2SCPA

Structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
174
structure length
174
Chain Sequence
SDLWVQKMKTYFNRIDFDKDGAITRMDFESMAERFAKESEMKAEHAKVLMDSLTGVWDNFLTAVAGGKGIDETTFINSMKEMVKNPEAKSVVEGPLPLFFRAVDTNEDNNISRDEYGIFFGMLGLDKTMAPASFDAIDTNNDGLLSLEEFVIAGSDFFMNDGDSTNKVFWGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords SARCOPLASMIC CALCIUM-BINDING PROTEIN
publication title Structure of a sarcoplasmic calcium-binding protein from Nereis diversicolor refined at 2.0 A resolution.
pubmed doi rcsb
source organism Neanthes diversicolor
total genus 70
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2scpA00
3TDZA 2TN4A 2ZRTA 1B7TY 1DJIA 1PSBA 2O60A 3SG4A 3VROA 1SBJA 1WY9A 1TNQA 5HKWA 1DGUA 2JC2A 3LK1A 2GV5A 3WNXB 2KAXA 1NX0A 2GGZA 1JSAA 2L0PA 2LLSA 1UWOA 4M2OA 4CFQA 1CDNA 2JT0A 1QASA 2MJWB 5BPJA 2KFFA 1CB1A 1IWQA 2WC8A 2O5GA 3AKBA 2MRDA 1S5GZ 1OZOA 1BLQA 3NSIA 1D1OA 1ODBA 3A8RA 3O4YA 1S6JA 2ZN9A 1A29A 1X02A 4NQGA 2I2RE 2BL0C 4M2PA 1Y1UA 5ER5A 4GGFA 1F70A 1XVJA 4YGBB 4A4CA 1CMGA 1SR6C 2WCEA 3CR2A 5HKYA 3AAJA 3PSRA 2KGRA 3BYAA 3MSEB 1IG5A 5CSFA 3I5GC 1DMOA 2LM5A 2KBIA 3EVRA 1BT6A 2RGIA 1KK8B 1KQMB 1TNPA 1M39A 2F2OA 1LA0A 5D69A 2DOQA 3TUYC 1QS7A 1QLKA 2K0JA 1SCMB 3CR5X 1C7WA 1IRJA 2M1KB 1J1DA 1GGZA 1QVIZ 4PDZA 4PCWA 2ZRSA 1B8LA 1XFYO 3IQOA 1GGWA 2IS9A 3IF7A 4YGCB 4XJKB 4PHNA 3I5FB 1CDPA 2Y5IA 1NSHA 1S1EA 5CPVA 2K61A 2OTGB 4NDCA 2GGMA 2PMYA 4P5OE 2JU0A 1J1EA 1DJXA 1KWOC 2LVJA 3H4SE 1J7OA 4L9MA 2MLEC 3NSOA 1YTZC 1B1GA 1Y1AA 2BE4A 2ZFDA 1CFDA 3SIAA 1XA5A 3CR4X 1UURA 1UHHA 2F3YA 1CFCA 2PVBA 2K7CA 3PLFB 5CSJA 1EL4A 1MR8A 1F55A 2K2FA 1WLZA 1GJYA 1LINA 2MA2A 4P2YB 1MWNA 3KHEA 2MBXA 1A03A 1B4CA 4WQ2A 1B8CA 1L2OB 2D8NA 5HLOA 2EC6B 1CDLA 1BR4B 4N5XA 1WDCB 1CFPA 4IL1A 3BUMB 4YGDB 5CSNA 1QATA 3OB1B 1NYAA 2I18A 3QRXA 5F6TA 1IH0A 2KI4C 1IQ3A 2JZIA 2H61A 3PN7C 2G9BA 4FTGA 3WHTB 1YRTB 4OKHA 1DTLA 1KK8C 1KQMC 1N2DA 2JQ6A 4ETOA 1MUXA 4ORCB 4R1EA 2MAZA 2Q91A 1HT9A 3DF0A 1MHOA 2LLUA 2LV7A 4MSPA 5I8NA 3GOFA 4GBAA 1FW4A 5I2QA 5AXIA 1U5IA 4YRUA 1UP5A 2F8PA 3I5FC 2MLFC 1SPYA 1ZMZA 2K8MB 3DVKA 2OTGC 2FOTA 2F3ZA 1QVIY 1S26D 1F4QA 5DKNA 1CMFA 5K89A 2JT8A 2M7LA 2JXLA 3DVMA 1J7RA 3O6BA 4ORAB 2LHIA 1DVIA 3I5HC 3EVUA 1ZACA 2BBNA 1CM4A 5PALA 2HQ8A 1K90D 1L7ZA 2K2AA 2LNKA 2MHHA 1CFFA 4BY4A 3JVTB 2KYFA 3CZTX 4A4BA 4PHMA 1UHKA 1W7IB 1B8RA 4PHKA 1FI6A 1PALA 2WORA 1K95A 2LC5A 4GAOA 1WRKA 1K94A 4GUKA 4GPLB 1SK6D 1DJWA 4MRYA 1TIZA 1Y6WA 1E8AA 2L50A 1OZSA 3LCPC 4TNCA 3VRRA 4CPVA 1DGVA 1BOCA 4YI9A 1AUIB 5G08A 3PFVA 3BUWB 1YX8A 1NCZA 3ZWHA 1AP4A 3BUNB 2QPTA 3KF9A 5DKRA 4DCKA 1SNLA 1KSOA 2M7NA 1N0YA 1CNPA 1V1FA 2F2PA 4PALA 1K2HA 1EG3A 1S3PA 2JT3A 4UPGA 3TDIA 1EJ3A 2I7AA 4CFRA 4Q04A 3VRPA 2CTNA 1V1GA 5B8IB 1M46A 3O78A 1Y0VH 2M49B 1K93D 3D0YA 1EH2A 1SL7A 1OOJA 3BQ3A 3EK8A 3I5IB 1ZUZA 2LUXA 3PATA 4ICBA 4MLWA 1BODA 1JWDA 1TOPA 4U8DA 4MEWA 4DUQA 5AERA 4AOMA 4XYNA 3KO0A 2CNPA 1OQPA 2NXQA 5HYDA 4HRGA 3C1VA 1C07A 1Q80A 4QJ5B 2KYCA 3BXKA 1YURA 2KI6D 4GGNA 3CGAA 1ALWA 2FCEA 1UUSA 4N1FA 1YUTA 2LHLA 3DF0B 5I2LA 2ZN8A 3SG5A 2Y1NA 2KQYA 1B47A 4MBEA 1SL8A 2LMUA 2M3WA 4NDBA 3KPXA 2H2KA 3BOWB 4D1EA 1UHNA 1QX5B 2M9GA 1M45A 4QJ4B 1C7VA 3GK2A 1NIWA 3AKAA 4ORBB 1J7QA 2LP3A 1KFUS 3RLZA 1NCXA 2L2EA 5AANA 2LP2A 1OMRA 3E3RA 4QJ3B 3ZNIA 2BBMA 5ER4X 2NZ0A 4YBHB 1NX3A 3SIBA 2KI6C 4I5KA 2LVIA 1LA3A 2R2IA 3SG6A 1CDMA 1VRKA 1DJHA 1YUUA 1XK4C 2KNEA 1YVLA 2KAVA 3M0WA 1NCYA 1LXFC 2NCOA 2B1UA 1XO5A 3OHMB 1R6PA 4M2QA 4AQJA 4MZKA 5KSZA 1A4PA 1RROA 3ICBA 2LMTA 1F8HA 1A75A 1QIVA 2LAPA 4PE1A 3TZ1A 3I5IC 1YUSA 1K9UA 1F4OA 1SCMC 2P6BB 3EKJA 1QV0A 3KEVA 1RTP1 1YRUB 1TRFA 2L51A 1CLLA 2KDHA 4WRIA 1IKUA 2EHBA 2L4HA 1IJ6A 4AQIA 4PHJA 1BMOA 2BL0B 4N1GA 2KAYA 2BKHB 3BUXB 3LK0A 3OX6A 3PALA 1NPQA 1FPWA 3RM1A 3BUOB 2HETA 1S6IA 4WQ3A 1KFUL 3CS1A 1BF5A 2K7OA 2NLNA 2V53A 3I5GB 1KCYA 5J3XA 1RJVA 2E30A 2AUCA 2JOJA 4DRWA 1NP8A 1BG1A 2FCDA 1WRLA 1PVBA 1WRZA 1UHIA 2JTTA 1QIWA 3D0YB 1AJ5A 1SKTA 4MRXA 1MXEA 1K96A 1QX2A 4JQ0D 3IQQA 3TUYB 3WHUB 4ZCUA 4PE4A 1QJTA 2F33A 4YGAA 1SL9A 1H4BA 2PSRA 4I5NB 3HX4A 5AEQA 1W7JB 1TCOB 1LKJA 3VGOA 1L2OC 2EC6C 1PVAA 1BR1B 1TCFA 1WDCC 2JNFA 2ZKMX 4PE0A 2JTZA 1G4YR 1AJ4A 5GQQC 2I94A 1S36A 3DVEA 2KBMA 1AK8A 1NUBA 4MZLA 4I5LB 2M1UA 4I5JA 1JC2A 3CLNA 1JF0A 1KWOB 1HQVA 5DKQA 3OP0A 4MZJA 2OS8B 2CBLA 1KK7Y 2KQ6A 3AAKA 1OSAA 3K21A 1DF0A 4USLA 5FYXA 2E6WA 3SG7A 3HCMA 5TNCA 4OV2A 2PALA 1TNWA 3TS5B 1FBVA 1IGVA 2AMIA 4HREE 2K7DA 4C0JA 1J7PA 3SG3A 1ZFSA 2EGDA 3JTDB 1J55A 1Y1XA 2JNXA 1M63B 1AHRA 2VRGA 2ZNEA 5KTYA 1KFXS 1M31A 2LVKA 1TN4A 1DJGA 4FQOA 4GGFC 2KFHA 4OR9B 1XFXO 2G2BA 1OMVA 2JXCA 4MN0A 3SJSA 2KI4B 3CWGA 3WXAA 2WCBA 2LLTA 2ZNDA 3PN7B 1K8UA 3NSKA 1RFJA 3VRQA 3EKHA 1JUOA 2L98A 1GQMA 1R2UA 1QTXA 2Y1MA 4C0LA 1EG4A 4DIRA 1CLBA 1BU3A 3A4UB 2WCFA 1JF2A 1A75B 3LL8B 3JVTC 1XFVO 4GNKB 2L4IA 4C0KA 3D10A 2Q4UA 3GK1A 3CTNA 5CSIA 5HKZA 2HQWA 3FS7A 1PSRA 3OX5A 2SASA 2CXJA 2LMVA 1CLMA 1U5IB 1SMGA 2A4JA 3FIAA 2Y4QA 3TDUA 2SCPA 1RECA 1SY9A 1RK9A 3GK4X 4YGEB 1F71A 2CT9A 1H8BA 1CM1A 2JRFA 1DJZA 2BKIB 1SRAA 1WLMA 1MF8B 2KSPA 2JPTA 1MQ1A 1XFUO 4JPZB 3VRNA 5IBWA 1FF1A 4HSZA 1FI5A 1QXPA 2HPSA 1B7TZ 2LUCA 2M97A 4YI8A 2M29A 1KK7Z 1ZOTB 2OS8C 1KFXL 1XYDA 3O2PA 2LE9B 1YVHA 1QV1A 3I5HB 2M0RA 2KOTA 4OVNF 2PRUA 1TTXA 2CCMA 1MXLC 3EVVA 1PULA 1XK4A 3DD4A 3TS5C 4CIDA 1NX1A 1B9AA 1S6CA 3JTDC 2WOSA 1SCVA 1EXRA 2BCAA 2JULA 1QLSA 1NWDA 3EK7A 2LVVA 1BJFA 1PK0D 2BECA 5JOLA 3LLEA 2COLB 1N65A 1CTRA 2HF5A 2KHNA 4GFTA 3FWCA 2LANA 1S5GY 1K9PA 3DVJA 4XJKA 5JJGA 2M8UA 2H61C 2KFGA 2PASA 5D7FA 4PE7A 4BY5A 1OE9B 1IJ5A 2BCBA 2NCPA 1XFWO 1SR6B 2K7BA 1YR5A 1DF0B 1G8IA 1QX7A 3EK4A 4MVFA 4CLNA 1SW8A 2FJUB 2L5XB 1JFJA 1TNXA 1JFKA 2LCPA 1A2XA 1IQ5A 2KGBC 4JWQA 5HLVA 1CKKA 4F0ZB 2WNDA 1G33A 1DT7B 1YX7A 3PM8A 1KQVA 1XFZO 3BOWA 3NSLA 3NXAA 1F54A 1KSMA 4ZCVA 4NDDA 2BE6A 2BCXA 4DS7A 2JWWA 2OPOA 3FWBA 1DJYA 2QACA 1UHJA 1JBAA 4HRHA 4OCIA 1PRWA 1AVSA 3OB2B 5KU1A 2ISDA 2AAOA 3SG2A 5AFPA 5I2OA 1OMDA 1NX2A 1ALVA 1RWYA 1LVCD 1K9KA 1SYMA 3F45A 4E68A
chains in the Genus database with same CATH superfamily
3IVTA 3TDZA 2TN4A 2ZRTA 1B7TY 1DJIA 1PSBA 2O60A 3SG4A 3VROA 1SBJA 3R1PA 1WY9A 1TNQA 5HKWA 1DGUA 2JC2A 3LK1A 2GV5A 3WNXB 2KAXA 1NX0A 2GGZA 1JSAA 2L0PA 2LLSA 1UWOA 4M2OA 4JD9A 4CFQA 3S0AA 1CDNA 2JT0A 3DYEA 1QASA 2MJWB 3CZ1A 2KFFA 5BPJA 1CB1A 1IWQA 2WC8A 2O5GA 3AKBA 2MRDA 1S5GZ 1OZOA 1BLQA 3NSIA 1D1OA 1ODBA 3A8RA 3O4YA 1S6JA 2ZN9A 1A29A 1X02A 4NQGA 2I2RE 2BL0C 4M2PA 1Y1UA 5ER5A 4GGFA 2WC6A 1F70A 3BJHA 1XVJA 4YGBB 4A4CA 1CMGA 1SR6C 3SS5A 2WCEA 3CR2A 5HKYA 3AAJA 3PSRA 2KGRA 3BYAA 3MSEB 1IG5A 5CSFA 3I5GC 1DMOA 2LM5A 2KBIA 3EVRA 1BT6A 2RGIA 1KK8B 1KQMB 1TNPA 3B6XA 3EG5B 3QMEA 1M39A 1Z4HA 3L4AA 2F2OA 2K60A 1LA0A 5D69A 2DOQA 3TUYC 1QS7A 1QLKA 2K0JA 1SCMB 3CR5X 1C7WA 2PYQA 1IRJA 2M1KB 1J1DA 1GGZA 1QVIZ 4PDZA 2YGUA 2BAPA 4PCWA 2ZRSA 1B8LA 1XFYO 3IQOA 2PQLA 2IS9A 3IF7A 4YGCB 1GGWA 4XJKB 4PHNA 3D77A 3I5FB 3NGVA 1CDPA 2Y5IA 1NSHA 3B86A 1S1EA 4INWA 5EL2A 5CPVA 3DZTA 2K61A 2OTGB 4NDCA 2GGMA 2PMYA 4P5OE 2JU0A 1J1EA 1C3YA 1DJXA 1KWOC 2LVJA 3H4SE 3N7HA 1J7OA 4L9MA 2MLEC 3NSOA 1YTZC 1B1GA 1DQEA 1Y1AA 2BE4A 2ZFDA 1CFDA 3SIAA 1XA5A 3CR4X 1UURA 1UHHA 2F3YA 3B87A 4IJ7A 1CFCA 2PVBA 3SS3A 2K7CA 3PLFB 5CSJA 1EL4A 1MR8A 3RZSA 2K2FA 1F55A 1WLZA 1GJYA 1LINA 2MA2A 4P2YB 1MWNA 3KHEA 2MBXA 1A03A 1H8BA 1B4CA 4WQ2A 3NHTA 1B8CA 1L2OB 2D8NA 5HLOA 2EC6B 1CDLA 1BR4B 4N5XA 1WDCB 1CFPA 4IL1A 3BUMB 4YGDB 5CSNA 1QATA 3SS4A 3OB1B 1NYAA 2I18A 3QRXA 5F6TA 1IH0A 2KI4C 2WCLA 3S0DA 1IQ3A 2JZIA 2H61A 3PN7C 2G9BA 4FTGA 3VB1A 3WHTB 1OOGA 1YRTB 4OKHA 1DTLA 1KK8C 1KQMC 1N2DA 2JQ6A 4ETOA 1MUXA 4ORCB 4R1EA 2MAZA 2Q91A 3K1EA 1HT9A 3DF0A 1MHOA 2LLUA 2LV7A 4MSPA 5I8NA 3GOFA 4GBAA 1FW4A 5I2QA 5AXIA 1U5IA 3CABA 1UP5A 4YRUA 2F8PA 3I5FC 2MLFC 1SPYA 1W9ZA 1ZMZA 3V2LA 2K8MB 3DVKA 2OTGC 1DEKA 2F3ZA 2FOTA 1QVIY 1S26D 1F4QA 5DKNA 1CMFA 5K89A 2JT8A 2M7LA 2JXLA 3DVMA 1J7RA 3O6BA 4ORAB 2LHIA 1DVIA 3I5HC 3EVUA 1ZACA 2BBNA 1CM4A 4FQTA 2HQ8A 1K90D 1L7ZA 2K2AA 2LNKA 5PALA 2MHHA 1CFFA 2WCKA 4BY4A 3JVTB 2KYFA 3CZTX 4A4BA 4PHMA 1UHKA 1W7IB 1B8RA 4PHKA 1FI6A 1C3ZA 1PALA 2WORA 1K95A 2LC5A 4GAOA 1WRKA 1K94A 4GUKA 4GPLB 1SK6D 1DJWA 4MRYA 1TIZA 1Y6WA 1E8AA 2L50A 1OZSA 3LCPC 4TNCA 3VRRA 4CPVA 1DGVA 1BOCA 4YI9A 1AUIB 5G08A 3PFVA 3BUWB 3FE6A 1P28A 1YX8A 1NCZA 3ZWHA 1AP4A 3BUNB 2QPTA 3KF9A 5DKRA 2WCMA 4DCKA 1SNLA 2L5YA 4INXA 1KSOA 2M7NA 1N0YA 1CNPA 1V1FA 2F2PA 4PALA 1K2HA 1EG3A 1S3PA 2JT3A 4UPGA 3OBVA 3TDIA 1EJ3A 2I7AA 4PT1A 4CFRA 4Q04A 1SSEB 3VRPA 2CTNA 1V1GA 5B8IB 1M46A 3O78A 1Y0VH 2M49B 1K93D 3D0YA 1EH2A 1SL7A 1OOJA 3BQ3A 3EK8A 3I5IB 1ZUZA 2LUXA 3PATA 4ICBA 4MLWA 1BODA 1JWDA 1TOPA 4U8DA 4MEWA 3NHIA 4DUQA 2JPOA 5AERA 3PJIA 4AOMA 4XYNA 3KO0A 2CNPA 1OQPA 2NXQA 5HYDA 4HRGA 3C1VA 1C07A 1Q80A 4QJ5B 2KYCA 3BXKA 1YURA 2KI6D 4GGNA 3CGAA 1ALWA 2FCEA 1UUSA 4N1FA 1YUTA 2LHLA 3DF0B 5I2LA 2ZN8A 3SG5A 2Y1NA 2KQYA 1B47A 4MBEA 1SL8A 2LMUA 2M3WA 4NDBA 3KPXA 2H2KA 3BOWB 4D1EA 1UHNA 1QX5B 2M9GA 1M45A 4QJ4B 1C7VA 1OOHA 3GK2A 1NIWA 3AKAA 3D73A 4ORBB 1J7QA 2LP3A 1KFUS 1IIOA 3O4XA 3RLZA 1NCXA 2L2EA 5FI6A 2LP2A 5AANA 1OMRA 3E3RA 4QJ3B 3ZNIA 2BBMA 1Z2CB 5HL1A 2QEVA 5ER4X 2L2CA 2NZ0A 4YBHB 1NX3A 2H8VA 3SIBA 3UNWA 2FJYA 2KI6C 4I5KA 1OOFA 2LVIA 1LA3A 2R2IA 3SG6A 1CDMA 1VRKA 1DJHA 1YUUA 2WC5A 1XK4C 2KNEA 1YVLA 2KAVA 3M0WA 1NCYA 3S0GA 1LXFC 2NCOA 2B1UA 1XO5A 3OHMB 1R6PA 4M2QA 4AQJA 4MZKA 5KSZA 1DELA 1A4PA 1RROA 2ERBA 1TUZA 3ICBA 2LMTA 1F8HA 3B88A 1A75A 1QIVA 2LAPA 4PE1A 3TZ1A 3I5IC 1YUSA 1K9UA 1F4OA 1SCMC 2P6BB 3CYZA 3EKJA 3DXLA 1QV0A 3KEVA 2P70A 1RTP1 1YRUB 1TRFA 2L51A 1CLLA 2KDHA 4WRIA 1IKUA 2EHBA 2L4HA 1IJ6A 4AQIA 4PHJA 1BMOA 2BL0B 4N1GA 2KAYA 2BKHB 3BUXB 3LK0A 3OX6A 3PALA 1NPQA 1FPWA 3RM1A 1ORGA 3BUOB 2HETA 1S6IA 1OW4A 4WQ3A 1KFUL 1DC1A 3CS1A 1BF5A 2K7OA 2NLNA 2V53A 3I5GB 1KCYA 5J3XA 1RJVA 2E30A 2AUCA 2JOJA 5DICA 4DRWA 1NP8A 1BG1A 2FCDA 1TWOA 1WRLA 1PVBA 2KPHA 1WRZA 1UHIA 2JTTA 1QIWA 3D0YB 1AJ5A 1SKTA 4MRXA 3D74A 1MXEA 1K96A 1OOIX 1QX2A 3FE9A 3IQQA 4JQ0D 1TUJA 4ZCUA 3TUYB 3WHUB 4PE4A 1QJTA 2F33A 4YGAA 1SL9A 1H4BA 2PSRA 4I5NB 3HX4A 5AEQA 1W7JB 3DY9A 1TCOB 1LKJA 3VGOA 1L2OC 3S0EA 2EC6C 1PVAA 1BR1B 1TCFA 1WDCC 2JNFA 2ZKMX 4PE0A 2JTZA 1G4YR 1AJ4A 5GQQC 2I94A 1S36A 3DVEA 3S0FA 2KBMA 1AK8A 1NUBA 1T14A 4MZLA 4I5LB 2M1UA 4I5JA 1JC2A 3CLNA 3R72A 1JF0A 1KWOB 1HQVA 5DKQA 3FE8A 3OP0A 4MZJA 2OS8B 2CBLA 1KK7Y 2KQ6A 3AAKA 1OSAA 3BFAA 3K21A 1DF0A 4USLA 5FYXA 2E6WA 3SG7A 3HCMA 5TNCA 4OV2A 2PALA 2QDIA 4OZDA 1TNWA 3TS5B 1FBVA 1IGVA 2AMIA 4HREE 2K7DA 4C0JA 1J7PA 3SG3A 1ZFSA 2EGDA 3JTDB 1J55A 1Y1XA 2JNXA 1M63B 1AHRA 2VRGA 2BNXA 2ZNEA 1KFXS 1M31A 5KTYA 2LVKA 1TN4A 3CZ0A 1DJGA 2WCJA 3D75A 4FQOA 4GGFC 2KFHA 1QWVA 4OR9B 1XFXO 2G2BA 1OMVA 2JXCA 4MN0A 3SJSA 2KI4B 3CWGA 3WXAA 1XFRA 2WCBA 2LLTA 2ZNDA 2GTEA 3PN7B 1K8UA 2QEOA 1RFJA 3NSKA 3VRQA 3Q8IA 3EKHA 1JUOA 2L98A 1GQMA 1R2UA 1QTXA 2Y1MA 3D78A 5D3OA 1EG4A 4C0LA 4DIRA 1CLBA 1BU3A 3A4UB 2WCFA 1JF2A 1A75B 3LL8B 3JVTC 1XFVO 2QEBA 4GNKB 2L4IA 4C0KA 3D10A 2Q4UA 3D76A 3GK1A 3CTNA 5I94A 5CSIA 5HKZA 2HQWA 3FS7A 3R1VA 1PSRA 3OX5A 2SASA 2CXJA 2LMVA 1CLMA 1U5IB 1SMGA 2A4JA 3FIAA 2Y4QA 3TDUA 2SCPA 1RECA 1SY9A 1RK9A 3GK4X 3L47A 4YGEB 2CT9A 4F7FA 1F71A 1CM1A 2JRFA 1DJZA 1WLMA 1SRAA 2BKIB 1MF8B 2KSPA 2JPTA 1MQ1A 1XFUO 4JPZB 3VRNA 5IBWA 1FF1A 4HSZA 1FI5A 1QXPA 2HPSA 1B7TZ 2LUCA 2M97A 4YI8A 2M29A 1KK7Z 3BFBA 1ZOTB 2OS8C 1KFXL 1XYDA 3O2PA 2LE9B 2P71A 1YVHA 1QV1A 3I5HB 3OGNA 2M0RA 2KOTA 4OVNF 2PRUA 1LS8A 1TTXA 2CCMA 3B7AA 1MXLC 3EVVA 1PULA 1XK4A 3DD4A 3TS5C 4CIDA 1NX1A 1B9AA 1S6CA 3JTDC 2WOSA 5FI2A 1SCVA 2KLEA 2QEHA 1EXRA 2BCAA 2JULA 1QLSA 2WCHA 3R1OA 4JKTA 1NWDA 3EK7A 2LVVA 1BJFA 1PK0D 2BECA 5JOLA 3LLEA 2COLB 1N65A 1CTRA 2HF5A 2KHNA 4GFTA 3FWCA 2LANA 3CZ2A 1S5GY 1K9PA 3DVJA 4XJKA 5JJGA 2M8UA 2H61C 2KFGA 2PASA 2KLDA 5D7FA 4PE7A 4BY5A 1OE9B 1IJ5A 3L4LA 2BCBA 2NCPA 1XFWO 1SR6B 2K7BA 1YR5A 1DF0B 1G8IA 1QX7A 3EK4A 4MVFA 5FI7A 4CLNA 1SW8A 2FJUB 2L5XB 1JFJA 1TNXA 1JFKA 2LCPA 1A2XA 1IQ5A 2KGBC 4JWQA 5HLVA 1CKKA 4F0ZB 2WNDA 1G33A 4KYNA 1DT7B 1YX7A 3PM8A 1KQVA 1XFZO 3BOWA 3NSLA 3NXAA 3PM2A 1F54A 1KSMA 4ZCVA 4NDDA 2BE6A 2BCXA 4DS7A 3BFHA 1GM0A 2JWWA 2OPOA 3S0BA 3FWBA 1DJYA 2QACA 1UHJA 1JBAA 4HRHA 4OCIA 3UO9A 1PRWA 1AVSA 3OB2B 5KU1A 2ISDA 2AAOA 3CDNA 3SG2A 5AFPA 5I2OA 1OMDA 1NX2A 1ALVA 1RWYA 1LVCD 1K9KA 1SYMA 3F45A 4E68A
chains in the Genus database with same CATH topology
3TDZA 2TN4A 2ZRTA 1B7TY 1DJIA 1PSBA 2O60A 3SG4A 3VROA 1SBJA 1WY9A 1TNQA 5HKWA 1DGUA 2JC2A 3LK1A 2GV5A 3WNXB 2KAXA 1NX0A 2GGZA 1JSAA 2L0PA 2LLSA 1UWOA 4M2OA 4CFQA 1CDNA 2JT0A 1QASA 2MJWB 5BPJA 2KFFA 1CB1A 1IWQA 2WC8A 2O5GA 3AKBA 2MRDA 1S5GZ 1OZOA 1BLQA 3NSIA 1D1OA 1ODBA 3A8RA 3O4YA 1S6JA 2ZN9A 1A29A 1X02A 4NQGA 2I2RE 2BL0C 4M2PA 1Y1UA 5ER5A 4GGFA 1F70A 1XVJA 4YGBB 4A4CA 1CMGA 1SR6C 2WCEA 3CR2A 5HKYA 3AAJA 3PSRA 2KGRA 3BYAA 3MSEB 1IG5A 5CSFA 3I5GC 1DMOA 2LM5A 2KBIA 3EVRA 1BT6A 2RGIA 1KK8B 1KQMB 1TNPA 1M39A 2F2OA 1LA0A 5D69A 2DOQA 3TUYC 1QS7A 1QLKA 2K0JA 1SCMB 3CR5X 1C7WA 1IRJA 2M1KB 1J1DA 1GGZA 1QVIZ 4PDZA 4PCWA 2ZRSA 1B8LA 1XFYO 3IQOA 1GGWA 2IS9A 3IF7A 4YGCB 4XJKB 4PHNA 3I5FB 1CDPA 2Y5IA 1NSHA 1S1EA 5CPVA 2K61A 2OTGB 4NDCA 2GGMA 2PMYA 4P5OE 2JU0A 1J1EA 1DJXA 1KWOC 2LVJA 3H4SE 1J7OA 4L9MA 2MLEC 3NSOA 1YTZC 1B1GA 1Y1AA 2BE4A 2ZFDA 1CFDA 3SIAA 1XA5A 3CR4X 1UURA 1UHHA 2F3YA 1CFCA 2PVBA 2K7CA 3PLFB 5CSJA 1EL4A 1MR8A 1F55A 2K2FA 1WLZA 1GJYA 1LINA 2MA2A 4P2YB 1MWNA 3KHEA 2MBXA 1A03A 1B4CA 4WQ2A 1B8CA 1L2OB 2D8NA 5HLOA 2EC6B 1CDLA 1BR4B 4N5XA 1WDCB 1CFPA 4IL1A 3BUMB 4YGDB 5CSNA 1QATA 3OB1B 1NYAA 2I18A 3QRXA 5F6TA 1IH0A 2KI4C 1IQ3A 2JZIA 2H61A 3PN7C 2G9BA 4FTGA 3WHTB 1YRTB 4OKHA 1DTLA 1KK8C 1KQMC 1N2DA 2JQ6A 4ETOA 1MUXA 4ORCB 4R1EA 2MAZA 2Q91A 1HT9A 3DF0A 1MHOA 2LLUA 2LV7A 4MSPA 5I8NA 3GOFA 4GBAA 1FW4A 5I2QA 5AXIA 1U5IA 4YRUA 1UP5A 2F8PA 3I5FC 2MLFC 1SPYA 1ZMZA 2K8MB 3DVKA 2OTGC 2FOTA 2F3ZA 1QVIY 1S26D 1F4QA 5DKNA 1CMFA 5K89A 2JT8A 2M7LA 2JXLA 3DVMA 1J7RA 3O6BA 4ORAB 2LHIA 1DVIA 3I5HC 3EVUA 1ZACA 2BBNA 1CM4A 5PALA 2HQ8A 1K90D 1L7ZA 2K2AA 2LNKA 2MHHA 1CFFA 4BY4A 3JVTB 2KYFA 3CZTX 4A4BA 4PHMA 1UHKA 1W7IB 1B8RA 4PHKA 1FI6A 1PALA 2WORA 1K95A 2LC5A 4GAOA 1WRKA 1K94A 4GUKA 4GPLB 1SK6D 1DJWA 4MRYA 1TIZA 1Y6WA 1E8AA 2L50A 1OZSA 3LCPC 4TNCA 3VRRA 4CPVA 1DGVA 1BOCA 4YI9A 1AUIB 5G08A 3PFVA 3BUWB 1YX8A 1NCZA 3ZWHA 1AP4A 3BUNB 2QPTA 3KF9A 5DKRA 4DCKA 1SNLA 1KSOA 2M7NA 1N0YA 1CNPA 1V1FA 2F2PA 4PALA 1K2HA 1EG3A 1S3PA 2JT3A 4UPGA 3TDIA 1EJ3A 2I7AA 4CFRA 4Q04A 3VRPA 2CTNA 1V1GA 5B8IB 1M46A 3O78A 1Y0VH 2M49B 1K93D 3D0YA 1EH2A 1SL7A 1OOJA 3BQ3A 3EK8A 3I5IB 1ZUZA 2LUXA 3PATA 4ICBA 4MLWA 1BODA 1JWDA 1TOPA 4U8DA 4MEWA 4DUQA 5AERA 4AOMA 4XYNA 3KO0A 2CNPA 1OQPA 2NXQA 5HYDA 4HRGA 3C1VA 1C07A 1Q80A 4QJ5B 2KYCA 3BXKA 1YURA 2KI6D 4GGNA 3CGAA 1ALWA 2FCEA 1UUSA 4N1FA 1YUTA 2LHLA 3DF0B 5I2LA 2ZN8A 3SG5A 2Y1NA 2KQYA 1B47A 4MBEA 1SL8A 2LMUA 2M3WA 4NDBA 3KPXA 2H2KA 3BOWB 4D1EA 1UHNA 1QX5B 2M9GA 1M45A 4QJ4B 1C7VA 3GK2A 1NIWA 3AKAA 4ORBB 1J7QA 2LP3A 1KFUS 3RLZA 1NCXA 2L2EA 5AANA 2LP2A 1OMRA 3E3RA 4QJ3B 3ZNIA 2BBMA 5ER4X 2NZ0A 4YBHB 1NX3A 3SIBA 2KI6C 4I5KA 2LVIA 1LA3A 2R2IA 3SG6A 1CDMA 1VRKA 1DJHA 1YUUA 1XK4C 2KNEA 1YVLA 2KAVA 3M0WA 1NCYA 1LXFC 2NCOA 2B1UA 1XO5A 3OHMB 1R6PA 4M2QA 4AQJA 4MZKA 5KSZA 1A4PA 1RROA 3ICBA 2LMTA 1F8HA 1A75A 1QIVA 2LAPA 4PE1A 3TZ1A 3I5IC 1YUSA 1K9UA 1F4OA 1SCMC 2P6BB 3EKJA 1QV0A 3KEVA 1RTP1 1YRUB 1TRFA 2L51A 1CLLA 2KDHA 4WRIA 1IKUA 2EHBA 2L4HA 1IJ6A 4AQIA 4PHJA 1BMOA 2BL0B 4N1GA 2KAYA 2BKHB 3BUXB 3LK0A 3OX6A 3PALA 1NPQA 1FPWA 3RM1A 3BUOB 2HETA 1S6IA 4WQ3A 1KFUL 3CS1A 1BF5A 2K7OA 2NLNA 2V53A 3I5GB 1KCYA 5J3XA 1RJVA 2E30A 2AUCA 2JOJA 4DRWA 1NP8A 1BG1A 2FCDA 1WRLA 1PVBA 1WRZA 1UHIA 2JTTA 1QIWA 3D0YB 1AJ5A 1SKTA 4MRXA 1MXEA 1K96A 1QX2A 4JQ0D 3IQQA 3TUYB 3WHUB 4ZCUA 4PE4A 1QJTA 2F33A 4YGAA 1SL9A 1H4BA 2PSRA 4I5NB 3HX4A 5AEQA 1W7JB 1TCOB 1LKJA 3VGOA 1L2OC 2EC6C 1PVAA 1BR1B 1TCFA 1WDCC 2JNFA 2ZKMX 4PE0A 2JTZA 1G4YR 1AJ4A 5GQQC 2I94A 1S36A 3DVEA 2KBMA 1AK8A 1NUBA 4MZLA 4I5LB 2M1UA 4I5JA 1JC2A 3CLNA 1JF0A 1KWOB 1HQVA 5DKQA 3OP0A 4MZJA 2OS8B 2CBLA 1KK7Y 2KQ6A 3AAKA 1OSAA 3K21A 1DF0A 4USLA 5FYXA 2E6WA 3SG7A 3HCMA 5TNCA 4OV2A 2PALA 1TNWA 3TS5B 1FBVA 1IGVA 2AMIA 4HREE 2K7DA 4C0JA 1J7PA 3SG3A 1ZFSA 2EGDA 3JTDB 1J55A 1Y1XA 2JNXA 1M63B 1AHRA 2VRGA 2ZNEA 5KTYA 1KFXS 1M31A 2LVKA 1TN4A 1DJGA 4FQOA 4GGFC 2KFHA 4OR9B 1XFXO 2G2BA 1OMVA 2JXCA 4MN0A 3SJSA 2KI4B 3CWGA 3WXAA 2WCBA 2LLTA 2ZNDA 3PN7B 1K8UA 3NSKA 1RFJA 3VRQA 3EKHA 1JUOA 2L98A 1GQMA 1R2UA 1QTXA 2Y1MA 4C0LA 1EG4A 4DIRA 1CLBA 1BU3A 3A4UB 2WCFA 1JF2A 1A75B 3LL8B 3JVTC 1XFVO 4GNKB 2L4IA 4C0KA 3D10A 2Q4UA 3GK1A 3CTNA 5CSIA 5HKZA 2HQWA 3FS7A 1PSRA 3OX5A 2SASA 2CXJA 2LMVA 1CLMA 1U5IB 1SMGA 2A4JA 3FIAA 2Y4QA 3TDUA 2SCPA 1RECA 1SY9A 1RK9A 3GK4X 4YGEB 1F71A 2CT9A 1H8BA 1CM1A 2JRFA 1DJZA 2BKIB 1SRAA 1WLMA 1MF8B 2KSPA 2JPTA 1MQ1A 1XFUO 4JPZB 3VRNA 5IBWA 1FF1A 4HSZA 1FI5A 1QXPA 2HPSA 1B7TZ 2LUCA 2M97A 4YI8A 2M29A 1KK7Z 1ZOTB 2OS8C 1KFXL 1XYDA 3O2PA 2LE9B 1YVHA 1QV1A 3I5HB 2M0RA 2KOTA 4OVNF 2PRUA 1TTXA 2CCMA 1MXLC 3EVVA 1PULA 1XK4A 3DD4A 3TS5C 4CIDA 1NX1A 1B9AA 1S6CA 3JTDC 2WOSA 1SCVA 1EXRA 2BCAA 2JULA 1QLSA 1NWDA 3EK7A 2LVVA 1BJFA 1PK0D 2BECA 5JOLA 3LLEA 2COLB 1N65A 1CTRA 2HF5A 2KHNA 4GFTA 3FWCA 2LANA 1S5GY 1K9PA 3DVJA 4XJKA 5JJGA 2M8UA 2H61C 2KFGA 2PASA 5D7FA 4PE7A 4BY5A 1OE9B 1IJ5A 2BCBA 2NCPA 1XFWO 1SR6B 2K7BA 1YR5A 1DF0B 1G8IA 1QX7A 3EK4A 4MVFA 4CLNA 1SW8A 2FJUB 2L5XB 1JFJA 1TNXA 1JFKA 2LCPA 1A2XA 1IQ5A 2KGBC 4JWQA 5HLVA 1CKKA 4F0ZB 2WNDA 1G33A 1DT7B 1YX7A 3PM8A 1KQVA 1XFZO 3BOWA 3NSLA 3NXAA 1F54A 1KSMA 4ZCVA 4NDDA 2BE6A 2BCXA 4DS7A 2JWWA 2OPOA 3FWBA 1DJYA 2QACA 1UHJA 1JBAA 4HRHA 4OCIA 1PRWA 1AVSA 3OB2B 5KU1A 2ISDA 2AAOA 3SG2A 5AFPA 5I2OA 1OMDA 1NX2A 1ALVA 1RWYA 1LVCD 1K9KA 1SYMA 3F45A 4E68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDZ A;  2TN4 A;  2ZRT A;  1B7T Y;  1DJI A;  1PSB A;  2O60 A;  3SG4 A;  3VRO A;  1SBJ A;  1WY9 A;  1TNQ A;  5HKW A;  1DGU A;  2JC2 A;  3LK1 A;  2GV5 A;  3WNX B;  2KAX A;  1NX0 A;  2GGZ A;  1JSA A;  2L0P A;  2LLS A;  1UWO A;  4M2O A;  4CFQ A;  1CDN A;  2JT0 A;  1QAS A;  2MJW B;  5BPJ A;  2KFF A;  1CB1 A;  1IWQ A;  2WC8 A;  2O5G A;  3AKB A;  2MRD A;  1S5G Z;  1OZO A;  1BLQ A;  3NSI A;  1D1O A;  1ODB A;  3A8R A;  3O4Y A;  1S6J A;  2ZN9 A;  1A29 A;  1X02 A;  4NQG A;  2I2R E;  2BL0 C;  4M2P A;  1Y1U A;  5ER5 A;  4GGF A;  1F70 A;  1XVJ A;  4YGB B;  4A4C A;  1CMG A;  1SR6 C;  2WCE A;  3CR2 A;  5HKY A;  3AAJ A;  3PSR A;  2KGR A;  3BYA A;  3MSE B;  1IG5 A;  5CSF A;  3I5G C;  1DMO A;  2LM5 A;  2KBI A;  3EVR A;  1BT6 A;  2RGI A;  1KK8 B;  1KQM B;  1TNP A;  1M39 A;  2F2O A;  1LA0 A;  5D69 A;  2DOQ A;  3TUY C;  1QS7 A;  1QLK A;  2K0J A;  1SCM B;  3CR5 X;  1C7W A;  1IRJ A;  2M1K B;  1J1D A;  1GGZ A;  1QVI Z;  4PDZ A;  4PCW A;  2ZRS A;  1B8L A;  1XFY O;  3IQO A;  1GGW A;  2IS9 A;  3IF7 A;  4YGC B;  4XJK B;  4PHN A;  3I5F B;  1CDP A;  2Y5I A;  1NSH A;  1S1E A;  5CPV A;  2K61 A;  2OTG B;  4NDC A;  2GGM A;  2PMY A;  4P5O E;  2JU0 A;  1J1E A;  1DJX A;  1KWO C;  2LVJ A;  3H4S E;  1J7O A;  4L9M A;  2MLE C;  3NSO A;  1YTZ C;  1B1G A;  1Y1A A;  2BE4 A;  2ZFD A;  1CFD A;  3SIA A;  1XA5 A;  3CR4 X;  1UUR A;  1UHH A;  2F3Y A;  1CFC A;  2PVB A;  2K7C A;  3PLF B;  5CSJ A;  1EL4 A;  1MR8 A;  1F55 A;  2K2F A;  1WLZ A;  1GJY A;  1LIN A;  2MA2 A;  4P2Y B;  1MWN A;  3KHE A;  2MBX A;  1A03 A;  1B4C A;  4WQ2 A;  1B8C A;  1L2O B;  2D8N A;  5HLO A;  2EC6 B;  1CDL A;  1BR4 B;  4N5X A;  1WDC B;  1CFP A;  4IL1 A;  3BUM B;  4YGD B;  5CSN A;  1QAT A;  3OB1 B;  1NYA A;  2I18 A;  3QRX A;  5F6T A;  1IH0 A;  2KI4 C;  1IQ3 A;  2JZI A;  2H61 A;  3PN7 C;  2G9B A;  4FTG A;  3WHT B;  1YRT B;  4OKH A;  1DTL A;  1KK8 C;  1KQM C;  1N2D A;  2JQ6 A;  4ETO A;  1MUX A;  4ORC B;  4R1E A;  2MAZ A;  2Q91 A;  1HT9 A;  3DF0 A;  1MHO A;  2LLU A;  2LV7 A;  4MSP A;  5I8N A;  3GOF A;  4GBA A;  1FW4 A;  5I2Q A;  5AXI A;  1U5I A;  4YRU A;  1UP5 A;  2F8P A;  3I5F C;  2MLF C;  1SPY A;  1ZMZ A;  2K8M B;  3DVK A;  2OTG C;  2FOT A;  2F3Z A;  1QVI Y;  1S26 D;  1F4Q A;  5DKN A;  1CMF A;  5K89 A;  2JT8 A;  2M7L A;  2JXL A;  3DVM A;  1J7R A;  3O6B A;  4ORA B;  2LHI A;  1DVI A;  3I5H C;  3EVU A;  1ZAC A;  2BBN A;  1CM4 A;  5PAL A;  2HQ8 A;  1K90 D;  1L7Z A;  2K2A A;  2LNK A;  2MHH A;  1CFF A;  4BY4 A;  3JVT B;  2KYF A;  3CZT X;  4A4B A;  4PHM A;  1UHK A;  1W7I B;  1B8R A;  4PHK A;  1FI6 A;  1PAL A;  2WOR A;  1K95 A;  2LC5 A;  4GAO A;  1WRK A;  1K94 A;  4GUK A;  4GPL B;  1SK6 D;  1DJW A;  4MRY A;  1TIZ A;  1Y6W A;  1E8A A;  2L50 A;  1OZS A;  3LCP C;  4TNC A;  3VRR A;  4CPV A;  1DGV A;  1BOC A;  4YI9 A;  1AUI B;  5G08 A;  3PFV A;  3BUW B;  1YX8 A;  1NCZ A;  3ZWH A;  1AP4 A;  3BUN B;  2QPT A;  3KF9 A;  5DKR A;  4DCK A;  1SNL A;  1KSO A;  2M7N A;  1N0Y A;  1CNP A;  1V1F A;  2F2P A;  4PAL A;  1K2H A;  1EG3 A;  1S3P A;  2JT3 A;  4UPG A;  3TDI A;  1EJ3 A;  2I7A A;  4CFR A;  4Q04 A;  3VRP A;  2CTN A;  1V1G A;  5B8I B;  1M46 A;  3O78 A;  1Y0V H;  2M49 B;  1K93 D;  3D0Y A;  1EH2 A;  1SL7 A;  1OOJ A;  3BQ3 A;  3EK8 A;  3I5I B;  1ZUZ A;  2LUX A;  3PAT A;  4ICB A;  4MLW A;  1BOD A;  1JWD A;  1TOP A;  4U8D A;  4MEW A;  4DUQ A;  5AER A;  4AOM A;  4XYN A;  3KO0 A;  2CNP A;  1OQP A;  2NXQ A;  5HYD A;  4HRG A;  3C1V A;  1C07 A;  1Q80 A;  4QJ5 B;  2KYC A;  3BXK A;  1YUR A;  2KI6 D;  4GGN A;  3CGA A;  1ALW A;  2FCE A;  1UUS A;  4N1F A;  1YUT A;  2LHL A;  3DF0 B;  5I2L A;  2ZN8 A;  3SG5 A;  2Y1N A;  2KQY A;  1B47 A;  4MBE A;  1SL8 A;  2LMU A;  2M3W A;  4NDB A;  3KPX A;  2H2K A;  3BOW B;  4D1E A;  1UHN A;  1QX5 B;  2M9G A;  1M45 A;  4QJ4 B;  1C7V A;  3GK2 A;  1NIW A;  3AKA A;  4ORB B;  1J7Q A;  2LP3 A;  1KFU S;  3RLZ A;  1NCX A;  2L2E A;  5AAN A;  2LP2 A;  1OMR A;  3E3R A;  4QJ3 B;  3ZNI A;  2BBM A;  5ER4 X;  2NZ0 A;  4YBH B;  1NX3 A;  3SIB A;  2KI6 C;  4I5K A;  2LVI A;  1LA3 A;  2R2I A;  3SG6 A;  1CDM A;  1VRK A;  1DJH A;  1YUU A;  1XK4 C;  2KNE A;  1YVL A;  2KAV A;  3M0W A;  1NCY A;  1LXF C;  2NCO A;  2B1U A;  1XO5 A;  3OHM B;  1R6P A;  4M2Q A;  4AQJ A;  4MZK A;  5KSZ A;  1A4P A;  1RRO A;  3ICB A;  2LMT A;  1F8H A;  1A75 A;  1QIV A;  2LAP A;  4PE1 A;  3TZ1 A;  3I5I C;  1YUS A;  1K9U A;  1F4O A;  1SCM C;  2P6B B;  3EKJ A;  1QV0 A;  3KEV A;  1RTP 1;  1YRU B;  1TRF A;  2L51 A;  1CLL A;  2KDH A;  4WRI A;  1IKU A;  2EHB A;  2L4H A;  1IJ6 A;  4AQI A;  4PHJ A;  1BMO A;  2BL0 B;  4N1G A;  2KAY A;  2BKH B;  3BUX B;  3LK0 A;  3OX6 A;  3PAL A;  1NPQ A;  1FPW A;  3RM1 A;  3BUO B;  2HET A;  1S6I A;  4WQ3 A;  1KFU L;  3CS1 A;  1BF5 A;  2K7O A;  2NLN A;  2V53 A;  3I5G B;  1KCY A;  5J3X A;  1RJV A;  2E30 A;  2AUC A;  2JOJ A;  4DRW A;  1NP8 A;  1BG1 A;  2FCD A;  1WRL A;  1PVB A;  1WRZ A;  1UHI A;  2JTT A;  1QIW A;  3D0Y B;  1AJ5 A;  1SKT A;  4MRX A;  1MXE A;  1K96 A;  1QX2 A;  4JQ0 D;  3IQQ A;  3TUY B;  3WHU B;  4ZCU A;  4PE4 A;  1QJT A;  2F33 A;  4YGA A;  1SL9 A;  1H4B A;  2PSR A;  4I5N B;  3HX4 A;  5AEQ A;  1W7J B;  1TCO B;  1LKJ A;  3VGO A;  1L2O C;  2EC6 C;  1PVA A;  1BR1 B;  1TCF A;  1WDC C;  2JNF A;  2ZKM X;  4PE0 A;  2JTZ A;  1G4Y R;  1AJ4 A;  5GQQ C;  2I94 A;  1S36 A;  3DVE A;  2KBM A;  1AK8 A;  1NUB A;  4MZL A;  4I5L B;  2M1U A;  4I5J A;  1JC2 A;  3CLN A;  1JF0 A;  1KWO B;  1HQV A;  5DKQ A;  3OP0 A;  4MZJ A;  2OS8 B;  2CBL A;  1KK7 Y;  2KQ6 A;  3AAK A;  1OSA A;  3K21 A;  1DF0 A;  4USL A;  5FYX A;  2E6W A;  3SG7 A;  3HCM A;  5TNC A;  4OV2 A;  2PAL A;  1TNW A;  3TS5 B;  1FBV A;  1IGV A;  2AMI A;  4HRE E;  2K7D A;  4C0J A;  1J7P A;  3SG3 A;  1ZFS A;  2EGD A;  3JTD B;  1J55 A;  1Y1X A;  2JNX A;  1M63 B;  1AHR A;  2VRG A;  2ZNE A;  5KTY A;  1KFX S;  1M31 A;  2LVK A;  1TN4 A;  1DJG A;  4FQO A;  4GGF C;  2KFH A;  4OR9 B;  1XFX O;  2G2B A;  1OMV A;  2JXC A;  4MN0 A;  3SJS A;  2KI4 B;  3CWG A;  3WXA A;  2WCB A;  2LLT A;  2ZND A;  3PN7 B;  1K8U A;  3NSK A;  1RFJ A;  3VRQ A;  3EKH A;  1JUO A;  2L98 A;  1GQM A;  1R2U A;  1QTX A;  2Y1M A;  4C0L A;  1EG4 A;  4DIR A;  1CLB A;  1BU3 A;  3A4U B;  2WCF A;  1JF2 A;  1A75 B;  3LL8 B;  3JVT C;  1XFV O;  4GNK B;  2L4I A;  4C0K A;  3D10 A;  2Q4U A;  3GK1 A;  3CTN A;  5CSI A;  5HKZ A;  2HQW A;  3FS7 A;  1PSR A;  3OX5 A;  2SAS A;  2CXJ A;  2LMV A;  1CLM A;  1U5I B;  1SMG A;  2A4J A;  3FIA A;  2Y4Q A;  3TDU A;  2SCP A;  1REC A;  1SY9 A;  1RK9 A;  3GK4 X;  4YGE B;  1F71 A;  2CT9 A;  1H8B A;  1CM1 A;  2JRF A;  1DJZ A;  2BKI B;  1SRA A;  1WLM A;  1MF8 B;  2KSP A;  2JPT A;  1MQ1 A;  1XFU O;  4JPZ B;  3VRN A;  5IBW A;  1FF1 A;  4HSZ A;  1FI5 A;  1QXP A;  2HPS A;  1B7T Z;  2LUC A;  2M97 A;  4YI8 A;  2M29 A;  1KK7 Z;  1ZOT B;  2OS8 C;  1KFX L;  1XYD A;  3O2P A;  2LE9 B;  1YVH A;  1QV1 A;  3I5H B;  2M0R A;  2KOT A;  4OVN F;  2PRU A;  1TTX A;  2CCM A;  1MXL C;  3EVV A;  1PUL A;  1XK4 A;  3DD4 A;  3TS5 C;  4CID A;  1NX1 A;  1B9A A;  1S6C A;  3JTD C;  2WOS A;  1SCV A;  1EXR A;  2BCA A;  2JUL A;  1QLS A;  1NWD A;  3EK7 A;  2LVV A;  1BJF A;  1PK0 D;  2BEC A;  5JOL A;  3LLE A;  2COL B;  1N65 A;  1CTR A;  2HF5 A;  2KHN A;  4GFT A;  3FWC A;  2LAN A;  1S5G Y;  1K9P A;  3DVJ A;  4XJK A;  5JJG A;  2M8U A;  2H61 C;  2KFG A;  2PAS A;  5D7F A;  4PE7 A;  4BY5 A;  1OE9 B;  1IJ5 A;  2BCB A;  2NCP A;  1XFW O;  1SR6 B;  2K7B A;  1YR5 A;  1DF0 B;  1G8I A;  1QX7 A;  3EK4 A;  4MVF A;  4CLN A;  1SW8 A;  2FJU B;  2L5X B;  1JFJ A;  1TNX A;  1JFK A;  2LCP A;  1A2X A;  1IQ5 A;  2KGB C;  4JWQ A;  5HLV A;  1CKK A;  4F0Z B;  2WND A;  1G33 A;  1DT7 B;  1YX7 A;  3PM8 A;  1KQV A;  1XFZ O;  3BOW A;  3NSL A;  3NXA A;  1F54 A;  1KSM A;  4ZCV A;  4NDD A;  2BE6 A;  2BCX A;  4DS7 A;  2JWW A;  2OPO A;  3FWB A;  1DJY A;  2QAC A;  1UHJ A;  1JBA A;  4HRH A;  4OCI A;  1PRW A;  1AVS A;  3OB2 B;  5KU1 A;  2ISD A;  2AAO A;  3SG2 A;  5AFP A;  5I2O A;  1OMD A;  1NX2 A;  1ALV A;  1RWY A;  1LVC D;  1K9K A;  1SYM A;  3F45 A;  4E68 A; 
#chains in the Genus database with same CATH topology
 3IVT A;  3TDZ A;  2TN4 A;  2ZRT A;  1B7T Y;  1DJI A;  1PSB A;  2O60 A;  3SG4 A;  3VRO A;  1SBJ A;  3R1P A;  1WY9 A;  1TNQ A;  5HKW A;  1DGU A;  2JC2 A;  3LK1 A;  2GV5 A;  3WNX B;  2KAX A;  1NX0 A;  2GGZ A;  1JSA A;  2L0P A;  2LLS A;  1UWO A;  4M2O A;  4JD9 A;  4CFQ A;  3S0A A;  1CDN A;  2JT0 A;  3DYE A;  1QAS A;  2MJW B;  3CZ1 A;  2KFF A;  5BPJ A;  1CB1 A;  1IWQ A;  2WC8 A;  2O5G A;  3AKB A;  2MRD A;  1S5G Z;  1OZO A;  1BLQ A;  3NSI A;  1D1O A;  1ODB A;  3A8R A;  3O4Y A;  1S6J A;  2ZN9 A;  1A29 A;  1X02 A;  4NQG A;  2I2R E;  2BL0 C;  4M2P A;  1Y1U A;  5ER5 A;  4GGF A;  2WC6 A;  1F70 A;  3BJH A;  1XVJ A;  4YGB B;  4A4C A;  1CMG A;  1SR6 C;  3SS5 A;  2WCE A;  3CR2 A;  5HKY A;  3AAJ A;  3PSR A;  2KGR A;  3BYA A;  3MSE B;  1IG5 A;  5CSF A;  3I5G C;  1DMO A;  2LM5 A;  2KBI A;  3EVR A;  1BT6 A;  2RGI A;  1KK8 B;  1KQM B;  1TNP A;  3B6X A;  3EG5 B;  3QME A;  1M39 A;  1Z4H A;  3L4A A;  2F2O A;  2K60 A;  1LA0 A;  5D69 A;  2DOQ A;  3TUY C;  1QS7 A;  1QLK A;  2K0J A;  1SCM B;  3CR5 X;  1C7W A;  2PYQ A;  1IRJ A;  2M1K B;  1J1D A;  1GGZ A;  1QVI Z;  4PDZ A;  2YGU A;  2BAP A;  4PCW A;  2ZRS A;  1B8L A;  1XFY O;  3IQO A;  2PQL A;  2IS9 A;  3IF7 A;  4YGC B;  1GGW A;  4XJK B;  4PHN A;  3D77 A;  3I5F B;  3NGV A;  1CDP A;  2Y5I A;  1NSH A;  3B86 A;  1S1E A;  4INW A;  5EL2 A;  5CPV A;  3DZT A;  2K61 A;  2OTG B;  4NDC A;  2GGM A;  2PMY A;  4P5O E;  2JU0 A;  1J1E A;  1C3Y A;  1DJX A;  1KWO C;  2LVJ A;  3H4S E;  3N7H A;  1J7O A;  4L9M A;  2MLE C;  3NSO A;  1YTZ C;  1B1G A;  1DQE A;  1Y1A A;  2BE4 A;  2ZFD A;  1CFD A;  3SIA A;  1XA5 A;  3CR4 X;  1UUR A;  1UHH A;  2F3Y A;  3B87 A;  4IJ7 A;  1CFC A;  2PVB A;  3SS3 A;  2K7C A;  3PLF B;  5CSJ A;  1EL4 A;  1MR8 A;  3RZS A;  2K2F A;  1F55 A;  1WLZ A;  1GJY A;  1LIN A;  2MA2 A;  4P2Y B;  1MWN A;  3KHE A;  2MBX A;  1A03 A;  1H8B A;  1B4C A;  4WQ2 A;  3NHT A;  1B8C A;  1L2O B;  2D8N A;  5HLO A;  2EC6 B;  1CDL A;  1BR4 B;  4N5X A;  1WDC B;  1CFP A;  4IL1 A;  3BUM B;  4YGD B;  5CSN A;  1QAT A;  3SS4 A;  3OB1 B;  1NYA A;  2I18 A;  3QRX A;  5F6T A;  1IH0 A;  2KI4 C;  2WCL A;  3S0D A;  1IQ3 A;  2JZI A;  2H61 A;  3PN7 C;  2G9B A;  4FTG A;  3VB1 A;  3WHT B;  1OOG A;  1YRT B;  4OKH A;  1DTL A;  1KK8 C;  1KQM C;  1N2D A;  2JQ6 A;  4ETO A;  1MUX A;  4ORC B;  4R1E A;  2MAZ A;  2Q91 A;  3K1E A;  1HT9 A;  3DF0 A;  1MHO A;  2LLU A;  2LV7 A;  4MSP A;  5I8N A;  3GOF A;  4GBA A;  1FW4 A;  5I2Q A;  5AXI A;  1U5I A;  3CAB A;  1UP5 A;  4YRU A;  2F8P A;  3I5F C;  2MLF C;  1SPY A;  1W9Z A;  1ZMZ A;  3V2L A;  2K8M B;  3DVK A;  2OTG C;  1DEK A;  2F3Z A;  2FOT A;  1QVI Y;  1S26 D;  1F4Q A;  5DKN A;  1CMF A;  5K89 A;  2JT8 A;  2M7L A;  2JXL A;  3DVM A;  1J7R A;  3O6B A;  4ORA B;  2LHI A;  1DVI A;  3I5H C;  3EVU A;  1ZAC A;  2BBN A;  1CM4 A;  4FQT A;  2HQ8 A;  1K90 D;  1L7Z A;  2K2A A;  2LNK A;  5PAL A;  2MHH A;  1CFF A;  2WCK A;  4BY4 A;  3JVT B;  2KYF A;  3CZT X;  4A4B A;  4PHM A;  1UHK A;  1W7I B;  1B8R A;  4PHK A;  1FI6 A;  1C3Z A;  1PAL A;  2WOR A;  1K95 A;  2LC5 A;  4GAO A;  1WRK A;  1K94 A;  4GUK A;  4GPL B;  1SK6 D;  1DJW A;  4MRY A;  1TIZ A;  1Y6W A;  1E8A A;  2L50 A;  1OZS A;  3LCP C;  4TNC A;  3VRR A;  4CPV A;  1DGV A;  1BOC A;  4YI9 A;  1AUI B;  5G08 A;  3PFV A;  3BUW B;  3FE6 A;  1P28 A;  1YX8 A;  1NCZ A;  3ZWH A;  1AP4 A;  3BUN B;  2QPT A;  3KF9 A;  5DKR A;  2WCM A;  4DCK A;  1SNL A;  2L5Y A;  4INX A;  1KSO A;  2M7N A;  1N0Y A;  1CNP A;  1V1F A;  2F2P A;  4PAL A;  1K2H A;  1EG3 A;  1S3P A;  2JT3 A;  4UPG A;  3OBV A;  3TDI A;  1EJ3 A;  2I7A A;  4PT1 A;  4CFR A;  4Q04 A;  1SSE B;  3VRP A;  2CTN A;  1V1G A;  5B8I B;  1M46 A;  3O78 A;  1Y0V H;  2M49 B;  1K93 D;  3D0Y A;  1EH2 A;  1SL7 A;  1OOJ A;  3BQ3 A;  3EK8 A;  3I5I B;  1ZUZ A;  2LUX A;  3PAT A;  4ICB A;  4MLW A;  1BOD A;  1JWD A;  1TOP A;  4U8D A;  4MEW A;  3NHI A;  4DUQ A;  2JPO A;  5AER A;  3PJI A;  4AOM A;  4XYN A;  3KO0 A;  2CNP A;  1OQP A;  2NXQ A;  5HYD A;  4HRG A;  3C1V A;  1C07 A;  1Q80 A;  4QJ5 B;  2KYC A;  3BXK A;  1YUR A;  2KI6 D;  4GGN A;  3CGA A;  1ALW A;  2FCE A;  1UUS A;  4N1F A;  1YUT A;  2LHL A;  3DF0 B;  5I2L A;  2ZN8 A;  3SG5 A;  2Y1N A;  2KQY A;  1B47 A;  4MBE A;  1SL8 A;  2LMU A;  2M3W A;  4NDB A;  3KPX A;  2H2K A;  3BOW B;  4D1E A;  1UHN A;  1QX5 B;  2M9G A;  1M45 A;  4QJ4 B;  1C7V A;  1OOH A;  3GK2 A;  1NIW A;  3AKA A;  3D73 A;  4ORB B;  1J7Q A;  2LP3 A;  1KFU S;  1IIO A;  3O4X A;  3RLZ A;  1NCX A;  2L2E A;  5FI6 A;  2LP2 A;  5AAN A;  1OMR A;  3E3R A;  4QJ3 B;  3ZNI A;  2BBM A;  1Z2C B;  5HL1 A;  2QEV A;  5ER4 X;  2L2C A;  2NZ0 A;  4YBH B;  1NX3 A;  2H8V A;  3SIB A;  3UNW A;  2FJY A;  2KI6 C;  4I5K A;  1OOF A;  2LVI A;  1LA3 A;  2R2I A;  3SG6 A;  1CDM A;  1VRK A;  1DJH A;  1YUU A;  2WC5 A;  1XK4 C;  2KNE A;  1YVL A;  2KAV A;  3M0W A;  1NCY A;  3S0G A;  1LXF C;  2NCO A;  2B1U A;  1XO5 A;  3OHM B;  1R6P A;  4M2Q A;  4AQJ A;  4MZK A;  5KSZ A;  1DEL A;  1A4P A;  1RRO A;  2ERB A;  1TUZ A;  3ICB A;  2LMT A;  1F8H A;  3B88 A;  1A75 A;  1QIV A;  2LAP A;  4PE1 A;  3TZ1 A;  3I5I C;  1YUS A;  1K9U A;  1F4O A;  1SCM C;  2P6B B;  3CYZ A;  3EKJ A;  3DXL A;  1QV0 A;  3KEV A;  2P70 A;  1RTP 1;  1YRU B;  1TRF A;  2L51 A;  1CLL A;  2KDH A;  4WRI A;  1IKU A;  2EHB A;  2L4H A;  1IJ6 A;  4AQI A;  4PHJ A;  1BMO A;  2BL0 B;  4N1G A;  2KAY A;  2BKH B;  3BUX B;  3LK0 A;  3OX6 A;  3PAL A;  1NPQ A;  1FPW A;  3RM1 A;  1ORG A;  3BUO B;  2HET A;  1S6I A;  1OW4 A;  4WQ3 A;  1KFU L;  1DC1 A;  3CS1 A;  1BF5 A;  2K7O A;  2NLN A;  2V53 A;  3I5G B;  1KCY A;  5J3X A;  1RJV A;  2E30 A;  2AUC A;  2JOJ A;  5DIC A;  4DRW A;  1NP8 A;  1BG1 A;  2FCD A;  1TWO A;  1WRL A;  1PVB A;  2KPH A;  1WRZ A;  1UHI A;  2JTT A;  1QIW A;  3D0Y B;  1AJ5 A;  1SKT A;  4MRX A;  3D74 A;  1MXE A;  1K96 A;  1OOI X;  1QX2 A;  3FE9 A;  3IQQ A;  4JQ0 D;  1TUJ A;  4ZCU A;  3TUY B;  3WHU B;  4PE4 A;  1QJT A;  2F33 A;  4YGA A;  1SL9 A;  1H4B A;  2PSR A;  4I5N B;  3HX4 A;  5AEQ A;  1W7J B;  3DY9 A;  1TCO B;  1LKJ A;  3VGO A;  1L2O C;  3S0E A;  2EC6 C;  1PVA A;  1BR1 B;  1TCF A;  1WDC C;  2JNF A;  2ZKM X;  4PE0 A;  2JTZ A;  1G4Y R;  1AJ4 A;  5GQQ C;  2I94 A;  1S36 A;  3DVE A;  3S0F A;  2KBM A;  1AK8 A;  1NUB A;  1T14 A;  4MZL A;  4I5L B;  2M1U A;  4I5J A;  1JC2 A;  3CLN A;  3R72 A;  1JF0 A;  1KWO B;  1HQV A;  5DKQ A;  3FE8 A;  3OP0 A;  4MZJ A;  2OS8 B;  2CBL A;  1KK7 Y;  2KQ6 A;  3AAK A;  1OSA A;  3BFA A;  3K21 A;  1DF0 A;  4USL A;  5FYX A;  2E6W A;  3SG7 A;  3HCM A;  5TNC A;  4OV2 A;  2PAL A;  2QDI A;  4OZD A;  1TNW A;  3TS5 B;  1FBV A;  1IGV A;  2AMI A;  4HRE E;  2K7D A;  4C0J A;  1J7P A;  3SG3 A;  1ZFS A;  2EGD A;  3JTD B;  1J55 A;  1Y1X A;  2JNX A;  1M63 B;  1AHR A;  2VRG A;  2BNX A;  2ZNE A;  1KFX S;  1M31 A;  5KTY A;  2LVK A;  1TN4 A;  3CZ0 A;  1DJG A;  2WCJ A;  3D75 A;  4FQO A;  4GGF C;  2KFH A;  1QWV A;  4OR9 B;  1XFX O;  2G2B A;  1OMV A;  2JXC A;  4MN0 A;  3SJS A;  2KI4 B;  3CWG A;  3WXA A;  1XFR A;  2WCB A;  2LLT A;  2ZND A;  2GTE A;  3PN7 B;  1K8U A;  2QEO A;  1RFJ A;  3NSK A;  3VRQ A;  3Q8I A;  3EKH A;  1JUO A;  2L98 A;  1GQM A;  1R2U A;  1QTX A;  2Y1M A;  3D78 A;  5D3O A;  1EG4 A;  4C0L A;  4DIR A;  1CLB A;  1BU3 A;  3A4U B;  2WCF A;  1JF2 A;  1A75 B;  3LL8 B;  3JVT C;  1XFV O;  2QEB A;  4GNK B;  2L4I A;  4C0K A;  3D10 A;  2Q4U A;  3D76 A;  3GK1 A;  3CTN A;  5I94 A;  5CSI A;  5HKZ A;  2HQW A;  3FS7 A;  3R1V A;  1PSR A;  3OX5 A;  2SAS A;  2CXJ A;  2LMV A;  1CLM A;  1U5I B;  1SMG A;  2A4J A;  3FIA A;  2Y4Q A;  3TDU A;  2SCP A;  1REC A;  1SY9 A;  1RK9 A;  3GK4 X;  3L47 A;  4YGE B;  2CT9 A;  4F7F A;  1F71 A;  1CM1 A;  2JRF A;  1DJZ A;  1WLM A;  1SRA A;  2BKI B;  1MF8 B;  2KSP A;  2JPT A;  1MQ1 A;  1XFU O;  4JPZ B;  3VRN A;  5IBW A;  1FF1 A;  4HSZ A;  1FI5 A;  1QXP A;  2HPS A;  1B7T Z;  2LUC A;  2M97 A;  4YI8 A;  2M29 A;  1KK7 Z;  3BFB A;  1ZOT B;  2OS8 C;  1KFX L;  1XYD A;  3O2P A;  2LE9 B;  2P71 A;  1YVH A;  1QV1 A;  3I5H B;  3OGN A;  2M0R A;  2KOT A;  4OVN F;  2PRU A;  1LS8 A;  1TTX A;  2CCM A;  3B7A A;  1MXL C;  3EVV A;  1PUL A;  1XK4 A;  3DD4 A;  3TS5 C;  4CID A;  1NX1 A;  1B9A A;  1S6C A;  3JTD C;  2WOS A;  5FI2 A;  1SCV A;  2KLE A;  2QEH A;  1EXR A;  2BCA A;  2JUL A;  1QLS A;  2WCH A;  3R1O A;  4JKT A;  1NWD A;  3EK7 A;  2LVV A;  1BJF A;  1PK0 D;  2BEC A;  5JOL A;  3LLE A;  2COL B;  1N65 A;  1CTR A;  2HF5 A;  2KHN A;  4GFT A;  3FWC A;  2LAN A;  3CZ2 A;  1S5G Y;  1K9P A;  3DVJ A;  4XJK A;  5JJG A;  2M8U A;  2H61 C;  2KFG A;  2PAS A;  2KLD A;  5D7F A;  4PE7 A;  4BY5 A;  1OE9 B;  1IJ5 A;  3L4L A;  2BCB A;  2NCP A;  1XFW O;  1SR6 B;  2K7B A;  1YR5 A;  1DF0 B;  1G8I A;  1QX7 A;  3EK4 A;  4MVF A;  5FI7 A;  4CLN A;  1SW8 A;  2FJU B;  2L5X B;  1JFJ A;  1TNX A;  1JFK A;  2LCP A;  1A2X A;  1IQ5 A;  2KGB C;  4JWQ A;  5HLV A;  1CKK A;  4F0Z B;  2WND A;  1G33 A;  4KYN A;  1DT7 B;  1YX7 A;  3PM8 A;  1KQV A;  1XFZ O;  3BOW A;  3NSL A;  3NXA A;  3PM2 A;  1F54 A;  1KSM A;  4ZCV A;  4NDD A;  2BE6 A;  2BCX A;  4DS7 A;  3BFH A;  1GM0 A;  2JWW A;  2OPO A;  3S0B A;  3FWB A;  1DJY A;  2QAC A;  1UHJ A;  1JBA A;  4HRH A;  4OCI A;  3UO9 A;  1PRW A;  1AVS A;  3OB2 B;  5KU1 A;  2ISD A;  2AAO A;  3CDN A;  3SG2 A;  5AFP A;  5I2O A;  1OMD A;  1NX2 A;  1ALV A;  1RWY A;  1LVC D;  1K9K A;  1SYM A;  3F45 A;  4E68 A; 
#chains in the Genus database with same CATH homology
 3TDZ A;  2TN4 A;  2ZRT A;  1B7T Y;  1DJI A;  1PSB A;  2O60 A;  3SG4 A;  3VRO A;  1SBJ A;  1WY9 A;  1TNQ A;  5HKW A;  1DGU A;  2JC2 A;  3LK1 A;  2GV5 A;  3WNX B;  2KAX A;  1NX0 A;  2GGZ A;  1JSA A;  2L0P A;  2LLS A;  1UWO A;  4M2O A;  4CFQ A;  1CDN A;  2JT0 A;  1QAS A;  2MJW B;  5BPJ A;  2KFF A;  1CB1 A;  1IWQ A;  2WC8 A;  2O5G A;  3AKB A;  2MRD A;  1S5G Z;  1OZO A;  1BLQ A;  3NSI A;  1D1O A;  1ODB A;  3A8R A;  3O4Y A;  1S6J A;  2ZN9 A;  1A29 A;  1X02 A;  4NQG A;  2I2R E;  2BL0 C;  4M2P A;  1Y1U A;  5ER5 A;  4GGF A;  1F70 A;  1XVJ A;  4YGB B;  4A4C A;  1CMG A;  1SR6 C;  2WCE A;  3CR2 A;  5HKY A;  3AAJ A;  3PSR A;  2KGR A;  3BYA A;  3MSE B;  1IG5 A;  5CSF A;  3I5G C;  1DMO A;  2LM5 A;  2KBI A;  3EVR A;  1BT6 A;  2RGI A;  1KK8 B;  1KQM B;  1TNP A;  1M39 A;  2F2O A;  1LA0 A;  5D69 A;  2DOQ A;  3TUY C;  1QS7 A;  1QLK A;  2K0J A;  1SCM B;  3CR5 X;  1C7W A;  1IRJ A;  2M1K B;  1J1D A;  1GGZ A;  1QVI Z;  4PDZ A;  4PCW A;  2ZRS A;  1B8L A;  1XFY O;  3IQO A;  1GGW A;  2IS9 A;  3IF7 A;  4YGC B;  4XJK B;  4PHN A;  3I5F B;  1CDP A;  2Y5I A;  1NSH A;  1S1E A;  5CPV A;  2K61 A;  2OTG B;  4NDC A;  2GGM A;  2PMY A;  4P5O E;  2JU0 A;  1J1E A;  1DJX A;  1KWO C;  2LVJ A;  3H4S E;  1J7O A;  4L9M A;  2MLE C;  3NSO A;  1YTZ C;  1B1G A;  1Y1A A;  2BE4 A;  2ZFD A;  1CFD A;  3SIA A;  1XA5 A;  3CR4 X;  1UUR A;  1UHH A;  2F3Y A;  1CFC A;  2PVB A;  2K7C A;  3PLF B;  5CSJ A;  1EL4 A;  1MR8 A;  1F55 A;  2K2F A;  1WLZ A;  1GJY A;  1LIN A;  2MA2 A;  4P2Y B;  1MWN A;  3KHE A;  2MBX A;  1A03 A;  1B4C A;  4WQ2 A;  1B8C A;  1L2O B;  2D8N A;  5HLO A;  2EC6 B;  1CDL A;  1BR4 B;  4N5X A;  1WDC B;  1CFP A;  4IL1 A;  3BUM B;  4YGD B;  5CSN A;  1QAT A;  3OB1 B;  1NYA A;  2I18 A;  3QRX A;  5F6T A;  1IH0 A;  2KI4 C;  1IQ3 A;  2JZI A;  2H61 A;  3PN7 C;  2G9B A;  4FTG A;  3WHT B;  1YRT B;  4OKH A;  1DTL A;  1KK8 C;  1KQM C;  1N2D A;  2JQ6 A;  4ETO A;  1MUX A;  4ORC B;  4R1E A;  2MAZ A;  2Q91 A;  1HT9 A;  3DF0 A;  1MHO A;  2LLU A;  2LV7 A;  4MSP A;  5I8N A;  3GOF A;  4GBA A;  1FW4 A;  5I2Q A;  5AXI A;  1U5I A;  4YRU A;  1UP5 A;  2F8P A;  3I5F C;  2MLF C;  1SPY A;  1ZMZ A;  2K8M B;  3DVK A;  2OTG C;  2FOT A;  2F3Z A;  1QVI Y;  1S26 D;  1F4Q A;  5DKN A;  1CMF A;  5K89 A;  2JT8 A;  2M7L A;  2JXL A;  3DVM A;  1J7R A;  3O6B A;  4ORA B;  2LHI A;  1DVI A;  3I5H C;  3EVU A;  1ZAC A;  2BBN A;  1CM4 A;  5PAL A;  2HQ8 A;  1K90 D;  1L7Z A;  2K2A A;  2LNK A;  2MHH A;  1CFF A;  4BY4 A;  3JVT B;  2KYF A;  3CZT X;  4A4B A;  4PHM A;  1UHK A;  1W7I B;  1B8R A;  4PHK A;  1FI6 A;  1PAL A;  2WOR A;  1K95 A;  2LC5 A;  4GAO A;  1WRK A;  1K94 A;  4GUK A;  4GPL B;  1SK6 D;  1DJW A;  4MRY A;  1TIZ A;  1Y6W A;  1E8A A;  2L50 A;  1OZS A;  3LCP C;  4TNC A;  3VRR A;  4CPV A;  1DGV A;  1BOC A;  4YI9 A;  1AUI B;  5G08 A;  3PFV A;  3BUW B;  1YX8 A;  1NCZ A;  3ZWH A;  1AP4 A;  3BUN B;  2QPT A;  3KF9 A;  5DKR A;  4DCK A;  1SNL A;  1KSO A;  2M7N A;  1N0Y A;  1CNP A;  1V1F A;  2F2P A;  4PAL A;  1K2H A;  1EG3 A;  1S3P A;  2JT3 A;  4UPG A;  3TDI A;  1EJ3 A;  2I7A A;  4CFR A;  4Q04 A;  3VRP A;  2CTN A;  1V1G A;  5B8I B;  1M46 A;  3O78 A;  1Y0V H;  2M49 B;  1K93 D;  3D0Y A;  1EH2 A;  1SL7 A;  1OOJ A;  3BQ3 A;  3EK8 A;  3I5I B;  1ZUZ A;  2LUX A;  3PAT A;  4ICB A;  4MLW A;  1BOD A;  1JWD A;  1TOP A;  4U8D A;  4MEW A;  4DUQ A;  5AER A;  4AOM A;  4XYN A;  3KO0 A;  2CNP A;  1OQP A;  2NXQ A;  5HYD A;  4HRG A;  3C1V A;  1C07 A;  1Q80 A;  4QJ5 B;  2KYC A;  3BXK A;  1YUR A;  2KI6 D;  4GGN A;  3CGA A;  1ALW A;  2FCE A;  1UUS A;  4N1F A;  1YUT A;  2LHL A;  3DF0 B;  5I2L A;  2ZN8 A;  3SG5 A;  2Y1N A;  2KQY A;  1B47 A;  4MBE A;  1SL8 A;  2LMU A;  2M3W A;  4NDB A;  3KPX A;  2H2K A;  3BOW B;  4D1E A;  1UHN A;  1QX5 B;  2M9G A;  1M45 A;  4QJ4 B;  1C7V A;  3GK2 A;  1NIW A;  3AKA A;  4ORB B;  1J7Q A;  2LP3 A;  1KFU S;  3RLZ A;  1NCX A;  2L2E A;  5AAN A;  2LP2 A;  1OMR A;  3E3R A;  4QJ3 B;  3ZNI A;  2BBM A;  5ER4 X;  2NZ0 A;  4YBH B;  1NX3 A;  3SIB A;  2KI6 C;  4I5K A;  2LVI A;  1LA3 A;  2R2I A;  3SG6 A;  1CDM A;  1VRK A;  1DJH A;  1YUU A;  1XK4 C;  2KNE A;  1YVL A;  2KAV A;  3M0W A;  1NCY A;  1LXF C;  2NCO A;  2B1U A;  1XO5 A;  3OHM B;  1R6P A;  4M2Q A;  4AQJ A;  4MZK A;  5KSZ A;  1A4P A;  1RRO A;  3ICB A;  2LMT A;  1F8H A;  1A75 A;  1QIV A;  2LAP A;  4PE1 A;  3TZ1 A;  3I5I C;  1YUS A;  1K9U A;  1F4O A;  1SCM C;  2P6B B;  3EKJ A;  1QV0 A;  3KEV A;  1RTP 1;  1YRU B;  1TRF A;  2L51 A;  1CLL A;  2KDH A;  4WRI A;  1IKU A;  2EHB A;  2L4H A;  1IJ6 A;  4AQI A;  4PHJ A;  1BMO A;  2BL0 B;  4N1G A;  2KAY A;  2BKH B;  3BUX B;  3LK0 A;  3OX6 A;  3PAL A;  1NPQ A;  1FPW A;  3RM1 A;  3BUO B;  2HET A;  1S6I A;  4WQ3 A;  1KFU L;  3CS1 A;  1BF5 A;  2K7O A;  2NLN A;  2V53 A;  3I5G B;  1KCY A;  5J3X A;  1RJV A;  2E30 A;  2AUC A;  2JOJ A;  4DRW A;  1NP8 A;  1BG1 A;  2FCD A;  1WRL A;  1PVB A;  1WRZ A;  1UHI A;  2JTT A;  1QIW A;  3D0Y B;  1AJ5 A;  1SKT A;  4MRX A;  1MXE A;  1K96 A;  1QX2 A;  4JQ0 D;  3IQQ A;  3TUY B;  3WHU B;  4ZCU A;  4PE4 A;  1QJT A;  2F33 A;  4YGA A;  1SL9 A;  1H4B A;  2PSR A;  4I5N B;  3HX4 A;  5AEQ A;  1W7J B;  1TCO B;  1LKJ A;  3VGO A;  1L2O C;  2EC6 C;  1PVA A;  1BR1 B;  1TCF A;  1WDC C;  2JNF A;  2ZKM X;  4PE0 A;  2JTZ A;  1G4Y R;  1AJ4 A;  5GQQ C;  2I94 A;  1S36 A;  3DVE A;  2KBM A;  1AK8 A;  1NUB A;  4MZL A;  4I5L B;  2M1U A;  4I5J A;  1JC2 A;  3CLN A;  1JF0 A;  1KWO B;  1HQV A;  5DKQ A;  3OP0 A;  4MZJ A;  2OS8 B;  2CBL A;  1KK7 Y;  2KQ6 A;  3AAK A;  1OSA A;  3K21 A;  1DF0 A;  4USL A;  5FYX A;  2E6W A;  3SG7 A;  3HCM A;  5TNC A;  4OV2 A;  2PAL A;  1TNW A;  3TS5 B;  1FBV A;  1IGV A;  2AMI A;  4HRE E;  2K7D A;  4C0J A;  1J7P A;  3SG3 A;  1ZFS A;  2EGD A;  3JTD B;  1J55 A;  1Y1X A;  2JNX A;  1M63 B;  1AHR A;  2VRG A;  2ZNE A;  5KTY A;  1KFX S;  1M31 A;  2LVK A;  1TN4 A;  1DJG A;  4FQO A;  4GGF C;  2KFH A;  4OR9 B;  1XFX O;  2G2B A;  1OMV A;  2JXC A;  4MN0 A;  3SJS A;  2KI4 B;  3CWG A;  3WXA A;  2WCB A;  2LLT A;  2ZND A;  3PN7 B;  1K8U A;  3NSK A;  1RFJ A;  3VRQ A;  3EKH A;  1JUO A;  2L98 A;  1GQM A;  1R2U A;  1QTX A;  2Y1M A;  4C0L A;  1EG4 A;  4DIR A;  1CLB A;  1BU3 A;  3A4U B;  2WCF A;  1JF2 A;  1A75 B;  3LL8 B;  3JVT C;  1XFV O;  4GNK B;  2L4I A;  4C0K A;  3D10 A;  2Q4U A;  3GK1 A;  3CTN A;  5CSI A;  5HKZ A;  2HQW A;  3FS7 A;  1PSR A;  3OX5 A;  2SAS A;  2CXJ A;  2LMV A;  1CLM A;  1U5I B;  1SMG A;  2A4J A;  3FIA A;  2Y4Q A;  3TDU A;  2SCP A;  1REC A;  1SY9 A;  1RK9 A;  3GK4 X;  4YGE B;  1F71 A;  2CT9 A;  1H8B A;  1CM1 A;  2JRF A;  1DJZ A;  2BKI B;  1SRA A;  1WLM A;  1MF8 B;  2KSP A;  2JPT A;  1MQ1 A;  1XFU O;  4JPZ B;  3VRN A;  5IBW A;  1FF1 A;  4HSZ A;  1FI5 A;  1QXP A;  2HPS A;  1B7T Z;  2LUC A;  2M97 A;  4YI8 A;  2M29 A;  1KK7 Z;  1ZOT B;  2OS8 C;  1KFX L;  1XYD A;  3O2P A;  2LE9 B;  1YVH A;  1QV1 A;  3I5H B;  2M0R A;  2KOT A;  4OVN F;  2PRU A;  1TTX A;  2CCM A;  1MXL C;  3EVV A;  1PUL A;  1XK4 A;  3DD4 A;  3TS5 C;  4CID A;  1NX1 A;  1B9A A;  1S6C A;  3JTD C;  2WOS A;  1SCV A;  1EXR A;  2BCA A;  2JUL A;  1QLS A;  1NWD A;  3EK7 A;  2LVV A;  1BJF A;  1PK0 D;  2BEC A;  5JOL A;  3LLE A;  2COL B;  1N65 A;  1CTR A;  2HF5 A;  2KHN A;  4GFT A;  3FWC A;  2LAN A;  1S5G Y;  1K9P A;  3DVJ A;  4XJK A;  5JJG A;  2M8U A;  2H61 C;  2KFG A;  2PAS A;  5D7F A;  4PE7 A;  4BY5 A;  1OE9 B;  1IJ5 A;  2BCB A;  2NCP A;  1XFW O;  1SR6 B;  2K7B A;  1YR5 A;  1DF0 B;  1G8I A;  1QX7 A;  3EK4 A;  4MVF A;  4CLN A;  1SW8 A;  2FJU B;  2L5X B;  1JFJ A;  1TNX A;  1JFK A;  2LCP A;  1A2X A;  1IQ5 A;  2KGB C;  4JWQ A;  5HLV A;  1CKK A;  4F0Z B;  2WND A;  1G33 A;  1DT7 B;  1YX7 A;  3PM8 A;  1KQV A;  1XFZ O;  3BOW A;  3NSL A;  3NXA A;  1F54 A;  1KSM A;  4ZCV A;  4NDD A;  2BE6 A;  2BCX A;  4DS7 A;  2JWW A;  2OPO A;  3FWB A;  1DJY A;  2QAC A;  1UHJ A;  1JBA A;  4HRH A;  4OCI A;  1PRW A;  1AVS A;  3OB2 B;  5KU1 A;  2ISD A;  2AAO A;  3SG2 A;  5AFP A;  5I2O A;  1OMD A;  1NX2 A;  1ALV A;  1RWY A;  1LVC D;  1K9K A;  1SYM A;  3F45 A;  4E68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...