2SCPA

Structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
174
structure length
174
Chain Sequence
b'SDLWVQKMKTYFNRIDFDKDGAITRMDFESMAERFAKESEMKAEHAKVLMDSLTGVWDNFLTAVAGGKGIDETTFINSMKEMVKNPEAKSVVEGPLPLFFRAVDTNEDNNISRDEYGIFFGMLGLDKTMAPASFDAIDTNNDGLLSLEEFVIAGSDFFMNDGDSTNKVFWGPLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARCOPLASMIC CALCIUM-BINDING PROTEIN
publication title Structure of a sarcoplasmic calcium-binding protein from Nereis diversicolor refined at 2.0 A resolution.
pubmed doi rcsb
source organism Neanthes diversicolor
molecule tags Binding protein
total genus 70
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2scpA00
1SBJA 3TUYB 4CFQA 1TNXA 2LP2A 3AKBA 2MBXA 1JFKA 1OZSA 2K8MB 1B47A 3TUYC 1UUSA 1J1DA 2K7CA 4A4BA 2LAPA 2F8PA 3TDZA 5ER5A 1C7WA 1SL8A 1A03A 1F8HA 2L0PA 2EC6B 4YGAA 1HQVA 4MRYA 1UHKA 5HLVA 4HSZA 1QX7A 4FQOA 1Y6WA 2KQ6A 1S6IA 4XJKB 2KQYA 5HLOA 2M0RA 4GPLB 2LUCA 3DF0B 3RLZA 1OMVA 3DVMA 3WHUB 2K2FA 2ZN9A 1K93D 1CNPA 3CGAA 4GNKB 2I2RE 1CM4A 1TNPA 1S5GZ 1SCMC 3SIAA 4BY4A 1LINA 2KI6C 2RGIA 2NXQA 1MUXA 1U5IB 5DKQA 5AERA 3AAJA 2NCOA 1MQ1A 3KO0A 1RROA 2D8NA 3BUXB 2PSRA 5I8NA 2PVBA 2LHLA 4I5KA 1CLLA 5D69A 1A29A 1CM1A 4I5NB 1DJIA 3E3RA 4ORBB 5K89A 1BODA 1J7OA 1KWOB 2WORA 4M2PA 1SCVA 1Y1XA 3PSRA 2WOSA 5I2LA 1WLZA 1NX3A 1G4YR 3I5HB 1LVCD 2F3ZA 2O60A 1U5IA 2WCFA 1SW8A 2DOQA 3I5HC 4PHMA 1K9KA 3LK0A 1N2DA 1A75A 1CMGA 1S5GY 1PVAA 1YRUB 1OMRA 1PRWA 3EK4A 1QJTA 2L51A 4PHKA 5KTYA 5JJGA 2KYCA 1QX5B 1CDNA 2KAVA 4MN0A 1IJ6A 2CTNA 1JFJA 3NSOA 1PSRA 1CTRA 2JT8A 1PK0D 3PM8A 4GBAA 3GK4X 4N5XA 1IGVA 3BXKA 2JT0A 1NIWA 1QS7A 1KSOA 1H4BA 2BCBA 2GV5A 1OZOA 4WQ2A 3BUNB 3JTDB 1KFXL 2OTGB 1TCFA 3JVTB 4PDZA 2ZN8A 4XYNA 1VRKA 2I7AA 1A2XA 3TS5B 1QV0A 5I2QA 2OTGC 1BF5A 2M7NA 2P6BB 1K94A 2KAXA 3TS5C 3VRNA 3KHEA 4Q04A 2JRFA 3RM1A 1X02A 1PULA 3KEVA 1TNWA 2G9BA 2KBIA 3C1VA 1IRJA 1MHOA 1CFPA 3OB2B 2LMVA 1KK7Z 1S1EA 3FIAA 3CR4X 3IQQA 1CMFA 2JULA 2M1UA 1YVHA 2LLTA 1KCYA 4YGEB 1NYAA 3BUOB 2V53A 2KFHA 1M31A 1FPWA 2GGMA 2L50A 1GQMA 2LVKA 1OOJA 1LA0A 2NZ0A 1R2UA 1N65A 1LKJA 2JXLA 5F6TA 1FW4A 2K2AA 4GUKA 4JQ0D 4DS7A 2BE6A 3PN7C 1PSBA 2LVIA 1SR6B 2SCPA 2PMYA 3CTNA 1BLQA 1KK7Y 2FCDA 3D0YB 1B9AA 1EG3A 3LK1A 1DF0B 1A4PA 1SR6C 1D1OA 1NX0A 1NX1A 3CWGA 3IF7A 3EKJA 2NCPA 3LCPC 1B8CA 1SMGA 1KQVA 3FWBA 2SASA 2ZNEA 1OE9B 3BOWA 1B8LA 2JTTA 4MSPA 1FI6A 1DMOA 2I94A 1UHHA 1MR8A 3QRXA 1LA3A 3D0YA 1XK4C 2E30A 4AQIA 2HETA 1J7RA 3OP0A 2CT9A 2M49B 3F45A 1MXLC 4F0ZB 1RFJA 1S3PA 4TNCA 1Y0VH 1AP4A 1AJ5A 3NSLA 4PE1A 4C0KA 3D10A 2LMUA 1Y1UA 1JSAA 1XK4A 1QIWA 3EK7A 2BKHB 1XFWO 3SJSA 2FJUB 4PHJA 2ZRTA 5AANA 1CFDA 2LUXA 5ER4X 1NPQA 3I5GB 2JC2A 3TZ1A 1QTXA 1RK9A 4CLNA 1Y1AA 5KSZA 2BE4A 4MRXA 2EC6C 3I5GC 3VGOA 1BJFA 1XFZO 2QPTA 2LE9B 3A8RA 3CZTX 2TN4A 4GGNA 1SY9A 2K7OA 3VRPA 1TOPA 4DUQA 3NXAA 1EG4A 1EH2A 3CLNA 2L98A 3SG6A 3KF9A 1EXRA 1F4QA 2OPOA 1WRKA 2LMTA 1UHIA 1KFUS 1QXPA 2L5XB 3LLEA 4GGFC 3LL8B 3A4UB 1SYMA 1G33A 4OR9B 4XJKA 2G2BA 3SIBA 2CCMA 2WCEA 2MJWB 2JWWA 1NSHA 3DF0A 3WXAA 2AMIA 2LLSA 4GAOA 2JPTA 1BR4B 1QLKA 1NCZA 3VROA 1CFCA 2MHHA 1L2OB 1WRLA 4GGFA 1KSMA 1KWOC 1FF1A 3FS7A 2KNEA 1GGZA 1UURA 1BOCA 1L2OC 1EL4A 3GK1A 4PALA 2B1UA 2M29A 2AAOA 3OX5A 5CSFA 1NCXA 4ICBA 1J7PA 1F4OA 3OB1B 2K7DA 4NDBA 2PRUA 3M0WA 2BCAA 2L4IA 3MSEB 2LM5A 1YVLA 2LP3A 1OQPA 2BBMA 2M7LA 4JWQA 1HT9A 3DD4A 4HRHA 1QIVA 1MXEA 1M46A 2L4HA 2LCPA 3O6BA 2CNPA 5CSIA 2Q91A 5CSNA 4U8DA 1CDLA 4MEWA 3JTDC 4YBHB 1N0YA 1AK8A 2KFGA 3JVTC 4CFRA 2JOJA 1XA5A 1KQMB 3BYAA 2KI4B 2KBMA 1BMOA 2Y4QA 4D1EA 5JOLA 1DJZA 2HQ8A 1KQMC 5I2OA 2H61C 2KI4C 1ZOTB 1XYDA 1ODBA 1L7ZA 4DRWA 2HPSA 5TNCA 1BG1A 1MF8B 1QLSA 1LXFC 1MWNA 3ICBA 5AXIA 2LVJA 1NWDA 1S6JA 3OHMB 2H61A 3PLFB 2BCXA 4M2OA 2L2EA 1M63B 2KYFA 5GQQC 2Q4UA 1FBVA 2PASA 1K9PA 2WCBA 1GGWA 1ZUZA 5AEQA 3CR2A 1B1GA 3SG4A 1WLMA 4BY5A 2LANA 1QX2A 1PVBA 3BUMB 2KDHA 1B7TZ 4ETOA 1BU3A 1QASA 2M8UA 3CR5X 2I18A 2COLB 4AQJA 5DKNA 1CLBA 4UPGA 2OS8B 4OV2A 2JTZA 4MVFA 2ZNDA 1DGVA 1UP5A 1V1FA 4HRGA 1KK8B 1Q80A 2F2PA 4ZCVA 5KU1A 2OS8C 2QACA 4ORAB 4E68A 4QJ5B 1H8BA 1KK8C 2M3WA 2MAZA 2Y5IA 1UWOA 1TN4A 3EVRA 1DF0A 1BT6A 1K95A 1KFUL 1XFVO 4R1EA 3EK8A 2FOTA 1B7TY 2CXJA 2ZKMX 3DVEA 5CSJA 1YURA 2K7BA 5HYDA 1NP8A 1ZACA 4MLWA 1IQ3A 2ISDA 1ALWA 2VRGA 1CDMA 2Y1MA 5B8IB 1W7JB 2LC5A 1K2HA 3PFVA 4GFTA 1F55A 1XO5A 2F2OA 2M97A 5HKYA 4L9MA 1DGUA 3ZNIA 4M2QA 1YRTB 3FWCA 3K21A 4NDDA 1QVIZ 2K0JA 3KPXA 2KI6D 2JT3A 4MZLA 2BKIB 1BR1B 1RWYA 2MLEC 1XFXO 2K61A 4HREE 4OKHA 1J7QA 1YUSA 3TDIA 1FI5A 4MZJA 2KGBC 2F33A 5AFPA 4ZCUA 1YUUA 1AHRA 5DKRA 4CPVA 1G8IA 3IQOA 1QATA 1RTP1 3DVKA 3WNXB 1F71A 1SL7A 2MLFC 4P5OE 1DJHA 1IKUA 1YR5A 2GGZA 1QVIY 3SG3A 2JQ6A 3TDUA 1SL9A 1XVJA 3HCMA 1JWDA 1SCMB 2MA2A 2WC8A 2HQWA 2PALA 4PE7A 2BL0B 4PE4A 3O4YA 5CPVA 4YGBB 1AJ4A 1B4CA 3GK2A 1K9UA 3ZWHA 4NDCA 2BL0C 1M39A 4WRIA 2O5GA 2Y1NA 1AUIB 1V1GA 2JU0A 4YGDB 3EKHA 1YUTA 3VRRA 1A75B 2FCEA 2LV7A 4OCIA 3EVVA 2M9GA 1XFUO 1C7VA 1WRZA 2LLUA 5G08A 4DIRA 5FYXA 3HX4A 4I5LB 2E6WA 3SG5A 1XFYO 2KGRA 1JUOA 4JPZB 1K90D 3PALA 3NSKA 4YI8A 1TCOB 3EVUA 1CDPA 1ZFSA 1M45A 3H4SE 4PCWA 1CLMA 1NCYA 4YGCB 3VRQA 1DT7B 1DJXA 5J3XA 1J55A 4USLA 4A4CA 2MRDA 1CFFA 2JNFA 2ZRSA 2JXCA 1K8UA 1S36A 1YX7A 1SNLA 4ORCB 1JF2A 3SG2A 3I5IB 1DVIA 1TIZA 2LHIA 3AKAA 5BPJA 1IJ5A 2KSPA 4YI9A 4P2YB 1C07A 3I5IC 2KAYA 1TRFA 5HKZA 2JNXA 4N1GA 4YRUA 1F54A 1PALA 4MBEA 1TTXA 1QV1A 3O78A 1JF0A 1ALVA 1UHJA 5PALA 4CIDA 1RJVA 1IH0A 2LVVA 2A4JA 1WDCB 2EGDA 2IS9A 2F3YA 1CB1A 2EHBA 2ZFDA 1E8AA 3O2PA 4IL1A 2WNDA 1WDCC 1JBAA 1SRAA 2CBLA 1CKKA 3WHTB 1R6PA 4C0JA 1JC2A 1RECA 3AAKA 1IQ5A 1DTLA 1WY9A 2AUCA 2HF5A 4PE0A 4QJ4B 3BQ3A 2BECA 1OSAA 1S6CA 1S26D 1GJYA 1ZMZA 1AVSA 5D7FA 4WQ3A 1KFXS 2BBNA 4OVNF 4PHNA 2R2IA 1YTZC 2NLNA 3PN7B 1B8RA 4I5JA 1YX8A 3BOWB 2M1KB 1IWQA 2H2KA 1W7IB 2JZIA 4MZKA 1SKTA 4AOMA 1J1EA 5IBWA 2LNKA 4QJ3B 1IG5A 1DJGA 1SK6D 1UHNA 1K96A 3GOFA 3SG7A 3OX6A 3DVJA 4FTGA 5HKWA 3CS1A 3I5FB 3BUWB 1NUBA 2KFFA 1EJ3A 1NX2A 4C0LA 3NSIA 2KHNA 1TNQA 3I5FC 1DJWA 4DCKA 4N1FA 4NQGA 1DJYA 2KOTA 1SPYA 1OMDA 3PATA 1F70A
chains in the Genus database with same CATH superfamily
1SBJA 3TUYB 4CFQA 1TNXA 2LP2A 1SSEB 3AKBA 2MBXA 1JFKA 1OZSA 2K8MB 1B47A 3TUYC 1UUSA 1J1DA 2K7CA 4A4BA 2LAPA 2F8PA 3TDZA 5ER5A 3L47A 1C7WA 1SL8A 1A03A 2WC6A 1F8HA 2L0PA 2EC6B 4YGAA 1HQVA 3SS5A 4MRYA 1UHKA 5HLVA 4HSZA 4IJ7A 1QX7A 4FQOA 1Y6WA 2KQ6A 1S6IA 4XJKB 2KQYA 5HLOA 2M0RA 4GPLB 2LUCA 3DF0B 3RLZA 1OMVA 3DVMA 3WHUB 2K2FA 2ZN9A 1K93D 1CNPA 4INWA 3CGAA 3B87A 2I2RE 4GNKB 1CM4A 1TNPA 1S5GZ 1SCMC 3SIAA 4BY4A 1LINA 2KI6C 2RGIA 2NXQA 1MUXA 1U5IB 5DKQA 5AERA 3AAJA 1DELA 2NCOA 1MQ1A 3B88A 3KO0A 1RROA 2D8NA 3BUXB 2YGUA 3CZ2A 2PSRA 5I8NA 1DC1A 2PVBA 2LHLA 4I5KA 1CLLA 1T14A 5D69A 1A29A 1CM1A 4I5NB 1DJIA 3D78A 3E3RA 4ORBB 5K89A 1BODA 1KWOB 2WORA 1J7OA 4M2PA 1SCVA 1Y1XA 3L4AA 3PSRA 2WOSA 5I2LA 1WLZA 1NX3A 1G4YR 3CZ1A 1LVCD 2F3ZA 2O60A 3I5HB 1U5IA 2WCFA 1SW8A 2DOQA 3I5HC 4PHMA 1K9KA 3LK0A 1N2DA 1A75A 2ERBA 3R1PA 1S5GY 1CMGA 1PVAA 1YRUB 1OMRA 1PRWA 2WCKA 1QJTA 2L51A 3B86A 3D77A 3EK4A 2KYCA 1QX5B 4PHKA 5JJGA 2KAVA 4MN0A 5KTYA 1IJ6A 2CTNA 1CDNA 1JFJA 3K1EA 3NSOA 1PSRA 1CTRA 2JT8A 1PK0D 3PM8A 4GBAA 3GK4X 4N5XA 1IGVA 3BXKA 2JT0A 1NIWA 1QS7A 1KSOA 1H4BA 5EL2A 2BCBA 2GV5A 1OZOA 4WQ2A 3BUNB 3BFAA 3V2LA 3JTDB 1KFXL 2OTGB 1TCFA 3JVTB 4PDZA 2ZN8A 4XYNA 1VRKA 2I7AA 1A2XA 3TS5B 1QV0A 5I2QA 2OTGC 3B6XA 1BF5A 2M7NA 3BFHA 1OW4A 1K94A 2P6BB 2KAXA 3Q8IA 3TS5C 3VRNA 3KHEA 4Q04A 2JRFA 3RM1A 1X02A 1PULA 3KEVA 1TNWA 2G9BA 3R72A 2KBIA 3C1VA 1IRJA 1MHOA 1CFPA 3OB2B 2LMVA 1KK7Z 1S1EA 3FIAA 3CR4X 3IQQA 1CMFA 2JULA 2QEBA 2M1UA 1YVHA 2LLTA 1KCYA 4YGEB 1NYAA 3BUOB 3D73A 2V53A 2KFHA 1M31A 1FPWA 2GGMA 2L50A 3RZSA 1GQMA 2LVKA 1OOJA 1LA0A 2NZ0A 2PQLA 1R2UA 1N65A 1LKJA 2JXLA 5F6TA 1FW4A 2K2AA 4GUKA 4JQ0D 4DS7A 2BE6A 3PN7C 1PSBA 2LVIA 1SR6B 2SCPA 2PMYA 3CTNA 1BLQA 1KK7Y 2FCDA 3D0YB 1B9AA 4INXA 1EG3A 3LK1A 1DF0B 1A4PA 1SR6C 1D1OA 1NX0A 1NX1A 3CWGA 3OGNA 3IF7A 3EKJA 2NCPA 3LCPC 1B8CA 1SMGA 1KQVA 3FWBA 2SASA 2ZNEA 1OE9B 3BOWA 1B8LA 2JTTA 4MSPA 1FI6A 1DMOA 2I94A 1UHHA 1MR8A 3DY9A 1LA3A 3D0YA 3QRXA 1XK4C 2E30A 3D75A 3S0FA 4AQIA 3UO9A 2HETA 1J7RA 3OP0A 2CT9A 2M49B 3F45A 1MXLC 4F0ZB 1RFJA 1S3PA 4TNCA 1Y0VH 1AP4A 1AJ5A 3NSLA 4PE1A 4C0KA 5FI7A 3D10A 2LMUA 1Y1UA 1JSAA 1XK4A 1QIWA 3EK7A 2WCMA 2BKHB 1XFWO 3SJSA 2FJUB 4PHJA 2ZRTA 2WCHA 1CFDA 2LUXA 5AANA 5ER4X 1NPQA 3I5GB 2JC2A 3TZ1A 5FI6A 1QTXA 3BFBA 1RK9A 4CLNA 1Y1AA 5KSZA 2BE4A 4MRXA 2EC6C 5DICA 3I5GC 3VGOA 1OOFA 1BJFA 1XFZO 2QPTA 2LE9B 3D74A 3A8RA 3CZTX 2TN4A 4GGNA 1SY9A 2K7OA 3VRPA 1TOPA 4DUQA 3NXAA 1EG4A 1EH2A 3CLNA 2L98A 3SG6A 2WC5A 3KF9A 1EXRA 1F4QA 1OOHA 2OPOA 1WRKA 2LMTA 1UHIA 1KFUS 1QXPA 2L5XB 3LLEA 4GGFC 3LL8B 5D3OA 3A4UB 1IIOA 1SYMA 1G33A 4OR9B 4XJKA 2G2BA 3SIBA 2CCMA 2WCJA 2WCEA 2MJWB 2JWWA 1NSHA 3DF0A 3WXAA 3S0DA 2AMIA 2LLSA 2GTEA 2JPTA 1BR4B 4GAOA 1QLKA 1NCZA 3VROA 1CFCA 2MHHA 1L2OB 1WRLA 4GGFA 1KSMA 1KWOC 5HL1A 1FF1A 3FS7A 2KNEA 1GGZA 1UURA 2BAPA 1BOCA 1L2OC 1EL4A 2QEHA 3GK1A 2B1UA 4PALA 3UNWA 2M29A 2AAOA 3OX5A 5CSFA 1NCXA 4ICBA 1J7PA 1F4OA 3OB1B 2K7DA 4NDBA 2PRUA 3DZTA 3M0WA 2BCAA 2L4IA 3MSEB 2LM5A 1W9ZA 1YVLA 2LP3A 1OQPA 2BBMA 2M7LA 4JWQA 1HT9A 3DD4A 3QMEA 4HRHA 1QIVA 1MXEA 1M46A 2L4HA 2LCPA 3O6BA 3FE8A 2BNXA 2CNPA 5CSIA 4F7FA 1TUZA 2Q91A 5CSNA 4U8DA 2K60A 2PYQA 1CDLA 4MEWA 3JTDC 3IVTA 4YBHB 1N0YA 3S0AA 1AK8A 2KFGA 3JVTC 4CFRA 2JOJA 1OOGA 1XA5A 1KQMB 3BYAA 2KI4B 2KBMA 1BMOA 2Y4QA 4D1EA 5JOLA 1DJZA 2HQ8A 1KQMC 5I2OA 2H61C 2KI4C 1ZOTB 2WCLA 1XYDA 1ODBA 1L7ZA 4DRWA 2HPSA 5TNCA 1BG1A 1MF8B 1QLSA 1LXFC 1MWNA 3ICBA 5AXIA 2LVJA 1NWDA 1S6JA 3OHMB 2H61A 3PLFB 2BCXA 4M2OA 2L2EA 1M63B 2KYFA 5GQQC 2Q4UA 1FBVA 2PASA 1K9PA 2WCBA 1GGWA 1ZUZA 4PT1A 3CR2A 5AEQA 1B1GA 2QEOA 3SG4A 1WLMA 4BY5A 2LANA 1QX2A 1PVBA 3BUMB 2KDHA 3DXLA 1DQEA 1B7TZ 3CYZA 4ETOA 1BU3A 1QASA 2M8UA 3CR5X 2I18A 2COLB 4AQJA 2H8VA 5DKNA 1CLBA 4UPGA 2OS8B 4OV2A 2JTZA 4MVFA 2ZNDA 1V1FA 1DGVA 1UP5A 4HRGA 1KK8B 1Q80A 2F2PA 4ZCVA 5KU1A 2OS8C 1TWOA 2QACA 4ORAB 4E68A 4QJ5B 1H8BA 1KK8C 1ORGA 3PM2A 2M3WA 2MAZA 3S0GA 2Y5IA 4OZDA 1UWOA 1TN4A 3S0BA 3EVRA 1Z4HA 1DF0A 1BT6A 1K95A 1KFUL 1XFVO 4R1EA 2JPOA 2FOTA 3EK8A 5FI2A 1B7TY 2CXJA 3NGVA 2ZKMX 3DVEA 3NHIA 5CSJA 1YURA 2K7BA 5HYDA 1NP8A 1ZACA 4MLWA 1IQ3A 2ISDA 1ALWA 2VRGA 1GM0A 1CDMA 2Y1MA 3FE9A 1W7JB 5B8IB 2LC5A 2P70A 1K2HA 3PFVA 4GFTA 1Z2CB 1F55A 1XO5A 2F2OA 2M97A 5HKYA 4L9MA 1DGUA 3ZNIA 4M2QA 1YRTB 1C3ZA 3FWCA 3K21A 4NDDA 1QVIZ 2K0JA 3KPXA 2KI6D 2JT3A 3PJIA 4MZLA 2BKIB 2KLEA 1BR1B 1RWYA 2MLEC 1XFXO 2K61A 4FQTA 4HREE 4OKHA 1YUSA 3TDIA 1J7QA 4MZJA 2KGBC 2F33A 1LS8A 5AFPA 4ZCUA 1YUUA 1AHRA 5DKRA 4CPVA 1G8IA 3IQOA 1QATA 1RTP1 3DVKA 3WNXB 1F71A 1SL7A 2MLFC 4P5OE 3R1VA 1DJHA 1IKUA 1YR5A 2GGZA 1QVIY 3SG3A 2JQ6A 3TDUA 1SL9A 3SS4A 1XVJA 3HCMA 1JWDA 1SCMB 2MA2A 2WC8A 1FI5A 2HQWA 2PALA 4PE7A 2BL0B 4PE4A 3O4YA 5CPVA 4YGBB 1AJ4A 4KYNA 1B4CA 3GK2A 1K9UA 3ZWHA 4NDCA 2KLDA 2BL0C 1M39A 4WRIA 2O5GA 2Y1NA 1AUIB 1V1GA 2JU0A 3EG5B 4YGDB 3EKHA 1YUTA 3VRRA 1A75B 2FCEA 5I94A 2LV7A 4OCIA 1C3YA 3EVVA 2M9GA 3CZ0A 2L2CA 1TUJA 1XFUO 1C7VA 1WRZA 2LLUA 5G08A 4DIRA 3BJHA 5FYXA 3HX4A 4I5LB 2E6WA 3SG5A 1XFYO 2KGRA 1JUOA 4JPZB 3DYEA 1K90D 3PALA 3NSKA 4YI8A 1TCOB 3EVUA 1CDPA 3B7AA 1ZFSA 1QWVA 1M45A 3H4SE 4PCWA 1CLMA 1NCYA 3N7HA 4YGCB 3VRQA 1DT7B 1DJXA 3NHTA 5J3XA 1J55A 4USLA 4A4CA 2P71A 2MRDA 1CFFA 2JNFA 2ZRSA 2JXCA 1K8UA 1S36A 1YX7A 3O4XA 1SNLA 4ORCB 1JF2A 2FJYA 3SG2A 3I5IB 1DVIA 1TIZA 2LHIA 3AKAA 5BPJA 1IJ5A 2KSPA 3CDNA 4P2YB 4YI9A 3I5IC 1C07A 2KAYA 1TRFA 5HKZA 2JNXA 4N1GA 1OOIX 3L4LA 4YRUA 1F54A 1PALA 3CABA 4MBEA 1TTXA 1QV1A 3O78A 1JF0A 3D76A 1ALVA 1UHJA 5PALA 4CIDA 1RJVA 1IH0A 2LVVA 1WDCB 2A4JA 2EGDA 2IS9A 2F3YA 1CB1A 2L5YA 2EHBA 2ZFDA 1E8AA 3O2PA 4IL1A 2WNDA 1WDCC 1JBAA 1SRAA 2CBLA 1CKKA 3WHTB 1R6PA 1DEKA 4C0JA 1JC2A 1RECA 3AAKA 1IQ5A 4JKTA 1DTLA 1WY9A 2AUCA 2HF5A 4PE0A 4QJ4B 3BQ3A 2BECA 1OSAA 4JD9A 1S6CA 1S26D 1GJYA 1ZMZA 1AVSA 5D7FA 3R1OA 4WQ3A 1KFXS 2BBNA 4OVNF 4PHNA 2R2IA 1YTZC 2QEVA 2NLNA 3PN7B 1B8RA 4I5JA 1YX8A 3BOWB 2M1KB 1IWQA 2H2KA 1W7IB 1XFRA 2JZIA 4MZKA 3SS3A 3VB1A 1SKTA 2KPHA 4AOMA 1J1EA 5IBWA 2LNKA 4QJ3B 1IG5A 1DJGA 1SK6D 1UHNA 1K96A 3OBVA 3GOFA 3SG7A 3OX6A 1P28A 3DVJA 4FTGA 5HKWA 3CS1A 3I5FB 3BUWB 1NUBA 2KFFA 1EJ3A 1NX2A 4C0LA 3NSIA 2KHNA 1TNQA 3I5FC 1DJWA 4DCKA 3FE6A 3S0EA 4N1FA 2QDIA 1DJYA 2KOTA 1SPYA 1OMDA 4NQGA 3PATA 1F70A
chains in the Genus database with same CATH topology
1SBJA 3TUYB 4CFQA 1TNXA 2LP2A 3AKBA 2MBXA 1JFKA 1OZSA 2K8MB 1B47A 3TUYC 1UUSA 1J1DA 2K7CA 4A4BA 2LAPA 2F8PA 3TDZA 5ER5A 1C7WA 1SL8A 1A03A 1F8HA 2L0PA 2EC6B 4YGAA 1HQVA 4MRYA 1UHKA 5HLVA 4HSZA 1QX7A 4FQOA 1Y6WA 2KQ6A 1S6IA 4XJKB 2KQYA 5HLOA 2M0RA 4GPLB 2LUCA 3DF0B 3RLZA 1OMVA 3DVMA 3WHUB 2K2FA 2ZN9A 1K93D 1CNPA 3CGAA 4GNKB 2I2RE 1CM4A 1TNPA 1S5GZ 1SCMC 3SIAA 4BY4A 1LINA 2KI6C 2RGIA 2NXQA 1MUXA 1U5IB 5DKQA 5AERA 3AAJA 2NCOA 1MQ1A 3KO0A 1RROA 2D8NA 3BUXB 2PSRA 5I8NA 2PVBA 2LHLA 4I5KA 1CLLA 5D69A 1A29A 1CM1A 4I5NB 1DJIA 3E3RA 4ORBB 5K89A 1BODA 1J7OA 1KWOB 2WORA 4M2PA 1SCVA 1Y1XA 3PSRA 2WOSA 5I2LA 1WLZA 1NX3A 1G4YR 3I5HB 1LVCD 2F3ZA 2O60A 1U5IA 2WCFA 1SW8A 2DOQA 3I5HC 4PHMA 1K9KA 3LK0A 1N2DA 1A75A 1CMGA 1S5GY 1PVAA 1YRUB 1OMRA 1PRWA 3EK4A 1QJTA 2L51A 4PHKA 5KTYA 5JJGA 2KYCA 1QX5B 1CDNA 2KAVA 4MN0A 1IJ6A 2CTNA 1JFJA 3NSOA 1PSRA 1CTRA 2JT8A 1PK0D 3PM8A 4GBAA 3GK4X 4N5XA 1IGVA 3BXKA 2JT0A 1NIWA 1QS7A 1KSOA 1H4BA 2BCBA 2GV5A 1OZOA 4WQ2A 3BUNB 3JTDB 1KFXL 2OTGB 1TCFA 3JVTB 4PDZA 2ZN8A 4XYNA 1VRKA 2I7AA 1A2XA 3TS5B 1QV0A 5I2QA 2OTGC 1BF5A 2M7NA 2P6BB 1K94A 2KAXA 3TS5C 3VRNA 3KHEA 4Q04A 2JRFA 3RM1A 1X02A 1PULA 3KEVA 1TNWA 2G9BA 2KBIA 3C1VA 1IRJA 1MHOA 1CFPA 3OB2B 2LMVA 1KK7Z 1S1EA 3FIAA 3CR4X 3IQQA 1CMFA 2JULA 2M1UA 1YVHA 2LLTA 1KCYA 4YGEB 1NYAA 3BUOB 2V53A 2KFHA 1M31A 1FPWA 2GGMA 2L50A 1GQMA 2LVKA 1OOJA 1LA0A 2NZ0A 1R2UA 1N65A 1LKJA 2JXLA 5F6TA 1FW4A 2K2AA 4GUKA 4JQ0D 4DS7A 2BE6A 3PN7C 1PSBA 2LVIA 1SR6B 2SCPA 2PMYA 3CTNA 1BLQA 1KK7Y 2FCDA 3D0YB 1B9AA 1EG3A 3LK1A 1DF0B 1A4PA 1SR6C 1D1OA 1NX0A 1NX1A 3CWGA 3IF7A 3EKJA 2NCPA 3LCPC 1B8CA 1SMGA 1KQVA 3FWBA 2SASA 2ZNEA 1OE9B 3BOWA 1B8LA 2JTTA 4MSPA 1FI6A 1DMOA 2I94A 1UHHA 1MR8A 3QRXA 1LA3A 3D0YA 1XK4C 2E30A 4AQIA 2HETA 1J7RA 3OP0A 2CT9A 2M49B 3F45A 1MXLC 4F0ZB 1RFJA 1S3PA 4TNCA 1Y0VH 1AP4A 1AJ5A 3NSLA 4PE1A 4C0KA 3D10A 2LMUA 1Y1UA 1JSAA 1XK4A 1QIWA 3EK7A 2BKHB 1XFWO 3SJSA 2FJUB 4PHJA 2ZRTA 5AANA 1CFDA 2LUXA 5ER4X 1NPQA 3I5GB 2JC2A 3TZ1A 1QTXA 1RK9A 4CLNA 1Y1AA 5KSZA 2BE4A 4MRXA 2EC6C 3I5GC 3VGOA 1BJFA 1XFZO 2QPTA 2LE9B 3A8RA 3CZTX 2TN4A 4GGNA 1SY9A 2K7OA 3VRPA 1TOPA 4DUQA 3NXAA 1EG4A 1EH2A 3CLNA 2L98A 3SG6A 3KF9A 1EXRA 1F4QA 2OPOA 1WRKA 2LMTA 1UHIA 1KFUS 1QXPA 2L5XB 3LLEA 4GGFC 3LL8B 3A4UB 1SYMA 1G33A 4OR9B 4XJKA 2G2BA 3SIBA 2CCMA 2WCEA 2MJWB 2JWWA 1NSHA 3DF0A 3WXAA 2AMIA 2LLSA 4GAOA 2JPTA 1BR4B 1QLKA 1NCZA 3VROA 1CFCA 2MHHA 1L2OB 1WRLA 4GGFA 1KSMA 1KWOC 1FF1A 3FS7A 2KNEA 1GGZA 1UURA 1BOCA 1L2OC 1EL4A 3GK1A 4PALA 2B1UA 2M29A 2AAOA 3OX5A 5CSFA 1NCXA 4ICBA 1J7PA 1F4OA 3OB1B 2K7DA 4NDBA 2PRUA 3M0WA 2BCAA 2L4IA 3MSEB 2LM5A 1YVLA 2LP3A 1OQPA 2BBMA 2M7LA 4JWQA 1HT9A 3DD4A 4HRHA 1QIVA 1MXEA 1M46A 2L4HA 2LCPA 3O6BA 2CNPA 5CSIA 2Q91A 5CSNA 4U8DA 1CDLA 4MEWA 3JTDC 4YBHB 1N0YA 1AK8A 2KFGA 3JVTC 4CFRA 2JOJA 1XA5A 1KQMB 3BYAA 2KI4B 2KBMA 1BMOA 2Y4QA 4D1EA 5JOLA 1DJZA 2HQ8A 1KQMC 5I2OA 2H61C 2KI4C 1ZOTB 1XYDA 1ODBA 1L7ZA 4DRWA 2HPSA 5TNCA 1BG1A 1MF8B 1QLSA 1LXFC 1MWNA 3ICBA 5AXIA 2LVJA 1NWDA 1S6JA 3OHMB 2H61A 3PLFB 2BCXA 4M2OA 2L2EA 1M63B 2KYFA 5GQQC 2Q4UA 1FBVA 2PASA 1K9PA 2WCBA 1GGWA 1ZUZA 5AEQA 3CR2A 1B1GA 3SG4A 1WLMA 4BY5A 2LANA 1QX2A 1PVBA 3BUMB 2KDHA 1B7TZ 4ETOA 1BU3A 1QASA 2M8UA 3CR5X 2I18A 2COLB 4AQJA 5DKNA 1CLBA 4UPGA 2OS8B 4OV2A 2JTZA 4MVFA 2ZNDA 1DGVA 1UP5A 1V1FA 4HRGA 1KK8B 1Q80A 2F2PA 4ZCVA 5KU1A 2OS8C 2QACA 4ORAB 4E68A 4QJ5B 1H8BA 1KK8C 2M3WA 2MAZA 2Y5IA 1UWOA 1TN4A 3EVRA 1DF0A 1BT6A 1K95A 1KFUL 1XFVO 4R1EA 3EK8A 2FOTA 1B7TY 2CXJA 2ZKMX 3DVEA 5CSJA 1YURA 2K7BA 5HYDA 1NP8A 1ZACA 4MLWA 1IQ3A 2ISDA 1ALWA 2VRGA 1CDMA 2Y1MA 5B8IB 1W7JB 2LC5A 1K2HA 3PFVA 4GFTA 1F55A 1XO5A 2F2OA 2M97A 5HKYA 4L9MA 1DGUA 3ZNIA 4M2QA 1YRTB 3FWCA 3K21A 4NDDA 1QVIZ 2K0JA 3KPXA 2KI6D 2JT3A 4MZLA 2BKIB 1BR1B 1RWYA 2MLEC 1XFXO 2K61A 4HREE 4OKHA 1J7QA 1YUSA 3TDIA 1FI5A 4MZJA 2KGBC 2F33A 5AFPA 4ZCUA 1YUUA 1AHRA 5DKRA 4CPVA 1G8IA 3IQOA 1QATA 1RTP1 3DVKA 3WNXB 1F71A 1SL7A 2MLFC 4P5OE 1DJHA 1IKUA 1YR5A 2GGZA 1QVIY 3SG3A 2JQ6A 3TDUA 1SL9A 1XVJA 3HCMA 1JWDA 1SCMB 2MA2A 2WC8A 2HQWA 2PALA 4PE7A 2BL0B 4PE4A 3O4YA 5CPVA 4YGBB 1AJ4A 1B4CA 3GK2A 1K9UA 3ZWHA 4NDCA 2BL0C 1M39A 4WRIA 2O5GA 2Y1NA 1AUIB 1V1GA 2JU0A 4YGDB 3EKHA 1YUTA 3VRRA 1A75B 2FCEA 2LV7A 4OCIA 3EVVA 2M9GA 1XFUO 1C7VA 1WRZA 2LLUA 5G08A 4DIRA 5FYXA 3HX4A 4I5LB 2E6WA 3SG5A 1XFYO 2KGRA 1JUOA 4JPZB 1K90D 3PALA 3NSKA 4YI8A 1TCOB 3EVUA 1CDPA 1ZFSA 1M45A 3H4SE 4PCWA 1CLMA 1NCYA 4YGCB 3VRQA 1DT7B 1DJXA 5J3XA 1J55A 4USLA 4A4CA 2MRDA 1CFFA 2JNFA 2ZRSA 2JXCA 1K8UA 1S36A 1YX7A 1SNLA 4ORCB 1JF2A 3SG2A 3I5IB 1DVIA 1TIZA 2LHIA 3AKAA 5BPJA 1IJ5A 2KSPA 4YI9A 4P2YB 1C07A 3I5IC 2KAYA 1TRFA 5HKZA 2JNXA 4N1GA 4YRUA 1F54A 1PALA 4MBEA 1TTXA 1QV1A 3O78A 1JF0A 1ALVA 1UHJA 5PALA 4CIDA 1RJVA 1IH0A 2LVVA 2A4JA 1WDCB 2EGDA 2IS9A 2F3YA 1CB1A 2EHBA 2ZFDA 1E8AA 3O2PA 4IL1A 2WNDA 1WDCC 1JBAA 1SRAA 2CBLA 1CKKA 3WHTB 1R6PA 4C0JA 1JC2A 1RECA 3AAKA 1IQ5A 1DTLA 1WY9A 2AUCA 2HF5A 4PE0A 4QJ4B 3BQ3A 2BECA 1OSAA 1S6CA 1S26D 1GJYA 1ZMZA 1AVSA 5D7FA 4WQ3A 1KFXS 2BBNA 4OVNF 4PHNA 2R2IA 1YTZC 2NLNA 3PN7B 1B8RA 4I5JA 1YX8A 3BOWB 2M1KB 1IWQA 2H2KA 1W7IB 2JZIA 4MZKA 1SKTA 4AOMA 1J1EA 5IBWA 2LNKA 4QJ3B 1IG5A 1DJGA 1SK6D 1UHNA 1K96A 3GOFA 3SG7A 3OX6A 3DVJA 4FTGA 5HKWA 3CS1A 3I5FB 3BUWB 1NUBA 2KFFA 1EJ3A 1NX2A 4C0LA 3NSIA 2KHNA 1TNQA 3I5FC 1DJWA 4DCKA 4N1FA 4NQGA 1DJYA 2KOTA 1SPYA 1OMDA 3PATA 1F70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SBJ A;  3TUY B;  4CFQ A;  1TNX A;  2LP2 A;  3AKB A;  2MBX A;  1JFK A;  1OZS A;  2K8M B;  1B47 A;  3TUY C;  1UUS A;  1J1D A;  2K7C A;  4A4B A;  2LAP A;  2F8P A;  3TDZ A;  5ER5 A;  1C7W A;  1SL8 A;  1A03 A;  1F8H A;  2L0P A;  2EC6 B;  4YGA A;  1HQV A;  4MRY A;  1UHK A;  5HLV A;  4HSZ A;  1QX7 A;  4FQO A;  1Y6W A;  2KQ6 A;  1S6I A;  4XJK B;  2KQY A;  5HLO A;  2M0R A;  4GPL B;  2LUC A;  3DF0 B;  3RLZ A;  1OMV A;  3DVM A;  3WHU B;  2K2F A;  2ZN9 A;  1K93 D;  1CNP A;  3CGA A;  4GNK B;  2I2R E;  1CM4 A;  1TNP A;  1S5G Z;  1SCM C;  3SIA A;  4BY4 A;  1LIN A;  2KI6 C;  2RGI A;  2NXQ A;  1MUX A;  1U5I B;  5DKQ A;  5AER A;  3AAJ A;  2NCO A;  1MQ1 A;  3KO0 A;  1RRO A;  2D8N A;  3BUX B;  2PSR A;  5I8N A;  2PVB A;  2LHL A;  4I5K A;  1CLL A;  5D69 A;  1A29 A;  1CM1 A;  4I5N B;  1DJI A;  3E3R A;  4ORB B;  5K89 A;  1BOD A;  1J7O A;  1KWO B;  2WOR A;  4M2P A;  1SCV A;  1Y1X A;  3PSR A;  2WOS A;  5I2L A;  1WLZ A;  1NX3 A;  1G4Y R;  3I5H B;  1LVC D;  2F3Z A;  2O60 A;  1U5I A;  2WCF A;  1SW8 A;  2DOQ A;  3I5H C;  4PHM A;  1K9K A;  3LK0 A;  1N2D A;  1A75 A;  1CMG A;  1S5G Y;  1PVA A;  1YRU B;  1OMR A;  1PRW A;  3EK4 A;  1QJT A;  2L51 A;  4PHK A;  5KTY A;  5JJG A;  2KYC A;  1QX5 B;  1CDN A;  2KAV A;  4MN0 A;  1IJ6 A;  2CTN A;  1JFJ A;  3NSO A;  1PSR A;  1CTR A;  2JT8 A;  1PK0 D;  3PM8 A;  4GBA A;  3GK4 X;  4N5X A;  1IGV A;  3BXK A;  2JT0 A;  1NIW A;  1QS7 A;  1KSO A;  1H4B A;  2BCB A;  2GV5 A;  1OZO A;  4WQ2 A;  3BUN B;  3JTD B;  1KFX L;  2OTG B;  1TCF A;  3JVT B;  4PDZ A;  2ZN8 A;  4XYN A;  1VRK A;  2I7A A;  1A2X A;  3TS5 B;  1QV0 A;  5I2Q A;  2OTG C;  1BF5 A;  2M7N A;  2P6B B;  1K94 A;  2KAX A;  3TS5 C;  3VRN A;  3KHE A;  4Q04 A;  2JRF A;  3RM1 A;  1X02 A;  1PUL A;  3KEV A;  1TNW A;  2G9B A;  2KBI A;  3C1V A;  1IRJ A;  1MHO A;  1CFP A;  3OB2 B;  2LMV A;  1KK7 Z;  1S1E A;  3FIA A;  3CR4 X;  3IQQ A;  1CMF A;  2JUL A;  2M1U A;  1YVH A;  2LLT A;  1KCY A;  4YGE B;  1NYA A;  3BUO B;  2V53 A;  2KFH A;  1M31 A;  1FPW A;  2GGM A;  2L50 A;  1GQM A;  2LVK A;  1OOJ A;  1LA0 A;  2NZ0 A;  1R2U A;  1N65 A;  1LKJ A;  2JXL A;  5F6T A;  1FW4 A;  2K2A A;  4GUK A;  4JQ0 D;  4DS7 A;  2BE6 A;  3PN7 C;  1PSB A;  2LVI A;  1SR6 B;  2SCP A;  2PMY A;  3CTN A;  1BLQ A;  1KK7 Y;  2FCD A;  3D0Y B;  1B9A A;  1EG3 A;  3LK1 A;  1DF0 B;  1A4P A;  1SR6 C;  1D1O A;  1NX0 A;  1NX1 A;  3CWG A;  3IF7 A;  3EKJ A;  2NCP A;  3LCP C;  1B8C A;  1SMG A;  1KQV A;  3FWB A;  2SAS A;  2ZNE A;  1OE9 B;  3BOW A;  1B8L A;  2JTT A;  4MSP A;  1FI6 A;  1DMO A;  2I94 A;  1UHH A;  1MR8 A;  3QRX A;  1LA3 A;  3D0Y A;  1XK4 C;  2E30 A;  4AQI A;  2HET A;  1J7R A;  3OP0 A;  2CT9 A;  2M49 B;  3F45 A;  1MXL C;  4F0Z B;  1RFJ A;  1S3P A;  4TNC A;  1Y0V H;  1AP4 A;  1AJ5 A;  3NSL A;  4PE1 A;  4C0K A;  3D10 A;  2LMU A;  1Y1U A;  1JSA A;  1XK4 A;  1QIW A;  3EK7 A;  2BKH B;  1XFW O;  3SJS A;  2FJU B;  4PHJ A;  2ZRT A;  5AAN A;  1CFD A;  2LUX A;  5ER4 X;  1NPQ A;  3I5G B;  2JC2 A;  3TZ1 A;  1QTX A;  1RK9 A;  4CLN A;  1Y1A A;  5KSZ A;  2BE4 A;  4MRX A;  2EC6 C;  3I5G C;  3VGO A;  1BJF A;  1XFZ O;  2QPT A;  2LE9 B;  3A8R A;  3CZT X;  2TN4 A;  4GGN A;  1SY9 A;  2K7O A;  3VRP A;  1TOP A;  4DUQ A;  3NXA A;  1EG4 A;  1EH2 A;  3CLN A;  2L98 A;  3SG6 A;  3KF9 A;  1EXR A;  1F4Q A;  2OPO A;  1WRK A;  2LMT A;  1UHI A;  1KFU S;  1QXP A;  2L5X B;  3LLE A;  4GGF C;  3LL8 B;  3A4U B;  1SYM A;  1G33 A;  4OR9 B;  4XJK A;  2G2B A;  3SIB A;  2CCM A;  2WCE A;  2MJW B;  2JWW A;  1NSH A;  3DF0 A;  3WXA A;  2AMI A;  2LLS A;  4GAO A;  2JPT A;  1BR4 B;  1QLK A;  1NCZ A;  3VRO A;  1CFC A;  2MHH A;  1L2O B;  1WRL A;  4GGF A;  1KSM A;  1KWO C;  1FF1 A;  3FS7 A;  2KNE A;  1GGZ A;  1UUR A;  1BOC A;  1L2O C;  1EL4 A;  3GK1 A;  4PAL A;  2B1U A;  2M29 A;  2AAO A;  3OX5 A;  5CSF A;  1NCX A;  4ICB A;  1J7P A;  1F4O A;  3OB1 B;  2K7D A;  4NDB A;  2PRU A;  3M0W A;  2BCA A;  2L4I A;  3MSE B;  2LM5 A;  1YVL A;  2LP3 A;  1OQP A;  2BBM A;  2M7L A;  4JWQ A;  1HT9 A;  3DD4 A;  4HRH A;  1QIV A;  1MXE A;  1M46 A;  2L4H A;  2LCP A;  3O6B A;  2CNP A;  5CSI A;  2Q91 A;  5CSN A;  4U8D A;  1CDL A;  4MEW A;  3JTD C;  4YBH B;  1N0Y A;  1AK8 A;  2KFG A;  3JVT C;  4CFR A;  2JOJ A;  1XA5 A;  1KQM B;  3BYA A;  2KI4 B;  2KBM A;  1BMO A;  2Y4Q A;  4D1E A;  5JOL A;  1DJZ A;  2HQ8 A;  1KQM C;  5I2O A;  2H61 C;  2KI4 C;  1ZOT B;  1XYD A;  1ODB A;  1L7Z A;  4DRW A;  2HPS A;  5TNC A;  1BG1 A;  1MF8 B;  1QLS A;  1LXF C;  1MWN A;  3ICB A;  5AXI A;  2LVJ A;  1NWD A;  1S6J A;  3OHM B;  2H61 A;  3PLF B;  2BCX A;  4M2O A;  2L2E A;  1M63 B;  2KYF A;  5GQQ C;  2Q4U A;  1FBV A;  2PAS A;  1K9P A;  2WCB A;  1GGW A;  1ZUZ A;  5AEQ A;  3CR2 A;  1B1G A;  3SG4 A;  1WLM A;  4BY5 A;  2LAN A;  1QX2 A;  1PVB A;  3BUM B;  2KDH A;  1B7T Z;  4ETO A;  1BU3 A;  1QAS A;  2M8U A;  3CR5 X;  2I18 A;  2COL B;  4AQJ A;  5DKN A;  1CLB A;  4UPG A;  2OS8 B;  4OV2 A;  2JTZ A;  4MVF A;  2ZND A;  1DGV A;  1UP5 A;  1V1F A;  4HRG A;  1KK8 B;  1Q80 A;  2F2P A;  4ZCV A;  5KU1 A;  2OS8 C;  2QAC A;  4ORA B;  4E68 A;  4QJ5 B;  1H8B A;  1KK8 C;  2M3W A;  2MAZ A;  2Y5I A;  1UWO A;  1TN4 A;  3EVR A;  1DF0 A;  1BT6 A;  1K95 A;  1KFU L;  1XFV O;  4R1E A;  3EK8 A;  2FOT A;  1B7T Y;  2CXJ A;  2ZKM X;  3DVE A;  5CSJ A;  1YUR A;  2K7B A;  5HYD A;  1NP8 A;  1ZAC A;  4MLW A;  1IQ3 A;  2ISD A;  1ALW A;  2VRG A;  1CDM A;  2Y1M A;  5B8I B;  1W7J B;  2LC5 A;  1K2H A;  3PFV A;  4GFT A;  1F55 A;  1XO5 A;  2F2O A;  2M97 A;  5HKY A;  4L9M A;  1DGU A;  3ZNI A;  4M2Q A;  1YRT B;  3FWC A;  3K21 A;  4NDD A;  1QVI Z;  2K0J A;  3KPX A;  2KI6 D;  2JT3 A;  4MZL A;  2BKI B;  1BR1 B;  1RWY A;  2MLE C;  1XFX O;  2K61 A;  4HRE E;  4OKH A;  1J7Q A;  1YUS A;  3TDI A;  1FI5 A;  4MZJ A;  2KGB C;  2F33 A;  5AFP A;  4ZCU A;  1YUU A;  1AHR A;  5DKR A;  4CPV A;  1G8I A;  3IQO A;  1QAT A;  1RTP 1;  3DVK A;  3WNX B;  1F71 A;  1SL7 A;  2MLF C;  4P5O E;  1DJH A;  1IKU A;  1YR5 A;  2GGZ A;  1QVI Y;  3SG3 A;  2JQ6 A;  3TDU A;  1SL9 A;  1XVJ A;  3HCM A;  1JWD A;  1SCM B;  2MA2 A;  2WC8 A;  2HQW A;  2PAL A;  4PE7 A;  2BL0 B;  4PE4 A;  3O4Y A;  5CPV A;  4YGB B;  1AJ4 A;  1B4C A;  3GK2 A;  1K9U A;  3ZWH A;  4NDC A;  2BL0 C;  1M39 A;  4WRI A;  2O5G A;  2Y1N A;  1AUI B;  1V1G A;  2JU0 A;  4YGD B;  3EKH A;  1YUT A;  3VRR A;  1A75 B;  2FCE A;  2LV7 A;  4OCI A;  3EVV A;  2M9G A;  1XFU O;  1C7V A;  1WRZ A;  2LLU A;  5G08 A;  4DIR A;  5FYX A;  3HX4 A;  4I5L B;  2E6W A;  3SG5 A;  1XFY O;  2KGR A;  1JUO A;  4JPZ B;  1K90 D;  3PAL A;  3NSK A;  4YI8 A;  1TCO B;  3EVU A;  1CDP A;  1ZFS A;  1M45 A;  3H4S E;  4PCW A;  1CLM A;  1NCY A;  4YGC B;  3VRQ A;  1DT7 B;  1DJX A;  5J3X A;  1J55 A;  4USL A;  4A4C A;  2MRD A;  1CFF A;  2JNF A;  2ZRS A;  2JXC A;  1K8U A;  1S36 A;  1YX7 A;  1SNL A;  4ORC B;  1JF2 A;  3SG2 A;  3I5I B;  1DVI A;  1TIZ A;  2LHI A;  3AKA A;  5BPJ A;  1IJ5 A;  2KSP A;  4YI9 A;  4P2Y B;  1C07 A;  3I5I C;  2KAY A;  1TRF A;  5HKZ A;  2JNX A;  4N1G A;  4YRU A;  1F54 A;  1PAL A;  4MBE A;  1TTX A;  1QV1 A;  3O78 A;  1JF0 A;  1ALV A;  1UHJ A;  5PAL A;  4CID A;  1RJV A;  1IH0 A;  2LVV A;  2A4J A;  1WDC B;  2EGD A;  2IS9 A;  2F3Y A;  1CB1 A;  2EHB A;  2ZFD A;  1E8A A;  3O2P A;  4IL1 A;  2WND A;  1WDC C;  1JBA A;  1SRA A;  2CBL A;  1CKK A;  3WHT B;  1R6P A;  4C0J A;  1JC2 A;  1REC A;  3AAK A;  1IQ5 A;  1DTL A;  1WY9 A;  2AUC A;  2HF5 A;  4PE0 A;  4QJ4 B;  3BQ3 A;  2BEC A;  1OSA A;  1S6C A;  1S26 D;  1GJY A;  1ZMZ A;  1AVS A;  5D7F A;  4WQ3 A;  1KFX S;  2BBN A;  4OVN F;  4PHN A;  2R2I A;  1YTZ C;  2NLN A;  3PN7 B;  1B8R A;  4I5J A;  1YX8 A;  3BOW B;  2M1K B;  1IWQ A;  2H2K A;  1W7I B;  2JZI A;  4MZK A;  1SKT A;  4AOM A;  1J1E A;  5IBW A;  2LNK A;  4QJ3 B;  1IG5 A;  1DJG A;  1SK6 D;  1UHN A;  1K96 A;  3GOF A;  3SG7 A;  3OX6 A;  3DVJ A;  4FTG A;  5HKW A;  3CS1 A;  3I5F B;  3BUW B;  1NUB A;  2KFF A;  1EJ3 A;  1NX2 A;  4C0L A;  3NSI A;  2KHN A;  1TNQ A;  3I5F C;  1DJW A;  4DCK A;  4N1F A;  4NQG A;  1DJY A;  2KOT A;  1SPY A;  1OMD A;  3PAT A;  1F70 A; 
#chains in the Genus database with same CATH topology
 1SBJ A;  3TUY B;  4CFQ A;  1TNX A;  2LP2 A;  1SSE B;  3AKB A;  2MBX A;  1JFK A;  1OZS A;  2K8M B;  1B47 A;  3TUY C;  1UUS A;  1J1D A;  2K7C A;  4A4B A;  2LAP A;  2F8P A;  3TDZ A;  5ER5 A;  3L47 A;  1C7W A;  1SL8 A;  1A03 A;  2WC6 A;  1F8H A;  2L0P A;  2EC6 B;  4YGA A;  1HQV A;  3SS5 A;  4MRY A;  1UHK A;  5HLV A;  4HSZ A;  4IJ7 A;  1QX7 A;  4FQO A;  1Y6W A;  2KQ6 A;  1S6I A;  4XJK B;  2KQY A;  5HLO A;  2M0R A;  4GPL B;  2LUC A;  3DF0 B;  3RLZ A;  1OMV A;  3DVM A;  3WHU B;  2K2F A;  2ZN9 A;  1K93 D;  1CNP A;  4INW A;  3CGA A;  3B87 A;  2I2R E;  4GNK B;  1CM4 A;  1TNP A;  1S5G Z;  1SCM C;  3SIA A;  4BY4 A;  1LIN A;  2KI6 C;  2RGI A;  2NXQ A;  1MUX A;  1U5I B;  5DKQ A;  5AER A;  3AAJ A;  1DEL A;  2NCO A;  1MQ1 A;  3B88 A;  3KO0 A;  1RRO A;  2D8N A;  3BUX B;  2YGU A;  3CZ2 A;  2PSR A;  5I8N A;  1DC1 A;  2PVB A;  2LHL A;  4I5K A;  1CLL A;  1T14 A;  5D69 A;  1A29 A;  1CM1 A;  4I5N B;  1DJI A;  3D78 A;  3E3R A;  4ORB B;  5K89 A;  1BOD A;  1KWO B;  2WOR A;  1J7O A;  4M2P A;  1SCV A;  1Y1X A;  3L4A A;  3PSR A;  2WOS A;  5I2L A;  1WLZ A;  1NX3 A;  1G4Y R;  3CZ1 A;  1LVC D;  2F3Z A;  2O60 A;  3I5H B;  1U5I A;  2WCF A;  1SW8 A;  2DOQ A;  3I5H C;  4PHM A;  1K9K A;  3LK0 A;  1N2D A;  1A75 A;  2ERB A;  3R1P A;  1S5G Y;  1CMG A;  1PVA A;  1YRU B;  1OMR A;  1PRW A;  2WCK A;  1QJT A;  2L51 A;  3B86 A;  3D77 A;  3EK4 A;  2KYC A;  1QX5 B;  4PHK A;  5JJG A;  2KAV A;  4MN0 A;  5KTY A;  1IJ6 A;  2CTN A;  1CDN A;  1JFJ A;  3K1E A;  3NSO A;  1PSR A;  1CTR A;  2JT8 A;  1PK0 D;  3PM8 A;  4GBA A;  3GK4 X;  4N5X A;  1IGV A;  3BXK A;  2JT0 A;  1NIW A;  1QS7 A;  1KSO A;  1H4B A;  5EL2 A;  2BCB A;  2GV5 A;  1OZO A;  4WQ2 A;  3BUN B;  3BFA A;  3V2L A;  3JTD B;  1KFX L;  2OTG B;  1TCF A;  3JVT B;  4PDZ A;  2ZN8 A;  4XYN A;  1VRK A;  2I7A A;  1A2X A;  3TS5 B;  1QV0 A;  5I2Q A;  2OTG C;  3B6X A;  1BF5 A;  2M7N A;  3BFH A;  1OW4 A;  1K94 A;  2P6B B;  2KAX A;  3Q8I A;  3TS5 C;  3VRN A;  3KHE A;  4Q04 A;  2JRF A;  3RM1 A;  1X02 A;  1PUL A;  3KEV A;  1TNW A;  2G9B A;  3R72 A;  2KBI A;  3C1V A;  1IRJ A;  1MHO A;  1CFP A;  3OB2 B;  2LMV A;  1KK7 Z;  1S1E A;  3FIA A;  3CR4 X;  3IQQ A;  1CMF A;  2JUL A;  2QEB A;  2M1U A;  1YVH A;  2LLT A;  1KCY A;  4YGE B;  1NYA A;  3BUO B;  3D73 A;  2V53 A;  2KFH A;  1M31 A;  1FPW A;  2GGM A;  2L50 A;  3RZS A;  1GQM A;  2LVK A;  1OOJ A;  1LA0 A;  2NZ0 A;  2PQL A;  1R2U A;  1N65 A;  1LKJ A;  2JXL A;  5F6T A;  1FW4 A;  2K2A A;  4GUK A;  4JQ0 D;  4DS7 A;  2BE6 A;  3PN7 C;  1PSB A;  2LVI A;  1SR6 B;  2SCP A;  2PMY A;  3CTN A;  1BLQ A;  1KK7 Y;  2FCD A;  3D0Y B;  1B9A A;  4INX A;  1EG3 A;  3LK1 A;  1DF0 B;  1A4P A;  1SR6 C;  1D1O A;  1NX0 A;  1NX1 A;  3CWG A;  3OGN A;  3IF7 A;  3EKJ A;  2NCP A;  3LCP C;  1B8C A;  1SMG A;  1KQV A;  3FWB A;  2SAS A;  2ZNE A;  1OE9 B;  3BOW A;  1B8L A;  2JTT A;  4MSP A;  1FI6 A;  1DMO A;  2I94 A;  1UHH A;  1MR8 A;  3DY9 A;  1LA3 A;  3D0Y A;  3QRX A;  1XK4 C;  2E30 A;  3D75 A;  3S0F A;  4AQI A;  3UO9 A;  2HET A;  1J7R A;  3OP0 A;  2CT9 A;  2M49 B;  3F45 A;  1MXL C;  4F0Z B;  1RFJ A;  1S3P A;  4TNC A;  1Y0V H;  1AP4 A;  1AJ5 A;  3NSL A;  4PE1 A;  4C0K A;  5FI7 A;  3D10 A;  2LMU A;  1Y1U A;  1JSA A;  1XK4 A;  1QIW A;  3EK7 A;  2WCM A;  2BKH B;  1XFW O;  3SJS A;  2FJU B;  4PHJ A;  2ZRT A;  2WCH A;  1CFD A;  2LUX A;  5AAN A;  5ER4 X;  1NPQ A;  3I5G B;  2JC2 A;  3TZ1 A;  5FI6 A;  1QTX A;  3BFB A;  1RK9 A;  4CLN A;  1Y1A A;  5KSZ A;  2BE4 A;  4MRX A;  2EC6 C;  5DIC A;  3I5G C;  3VGO A;  1OOF A;  1BJF A;  1XFZ O;  2QPT A;  2LE9 B;  3D74 A;  3A8R A;  3CZT X;  2TN4 A;  4GGN A;  1SY9 A;  2K7O A;  3VRP A;  1TOP A;  4DUQ A;  3NXA A;  1EG4 A;  1EH2 A;  3CLN A;  2L98 A;  3SG6 A;  2WC5 A;  3KF9 A;  1EXR A;  1F4Q A;  1OOH A;  2OPO A;  1WRK A;  2LMT A;  1UHI A;  1KFU S;  1QXP A;  2L5X B;  3LLE A;  4GGF C;  3LL8 B;  5D3O A;  3A4U B;  1IIO A;  1SYM A;  1G33 A;  4OR9 B;  4XJK A;  2G2B A;  3SIB A;  2CCM A;  2WCJ A;  2WCE A;  2MJW B;  2JWW A;  1NSH A;  3DF0 A;  3WXA A;  3S0D A;  2AMI A;  2LLS A;  2GTE A;  2JPT A;  1BR4 B;  4GAO A;  1QLK A;  1NCZ A;  3VRO A;  1CFC A;  2MHH A;  1L2O B;  1WRL A;  4GGF A;  1KSM A;  1KWO C;  5HL1 A;  1FF1 A;  3FS7 A;  2KNE A;  1GGZ A;  1UUR A;  2BAP A;  1BOC A;  1L2O C;  1EL4 A;  2QEH A;  3GK1 A;  2B1U A;  4PAL A;  3UNW A;  2M29 A;  2AAO A;  3OX5 A;  5CSF A;  1NCX A;  4ICB A;  1J7P A;  1F4O A;  3OB1 B;  2K7D A;  4NDB A;  2PRU A;  3DZT A;  3M0W A;  2BCA A;  2L4I A;  3MSE B;  2LM5 A;  1W9Z A;  1YVL A;  2LP3 A;  1OQP A;  2BBM A;  2M7L A;  4JWQ A;  1HT9 A;  3DD4 A;  3QME A;  4HRH A;  1QIV A;  1MXE A;  1M46 A;  2L4H A;  2LCP A;  3O6B A;  3FE8 A;  2BNX A;  2CNP A;  5CSI A;  4F7F A;  1TUZ A;  2Q91 A;  5CSN A;  4U8D A;  2K60 A;  2PYQ A;  1CDL A;  4MEW A;  3JTD C;  3IVT A;  4YBH B;  1N0Y A;  3S0A A;  1AK8 A;  2KFG A;  3JVT C;  4CFR A;  2JOJ A;  1OOG A;  1XA5 A;  1KQM B;  3BYA A;  2KI4 B;  2KBM A;  1BMO A;  2Y4Q A;  4D1E A;  5JOL A;  1DJZ A;  2HQ8 A;  1KQM C;  5I2O A;  2H61 C;  2KI4 C;  1ZOT B;  2WCL A;  1XYD A;  1ODB A;  1L7Z A;  4DRW A;  2HPS A;  5TNC A;  1BG1 A;  1MF8 B;  1QLS A;  1LXF C;  1MWN A;  3ICB A;  5AXI A;  2LVJ A;  1NWD A;  1S6J A;  3OHM B;  2H61 A;  3PLF B;  2BCX A;  4M2O A;  2L2E A;  1M63 B;  2KYF A;  5GQQ C;  2Q4U A;  1FBV A;  2PAS A;  1K9P A;  2WCB A;  1GGW A;  1ZUZ A;  4PT1 A;  3CR2 A;  5AEQ A;  1B1G A;  2QEO A;  3SG4 A;  1WLM A;  4BY5 A;  2LAN A;  1QX2 A;  1PVB A;  3BUM B;  2KDH A;  3DXL A;  1DQE A;  1B7T Z;  3CYZ A;  4ETO A;  1BU3 A;  1QAS A;  2M8U A;  3CR5 X;  2I18 A;  2COL B;  4AQJ A;  2H8V A;  5DKN A;  1CLB A;  4UPG A;  2OS8 B;  4OV2 A;  2JTZ A;  4MVF A;  2ZND A;  1V1F A;  1DGV A;  1UP5 A;  4HRG A;  1KK8 B;  1Q80 A;  2F2P A;  4ZCV A;  5KU1 A;  2OS8 C;  1TWO A;  2QAC A;  4ORA B;  4E68 A;  4QJ5 B;  1H8B A;  1KK8 C;  1ORG A;  3PM2 A;  2M3W A;  2MAZ A;  3S0G A;  2Y5I A;  4OZD A;  1UWO A;  1TN4 A;  3S0B A;  3EVR A;  1Z4H A;  1DF0 A;  1BT6 A;  1K95 A;  1KFU L;  1XFV O;  4R1E A;  2JPO A;  2FOT A;  3EK8 A;  5FI2 A;  1B7T Y;  2CXJ A;  3NGV A;  2ZKM X;  3DVE A;  3NHI A;  5CSJ A;  1YUR A;  2K7B A;  5HYD A;  1NP8 A;  1ZAC A;  4MLW A;  1IQ3 A;  2ISD A;  1ALW A;  2VRG A;  1GM0 A;  1CDM A;  2Y1M A;  3FE9 A;  1W7J B;  5B8I B;  2LC5 A;  2P70 A;  1K2H A;  3PFV A;  4GFT A;  1Z2C B;  1F55 A;  1XO5 A;  2F2O A;  2M97 A;  5HKY A;  4L9M A;  1DGU A;  3ZNI A;  4M2Q A;  1YRT B;  1C3Z A;  3FWC A;  3K21 A;  4NDD A;  1QVI Z;  2K0J A;  3KPX A;  2KI6 D;  2JT3 A;  3PJI A;  4MZL A;  2BKI B;  2KLE A;  1BR1 B;  1RWY A;  2MLE C;  1XFX O;  2K61 A;  4FQT A;  4HRE E;  4OKH A;  1YUS A;  3TDI A;  1J7Q A;  4MZJ A;  2KGB C;  2F33 A;  1LS8 A;  5AFP A;  4ZCU A;  1YUU A;  1AHR A;  5DKR A;  4CPV A;  1G8I A;  3IQO A;  1QAT A;  1RTP 1;  3DVK A;  3WNX B;  1F71 A;  1SL7 A;  2MLF C;  4P5O E;  3R1V A;  1DJH A;  1IKU A;  1YR5 A;  2GGZ A;  1QVI Y;  3SG3 A;  2JQ6 A;  3TDU A;  1SL9 A;  3SS4 A;  1XVJ A;  3HCM A;  1JWD A;  1SCM B;  2MA2 A;  2WC8 A;  1FI5 A;  2HQW A;  2PAL A;  4PE7 A;  2BL0 B;  4PE4 A;  3O4Y A;  5CPV A;  4YGB B;  1AJ4 A;  4KYN A;  1B4C A;  3GK2 A;  1K9U A;  3ZWH A;  4NDC A;  2KLD A;  2BL0 C;  1M39 A;  4WRI A;  2O5G A;  2Y1N A;  1AUI B;  1V1G A;  2JU0 A;  3EG5 B;  4YGD B;  3EKH A;  1YUT A;  3VRR A;  1A75 B;  2FCE A;  5I94 A;  2LV7 A;  4OCI A;  1C3Y A;  3EVV A;  2M9G A;  3CZ0 A;  2L2C A;  1TUJ A;  1XFU O;  1C7V A;  1WRZ A;  2LLU A;  5G08 A;  4DIR A;  3BJH A;  5FYX A;  3HX4 A;  4I5L B;  2E6W A;  3SG5 A;  1XFY O;  2KGR A;  1JUO A;  4JPZ B;  3DYE A;  1K90 D;  3PAL A;  3NSK A;  4YI8 A;  1TCO B;  3EVU A;  1CDP A;  3B7A A;  1ZFS A;  1QWV A;  1M45 A;  3H4S E;  4PCW A;  1CLM A;  1NCY A;  3N7H A;  4YGC B;  3VRQ A;  1DT7 B;  1DJX A;  3NHT A;  5J3X A;  1J55 A;  4USL A;  4A4C A;  2P71 A;  2MRD A;  1CFF A;  2JNF A;  2ZRS A;  2JXC A;  1K8U A;  1S36 A;  1YX7 A;  3O4X A;  1SNL A;  4ORC B;  1JF2 A;  2FJY A;  3SG2 A;  3I5I B;  1DVI A;  1TIZ A;  2LHI A;  3AKA A;  5BPJ A;  1IJ5 A;  2KSP A;  3CDN A;  4P2Y B;  4YI9 A;  3I5I C;  1C07 A;  2KAY A;  1TRF A;  5HKZ A;  2JNX A;  4N1G A;  1OOI X;  3L4L A;  4YRU A;  1F54 A;  1PAL A;  3CAB A;  4MBE A;  1TTX A;  1QV1 A;  3O78 A;  1JF0 A;  3D76 A;  1ALV A;  1UHJ A;  5PAL A;  4CID A;  1RJV A;  1IH0 A;  2LVV A;  1WDC B;  2A4J A;  2EGD A;  2IS9 A;  2F3Y A;  1CB1 A;  2L5Y A;  2EHB A;  2ZFD A;  1E8A A;  3O2P A;  4IL1 A;  2WND A;  1WDC C;  1JBA A;  1SRA A;  2CBL A;  1CKK A;  3WHT B;  1R6P A;  1DEK A;  4C0J A;  1JC2 A;  1REC A;  3AAK A;  1IQ5 A;  4JKT A;  1DTL A;  1WY9 A;  2AUC A;  2HF5 A;  4PE0 A;  4QJ4 B;  3BQ3 A;  2BEC A;  1OSA A;  4JD9 A;  1S6C A;  1S26 D;  1GJY A;  1ZMZ A;  1AVS A;  5D7F A;  3R1O A;  4WQ3 A;  1KFX S;  2BBN A;  4OVN F;  4PHN A;  2R2I A;  1YTZ C;  2QEV A;  2NLN A;  3PN7 B;  1B8R A;  4I5J A;  1YX8 A;  3BOW B;  2M1K B;  1IWQ A;  2H2K A;  1W7I B;  1XFR A;  2JZI A;  4MZK A;  3SS3 A;  3VB1 A;  1SKT A;  2KPH A;  4AOM A;  1J1E A;  5IBW A;  2LNK A;  4QJ3 B;  1IG5 A;  1DJG A;  1SK6 D;  1UHN A;  1K96 A;  3OBV A;  3GOF A;  3SG7 A;  3OX6 A;  1P28 A;  3DVJ A;  4FTG A;  5HKW A;  3CS1 A;  3I5F B;  3BUW B;  1NUB A;  2KFF A;  1EJ3 A;  1NX2 A;  4C0L A;  3NSI A;  2KHN A;  1TNQ A;  3I5F C;  1DJW A;  4DCK A;  3FE6 A;  3S0E A;  4N1F A;  2QDI A;  1DJY A;  2KOT A;  1SPY A;  1OMD A;  4NQG A;  3PAT A;  1F70 A; 
#chains in the Genus database with same CATH homology
 1SBJ A;  3TUY B;  4CFQ A;  1TNX A;  2LP2 A;  3AKB A;  2MBX A;  1JFK A;  1OZS A;  2K8M B;  1B47 A;  3TUY C;  1UUS A;  1J1D A;  2K7C A;  4A4B A;  2LAP A;  2F8P A;  3TDZ A;  5ER5 A;  1C7W A;  1SL8 A;  1A03 A;  1F8H A;  2L0P A;  2EC6 B;  4YGA A;  1HQV A;  4MRY A;  1UHK A;  5HLV A;  4HSZ A;  1QX7 A;  4FQO A;  1Y6W A;  2KQ6 A;  1S6I A;  4XJK B;  2KQY A;  5HLO A;  2M0R A;  4GPL B;  2LUC A;  3DF0 B;  3RLZ A;  1OMV A;  3DVM A;  3WHU B;  2K2F A;  2ZN9 A;  1K93 D;  1CNP A;  3CGA A;  4GNK B;  2I2R E;  1CM4 A;  1TNP A;  1S5G Z;  1SCM C;  3SIA A;  4BY4 A;  1LIN A;  2KI6 C;  2RGI A;  2NXQ A;  1MUX A;  1U5I B;  5DKQ A;  5AER A;  3AAJ A;  2NCO A;  1MQ1 A;  3KO0 A;  1RRO A;  2D8N A;  3BUX B;  2PSR A;  5I8N A;  2PVB A;  2LHL A;  4I5K A;  1CLL A;  5D69 A;  1A29 A;  1CM1 A;  4I5N B;  1DJI A;  3E3R A;  4ORB B;  5K89 A;  1BOD A;  1J7O A;  1KWO B;  2WOR A;  4M2P A;  1SCV A;  1Y1X A;  3PSR A;  2WOS A;  5I2L A;  1WLZ A;  1NX3 A;  1G4Y R;  3I5H B;  1LVC D;  2F3Z A;  2O60 A;  1U5I A;  2WCF A;  1SW8 A;  2DOQ A;  3I5H C;  4PHM A;  1K9K A;  3LK0 A;  1N2D A;  1A75 A;  1CMG A;  1S5G Y;  1PVA A;  1YRU B;  1OMR A;  1PRW A;  3EK4 A;  1QJT A;  2L51 A;  4PHK A;  5KTY A;  5JJG A;  2KYC A;  1QX5 B;  1CDN A;  2KAV A;  4MN0 A;  1IJ6 A;  2CTN A;  1JFJ A;  3NSO A;  1PSR A;  1CTR A;  2JT8 A;  1PK0 D;  3PM8 A;  4GBA A;  3GK4 X;  4N5X A;  1IGV A;  3BXK A;  2JT0 A;  1NIW A;  1QS7 A;  1KSO A;  1H4B A;  2BCB A;  2GV5 A;  1OZO A;  4WQ2 A;  3BUN B;  3JTD B;  1KFX L;  2OTG B;  1TCF A;  3JVT B;  4PDZ A;  2ZN8 A;  4XYN A;  1VRK A;  2I7A A;  1A2X A;  3TS5 B;  1QV0 A;  5I2Q A;  2OTG C;  1BF5 A;  2M7N A;  2P6B B;  1K94 A;  2KAX A;  3TS5 C;  3VRN A;  3KHE A;  4Q04 A;  2JRF A;  3RM1 A;  1X02 A;  1PUL A;  3KEV A;  1TNW A;  2G9B A;  2KBI A;  3C1V A;  1IRJ A;  1MHO A;  1CFP A;  3OB2 B;  2LMV A;  1KK7 Z;  1S1E A;  3FIA A;  3CR4 X;  3IQQ A;  1CMF A;  2JUL A;  2M1U A;  1YVH A;  2LLT A;  1KCY A;  4YGE B;  1NYA A;  3BUO B;  2V53 A;  2KFH A;  1M31 A;  1FPW A;  2GGM A;  2L50 A;  1GQM A;  2LVK A;  1OOJ A;  1LA0 A;  2NZ0 A;  1R2U A;  1N65 A;  1LKJ A;  2JXL A;  5F6T A;  1FW4 A;  2K2A A;  4GUK A;  4JQ0 D;  4DS7 A;  2BE6 A;  3PN7 C;  1PSB A;  2LVI A;  1SR6 B;  2SCP A;  2PMY A;  3CTN A;  1BLQ A;  1KK7 Y;  2FCD A;  3D0Y B;  1B9A A;  1EG3 A;  3LK1 A;  1DF0 B;  1A4P A;  1SR6 C;  1D1O A;  1NX0 A;  1NX1 A;  3CWG A;  3IF7 A;  3EKJ A;  2NCP A;  3LCP C;  1B8C A;  1SMG A;  1KQV A;  3FWB A;  2SAS A;  2ZNE A;  1OE9 B;  3BOW A;  1B8L A;  2JTT A;  4MSP A;  1FI6 A;  1DMO A;  2I94 A;  1UHH A;  1MR8 A;  3QRX A;  1LA3 A;  3D0Y A;  1XK4 C;  2E30 A;  4AQI A;  2HET A;  1J7R A;  3OP0 A;  2CT9 A;  2M49 B;  3F45 A;  1MXL C;  4F0Z B;  1RFJ A;  1S3P A;  4TNC A;  1Y0V H;  1AP4 A;  1AJ5 A;  3NSL A;  4PE1 A;  4C0K A;  3D10 A;  2LMU A;  1Y1U A;  1JSA A;  1XK4 A;  1QIW A;  3EK7 A;  2BKH B;  1XFW O;  3SJS A;  2FJU B;  4PHJ A;  2ZRT A;  5AAN A;  1CFD A;  2LUX A;  5ER4 X;  1NPQ A;  3I5G B;  2JC2 A;  3TZ1 A;  1QTX A;  1RK9 A;  4CLN A;  1Y1A A;  5KSZ A;  2BE4 A;  4MRX A;  2EC6 C;  3I5G C;  3VGO A;  1BJF A;  1XFZ O;  2QPT A;  2LE9 B;  3A8R A;  3CZT X;  2TN4 A;  4GGN A;  1SY9 A;  2K7O A;  3VRP A;  1TOP A;  4DUQ A;  3NXA A;  1EG4 A;  1EH2 A;  3CLN A;  2L98 A;  3SG6 A;  3KF9 A;  1EXR A;  1F4Q A;  2OPO A;  1WRK A;  2LMT A;  1UHI A;  1KFU S;  1QXP A;  2L5X B;  3LLE A;  4GGF C;  3LL8 B;  3A4U B;  1SYM A;  1G33 A;  4OR9 B;  4XJK A;  2G2B A;  3SIB A;  2CCM A;  2WCE A;  2MJW B;  2JWW A;  1NSH A;  3DF0 A;  3WXA A;  2AMI A;  2LLS A;  4GAO A;  2JPT A;  1BR4 B;  1QLK A;  1NCZ A;  3VRO A;  1CFC A;  2MHH A;  1L2O B;  1WRL A;  4GGF A;  1KSM A;  1KWO C;  1FF1 A;  3FS7 A;  2KNE A;  1GGZ A;  1UUR A;  1BOC A;  1L2O C;  1EL4 A;  3GK1 A;  4PAL A;  2B1U A;  2M29 A;  2AAO A;  3OX5 A;  5CSF A;  1NCX A;  4ICB A;  1J7P A;  1F4O A;  3OB1 B;  2K7D A;  4NDB A;  2PRU A;  3M0W A;  2BCA A;  2L4I A;  3MSE B;  2LM5 A;  1YVL A;  2LP3 A;  1OQP A;  2BBM A;  2M7L A;  4JWQ A;  1HT9 A;  3DD4 A;  4HRH A;  1QIV A;  1MXE A;  1M46 A;  2L4H A;  2LCP A;  3O6B A;  2CNP A;  5CSI A;  2Q91 A;  5CSN A;  4U8D A;  1CDL A;  4MEW A;  3JTD C;  4YBH B;  1N0Y A;  1AK8 A;  2KFG A;  3JVT C;  4CFR A;  2JOJ A;  1XA5 A;  1KQM B;  3BYA A;  2KI4 B;  2KBM A;  1BMO A;  2Y4Q A;  4D1E A;  5JOL A;  1DJZ A;  2HQ8 A;  1KQM C;  5I2O A;  2H61 C;  2KI4 C;  1ZOT B;  1XYD A;  1ODB A;  1L7Z A;  4DRW A;  2HPS A;  5TNC A;  1BG1 A;  1MF8 B;  1QLS A;  1LXF C;  1MWN A;  3ICB A;  5AXI A;  2LVJ A;  1NWD A;  1S6J A;  3OHM B;  2H61 A;  3PLF B;  2BCX A;  4M2O A;  2L2E A;  1M63 B;  2KYF A;  5GQQ C;  2Q4U A;  1FBV A;  2PAS A;  1K9P A;  2WCB A;  1GGW A;  1ZUZ A;  5AEQ A;  3CR2 A;  1B1G A;  3SG4 A;  1WLM A;  4BY5 A;  2LAN A;  1QX2 A;  1PVB A;  3BUM B;  2KDH A;  1B7T Z;  4ETO A;  1BU3 A;  1QAS A;  2M8U A;  3CR5 X;  2I18 A;  2COL B;  4AQJ A;  5DKN A;  1CLB A;  4UPG A;  2OS8 B;  4OV2 A;  2JTZ A;  4MVF A;  2ZND A;  1DGV A;  1UP5 A;  1V1F A;  4HRG A;  1KK8 B;  1Q80 A;  2F2P A;  4ZCV A;  5KU1 A;  2OS8 C;  2QAC A;  4ORA B;  4E68 A;  4QJ5 B;  1H8B A;  1KK8 C;  2M3W A;  2MAZ A;  2Y5I A;  1UWO A;  1TN4 A;  3EVR A;  1DF0 A;  1BT6 A;  1K95 A;  1KFU L;  1XFV O;  4R1E A;  3EK8 A;  2FOT A;  1B7T Y;  2CXJ A;  2ZKM X;  3DVE A;  5CSJ A;  1YUR A;  2K7B A;  5HYD A;  1NP8 A;  1ZAC A;  4MLW A;  1IQ3 A;  2ISD A;  1ALW A;  2VRG A;  1CDM A;  2Y1M A;  5B8I B;  1W7J B;  2LC5 A;  1K2H A;  3PFV A;  4GFT A;  1F55 A;  1XO5 A;  2F2O A;  2M97 A;  5HKY A;  4L9M A;  1DGU A;  3ZNI A;  4M2Q A;  1YRT B;  3FWC A;  3K21 A;  4NDD A;  1QVI Z;  2K0J A;  3KPX A;  2KI6 D;  2JT3 A;  4MZL A;  2BKI B;  1BR1 B;  1RWY A;  2MLE C;  1XFX O;  2K61 A;  4HRE E;  4OKH A;  1J7Q A;  1YUS A;  3TDI A;  1FI5 A;  4MZJ A;  2KGB C;  2F33 A;  5AFP A;  4ZCU A;  1YUU A;  1AHR A;  5DKR A;  4CPV A;  1G8I A;  3IQO A;  1QAT A;  1RTP 1;  3DVK A;  3WNX B;  1F71 A;  1SL7 A;  2MLF C;  4P5O E;  1DJH A;  1IKU A;  1YR5 A;  2GGZ A;  1QVI Y;  3SG3 A;  2JQ6 A;  3TDU A;  1SL9 A;  1XVJ A;  3HCM A;  1JWD A;  1SCM B;  2MA2 A;  2WC8 A;  2HQW A;  2PAL A;  4PE7 A;  2BL0 B;  4PE4 A;  3O4Y A;  5CPV A;  4YGB B;  1AJ4 A;  1B4C A;  3GK2 A;  1K9U A;  3ZWH A;  4NDC A;  2BL0 C;  1M39 A;  4WRI A;  2O5G A;  2Y1N A;  1AUI B;  1V1G A;  2JU0 A;  4YGD B;  3EKH A;  1YUT A;  3VRR A;  1A75 B;  2FCE A;  2LV7 A;  4OCI A;  3EVV A;  2M9G A;  1XFU O;  1C7V A;  1WRZ A;  2LLU A;  5G08 A;  4DIR A;  5FYX A;  3HX4 A;  4I5L B;  2E6W A;  3SG5 A;  1XFY O;  2KGR A;  1JUO A;  4JPZ B;  1K90 D;  3PAL A;  3NSK A;  4YI8 A;  1TCO B;  3EVU A;  1CDP A;  1ZFS A;  1M45 A;  3H4S E;  4PCW A;  1CLM A;  1NCY A;  4YGC B;  3VRQ A;  1DT7 B;  1DJX A;  5J3X A;  1J55 A;  4USL A;  4A4C A;  2MRD A;  1CFF A;  2JNF A;  2ZRS A;  2JXC A;  1K8U A;  1S36 A;  1YX7 A;  1SNL A;  4ORC B;  1JF2 A;  3SG2 A;  3I5I B;  1DVI A;  1TIZ A;  2LHI A;  3AKA A;  5BPJ A;  1IJ5 A;  2KSP A;  4YI9 A;  4P2Y B;  1C07 A;  3I5I C;  2KAY A;  1TRF A;  5HKZ A;  2JNX A;  4N1G A;  4YRU A;  1F54 A;  1PAL A;  4MBE A;  1TTX A;  1QV1 A;  3O78 A;  1JF0 A;  1ALV A;  1UHJ A;  5PAL A;  4CID A;  1RJV A;  1IH0 A;  2LVV A;  2A4J A;  1WDC B;  2EGD A;  2IS9 A;  2F3Y A;  1CB1 A;  2EHB A;  2ZFD A;  1E8A A;  3O2P A;  4IL1 A;  2WND A;  1WDC C;  1JBA A;  1SRA A;  2CBL A;  1CKK A;  3WHT B;  1R6P A;  4C0J A;  1JC2 A;  1REC A;  3AAK A;  1IQ5 A;  1DTL A;  1WY9 A;  2AUC A;  2HF5 A;  4PE0 A;  4QJ4 B;  3BQ3 A;  2BEC A;  1OSA A;  1S6C A;  1S26 D;  1GJY A;  1ZMZ A;  1AVS A;  5D7F A;  4WQ3 A;  1KFX S;  2BBN A;  4OVN F;  4PHN A;  2R2I A;  1YTZ C;  2NLN A;  3PN7 B;  1B8R A;  4I5J A;  1YX8 A;  3BOW B;  2M1K B;  1IWQ A;  2H2K A;  1W7I B;  2JZI A;  4MZK A;  1SKT A;  4AOM A;  1J1E A;  5IBW A;  2LNK A;  4QJ3 B;  1IG5 A;  1DJG A;  1SK6 D;  1UHN A;  1K96 A;  3GOF A;  3SG7 A;  3OX6 A;  3DVJ A;  4FTG A;  5HKW A;  3CS1 A;  3I5F B;  3BUW B;  1NUB A;  2KFF A;  1EJ3 A;  1NX2 A;  4C0L A;  3NSI A;  2KHN A;  1TNQ A;  3I5F C;  1DJW A;  4DCK A;  4N1F A;  4NQG A;  1DJY A;  2KOT A;  1SPY A;  1OMD A;  3PAT A;  1F70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...