2SCPA

Structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
174
structure length
174
Chain Sequence
SDLWVQKMKTYFNRIDFDKDGAITRMDFESMAERFAKESEMKAEHAKVLMDSLTGVWDNFLTAVAGGKGIDETTFINSMKEMVKNPEAKSVVEGPLPLFFRAVDTNEDNNISRDEYGIFFGMLGLDKTMAPASFDAIDTNNDGLLSLEEFVIAGSDFFMNDGDSTNKVFWGPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARCOPLASMIC CALCIUM-BINDING PROTEIN
publication title Structure of a sarcoplasmic calcium-binding protein from Nereis diversicolor refined at 2.0 A resolution.
pubmed doi rcsb
source organism Neanthes diversicolor
molecule tags Binding protein
total genus 70
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2scpA00
1K2HA 3ZNIA 2MLEC 1DJWA 5CSIA 5AXIA 1PVAA 1MQ1A 2BECA 1FF1A 4P2YB 2L4IA 1JBAA 1EJ3A 2WC8A 3EK7A 4GBAA 5HYDA 1NYAA 1Y1AA 2L51A 2I2RE 3SIAA 2GGZA 1TNPA 2WCEA 3PATA 1M39A 2K2AA 1IG5A 1CTRA 1PRWA 2JRFA 3TUYB 2LVKA 5KSZA 1BOCA 3BUXB 1KQMB 1OMDA 1TCFA 2ISDA 3WHUB 4PHMA 2NLNA 2LLTA 3I5GB 5GQQC 2BKHB 2ZFDA 3CR5X 1NP8A 4ZCVA 3BUWB 1A2XA 2KSPA 1SBJA 1F70A 1U5IA 1U5IB 2JQ6A 1L7ZA 1A75B 1FBVA 4GPLB 4DCKA 1PVBA 2G9BA 4NDBA 1GJYA 1M46A 2MAZA 1DJZA 4OCIA 2MJWB 4JQ0D 3BOWB 1XFYO 1XVJA 2WCFA 3SG5A 2LC5A 4CFQA 2QPTA 1Y1XA 1SYMA 2OTGC 3CS1A 2PVBA 1UHNA 1N0YA 3TS5C 4ORAB 1MWNA 1R2UA 2BBMA 2EC6C 1WY9A 3A8RA 2GV5A 2KAYA 1B4CA 1JWDA 4MLWA 1KK8C 1OZOA 5G08A 1BF5A 4DRWA 2CBLA 2KBMA 2CXJA 1S6IA 5DKRA 4YGCB 2JXCA 1M45A 2MA2A 4M2PA 2I7AA 2KI4B 2LLSA 1K94A 2WNDA 4PE4A 1JC2A 4N5XA 1CLMA 1BR1B 4USLA 1ODBA 3SG4A 5J3XA 1F54A 2BL0B 2M8UA 1S5GZ 2Y4QA 2LMVA 2EGDA 5HLVA 1SCMC 2Q91A 3NSOA 1XFZO 4PALA 1KWOB 2L4HA 1PSRA 2HQWA 3AKAA 2KDHA 1Y6WA 1A03A 1S3PA 3NSIA 4YI8A 1LKJA 2JTZA 2M3WA 1YURA 5TNCA 4BY4A 2CCMA 1OOJA 2FCDA 2F2OA 2PMYA 2KFFA 3TDZA 3JTDC 4JPZB 1M63B 2B1UA 1VRKA 4PHJA 1LXFC 1IJ6A 3FIAA 3CWGA 2O60A 3I5FC 2AMIA 3K21A 3PLFB 4WQ3A 1JSAA 3LK1A 1SL7A 1OE9B 2BBNA 1YRUB 1XYDA 2PSRA 5I2LA 2OS8C 1YVLA 3SJSA 1SY9A 4MVFA 1PALA 1Q80A 1L2OC 1TNQA 2KGBC 3O4YA 1NCZA 1AK8A 1MF8B 1ZOTB 1SW8A 1KCYA 1J1DA 1S6CA 2M49B 4A4BA 1WRZA 4MRYA 5ER4X 1TIZA 3NSLA 2NCOA 2ZNDA 4PHNA 2VRGA 2QACA 1J7OA 1ALVA 3NSKA 1E8AA 1C7WA 1EXRA 5DKQA 3PFVA 3AAJA 3PM8A 4DS7A 3ZWHA 2H61A 1BU3A 4AOMA 2F33A 1A29A 3OP0A 1K9PA 1RJVA 3DVKA 1HT9A 2LMTA 1CDPA 3TZ1A 3SIBA 1CM1A 3BXKA 2R2IA 2TN4A 1UP5A 3BQ3A 4D1EA 1C07A 4AQJA 1QX2A 3M0WA 1CNPA 1JF0A 1TCOB 2AAOA 4CFRA 1W7JB 2LHIA 1KSMA 2P6BB 3FWCA 1GGZA 1J1EA 1S36A 5HLOA 1IQ3A 2OPOA 1LA3A 1AP4A 1M31A 4FQOA 1WDCC 1C7VA 3I5IB 1AUIB 4N1FA 1QTXA 1RECA 4YGBB 1F8HA 2JNXA 1QASA 3CR2A 2Y1NA 1ZACA 2K8MB 2H2KA 3OHMB 4F0ZB 3EK8A 2M7LA 2KBIA 2Y1MA 3BYAA 1IKUA 4GUKA 3SG3A 1DJXA 3HX4A 2CT9A 1QATA 4UPGA 1CDNA 1LA0A 2ZRTA 3EKHA 3SG2A 3DVJA 2CTNA 1TN4A 1CB1A 1DTLA 1B8RA 3LL8B 3JVTC 1MUXA 1YX7A 4WQ2A 3KEVA 5ER5A 2I18A 2JNFA 4HRGA 2EHBA 4QJ3B 2KQYA 1OMVA 4GGFA 3VRQA 1KQVA 5D7FA 5JJGA 2PASA 2L5XB 4DIRA 3AAKA 1CFCA 1GQMA 4MSPA 1CMGA 5K89A 1G8IA 1B8CA 4QJ5B 1SMGA 1QX7A 4Q04A 2SCPA 1F55A 3DVMA 1SR6C 1KSOA 1J7RA 1QLKA 2K7DA 2KFHA 2MBXA 1XA5A 4JWQA 1YUTA 1IQ5A 1X02A 1Y0VH 3BUOB 5B8IB 4YBHB 4C0KA 1ALWA 3PN7B 1FI6A 1BR4B 1WRKA 3I5HC 5IBWA 1JFJA 1XFWO 5F6TA 2WORA 1ZFSA 1NCYA 1N2DA 1CLLA 5JOLA 2NZ0A 1IWQA 2JXLA 2ZN8A 5BPJA 1SPYA 1ZUZA 3WXAA 1KK7Z 4E68A 4ORCB 3VROA 4ICBA 1QV1A 4GNKB 2BCXA 3RM1A 1CFDA 2LUXA 2A4JA 1G4YR 3QRXA 4YRUA 5KU1A 3E3RA 1DMOA 1CFFA 1CFPA 1HQVA 5I8NA 2LM5A 5I2OA 1H4BA 1TNXA 1DGUA 1XFVO 1DF0A 1DF0B 1BMOA 1YRTB 4ZCUA 1CDLA 2DOQA 3FWBA 1XK4C 3F45A 4MEWA 1F4OA 1BLQA 2LE9B 1WLZA 4MRXA 4MZLA 4MZKA 1TTXA 1QIVA 5AFPA 2JC2A 1OQPA 2MRDA 1S5GY 2FJUB 1KK7Y 1NWDA 2KYFA 5I2QA 3CTNA 1SK6D 1EL4A 3TUYC 2ZN9A 5AANA 2BCAA 1KQMC 1NX2A 2FOTA 2OTGB 2LHLA 2KAXA 1B8LA 3EVRA 4NQGA 3TS5B 2F2PA 1DJIA 3I5GC 3BUNB 1AJ5A 2EC6B 3EK4A 2BE6A 3HCMA 2BCBA 2Q4UA 1IRJA 1QIWA 4ORBB 2NXQA 2HPSA 1AJ4A 2LP3A 1KK8B 1CLBA 1A4PA 4WRIA 1B7TZ 1MR8A 3D10A 1B47A 1XO5A 1NCXA 1OSAA 3GK1A 4I5KA 3SG6A 2MLFC 4ETOA 3OX5A 4FTGA 2M1UA 1K93D 4C0JA 3I5HB 3LCPC 1SL9A 3CGAA 1GGWA 1ZMZA 2KQ6A 3DD4A 3O78A 1JF2A 3EKJA 2M29A 3IQQA 1AHRA 1SCMB 2K7CA 2ZRSA 3BUMB 3GK4X 4GAOA 1S26D 1DGVA 1S6JA 3WHTB 1BODA 1BG1A 2GGMA 5FYXA 1H8BA 2HF5A 2LVIA 4MZJA 1CKKA 1QJTA 1F4QA 2V53A 4I5NB 2F3YA 4PE0A 1NIWA 1KFUL 3JTDB 1AVSA 1KFXS 5HKYA 4OVNF 2NCPA 2PRUA 4PDZA 2WOSA 1SL8A 1CM4A 1MHOA 3I5FB 3OX6A 4AQIA 2KI4C 1J7PA 2LVJA 1YR5A 4HSZA 2LCPA 1EG3A 2LLUA 1IGVA 1NX3A 4IL1A 4MBEA 3KO0A 2MHHA 2BL0C 1NX0A 1F71A 1YUUA 2OS8B 3O2PA 1RFJA 1RTP1 4NDCA 3FS7A 1RK9A 2JT3A 1SCVA 3VRPA 1KWOC 1L2OB 2KAVA 3H4SE 3LK0A 2JZIA 4R1EA 1FW4A 5AEQA 1UURA 2F3ZA 1D1OA 3PSRA 1QXPA 2LMUA 2JWWA 2KYCA 3ICBA 2G2BA 4YI9A 1A75A 1W7IB 1K9UA 3CLNA 2ZKMX 3AKBA 2LNKA 1G33A 2L98A 2L2EA 2KNEA 4QJ4B 5AERA 1MXLC 2E30A 3TDIA 1TOPA 1KFUS 3CR4X 4U8DA 3BOWA 2FCEA 1R6PA 1DJGA 1UHIA 2LV7A 3SG7A 3GK2A 1UHKA 2Y5IA 1TRFA 2K61A 2JULA 1DJYA 5PALA 2COLB 5CSNA 2L0PA 1N65A 2JTTA 2LVVA 1K8UA 4GGNA 1DJHA 5CSJA 1NPQA 2AUCA 3D0YA 3D0YB 2LANA 1TNWA 4N1GA 1B1GA 1K96A 1QV0A 1BJFA 1WDCB 1PK0D 2IS9A 4YGDB 1K90D 2WCBA 4OR9B 2F8PA 4PCWA 5HKZA 3OB1B 1QS7A 2H61C 2KI6C 1PULA 4TNCA 2SASA 3VRRA 2BE4A 4CPVA 1NX1A 2L50A 2LP2A 2M9GA 1FI5A 4M2OA 1WRLA 2KI6D 2K2FA 1B9AA 1S1EA 1UWOA 2LUCA 4CIDA 4XYNA 1IJ5A 4DUQA 5CPVA 1YUSA 5CSFA 1QVIZ 3JVTB 2M1KB 2M7NA 2ZNEA 4NDDA 1RROA 5HKWA 1CDMA 1K95A 5KTYA 2JOJA 2K0JA 2HETA 1OMRA 4PE1A 2CNPA 3EVUA 2D8NA 2M97A 3I5IC 4OKHA 4PHKA 1EH2A 4C0LA 2PALA 4HRHA 1KFXL 4GFTA 1QX5B 3LLEA 2KOTA 4I5LB 3IQOA 2RGIA 1XFUO 1SR6B 4OV2A 1QLSA 1SNLA 1V1FA 2LAPA 1J55A 3VGOA 1EG4A 3C1VA 3DVEA 4XJKA 4XJKB 1FPWA 2HQ8A 1IH0A 3OB2B 1NUBA 4HREE 4P5OE 1MXEA 1YX8A 2K7OA 1Y1UA 1UHHA 1QVIY 4PE7A 4A4CA 3DF0A 3DF0B 3NXAA 1DVIA 3A4UB 1YTZC 2KGRA 1J7QA 4GGFC 1XFXO 2KHNA 3WNXB 2JT0A 3O6BA 2O5GA 1OZSA 3PALA 3RLZA 2E6WA 3TDUA 3VRNA 1WLMA 1NSHA 1JUOA 2M0RA 3CZTX 3MSEB 4I5JA 2JU0A 1LINA 3GOFA 5D69A 3KPXA 1BT6A 1SKTA 1UUSA 2KFGA 3KHEA 2BKIB 1V1GA 4MN0A 4CLNA 1SRAA 1YVHA 1B7TY 1DT7B 4M2QA 1RWYA 3IF7A 1LVCD 2JPTA 1JFKA 3KF9A 1CMFA 5DKNA 2JT8A 1UHJA 2I94A 3PN7C 4YGEB 4YGAA 2K7BA 1PSBA 3EVVA 1K9KA 4L9MA 4BY5A 1XK4A
chains in the Genus database with same CATH superfamily
1K2HA 3ZNIA 2MLEC 1DJWA 5CSIA 5AXIA 1PVAA 1MQ1A 2BECA 1FF1A 1OOIX 4P2YB 2L4IA 1JBAA 1EJ3A 2WC8A 3EK7A 4GBAA 5HYDA 1NYAA 1Y1AA 2L51A 2I2RE 2QEOA 3SIAA 2GGZA 1TNPA 2WCEA 3PATA 1M39A 2K2AA 1IG5A 1CTRA 1PRWA 1W9ZA 2JRFA 2LVKA 3TUYB 5KSZA 3BUXB 1BOCA 1KQMB 3CZ0A 1OMDA 1DELA 1TCFA 2ISDA 3WHUB 4PHMA 2NLNA 2LLTA 3I5GB 5GQQC 2BKHB 3PJIA 2ZFDA 3CR5X 1NP8A 4ZCVA 1GM0A 3BUWB 1A2XA 2KSPA 1SBJA 1F70A 1U5IA 1U5IB 2JQ6A 1L7ZA 2QEBA 4IJ7A 1A75B 1FBVA 4GPLB 3V2LA 4DCKA 4KYNA 1PVBA 2G9BA 4NDBA 1GJYA 3D74A 3CDNA 1C3YA 1M46A 2MAZA 2KPHA 1DJZA 4OCIA 1TUJA 2MJWB 5HL1A 4JQ0D 2PQLA 2QEHA 1XFYO 1XVJA 3BOWB 2WCFA 3SG5A 2LC5A 4CFQA 1TWOA 2QPTA 3DY9A 2H8VA 1Y1XA 3D77A 1SYMA 2OTGC 3CS1A 2PVBA 1UHNA 1N0YA 3TS5C 3SS4A 4ORAB 1MWNA 1R2UA 2BBMA 2EC6C 1WY9A 3S0AA 2K60A 3A8RA 2GV5A 2KAYA 3L4AA 4FQTA 1B4CA 1JWDA 4MLWA 1KK8C 3CZ2A 1OZOA 5G08A 1BF5A 3UNWA 4DRWA 2CBLA 2KBMA 2CXJA 1S6IA 5DKRA 4YGCB 2JXCA 3IVTA 1M45A 2MA2A 4M2PA 2I7AA 2KI4B 2LLSA 1K94A 2WNDA 4PE4A 1JC2A 4N5XA 1CLMA 1BR1B 4USLA 1ODBA 3SG4A 5J3XA 1F54A 2BL0B 2M8UA 1DEKA 1S5GZ 2Y4QA 2LMVA 2EGDA 5HLVA 1SCMC 2Q91A 3NSOA 1XFZO 4PALA 1KWOB 2L4HA 1PSRA 2HQWA 3AKAA 2KDHA 1C3ZA 1Y6WA 1A03A 1S3PA 3NSIA 4YI8A 1LKJA 2JTZA 2M3WA 1YURA 5TNCA 4BY4A 2CCMA 1OOJA 2FCDA 2F2OA 2PMYA 2PYQA 2KFFA 3TDZA 3JTDC 4JPZB 1M63B 2B1UA 1DQEA 1LS8A 1VRKA 4PHJA 1LXFC 1IJ6A 3FIAA 3CWGA 2O60A 3I5FC 2AMIA 3K21A 3PLFB 4WQ3A 1JSAA 3LK1A 1SL7A 1OE9B 2BBNA 1YRUB 1XYDA 2PSRA 5I2LA 2OS8C 1YVLA 3SJSA 1SY9A 4MVFA 1PALA 1TUZA 3PM2A 3D78A 1Q80A 1L2OC 1TNQA 3DYEA 2KGBC 3O4YA 1NCZA 1AK8A 1MF8B 1ZOTB 1SW8A 1KCYA 1J1DA 1DC1A 1S6CA 2M49B 4A4BA 3RZSA 1WRZA 4MRYA 3CABA 5ER4X 1TIZA 3NSLA 2NCOA 2ZNDA 3NHIA 4PHNA 2L5YA 2VRGA 2QACA 1J7OA 1ALVA 3NSKA 1E8AA 1C7WA 3NHTA 1EXRA 5EL2A 5DKQA 3PFVA 3AAJA 3PM8A 4DS7A 3ZWHA 2H61A 1BU3A 4AOMA 2F33A 1A29A 3OP0A 1K9PA 1RJVA 3DVKA 1HT9A 2LMTA 1CDPA 3TZ1A 3SIBA 1CM1A 3L4LA 3BXKA 2R2IA 2TN4A 1UP5A 3BQ3A 4JD9A 4D1EA 1C07A 4AQJA 1QX2A 3M0WA 1CNPA 1JF0A 1TCOB 2AAOA 2QEVA 4CFRA 1W7JB 2LHIA 2BAPA 1KSMA 2P6BB 1OOGA 3FWCA 1GGZA 1J1EA 1S36A 5HLOA 1IQ3A 2OPOA 2KLEA 1LA3A 1AP4A 1M31A 4FQOA 1WDCC 1C7VA 3I5IB 1AUIB 4N1FA 1QTXA 1RECA 4YGBB 1OW4A 1F8HA 2JNXA 1QASA 3CR2A 2Y1NA 1ZACA 3OGNA 2K8MB 2H2KA 3OHMB 4F0ZB 3EK8A 2M7LA 3R72A 2KBIA 2Y1MA 3BYAA 3L47A 1IKUA 4GUKA 3SG3A 1DJXA 3HX4A 2CT9A 1QATA 1QWVA 4UPGA 1LA0A 1CDNA 1Z2CB 2ZRTA 3EKHA 3SG2A 3DVJA 2CTNA 1TN4A 1CB1A 1DTLA 1B8RA 3LL8B 3JVTC 3R1PA 1MUXA 1YX7A 4WQ2A 3R1VA 3KEVA 5ER5A 2I18A 2L2CA 2JNFA 4HRGA 2EHBA 4QJ3B 2KQYA 1OMVA 2WC6A 4GGFA 3VRQA 1KQVA 5D7FA 2WC5A 5JJGA 2PASA 2L5XB 4DIRA 3AAKA 1CFCA 1GQMA 4MSPA 1CMGA 5K89A 1G8IA 1B8CA 3S0FA 4QJ5B 1SMGA 1QX7A 3N7HA 4Q04A 2SCPA 1F55A 3DVMA 1SR6C 1KSOA 1J7RA 1QLKA 2K7DA 3S0DA 3FE6A 2KFHA 2MBXA 1XA5A 4JWQA 1YUTA 4PT1A 1IQ5A 3B87A 1X02A 1Y0VH 3BUOB 5B8IB 4YBHB 2WCMA 4C0KA 1ALWA 3PN7B 1FI6A 1BR4B 1WRKA 3I5HC 5IBWA 1JFJA 1XFWO 5F6TA 2WORA 1ZFSA 5FI6A 1NCYA 1N2DA 1CLLA 5JOLA 2NZ0A 1IWQA 2JXLA 2ZN8A 3DZTA 5BPJA 1SPYA 1ZUZA 3WXAA 1KK7Z 1XFRA 4E68A 4ORCB 3VROA 4ICBA 1QV1A 4GNKB 5D3OA 1SSEB 2BCXA 3RM1A 1CFDA 2LUXA 2A4JA 1G4YR 3QRXA 4YRUA 5KU1A 3BJHA 3E3RA 1DMOA 1CFFA 1CFPA 1HQVA 5I8NA 2LM5A 5I2OA 1H4BA 1TNXA 1DGUA 1XFVO 1DF0A 1DF0B 1BMOA 1YRTB 4ZCUA 1CDLA 2DOQA 3FWBA 1XK4C 3F45A 4MEWA 1F4OA 1OOHA 1BLQA 2LE9B 1WLZA 4MRXA 4MZLA 4MZKA 2ERBA 1TTXA 3EG5B 1QIVA 5AFPA 2JC2A 1OQPA 2MRDA 1S5GY 2FJUB 1KK7Y 1NWDA 2KYFA 5I2QA 3CTNA 5DICA 1SK6D 1EL4A 3TUYC 2ZN9A 5AANA 2BCAA 1KQMC 1NX2A 2FOTA 2OTGB 2LHLA 2KAXA 1B8LA 3EVRA 4NQGA 3TS5B 2F2PA 1DJIA 3I5GC 3BUNB 1AJ5A 2EC6B 3EK4A 3D73A 2WCKA 2P70A 2BE6A 2GTEA 3HCMA 2BCBA 2Q4UA 1IRJA 1QIWA 4ORBB 2NXQA 2HPSA 1AJ4A 2LP3A 1KK8B 5FI2A 1CLBA 1A4PA 4WRIA 1B7TZ 1MR8A 3D10A 1B47A 1XO5A 1NCXA 1OSAA 3GK1A 4I5KA 3SG6A 2MLFC 4ETOA 3OX5A 4FTGA 2M1UA 1K93D 4C0JA 3I5HB 3LCPC 1SL9A 3CGAA 1GGWA 1ORGA 1ZMZA 2KQ6A 3B86A 3B88A 3DD4A 1JF2A 2P71A 3EKJA 3O78A 2M29A 3IQQA 1AHRA 2JPOA 1SCMB 2K7CA 2ZRSA 3BUMB 3SS5A 3GK4X 4GAOA 1S26D 1DGVA 1S6JA 3WHTB 2WCLA 1BODA 1BG1A 1OOFA 3S0GA 3R1OA 2GGMA 5FYXA 1H8BA 2HF5A 2LVIA 4MZJA 1CKKA 1QJTA 1F4QA 2V53A 4I5NB 2F3YA 4JKTA 4PE0A 1NIWA 1KFUL 3CZ1A 3FE9A 1AVSA 3JTDB 1KFXS 4F7FA 5HKYA 4OVNF 2NCPA 2PRUA 4PDZA 2WOSA 1SL8A 1CM4A 1MHOA 3QMEA 3I5FB 3OX6A 4AQIA 2KI4C 1J7PA 2LVJA 1YR5A 4HSZA 2LCPA 1EG3A 2LLUA 1IGVA 1NX3A 4IL1A 4MBEA 3KO0A 2MHHA 2BL0C 1NX0A 1F71A 1YUUA 2OS8B 3O2PA 1RFJA 1RTP1 4NDCA 3FS7A 1RK9A 2JT3A 1SCVA 1P28A 3VRPA 1KWOC 1L2OB 2KAVA 3H4SE 3LK0A 2JZIA 4R1EA 3BFHA 1FW4A 5AEQA 1UURA 2F3ZA 1D1OA 3PSRA 1QXPA 2LMUA 2JWWA 5FI7A 2KYCA 1Z4HA 3NGVA 3ICBA 3S0BA 2G2BA 4YI9A 1A75A 1W7IB 1K9UA 3CLNA 2ZKMX 3AKBA 2LNKA 2KLDA 1G33A 2L98A 2L2EA 2KNEA 4QJ4B 2WCJA 5AERA 1MXLC 2E30A 3TDIA 1TOPA 1KFUS 3CR4X 4U8DA 3BOWA 2FCEA 1R6PA 4INXA 2FJYA 1DJGA 1UHIA 2LV7A 3SG7A 3GK2A 1UHKA 2Y5IA 1TRFA 2K61A 2JULA 1DJYA 5PALA 2COLB 5CSNA 2L0PA 1N65A 3B7AA 2JTTA 2LVVA 1K8UA 4GGNA 1DJHA 5CSJA 1NPQA 2AUCA 3D0YA 3D0YB 2LANA 1TNWA 4N1GA 1B1GA 1K96A 1QV0A 1BJFA 1WDCB 1PK0D 2IS9A 4YGDB 1K90D 2WCBA 4OR9B 3FE8A 2F8PA 4PCWA 3D76A 3OB1B 1QS7A 4INWA 5HKZA 2H61C 2KI6C 1PULA 4TNCA 2SASA 3VRRA 2BE4A 4CPVA 1NX1A 2L50A 2LP2A 2M9GA 3B6XA 4M2OA 1FI5A 1WRLA 2KI6D 2K2FA 1B9AA 1S1EA 1UWOA 2LUCA 4CIDA 4XYNA 4OZDA 1IJ5A 3Q8IA 4DUQA 5CPVA 1YUSA 5CSFA 1QVIZ 3JVTB 2M1KB 2M7NA 3BFAA 3UO9A 2ZNEA 4NDDA 1RROA 5HKWA 1CDMA 3D75A 1K95A 5KTYA 2JOJA 2K0JA 2HETA 1OMRA 4PE1A 2CNPA 3EVUA 2D8NA 2M97A 3I5IC 4OKHA 4PHKA 1EH2A 1IIOA 4C0LA 3CYZA 2PALA 4HRHA 1KFXL 1T14A 4GFTA 1QX5B 3LLEA 2KOTA 4I5LB 3IQOA 2RGIA 1XFUO 1SR6B 4OV2A 1QLSA 1SNLA 1V1FA 2LAPA 1J55A 3VGOA 1EG4A 3C1VA 3DVEA 4XJKA 4XJKB 1FPWA 2HQ8A 1IH0A 2YGUA 3OB2B 1NUBA 4HREE 4P5OE 1MXEA 1YX8A 2K7OA 1Y1UA 5I94A 3K1EA 1UHHA 1QVIY 4PE7A 4A4CA 3DF0A 3DF0B 3SS3A 3NXAA 1DVIA 3A4UB 3O4XA 1YTZC 2KGRA 1J7QA 4GGFC 3DXLA 2WCHA 1XFXO 3VB1A 2KHNA 3BFBA 3WNXB 2JT0A 3O6BA 2O5GA 1OZSA 3PALA 3RLZA 2E6WA 3TDUA 3VRNA 1WLMA 1NSHA 1JUOA 2M0RA 3CZTX 3MSEB 4I5JA 2JU0A 1LINA 3GOFA 5D69A 3OBVA 2BNXA 1BT6A 1SKTA 1UUSA 3KPXA 2KFGA 3KHEA 2BKIB 1V1GA 4MN0A 4CLNA 1SRAA 1YVHA 1B7TY 1DT7B 4M2QA 1RWYA 3IF7A 1LVCD 2JPTA 1JFKA 3KF9A 3S0EA 5DKNA 1CMFA 2JT8A 1UHJA 2I94A 3PN7C 4YGEB 4YGAA 2K7BA 1PSBA 3EVVA 1K9KA 4L9MA 4BY5A 2QDIA 1XK4A
chains in the Genus database with same CATH topology
1K2HA 3ZNIA 2MLEC 1DJWA 5CSIA 5AXIA 1PVAA 1MQ1A 2BECA 1FF1A 4P2YB 2L4IA 1JBAA 1EJ3A 2WC8A 3EK7A 4GBAA 5HYDA 1NYAA 1Y1AA 2L51A 2I2RE 3SIAA 2GGZA 1TNPA 2WCEA 3PATA 1M39A 2K2AA 1IG5A 1CTRA 1PRWA 2JRFA 3TUYB 2LVKA 5KSZA 1BOCA 3BUXB 1KQMB 1OMDA 1TCFA 2ISDA 3WHUB 4PHMA 2NLNA 2LLTA 3I5GB 5GQQC 2BKHB 2ZFDA 3CR5X 1NP8A 4ZCVA 3BUWB 1A2XA 2KSPA 1SBJA 1F70A 1U5IA 1U5IB 2JQ6A 1L7ZA 1A75B 1FBVA 4GPLB 4DCKA 1PVBA 2G9BA 4NDBA 1GJYA 1M46A 2MAZA 1DJZA 4OCIA 2MJWB 4JQ0D 3BOWB 1XFYO 1XVJA 2WCFA 3SG5A 2LC5A 4CFQA 2QPTA 1Y1XA 1SYMA 2OTGC 3CS1A 2PVBA 1UHNA 1N0YA 3TS5C 4ORAB 1MWNA 1R2UA 2BBMA 2EC6C 1WY9A 3A8RA 2GV5A 2KAYA 1B4CA 1JWDA 4MLWA 1KK8C 1OZOA 5G08A 1BF5A 4DRWA 2CBLA 2KBMA 2CXJA 1S6IA 5DKRA 4YGCB 2JXCA 1M45A 2MA2A 4M2PA 2I7AA 2KI4B 2LLSA 1K94A 2WNDA 4PE4A 1JC2A 4N5XA 1CLMA 1BR1B 4USLA 1ODBA 3SG4A 5J3XA 1F54A 2BL0B 2M8UA 1S5GZ 2Y4QA 2LMVA 2EGDA 5HLVA 1SCMC 2Q91A 3NSOA 1XFZO 4PALA 1KWOB 2L4HA 1PSRA 2HQWA 3AKAA 2KDHA 1Y6WA 1A03A 1S3PA 3NSIA 4YI8A 1LKJA 2JTZA 2M3WA 1YURA 5TNCA 4BY4A 2CCMA 1OOJA 2FCDA 2F2OA 2PMYA 2KFFA 3TDZA 3JTDC 4JPZB 1M63B 2B1UA 1VRKA 4PHJA 1LXFC 1IJ6A 3FIAA 3CWGA 2O60A 3I5FC 2AMIA 3K21A 3PLFB 4WQ3A 1JSAA 3LK1A 1SL7A 1OE9B 2BBNA 1YRUB 1XYDA 2PSRA 5I2LA 2OS8C 1YVLA 3SJSA 1SY9A 4MVFA 1PALA 1Q80A 1L2OC 1TNQA 2KGBC 3O4YA 1NCZA 1AK8A 1MF8B 1ZOTB 1SW8A 1KCYA 1J1DA 1S6CA 2M49B 4A4BA 1WRZA 4MRYA 5ER4X 1TIZA 3NSLA 2NCOA 2ZNDA 4PHNA 2VRGA 2QACA 1J7OA 1ALVA 3NSKA 1E8AA 1C7WA 1EXRA 5DKQA 3PFVA 3AAJA 3PM8A 4DS7A 3ZWHA 2H61A 1BU3A 4AOMA 2F33A 1A29A 3OP0A 1K9PA 1RJVA 3DVKA 1HT9A 2LMTA 1CDPA 3TZ1A 3SIBA 1CM1A 3BXKA 2R2IA 2TN4A 1UP5A 3BQ3A 4D1EA 1C07A 4AQJA 1QX2A 3M0WA 1CNPA 1JF0A 1TCOB 2AAOA 4CFRA 1W7JB 2LHIA 1KSMA 2P6BB 3FWCA 1GGZA 1J1EA 1S36A 5HLOA 1IQ3A 2OPOA 1LA3A 1AP4A 1M31A 4FQOA 1WDCC 1C7VA 3I5IB 1AUIB 4N1FA 1QTXA 1RECA 4YGBB 1F8HA 2JNXA 1QASA 3CR2A 2Y1NA 1ZACA 2K8MB 2H2KA 3OHMB 4F0ZB 3EK8A 2M7LA 2KBIA 2Y1MA 3BYAA 1IKUA 4GUKA 3SG3A 1DJXA 3HX4A 2CT9A 1QATA 4UPGA 1CDNA 1LA0A 2ZRTA 3EKHA 3SG2A 3DVJA 2CTNA 1TN4A 1CB1A 1DTLA 1B8RA 3LL8B 3JVTC 1MUXA 1YX7A 4WQ2A 3KEVA 5ER5A 2I18A 2JNFA 4HRGA 2EHBA 4QJ3B 2KQYA 1OMVA 4GGFA 3VRQA 1KQVA 5D7FA 5JJGA 2PASA 2L5XB 4DIRA 3AAKA 1CFCA 1GQMA 4MSPA 1CMGA 5K89A 1G8IA 1B8CA 4QJ5B 1SMGA 1QX7A 4Q04A 2SCPA 1F55A 3DVMA 1SR6C 1KSOA 1J7RA 1QLKA 2K7DA 2KFHA 2MBXA 1XA5A 4JWQA 1YUTA 1IQ5A 1X02A 1Y0VH 3BUOB 5B8IB 4YBHB 4C0KA 1ALWA 3PN7B 1FI6A 1BR4B 1WRKA 3I5HC 5IBWA 1JFJA 1XFWO 5F6TA 2WORA 1ZFSA 1NCYA 1N2DA 1CLLA 5JOLA 2NZ0A 1IWQA 2JXLA 2ZN8A 5BPJA 1SPYA 1ZUZA 3WXAA 1KK7Z 4E68A 4ORCB 3VROA 4ICBA 1QV1A 4GNKB 2BCXA 3RM1A 1CFDA 2LUXA 2A4JA 1G4YR 3QRXA 4YRUA 5KU1A 3E3RA 1DMOA 1CFFA 1CFPA 1HQVA 5I8NA 2LM5A 5I2OA 1H4BA 1TNXA 1DGUA 1XFVO 1DF0A 1DF0B 1BMOA 1YRTB 4ZCUA 1CDLA 2DOQA 3FWBA 1XK4C 3F45A 4MEWA 1F4OA 1BLQA 2LE9B 1WLZA 4MRXA 4MZLA 4MZKA 1TTXA 1QIVA 5AFPA 2JC2A 1OQPA 2MRDA 1S5GY 2FJUB 1KK7Y 1NWDA 2KYFA 5I2QA 3CTNA 1SK6D 1EL4A 3TUYC 2ZN9A 5AANA 2BCAA 1KQMC 1NX2A 2FOTA 2OTGB 2LHLA 2KAXA 1B8LA 3EVRA 4NQGA 3TS5B 2F2PA 1DJIA 3I5GC 3BUNB 1AJ5A 2EC6B 3EK4A 2BE6A 3HCMA 2BCBA 2Q4UA 1IRJA 1QIWA 4ORBB 2NXQA 2HPSA 1AJ4A 2LP3A 1KK8B 1CLBA 1A4PA 4WRIA 1B7TZ 1MR8A 3D10A 1B47A 1XO5A 1NCXA 1OSAA 3GK1A 4I5KA 3SG6A 2MLFC 4ETOA 3OX5A 4FTGA 2M1UA 1K93D 4C0JA 3I5HB 3LCPC 1SL9A 3CGAA 1GGWA 1ZMZA 2KQ6A 3DD4A 3O78A 1JF2A 3EKJA 2M29A 3IQQA 1AHRA 1SCMB 2K7CA 2ZRSA 3BUMB 3GK4X 4GAOA 1S26D 1DGVA 1S6JA 3WHTB 1BODA 1BG1A 2GGMA 5FYXA 1H8BA 2HF5A 2LVIA 4MZJA 1CKKA 1QJTA 1F4QA 2V53A 4I5NB 2F3YA 4PE0A 1NIWA 1KFUL 3JTDB 1AVSA 1KFXS 5HKYA 4OVNF 2NCPA 2PRUA 4PDZA 2WOSA 1SL8A 1CM4A 1MHOA 3I5FB 3OX6A 4AQIA 2KI4C 1J7PA 2LVJA 1YR5A 4HSZA 2LCPA 1EG3A 2LLUA 1IGVA 1NX3A 4IL1A 4MBEA 3KO0A 2MHHA 2BL0C 1NX0A 1F71A 1YUUA 2OS8B 3O2PA 1RFJA 1RTP1 4NDCA 3FS7A 1RK9A 2JT3A 1SCVA 3VRPA 1KWOC 1L2OB 2KAVA 3H4SE 3LK0A 2JZIA 4R1EA 1FW4A 5AEQA 1UURA 2F3ZA 1D1OA 3PSRA 1QXPA 2LMUA 2JWWA 2KYCA 3ICBA 2G2BA 4YI9A 1A75A 1W7IB 1K9UA 3CLNA 2ZKMX 3AKBA 2LNKA 1G33A 2L98A 2L2EA 2KNEA 4QJ4B 5AERA 1MXLC 2E30A 3TDIA 1TOPA 1KFUS 3CR4X 4U8DA 3BOWA 2FCEA 1R6PA 1DJGA 1UHIA 2LV7A 3SG7A 3GK2A 1UHKA 2Y5IA 1TRFA 2K61A 2JULA 1DJYA 5PALA 2COLB 5CSNA 2L0PA 1N65A 2JTTA 2LVVA 1K8UA 4GGNA 1DJHA 5CSJA 1NPQA 2AUCA 3D0YA 3D0YB 2LANA 1TNWA 4N1GA 1B1GA 1K96A 1QV0A 1BJFA 1WDCB 1PK0D 2IS9A 4YGDB 1K90D 2WCBA 4OR9B 2F8PA 4PCWA 5HKZA 3OB1B 1QS7A 2H61C 2KI6C 1PULA 4TNCA 2SASA 3VRRA 2BE4A 4CPVA 1NX1A 2L50A 2LP2A 2M9GA 1FI5A 4M2OA 1WRLA 2KI6D 2K2FA 1B9AA 1S1EA 1UWOA 2LUCA 4CIDA 4XYNA 1IJ5A 4DUQA 5CPVA 1YUSA 5CSFA 1QVIZ 3JVTB 2M1KB 2M7NA 2ZNEA 4NDDA 1RROA 5HKWA 1CDMA 1K95A 5KTYA 2JOJA 2K0JA 2HETA 1OMRA 4PE1A 2CNPA 3EVUA 2D8NA 2M97A 3I5IC 4OKHA 4PHKA 1EH2A 4C0LA 2PALA 4HRHA 1KFXL 4GFTA 1QX5B 3LLEA 2KOTA 4I5LB 3IQOA 2RGIA 1XFUO 1SR6B 4OV2A 1QLSA 1SNLA 1V1FA 2LAPA 1J55A 3VGOA 1EG4A 3C1VA 3DVEA 4XJKA 4XJKB 1FPWA 2HQ8A 1IH0A 3OB2B 1NUBA 4HREE 4P5OE 1MXEA 1YX8A 2K7OA 1Y1UA 1UHHA 1QVIY 4PE7A 4A4CA 3DF0A 3DF0B 3NXAA 1DVIA 3A4UB 1YTZC 2KGRA 1J7QA 4GGFC 1XFXO 2KHNA 3WNXB 2JT0A 3O6BA 2O5GA 1OZSA 3PALA 3RLZA 2E6WA 3TDUA 3VRNA 1WLMA 1NSHA 1JUOA 2M0RA 3CZTX 3MSEB 4I5JA 2JU0A 1LINA 3GOFA 5D69A 3KPXA 1BT6A 1SKTA 1UUSA 2KFGA 3KHEA 2BKIB 1V1GA 4MN0A 4CLNA 1SRAA 1YVHA 1B7TY 1DT7B 4M2QA 1RWYA 3IF7A 1LVCD 2JPTA 1JFKA 3KF9A 1CMFA 5DKNA 2JT8A 1UHJA 2I94A 3PN7C 4YGEB 4YGAA 2K7BA 1PSBA 3EVVA 1K9KA 4L9MA 4BY5A 1XK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K2H A;  3ZNI A;  2MLE C;  1DJW A;  5CSI A;  5AXI A;  1PVA A;  1MQ1 A;  2BEC A;  1FF1 A;  4P2Y B;  2L4I A;  1JBA A;  1EJ3 A;  2WC8 A;  3EK7 A;  4GBA A;  5HYD A;  1NYA A;  1Y1A A;  2L51 A;  2I2R E;  3SIA A;  2GGZ A;  1TNP A;  2WCE A;  3PAT A;  1M39 A;  2K2A A;  1IG5 A;  1CTR A;  1PRW A;  2JRF A;  3TUY B;  2LVK A;  5KSZ A;  1BOC A;  3BUX B;  1KQM B;  1OMD A;  1TCF A;  2ISD A;  3WHU B;  4PHM A;  2NLN A;  2LLT A;  3I5G B;  5GQQ C;  2BKH B;  2ZFD A;  3CR5 X;  1NP8 A;  4ZCV A;  3BUW B;  1A2X A;  2KSP A;  1SBJ A;  1F70 A;  1U5I A;  1U5I B;  2JQ6 A;  1L7Z A;  1A75 B;  1FBV A;  4GPL B;  4DCK A;  1PVB A;  2G9B A;  4NDB A;  1GJY A;  1M46 A;  2MAZ A;  1DJZ A;  4OCI A;  2MJW B;  4JQ0 D;  3BOW B;  1XFY O;  1XVJ A;  2WCF A;  3SG5 A;  2LC5 A;  4CFQ A;  2QPT A;  1Y1X A;  1SYM A;  2OTG C;  3CS1 A;  2PVB A;  1UHN A;  1N0Y A;  3TS5 C;  4ORA B;  1MWN A;  1R2U A;  2BBM A;  2EC6 C;  1WY9 A;  3A8R A;  2GV5 A;  2KAY A;  1B4C A;  1JWD A;  4MLW A;  1KK8 C;  1OZO A;  5G08 A;  1BF5 A;  4DRW A;  2CBL A;  2KBM A;  2CXJ A;  1S6I A;  5DKR A;  4YGC B;  2JXC A;  1M45 A;  2MA2 A;  4M2P A;  2I7A A;  2KI4 B;  2LLS A;  1K94 A;  2WND A;  4PE4 A;  1JC2 A;  4N5X A;  1CLM A;  1BR1 B;  4USL A;  1ODB A;  3SG4 A;  5J3X A;  1F54 A;  2BL0 B;  2M8U A;  1S5G Z;  2Y4Q A;  2LMV A;  2EGD A;  5HLV A;  1SCM C;  2Q91 A;  3NSO A;  1XFZ O;  4PAL A;  1KWO B;  2L4H A;  1PSR A;  2HQW A;  3AKA A;  2KDH A;  1Y6W A;  1A03 A;  1S3P A;  3NSI A;  4YI8 A;  1LKJ A;  2JTZ A;  2M3W A;  1YUR A;  5TNC A;  4BY4 A;  2CCM A;  1OOJ A;  2FCD A;  2F2O A;  2PMY A;  2KFF A;  3TDZ A;  3JTD C;  4JPZ B;  1M63 B;  2B1U A;  1VRK A;  4PHJ A;  1LXF C;  1IJ6 A;  3FIA A;  3CWG A;  2O60 A;  3I5F C;  2AMI A;  3K21 A;  3PLF B;  4WQ3 A;  1JSA A;  3LK1 A;  1SL7 A;  1OE9 B;  2BBN A;  1YRU B;  1XYD A;  2PSR A;  5I2L A;  2OS8 C;  1YVL A;  3SJS A;  1SY9 A;  4MVF A;  1PAL A;  1Q80 A;  1L2O C;  1TNQ A;  2KGB C;  3O4Y A;  1NCZ A;  1AK8 A;  1MF8 B;  1ZOT B;  1SW8 A;  1KCY A;  1J1D A;  1S6C A;  2M49 B;  4A4B A;  1WRZ A;  4MRY A;  5ER4 X;  1TIZ A;  3NSL A;  2NCO A;  2ZND A;  4PHN A;  2VRG A;  2QAC A;  1J7O A;  1ALV A;  3NSK A;  1E8A A;  1C7W A;  1EXR A;  5DKQ A;  3PFV A;  3AAJ A;  3PM8 A;  4DS7 A;  3ZWH A;  2H61 A;  1BU3 A;  4AOM A;  2F33 A;  1A29 A;  3OP0 A;  1K9P A;  1RJV A;  3DVK A;  1HT9 A;  2LMT A;  1CDP A;  3TZ1 A;  3SIB A;  1CM1 A;  3BXK A;  2R2I A;  2TN4 A;  1UP5 A;  3BQ3 A;  4D1E A;  1C07 A;  4AQJ A;  1QX2 A;  3M0W A;  1CNP A;  1JF0 A;  1TCO B;  2AAO A;  4CFR A;  1W7J B;  2LHI A;  1KSM A;  2P6B B;  3FWC A;  1GGZ A;  1J1E A;  1S36 A;  5HLO A;  1IQ3 A;  2OPO A;  1LA3 A;  1AP4 A;  1M31 A;  4FQO A;  1WDC C;  1C7V A;  3I5I B;  1AUI B;  4N1F A;  1QTX A;  1REC A;  4YGB B;  1F8H A;  2JNX A;  1QAS A;  3CR2 A;  2Y1N A;  1ZAC A;  2K8M B;  2H2K A;  3OHM B;  4F0Z B;  3EK8 A;  2M7L A;  2KBI A;  2Y1M A;  3BYA A;  1IKU A;  4GUK A;  3SG3 A;  1DJX A;  3HX4 A;  2CT9 A;  1QAT A;  4UPG A;  1CDN A;  1LA0 A;  2ZRT A;  3EKH A;  3SG2 A;  3DVJ A;  2CTN A;  1TN4 A;  1CB1 A;  1DTL A;  1B8R A;  3LL8 B;  3JVT C;  1MUX A;  1YX7 A;  4WQ2 A;  3KEV A;  5ER5 A;  2I18 A;  2JNF A;  4HRG A;  2EHB A;  4QJ3 B;  2KQY A;  1OMV A;  4GGF A;  3VRQ A;  1KQV A;  5D7F A;  5JJG A;  2PAS A;  2L5X B;  4DIR A;  3AAK A;  1CFC A;  1GQM A;  4MSP A;  1CMG A;  5K89 A;  1G8I A;  1B8C A;  4QJ5 B;  1SMG A;  1QX7 A;  4Q04 A;  2SCP A;  1F55 A;  3DVM A;  1SR6 C;  1KSO A;  1J7R A;  1QLK A;  2K7D A;  2KFH A;  2MBX A;  1XA5 A;  4JWQ A;  1YUT A;  1IQ5 A;  1X02 A;  1Y0V H;  3BUO B;  5B8I B;  4YBH B;  4C0K A;  1ALW A;  3PN7 B;  1FI6 A;  1BR4 B;  1WRK A;  3I5H C;  5IBW A;  1JFJ A;  1XFW O;  5F6T A;  2WOR A;  1ZFS A;  1NCY A;  1N2D A;  1CLL A;  5JOL A;  2NZ0 A;  1IWQ A;  2JXL A;  2ZN8 A;  5BPJ A;  1SPY A;  1ZUZ A;  3WXA A;  1KK7 Z;  4E68 A;  4ORC B;  3VRO A;  4ICB A;  1QV1 A;  4GNK B;  2BCX A;  3RM1 A;  1CFD A;  2LUX A;  2A4J A;  1G4Y R;  3QRX A;  4YRU A;  5KU1 A;  3E3R A;  1DMO A;  1CFF A;  1CFP A;  1HQV A;  5I8N A;  2LM5 A;  5I2O A;  1H4B A;  1TNX A;  1DGU A;  1XFV O;  1DF0 A;  1DF0 B;  1BMO A;  1YRT B;  4ZCU A;  1CDL A;  2DOQ A;  3FWB A;  1XK4 C;  3F45 A;  4MEW A;  1F4O A;  1BLQ A;  2LE9 B;  1WLZ A;  4MRX A;  4MZL A;  4MZK A;  1TTX A;  1QIV A;  5AFP A;  2JC2 A;  1OQP A;  2MRD A;  1S5G Y;  2FJU B;  1KK7 Y;  1NWD A;  2KYF A;  5I2Q A;  3CTN A;  1SK6 D;  1EL4 A;  3TUY C;  2ZN9 A;  5AAN A;  2BCA A;  1KQM C;  1NX2 A;  2FOT A;  2OTG B;  2LHL A;  2KAX A;  1B8L A;  3EVR A;  4NQG A;  3TS5 B;  2F2P A;  1DJI A;  3I5G C;  3BUN B;  1AJ5 A;  2EC6 B;  3EK4 A;  2BE6 A;  3HCM A;  2BCB A;  2Q4U A;  1IRJ A;  1QIW A;  4ORB B;  2NXQ A;  2HPS A;  1AJ4 A;  2LP3 A;  1KK8 B;  1CLB A;  1A4P A;  4WRI A;  1B7T Z;  1MR8 A;  3D10 A;  1B47 A;  1XO5 A;  1NCX A;  1OSA A;  3GK1 A;  4I5K A;  3SG6 A;  2MLF C;  4ETO A;  3OX5 A;  4FTG A;  2M1U A;  1K93 D;  4C0J A;  3I5H B;  3LCP C;  1SL9 A;  3CGA A;  1GGW A;  1ZMZ A;  2KQ6 A;  3DD4 A;  3O78 A;  1JF2 A;  3EKJ A;  2M29 A;  3IQQ A;  1AHR A;  1SCM B;  2K7C A;  2ZRS A;  3BUM B;  3GK4 X;  4GAO A;  1S26 D;  1DGV A;  1S6J A;  3WHT B;  1BOD A;  1BG1 A;  2GGM A;  5FYX A;  1H8B A;  2HF5 A;  2LVI A;  4MZJ A;  1CKK A;  1QJT A;  1F4Q A;  2V53 A;  4I5N B;  2F3Y A;  4PE0 A;  1NIW A;  1KFU L;  3JTD B;  1AVS A;  1KFX S;  5HKY A;  4OVN F;  2NCP A;  2PRU A;  4PDZ A;  2WOS A;  1SL8 A;  1CM4 A;  1MHO A;  3I5F B;  3OX6 A;  4AQI A;  2KI4 C;  1J7P A;  2LVJ A;  1YR5 A;  4HSZ A;  2LCP A;  1EG3 A;  2LLU A;  1IGV A;  1NX3 A;  4IL1 A;  4MBE A;  3KO0 A;  2MHH A;  2BL0 C;  1NX0 A;  1F71 A;  1YUU A;  2OS8 B;  3O2P A;  1RFJ A;  1RTP 1;  4NDC A;  3FS7 A;  1RK9 A;  2JT3 A;  1SCV A;  3VRP A;  1KWO C;  1L2O B;  2KAV A;  3H4S E;  3LK0 A;  2JZI A;  4R1E A;  1FW4 A;  5AEQ A;  1UUR A;  2F3Z A;  1D1O A;  3PSR A;  1QXP A;  2LMU A;  2JWW A;  2KYC A;  3ICB A;  2G2B A;  4YI9 A;  1A75 A;  1W7I B;  1K9U A;  3CLN A;  2ZKM X;  3AKB A;  2LNK A;  1G33 A;  2L98 A;  2L2E A;  2KNE A;  4QJ4 B;  5AER A;  1MXL C;  2E30 A;  3TDI A;  1TOP A;  1KFU S;  3CR4 X;  4U8D A;  3BOW A;  2FCE A;  1R6P A;  1DJG A;  1UHI A;  2LV7 A;  3SG7 A;  3GK2 A;  1UHK A;  2Y5I A;  1TRF A;  2K61 A;  2JUL A;  1DJY A;  5PAL A;  2COL B;  5CSN A;  2L0P A;  1N65 A;  2JTT A;  2LVV A;  1K8U A;  4GGN A;  1DJH A;  5CSJ A;  1NPQ A;  2AUC A;  3D0Y A;  3D0Y B;  2LAN A;  1TNW A;  4N1G A;  1B1G A;  1K96 A;  1QV0 A;  1BJF A;  1WDC B;  1PK0 D;  2IS9 A;  4YGD B;  1K90 D;  2WCB A;  4OR9 B;  2F8P A;  4PCW A;  5HKZ A;  3OB1 B;  1QS7 A;  2H61 C;  2KI6 C;  1PUL A;  4TNC A;  2SAS A;  3VRR A;  2BE4 A;  4CPV A;  1NX1 A;  2L50 A;  2LP2 A;  2M9G A;  1FI5 A;  4M2O A;  1WRL A;  2KI6 D;  2K2F A;  1B9A A;  1S1E A;  1UWO A;  2LUC A;  4CID A;  4XYN A;  1IJ5 A;  4DUQ A;  5CPV A;  1YUS A;  5CSF A;  1QVI Z;  3JVT B;  2M1K B;  2M7N A;  2ZNE A;  4NDD A;  1RRO A;  5HKW A;  1CDM A;  1K95 A;  5KTY A;  2JOJ A;  2K0J A;  2HET A;  1OMR A;  4PE1 A;  2CNP A;  3EVU A;  2D8N A;  2M97 A;  3I5I C;  4OKH A;  4PHK A;  1EH2 A;  4C0L A;  2PAL A;  4HRH A;  1KFX L;  4GFT A;  1QX5 B;  3LLE A;  2KOT A;  4I5L B;  3IQO A;  2RGI A;  1XFU O;  1SR6 B;  4OV2 A;  1QLS A;  1SNL A;  1V1F A;  2LAP A;  1J55 A;  3VGO A;  1EG4 A;  3C1V A;  3DVE A;  4XJK A;  4XJK B;  1FPW A;  2HQ8 A;  1IH0 A;  3OB2 B;  1NUB A;  4HRE E;  4P5O E;  1MXE A;  1YX8 A;  2K7O A;  1Y1U A;  1UHH A;  1QVI Y;  4PE7 A;  4A4C A;  3DF0 A;  3DF0 B;  3NXA A;  1DVI A;  3A4U B;  1YTZ C;  2KGR A;  1J7Q A;  4GGF C;  1XFX O;  2KHN A;  3WNX B;  2JT0 A;  3O6B A;  2O5G A;  1OZS A;  3PAL A;  3RLZ A;  2E6W A;  3TDU A;  3VRN A;  1WLM A;  1NSH A;  1JUO A;  2M0R A;  3CZT X;  3MSE B;  4I5J A;  2JU0 A;  1LIN A;  3GOF A;  5D69 A;  3KPX A;  1BT6 A;  1SKT A;  1UUS A;  2KFG A;  3KHE A;  2BKI B;  1V1G A;  4MN0 A;  4CLN A;  1SRA A;  1YVH A;  1B7T Y;  1DT7 B;  4M2Q A;  1RWY A;  3IF7 A;  1LVC D;  2JPT A;  1JFK A;  3KF9 A;  1CMF A;  5DKN A;  2JT8 A;  1UHJ A;  2I94 A;  3PN7 C;  4YGE B;  4YGA A;  2K7B A;  1PSB A;  3EVV A;  1K9K A;  4L9M A;  4BY5 A;  1XK4 A; 
#chains in the Genus database with same CATH topology
 1K2H A;  3ZNI A;  2MLE C;  1DJW A;  5CSI A;  5AXI A;  1PVA A;  1MQ1 A;  2BEC A;  1FF1 A;  1OOI X;  4P2Y B;  2L4I A;  1JBA A;  1EJ3 A;  2WC8 A;  3EK7 A;  4GBA A;  5HYD A;  1NYA A;  1Y1A A;  2L51 A;  2I2R E;  2QEO A;  3SIA A;  2GGZ A;  1TNP A;  2WCE A;  3PAT A;  1M39 A;  2K2A A;  1IG5 A;  1CTR A;  1PRW A;  1W9Z A;  2JRF A;  2LVK A;  3TUY B;  5KSZ A;  3BUX B;  1BOC A;  1KQM B;  3CZ0 A;  1OMD A;  1DEL A;  1TCF A;  2ISD A;  3WHU B;  4PHM A;  2NLN A;  2LLT A;  3I5G B;  5GQQ C;  2BKH B;  3PJI A;  2ZFD A;  3CR5 X;  1NP8 A;  4ZCV A;  1GM0 A;  3BUW B;  1A2X A;  2KSP A;  1SBJ A;  1F70 A;  1U5I A;  1U5I B;  2JQ6 A;  1L7Z A;  2QEB A;  4IJ7 A;  1A75 B;  1FBV A;  4GPL B;  3V2L A;  4DCK A;  4KYN A;  1PVB A;  2G9B A;  4NDB A;  1GJY A;  3D74 A;  3CDN A;  1C3Y A;  1M46 A;  2MAZ A;  2KPH A;  1DJZ A;  4OCI A;  1TUJ A;  2MJW B;  5HL1 A;  4JQ0 D;  2PQL A;  2QEH A;  1XFY O;  1XVJ A;  3BOW B;  2WCF A;  3SG5 A;  2LC5 A;  4CFQ A;  1TWO A;  2QPT A;  3DY9 A;  2H8V A;  1Y1X A;  3D77 A;  1SYM A;  2OTG C;  3CS1 A;  2PVB A;  1UHN A;  1N0Y A;  3TS5 C;  3SS4 A;  4ORA B;  1MWN A;  1R2U A;  2BBM A;  2EC6 C;  1WY9 A;  3S0A A;  2K60 A;  3A8R A;  2GV5 A;  2KAY A;  3L4A A;  4FQT A;  1B4C A;  1JWD A;  4MLW A;  1KK8 C;  3CZ2 A;  1OZO A;  5G08 A;  1BF5 A;  3UNW A;  4DRW A;  2CBL A;  2KBM A;  2CXJ A;  1S6I A;  5DKR A;  4YGC B;  2JXC A;  3IVT A;  1M45 A;  2MA2 A;  4M2P A;  2I7A A;  2KI4 B;  2LLS A;  1K94 A;  2WND A;  4PE4 A;  1JC2 A;  4N5X A;  1CLM A;  1BR1 B;  4USL A;  1ODB A;  3SG4 A;  5J3X A;  1F54 A;  2BL0 B;  2M8U A;  1DEK A;  1S5G Z;  2Y4Q A;  2LMV A;  2EGD A;  5HLV A;  1SCM C;  2Q91 A;  3NSO A;  1XFZ O;  4PAL A;  1KWO B;  2L4H A;  1PSR A;  2HQW A;  3AKA A;  2KDH A;  1C3Z A;  1Y6W A;  1A03 A;  1S3P A;  3NSI A;  4YI8 A;  1LKJ A;  2JTZ A;  2M3W A;  1YUR A;  5TNC A;  4BY4 A;  2CCM A;  1OOJ A;  2FCD A;  2F2O A;  2PMY A;  2PYQ A;  2KFF A;  3TDZ A;  3JTD C;  4JPZ B;  1M63 B;  2B1U A;  1DQE A;  1LS8 A;  1VRK A;  4PHJ A;  1LXF C;  1IJ6 A;  3FIA A;  3CWG A;  2O60 A;  3I5F C;  2AMI A;  3K21 A;  3PLF B;  4WQ3 A;  1JSA A;  3LK1 A;  1SL7 A;  1OE9 B;  2BBN A;  1YRU B;  1XYD A;  2PSR A;  5I2L A;  2OS8 C;  1YVL A;  3SJS A;  1SY9 A;  4MVF A;  1PAL A;  1TUZ A;  3PM2 A;  3D78 A;  1Q80 A;  1L2O C;  1TNQ A;  3DYE A;  2KGB C;  3O4Y A;  1NCZ A;  1AK8 A;  1MF8 B;  1ZOT B;  1SW8 A;  1KCY A;  1J1D A;  1DC1 A;  1S6C A;  2M49 B;  4A4B A;  3RZS A;  1WRZ A;  4MRY A;  3CAB A;  5ER4 X;  1TIZ A;  3NSL A;  2NCO A;  2ZND A;  3NHI A;  4PHN A;  2L5Y A;  2VRG A;  2QAC A;  1J7O A;  1ALV A;  3NSK A;  1E8A A;  1C7W A;  3NHT A;  1EXR A;  5EL2 A;  5DKQ A;  3PFV A;  3AAJ A;  3PM8 A;  4DS7 A;  3ZWH A;  2H61 A;  1BU3 A;  4AOM A;  2F33 A;  1A29 A;  3OP0 A;  1K9P A;  1RJV A;  3DVK A;  1HT9 A;  2LMT A;  1CDP A;  3TZ1 A;  3SIB A;  1CM1 A;  3L4L A;  3BXK A;  2R2I A;  2TN4 A;  1UP5 A;  3BQ3 A;  4JD9 A;  4D1E A;  1C07 A;  4AQJ A;  1QX2 A;  3M0W A;  1CNP A;  1JF0 A;  1TCO B;  2AAO A;  2QEV A;  4CFR A;  1W7J B;  2LHI A;  2BAP A;  1KSM A;  2P6B B;  1OOG A;  3FWC A;  1GGZ A;  1J1E A;  1S36 A;  5HLO A;  1IQ3 A;  2OPO A;  2KLE A;  1LA3 A;  1AP4 A;  1M31 A;  4FQO A;  1WDC C;  1C7V A;  3I5I B;  1AUI B;  4N1F A;  1QTX A;  1REC A;  4YGB B;  1OW4 A;  1F8H A;  2JNX A;  1QAS A;  3CR2 A;  2Y1N A;  1ZAC A;  3OGN A;  2K8M B;  2H2K A;  3OHM B;  4F0Z B;  3EK8 A;  2M7L A;  3R72 A;  2KBI A;  2Y1M A;  3BYA A;  3L47 A;  1IKU A;  4GUK A;  3SG3 A;  1DJX A;  3HX4 A;  2CT9 A;  1QAT A;  1QWV A;  4UPG A;  1LA0 A;  1CDN A;  1Z2C B;  2ZRT A;  3EKH A;  3SG2 A;  3DVJ A;  2CTN A;  1TN4 A;  1CB1 A;  1DTL A;  1B8R A;  3LL8 B;  3JVT C;  3R1P A;  1MUX A;  1YX7 A;  4WQ2 A;  3R1V A;  3KEV A;  5ER5 A;  2I18 A;  2L2C A;  2JNF A;  4HRG A;  2EHB A;  4QJ3 B;  2KQY A;  1OMV A;  2WC6 A;  4GGF A;  3VRQ A;  1KQV A;  5D7F A;  2WC5 A;  5JJG A;  2PAS A;  2L5X B;  4DIR A;  3AAK A;  1CFC A;  1GQM A;  4MSP A;  1CMG A;  5K89 A;  1G8I A;  1B8C A;  3S0F A;  4QJ5 B;  1SMG A;  1QX7 A;  3N7H A;  4Q04 A;  2SCP A;  1F55 A;  3DVM A;  1SR6 C;  1KSO A;  1J7R A;  1QLK A;  2K7D A;  3S0D A;  3FE6 A;  2KFH A;  2MBX A;  1XA5 A;  4JWQ A;  1YUT A;  4PT1 A;  1IQ5 A;  3B87 A;  1X02 A;  1Y0V H;  3BUO B;  5B8I B;  4YBH B;  2WCM A;  4C0K A;  1ALW A;  3PN7 B;  1FI6 A;  1BR4 B;  1WRK A;  3I5H C;  5IBW A;  1JFJ A;  1XFW O;  5F6T A;  2WOR A;  1ZFS A;  5FI6 A;  1NCY A;  1N2D A;  1CLL A;  5JOL A;  2NZ0 A;  1IWQ A;  2JXL A;  2ZN8 A;  3DZT A;  5BPJ A;  1SPY A;  1ZUZ A;  3WXA A;  1KK7 Z;  1XFR A;  4E68 A;  4ORC B;  3VRO A;  4ICB A;  1QV1 A;  4GNK B;  5D3O A;  1SSE B;  2BCX A;  3RM1 A;  1CFD A;  2LUX A;  2A4J A;  1G4Y R;  3QRX A;  4YRU A;  5KU1 A;  3BJH A;  3E3R A;  1DMO A;  1CFF A;  1CFP A;  1HQV A;  5I8N A;  2LM5 A;  5I2O A;  1H4B A;  1TNX A;  1DGU A;  1XFV O;  1DF0 A;  1DF0 B;  1BMO A;  1YRT B;  4ZCU A;  1CDL A;  2DOQ A;  3FWB A;  1XK4 C;  3F45 A;  4MEW A;  1F4O A;  1OOH A;  1BLQ A;  2LE9 B;  1WLZ A;  4MRX A;  4MZL A;  4MZK A;  2ERB A;  1TTX A;  3EG5 B;  1QIV A;  5AFP A;  2JC2 A;  1OQP A;  2MRD A;  1S5G Y;  2FJU B;  1KK7 Y;  1NWD A;  2KYF A;  5I2Q A;  3CTN A;  5DIC A;  1SK6 D;  1EL4 A;  3TUY C;  2ZN9 A;  5AAN A;  2BCA A;  1KQM C;  1NX2 A;  2FOT A;  2OTG B;  2LHL A;  2KAX A;  1B8L A;  3EVR A;  4NQG A;  3TS5 B;  2F2P A;  1DJI A;  3I5G C;  3BUN B;  1AJ5 A;  2EC6 B;  3EK4 A;  3D73 A;  2WCK A;  2P70 A;  2BE6 A;  2GTE A;  3HCM A;  2BCB A;  2Q4U A;  1IRJ A;  1QIW A;  4ORB B;  2NXQ A;  2HPS A;  1AJ4 A;  2LP3 A;  1KK8 B;  5FI2 A;  1CLB A;  1A4P A;  4WRI A;  1B7T Z;  1MR8 A;  3D10 A;  1B47 A;  1XO5 A;  1NCX A;  1OSA A;  3GK1 A;  4I5K A;  3SG6 A;  2MLF C;  4ETO A;  3OX5 A;  4FTG A;  2M1U A;  1K93 D;  4C0J A;  3I5H B;  3LCP C;  1SL9 A;  3CGA A;  1GGW A;  1ORG A;  1ZMZ A;  2KQ6 A;  3B86 A;  3B88 A;  3DD4 A;  1JF2 A;  2P71 A;  3EKJ A;  3O78 A;  2M29 A;  3IQQ A;  1AHR A;  2JPO A;  1SCM B;  2K7C A;  2ZRS A;  3BUM B;  3SS5 A;  3GK4 X;  4GAO A;  1S26 D;  1DGV A;  1S6J A;  3WHT B;  2WCL A;  1BOD A;  1BG1 A;  1OOF A;  3S0G A;  3R1O A;  2GGM A;  5FYX A;  1H8B A;  2HF5 A;  2LVI A;  4MZJ A;  1CKK A;  1QJT A;  1F4Q A;  2V53 A;  4I5N B;  2F3Y A;  4JKT A;  4PE0 A;  1NIW A;  1KFU L;  3CZ1 A;  3FE9 A;  1AVS A;  3JTD B;  1KFX S;  4F7F A;  5HKY A;  4OVN F;  2NCP A;  2PRU A;  4PDZ A;  2WOS A;  1SL8 A;  1CM4 A;  1MHO A;  3QME A;  3I5F B;  3OX6 A;  4AQI A;  2KI4 C;  1J7P A;  2LVJ A;  1YR5 A;  4HSZ A;  2LCP A;  1EG3 A;  2LLU A;  1IGV A;  1NX3 A;  4IL1 A;  4MBE A;  3KO0 A;  2MHH A;  2BL0 C;  1NX0 A;  1F71 A;  1YUU A;  2OS8 B;  3O2P A;  1RFJ A;  1RTP 1;  4NDC A;  3FS7 A;  1RK9 A;  2JT3 A;  1SCV A;  1P28 A;  3VRP A;  1KWO C;  1L2O B;  2KAV A;  3H4S E;  3LK0 A;  2JZI A;  4R1E A;  3BFH A;  1FW4 A;  5AEQ A;  1UUR A;  2F3Z A;  1D1O A;  3PSR A;  1QXP A;  2LMU A;  2JWW A;  5FI7 A;  2KYC A;  1Z4H A;  3NGV A;  3ICB A;  3S0B A;  2G2B A;  4YI9 A;  1A75 A;  1W7I B;  1K9U A;  3CLN A;  2ZKM X;  3AKB A;  2LNK A;  2KLD A;  1G33 A;  2L98 A;  2L2E A;  2KNE A;  4QJ4 B;  2WCJ A;  5AER A;  1MXL C;  2E30 A;  3TDI A;  1TOP A;  1KFU S;  3CR4 X;  4U8D A;  3BOW A;  2FCE A;  1R6P A;  4INX A;  2FJY A;  1DJG A;  1UHI A;  2LV7 A;  3SG7 A;  3GK2 A;  1UHK A;  2Y5I A;  1TRF A;  2K61 A;  2JUL A;  1DJY A;  5PAL A;  2COL B;  5CSN A;  2L0P A;  1N65 A;  3B7A A;  2JTT A;  2LVV A;  1K8U A;  4GGN A;  1DJH A;  5CSJ A;  1NPQ A;  2AUC A;  3D0Y A;  3D0Y B;  2LAN A;  1TNW A;  4N1G A;  1B1G A;  1K96 A;  1QV0 A;  1BJF A;  1WDC B;  1PK0 D;  2IS9 A;  4YGD B;  1K90 D;  2WCB A;  4OR9 B;  3FE8 A;  2F8P A;  4PCW A;  3D76 A;  3OB1 B;  1QS7 A;  4INW A;  5HKZ A;  2H61 C;  2KI6 C;  1PUL A;  4TNC A;  2SAS A;  3VRR A;  2BE4 A;  4CPV A;  1NX1 A;  2L50 A;  2LP2 A;  2M9G A;  3B6X A;  4M2O A;  1FI5 A;  1WRL A;  2KI6 D;  2K2F A;  1B9A A;  1S1E A;  1UWO A;  2LUC A;  4CID A;  4XYN A;  4OZD A;  1IJ5 A;  3Q8I A;  4DUQ A;  5CPV A;  1YUS A;  5CSF A;  1QVI Z;  3JVT B;  2M1K B;  2M7N A;  3BFA A;  3UO9 A;  2ZNE A;  4NDD A;  1RRO A;  5HKW A;  1CDM A;  3D75 A;  1K95 A;  5KTY A;  2JOJ A;  2K0J A;  2HET A;  1OMR A;  4PE1 A;  2CNP A;  3EVU A;  2D8N A;  2M97 A;  3I5I C;  4OKH A;  4PHK A;  1EH2 A;  1IIO A;  4C0L A;  3CYZ A;  2PAL A;  4HRH A;  1KFX L;  1T14 A;  4GFT A;  1QX5 B;  3LLE A;  2KOT A;  4I5L B;  3IQO A;  2RGI A;  1XFU O;  1SR6 B;  4OV2 A;  1QLS A;  1SNL A;  1V1F A;  2LAP A;  1J55 A;  3VGO A;  1EG4 A;  3C1V A;  3DVE A;  4XJK A;  4XJK B;  1FPW A;  2HQ8 A;  1IH0 A;  2YGU A;  3OB2 B;  1NUB A;  4HRE E;  4P5O E;  1MXE A;  1YX8 A;  2K7O A;  1Y1U A;  5I94 A;  3K1E A;  1UHH A;  1QVI Y;  4PE7 A;  4A4C A;  3DF0 A;  3DF0 B;  3SS3 A;  3NXA A;  1DVI A;  3A4U B;  3O4X A;  1YTZ C;  2KGR A;  1J7Q A;  4GGF C;  3DXL A;  2WCH A;  1XFX O;  3VB1 A;  2KHN A;  3BFB A;  3WNX B;  2JT0 A;  3O6B A;  2O5G A;  1OZS A;  3PAL A;  3RLZ A;  2E6W A;  3TDU A;  3VRN A;  1WLM A;  1NSH A;  1JUO A;  2M0R A;  3CZT X;  3MSE B;  4I5J A;  2JU0 A;  1LIN A;  3GOF A;  5D69 A;  3OBV A;  2BNX A;  1BT6 A;  1SKT A;  1UUS A;  3KPX A;  2KFG A;  3KHE A;  2BKI B;  1V1G A;  4MN0 A;  4CLN A;  1SRA A;  1YVH A;  1B7T Y;  1DT7 B;  4M2Q A;  1RWY A;  3IF7 A;  1LVC D;  2JPT A;  1JFK A;  3KF9 A;  3S0E A;  5DKN A;  1CMF A;  2JT8 A;  1UHJ A;  2I94 A;  3PN7 C;  4YGE B;  4YGA A;  2K7B A;  1PSB A;  3EVV A;  1K9K A;  4L9M A;  4BY5 A;  2QDI A;  1XK4 A; 
#chains in the Genus database with same CATH homology
 1K2H A;  3ZNI A;  2MLE C;  1DJW A;  5CSI A;  5AXI A;  1PVA A;  1MQ1 A;  2BEC A;  1FF1 A;  4P2Y B;  2L4I A;  1JBA A;  1EJ3 A;  2WC8 A;  3EK7 A;  4GBA A;  5HYD A;  1NYA A;  1Y1A A;  2L51 A;  2I2R E;  3SIA A;  2GGZ A;  1TNP A;  2WCE A;  3PAT A;  1M39 A;  2K2A A;  1IG5 A;  1CTR A;  1PRW A;  2JRF A;  3TUY B;  2LVK A;  5KSZ A;  1BOC A;  3BUX B;  1KQM B;  1OMD A;  1TCF A;  2ISD A;  3WHU B;  4PHM A;  2NLN A;  2LLT A;  3I5G B;  5GQQ C;  2BKH B;  2ZFD A;  3CR5 X;  1NP8 A;  4ZCV A;  3BUW B;  1A2X A;  2KSP A;  1SBJ A;  1F70 A;  1U5I A;  1U5I B;  2JQ6 A;  1L7Z A;  1A75 B;  1FBV A;  4GPL B;  4DCK A;  1PVB A;  2G9B A;  4NDB A;  1GJY A;  1M46 A;  2MAZ A;  1DJZ A;  4OCI A;  2MJW B;  4JQ0 D;  3BOW B;  1XFY O;  1XVJ A;  2WCF A;  3SG5 A;  2LC5 A;  4CFQ A;  2QPT A;  1Y1X A;  1SYM A;  2OTG C;  3CS1 A;  2PVB A;  1UHN A;  1N0Y A;  3TS5 C;  4ORA B;  1MWN A;  1R2U A;  2BBM A;  2EC6 C;  1WY9 A;  3A8R A;  2GV5 A;  2KAY A;  1B4C A;  1JWD A;  4MLW A;  1KK8 C;  1OZO A;  5G08 A;  1BF5 A;  4DRW A;  2CBL A;  2KBM A;  2CXJ A;  1S6I A;  5DKR A;  4YGC B;  2JXC A;  1M45 A;  2MA2 A;  4M2P A;  2I7A A;  2KI4 B;  2LLS A;  1K94 A;  2WND A;  4PE4 A;  1JC2 A;  4N5X A;  1CLM A;  1BR1 B;  4USL A;  1ODB A;  3SG4 A;  5J3X A;  1F54 A;  2BL0 B;  2M8U A;  1S5G Z;  2Y4Q A;  2LMV A;  2EGD A;  5HLV A;  1SCM C;  2Q91 A;  3NSO A;  1XFZ O;  4PAL A;  1KWO B;  2L4H A;  1PSR A;  2HQW A;  3AKA A;  2KDH A;  1Y6W A;  1A03 A;  1S3P A;  3NSI A;  4YI8 A;  1LKJ A;  2JTZ A;  2M3W A;  1YUR A;  5TNC A;  4BY4 A;  2CCM A;  1OOJ A;  2FCD A;  2F2O A;  2PMY A;  2KFF A;  3TDZ A;  3JTD C;  4JPZ B;  1M63 B;  2B1U A;  1VRK A;  4PHJ A;  1LXF C;  1IJ6 A;  3FIA A;  3CWG A;  2O60 A;  3I5F C;  2AMI A;  3K21 A;  3PLF B;  4WQ3 A;  1JSA A;  3LK1 A;  1SL7 A;  1OE9 B;  2BBN A;  1YRU B;  1XYD A;  2PSR A;  5I2L A;  2OS8 C;  1YVL A;  3SJS A;  1SY9 A;  4MVF A;  1PAL A;  1Q80 A;  1L2O C;  1TNQ A;  2KGB C;  3O4Y A;  1NCZ A;  1AK8 A;  1MF8 B;  1ZOT B;  1SW8 A;  1KCY A;  1J1D A;  1S6C A;  2M49 B;  4A4B A;  1WRZ A;  4MRY A;  5ER4 X;  1TIZ A;  3NSL A;  2NCO A;  2ZND A;  4PHN A;  2VRG A;  2QAC A;  1J7O A;  1ALV A;  3NSK A;  1E8A A;  1C7W A;  1EXR A;  5DKQ A;  3PFV A;  3AAJ A;  3PM8 A;  4DS7 A;  3ZWH A;  2H61 A;  1BU3 A;  4AOM A;  2F33 A;  1A29 A;  3OP0 A;  1K9P A;  1RJV A;  3DVK A;  1HT9 A;  2LMT A;  1CDP A;  3TZ1 A;  3SIB A;  1CM1 A;  3BXK A;  2R2I A;  2TN4 A;  1UP5 A;  3BQ3 A;  4D1E A;  1C07 A;  4AQJ A;  1QX2 A;  3M0W A;  1CNP A;  1JF0 A;  1TCO B;  2AAO A;  4CFR A;  1W7J B;  2LHI A;  1KSM A;  2P6B B;  3FWC A;  1GGZ A;  1J1E A;  1S36 A;  5HLO A;  1IQ3 A;  2OPO A;  1LA3 A;  1AP4 A;  1M31 A;  4FQO A;  1WDC C;  1C7V A;  3I5I B;  1AUI B;  4N1F A;  1QTX A;  1REC A;  4YGB B;  1F8H A;  2JNX A;  1QAS A;  3CR2 A;  2Y1N A;  1ZAC A;  2K8M B;  2H2K A;  3OHM B;  4F0Z B;  3EK8 A;  2M7L A;  2KBI A;  2Y1M A;  3BYA A;  1IKU A;  4GUK A;  3SG3 A;  1DJX A;  3HX4 A;  2CT9 A;  1QAT A;  4UPG A;  1CDN A;  1LA0 A;  2ZRT A;  3EKH A;  3SG2 A;  3DVJ A;  2CTN A;  1TN4 A;  1CB1 A;  1DTL A;  1B8R A;  3LL8 B;  3JVT C;  1MUX A;  1YX7 A;  4WQ2 A;  3KEV A;  5ER5 A;  2I18 A;  2JNF A;  4HRG A;  2EHB A;  4QJ3 B;  2KQY A;  1OMV A;  4GGF A;  3VRQ A;  1KQV A;  5D7F A;  5JJG A;  2PAS A;  2L5X B;  4DIR A;  3AAK A;  1CFC A;  1GQM A;  4MSP A;  1CMG A;  5K89 A;  1G8I A;  1B8C A;  4QJ5 B;  1SMG A;  1QX7 A;  4Q04 A;  2SCP A;  1F55 A;  3DVM A;  1SR6 C;  1KSO A;  1J7R A;  1QLK A;  2K7D A;  2KFH A;  2MBX A;  1XA5 A;  4JWQ A;  1YUT A;  1IQ5 A;  1X02 A;  1Y0V H;  3BUO B;  5B8I B;  4YBH B;  4C0K A;  1ALW A;  3PN7 B;  1FI6 A;  1BR4 B;  1WRK A;  3I5H C;  5IBW A;  1JFJ A;  1XFW O;  5F6T A;  2WOR A;  1ZFS A;  1NCY A;  1N2D A;  1CLL A;  5JOL A;  2NZ0 A;  1IWQ A;  2JXL A;  2ZN8 A;  5BPJ A;  1SPY A;  1ZUZ A;  3WXA A;  1KK7 Z;  4E68 A;  4ORC B;  3VRO A;  4ICB A;  1QV1 A;  4GNK B;  2BCX A;  3RM1 A;  1CFD A;  2LUX A;  2A4J A;  1G4Y R;  3QRX A;  4YRU A;  5KU1 A;  3E3R A;  1DMO A;  1CFF A;  1CFP A;  1HQV A;  5I8N A;  2LM5 A;  5I2O A;  1H4B A;  1TNX A;  1DGU A;  1XFV O;  1DF0 A;  1DF0 B;  1BMO A;  1YRT B;  4ZCU A;  1CDL A;  2DOQ A;  3FWB A;  1XK4 C;  3F45 A;  4MEW A;  1F4O A;  1BLQ A;  2LE9 B;  1WLZ A;  4MRX A;  4MZL A;  4MZK A;  1TTX A;  1QIV A;  5AFP A;  2JC2 A;  1OQP A;  2MRD A;  1S5G Y;  2FJU B;  1KK7 Y;  1NWD A;  2KYF A;  5I2Q A;  3CTN A;  1SK6 D;  1EL4 A;  3TUY C;  2ZN9 A;  5AAN A;  2BCA A;  1KQM C;  1NX2 A;  2FOT A;  2OTG B;  2LHL A;  2KAX A;  1B8L A;  3EVR A;  4NQG A;  3TS5 B;  2F2P A;  1DJI A;  3I5G C;  3BUN B;  1AJ5 A;  2EC6 B;  3EK4 A;  2BE6 A;  3HCM A;  2BCB A;  2Q4U A;  1IRJ A;  1QIW A;  4ORB B;  2NXQ A;  2HPS A;  1AJ4 A;  2LP3 A;  1KK8 B;  1CLB A;  1A4P A;  4WRI A;  1B7T Z;  1MR8 A;  3D10 A;  1B47 A;  1XO5 A;  1NCX A;  1OSA A;  3GK1 A;  4I5K A;  3SG6 A;  2MLF C;  4ETO A;  3OX5 A;  4FTG A;  2M1U A;  1K93 D;  4C0J A;  3I5H B;  3LCP C;  1SL9 A;  3CGA A;  1GGW A;  1ZMZ A;  2KQ6 A;  3DD4 A;  3O78 A;  1JF2 A;  3EKJ A;  2M29 A;  3IQQ A;  1AHR A;  1SCM B;  2K7C A;  2ZRS A;  3BUM B;  3GK4 X;  4GAO A;  1S26 D;  1DGV A;  1S6J A;  3WHT B;  1BOD A;  1BG1 A;  2GGM A;  5FYX A;  1H8B A;  2HF5 A;  2LVI A;  4MZJ A;  1CKK A;  1QJT A;  1F4Q A;  2V53 A;  4I5N B;  2F3Y A;  4PE0 A;  1NIW A;  1KFU L;  3JTD B;  1AVS A;  1KFX S;  5HKY A;  4OVN F;  2NCP A;  2PRU A;  4PDZ A;  2WOS A;  1SL8 A;  1CM4 A;  1MHO A;  3I5F B;  3OX6 A;  4AQI A;  2KI4 C;  1J7P A;  2LVJ A;  1YR5 A;  4HSZ A;  2LCP A;  1EG3 A;  2LLU A;  1IGV A;  1NX3 A;  4IL1 A;  4MBE A;  3KO0 A;  2MHH A;  2BL0 C;  1NX0 A;  1F71 A;  1YUU A;  2OS8 B;  3O2P A;  1RFJ A;  1RTP 1;  4NDC A;  3FS7 A;  1RK9 A;  2JT3 A;  1SCV A;  3VRP A;  1KWO C;  1L2O B;  2KAV A;  3H4S E;  3LK0 A;  2JZI A;  4R1E A;  1FW4 A;  5AEQ A;  1UUR A;  2F3Z A;  1D1O A;  3PSR A;  1QXP A;  2LMU A;  2JWW A;  2KYC A;  3ICB A;  2G2B A;  4YI9 A;  1A75 A;  1W7I B;  1K9U A;  3CLN A;  2ZKM X;  3AKB A;  2LNK A;  1G33 A;  2L98 A;  2L2E A;  2KNE A;  4QJ4 B;  5AER A;  1MXL C;  2E30 A;  3TDI A;  1TOP A;  1KFU S;  3CR4 X;  4U8D A;  3BOW A;  2FCE A;  1R6P A;  1DJG A;  1UHI A;  2LV7 A;  3SG7 A;  3GK2 A;  1UHK A;  2Y5I A;  1TRF A;  2K61 A;  2JUL A;  1DJY A;  5PAL A;  2COL B;  5CSN A;  2L0P A;  1N65 A;  2JTT A;  2LVV A;  1K8U A;  4GGN A;  1DJH A;  5CSJ A;  1NPQ A;  2AUC A;  3D0Y A;  3D0Y B;  2LAN A;  1TNW A;  4N1G A;  1B1G A;  1K96 A;  1QV0 A;  1BJF A;  1WDC B;  1PK0 D;  2IS9 A;  4YGD B;  1K90 D;  2WCB A;  4OR9 B;  2F8P A;  4PCW A;  5HKZ A;  3OB1 B;  1QS7 A;  2H61 C;  2KI6 C;  1PUL A;  4TNC A;  2SAS A;  3VRR A;  2BE4 A;  4CPV A;  1NX1 A;  2L50 A;  2LP2 A;  2M9G A;  1FI5 A;  4M2O A;  1WRL A;  2KI6 D;  2K2F A;  1B9A A;  1S1E A;  1UWO A;  2LUC A;  4CID A;  4XYN A;  1IJ5 A;  4DUQ A;  5CPV A;  1YUS A;  5CSF A;  1QVI Z;  3JVT B;  2M1K B;  2M7N A;  2ZNE A;  4NDD A;  1RRO A;  5HKW A;  1CDM A;  1K95 A;  5KTY A;  2JOJ A;  2K0J A;  2HET A;  1OMR A;  4PE1 A;  2CNP A;  3EVU A;  2D8N A;  2M97 A;  3I5I C;  4OKH A;  4PHK A;  1EH2 A;  4C0L A;  2PAL A;  4HRH A;  1KFX L;  4GFT A;  1QX5 B;  3LLE A;  2KOT A;  4I5L B;  3IQO A;  2RGI A;  1XFU O;  1SR6 B;  4OV2 A;  1QLS A;  1SNL A;  1V1F A;  2LAP A;  1J55 A;  3VGO A;  1EG4 A;  3C1V A;  3DVE A;  4XJK A;  4XJK B;  1FPW A;  2HQ8 A;  1IH0 A;  3OB2 B;  1NUB A;  4HRE E;  4P5O E;  1MXE A;  1YX8 A;  2K7O A;  1Y1U A;  1UHH A;  1QVI Y;  4PE7 A;  4A4C A;  3DF0 A;  3DF0 B;  3NXA A;  1DVI A;  3A4U B;  1YTZ C;  2KGR A;  1J7Q A;  4GGF C;  1XFX O;  2KHN A;  3WNX B;  2JT0 A;  3O6B A;  2O5G A;  1OZS A;  3PAL A;  3RLZ A;  2E6W A;  3TDU A;  3VRN A;  1WLM A;  1NSH A;  1JUO A;  2M0R A;  3CZT X;  3MSE B;  4I5J A;  2JU0 A;  1LIN A;  3GOF A;  5D69 A;  3KPX A;  1BT6 A;  1SKT A;  1UUS A;  2KFG A;  3KHE A;  2BKI B;  1V1G A;  4MN0 A;  4CLN A;  1SRA A;  1YVH A;  1B7T Y;  1DT7 B;  4M2Q A;  1RWY A;  3IF7 A;  1LVC D;  2JPT A;  1JFK A;  3KF9 A;  1CMF A;  5DKN A;  2JT8 A;  1UHJ A;  2I94 A;  3PN7 C;  4YGE B;  4YGA A;  2K7B A;  1PSB A;  3EVV A;  1K9K A;  4L9M A;  4BY5 A;  1XK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...