5I94A 2WCEA 3L47A 1A75A 3R72A 1B4CA 2PQLA 3IQQA 1CDNA 2TN4A 1KQMC 5G08A 2BAPA 3M0WA 5AEQA 3CR5X 4CLNA 1E8AA 2F8PA 1Z2CB 2NZ0A 1OZSA 4OV2A 2Y4QA 2BL0B 5DKQA 1DELA 1KFXS 3D10A 3SG4A 2QDIA 1MUXA 4N1FA 2D8NA 4CIDA 1MR8A 3HCMA 3SG2A 2ZKMX 1WLZA 1DGVA 4C0KA 1MQ1A 5DKNA 2JNFA 3V2LA 3OX6A 2WCFA 4PE4A 1DC1A 2L0PA 2MLEC 2KBMA 2JTZA 3CGAA 3E3RA 2LLSA 1K93D 3FS7A 4Q04A 2M97A 2KQYA 3DVEA 5F6TA 5FI7A 4PHMA 4ORCB 2QEVA 3CR4X 1KWOB 1K96A 1JFJA 3AKBA 4YGAA 2LVIA 2ZRTA 2LP3A 2KGBC 2LHIA 4FQOA 2GTEA 2I94A 1PVAA 2DOQA 3JTDB 4MRYA 3BYAA 1K9PA 5I2QA 1SL7A 3GK2A 1CTRA 4HRHA 1KSOA 2BKIB 1BLQA 1F55A 1K2HA 3OB2B 1XK4C 1K95A 2WCJA 4OR9B 1EG3A 1KQMB 1MHOA 2NLNA 4PHKA 3I5IC 4I5LB 1W9ZA 2BCAA 1KSMA 3TZ1A 3A4UB 4XYNA 3NSKA 3WNXB 1RROA 1JUOA 1DEKA 3BJHA 3DZTA 1BT6A 2LHLA 4INWA 1BJFA
chains in the Genus database with same CATH topology
3EKHA 3LLEA 2AUCA 5HYDA 4GGNA 1LINA 1IGVA 1TOPA 2R2IA 1A2XA 1IWQA 1YR5A 2KI4C 1SL9A 4E68A 2PRUA 2BBMA 1VRKA 1FI6A 1TCFA 1B47A 5I2OA 3H4SE 2Y5IA 1J55A 1YUSA 4QJ5B 2EHBA 5HLVA 1IKUA 2BCBA 3I5HC 2WOSA 4N1GA 3GOFA 4BY4A 1KK7Z 2BBNA 4FTGA 4AOMA 1ZACA 1S5GY 2NCOA 3D0YB 1ZOTB 2PMYA 1NIWA 1NPQA 2WORA 2SCPA 2K7OA 2ZN8A 4I5NB 1ALVA 4C0JA 2WNDA 2KFGA 4ETOA 3EVVA 3K21A 2KGRA 1OMDA 3I5IB 4PE1A 5KTYA 4IL1A 3VRNA 3SG5A 2K8MB 3VROA 3TDUA 1JBAA 2LVVA 1IRJA 1JC2A 2LE9B 2I18A 1DF0B 1EH2A 2HETA 1LA3A 4MBEA 1OOJA 4PALA 2KI4B 1H4BA 3CLNA 2HPSA 2PALA 1IQ5A 4WQ2A 1MWNA 2O5GA 1F71A 1U5IA 1KFUS 3MSEB 2JOJA 3EVRA 2KDHA 1NSHA 1KCYA 1IQ3A 1NX0A 2RGIA 2Q4UA 1JWDA 3CS1A 3I5HB 4NDCA 1QVIY 2LMTA 2F3YA 4DIRA 1N65A 1BODA 2CCMA 2FOTA 1J1DA 1M45A 2LLUA 4C0LA 2MJWB 3BXKA 1UUSA 1L7ZA 2JULA 1XFUO 3BOWA 1CKKA 1J7OA 1QATA 5CPVA 1UWOA 2K7BA 3NSOA 1S26D 4QJ3B 4ZCVA 2QACA 1J7RA 1HT9A 2JT8A 3AAJA 1QIVA 3TS5C 4AQIA 1PRWA 1QJTA 1QX7A 2MAZA 1K9UA 2Q91A 4ORAB 1B1GA 2KYFA 2HQWA 3WHTB 1BF5A 4NQGA 1YVHA 4ORBB 4GGFC 3HX4A 1CB1A 2LV7A 1YTZC 2MLFC 3KPXA 4R1EA 2COLB 1EG4A 2HF5A 2MBXA 4DCKA 1FPWA 2KBIA 4UPGA 1B9AA 1CFFA 1PULA 1B8LA 1BG1A 2G9BA 2JXCA 2L51A 4P2YB 1WRKA 2OS8B 2JC2A 3OX5A 1UURA 3DD4A 1XVJA 3O4YA 2L4HA 1CMGA 1JFKA 1TN4A 4HREE 3CWGA 4XJKA 2JQ6A 1FBVA 2LUXA 2M7LA 2K61A 1OSAA 3BUWB 3OHMB 1YRTB 2JT0A 3CZTX 4MZLA 5KU1A 1SNLA 1YVLA 1C07A 1B7TY 1GGZA 2CTNA 1DJYA 3GK4X 4OKHA 1PALA 2JT3A 2NXQA 1CM1A 3I5FC 4PE7A 4WQ3A 5D69A 5PALA 1YRUB 3PLFB 2ZNDA 1BR1B 5J3XA 1H8BA 4DS7A 5HKYA 1CFPA 4MSPA 3TS5B 2KI6C 2KYCA 2BE6A 1ZMZA 3VRRA 2LNKA 2JTTA 2MRDA 3DVMA 4PCWA 4HSZA 2ZRSA 3O2PA 1TTXA 1SYMA 2IS9A 1FW4A 1SCVA 1BR4B 5D7FA 3TUYC 5GQQC 1NCZA 4WRIA 1OE9B 3NSIA 1N0YA 1YURA 1A75B 3SG6A 2JU0A 1A4PA 1IG5A 1YUTA 1YUUA 1KK8C 5CSFA 1K8UA 2FCEA 2V53A 1CLBA 1CDLA 1M63B 1RFJA 4YGEB 2L50A 1W7IB 5AXIA 3ZNIA 4YGDB 4YRUA 4PDZA 1QS7A 1QX5B 4ICBA 5KSZA 1SPYA 1SL8A 2K0JA 1QV1A 1TIZA 3I5FB 1UHKA 2A4JA 1J7PA 3RLZA 4M2PA 2LVKA 2M1UA 2K7DA 4U8DA 1DMOA 2KFHA 1BMOA 3GK1A 4MVFA 2KHNA 1PSBA 4MZKA 4QJ4B 4JPZB 5CSIA 1LKJA 1N2DA 3NXAA 1RECA 2LP2A 1RTP1 1SK6D 3DF0A 3FWCA 3LK0A 3O6BA 1K90D 2G2BA 4OCIA 1M39A 1WRLA 2M8UA 1YX7A 1XFZO 1SMGA 1Y0VH 4GNKB 4MEWA 1KFUL 1UP5A 2LCPA 1Y1UA 2LMVA 3KEVA 1FF1A 1DJGA 3BUXB 2GV5A 1AHRA 1ODBA 1KK8B 3DVKA 1W7JB 4N5XA 1M31A 1Y1AA 3EVUA 4NDDA 2F2PA 1FI5A 2BE4A 1R2UA 5B8IB 1YX8A 2PSRA 5IBWA 1RWYA 1NCXA 4L9MA 2JPTA 1TNXA 2E6WA 4GUKA 4OVNF 1RK9A 2HQ8A 5AERA 1DT7B 3FIAA 1V1FA 3O78A 4I5KA 2SASA 1B8RA 4PE0A 2E30A 1QASA 1C7WA 1GGWA 1K9KA 1S1EA 2QPTA 5CSNA 1IJ5A 1LVCD 1G33A 4MN0A 1CMFA 2LLTA 1S6JA 5JOLA 2K2FA 3PM8A 1KFXL 1TRFA 3BQ3A 2L4IA 1RJVA 2JRFA 1CM4A 3PATA 1WY9A 2KFFA 4YBHB 1AP4A 1F4OA 2KAXA 4ZCUA 2WCBA 1V1GA 2M0RA 3VGOA 2M9GA 3LK1A 2JXLA 1BU3A 2KQ6A 2M3WA 3TDZA 2I2RE 1NYAA 2JZIA 4AQJA 1S5GZ 1ZFSA 2WC8A 3LCPC 4F0ZB 1F8HA 2FCDA 2CNPA 2NCPA 4MLWA 5CSJA 1AJ4A 1NWDA 1LXFC 3TDIA 1UHIA 2B1UA 3PFVA 1PVBA 1XFWO 1WRZA 4GPLB 1CDMA 1JF0A 3SG7A 1JF2A 2I7AA 4YGCB 3BUOB 3CTNA 1KQVA 1WDCC 1QX2A 2KNEA 1J7QA 4CFQA 1GJYA 1WLMA 3JVTC 1UHHA 2KSPA 4M2OA 4NDBA 4DRWA 3C1VA 1QIWA 1EL4A 1DGUA 1PSRA 1DJHA 1TNPA 2AAOA 2MA2A 1OZOA 2L5XB 3BUNB 1U5IB 3BUMB 2LMUA 1IJ6A 3AAKA 3AKAA 3KF9A 3PSRA 4GAOA 4PHNA 3SIAA 1L2OC 1GQMA 1KK7Y 5BPJA 1K94A 2CBLA 2LANA 3VRQA 1NUBA 3IQOA 1CLLA 2Y1NA 3D0YA 5TNCA 1QVIZ 2M29A 3RM1A 1ALWA 3DVJA 1XK4A 2LVJA 4A4CA 3A8RA 1SKTA 4USLA 5AFPA 1A29A 3BOWB 1NX2A 1SR6C 1X02A 5I8NA 1S6CA 2LUCA 3OB1B 2H2KA 3KO0A 1F54A 2MHHA 3CR2A 1DTLA 2F3ZA 4A4BA 3PN7C 2ZNEA 3SG3A 3ZWHA 2KAYA 1TNQA 1QLSA 1WDCB 1QV0A 1DF0A 5JJGA 3FWBA 1MXLC 1OMRA 3JVTB 1CLMA 1NX3A 1UHNA 5ER5A 4DUQA 1M46A 3VRPA 3SIBA 4GFTA 1CNPA 1CDPA 1AUIB 1S3PA 3I5GC 2LAPA 1F70A 2CXJA 1XYDA 2BCXA 1DVIA 4JQ0D 1S36A 2F2OA 1MF8B 2BECA 2GGZA 2AMIA 4MZJA 4PHJA 4CFRA 1L2OB 1DJWA 2PASA 1LA0A 1SY9A 4XJKB 1SRAA 1Q80A 1XFYO 3WHUB 2O60A 1HQVA 1CFDA 1F4QA 1A03A 1Y1XA 1OMVA 2OPOA 5HKZA 5HLOA 1SBJA 2JNXA 2FJUB 1JSAA 1QLKA 2PVBA 2M49B 1SCMC 1BOCA 1EJ3A 2K2AA 5DKRA 2OTGC 1SR6B 2ISDA 2Y1MA 1B7TZ 1DJXA 1G8IA 3TUYB 1DJIA 3F45A 2EC6C 1IH0A 3ICBA 3KHEA 4P5OE 1S6IA 3PN7B 4MRXA 1B8CA 5ER4X 1R6PA 2H61A 2ZN9A 1J1EA 4M2QA 2JWWA 1XO5A 4TNCA 1TNWA 3EK4A 2KOTA 3PALA 5HKWA 2L2EA 2KAVA 1MXEA 5K89A 1NCYA 1TCOB 2EGDA 2M7NA 5AANA 1ZUZA 1D1OA 3LL8B 3I5GB 1DJZA 4GBAA 3IF7A 2BL0C 2VRGA 4I5JA 2H61C 1XFVO 4BY5A 3OP0A 1QTXA 1Y6WA 1CFCA 4HRGA 4D1EA 1AK8A 2ZFDA 1XFXO 1QXPA 2BKHB 2OS8C 1UHJA 1AVSA 1C7VA 3EKJA 5FYXA 1NP8A 1SCMB 4JWQA 1XA5A 3SJSA 2L98A 4YGBB 1EXRA 2CT9A 2F33A 2LM5A 2OTGB 4YI9A 2LC5A 1NX1A 3NSLA 2EC6B 3QRXA 2KI6D 1PK0D 2K7CA 4YI8A 1G4YR 3EK8A 1KWOC 4GGFA 4CPVA 5I2LA 2P6BB 2M1KB 3DF0B 2GGMA 3WXAA 1AJ5A 1OQPA 3JTDC 1SW8A 3EK7A 2WCEA 1A75A 1B4CA 3IQQA 1CDNA 2TN4A 1KQMC 5G08A 3M0WA 5AEQA 4CLNA 3CR5X 1E8AA 2F8PA 2NZ0A 4OV2A 1OZSA 2Y4QA 2BL0B 5DKQA 3D10A 1KFXS 3SG4A 1MUXA 4N1FA 2D8NA 4CIDA 1MR8A 3HCMA 3SG2A 2ZKMX 1WLZA 1DGVA 4C0KA 1MQ1A 5DKNA 2JNFA 3OX6A 2WCFA 4PE4A 2L0PA 2MLEC 2KBMA 2JTZA 3CGAA 3E3RA 2LLSA 1K93D 3FS7A 4Q04A 2M97A 2KQYA 3DVEA 5F6TA 4PHMA 4ORCB 3CR4X 1KWOB 1K96A 1JFJA 3AKBA 4YGAA 2LVIA 2ZRTA 2LP3A 2KGBC 2LHIA 4FQOA 2I94A 1PVAA 2DOQA 3JTDB 4MRYA 3BYAA 1K9PA 5I2QA 1SL7A 3GK2A 1CTRA 4HRHA 1KSOA 2BKIB 1BLQA 1F55A 1K2HA 3OB2B 1XK4C 1K95A 4OR9B 1EG3A 1KQMB 1MHOA 2NLNA 4PHKA 3I5IC 4I5LB 2BCAA 1KSMA 3TZ1A 3A4UB 4XYNA 3NSKA 3WNXB 1RROA 1JUOA 1BT6A 2LHLA 1BJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKH A;  3LLE A;  2AUC A;  5HYD A;  4GGN A;  1LIN A;  1IGV A;  1TOP A;  2R2I A;  1A2X A;  1IWQ A;  1YR5 A;  2KI4 C;  1SL9 A;  4E68 A;  2PRU A;  2BBM A;  1VRK A;  1FI6 A;  1TCF A;  1B47 A;  5I2O A;  3H4S E;  2Y5I A;  1J55 A;  1YUS A;  4QJ5 B;  2EHB A;  5HLV A;  1IKU A;  2BCB A;  3I5H C;  2WOS A;  4N1G A;  3GOF A;  4BY4 A;  1KK7 Z;  2BBN A;  4FTG A;  4AOM A;  1ZAC A;  1S5G Y;  2NCO A;  3D0Y B;  1ZOT B;  2PMY A;  1NIW A;  1NPQ A;  2WOR A;  2SCP A;  2K7O A;  2ZN8 A;  4I5N B;  1ALV A;  4C0J A;  2WND A;  2KFG A;  4ETO A;  3EVV A;  3K21 A;  2KGR A;  1OMD A;  3I5I B;  4PE1 A;  5KTY A;  4IL1 A;  3VRN A;  3SG5 A;  2K8M B;  3VRO A;  3TDU A;  1JBA A;  2LVV A;  1IRJ A;  1JC2 A;  2LE9 B;  2I18 A;  1DF0 B;  1EH2 A;  2HET A;  1LA3 A;  4MBE A;  1OOJ A;  4PAL A;  2KI4 B;  1H4B A;  3CLN A;  2HPS A;  2PAL A;  1IQ5 A;  4WQ2 A;  1MWN A;  2O5G A;  1F71 A;  1U5I A;  1KFU S;  3MSE B;  2JOJ A;  3EVR A;  2KDH A;  1NSH A;  1KCY A;  1IQ3 A;  1NX0 A;  2RGI A;  2Q4U A;  1JWD A;  3CS1 A;  3I5H B;  4NDC A;  1QVI Y;  2LMT A;  2F3Y A;  4DIR A;  1N65 A;  1BOD A;  2CCM A;  2FOT A;  1J1D A;  1M45 A;  2LLU A;  4C0L A;  2MJW B;  3BXK A;  1UUS A;  1L7Z A;  2JUL A;  1XFU O;  3BOW A;  1CKK A;  1J7O A;  1QAT A;  5CPV A;  1UWO A;  2K7B A;  3NSO A;  1S26 D;  4QJ3 B;  4ZCV A;  2QAC A;  1J7R A;  1HT9 A;  2JT8 A;  3AAJ A;  1QIV A;  3TS5 C;  4AQI A;  1PRW A;  1QJT A;  1QX7 A;  2MAZ A;  1K9U A;  2Q91 A;  4ORA B;  1B1G A;  2KYF A;  2HQW A;  3WHT B;  1BF5 A;  4NQG A;  1YVH A;  4ORB B;  4GGF C;  3HX4 A;  1CB1 A;  2LV7 A;  1YTZ C;  2MLF C;  3KPX A;  4R1E A;  2COL B;  1EG4 A;  2HF5 A;  2MBX A;  4DCK A;  1FPW A;  2KBI A;  4UPG A;  1B9A A;  1CFF A;  1PUL A;  1B8L A;  1BG1 A;  2G9B A;  2JXC A;  2L51 A;  4P2Y B;  1WRK A;  2OS8 B;  2JC2 A;  3OX5 A;  1UUR A;  3DD4 A;  1XVJ A;  3O4Y A;  2L4H A;  1CMG A;  1JFK A;  1TN4 A;  4HRE E;  3CWG A;  4XJK A;  2JQ6 A;  1FBV A;  2LUX A;  2M7L A;  2K61 A;  1OSA A;  3BUW B;  3OHM B;  1YRT B;  2JT0 A;  3CZT X;  4MZL A;  5KU1 A;  1SNL A;  1YVL A;  1C07 A;  1B7T Y;  1GGZ A;  2CTN A;  1DJY A;  3GK4 X;  4OKH A;  1PAL A;  2JT3 A;  2NXQ A;  1CM1 A;  3I5F C;  4PE7 A;  4WQ3 A;  5D69 A;  5PAL A;  1YRU B;  3PLF B;  2ZND A;  1BR1 B;  5J3X A;  1H8B A;  4DS7 A;  5HKY A;  1CFP A;  4MSP A;  3TS5 B;  2KI6 C;  2KYC A;  2BE6 A;  1ZMZ A;  3VRR A;  2LNK A;  2JTT A;  2MRD A;  3DVM A;  4PCW A;  4HSZ A;  2ZRS A;  3O2P A;  1TTX A;  1SYM A;  2IS9 A;  1FW4 A;  1SCV A;  1BR4 B;  5D7F A;  3TUY C;  5GQQ C;  1NCZ A;  4WRI A;  1OE9 B;  3NSI A;  1N0Y A;  1YUR A;  1A75 B;  3SG6 A;  2JU0 A;  1A4P A;  1IG5 A;  1YUT A;  1YUU A;  1KK8 C;  5CSF A;  1K8U A;  2FCE A;  2V53 A;  1CLB A;  1CDL A;  1M63 B;  1RFJ A;  4YGE B;  2L50 A;  1W7I B;  5AXI A;  3ZNI A;  4YGD B;  4YRU A;  4PDZ A;  1QS7 A;  1QX5 B;  4ICB A;  5KSZ A;  1SPY A;  1SL8 A;  2K0J A;  1QV1 A;  1TIZ A;  3I5F B;  1UHK A;  2A4J A;  1J7P A;  3RLZ A;  4M2P A;  2LVK A;  2M1U A;  2K7D A;  4U8D A;  1DMO A;  2KFH A;  1BMO A;  3GK1 A;  4MVF A;  2KHN A;  1PSB A;  4MZK A;  4QJ4 B;  4JPZ B;  5CSI A;  1LKJ A;  1N2D A;  3NXA A;  1REC A;  2LP2 A;  1RTP 1;  1SK6 D;  3DF0 A;  3FWC A;  3LK0 A;  3O6B A;  1K90 D;  2G2B A;  4OCI A;  1M39 A;  1WRL A;  2M8U A;  1YX7 A;  1XFZ O;  1SMG A;  1Y0V H;  4GNK B;  4MEW A;  1KFU L;  1UP5 A;  2LCP A;  1Y1U A;  2LMV A;  3KEV A;  1FF1 A;  1DJG A;  3BUX B;  2GV5 A;  1AHR A;  1ODB A;  1KK8 B;  3DVK A;  1W7J B;  4N5X A;  1M31 A;  1Y1A A;  3EVU A;  4NDD A;  2F2P A;  1FI5 A;  2BE4 A;  1R2U A;  5B8I B;  1YX8 A;  2PSR A;  5IBW A;  1RWY A;  1NCX A;  4L9M A;  2JPT A;  1TNX A;  2E6W A;  4GUK A;  4OVN F;  1RK9 A;  2HQ8 A;  5AER A;  1DT7 B;  3FIA A;  1V1F A;  3O78 A;  4I5K A;  2SAS A;  1B8R A;  4PE0 A;  2E30 A;  1QAS A;  1C7W A;  1GGW A;  1K9K A;  1S1E A;  2QPT A;  5CSN A;  1IJ5 A;  1LVC D;  1G33 A;  4MN0 A;  1CMF A;  2LLT A;  1S6J A;  5JOL A;  2K2F A;  3PM8 A;  1KFX L;  1TRF A;  3BQ3 A;  2L4I A;  1RJV A;  2JRF A;  1CM4 A;  3PAT A;  1WY9 A;  2KFF A;  4YBH B;  1AP4 A;  1F4O A;  2KAX A;  4ZCU A;  2WCB A;  1V1G A;  2M0R A;  3VGO A;  2M9G A;  3LK1 A;  2JXL A;  1BU3 A;  2KQ6 A;  2M3W A;  3TDZ A;  2I2R E;  1NYA A;  2JZI A;  4AQJ A;  1S5G Z;  1ZFS A;  2WC8 A;  3LCP C;  4F0Z B;  1F8H A;  2FCD A;  2CNP A;  2NCP A;  4MLW A;  5CSJ A;  1AJ4 A;  1NWD A;  1LXF C;  3TDI A;  1UHI A;  2B1U A;  3PFV A;  1PVB A;  1XFW O;  1WRZ A;  4GPL B;  1CDM A;  1JF0 A;  3SG7 A;  1JF2 A;  2I7A A;  4YGC B;  3BUO B;  3CTN A;  1KQV A;  1WDC C;  1QX2 A;  2KNE A;  1J7Q A;  4CFQ A;  1GJY A;  1WLM A;  3JVT C;  1UHH A;  2KSP A;  4M2O A;  4NDB A;  4DRW A;  3C1V A;  1QIW A;  1EL4 A;  1DGU A;  1PSR A;  1DJH A;  1TNP A;  2AAO A;  2MA2 A;  1OZO A;  2L5X B;  3BUN B;  1U5I B;  3BUM B;  2LMU A;  1IJ6 A;  3AAK A;  3AKA A;  3KF9 A;  3PSR A;  4GAO A;  4PHN A;  3SIA A;  1L2O C;  1GQM A;  1KK7 Y;  5BPJ A;  1K94 A;  2CBL A;  2LAN A;  3VRQ A;  1NUB A;  3IQO A;  1CLL A;  2Y1N A;  3D0Y A;  5TNC A;  1QVI Z;  2M29 A;  3RM1 A;  1ALW A;  3DVJ A;  1XK4 A;  2LVJ A;  4A4C A;  3A8R A;  1SKT A;  4USL A;  5AFP A;  1A29 A;  3BOW B;  1NX2 A;  1SR6 C;  1X02 A;  5I8N A;  1S6C A;  2LUC A;  3OB1 B;  2H2K A;  3KO0 A;  1F54 A;  2MHH A;  3CR2 A;  1DTL A;  2F3Z A;  4A4B A;  3PN7 C;  2ZNE A;  3SG3 A;  3ZWH A;  2KAY A;  1TNQ A;  1QLS A;  1WDC B;  1QV0 A;  1DF0 A;  5JJG A;  3FWB A;  1MXL C;  1OMR A;  3JVT B;  1CLM A;  1NX3 A;  1UHN A;  5ER5 A;  4DUQ A;  1M46 A;  3VRP A;  3SIB A;  4GFT A;  1CNP A;  1CDP A;  1AUI B;  1S3P A;  3I5G C;  2LAP A;  1F70 A;  2CXJ A;  1XYD A;  2BCX A;  1DVI A;  4JQ0 D;  1S36 A;  2F2O A;  1MF8 B;  2BEC A;  2GGZ A;  2AMI A;  4MZJ A;  4PHJ A;  4CFR A;  1L2O B;  1DJW A;  2PAS A;  1LA0 A;  1SY9 A;  4XJK B;  1SRA A;  1Q80 A;  1XFY O;  3WHU B;  2O60 A;  1HQV A;  1CFD A;  1F4Q A;  1A03 A;  1Y1X A;  1OMV A;  2OPO A;  5HKZ A;  5HLO A;  1SBJ A;  2JNX A;  2FJU B;  1JSA A;  1QLK A;  2PVB A;  2M49 B;  1SCM C;  1BOC A;  1EJ3 A;  2K2A A;  5DKR A;  2OTG C;  1SR6 B;  2ISD A;  2Y1M A;  1B7T Z;  1DJX A;  1G8I A;  3TUY B;  1DJI A;  3F45 A;  2EC6 C;  1IH0 A;  3ICB A;  3KHE A;  4P5O E;  1S6I A;  3PN7 B;  4MRX A;  1B8C A;  5ER4 X;  1R6P A;  2H61 A;  2ZN9 A;  1J1E A;  4M2Q A;  2JWW A;  1XO5 A;  4TNC A;  1TNW A;  3EK4 A;  2KOT A;  3PAL A;  5HKW A;  2L2E A;  2KAV A;  1MXE A;  5K89 A;  1NCY A;  1TCO B;  2EGD A;  2M7N A;  5AAN A;  1ZUZ A;  1D1O A;  3LL8 B;  3I5G B;  1DJZ A;  4GBA A;  3IF7 A;  2BL0 C;  2VRG A;  4I5J A;  2H61 C;  1XFV O;  4BY5 A;  3OP0 A;  1QTX A;  1Y6W A;  1CFC A;  4HRG A;  4D1E A;  1AK8 A;  2ZFD A;  1XFX O;  1QXP A;  2BKH B;  2OS8 C;  1UHJ A;  1AVS A;  1C7V A;  3EKJ A;  5FYX A;  1NP8 A;  1SCM B;  4JWQ A;  1XA5 A;  3SJS A;  2L98 A;  4YGB B;  1EXR A;  2CT9 A;  2F33 A;  2LM5 A;  2OTG B;  4YI9 A;  2LC5 A;  1NX1 A;  3NSL A;  2EC6 B;  3QRX A;  2KI6 D;  1PK0 D;  2K7C A;  4YI8 A;  1G4Y R;  3EK8 A;  1KWO C;  4GGF A;  4CPV A;  5I2L A;  2P6B B;  2M1K B;  3DF0 B;  2GGM A;  3WXA A;  1AJ5 A;  1OQP A;  3JTD C;  1SW8 A;  3EK7 A;  2WCE A;  1A75 A;  1B4C A;  3IQQ A;  1CDN A;  2TN4 A;  1KQM C;  5G08 A;  3M0W A;  5AEQ A;  4CLN A;  3CR5 X;  1E8A A;  2F8P A;  2NZ0 A;  4OV2 A;  1OZS A;  2Y4Q A;  2BL0 B;  5DKQ A;  3D10 A;  1KFX S;  3SG4 A;  1MUX A;  4N1F A;  2D8N A;  4CID A;  1MR8 A;  3HCM A;  3SG2 A;  2ZKM X;  1WLZ A;  1DGV A;  4C0K A;  1MQ1 A;  5DKN A;  2JNF A;  3OX6 A;  2WCF A;  4PE4 A;  2L0P A;  2MLE C;  2KBM A;  2JTZ A;  3CGA A;  3E3R A;  2LLS A;  1K93 D;  3FS7 A;  4Q04 A;  2M97 A;  2KQY A;  3DVE A;  5F6T A;  4PHM A;  4ORC B;  3CR4 X;  1KWO B;  1K96 A;  1JFJ A;  3AKB A;  4YGA A;  2LVI A;  2ZRT A;  2LP3 A;  2KGB C;  2LHI A;  4FQO A;  2I94 A;  1PVA A;  2DOQ A;  3JTD B;  4MRY A;  3BYA A;  1K9P A;  5I2Q A;  1SL7 A;  3GK2 A;  1CTR A;  4HRH A;  1KSO A;  2BKI B;  1BLQ A;  1F55 A;  1K2H A;  3OB2 B;  1XK4 C;  1K95 A;  4OR9 B;  1EG3 A;  1KQM B;  1MHO A;  2NLN A;  4PHK A;  3I5I C;  4I5L B;  2BCA A;  1KSM A;  3TZ1 A;  3A4U B;  4XYN A;  3NSK A;  3WNX B;  1RRO A;  1JUO A;  1BT6 A;  2LHL A;  1BJF A; 
#chains in the Genus database with same CATH topology
 2WC6 A;  3EKH A;  3LLE A;  2AUC A;  5HYD A;  4GGN A;  1C3Z A;  1LIN A;  1IGV A;  1TOP A;  2R2I A;  1A2X A;  1IWQ A;  1YR5 A;  2KI4 C;  1SL9 A;  4E68 A;  2PRU A;  2BBM A;  1VRK A;  1FI6 A;  1TCF A;  1B47 A;  5I2O A;  3H4S E;  2Y5I A;  1J55 A;  1YUS A;  4QJ5 B;  2EHB A;  5HLV A;  1IKU A;  1T14 A;  2BCB A;  3I5H C;  2WOS A;  4N1G A;  3GOF A;  3CDN A;  4BY4 A;  1KK7 Z;  2BBN A;  4FTG A;  4AOM A;  1ZAC A;  1S5G Y;  1OOI X;  1QWV A;  2NCO A;  3D0Y B;  1ZOT B;  2K60 A;  1NIW A;  1NPQ A;  2PMY A;  2SCP A;  2K7O A;  2WOR A;  2ZN8 A;  1ALV A;  4I5N B;  4C0J A;  2WND A;  2KFG A;  4ETO A;  3FE9 A;  3EVV A;  3K21 A;  2KGR A;  3NHT A;  1OMD A;  3I5I B;  4PE1 A;  5KTY A;  3CYZ A;  4IL1 A;  2P71 A;  3VRN A;  3SG5 A;  2K8M B;  3VRO A;  3TDU A;  1JBA A;  4PT1 A;  2L2C A;  2LVV A;  1IRJ A;  1JC2 A;  2P70 A;  1IIO A;  2LE9 B;  2I18 A;  1ORG A;  1DF0 B;  3SS4 A;  1EH2 A;  2HET A;  1LA3 A;  4MBE A;  1OOJ A;  4PAL A;  2KI4 B;  1H4B A;  3BFA A;  3CLN A;  2HPS A;  2PAL A;  1IQ5 A;  4WQ2 A;  1MWN A;  2O5G A;  1F71 A;  3D77 A;  1U5I A;  1KFU S;  3MSE B;  2JOJ A;  2WCK A;  3EVR A;  2KDH A;  2JPO A;  1NSH A;  1KCY A;  1IQ3 A;  1NX0 A;  2RGI A;  2Q4U A;  1JWD A;  3CS1 A;  3D78 A;  3I5H B;  1QVI Y;  4NDC A;  2LMT A;  2F3Y A;  4DIR A;  1N65 A;  1BOD A;  2CCM A;  2FOT A;  1J1D A;  1M45 A;  2LLU A;  4C0L A;  2MJW B;  3RZS A;  3BXK A;  1UUS A;  1L7Z A;  3NGV A;  2JUL A;  1XFU O;  3S0A A;  3S0E A;  3BOW A;  1CKK A;  1J7O A;  1QAT A;  5CPV A;  1UWO A;  2K7B A;  1OOF A;  3NSO A;  1S26 D;  4QJ3 B;  4ZCV A;  2QAC A;  1J7R A;  1HT9 A;  2JT8 A;  3AAJ A;  1GM0 A;  1QIV A;  3TS5 C;  4AQI A;  1PRW A;  1QJT A;  1QX7 A;  2MAZ A;  1K9U A;  2Q91 A;  3FE6 A;  4ORA B;  1B1G A;  2KYF A;  2HQW A;  3WHT B;  1BF5 A;  4NQG A;  1YVH A;  4ORB B;  4GGF C;  3SS5 A;  3HX4 A;  1CB1 A;  2LV7 A;  1YTZ C;  2MLF C;  3KPX A;  4R1E A;  2COL B;  1EG4 A;  2HF5 A;  2MBX A;  4DCK A;  4INX A;  2KBI A;  1FPW A;  4UPG A;  1B9A A;  1CFF A;  1PUL A;  1B8L A;  1BG1 A;  2G9B A;  2JXC A;  2L51 A;  4P2Y B;  1WRK A;  2OS8 B;  2JC2 A;  3OX5 A;  1UUR A;  3DD4 A;  1XVJ A;  3NHI A;  3O4Y A;  2L4H A;  4FQT A;  1CMG A;  1JFK A;  1TN4 A;  4HRE E;  3CWG A;  2H8V A;  3CZ1 A;  4XJK A;  2JQ6 A;  1FBV A;  2LUX A;  2M7L A;  2K61 A;  1OSA A;  3BUW B;  3OHM B;  3QME A;  5FI2 A;  1YRT B;  2JT0 A;  3CZT X;  4MZL A;  5KU1 A;  1SNL A;  1YVL A;  1C07 A;  1B7T Y;  1GGZ A;  2CTN A;  1DJY A;  3GK4 X;  4OKH A;  1PAL A;  2JT3 A;  2NXQ A;  1CM1 A;  3I5F C;  4PE7 A;  4WQ3 A;  5D69 A;  5PAL A;  1P28 A;  1YRU B;  2QEB A;  3PLF B;  2ZND A;  5FI6 A;  1BR1 B;  5J3X A;  1H8B A;  3UO9 A;  4DS7 A;  5HKY A;  1CFP A;  4JD9 A;  4MSP A;  3B88 A;  3TS5 B;  2KI6 C;  2KYC A;  2BE6 A;  2YGU A;  1ZMZ A;  5HL1 A;  3VRR A;  2LNK A;  2JTT A;  2MRD A;  3DVM A;  4PCW A;  4HSZ A;  2ZRS A;  3O2P A;  1TTX A;  1SYM A;  2IS9 A;  1FW4 A;  1SCV A;  1BR4 B;  5D7F A;  3TUY C;  5GQQ C;  1NCZ A;  4WRI A;  1OE9 B;  2ERB A;  3NSI A;  1N0Y A;  1YUR A;  1A75 B;  3SG6 A;  2JU0 A;  1A4P A;  1IG5 A;  1YUT A;  1YUU A;  1KK8 C;  2QEH A;  3D75 A;  5CSF A;  1K8U A;  2FCE A;  2V53 A;  1CLB A;  1CDL A;  1M63 B;  1OW4 A;  1RFJ A;  4YGE B;  2L50 A;  1TUJ A;  1W7I B;  5AXI A;  3ZNI A;  4YGD B;  4YRU A;  4PDZ A;  1QS7 A;  1QX5 B;  4ICB A;  5KSZ A;  1SPY A;  1SL8 A;  2K0J A;  1QV1 A;  1TIZ A;  3I5F B;  1UHK A;  2A4J A;  1J7P A;  3RLZ A;  4M2P A;  2LVK A;  2M1U A;  1TUZ A;  2K7D A;  4U8D A;  1DMO A;  2KFH A;  1BMO A;  3GK1 A;  4MVF A;  2KHN A;  1PSB A;  4MZK A;  3VB1 A;  4QJ4 B;  4JPZ B;  5CSI A;  1LKJ A;  1N2D A;  3NXA A;  1REC A;  2LP2 A;  1RTP 1;  1SK6 D;  3DF0 A;  3FWC A;  3LK0 A;  3O6B A;  1K90 D;  3IVT A;  2G2B A;  4OCI A;  1M39 A;  1WRL A;  2KLD A;  2M8U A;  3DY9 A;  1YX7 A;  1XFZ O;  1SMG A;  1Y0V H;  1OOG A;  4GNK B;  4MEW A;  1KFU L;  3L4A A;  1UP5 A;  2LCP A;  1Y1U A;  2LMV A;  2PYQ A;  3BFB A;  3KEV A;  4IJ7 A;  1FF1 A;  1DJG A;  3BUX B;  2GV5 A;  1AHR A;  1OOH A;  1ODB A;  1KK8 B;  3DVK A;  1W7J B;  4N5X A;  1M31 A;  1Y1A A;  3EVU A;  4NDD A;  2F2P A;  1FI5 A;  3B87 A;  2BE4 A;  1R2U A;  5B8I B;  1YX8 A;  2PSR A;  5IBW A;  1RWY A;  1NCX A;  4L9M A;  2JPT A;  1TNX A;  2E6W A;  4GUK A;  4OVN F;  1RK9 A;  2HQ8 A;  5AER A;  1DT7 B;  3FIA A;  1V1F A;  3O78 A;  3O4X A;  4I5K A;  2SAS A;  3S0D A;  1B8R A;  4PE0 A;  2E30 A;  1QAS A;  1C7W A;  1GGW A;  1K9K A;  1S1E A;  2QPT A;  5CSN A;  1IJ5 A;  1LVC D;  1G33 A;  4MN0 A;  1CMF A;  2LLT A;  1S6J A;  3D76 A;  5JOL A;  2K2F A;  3PM8 A;  1KFX L;  3PM2 A;  1TRF A;  3BQ3 A;  2L4I A;  3CZ2 A;  1RJV A;  2JRF A;  1Z4H A;  1CM4 A;  3PAT A;  1WY9 A;  2KFF A;  4YBH B;  1AP4 A;  1F4O A;  2KAX A;  4ZCU A;  2WCB A;  1V1G A;  2M0R A;  3VGO A;  2M9G A;  3LK1 A;  1LS8 A;  2JXL A;  1BU3 A;  2KQ6 A;  2M3W A;  3TDZ A;  2I2R E;  2L5Y A;  1NYA A;  2JZI A;  4AQJ A;  1S5G Z;  1ZFS A;  2WC8 A;  3LCP C;  5DIC A;  4F0Z B;  1F8H A;  2FCD A;  2CNP A;  1DQE A;  2NCP A;  4MLW A;  5CSJ A;  4F7F A;  1AJ4 A;  1NWD A;  1LXF C;  3TDI A;  1UHI A;  2B1U A;  3CAB A;  3PFV A;  3B7A A;  1PVB A;  1XFW O;  1WRZ A;  1TWO A;  5D3O A;  4GPL B;  1CDM A;  1JF0 A;  3SG7 A;  1JF2 A;  2I7A A;  4YGC B;  3BUO B;  3CTN A;  1KQV A;  1WDC C;  1QX2 A;  2KNE A;  1J7Q A;  2BNX A;  4CFQ A;  1GJY A;  1WLM A;  3JVT C;  1UHH A;  2KSP A;  4M2O A;  4NDB A;  4DRW A;  3C1V A;  1QIW A;  1EL4 A;  1DGU A;  1PSR A;  1DJH A;  1TNP A;  2AAO A;  2MA2 A;  1OZO A;  2L5X B;  3BUN B;  1U5I B;  3BUM B;  2LMU A;  1IJ6 A;  3AAK A;  3AKA A;  3KF9 A;  3PSR A;  4GAO A;  4PHN A;  3SIA A;  1L2O C;  1GQM A;  1KK7 Y;  5BPJ A;  3OBV A;  1K94 A;  2CBL A;  2LAN A;  3VRQ A;  1NUB A;  3S0G A;  3DXL A;  3IQO A;  1CLL A;  2Y1N A;  3D0Y A;  5TNC A;  1QVI Z;  2M29 A;  3RM1 A;  1ALW A;  3DVJ A;  1XK4 A;  2LVJ A;  4A4C A;  3A8R A;  1SKT A;  4USL A;  5AFP A;  1A29 A;  2WCL A;  3BOW B;  1NX2 A;  1SR6 C;  1X02 A;  5I8N A;  1S6C A;  2LUC A;  3OB1 B;  2H2K A;  4KYN A;  3KO0 A;  2WCM A;  1F54 A;  2MHH A;  3CR2 A;  1DTL A;  2F3Z A;  4A4B A;  2WCH A;  3PN7 C;  2ZNE A;  3SG3 A;  3ZWH A;  2KAY A;  1TNQ A;  1QLS A;  1WDC B;  1QV0 A;  1DF0 A;  5JJG A;  3FWB A;  1MXL C;  1OMR A;  3JVT B;  1CLM A;  1NX3 A;  1UHN A;  5ER5 A;  4DUQ A;  1M46 A;  3VRP A;  3SIB A;  4GFT A;  1CNP A;  1CDP A;  3FE8 A;  1AUI B;  1S3P A;  3I5G C;  2LAP A;  1F70 A;  2CXJ A;  1XYD A;  2BCX A;  1DVI A;  4JQ0 D;  1S36 A;  2F2O A;  1MF8 B;  2BEC A;  2GGZ A;  2AMI A;  4MZJ A;  4PHJ A;  4CFR A;  1L2O B;  3R1V A;  1DJW A;  2PAS A;  3BFH A;  1LA0 A;  1SY9 A;  4XJK B;  1SRA A;  1Q80 A;  1XFY O;  3WHU B;  2O60 A;  1HQV A;  1CFD A;  1F4Q A;  1A03 A;  1Y1X A;  3S0B A;  1OMV A;  2OPO A;  5HKZ A;  5HLO A;  1SBJ A;  2JNX A;  1XFR A;  2FJU B;  1JSA A;  1QLK A;  2PVB A;  3DYE A;  2M49 B;  1SCM C;  1BOC A;  3L4L A;  3R1O A;  1EJ3 A;  2K2A A;  5DKR A;  3B6X A;  2OTG C;  1SR6 B;  3D74 A;  2ISD A;  2Y1M A;  1B7T Z;  3CZ0 A;  1DJX A;  1G8I A;  3TUY B;  1DJI A;  2KLE A;  3F45 A;  2EC6 C;  3R1P A;  1IH0 A;  3ICB A;  3KHE A;  4P5O E;  1S6I A;  2WC5 A;  3PN7 B;  4MRX A;  1B8C A;  5ER4 X;  1R6P A;  2H61 A;  2ZN9 A;  1J1E A;  4M2Q A;  2JWW A;  1XO5 A;  2QEO A;  3D73 A;  3EG5 B;  4JKT A;  4TNC A;  3SS3 A;  1TNW A;  3EK4 A;  2KOT A;  3PAL A;  5HKW A;  2L2E A;  2KAV A;  1MXE A;  5K89 A;  1NCY A;  3PJI A;  1TCO B;  3B86 A;  2EGD A;  2M7N A;  5AAN A;  2KPH A;  1ZUZ A;  1D1O A;  3LL8 B;  2FJY A;  3I5G B;  1DJZ A;  4GBA A;  3IF7 A;  2BL0 C;  2VRG A;  4I5J A;  2H61 C;  1XFV O;  3Q8I A;  3UNW A;  3OP0 A;  1QTX A;  1Y6W A;  4BY5 A;  1CFC A;  4HRG A;  4D1E A;  1AK8 A;  2ZFD A;  1XFX O;  1QXP A;  5EL2 A;  2BKH B;  2OS8 C;  1UHJ A;  1AVS A;  1SSE B;  3OGN A;  1C7V A;  3EKJ A;  5FYX A;  1NP8 A;  1SCM B;  4JWQ A;  1XA5 A;  3SJS A;  2L98 A;  4YGB B;  1EXR A;  2CT9 A;  2F33 A;  2LM5 A;  2OTG B;  3S0F A;  4YI9 A;  2LC5 A;  1NX1 A;  3N7H A;  3NSL A;  2EC6 B;  3QRX A;  1C3Y A;  2KI6 D;  1PK0 D;  2K7C A;  4YI8 A;  1G4Y R;  3EK8 A;  1KWO C;  4GGF A;  4CPV A;  5I2L A;  2P6B B;  2M1K B;  3DF0 B;  2GGM A;  3WXA A;  4OZD A;  1AJ5 A;  1OQP A;  3JTD C;  1SW8 A;  3K1E A;  3EK7 A;  5I94 A;  2WCE A;  3L47 A;  1A75 A;  3R72 A;  1B4C A;  2PQL A;  3IQQ A;  1CDN A;  2TN4 A;  1KQM C;  5G08 A;  2BAP A;  3M0W A;  5AEQ A;  3CR5 X;  4CLN A;  1E8A A;  2F8P A;  1Z2C B;  2NZ0 A;  1OZS A;  4OV2 A;  2Y4Q A;  2BL0 B;  5DKQ A;  1DEL A;  1KFX S;  3D10 A;  3SG4 A;  2QDI A;  1MUX A;  4N1F A;  2D8N A;  4CID A;  1MR8 A;  3HCM A;  3SG2 A;  2ZKM X;  1WLZ A;  1DGV A;  4C0K A;  1MQ1 A;  5DKN A;  2JNF A;  3V2L A;  3OX6 A;  2WCF A;  4PE4 A;  1DC1 A;  2L0P A;  2MLE C;  2KBM A;  2JTZ A;  3CGA A;  3E3R A;  2LLS A;  1K93 D;  3FS7 A;  4Q04 A;  2M97 A;  2KQY A;  3DVE A;  5F6T A;  5FI7 A;  4PHM A;  4ORC B;  2QEV A;  3CR4 X;  1KWO B;  1K96 A;  1JFJ A;  3AKB A;  4YGA A;  2LVI A;  2ZRT A;  2LP3 A;  2KGB C;  2LHI A;  4FQO A;  2GTE A;  2I94 A;  1PVA A;  2DOQ A;  3JTD B;  4MRY A;  3BYA A;  1K9P A;  5I2Q A;  1SL7 A;  3GK2 A;  1CTR A;  4HRH A;  1KSO A;  2BKI B;  1BLQ A;  1F55 A;  1K2H A;  3OB2 B;  1XK4 C;  1K95 A;  2WCJ A;  4OR9 B;  1EG3 A;  1KQM B;  1MHO A;  2NLN A;  4PHK A;  3I5I C;  4I5L B;  1W9Z A;  2BCA A;  1KSM A;  3TZ1 A;  3A4U B;  4XYN A;  3NSK A;  3WNX B;  1RRO A;  1JUO A;  1DEK A;  3BJH A;  3DZT A;  1BT6 A;  2LHL A;  4INW A;  1BJF A; 
#chains in the Genus database with same CATH homology
 3EKH A;  3LLE A;  2AUC A;  5HYD A;  4GGN A;  1LIN A;  1IGV A;  1TOP A;  2R2I A;  1A2X A;  1IWQ A;  1YR5 A;  2KI4 C;  1SL9 A;  4E68 A;  2PRU A;  2BBM A;  1VRK A;  1FI6 A;  1TCF A;  1B47 A;  5I2O A;  3H4S E;  2Y5I A;  1J55 A;  1YUS A;  4QJ5 B;  2EHB A;  5HLV A;  1IKU A;  2BCB A;  3I5H C;  2WOS A;  4N1G A;  3GOF A;  4BY4 A;  1KK7 Z;  2BBN A;  4FTG A;  4AOM A;  1ZAC A;  1S5G Y;  2NCO A;  3D0Y B;  1ZOT B;  2PMY A;  1NIW A;  1NPQ A;  2WOR A;  2SCP A;  2K7O A;  2ZN8 A;  4I5N B;  1ALV A;  4C0J A;  2WND A;  2KFG A;  4ETO A;  3EVV A;  3K21 A;  2KGR A;  1OMD A;  3I5I B;  4PE1 A;  5KTY A;  4IL1 A;  3VRN A;  3SG5 A;  2K8M B;  3VRO A;  3TDU A;  1JBA A;  2LVV A;  1IRJ A;  1JC2 A;  2LE9 B;  2I18 A;  1DF0 B;  1EH2 A;  2HET A;  1LA3 A;  4MBE A;  1OOJ A;  4PAL A;  2KI4 B;  1H4B A;  3CLN A;  2HPS A;  2PAL A;  1IQ5 A;  4WQ2 A;  1MWN A;  2O5G A;  1F71 A;  1U5I A;  1KFU S;  3MSE B;  2JOJ A;  3EVR A;  2KDH A;  1NSH A;  1KCY A;  1IQ3 A;  1NX0 A;  2RGI A;  2Q4U A;  1JWD A;  3CS1 A;  3I5H B;  4NDC A;  1QVI Y;  2LMT A;  2F3Y A;  4DIR A;  1N65 A;  1BOD A;  2CCM A;  2FOT A;  1J1D A;  1M45 A;  2LLU A;  4C0L A;  2MJW B;  3BXK A;  1UUS A;  1L7Z A;  2JUL A;  1XFU O;  3BOW A;  1CKK A;  1J7O A;  1QAT A;  5CPV A;  1UWO A;  2K7B A;  3NSO A;  1S26 D;  4QJ3 B;  4ZCV A;  2QAC A;  1J7R A;  1HT9 A;  2JT8 A;  3AAJ A;  1QIV A;  3TS5 C;  4AQI A;  1PRW A;  1QJT A;  1QX7 A;  2MAZ A;  1K9U A;  2Q91 A;  4ORA B;  1B1G A;  2KYF A;  2HQW A;  3WHT B;  1BF5 A;  4NQG A;  1YVH A;  4ORB B;  4GGF C;  3HX4 A;  1CB1 A;  2LV7 A;  1YTZ C;  2MLF C;  3KPX A;  4R1E A;  2COL B;  1EG4 A;  2HF5 A;  2MBX A;  4DCK A;  1FPW A;  2KBI A;  4UPG A;  1B9A A;  1CFF A;  1PUL A;  1B8L A;  1BG1 A;  2G9B A;  2JXC A;  2L51 A;  4P2Y B;  1WRK A;  2OS8 B;  2JC2 A;  3OX5 A;  1UUR A;  3DD4 A;  1XVJ A;  3O4Y A;  2L4H A;  1CMG A;  1JFK A;  1TN4 A;  4HRE E;  3CWG A;  4XJK A;  2JQ6 A;  1FBV A;  2LUX A;  2M7L A;  2K61 A;  1OSA A;  3BUW B;  3OHM B;  1YRT B;  2JT0 A;  3CZT X;  4MZL A;  5KU1 A;  1SNL A;  1YVL A;  1C07 A;  1B7T Y;  1GGZ A;  2CTN A;  1DJY A;  3GK4 X;  4OKH A;  1PAL A;  2JT3 A;  2NXQ A;  1CM1 A;  3I5F C;  4PE7 A;  4WQ3 A;  5D69 A;  5PAL A;  1YRU B;  3PLF B;  2ZND A;  1BR1 B;  5J3X A;  1H8B A;  4DS7 A;  5HKY A;  1CFP A;  4MSP A;  3TS5 B;  2KI6 C;  2KYC A;  2BE6 A;  1ZMZ A;  3VRR A;  2LNK A;  2JTT A;  2MRD A;  3DVM A;  4PCW A;  4HSZ A;  2ZRS A;  3O2P A;  1TTX A;  1SYM A;  2IS9 A;  1FW4 A;  1SCV A;  1BR4 B;  5D7F A;  3TUY C;  5GQQ C;  1NCZ A;  4WRI A;  1OE9 B;  3NSI A;  1N0Y A;  1YUR A;  1A75 B;  3SG6 A;  2JU0 A;  1A4P A;  1IG5 A;  1YUT A;  1YUU A;  1KK8 C;  5CSF A;  1K8U A;  2FCE A;  2V53 A;  1CLB A;  1CDL A;  1M63 B;  1RFJ A;  4YGE B;  2L50 A;  1W7I B;  5AXI A;  3ZNI A;  4YGD B;  4YRU A;  4PDZ A;  1QS7 A;  1QX5 B;  4ICB A;  5KSZ A;  1SPY A;  1SL8 A;  2K0J A;  1QV1 A;  1TIZ A;  3I5F B;  1UHK A;  2A4J A;  1J7P A;  3RLZ A;  4M2P A;  2LVK A;  2M1U A;  2K7D A;  4U8D A;  1DMO A;  2KFH A;  1BMO A;  3GK1 A;  4MVF A;  2KHN A;  1PSB A;  4MZK A;  4QJ4 B;  4JPZ B;  5CSI A;  1LKJ A;  1N2D A;  3NXA A;  1REC A;  2LP2 A;  1RTP 1;  1SK6 D;  3DF0 A;  3FWC A;  3LK0 A;  3O6B A;  1K90 D;  2G2B A;  4OCI A;  1M39 A;  1WRL A;  2M8U A;  1YX7 A;  1XFZ O;  1SMG A;  1Y0V H;  4GNK B;  4MEW A;  1KFU L;  1UP5 A;  2LCP A;  1Y1U A;  2LMV A;  3KEV A;  1FF1 A;  1DJG A;  3BUX B;  2GV5 A;  1AHR A;  1ODB A;  1KK8 B;  3DVK A;  1W7J B;  4N5X A;  1M31 A;  1Y1A A;  3EVU A;  4NDD A;  2F2P A;  1FI5 A;  2BE4 A;  1R2U A;  5B8I B;  1YX8 A;  2PSR A;  5IBW A;  1RWY A;  1NCX A;  4L9M A;  2JPT A;  1TNX A;  2E6W A;  4GUK A;  4OVN F;  1RK9 A;  2HQ8 A;  5AER A;  1DT7 B;  3FIA A;  1V1F A;  3O78 A;  4I5K A;  2SAS A;  1B8R A;  4PE0 A;  2E30 A;  1QAS A;  1C7W A;  1GGW A;  1K9K A;  1S1E A;  2QPT A;  5CSN A;  1IJ5 A;  1LVC D;  1G33 A;  4MN0 A;  1CMF A;  2LLT A;  1S6J A;  5JOL A;  2K2F A;  3PM8 A;  1KFX L;  1TRF A;  3BQ3 A;  2L4I A;  1RJV A;  2JRF A;  1CM4 A;  3PAT A;  1WY9 A;  2KFF A;  4YBH B;  1AP4 A;  1F4O A;  2KAX A;  4ZCU A;  2WCB A;  1V1G A;  2M0R A;  3VGO A;  2M9G A;  3LK1 A;  2JXL A;  1BU3 A;  2KQ6 A;  2M3W A;  3TDZ A;  2I2R E;  1NYA A;  2JZI A;  4AQJ A;  1S5G Z;  1ZFS A;  2WC8 A;  3LCP C;  4F0Z B;  1F8H A;  2FCD A;  2CNP A;  2NCP A;  4MLW A;  5CSJ A;  1AJ4 A;  1NWD A;  1LXF C;  3TDI A;  1UHI A;  2B1U A;  3PFV A;  1PVB A;  1XFW O;  1WRZ A;  4GPL B;  1CDM A;  1JF0 A;  3SG7 A;  1JF2 A;  2I7A A;  4YGC B;  3BUO B;  3CTN A;  1KQV A;  1WDC C;  1QX2 A;  2KNE A;  1J7Q A;  4CFQ A;  1GJY A;  1WLM A;  3JVT C;  1UHH A;  2KSP A;  4M2O A;  4NDB A;  4DRW A;  3C1V A;  1QIW A;  1EL4 A;  1DGU A;  1PSR A;  1DJH A;  1TNP A;  2AAO A;  2MA2 A;  1OZO A;  2L5X B;  3BUN B;  1U5I B;  3BUM B;  2LMU A;  1IJ6 A;  3AAK A;  3AKA A;  3KF9 A;  3PSR A;  4GAO A;  4PHN A;  3SIA A;  1L2O C;  1GQM A;  1KK7 Y;  5BPJ A;  1K94 A;  2CBL A;  2LAN A;  3VRQ A;  1NUB A;  3IQO A;  1CLL A;  2Y1N A;  3D0Y A;  5TNC A;  1QVI Z;  2M29 A;  3RM1 A;  1ALW A;  3DVJ A;  1XK4 A;  2LVJ A;  4A4C A;  3A8R A;  1SKT A;  4USL A;  5AFP A;  1A29 A;  3BOW B;  1NX2 A;  1SR6 C;  1X02 A;  5I8N A;  1S6C A;  2LUC A;  3OB1 B;  2H2K A;  3KO0 A;  1F54 A;  2MHH A;  3CR2 A;  1DTL A;  2F3Z A;  4A4B A;  3PN7 C;  2ZNE A;  3SG3 A;  3ZWH A;  2KAY A;  1TNQ A;  1QLS A;  1WDC B;  1QV0 A;  1DF0 A;  5JJG A;  3FWB A;  1MXL C;  1OMR A;  3JVT B;  1CLM A;  1NX3 A;  1UHN A;  5ER5 A;  4DUQ A;  1M46 A;  3VRP A;  3SIB A;  4GFT A;  1CNP A;  1CDP A;  1AUI B;  1S3P A;  3I5G C;  2LAP A;  1F70 A;  2CXJ A;  1XYD A;  2BCX A;  1DVI A;  4JQ0 D;  1S36 A;  2F2O A;  1MF8 B;  2BEC A;  2GGZ A;  2AMI A;  4MZJ A;  4PHJ A;  4CFR A;  1L2O B;  1DJW A;  2PAS A;  1LA0 A;  1SY9 A;  4XJK B;  1SRA A;  1Q80 A;  1XFY O;  3WHU B;  2O60 A;  1HQV A;  1CFD A;  1F4Q A;  1A03 A;  1Y1X A;  1OMV A;  2OPO A;  5HKZ A;  5HLO A;  1SBJ A;  2JNX A;  2FJU B;  1JSA A;  1QLK A;  2PVB A;  2M49 B;  1SCM C;  1BOC A;  1EJ3 A;  2K2A A;  5DKR A;  2OTG C;  1SR6 B;  2ISD A;  2Y1M A;  1B7T Z;  1DJX A;  1G8I A;  3TUY B;  1DJI A;  3F45 A;  2EC6 C;  1IH0 A;  3ICB A;  3KHE A;  4P5O E;  1S6I A;  3PN7 B;  4MRX A;  1B8C A;  5ER4 X;  1R6P A;  2H61 A;  2ZN9 A;  1J1E A;  4M2Q A;  2JWW A;  1XO5 A;  4TNC A;  1TNW A;  3EK4 A;  2KOT A;  3PAL A;  5HKW A;  2L2E A;  2KAV A;  1MXE A;  5K89 A;  1NCY A;  1TCO B;  2EGD A;  2M7N A;  5AAN A;  1ZUZ A;  1D1O A;  3LL8 B;  3I5G B;  1DJZ A;  4GBA A;  3IF7 A;  2BL0 C;  2VRG A;  4I5J A;  2H61 C;  1XFV O;  4BY5 A;  3OP0 A;  1QTX A;  1Y6W A;  1CFC A;  4HRG A;  4D1E A;  1AK8 A;  2ZFD A;  1XFX O;  1QXP A;  2BKH B;  2OS8 C;  1UHJ A;  1AVS A;  1C7V A;  3EKJ A;  5FYX A;  1NP8 A;  1SCM B;  4JWQ A;  1XA5 A;  3SJS A;  2L98 A;  4YGB B;  1EXR A;  2CT9 A;  2F33 A;  2LM5 A;  2OTG B;  4YI9 A;  2LC5 A;  1NX1 A;  3NSL A;  2EC6 B;  3QRX A;  2KI6 D;  1PK0 D;  2K7C A;  4YI8 A;  1G4Y R;  3EK8 A;  1KWO C;  4GGF A;  4CPV A;  5I2L A;  2P6B B;  2M1K B;  3DF0 B;  2GGM A;  3WXA A;  1AJ5 A;  1OQP A;  3JTD C;  1SW8 A;  3EK7 A;  2WCE A;  1A75 A;  1B4C A;  3IQQ A;  1CDN A;  2TN4 A;  1KQM C;  5G08 A;  3M0W A;  5AEQ A;  4CLN A;  3CR5 X;  1E8A A;  2F8P A;  2NZ0 A;  4OV2 A;  1OZS A;  2Y4Q A;  2BL0 B;  5DKQ A;  3D10 A;  1KFX S;  3SG4 A;  1MUX A;  4N1F A;  2D8N A;  4CID A;  1MR8 A;  3HCM A;  3SG2 A;  2ZKM X;  1WLZ A;  1DGV A;  4C0K A;  1MQ1 A;  5DKN A;  2JNF A;  3OX6 A;  2WCF A;  4PE4 A;  2L0P A;  2MLE C;  2KBM A;  2JTZ A;  3CGA A;  3E3R A;  2LLS A;  1K93 D;  3FS7 A;  4Q04 A;  2M97 A;  2KQY A;  3DVE A;  5F6T A;  4PHM A;  4ORC B;  3CR4 X;  1KWO B;  1K96 A;  1JFJ A;  3AKB A;  4YGA A;  2LVI A;  2ZRT A;  2LP3 A;  2KGB C;  2LHI A;  4FQO A;  2I94 A;  1PVA A;  2DOQ A;  3JTD B;  4MRY A;  3BYA A;  1K9P A;  5I2Q A;  1SL7 A;  3GK2 A;  1CTR A;  4HRH A;  1KSO A;  2BKI B;  1BLQ A;  1F55 A;  1K2H A;  3OB2 B;  1XK4 C;  1K95 A;  4OR9 B;  1EG3 A;  1KQM B;  1MHO A;  2NLN A;  4PHK A;  3I5I C;  4I5L B;  2BCA A;  1KSM A;  3TZ1 A;  3A4U B;  4XYN A;  3NSK A;  3WNX B;  1RRO A;  1JUO A;  1BT6 A;  2LHL A;  1BJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...