2SCPA

Structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
174
structure length
174
Chain Sequence
SDLWVQKMKTYFNRIDFDKDGAITRMDFESMAERFAKESEMKAEHAKVLMDSLTGVWDNFLTAVAGGKGIDETTFINSMKEMVKNPEAKSVVEGPLPLFFRAVDTNEDNNISRDEYGIFFGMLGLDKTMAPASFDAIDTNNDGLLSLEEFVIAGSDFFMNDGDSTNKVFWGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARCOPLASMIC CALCIUM-BINDING PROTEIN
publication title Structure of a sarcoplasmic calcium-binding protein from Nereis diversicolor refined at 2.0 A resolution.
pubmed doi rcsb
source organism Neanthes diversicolor
molecule tags Binding protein
total genus 70
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2scpA00
5CSIA 2ZN8A 2L4IA 2JWWA 3HCMA 1UHHA 3D0YA 3VRPA 1JF0A 3OB2B 1DJWA 2LHIA 4MRYA 1QVIZ 2MLFC 2NZ0A 2ZKMX 1BR1B 3PM8A 1J7OA 4I5NB 1J55A 3NSLA 3KO0A 2ZNDA 1CFDA 1WDCB 2LMTA 2JNFA 3O6BA 2JXCA 1TCFA 1DJHA 1BJFA 1YX8A 1M63B 1CMGA 3MSEB 4HSZA 3SG4A 4DCKA 1OMDA 1QXPA 4A4BA 2LLTA 2G2BA 2PSRA 1J7RA 1YRTB 4NDBA 1OOJA 3HX4A 1J1EA 2A4JA 2FJUB 1B47A 2BE6A 2HQ8A 2K8MB 2TN4A 2COLB 3BOWA 4WQ2A 2KFHA 1S1EA 2EC6C 2KYFA 4I5LB 1F71A 4FQOA 2KYCA 5JJGA 3AAKA 1KCYA 1NX1A 3CR5X 3KF9A 1QLSA 2OTGC 1XFZO 4I5KA 1JC2A 2M3WA 3I5HC 4XJKA 4MBEA 1TNPA 1F54A 1A2XA 1SBJA 1CLLA 1GJYA 1NUBA 1QIVA 2KGBC 3I5GB 1K9KA 4PE1A 4XYNA 1FPWA 2GGZA 1IQ3A 1OZOA 4OVNF 3NSOA 1TN4A 1IWQA 1V1FA 4AQIA 1QJTA 1C7VA 2MHHA 4MLWA 1A75A 2MRDA 3IQOA 1DF0B 3DD4A 3DVJA 2L50A 2LAPA 1SL9A 3TUYB 3QRXA 4QJ5B 4GGFA 2MJWB 1OSAA 4P5OE 1BF5A 3TS5B 2JTZA 2PMYA 3OP0A 2Y5IA 1LKJA 1RK9A 2K61A 3VRRA 1DJIA 5I8NA 5HKYA 2V53A 1CLBA 1IH0A 1CLMA 1L2OB 3CWGA 3TUYC 4GUKA 4PHKA 1FI5A 1G8IA 4AQJA 4GGNA 5AXIA 3BYAA 2HF5A 3VRQA 1PSRA 4OCIA 3OX5A 4OKHA 1YVHA 2LVVA 1NP8A 1R6PA 1DJXA 1QATA 4MSPA 5HLOA 3ZNIA 3PN7B 2LE9B 4WRIA 1NYAA 5G08A 1W7IB 2CT9A 2LUCA 3E3RA 1C07A 1RTP1 3ZWHA 1YX7A 2HETA 1B1GA 5TNCA 1S26D 2I94A 1Y0VH 1YUTA 2Y4QA 2ZN9A 3D0YB 1NCXA 1LINA 1IGVA 2KI4B 2Y1MA 4DRWA 2L98A 4M2OA 3AKAA 2MAZA 2EGDA 3FIAA 1S6IA 2NLNA 5CSFA 1K95A 1B8CA 2LMUA 2VRGA 1S5GY 1BLQA 4P2YB 2KQYA 3OX6A 1WLZA 1R2UA 1N0YA 2KAYA 4MVFA 4OR9B 1BU3A 4M2PA 1TIZA 2M1KB 1CKKA 1ALVA 5ER4X 3LLEA 3EKJA 2CBLA 1A03A 2L4HA 1K2HA 2CXJA 1YRUB 3EKHA 4N1FA 2M7NA 2JNXA 4BY5A 1AVSA 2L2EA 3NXAA 3BOWB 1K90D 1KSOA 1QS7A 1M31A 1XO5A 2CTNA 1XFWO 5CSNA 2CNPA 3DVMA 4CFRA 1UWOA 2NXQA 2MLEC 4YGBB 3DVKA 2K0JA 2JT8A 1J1DA 1DVIA 1XFUO 1DJYA 2QPTA 3BUWB 2PALA 3I5GC 1YUUA 4NQGA 3M0WA 2K7OA 5PALA 4DUQA 4XJKB 3WHTB 1RROA 1U5IA 2HPSA 4GPLB 1TNWA 2FCDA 2IS9A 4PE4A 2F3YA 3VGOA 1KSMA 1K9UA 3LCPC 1MXEA 1AHRA 2JPTA 1UHIA 2KGRA 2MA2A 1Q80A 4YGEB 1M45A 1A75B 2JOJA 3O4YA 1YVLA 4PE0A 1D1OA 1JFJA 1XYDA 2BECA 1KFXL 3TS5C 5AANA 5B8IB 1PVAA 1YR5A 2M49B 5K89A 3A8RA 3OB1B 1BG1A 1CFPA 1QLKA 3IF7A 4ICBA 2F8PA 2KHNA 2LLUA 2WNDA 1NPQA 1XFYO 2ZRTA 3IQQA 1Y1UA 1HT9A 4Q04A 1KK7Y 1RWYA 1WRZA 1BT6A 3BXKA 1KQVA 1XFXO 4USLA 2KAXA 1NX0A 2LLSA 3K21A 3PN7C 1F4QA 5I2LA 3PSRA 1RJVA 3DVEA 2I2RE 5KU1A 1BOCA 1J7QA 2LP2A 2WCBA 1HQVA 2BCBA 3JTDB 2LC5A 2M1UA 2BL0C 4HRHA 1KWOC 2KI4C 2KBMA 1F4OA 1S36A 1CTRA 4PHMA 2LCPA 1AUIB 3RLZA 3SJSA 4AOMA 2KQ6A 1EH2A 1CNPA 3EVVA 4HREE 3CR4X 4GAOA 3CZTX 4TNCA 4UPGA 1GGWA 2LMVA 1KQMC 2JT0A 3A4UB 1ZFSA 1SR6B 2LP3A 2PVBA 2LVJA 3D10A 1KK8B 1MHOA 2K2FA 4PCWA 1B9AA 1A4PA 1DTLA 1OMRA 1X02A 2KOTA 5KTYA 1W7JB 1N2DA 4JWQA 1WY9A 2JZIA 2GV5A 1XK4C 5HLVA 4ORCB 3WHUB 1SY9A 1V1GA 2OS8C 3BQ3A 3BUXB 5D7FA 2KI6D 3PALA 1TOPA 1NIWA 3F45A 1SCMB 5FYXA 3WNXB 2KDHA 5I2QA 2WOSA 2K2AA 2O5GA 1AP4A 1EG4A 1MXLC 1NX2A 3GOFA 2LNKA 2LM5A 1LXFC 2BKIB 1JFKA 1U5IB 1YURA 2EHBA 4BY4A 1FW4A 2JQ6A 4YBHB 1ZUZA 3VROA 2LANA 3NSKA 4GNKB 1B8RA 1S6CA 1LA0A 1GQMA 2BBMA 1WDCC 2I7AA 1H4BA 1QX2A 2DOQA 2P6BB 4L9MA 1K94A 1WLMA 4OV2A 5HKWA 1S5GZ 3TDUA 4HRGA 1TTXA 1Y1AA 1MQ1A 1NX3A 1TRFA 3CR2A 1FBVA 3PATA 1UUSA 1EJ3A 3TDIA 3EK8A 2R2IA 1K8UA 2KSPA 2EC6B 2M29A 3LK0A 2AAOA 1BMOA 1NSHA 2M8UA 1AK8A 1SYMA 2OTGB 1Y6WA 1QASA 1M46A 3I5HB 2ISDA 3RM1A 2M7LA 4ORAB 3GK4X 1PULA 1Y1XA 2G9BA 2FOTA 4I5JA 1CM1A 1NCZA 1CM4A 5DKQA 3SG2A 1B8LA 2JU0A 3GK1A 3H4SE 1PRWA 4MN0A 1RFJA 2L0PA 5D69A 3CTNA 2BE4A 1L7ZA 1PALA 4FTGA 1SK6D 5CSJA 1N65A 3OHMB 1LA3A 4CPVA 1DGVA 2H2KA 1SR6C 1SCVA 4MRXA 4CIDA 1YTZC 1B7TY 4QJ4B 1S6JA 2PASA 2M97A 2ZRSA 2FCEA 3DF0A 3SG6A 1SL7A 2BCAA 3TDZA 2H61C 2JRFA 5AEQA 1XA5A 1UHNA 1UURA 4R1EA 1H8BA 3O2PA 5CPVA 1DT7B 1UHJA 4ZCUA 3CLNA 1E8AA 1K96A 1K93D 1L2OC 3C1VA 3BUNB 4N1GA 5F6TA 3CGAA 1M39A 1TNQA 2JULA 1ZOTB 1SCMC 1RECA 1AJ5A 1IQ5A 4QJ3B 1KK7Z 4YGDB 1F8HA 4U8DA 3WXAA 3CS1A 1ZMZA 2BBNA 1EG3A 1QVIY 2WC8A 4JQ0D 4MEWA 5HYDA 3AKBA 1K9PA 3KEVA 3JVTB 3EK4A 3SIAA 1DMOA 1CDPA 4YGAA 1CMFA 1YUSA 1KFXS 3EK7A 1ZACA 5KSZA 4ORBB 4PE7A 1B4CA 1TCOB 3FWBA 3LL8B 4NDDA 1QIWA 3I5FB 4GBAA 1SPYA 2JXLA 4CLNA 1SRAA 1QV1A 3ICBA 2KFFA 1IJ5A 4A4CA 1XVJA 2Q4UA 2ZFDA 3EVRA 1SMGA 1XK4A 3BUMB 1MF8B 2OPOA 1PVBA 3PFVA 2BCXA 1OE9B 1SNLA 2KAVA 2LVKA 1JBAA 1F70A 4M2QA 1QV0A 5I2OA 2RGIA 4ZCVA 1TNXA 1XFVO 3I5IB 2D8NA 4N5XA 3SG5A 5DKNA 1JSAA 1JUOA 1OQPA 2LHLA 4YI8A 1BODA 2I18A 1IKUA 1FI6A 4C0KA 2LUXA 1IJ6A 1S3PA 1DJGA 2Q91A 2F33A 4WQ3A 1QX7A 3SG7A 2LVIA 1EXRA 1CDLA 2QACA 1MUXA 1CFCA 1PSBA 2F2PA 1C7WA 2K7CA 2JC2A 1SW8A 1ODBA 2M0RA 1MWNA 2KFGA 4GGFC 5AERA 1A29A 1CDMA 2E6WA 2SASA 1UHKA 3DF0B 2GGMA 2B1UA 4YGCB 2HQWA 2KNEA 2WCFA 1MR8A 2NCPA 1PK0D 1KFUL 4YRUA 5AFPA 3KPXA 5J3XA 1F55A 1QTXA 3EVUA 5HKZA 1FF1A 3SIBA 2SCPA 2K7BA 4YI9A 4ETOA 4MZLA 2E30A 1J7PA 1NWDA 1UP5A 4D1EA 3GK2A 4GFTA 2M9GA 3JVTC 1JF2A 3JTDC 2BL0B 1ALWA 1OZSA 1KWOB 1GGZA 1IRJA 3TZ1A 1IG5A 3VRNA 3O78A 5ER5A 1DF0A 3LK1A 3NSIA 1WRKA 3BUOB 3KHEA 1CFFA 2LV7A 4NDCA 1EL4A 1AJ4A 1QX5B 3I5FC 2JT3A 4PHJA 2AUCA 2F2OA 1BR4B 4DS7A 3PLFB 1VRKA 1SL8A 5GQQC 2WORA 3SG3A 1KFUS 1KQMB 2ZNEA 2PRUA 4CFQA 2BKHB 2H61A 2KI6C 2K7DA 1B7TZ 2AMIA 2L5XB 5IBWA 1JWDA 3AAJA 1G4YR 4DIRA 3FS7A 1KK8C 1NCYA 4F0ZB 2JTTA 4MZKA 2KBIA 2F3ZA 2L51A 3FWCA 4C0LA 2Y1NA 2NCOA 2O60A 4IL1A 4MZJA 4PHNA 1CDNA 1LVCD 2MBXA 4C0JA 4E68A 1WRLA 2OS8B 1SKTA 3I5IC 1OMVA 1CB1A 4PDZA 5BPJA 4PALA 1DJZA 5DKRA 5JOLA 1DGUA 2CCMA 4JPZB 1G33A 2WCEA
chains in the Genus database with same CATH superfamily
5CSIA 2ZN8A 2L4IA 2JWWA 3HCMA 1UHHA 3D0YA 3VRPA 1JF0A 3OB2B 1DJWA 2LHIA 4MRYA 1QVIZ 2MLFC 2NZ0A 2ZKMX 1BR1B 3PM8A 1J7OA 4I5NB 1C3YA 1J55A 3NSLA 3KO0A 2ZNDA 3QMEA 1CFDA 1WDCB 2LMTA 2JNFA 3O6BA 2JXCA 1TCFA 2QDIA 1DJHA 1BJFA 1YX8A 1M63B 1CMGA 3MSEB 4HSZA 3S0EA 3SG4A 4DCKA 1OMDA 1QXPA 2WCJA 3D75A 2LLTA 2G2BA 2PSRA 1J7RA 1YRTB 4NDBA 4A4BA 1OOJA 3HX4A 1J1EA 2A4JA 2FJUB 1B47A 2BE6A 2BNXA 2HQ8A 2K8MB 2TN4A 3D78A 2COLB 3BOWA 3R72A 4WQ2A 2KFHA 1S1EA 2EC6C 2KYFA 4I5LB 1F71A 4FQOA 2KYCA 5JJGA 3AAKA 1KCYA 1NX1A 3CR5X 3KF9A 1QLSA 2OTGC 1XFZO 4I5KA 1JC2A 1Z4HA 2M3WA 3I5HC 4XJKA 4MBEA 1TNPA 1F54A 1A2XA 1SBJA 1CLLA 1GJYA 1NUBA 1QIVA 2KGBC 3I5GB 1K9KA 3Q8IA 4PE1A 4XYNA 2GGZA 3UO9A 1IQ3A 1FPWA 3NHIA 1OZOA 4OVNF 3NSOA 1TN4A 1IWQA 1V1FA 4AQIA 1QJTA 2PQLA 2MHHA 4MLWA 1A75A 1C7VA 2MRDA 3FE8A 3IQOA 1DF0B 3DD4A 3DVJA 2L50A 2LAPA 1SL9A 3TUYB 3QRXA 4QJ5B 1DELA 4GGFA 2MJWB 1OSAA 4P5OE 1BF5A 3DYEA 2JTZA 2PMYA 3TS5B 3OP0A 2Y5IA 1LKJA 1RK9A 2K61A 3VRRA 1DJIA 5I8NA 5HKYA 3R1VA 2GTEA 2V53A 1CLBA 1IH0A 1T14A 1CLMA 1L2OB 3CWGA 3TUYC 4GUKA 4PHKA 1FI5A 1G8IA 4AQJA 3RZSA 4GGNA 5AXIA 3BYAA 2HF5A 3VRQA 1PSRA 4OCIA 3OX5A 4OKHA 2BAPA 1YVHA 2LVVA 1NP8A 1R6PA 1DJXA 3FE9A 1QATA 4MSPA 5HLOA 3SS5A 3ZNIA 3PN7B 2LE9B 4WRIA 1NYAA 5G08A 2WC5A 1W7IB 2CT9A 2LUCA 3E3RA 1C07A 1RTP1 3ZWHA 3O4XA 1YX7A 2HETA 1B1GA 1OOIX 5TNCA 1S26D 2I94A 1Y0VH 1YUTA 2Y4QA 2ZN9A 3D0YB 1NCXA 4INXA 1LINA 1IGVA 2KI4B 3CZ0A 2Y1MA 4DRWA 2L98A 4M2OA 3AKAA 2MAZA 2EGDA 3FIAA 1S6IA 2NLNA 5CSFA 1K95A 1B8CA 2P70A 2LMUA 2VRGA 1S5GY 1BLQA 4P2YB 2KQYA 3OX6A 1P28A 1WLZA 1R2UA 1N0YA 2KAYA 4MVFA 4OR9B 1BU3A 4M2PA 1TIZA 2M1KB 1CKKA 1ALVA 5ER4X 3LLEA 3EKJA 2CBLA 4IJ7A 2L4HA 1A03A 1K2HA 2CXJA 1YRUB 3EKHA 4N1FA 2M7NA 2JNXA 2QEOA 4BY5A 1AVSA 2L2EA 1Z2CB 3NXAA 3BOWB 1K90D 1KSOA 1QS7A 1M31A 1XO5A 2CTNA 1XFWO 5CSNA 2CNPA 3DVMA 4CFRA 1UWOA 2NXQA 3L47A 2H8VA 2MLEC 4YGBB 3DVKA 2K0JA 2JT8A 1J1DA 1DVIA 1XFUO 1DJYA 2QEHA 2QPTA 2PALA 3BUWB 3I5GC 1YUUA 1OOFA 3M0WA 4NQGA 3S0FA 2K7OA 5PALA 4DUQA 4XJKB 3WHTB 1RROA 1U5IA 2HPSA 4GPLB 1TNWA 2FCDA 2IS9A 4PE4A 2F3YA 3FE6A 3VGOA 3VB1A 1KSMA 1K9UA 3LCPC 1MXEA 1AHRA 2JPTA 1UHIA 2KGRA 2MA2A 1Q80A 4YGEB 1M45A 4F7FA 1A75B 2JOJA 3O4YA 1YVLA 4PE0A 1D1OA 1JFJA 1XYDA 2BECA 1KFXL 3DY9A 4OZDA 3TS5C 5AANA 5B8IB 1PVAA 1YR5A 2WCMA 2M49B 5K89A 3A8RA 3OB1B 1BG1A 1CFPA 1QLKA 3DXLA 3IF7A 4ICBA 2F8PA 2KHNA 2LLUA 1OOGA 1NPQA 1XFYO 2WNDA 2ZRTA 3IQQA 1Y1UA 1HT9A 4Q04A 1KK7Y 1RWYA 1WRZA 1BT6A 3BXKA 1KQVA 1XFXO 4USLA 2KAXA 1NX0A 2LLSA 3K21A 3PN7C 1F4QA 5I2LA 3PSRA 1RJVA 3DVEA 2I2RE 5KU1A 1BOCA 1J7QA 2LP2A 2WCBA 1HQVA 2BCBA 5FI2A 3CZ1A 3JTDB 2LC5A 2M1UA 2BL0C 4HRHA 1KWOC 2KI4C 2KBMA 1F4OA 1S36A 1CTRA 4FQTA 2LCPA 4PHMA 1AUIB 3RLZA 5EL2A 3SJSA 4AOMA 2KQ6A 1EH2A 1CNPA 3EVVA 1LS8A 4HREE 3CR4X 4GAOA 3CZTX 4TNCA 4UPGA 2YGUA 1GGWA 2LMVA 1KQMC 2JT0A 3A4UB 1ZFSA 2K60A 1SR6B 3BJHA 2LP3A 2PVBA 2LVJA 3D10A 3OGNA 1DQEA 1KK8B 1MHOA 2K2FA 4PCWA 1B9AA 1A4PA 1DTLA 1ORGA 1OMRA 1X02A 2KOTA 1TUZA 5KTYA 1W7JB 1N2DA 4JWQA 1WY9A 2JZIA 2GV5A 1XK4C 5HLVA 4ORCB 3WHUB 1SY9A 1V1GA 2OS8C 3BQ3A 3BUXB 5D7FA 2KI6D 3PALA 1TOPA 1NIWA 3F45A 1SCMB 5FYXA 3WNXB 2KDHA 5I2QA 2WOSA 2K2AA 3S0GA 2O5GA 2WCLA 1AP4A 1EG4A 1MXLC 1NX2A 3GOFA 2LNKA 2LM5A 1LXFC 2BKIB 1JFKA 1U5IB 1YURA 2EHBA 4BY4A 1FW4A 2JQ6A 4YBHB 2L2CA 1ZUZA 3VROA 2LANA 3NSKA 4GNKB 1B8RA 1S6CA 1LA0A 1GQMA 1OW4A 2BBMA 1WDCC 2I7AA 1H4BA 1QX2A 2DOQA 2P6BB 4L9MA 1K94A 1WLMA 4OV2A 5HKWA 1S5GZ 3TDUA 4HRGA 1TTXA 1Y1AA 1MQ1A 1NX3A 1TRFA 2ERBA 3CR2A 1FBVA 3PATA 4PT1A 1UUSA 1EJ3A 3TDIA 3EK8A 2R2IA 1K8UA 2KSPA 1XFRA 2EC6B 2M29A 3LK0A 2AAOA 1BMOA 1NSHA 2M8UA 1AK8A 1IIOA 1TUJA 1SYMA 2OTGB 3D74A 3DZTA 1Y6WA 1QASA 3D73A 1M46A 3I5HB 2ISDA 3RM1A 2M7LA 4ORAB 3GK4X 1PULA 1Y1XA 2G9BA 2FOTA 4I5JA 1CM1A 1NCZA 1CM4A 5DKQA 3SG2A 1B8LA 2JU0A 2WCHA 3GK1A 3H4SE 1PRWA 4MN0A 3L4LA 1RFJA 2L0PA 5D69A 3CTNA 2BE4A 1L7ZA 1PALA 4FTGA 5DICA 1OOHA 1SK6D 1N65A 3OHMB 1LA3A 3B86A 5CSJA 4CPVA 1DGVA 2H2KA 1SR6C 1SCVA 4MRXA 4CIDA 1YTZC 1B7TY 3L4AA 4JD9A 4QJ4B 1S6JA 2L5YA 2PASA 2M97A 2ZRSA 3N7HA 2FCEA 3SS3A 5HL1A 3DF0A 3SG6A 1SL7A 2BCAA 2KLDA 3TDZA 2H61C 2JRFA 5AEQA 1XA5A 1UHNA 1UURA 4R1EA 1H8BA 3O2PA 5I94A 5CPVA 1DT7B 1UHJA 4ZCUA 3CLNA 1E8AA 1K96A 1K93D 1L2OC 2WCKA 1QWVA 3BUNB 3C1VA 4N1GA 5F6TA 3CGAA 1M39A 1TNQA 2JULA 1ZOTB 1SCMC 1RECA 1AJ5A 3UNWA 1IQ5A 4QJ3B 1KK7Z 4YGDB 1F8HA 4U8DA 3WXAA 3CS1A 1ZMZA 2BBNA 1EG3A 1QVIY 2WC8A 4JQ0D 4MEWA 5HYDA 3AKBA 1K9PA 3KEVA 3JVTB 3EK4A 3CDNA 3CABA 3SIAA 1DMOA 1CDPA 4YGAA 1CMFA 1YUSA 1KFXS 1DC1A 3EK7A 1ZACA 5KSZA 4ORBB 1TWOA 3PM2A 3BFHA 4PE7A 1B4CA 1TCOB 3FWBA 3LL8B 4NDDA 1QIWA 4INWA 3I5FB 2KLEA 4GBAA 1SPYA 2JXLA 4CLNA 1SRAA 3S0BA 1QV1A 3ICBA 1SSEB 1IJ5A 2KFFA 2P71A 4A4CA 1XVJA 2Q4UA 2ZFDA 3EVRA 1SMGA 1XK4A 3R1PA 3BUMB 1MF8B 2OPOA 1PVBA 3PFVA 2BCXA 1OE9B 1SNLA 2KAVA 2LVKA 3R1OA 5FI6A 1JBAA 1F70A 4M2QA 1QV0A 2QEBA 5I2OA 2RGIA 3K1EA 4ZCVA 1TNXA 1XFVO 3I5IB 2D8NA 4N5XA 3SG5A 3PJIA 3B7AA 5DKNA 1JSAA 1JUOA 1OQPA 2LHLA 4YI8A 1BODA 3S0AA 3NHTA 2I18A 5FI7A 1IKUA 1FI6A 4C0KA 2KPHA 2LUXA 1IJ6A 1S3PA 1DJGA 2Q91A 2F33A 4WQ3A 3V2LA 1QX7A 3SG7A 2LVIA 3S0DA 1EXRA 1CDLA 2QACA 1MUXA 1CFCA 1PSBA 2F2PA 1C7WA 2K7CA 2JC2A 1SW8A 1ODBA 2M0RA 1MWNA 2KFGA 4GGFC 5AERA 5D3OA 1A29A 1CDMA 2E6WA 2SASA 1UHKA 3CYZA 3DF0B 2GGMA 3SS4A 3B87A 2B1UA 3B88A 4YGCB 4KYNA 3EG5B 3IVTA 2HQWA 2KNEA 2WCFA 1MR8A 2NCPA 1PK0D 1KFUL 4YRUA 5AFPA 3BFAA 1DEKA 3KPXA 5J3XA 1F55A 1QTXA 3CZ2A 3EVUA 5HKZA 1W9ZA 1FF1A 3SIBA 2SCPA 2K7BA 4JKTA 4YI9A 4ETOA 4MZLA 2E30A 2FJYA 1J7PA 1NWDA 1UP5A 4D1EA 3D76A 3GK2A 4GFTA 2M9GA 3JVTC 3D77A 2WC6A 1JF2A 3JTDC 2BL0B 1ALWA 1OZSA 1KWOB 1GGZA 1IRJA 3TZ1A 1IG5A 3VRNA 3O78A 5ER5A 1DF0A 3LK1A 3NSIA 1WRKA 3BUOB 3KHEA 1C3ZA 1CFFA 2LV7A 4NDCA 1EL4A 1GM0A 1AJ4A 1QX5B 3I5FC 2JT3A 4PHJA 2AUCA 2F2OA 1BR4B 4DS7A 3PLFB 1VRKA 1SL8A 5GQQC 2WORA 3SG3A 1KFUS 1KQMB 2ZNEA 2PRUA 4CFQA 2BKHB 2H61A 2KI6C 3OBVA 2PYQA 2K7DA 1B7TZ 2AMIA 2L5XB 5IBWA 1JWDA 3AAJA 1G4YR 4DIRA 3FS7A 1KK8C 1NCYA 4F0ZB 2JTTA 4MZKA 2KBIA 2F3ZA 2L51A 3B6XA 3FWCA 2Y1NA 2NCOA 2O60A 4IL1A 4C0LA 4MZJA 4PHNA 1CDNA 1LVCD 2MBXA 4C0JA 4E68A 2JPOA 1WRLA 2QEVA 2OS8B 3BFBA 1SKTA 3I5IC 1OMVA 3NGVA 1CB1A 4PDZA 5BPJA 4PALA 1DJZA 5DKRA 5JOLA 1DGUA 2CCMA 4JPZB 1G33A 2WCEA
chains in the Genus database with same CATH topology
5CSIA 2ZN8A 2L4IA 2JWWA 3HCMA 1UHHA 3D0YA 3VRPA 1JF0A 3OB2B 1DJWA 2LHIA 4MRYA 1QVIZ 2MLFC 2NZ0A 2ZKMX 1BR1B 3PM8A 1J7OA 4I5NB 1J55A 3NSLA 3KO0A 2ZNDA 1CFDA 1WDCB 2LMTA 2JNFA 3O6BA 2JXCA 1TCFA 1DJHA 1BJFA 1YX8A 1M63B 1CMGA 3MSEB 4HSZA 3SG4A 4DCKA 1OMDA 1QXPA 4A4BA 2LLTA 2G2BA 2PSRA 1J7RA 1YRTB 4NDBA 1OOJA 3HX4A 1J1EA 2A4JA 2FJUB 1B47A 2BE6A 2HQ8A 2K8MB 2TN4A 2COLB 3BOWA 4WQ2A 2KFHA 1S1EA 2EC6C 2KYFA 4I5LB 1F71A 4FQOA 2KYCA 5JJGA 3AAKA 1KCYA 1NX1A 3CR5X 3KF9A 1QLSA 2OTGC 1XFZO 4I5KA 1JC2A 2M3WA 3I5HC 4XJKA 4MBEA 1TNPA 1F54A 1A2XA 1SBJA 1CLLA 1GJYA 1NUBA 1QIVA 2KGBC 3I5GB 1K9KA 4PE1A 4XYNA 1FPWA 2GGZA 1IQ3A 1OZOA 4OVNF 3NSOA 1TN4A 1IWQA 1V1FA 4AQIA 1QJTA 1C7VA 2MHHA 4MLWA 1A75A 2MRDA 3IQOA 1DF0B 3DD4A 3DVJA 2L50A 2LAPA 1SL9A 3TUYB 3QRXA 4QJ5B 4GGFA 2MJWB 1OSAA 4P5OE 1BF5A 3TS5B 2JTZA 2PMYA 3OP0A 2Y5IA 1LKJA 1RK9A 2K61A 3VRRA 1DJIA 5I8NA 5HKYA 2V53A 1CLBA 1IH0A 1CLMA 1L2OB 3CWGA 3TUYC 4GUKA 4PHKA 1FI5A 1G8IA 4AQJA 4GGNA 5AXIA 3BYAA 2HF5A 3VRQA 1PSRA 4OCIA 3OX5A 4OKHA 1YVHA 2LVVA 1NP8A 1R6PA 1DJXA 1QATA 4MSPA 5HLOA 3ZNIA 3PN7B 2LE9B 4WRIA 1NYAA 5G08A 1W7IB 2CT9A 2LUCA 3E3RA 1C07A 1RTP1 3ZWHA 1YX7A 2HETA 1B1GA 5TNCA 1S26D 2I94A 1Y0VH 1YUTA 2Y4QA 2ZN9A 3D0YB 1NCXA 1LINA 1IGVA 2KI4B 2Y1MA 4DRWA 2L98A 4M2OA 3AKAA 2MAZA 2EGDA 3FIAA 1S6IA 2NLNA 5CSFA 1K95A 1B8CA 2LMUA 2VRGA 1S5GY 1BLQA 4P2YB 2KQYA 3OX6A 1WLZA 1R2UA 1N0YA 2KAYA 4MVFA 4OR9B 1BU3A 4M2PA 1TIZA 2M1KB 1CKKA 1ALVA 5ER4X 3LLEA 3EKJA 2CBLA 1A03A 2L4HA 1K2HA 2CXJA 1YRUB 3EKHA 4N1FA 2M7NA 2JNXA 4BY5A 1AVSA 2L2EA 3NXAA 3BOWB 1K90D 1KSOA 1QS7A 1M31A 1XO5A 2CTNA 1XFWO 5CSNA 2CNPA 3DVMA 4CFRA 1UWOA 2NXQA 2MLEC 4YGBB 3DVKA 2K0JA 2JT8A 1J1DA 1DVIA 1XFUO 1DJYA 2QPTA 3BUWB 2PALA 3I5GC 1YUUA 4NQGA 3M0WA 2K7OA 5PALA 4DUQA 4XJKB 3WHTB 1RROA 1U5IA 2HPSA 4GPLB 1TNWA 2FCDA 2IS9A 4PE4A 2F3YA 3VGOA 1KSMA 1K9UA 3LCPC 1MXEA 1AHRA 2JPTA 1UHIA 2KGRA 2MA2A 1Q80A 4YGEB 1M45A 1A75B 2JOJA 3O4YA 1YVLA 4PE0A 1D1OA 1JFJA 1XYDA 2BECA 1KFXL 3TS5C 5AANA 5B8IB 1PVAA 1YR5A 2M49B 5K89A 3A8RA 3OB1B 1BG1A 1CFPA 1QLKA 3IF7A 4ICBA 2F8PA 2KHNA 2LLUA 2WNDA 1NPQA 1XFYO 2ZRTA 3IQQA 1Y1UA 1HT9A 4Q04A 1KK7Y 1RWYA 1WRZA 1BT6A 3BXKA 1KQVA 1XFXO 4USLA 2KAXA 1NX0A 2LLSA 3K21A 3PN7C 1F4QA 5I2LA 3PSRA 1RJVA 3DVEA 2I2RE 5KU1A 1BOCA 1J7QA 2LP2A 2WCBA 1HQVA 2BCBA 3JTDB 2LC5A 2M1UA 2BL0C 4HRHA 1KWOC 2KI4C 2KBMA 1F4OA 1S36A 1CTRA 4PHMA 2LCPA 1AUIB 3RLZA 3SJSA 4AOMA 2KQ6A 1EH2A 1CNPA 3EVVA 4HREE 3CR4X 4GAOA 3CZTX 4TNCA 4UPGA 1GGWA 2LMVA 1KQMC 2JT0A 3A4UB 1ZFSA 1SR6B 2LP3A 2PVBA 2LVJA 3D10A 1KK8B 1MHOA 2K2FA 4PCWA 1B9AA 1A4PA 1DTLA 1OMRA 1X02A 2KOTA 5KTYA 1W7JB 1N2DA 4JWQA 1WY9A 2JZIA 2GV5A 1XK4C 5HLVA 4ORCB 3WHUB 1SY9A 1V1GA 2OS8C 3BQ3A 3BUXB 5D7FA 2KI6D 3PALA 1TOPA 1NIWA 3F45A 1SCMB 5FYXA 3WNXB 2KDHA 5I2QA 2WOSA 2K2AA 2O5GA 1AP4A 1EG4A 1MXLC 1NX2A 3GOFA 2LNKA 2LM5A 1LXFC 2BKIB 1JFKA 1U5IB 1YURA 2EHBA 4BY4A 1FW4A 2JQ6A 4YBHB 1ZUZA 3VROA 2LANA 3NSKA 4GNKB 1B8RA 1S6CA 1LA0A 1GQMA 2BBMA 1WDCC 2I7AA 1H4BA 1QX2A 2DOQA 2P6BB 4L9MA 1K94A 1WLMA 4OV2A 5HKWA 1S5GZ 3TDUA 4HRGA 1TTXA 1Y1AA 1MQ1A 1NX3A 1TRFA 3CR2A 1FBVA 3PATA 1UUSA 1EJ3A 3TDIA 3EK8A 2R2IA 1K8UA 2KSPA 2EC6B 2M29A 3LK0A 2AAOA 1BMOA 1NSHA 2M8UA 1AK8A 1SYMA 2OTGB 1Y6WA 1QASA 1M46A 3I5HB 2ISDA 3RM1A 2M7LA 4ORAB 3GK4X 1PULA 1Y1XA 2G9BA 2FOTA 4I5JA 1CM1A 1NCZA 1CM4A 5DKQA 3SG2A 1B8LA 2JU0A 3GK1A 3H4SE 1PRWA 4MN0A 1RFJA 2L0PA 5D69A 3CTNA 2BE4A 1L7ZA 1PALA 4FTGA 1SK6D 5CSJA 1N65A 3OHMB 1LA3A 4CPVA 1DGVA 2H2KA 1SR6C 1SCVA 4MRXA 4CIDA 1YTZC 1B7TY 4QJ4B 1S6JA 2PASA 2M97A 2ZRSA 2FCEA 3DF0A 3SG6A 1SL7A 2BCAA 3TDZA 2H61C 2JRFA 5AEQA 1XA5A 1UHNA 1UURA 4R1EA 1H8BA 3O2PA 5CPVA 1DT7B 1UHJA 4ZCUA 3CLNA 1E8AA 1K96A 1K93D 1L2OC 3C1VA 3BUNB 4N1GA 5F6TA 3CGAA 1M39A 1TNQA 2JULA 1ZOTB 1SCMC 1RECA 1AJ5A 1IQ5A 4QJ3B 1KK7Z 4YGDB 1F8HA 4U8DA 3WXAA 3CS1A 1ZMZA 2BBNA 1EG3A 1QVIY 2WC8A 4JQ0D 4MEWA 5HYDA 3AKBA 1K9PA 3KEVA 3JVTB 3EK4A 3SIAA 1DMOA 1CDPA 4YGAA 1CMFA 1YUSA 1KFXS 3EK7A 1ZACA 5KSZA 4ORBB 4PE7A 1B4CA 1TCOB 3FWBA 3LL8B 4NDDA 1QIWA 3I5FB 4GBAA 1SPYA 2JXLA 4CLNA 1SRAA 1QV1A 3ICBA 2KFFA 1IJ5A 4A4CA 1XVJA 2Q4UA 2ZFDA 3EVRA 1SMGA 1XK4A 3BUMB 1MF8B 2OPOA 1PVBA 3PFVA 2BCXA 1OE9B 1SNLA 2KAVA 2LVKA 1JBAA 1F70A 4M2QA 1QV0A 5I2OA 2RGIA 4ZCVA 1TNXA 1XFVO 3I5IB 2D8NA 4N5XA 3SG5A 5DKNA 1JSAA 1JUOA 1OQPA 2LHLA 4YI8A 1BODA 2I18A 1IKUA 1FI6A 4C0KA 2LUXA 1IJ6A 1S3PA 1DJGA 2Q91A 2F33A 4WQ3A 1QX7A 3SG7A 2LVIA 1EXRA 1CDLA 2QACA 1MUXA 1CFCA 1PSBA 2F2PA 1C7WA 2K7CA 2JC2A 1SW8A 1ODBA 2M0RA 1MWNA 2KFGA 4GGFC 5AERA 1A29A 1CDMA 2E6WA 2SASA 1UHKA 3DF0B 2GGMA 2B1UA 4YGCB 2HQWA 2KNEA 2WCFA 1MR8A 2NCPA 1PK0D 1KFUL 4YRUA 5AFPA 3KPXA 5J3XA 1F55A 1QTXA 3EVUA 5HKZA 1FF1A 3SIBA 2SCPA 2K7BA 4YI9A 4ETOA 4MZLA 2E30A 1J7PA 1NWDA 1UP5A 4D1EA 3GK2A 4GFTA 2M9GA 3JVTC 1JF2A 3JTDC 2BL0B 1ALWA 1OZSA 1KWOB 1GGZA 1IRJA 3TZ1A 1IG5A 3VRNA 3O78A 5ER5A 1DF0A 3LK1A 3NSIA 1WRKA 3BUOB 3KHEA 1CFFA 2LV7A 4NDCA 1EL4A 1AJ4A 1QX5B 3I5FC 2JT3A 4PHJA 2AUCA 2F2OA 1BR4B 4DS7A 3PLFB 1VRKA 1SL8A 5GQQC 2WORA 3SG3A 1KFUS 1KQMB 2ZNEA 2PRUA 4CFQA 2BKHB 2H61A 2KI6C 2K7DA 1B7TZ 2AMIA 2L5XB 5IBWA 1JWDA 3AAJA 1G4YR 4DIRA 3FS7A 1KK8C 1NCYA 4F0ZB 2JTTA 4MZKA 2KBIA 2F3ZA 2L51A 3FWCA 4C0LA 2Y1NA 2NCOA 2O60A 4IL1A 4MZJA 4PHNA 1CDNA 1LVCD 2MBXA 4C0JA 4E68A 1WRLA 2OS8B 1SKTA 3I5IC 1OMVA 1CB1A 4PDZA 5BPJA 4PALA 1DJZA 5DKRA 5JOLA 1DGUA 2CCMA 4JPZB 1G33A 2WCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSI A;  2ZN8 A;  2L4I A;  2JWW A;  3HCM A;  1UHH A;  3D0Y A;  3VRP A;  1JF0 A;  3OB2 B;  1DJW A;  2LHI A;  4MRY A;  1QVI Z;  2MLF C;  2NZ0 A;  2ZKM X;  1BR1 B;  3PM8 A;  1J7O A;  4I5N B;  1J55 A;  3NSL A;  3KO0 A;  2ZND A;  1CFD A;  1WDC B;  2LMT A;  2JNF A;  3O6B A;  2JXC A;  1TCF A;  1DJH A;  1BJF A;  1YX8 A;  1M63 B;  1CMG A;  3MSE B;  4HSZ A;  3SG4 A;  4DCK A;  1OMD A;  1QXP A;  4A4B A;  2LLT A;  2G2B A;  2PSR A;  1J7R A;  1YRT B;  4NDB A;  1OOJ A;  3HX4 A;  1J1E A;  2A4J A;  2FJU B;  1B47 A;  2BE6 A;  2HQ8 A;  2K8M B;  2TN4 A;  2COL B;  3BOW A;  4WQ2 A;  2KFH A;  1S1E A;  2EC6 C;  2KYF A;  4I5L B;  1F71 A;  4FQO A;  2KYC A;  5JJG A;  3AAK A;  1KCY A;  1NX1 A;  3CR5 X;  3KF9 A;  1QLS A;  2OTG C;  1XFZ O;  4I5K A;  1JC2 A;  2M3W A;  3I5H C;  4XJK A;  4MBE A;  1TNP A;  1F54 A;  1A2X A;  1SBJ A;  1CLL A;  1GJY A;  1NUB A;  1QIV A;  2KGB C;  3I5G B;  1K9K A;  4PE1 A;  4XYN A;  1FPW A;  2GGZ A;  1IQ3 A;  1OZO A;  4OVN F;  3NSO A;  1TN4 A;  1IWQ A;  1V1F A;  4AQI A;  1QJT A;  1C7V A;  2MHH A;  4MLW A;  1A75 A;  2MRD A;  3IQO A;  1DF0 B;  3DD4 A;  3DVJ A;  2L50 A;  2LAP A;  1SL9 A;  3TUY B;  3QRX A;  4QJ5 B;  4GGF A;  2MJW B;  1OSA A;  4P5O E;  1BF5 A;  3TS5 B;  2JTZ A;  2PMY A;  3OP0 A;  2Y5I A;  1LKJ A;  1RK9 A;  2K61 A;  3VRR A;  1DJI A;  5I8N A;  5HKY A;  2V53 A;  1CLB A;  1IH0 A;  1CLM A;  1L2O B;  3CWG A;  3TUY C;  4GUK A;  4PHK A;  1FI5 A;  1G8I A;  4AQJ A;  4GGN A;  5AXI A;  3BYA A;  2HF5 A;  3VRQ A;  1PSR A;  4OCI A;  3OX5 A;  4OKH A;  1YVH A;  2LVV A;  1NP8 A;  1R6P A;  1DJX A;  1QAT A;  4MSP A;  5HLO A;  3ZNI A;  3PN7 B;  2LE9 B;  4WRI A;  1NYA A;  5G08 A;  1W7I B;  2CT9 A;  2LUC A;  3E3R A;  1C07 A;  1RTP 1;  3ZWH A;  1YX7 A;  2HET A;  1B1G A;  5TNC A;  1S26 D;  2I94 A;  1Y0V H;  1YUT A;  2Y4Q A;  2ZN9 A;  3D0Y B;  1NCX A;  1LIN A;  1IGV A;  2KI4 B;  2Y1M A;  4DRW A;  2L98 A;  4M2O A;  3AKA A;  2MAZ A;  2EGD A;  3FIA A;  1S6I A;  2NLN A;  5CSF A;  1K95 A;  1B8C A;  2LMU A;  2VRG A;  1S5G Y;  1BLQ A;  4P2Y B;  2KQY A;  3OX6 A;  1WLZ A;  1R2U A;  1N0Y A;  2KAY A;  4MVF A;  4OR9 B;  1BU3 A;  4M2P A;  1TIZ A;  2M1K B;  1CKK A;  1ALV A;  5ER4 X;  3LLE A;  3EKJ A;  2CBL A;  1A03 A;  2L4H A;  1K2H A;  2CXJ A;  1YRU B;  3EKH A;  4N1F A;  2M7N A;  2JNX A;  4BY5 A;  1AVS A;  2L2E A;  3NXA A;  3BOW B;  1K90 D;  1KSO A;  1QS7 A;  1M31 A;  1XO5 A;  2CTN A;  1XFW O;  5CSN A;  2CNP A;  3DVM A;  4CFR A;  1UWO A;  2NXQ A;  2MLE C;  4YGB B;  3DVK A;  2K0J A;  2JT8 A;  1J1D A;  1DVI A;  1XFU O;  1DJY A;  2QPT A;  3BUW B;  2PAL A;  3I5G C;  1YUU A;  4NQG A;  3M0W A;  2K7O A;  5PAL A;  4DUQ A;  4XJK B;  3WHT B;  1RRO A;  1U5I A;  2HPS A;  4GPL B;  1TNW A;  2FCD A;  2IS9 A;  4PE4 A;  2F3Y A;  3VGO A;  1KSM A;  1K9U A;  3LCP C;  1MXE A;  1AHR A;  2JPT A;  1UHI A;  2KGR A;  2MA2 A;  1Q80 A;  4YGE B;  1M45 A;  1A75 B;  2JOJ A;  3O4Y A;  1YVL A;  4PE0 A;  1D1O A;  1JFJ A;  1XYD A;  2BEC A;  1KFX L;  3TS5 C;  5AAN A;  5B8I B;  1PVA A;  1YR5 A;  2M49 B;  5K89 A;  3A8R A;  3OB1 B;  1BG1 A;  1CFP A;  1QLK A;  3IF7 A;  4ICB A;  2F8P A;  2KHN A;  2LLU A;  2WND A;  1NPQ A;  1XFY O;  2ZRT A;  3IQQ A;  1Y1U A;  1HT9 A;  4Q04 A;  1KK7 Y;  1RWY A;  1WRZ A;  1BT6 A;  3BXK A;  1KQV A;  1XFX O;  4USL A;  2KAX A;  1NX0 A;  2LLS A;  3K21 A;  3PN7 C;  1F4Q A;  5I2L A;  3PSR A;  1RJV A;  3DVE A;  2I2R E;  5KU1 A;  1BOC A;  1J7Q A;  2LP2 A;  2WCB A;  1HQV A;  2BCB A;  3JTD B;  2LC5 A;  2M1U A;  2BL0 C;  4HRH A;  1KWO C;  2KI4 C;  2KBM A;  1F4O A;  1S36 A;  1CTR A;  4PHM A;  2LCP A;  1AUI B;  3RLZ A;  3SJS A;  4AOM A;  2KQ6 A;  1EH2 A;  1CNP A;  3EVV A;  4HRE E;  3CR4 X;  4GAO A;  3CZT X;  4TNC A;  4UPG A;  1GGW A;  2LMV A;  1KQM C;  2JT0 A;  3A4U B;  1ZFS A;  1SR6 B;  2LP3 A;  2PVB A;  2LVJ A;  3D10 A;  1KK8 B;  1MHO A;  2K2F A;  4PCW A;  1B9A A;  1A4P A;  1DTL A;  1OMR A;  1X02 A;  2KOT A;  5KTY A;  1W7J B;  1N2D A;  4JWQ A;  1WY9 A;  2JZI A;  2GV5 A;  1XK4 C;  5HLV A;  4ORC B;  3WHU B;  1SY9 A;  1V1G A;  2OS8 C;  3BQ3 A;  3BUX B;  5D7F A;  2KI6 D;  3PAL A;  1TOP A;  1NIW A;  3F45 A;  1SCM B;  5FYX A;  3WNX B;  2KDH A;  5I2Q A;  2WOS A;  2K2A A;  2O5G A;  1AP4 A;  1EG4 A;  1MXL C;  1NX2 A;  3GOF A;  2LNK A;  2LM5 A;  1LXF C;  2BKI B;  1JFK A;  1U5I B;  1YUR A;  2EHB A;  4BY4 A;  1FW4 A;  2JQ6 A;  4YBH B;  1ZUZ A;  3VRO A;  2LAN A;  3NSK A;  4GNK B;  1B8R A;  1S6C A;  1LA0 A;  1GQM A;  2BBM A;  1WDC C;  2I7A A;  1H4B A;  1QX2 A;  2DOQ A;  2P6B B;  4L9M A;  1K94 A;  1WLM A;  4OV2 A;  5HKW A;  1S5G Z;  3TDU A;  4HRG A;  1TTX A;  1Y1A A;  1MQ1 A;  1NX3 A;  1TRF A;  3CR2 A;  1FBV A;  3PAT A;  1UUS A;  1EJ3 A;  3TDI A;  3EK8 A;  2R2I A;  1K8U A;  2KSP A;  2EC6 B;  2M29 A;  3LK0 A;  2AAO A;  1BMO A;  1NSH A;  2M8U A;  1AK8 A;  1SYM A;  2OTG B;  1Y6W A;  1QAS A;  1M46 A;  3I5H B;  2ISD A;  3RM1 A;  2M7L A;  4ORA B;  3GK4 X;  1PUL A;  1Y1X A;  2G9B A;  2FOT A;  4I5J A;  1CM1 A;  1NCZ A;  1CM4 A;  5DKQ A;  3SG2 A;  1B8L A;  2JU0 A;  3GK1 A;  3H4S E;  1PRW A;  4MN0 A;  1RFJ A;  2L0P A;  5D69 A;  3CTN A;  2BE4 A;  1L7Z A;  1PAL A;  4FTG A;  1SK6 D;  5CSJ A;  1N65 A;  3OHM B;  1LA3 A;  4CPV A;  1DGV A;  2H2K A;  1SR6 C;  1SCV A;  4MRX A;  4CID A;  1YTZ C;  1B7T Y;  4QJ4 B;  1S6J A;  2PAS A;  2M97 A;  2ZRS A;  2FCE A;  3DF0 A;  3SG6 A;  1SL7 A;  2BCA A;  3TDZ A;  2H61 C;  2JRF A;  5AEQ A;  1XA5 A;  1UHN A;  1UUR A;  4R1E A;  1H8B A;  3O2P A;  5CPV A;  1DT7 B;  1UHJ A;  4ZCU A;  3CLN A;  1E8A A;  1K96 A;  1K93 D;  1L2O C;  3C1V A;  3BUN B;  4N1G A;  5F6T A;  3CGA A;  1M39 A;  1TNQ A;  2JUL A;  1ZOT B;  1SCM C;  1REC A;  1AJ5 A;  1IQ5 A;  4QJ3 B;  1KK7 Z;  4YGD B;  1F8H A;  4U8D A;  3WXA A;  3CS1 A;  1ZMZ A;  2BBN A;  1EG3 A;  1QVI Y;  2WC8 A;  4JQ0 D;  4MEW A;  5HYD A;  3AKB A;  1K9P A;  3KEV A;  3JVT B;  3EK4 A;  3SIA A;  1DMO A;  1CDP A;  4YGA A;  1CMF A;  1YUS A;  1KFX S;  3EK7 A;  1ZAC A;  5KSZ A;  4ORB B;  4PE7 A;  1B4C A;  1TCO B;  3FWB A;  3LL8 B;  4NDD A;  1QIW A;  3I5F B;  4GBA A;  1SPY A;  2JXL A;  4CLN A;  1SRA A;  1QV1 A;  3ICB A;  2KFF A;  1IJ5 A;  4A4C A;  1XVJ A;  2Q4U A;  2ZFD A;  3EVR A;  1SMG A;  1XK4 A;  3BUM B;  1MF8 B;  2OPO A;  1PVB A;  3PFV A;  2BCX A;  1OE9 B;  1SNL A;  2KAV A;  2LVK A;  1JBA A;  1F70 A;  4M2Q A;  1QV0 A;  5I2O A;  2RGI A;  4ZCV A;  1TNX A;  1XFV O;  3I5I B;  2D8N A;  4N5X A;  3SG5 A;  5DKN A;  1JSA A;  1JUO A;  1OQP A;  2LHL A;  4YI8 A;  1BOD A;  2I18 A;  1IKU A;  1FI6 A;  4C0K A;  2LUX A;  1IJ6 A;  1S3P A;  1DJG A;  2Q91 A;  2F33 A;  4WQ3 A;  1QX7 A;  3SG7 A;  2LVI A;  1EXR A;  1CDL A;  2QAC A;  1MUX A;  1CFC A;  1PSB A;  2F2P A;  1C7W A;  2K7C A;  2JC2 A;  1SW8 A;  1ODB A;  2M0R A;  1MWN A;  2KFG A;  4GGF C;  5AER A;  1A29 A;  1CDM A;  2E6W A;  2SAS A;  1UHK A;  3DF0 B;  2GGM A;  2B1U A;  4YGC B;  2HQW A;  2KNE A;  2WCF A;  1MR8 A;  2NCP A;  1PK0 D;  1KFU L;  4YRU A;  5AFP A;  3KPX A;  5J3X A;  1F55 A;  1QTX A;  3EVU A;  5HKZ A;  1FF1 A;  3SIB A;  2SCP A;  2K7B A;  4YI9 A;  4ETO A;  4MZL A;  2E30 A;  1J7P A;  1NWD A;  1UP5 A;  4D1E A;  3GK2 A;  4GFT A;  2M9G A;  3JVT C;  1JF2 A;  3JTD C;  2BL0 B;  1ALW A;  1OZS A;  1KWO B;  1GGZ A;  1IRJ A;  3TZ1 A;  1IG5 A;  3VRN A;  3O78 A;  5ER5 A;  1DF0 A;  3LK1 A;  3NSI A;  1WRK A;  3BUO B;  3KHE A;  1CFF A;  2LV7 A;  4NDC A;  1EL4 A;  1AJ4 A;  1QX5 B;  3I5F C;  2JT3 A;  4PHJ A;  2AUC A;  2F2O A;  1BR4 B;  4DS7 A;  3PLF B;  1VRK A;  1SL8 A;  5GQQ C;  2WOR A;  3SG3 A;  1KFU S;  1KQM B;  2ZNE A;  2PRU A;  4CFQ A;  2BKH B;  2H61 A;  2KI6 C;  2K7D A;  1B7T Z;  2AMI A;  2L5X B;  5IBW A;  1JWD A;  3AAJ A;  1G4Y R;  4DIR A;  3FS7 A;  1KK8 C;  1NCY A;  4F0Z B;  2JTT A;  4MZK A;  2KBI A;  2F3Z A;  2L51 A;  3FWC A;  4C0L A;  2Y1N A;  2NCO A;  2O60 A;  4IL1 A;  4MZJ A;  4PHN A;  1CDN A;  1LVC D;  2MBX A;  4C0J A;  4E68 A;  1WRL A;  2OS8 B;  1SKT A;  3I5I C;  1OMV A;  1CB1 A;  4PDZ A;  5BPJ A;  4PAL A;  1DJZ A;  5DKR A;  5JOL A;  1DGU A;  2CCM A;  4JPZ B;  1G33 A;  2WCE A; 
#chains in the Genus database with same CATH topology
 5CSI A;  2ZN8 A;  2L4I A;  2JWW A;  3HCM A;  1UHH A;  3D0Y A;  3VRP A;  1JF0 A;  3OB2 B;  1DJW A;  2LHI A;  4MRY A;  1QVI Z;  2MLF C;  2NZ0 A;  2ZKM X;  1BR1 B;  3PM8 A;  1J7O A;  4I5N B;  1C3Y A;  1J55 A;  3NSL A;  3KO0 A;  2ZND A;  3QME A;  1CFD A;  1WDC B;  2LMT A;  2JNF A;  3O6B A;  2JXC A;  1TCF A;  2QDI A;  1DJH A;  1BJF A;  1YX8 A;  1M63 B;  1CMG A;  3MSE B;  4HSZ A;  3S0E A;  3SG4 A;  4DCK A;  1OMD A;  1QXP A;  2WCJ A;  3D75 A;  2LLT A;  2G2B A;  2PSR A;  1J7R A;  1YRT B;  4NDB A;  4A4B A;  1OOJ A;  3HX4 A;  1J1E A;  2A4J A;  2FJU B;  1B47 A;  2BE6 A;  2BNX A;  2HQ8 A;  2K8M B;  2TN4 A;  3D78 A;  2COL B;  3BOW A;  3R72 A;  4WQ2 A;  2KFH A;  1S1E A;  2EC6 C;  2KYF A;  4I5L B;  1F71 A;  4FQO A;  2KYC A;  5JJG A;  3AAK A;  1KCY A;  1NX1 A;  3CR5 X;  3KF9 A;  1QLS A;  2OTG C;  1XFZ O;  4I5K A;  1JC2 A;  1Z4H A;  2M3W A;  3I5H C;  4XJK A;  4MBE A;  1TNP A;  1F54 A;  1A2X A;  1SBJ A;  1CLL A;  1GJY A;  1NUB A;  1QIV A;  2KGB C;  3I5G B;  1K9K A;  3Q8I A;  4PE1 A;  4XYN A;  2GGZ A;  3UO9 A;  1IQ3 A;  1FPW A;  3NHI A;  1OZO A;  4OVN F;  3NSO A;  1TN4 A;  1IWQ A;  1V1F A;  4AQI A;  1QJT A;  2PQL A;  2MHH A;  4MLW A;  1A75 A;  1C7V A;  2MRD A;  3FE8 A;  3IQO A;  1DF0 B;  3DD4 A;  3DVJ A;  2L50 A;  2LAP A;  1SL9 A;  3TUY B;  3QRX A;  4QJ5 B;  1DEL A;  4GGF A;  2MJW B;  1OSA A;  4P5O E;  1BF5 A;  3DYE A;  2JTZ A;  2PMY A;  3TS5 B;  3OP0 A;  2Y5I A;  1LKJ A;  1RK9 A;  2K61 A;  3VRR A;  1DJI A;  5I8N A;  5HKY A;  3R1V A;  2GTE A;  2V53 A;  1CLB A;  1IH0 A;  1T14 A;  1CLM A;  1L2O B;  3CWG A;  3TUY C;  4GUK A;  4PHK A;  1FI5 A;  1G8I A;  4AQJ A;  3RZS A;  4GGN A;  5AXI A;  3BYA A;  2HF5 A;  3VRQ A;  1PSR A;  4OCI A;  3OX5 A;  4OKH A;  2BAP A;  1YVH A;  2LVV A;  1NP8 A;  1R6P A;  1DJX A;  3FE9 A;  1QAT A;  4MSP A;  5HLO A;  3SS5 A;  3ZNI A;  3PN7 B;  2LE9 B;  4WRI A;  1NYA A;  5G08 A;  2WC5 A;  1W7I B;  2CT9 A;  2LUC A;  3E3R A;  1C07 A;  1RTP 1;  3ZWH A;  3O4X A;  1YX7 A;  2HET A;  1B1G A;  1OOI X;  5TNC A;  1S26 D;  2I94 A;  1Y0V H;  1YUT A;  2Y4Q A;  2ZN9 A;  3D0Y B;  1NCX A;  4INX A;  1LIN A;  1IGV A;  2KI4 B;  3CZ0 A;  2Y1M A;  4DRW A;  2L98 A;  4M2O A;  3AKA A;  2MAZ A;  2EGD A;  3FIA A;  1S6I A;  2NLN A;  5CSF A;  1K95 A;  1B8C A;  2P70 A;  2LMU A;  2VRG A;  1S5G Y;  1BLQ A;  4P2Y B;  2KQY A;  3OX6 A;  1P28 A;  1WLZ A;  1R2U A;  1N0Y A;  2KAY A;  4MVF A;  4OR9 B;  1BU3 A;  4M2P A;  1TIZ A;  2M1K B;  1CKK A;  1ALV A;  5ER4 X;  3LLE A;  3EKJ A;  2CBL A;  4IJ7 A;  2L4H A;  1A03 A;  1K2H A;  2CXJ A;  1YRU B;  3EKH A;  4N1F A;  2M7N A;  2JNX A;  2QEO A;  4BY5 A;  1AVS A;  2L2E A;  1Z2C B;  3NXA A;  3BOW B;  1K90 D;  1KSO A;  1QS7 A;  1M31 A;  1XO5 A;  2CTN A;  1XFW O;  5CSN A;  2CNP A;  3DVM A;  4CFR A;  1UWO A;  2NXQ A;  3L47 A;  2H8V A;  2MLE C;  4YGB B;  3DVK A;  2K0J A;  2JT8 A;  1J1D A;  1DVI A;  1XFU O;  1DJY A;  2QEH A;  2QPT A;  2PAL A;  3BUW B;  3I5G C;  1YUU A;  1OOF A;  3M0W A;  4NQG A;  3S0F A;  2K7O A;  5PAL A;  4DUQ A;  4XJK B;  3WHT B;  1RRO A;  1U5I A;  2HPS A;  4GPL B;  1TNW A;  2FCD A;  2IS9 A;  4PE4 A;  2F3Y A;  3FE6 A;  3VGO A;  3VB1 A;  1KSM A;  1K9U A;  3LCP C;  1MXE A;  1AHR A;  2JPT A;  1UHI A;  2KGR A;  2MA2 A;  1Q80 A;  4YGE B;  1M45 A;  4F7F A;  1A75 B;  2JOJ A;  3O4Y A;  1YVL A;  4PE0 A;  1D1O A;  1JFJ A;  1XYD A;  2BEC A;  1KFX L;  3DY9 A;  4OZD A;  3TS5 C;  5AAN A;  5B8I B;  1PVA A;  1YR5 A;  2WCM A;  2M49 B;  5K89 A;  3A8R A;  3OB1 B;  1BG1 A;  1CFP A;  1QLK A;  3DXL A;  3IF7 A;  4ICB A;  2F8P A;  2KHN A;  2LLU A;  1OOG A;  1NPQ A;  1XFY O;  2WND A;  2ZRT A;  3IQQ A;  1Y1U A;  1HT9 A;  4Q04 A;  1KK7 Y;  1RWY A;  1WRZ A;  1BT6 A;  3BXK A;  1KQV A;  1XFX O;  4USL A;  2KAX A;  1NX0 A;  2LLS A;  3K21 A;  3PN7 C;  1F4Q A;  5I2L A;  3PSR A;  1RJV A;  3DVE A;  2I2R E;  5KU1 A;  1BOC A;  1J7Q A;  2LP2 A;  2WCB A;  1HQV A;  2BCB A;  5FI2 A;  3CZ1 A;  3JTD B;  2LC5 A;  2M1U A;  2BL0 C;  4HRH A;  1KWO C;  2KI4 C;  2KBM A;  1F4O A;  1S36 A;  1CTR A;  4FQT A;  2LCP A;  4PHM A;  1AUI B;  3RLZ A;  5EL2 A;  3SJS A;  4AOM A;  2KQ6 A;  1EH2 A;  1CNP A;  3EVV A;  1LS8 A;  4HRE E;  3CR4 X;  4GAO A;  3CZT X;  4TNC A;  4UPG A;  2YGU A;  1GGW A;  2LMV A;  1KQM C;  2JT0 A;  3A4U B;  1ZFS A;  2K60 A;  1SR6 B;  3BJH A;  2LP3 A;  2PVB A;  2LVJ A;  3D10 A;  3OGN A;  1DQE A;  1KK8 B;  1MHO A;  2K2F A;  4PCW A;  1B9A A;  1A4P A;  1DTL A;  1ORG A;  1OMR A;  1X02 A;  2KOT A;  1TUZ A;  5KTY A;  1W7J B;  1N2D A;  4JWQ A;  1WY9 A;  2JZI A;  2GV5 A;  1XK4 C;  5HLV A;  4ORC B;  3WHU B;  1SY9 A;  1V1G A;  2OS8 C;  3BQ3 A;  3BUX B;  5D7F A;  2KI6 D;  3PAL A;  1TOP A;  1NIW A;  3F45 A;  1SCM B;  5FYX A;  3WNX B;  2KDH A;  5I2Q A;  2WOS A;  2K2A A;  3S0G A;  2O5G A;  2WCL A;  1AP4 A;  1EG4 A;  1MXL C;  1NX2 A;  3GOF A;  2LNK A;  2LM5 A;  1LXF C;  2BKI B;  1JFK A;  1U5I B;  1YUR A;  2EHB A;  4BY4 A;  1FW4 A;  2JQ6 A;  4YBH B;  2L2C A;  1ZUZ A;  3VRO A;  2LAN A;  3NSK A;  4GNK B;  1B8R A;  1S6C A;  1LA0 A;  1GQM A;  1OW4 A;  2BBM A;  1WDC C;  2I7A A;  1H4B A;  1QX2 A;  2DOQ A;  2P6B B;  4L9M A;  1K94 A;  1WLM A;  4OV2 A;  5HKW A;  1S5G Z;  3TDU A;  4HRG A;  1TTX A;  1Y1A A;  1MQ1 A;  1NX3 A;  1TRF A;  2ERB A;  3CR2 A;  1FBV A;  3PAT A;  4PT1 A;  1UUS A;  1EJ3 A;  3TDI A;  3EK8 A;  2R2I A;  1K8U A;  2KSP A;  1XFR A;  2EC6 B;  2M29 A;  3LK0 A;  2AAO A;  1BMO A;  1NSH A;  2M8U A;  1AK8 A;  1IIO A;  1TUJ A;  1SYM A;  2OTG B;  3D74 A;  3DZT A;  1Y6W A;  1QAS A;  3D73 A;  1M46 A;  3I5H B;  2ISD A;  3RM1 A;  2M7L A;  4ORA B;  3GK4 X;  1PUL A;  1Y1X A;  2G9B A;  2FOT A;  4I5J A;  1CM1 A;  1NCZ A;  1CM4 A;  5DKQ A;  3SG2 A;  1B8L A;  2JU0 A;  2WCH A;  3GK1 A;  3H4S E;  1PRW A;  4MN0 A;  3L4L A;  1RFJ A;  2L0P A;  5D69 A;  3CTN A;  2BE4 A;  1L7Z A;  1PAL A;  4FTG A;  5DIC A;  1OOH A;  1SK6 D;  1N65 A;  3OHM B;  1LA3 A;  3B86 A;  5CSJ A;  4CPV A;  1DGV A;  2H2K A;  1SR6 C;  1SCV A;  4MRX A;  4CID A;  1YTZ C;  1B7T Y;  3L4A A;  4JD9 A;  4QJ4 B;  1S6J A;  2L5Y A;  2PAS A;  2M97 A;  2ZRS A;  3N7H A;  2FCE A;  3SS3 A;  5HL1 A;  3DF0 A;  3SG6 A;  1SL7 A;  2BCA A;  2KLD A;  3TDZ A;  2H61 C;  2JRF A;  5AEQ A;  1XA5 A;  1UHN A;  1UUR A;  4R1E A;  1H8B A;  3O2P A;  5I94 A;  5CPV A;  1DT7 B;  1UHJ A;  4ZCU A;  3CLN A;  1E8A A;  1K96 A;  1K93 D;  1L2O C;  2WCK A;  1QWV A;  3BUN B;  3C1V A;  4N1G A;  5F6T A;  3CGA A;  1M39 A;  1TNQ A;  2JUL A;  1ZOT B;  1SCM C;  1REC A;  1AJ5 A;  3UNW A;  1IQ5 A;  4QJ3 B;  1KK7 Z;  4YGD B;  1F8H A;  4U8D A;  3WXA A;  3CS1 A;  1ZMZ A;  2BBN A;  1EG3 A;  1QVI Y;  2WC8 A;  4JQ0 D;  4MEW A;  5HYD A;  3AKB A;  1K9P A;  3KEV A;  3JVT B;  3EK4 A;  3CDN A;  3CAB A;  3SIA A;  1DMO A;  1CDP A;  4YGA A;  1CMF A;  1YUS A;  1KFX S;  1DC1 A;  3EK7 A;  1ZAC A;  5KSZ A;  4ORB B;  1TWO A;  3PM2 A;  3BFH A;  4PE7 A;  1B4C A;  1TCO B;  3FWB A;  3LL8 B;  4NDD A;  1QIW A;  4INW A;  3I5F B;  2KLE A;  4GBA A;  1SPY A;  2JXL A;  4CLN A;  1SRA A;  3S0B A;  1QV1 A;  3ICB A;  1SSE B;  1IJ5 A;  2KFF A;  2P71 A;  4A4C A;  1XVJ A;  2Q4U A;  2ZFD A;  3EVR A;  1SMG A;  1XK4 A;  3R1P A;  3BUM B;  1MF8 B;  2OPO A;  1PVB A;  3PFV A;  2BCX A;  1OE9 B;  1SNL A;  2KAV A;  2LVK A;  3R1O A;  5FI6 A;  1JBA A;  1F70 A;  4M2Q A;  1QV0 A;  2QEB A;  5I2O A;  2RGI A;  3K1E A;  4ZCV A;  1TNX A;  1XFV O;  3I5I B;  2D8N A;  4N5X A;  3SG5 A;  3PJI A;  3B7A A;  5DKN A;  1JSA A;  1JUO A;  1OQP A;  2LHL A;  4YI8 A;  1BOD A;  3S0A A;  3NHT A;  2I18 A;  5FI7 A;  1IKU A;  1FI6 A;  4C0K A;  2KPH A;  2LUX A;  1IJ6 A;  1S3P A;  1DJG A;  2Q91 A;  2F33 A;  4WQ3 A;  3V2L A;  1QX7 A;  3SG7 A;  2LVI A;  3S0D A;  1EXR A;  1CDL A;  2QAC A;  1MUX A;  1CFC A;  1PSB A;  2F2P A;  1C7W A;  2K7C A;  2JC2 A;  1SW8 A;  1ODB A;  2M0R A;  1MWN A;  2KFG A;  4GGF C;  5AER A;  5D3O A;  1A29 A;  1CDM A;  2E6W A;  2SAS A;  1UHK A;  3CYZ A;  3DF0 B;  2GGM A;  3SS4 A;  3B87 A;  2B1U A;  3B88 A;  4YGC B;  4KYN A;  3EG5 B;  3IVT A;  2HQW A;  2KNE A;  2WCF A;  1MR8 A;  2NCP A;  1PK0 D;  1KFU L;  4YRU A;  5AFP A;  3BFA A;  1DEK A;  3KPX A;  5J3X A;  1F55 A;  1QTX A;  3CZ2 A;  3EVU A;  5HKZ A;  1W9Z A;  1FF1 A;  3SIB A;  2SCP A;  2K7B A;  4JKT A;  4YI9 A;  4ETO A;  4MZL A;  2E30 A;  2FJY A;  1J7P A;  1NWD A;  1UP5 A;  4D1E A;  3D76 A;  3GK2 A;  4GFT A;  2M9G A;  3JVT C;  3D77 A;  2WC6 A;  1JF2 A;  3JTD C;  2BL0 B;  1ALW A;  1OZS A;  1KWO B;  1GGZ A;  1IRJ A;  3TZ1 A;  1IG5 A;  3VRN A;  3O78 A;  5ER5 A;  1DF0 A;  3LK1 A;  3NSI A;  1WRK A;  3BUO B;  3KHE A;  1C3Z A;  1CFF A;  2LV7 A;  4NDC A;  1EL4 A;  1GM0 A;  1AJ4 A;  1QX5 B;  3I5F C;  2JT3 A;  4PHJ A;  2AUC A;  2F2O A;  1BR4 B;  4DS7 A;  3PLF B;  1VRK A;  1SL8 A;  5GQQ C;  2WOR A;  3SG3 A;  1KFU S;  1KQM B;  2ZNE A;  2PRU A;  4CFQ A;  2BKH B;  2H61 A;  2KI6 C;  3OBV A;  2PYQ A;  2K7D A;  1B7T Z;  2AMI A;  2L5X B;  5IBW A;  1JWD A;  3AAJ A;  1G4Y R;  4DIR A;  3FS7 A;  1KK8 C;  1NCY A;  4F0Z B;  2JTT A;  4MZK A;  2KBI A;  2F3Z A;  2L51 A;  3B6X A;  3FWC A;  2Y1N A;  2NCO A;  2O60 A;  4IL1 A;  4C0L A;  4MZJ A;  4PHN A;  1CDN A;  1LVC D;  2MBX A;  4C0J A;  4E68 A;  2JPO A;  1WRL A;  2QEV A;  2OS8 B;  3BFB A;  1SKT A;  3I5I C;  1OMV A;  3NGV A;  1CB1 A;  4PDZ A;  5BPJ A;  4PAL A;  1DJZ A;  5DKR A;  5JOL A;  1DGU A;  2CCM A;  4JPZ B;  1G33 A;  2WCE A; 
#chains in the Genus database with same CATH homology
 5CSI A;  2ZN8 A;  2L4I A;  2JWW A;  3HCM A;  1UHH A;  3D0Y A;  3VRP A;  1JF0 A;  3OB2 B;  1DJW A;  2LHI A;  4MRY A;  1QVI Z;  2MLF C;  2NZ0 A;  2ZKM X;  1BR1 B;  3PM8 A;  1J7O A;  4I5N B;  1J55 A;  3NSL A;  3KO0 A;  2ZND A;  1CFD A;  1WDC B;  2LMT A;  2JNF A;  3O6B A;  2JXC A;  1TCF A;  1DJH A;  1BJF A;  1YX8 A;  1M63 B;  1CMG A;  3MSE B;  4HSZ A;  3SG4 A;  4DCK A;  1OMD A;  1QXP A;  4A4B A;  2LLT A;  2G2B A;  2PSR A;  1J7R A;  1YRT B;  4NDB A;  1OOJ A;  3HX4 A;  1J1E A;  2A4J A;  2FJU B;  1B47 A;  2BE6 A;  2HQ8 A;  2K8M B;  2TN4 A;  2COL B;  3BOW A;  4WQ2 A;  2KFH A;  1S1E A;  2EC6 C;  2KYF A;  4I5L B;  1F71 A;  4FQO A;  2KYC A;  5JJG A;  3AAK A;  1KCY A;  1NX1 A;  3CR5 X;  3KF9 A;  1QLS A;  2OTG C;  1XFZ O;  4I5K A;  1JC2 A;  2M3W A;  3I5H C;  4XJK A;  4MBE A;  1TNP A;  1F54 A;  1A2X A;  1SBJ A;  1CLL A;  1GJY A;  1NUB A;  1QIV A;  2KGB C;  3I5G B;  1K9K A;  4PE1 A;  4XYN A;  1FPW A;  2GGZ A;  1IQ3 A;  1OZO A;  4OVN F;  3NSO A;  1TN4 A;  1IWQ A;  1V1F A;  4AQI A;  1QJT A;  1C7V A;  2MHH A;  4MLW A;  1A75 A;  2MRD A;  3IQO A;  1DF0 B;  3DD4 A;  3DVJ A;  2L50 A;  2LAP A;  1SL9 A;  3TUY B;  3QRX A;  4QJ5 B;  4GGF A;  2MJW B;  1OSA A;  4P5O E;  1BF5 A;  3TS5 B;  2JTZ A;  2PMY A;  3OP0 A;  2Y5I A;  1LKJ A;  1RK9 A;  2K61 A;  3VRR A;  1DJI A;  5I8N A;  5HKY A;  2V53 A;  1CLB A;  1IH0 A;  1CLM A;  1L2O B;  3CWG A;  3TUY C;  4GUK A;  4PHK A;  1FI5 A;  1G8I A;  4AQJ A;  4GGN A;  5AXI A;  3BYA A;  2HF5 A;  3VRQ A;  1PSR A;  4OCI A;  3OX5 A;  4OKH A;  1YVH A;  2LVV A;  1NP8 A;  1R6P A;  1DJX A;  1QAT A;  4MSP A;  5HLO A;  3ZNI A;  3PN7 B;  2LE9 B;  4WRI A;  1NYA A;  5G08 A;  1W7I B;  2CT9 A;  2LUC A;  3E3R A;  1C07 A;  1RTP 1;  3ZWH A;  1YX7 A;  2HET A;  1B1G A;  5TNC A;  1S26 D;  2I94 A;  1Y0V H;  1YUT A;  2Y4Q A;  2ZN9 A;  3D0Y B;  1NCX A;  1LIN A;  1IGV A;  2KI4 B;  2Y1M A;  4DRW A;  2L98 A;  4M2O A;  3AKA A;  2MAZ A;  2EGD A;  3FIA A;  1S6I A;  2NLN A;  5CSF A;  1K95 A;  1B8C A;  2LMU A;  2VRG A;  1S5G Y;  1BLQ A;  4P2Y B;  2KQY A;  3OX6 A;  1WLZ A;  1R2U A;  1N0Y A;  2KAY A;  4MVF A;  4OR9 B;  1BU3 A;  4M2P A;  1TIZ A;  2M1K B;  1CKK A;  1ALV A;  5ER4 X;  3LLE A;  3EKJ A;  2CBL A;  1A03 A;  2L4H A;  1K2H A;  2CXJ A;  1YRU B;  3EKH A;  4N1F A;  2M7N A;  2JNX A;  4BY5 A;  1AVS A;  2L2E A;  3NXA A;  3BOW B;  1K90 D;  1KSO A;  1QS7 A;  1M31 A;  1XO5 A;  2CTN A;  1XFW O;  5CSN A;  2CNP A;  3DVM A;  4CFR A;  1UWO A;  2NXQ A;  2MLE C;  4YGB B;  3DVK A;  2K0J A;  2JT8 A;  1J1D A;  1DVI A;  1XFU O;  1DJY A;  2QPT A;  3BUW B;  2PAL A;  3I5G C;  1YUU A;  4NQG A;  3M0W A;  2K7O A;  5PAL A;  4DUQ A;  4XJK B;  3WHT B;  1RRO A;  1U5I A;  2HPS A;  4GPL B;  1TNW A;  2FCD A;  2IS9 A;  4PE4 A;  2F3Y A;  3VGO A;  1KSM A;  1K9U A;  3LCP C;  1MXE A;  1AHR A;  2JPT A;  1UHI A;  2KGR A;  2MA2 A;  1Q80 A;  4YGE B;  1M45 A;  1A75 B;  2JOJ A;  3O4Y A;  1YVL A;  4PE0 A;  1D1O A;  1JFJ A;  1XYD A;  2BEC A;  1KFX L;  3TS5 C;  5AAN A;  5B8I B;  1PVA A;  1YR5 A;  2M49 B;  5K89 A;  3A8R A;  3OB1 B;  1BG1 A;  1CFP A;  1QLK A;  3IF7 A;  4ICB A;  2F8P A;  2KHN A;  2LLU A;  2WND A;  1NPQ A;  1XFY O;  2ZRT A;  3IQQ A;  1Y1U A;  1HT9 A;  4Q04 A;  1KK7 Y;  1RWY A;  1WRZ A;  1BT6 A;  3BXK A;  1KQV A;  1XFX O;  4USL A;  2KAX A;  1NX0 A;  2LLS A;  3K21 A;  3PN7 C;  1F4Q A;  5I2L A;  3PSR A;  1RJV A;  3DVE A;  2I2R E;  5KU1 A;  1BOC A;  1J7Q A;  2LP2 A;  2WCB A;  1HQV A;  2BCB A;  3JTD B;  2LC5 A;  2M1U A;  2BL0 C;  4HRH A;  1KWO C;  2KI4 C;  2KBM A;  1F4O A;  1S36 A;  1CTR A;  4PHM A;  2LCP A;  1AUI B;  3RLZ A;  3SJS A;  4AOM A;  2KQ6 A;  1EH2 A;  1CNP A;  3EVV A;  4HRE E;  3CR4 X;  4GAO A;  3CZT X;  4TNC A;  4UPG A;  1GGW A;  2LMV A;  1KQM C;  2JT0 A;  3A4U B;  1ZFS A;  1SR6 B;  2LP3 A;  2PVB A;  2LVJ A;  3D10 A;  1KK8 B;  1MHO A;  2K2F A;  4PCW A;  1B9A A;  1A4P A;  1DTL A;  1OMR A;  1X02 A;  2KOT A;  5KTY A;  1W7J B;  1N2D A;  4JWQ A;  1WY9 A;  2JZI A;  2GV5 A;  1XK4 C;  5HLV A;  4ORC B;  3WHU B;  1SY9 A;  1V1G A;  2OS8 C;  3BQ3 A;  3BUX B;  5D7F A;  2KI6 D;  3PAL A;  1TOP A;  1NIW A;  3F45 A;  1SCM B;  5FYX A;  3WNX B;  2KDH A;  5I2Q A;  2WOS A;  2K2A A;  2O5G A;  1AP4 A;  1EG4 A;  1MXL C;  1NX2 A;  3GOF A;  2LNK A;  2LM5 A;  1LXF C;  2BKI B;  1JFK A;  1U5I B;  1YUR A;  2EHB A;  4BY4 A;  1FW4 A;  2JQ6 A;  4YBH B;  1ZUZ A;  3VRO A;  2LAN A;  3NSK A;  4GNK B;  1B8R A;  1S6C A;  1LA0 A;  1GQM A;  2BBM A;  1WDC C;  2I7A A;  1H4B A;  1QX2 A;  2DOQ A;  2P6B B;  4L9M A;  1K94 A;  1WLM A;  4OV2 A;  5HKW A;  1S5G Z;  3TDU A;  4HRG A;  1TTX A;  1Y1A A;  1MQ1 A;  1NX3 A;  1TRF A;  3CR2 A;  1FBV A;  3PAT A;  1UUS A;  1EJ3 A;  3TDI A;  3EK8 A;  2R2I A;  1K8U A;  2KSP A;  2EC6 B;  2M29 A;  3LK0 A;  2AAO A;  1BMO A;  1NSH A;  2M8U A;  1AK8 A;  1SYM A;  2OTG B;  1Y6W A;  1QAS A;  1M46 A;  3I5H B;  2ISD A;  3RM1 A;  2M7L A;  4ORA B;  3GK4 X;  1PUL A;  1Y1X A;  2G9B A;  2FOT A;  4I5J A;  1CM1 A;  1NCZ A;  1CM4 A;  5DKQ A;  3SG2 A;  1B8L A;  2JU0 A;  3GK1 A;  3H4S E;  1PRW A;  4MN0 A;  1RFJ A;  2L0P A;  5D69 A;  3CTN A;  2BE4 A;  1L7Z A;  1PAL A;  4FTG A;  1SK6 D;  5CSJ A;  1N65 A;  3OHM B;  1LA3 A;  4CPV A;  1DGV A;  2H2K A;  1SR6 C;  1SCV A;  4MRX A;  4CID A;  1YTZ C;  1B7T Y;  4QJ4 B;  1S6J A;  2PAS A;  2M97 A;  2ZRS A;  2FCE A;  3DF0 A;  3SG6 A;  1SL7 A;  2BCA A;  3TDZ A;  2H61 C;  2JRF A;  5AEQ A;  1XA5 A;  1UHN A;  1UUR A;  4R1E A;  1H8B A;  3O2P A;  5CPV A;  1DT7 B;  1UHJ A;  4ZCU A;  3CLN A;  1E8A A;  1K96 A;  1K93 D;  1L2O C;  3C1V A;  3BUN B;  4N1G A;  5F6T A;  3CGA A;  1M39 A;  1TNQ A;  2JUL A;  1ZOT B;  1SCM C;  1REC A;  1AJ5 A;  1IQ5 A;  4QJ3 B;  1KK7 Z;  4YGD B;  1F8H A;  4U8D A;  3WXA A;  3CS1 A;  1ZMZ A;  2BBN A;  1EG3 A;  1QVI Y;  2WC8 A;  4JQ0 D;  4MEW A;  5HYD A;  3AKB A;  1K9P A;  3KEV A;  3JVT B;  3EK4 A;  3SIA A;  1DMO A;  1CDP A;  4YGA A;  1CMF A;  1YUS A;  1KFX S;  3EK7 A;  1ZAC A;  5KSZ A;  4ORB B;  4PE7 A;  1B4C A;  1TCO B;  3FWB A;  3LL8 B;  4NDD A;  1QIW A;  3I5F B;  4GBA A;  1SPY A;  2JXL A;  4CLN A;  1SRA A;  1QV1 A;  3ICB A;  2KFF A;  1IJ5 A;  4A4C A;  1XVJ A;  2Q4U A;  2ZFD A;  3EVR A;  1SMG A;  1XK4 A;  3BUM B;  1MF8 B;  2OPO A;  1PVB A;  3PFV A;  2BCX A;  1OE9 B;  1SNL A;  2KAV A;  2LVK A;  1JBA A;  1F70 A;  4M2Q A;  1QV0 A;  5I2O A;  2RGI A;  4ZCV A;  1TNX A;  1XFV O;  3I5I B;  2D8N A;  4N5X A;  3SG5 A;  5DKN A;  1JSA A;  1JUO A;  1OQP A;  2LHL A;  4YI8 A;  1BOD A;  2I18 A;  1IKU A;  1FI6 A;  4C0K A;  2LUX A;  1IJ6 A;  1S3P A;  1DJG A;  2Q91 A;  2F33 A;  4WQ3 A;  1QX7 A;  3SG7 A;  2LVI A;  1EXR A;  1CDL A;  2QAC A;  1MUX A;  1CFC A;  1PSB A;  2F2P A;  1C7W A;  2K7C A;  2JC2 A;  1SW8 A;  1ODB A;  2M0R A;  1MWN A;  2KFG A;  4GGF C;  5AER A;  1A29 A;  1CDM A;  2E6W A;  2SAS A;  1UHK A;  3DF0 B;  2GGM A;  2B1U A;  4YGC B;  2HQW A;  2KNE A;  2WCF A;  1MR8 A;  2NCP A;  1PK0 D;  1KFU L;  4YRU A;  5AFP A;  3KPX A;  5J3X A;  1F55 A;  1QTX A;  3EVU A;  5HKZ A;  1FF1 A;  3SIB A;  2SCP A;  2K7B A;  4YI9 A;  4ETO A;  4MZL A;  2E30 A;  1J7P A;  1NWD A;  1UP5 A;  4D1E A;  3GK2 A;  4GFT A;  2M9G A;  3JVT C;  1JF2 A;  3JTD C;  2BL0 B;  1ALW A;  1OZS A;  1KWO B;  1GGZ A;  1IRJ A;  3TZ1 A;  1IG5 A;  3VRN A;  3O78 A;  5ER5 A;  1DF0 A;  3LK1 A;  3NSI A;  1WRK A;  3BUO B;  3KHE A;  1CFF A;  2LV7 A;  4NDC A;  1EL4 A;  1AJ4 A;  1QX5 B;  3I5F C;  2JT3 A;  4PHJ A;  2AUC A;  2F2O A;  1BR4 B;  4DS7 A;  3PLF B;  1VRK A;  1SL8 A;  5GQQ C;  2WOR A;  3SG3 A;  1KFU S;  1KQM B;  2ZNE A;  2PRU A;  4CFQ A;  2BKH B;  2H61 A;  2KI6 C;  2K7D A;  1B7T Z;  2AMI A;  2L5X B;  5IBW A;  1JWD A;  3AAJ A;  1G4Y R;  4DIR A;  3FS7 A;  1KK8 C;  1NCY A;  4F0Z B;  2JTT A;  4MZK A;  2KBI A;  2F3Z A;  2L51 A;  3FWC A;  4C0L A;  2Y1N A;  2NCO A;  2O60 A;  4IL1 A;  4MZJ A;  4PHN A;  1CDN A;  1LVC D;  2MBX A;  4C0J A;  4E68 A;  1WRL A;  2OS8 B;  1SKT A;  3I5I C;  1OMV A;  1CB1 A;  4PDZ A;  5BPJ A;  4PAL A;  1DJZ A;  5DKR A;  5JOL A;  1DGU A;  2CCM A;  4JPZ B;  1G33 A;  2WCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...