3CZ1A

Dimeric crystal structure of a pheromone binding protein from apis mellifera in complex with the n-butyl benzene sulfonamide at ph 7.0
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 35
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cz1A00
3FE8A 3R1PA 3S0DA 3QMEA 3S0BA 1XFRA 3BFHA 4INXA 2GTEA 2QEBA 2QDIA 1OW4A 3FE6A 3B6XA 2WCMA 5DICA 3R1OA 3K1EA 3L47A 2WC5A 2WC6A 3D76A 3DXLA 3S0EA 3BFAA 3D78A 3CABA 3S0GA 3CYZA 1TWOA 3N7HA 3R72A 5EL2A 1C3ZA 4OZDA 2WCHA 2FJYA 3B88A 3D77A 2ERBA 3CZ1A 3D75A 1C3YA 2P71A 3Q8IA 1LS8A 3S0AA 3R1VA 3D73A 2PQLA 3NHIA 1DQEA 1P28A 3NGVA 3DZTA 4INWA 2WCKA 2WCLA 3DYEA 2L2CA 2P70A 3S0FA 1OOGA 2QEVA 4PT1A 3V2LA 3DY9A 2QEOA 3B7AA 1QWVA 1TUJA 1OOIX 2H8VA 3L4AA 3CZ0A 3VB1A 2QEHA 3RZSA 3D74A 3BFBA 4JD9A 2JPOA 3BJHA 3PJIA 2WCJA 3B87A 4F7FA 1OOHA 4FQTA 3CDNA 1OOFA 3OGNA 3FE9A 1T14A 3B86A 3NHTA 3L4LA 1GM0A 3CZ2A 1ORGA 2KPHA
chains in the Genus database with same CATH superfamily
1N65A 1EL4A 2M8UA 1B1GA 1Y6WA 1A75A 1RTP1 1S6CA 1H4BA 1DJXA 1K96A 3BFHA 2NZ0A 4MZJA 4DIRA 1C07A 1EH2A 2NLNA 1WRKA 2GTEA 3A8RA 1VRKA 4YI8A 3EVUA 2PMYA 3KF9A 3PM8A 1S36A 3B6XA 1AVSA 1K93D 3MSEB 1KSMA 1PVBA 1YRTB 5DICA 4A4BA 1G4YR 1X02A 1ZMZA 2LMTA 3BUMB 5D3OA 5HL1A 2HPSA 3SG2A 2BNXA 1S3PA 3EK7A 3K1EA 1G8IA 5J3XA 1QJTA 3BUOB 4ORAB 4UPGA 1SY9A 2BE6A 5I2QA 2AAOA 2I7AA 2EHBA 4GGNA 3D76A 4YGDB 1DEKA 2OTGB 3BFAA 3I5GB 4BY4A 1CDMA 1KK8C 1N0YA 1KFUL 4N1GA 2LLSA 3JTDB 3TZ1A 2IS9A 2GGZA 2KFFA 4JWQA 3LCPC 3N7HA 1Z4HA 5EL2A 1C3ZA 1DF0B 2I2RE 4PALA 3PFVA 4HRHA 2Y1NA 1D1OA 4D1EA 3B88A 3EG5B 1MXLC 1DJGA 2ERBA 3FWBA 3D75A 1JFKA 1OZOA 3I5IC 3RM1A 2P71A 3D10A 2KNEA 2Y5IA 3BUWB 2BL0C 1SRAA 2AMIA 3S0AA 1A2XA 1BMOA 1DTLA 1DVIA 1Y0VH 2JTZA 5IBWA 1IKUA 4PE4A 1K9PA 2L2EA 1ALWA 1J55A 3VRRA 2ZRSA 2MLFC 2VRGA 2K2AA 3SG4A 3DZTA 1PK0D 3SG5A 4WQ3A 1SYMA 1MXEA 3DYEA 3BXKA 3NSOA 1XVJA 1BJFA 1B47A 3K21A 2KI6D 2LANA 1PULA 2BCAA 2TN4A 1XK4A 3B7AA 1QWVA 1JUOA 2LLTA 4MRYA 1OQPA 1TCOB 4ORBB 2ZN8A 3PN7C 1RJVA 1CLLA 2D8NA 2LVJA 1CMGA 1KWOB 2JRFA 4KYNA 4JD9A 3BFBA 4NDCA 2LMUA 4GNKB 1QX2A 4Q04A 2JPOA 2K8MB 4ETOA 3BJHA 2BE4A 4JPZB 4YI9A 2F2OA 2KHNA 1BOCA 2JT8A 2WCJA 5I94A 5KU1A 1LINA 1NCXA 3B87A 3LK1A 5FI7A 2F3YA 2KSPA 5AEQA 4I5KA 1DGVA 3CGAA 2ZN9A 4FQTA 2JOJA 1SW8A 2K0JA 3PM2A 4C0JA 1KK7Z 1M31A 4I5NB 4YBHB 4P2YB 1QVIZ 4P5OE 1EG4A 2KGRA 1DJWA 1S26D 3PSRA 4MN0A 4PCWA 1NX0A 1LVCD 5CPVA 1FPWA 3FE9A 2A4JA 4F0ZB 1J7QA 3LK0A 2LP3A 2GV5A 3CZ2A 3KPXA 2F33A 2WCBA 1UURA 1PRWA 1JWDA 2MRDA 1ORGA 3TDZA 2JPTA 1ZFSA 3GK1A 1S1EA 3BUXB 3R1PA 3QMEA 1AK8A 3OP0A 4OKHA 1C7WA 5D7FA 4XJKA 1E8AA 3D0YA 2LP2A 1TRFA 2JNFA 2KI6C 2MBXA 1XFWO 3FE6A 1SMGA 1H8BA 1W9ZA 1MHOA 1Y1AA 4CPVA 2KLDA 4PDZA 1QV0A 1SR6C 1QASA 1YUTA 2LHIA 3PLFB 3R1OA 3AAKA 3BOWB 2QPTA 2LNKA 1RK9A 4OV2A 1CB1A 2WC5A 3VRNA 4MEWA 4ZCUA 3D78A 4OR9B 4TNCA 4OVNF 1UHJA 1YURA 1A29A 2Y4QA 4FQOA 3TDUA 4E68A 3CLNA 3EK4A 3TS5B 1TUZA 2M3WA 1S6IA 4JKTA 3KO0A 4GFTA 2WORA 1PALA 4IL1A 1FBVA 4NQGA 2WCHA 4OZDA 1QX5B 3EKHA 1IG5A 2KFHA 3F45A 3D77A 5ER5A 5CSFA 5I2LA 2NXQA 1NCZA 3LL8B 1C3YA 1CM1A 2ZFDA 2K7CA 2JQ6A 5AERA 1CNPA 2KI4B 3R1VA 5G08A 4DUQA 3I5GC 1B7TZ 2KBIA 2B1UA 2E30A 4MSPA 5TNCA 1BT6A 1QS7A 1YX8A 2H2KA 1K9UA 2ZNDA 1HQVA 1QATA 2OS8B 3H4SE 3JTDC 5FI6A 1JF0A 1CTRA 2KOTA 2K7OA 2KLEA 2MHHA 3AKAA 3NGVA 3SG7A 1KQMB 1SL7A 2H61C 1MF8B 1PVAA 3DF0B 3I5HB 1MUXA 3SG6A 2L2CA 1J7OA 1FF1A 1K2HA 4N1FA 2HQWA 1YUSA 2P70A 2LCPA 3HX4A 1V1FA 1NX1A 1OOGA 3CTNA 4HSZA 3AAJA 1RFJA 2QEOA 5HLOA 2LM5A 1S5GY 1AUIB 2V53A 1XFUO 4YRUA 2BKHB 2P6BB 1OOIX 2Y1MA 4GAOA 2ZRTA 2E6WA 4A4CA 3L4AA 2LUXA 1J1DA 1XFXO 2HQ8A 2M1UA 2QEHA 5AXIA 1DMOA 2LV7A 4PE7A 2CXJA 3EVVA 4WRIA 3EK8A 4GGFC 1DJIA 1CLBA 2L50A 2M0RA 4MRXA 2KQYA 1LKJA 4YGBB 1L2OB 2K2FA 1IGVA 4ICBA 1JBAA 5AANA 2I18A 2KBMA 3DVEA 4DS7A 5PALA 2MJWB 1DELA 4AQJA 1QX7A 4F7FA 1MQ1A 2BBNA 4PHJA 2LMVA 2JZIA 2COLB 4GUKA 1CFDA 1TOPA 3A4UB 2BCBA 2YGUA 3M0WA 1SL9A 1WDCB 3NSKA 1KWOC 3CDNA 5B8IB 2OPOA 4R1EA 2O60A 1JSAA 2I94A 1ZACA 4C0LA 1CMFA 1KFXS 5F6TA 1XFZO 4PHKA 1HT9A 1SL8A 1UP5A 1U5IB 2KAYA 2M97A 4MVFA 1GM0A 1MWNA 3FWCA 4XYNA 5FI2A 1QV1A 3OX6A 1GJYA 1J7RA 2KAVA 3DVKA 3EKJA 3EVRA 4QJ3B 3AKBA 3ZNIA 1EXRA 3FE8A 3I5FB 4N5XA 5I2OA 1ZOTB 3JVTB 5HYDA 4QJ4B 1B8CA 2NCOA 4INXA 3SIAA 2KFGA 2KAXA 2QEBA 2JT0A 1K95A 1OW4A 2MLEC 2EC6B 2QDIA 3PALA 1XFVO 2KYCA 1A03A 1N2DA 4WQ2A 4I5JA 4PE0A 1FI5A 1SCMB 4CFRA 1DF0A 2H61A 4MLWA 1FW4A 1K90D 2BCXA 1ALVA 3CZTX 4MBEA 3ZWHA 3O4XA 4M2QA 3TUYB 1SPYA 1TNQA 2Q91A 5BPJA 1A75B 4NDBA 4OCIA 1NX2A 2WOSA 4M2OA 5DKNA 1K9KA 2LC5A 1JF2A 1BU3A 1CDPA 1CFCA 1OMDA 2GGMA 3CABA 2WNDA 1NIWA 3FS7A 3HCMA 1XYDA 1XA5A 1BODA 1UWOA 4FTGA 4GGFA 1TWOA 2JT3A 4ORCB 1MR8A 1RECA 3WHUB 1TCFA 2L5YA 4QJ5B 1OOJA 3KEVA 1M39A 4NDDA 1F4QA 1QTXA 1M63B 2FJYA 4PHNA 2BBMA 4HRGA 4MZKA 5CSNA 3LLEA 1NX3A 2KGBC 5CSJA 4M2PA 1EG3A 3GK2A 2L98A 3SIBA 1QIVA 1R6PA 2M9GA 5HKWA 1OE9B 2O5GA 3D73A 2CNPA 3VROA 2BAPA 1NPQA 2FJUB 2SCPA 3NXAA 3QRXA 5D69A 2JXLA 2PASA 3NHIA 1DQEA 1P28A 1LA3A 2K61A 3TS5C 4DCKA 1YVLA 3CR2A 1DC1A 4INWA 3BYAA 1XFYO 2WCFA 1J7PA 4MZLA 1M45A 2K7DA 3SJSA 3OB2B 3S0FA 2LVVA 3KHEA 3FIAA 2JULA 2M1KB 2QEVA 2RGIA 4PT1A 1C7VA 1Q80A 2L4HA 2KI4C 2JU0A 1S6JA 3PATA 1CKKA 5HKZA 1NSHA 4AQIA 1F54A 1QLKA 3CS1A 3UNWA 4GPLB 3CWGA 3VB1A 2K7BA 3RZSA 1K8UA 4JQ0D 1TN4A 1KQMC 5I8NA 1LXFC 2DOQA 2OTGC 3OX5A 2M29A 3I5HC 1Y1UA 4CLNA 1F70A 2WC8A 2K60A 1SR6B 3NSIA 2NCPA 2LLUA 5FYXA 1DJYA 2G9BA 1YVHA 3VRQA 2ZNEA 1OOHA 1IIOA 2EGDA 1V1GA 2MA2A 1J1EA 1R2UA 4YGCB 2L0PA 1BR4B 1OOFA 2QACA 4USLA 2LVIA 4YGEB 1YX7A 2CT9A 2LAPA 1NP8A 3IQQA 3OGNA 3VRPA 1L2OC 1OMRA 1SSEB 1T14A 1B8LA 5KSZA 4PHMA 1SCVA 1AJ4A 3L4LA 4ZCVA 1UHIA 3IF7A 2PYQA 1IQ5A 3GK4X 1F71A 2MAZA 1KCYA 4YGAA 1NYAA 1BR1B 1QLSA 3BOWA 3C1VA 4CFQA 3S0DA 3S0BA 1WDCC 5AFPA 2JTTA 2JWWA 4CIDA 1XFRA 1BG1A 1CDNA 1TNWA 1KFXL 1B8RA 2F3ZA 1W7JB 1YR5A 1F8HA 3WXAA 1RWYA 2R2IA 3DVMA 2G2BA 1WY9A 1KK8B 1YUUA 2AUCA 1FI6A 2JXCA 1B9AA 1UUSA 2FCDA 3SG3A 1GGZA 3E3RA 5K89A 1GGWA 3VGOA 1KFUS 5HKYA 2WCMA 2CTNA 3SS3A 1S5GZ 3CR4X 2PVBA 3I5FC 2M49B 3L47A 3JVTC 2M7LA 1IRJA 3I5IB 1TIZA 2LHLA 3IQOA 4I5LB 1JC2A 2WC6A 2BL0B 3DXLA 2LUCA 4XJKB 3S0EA 3RLZA 3D0YB 1IJ6A 1KK7Y 2L51A 3WNXB 3O4YA 1YRUB 2EC6C 1QVIY 3S0GA 1DJZA 1M46A 1WLZA 3CYZA 1IQ3A 1SCMC 1SBJA 4AOMA 3OB1B 3R72A 5DKRA 1G33A 3DF0A 1AJ5A 4DRWA 1CDLA 1WRLA 4L9MA 1DJHA 1KQVA 3SS5A 3WHTB 2CBLA 1F55A 3TUYC 1Y1XA 1AP4A 2KQ6A 3CZ1A 3GOFA 2LE9B 5HLVA 5CSIA 1DGUA 2FOTA 5JOLA 3O6BA 3Q8IA 5KTYA 2JC2A 1LS8A 2L5XB 1NCYA 3DD4A 2HETA 1SK6D 3PN7B 1JFJA 1RROA 2PQLA 1PSBA 5JJGA 1F4OA 2FCEA 2BECA 1K94A 2WCKA 1LA0A 1ODBA 2WCLA 2M7NA 2ISDA 1UHHA 4C0KA 1TTXA 3SS4A 4BY5A 2WCEA 1CLMA 1CFFA 1KSOA 3V2LA 3IVTA 3BUNB 3DY9A 1XO5A 2PALA 2ZKMX 1SNLA 3DVJA 2PRUA 3O2PA 2BKIB 3OHMB 1TUJA 5ER4X 1BF5A 1TNXA 2KDHA 1NWDA 2H8VA 2PSRA 3CZ0A 1OSAA 1IWQA 3O78A 1W7IB 3D74A 1QXPA 3BQ3A 1IH0A 2KYFA 1U5IA 2F8PA 1IJ5A 4HREE 3PJIA 1L7ZA 1AHRA 2SASA 3ICBA 3NSLA 1BLQA 5GQQC 1ZUZA 3TDIA 1EJ3A 4IJ7A 2F2PA 2JNXA 5DKQA 3OBVA 1GQMA 2Q4UA 1SKTA 1UHNA 1OMVA 1A4PA 1OZSA 2HF5A 4PE1A 1CFPA 1QIWA 1Z2CB 1B7TY 1YTZC 2L4IA 3UO9A 1CM4A 1UHKA 1WRZA 4GBAA 4U8DA 1DT7B 3B86A 1B4CA 2OS8C 3NHTA 1TNPA 1WLMA 2CCMA 1PSRA 2LVKA 1NUBA 3CR5X 2KPHA 1XK4C
chains in the Genus database with same CATH topology
3FE8A 3R1PA 3S0DA 3QMEA 3S0BA 1XFRA 3BFHA 4INXA 2GTEA 2QEBA 2QDIA 1OW4A 3FE6A 3B6XA 2WCMA 5DICA 3R1OA 3K1EA 3L47A 2WC5A 2WC6A 3D76A 3DXLA 3S0EA 3BFAA 3D78A 3CABA 3S0GA 3CYZA 1TWOA 3N7HA 3R72A 5EL2A 1C3ZA 4OZDA 2WCHA 2FJYA 3B88A 3D77A 2ERBA 3CZ1A 3D75A 1C3YA 2P71A 3Q8IA 1LS8A 3S0AA 3R1VA 3D73A 2PQLA 3NHIA 1DQEA 1P28A 3NGVA 3DZTA 4INWA 2WCKA 2WCLA 3DYEA 2L2CA 2P70A 3S0FA 1OOGA 2QEVA 4PT1A 3V2LA 3DY9A 2QEOA 3B7AA 1QWVA 1TUJA 1OOIX 2H8VA 3L4AA 3CZ0A 3VB1A 2QEHA 3RZSA 3D74A 3BFBA 4JD9A 2JPOA 3BJHA 3PJIA 2WCJA 3B87A 4F7FA 1OOHA 4FQTA 3CDNA 1OOFA 3OGNA 3FE9A 1T14A 3B86A 3NHTA 3L4LA 1GM0A 3CZ2A 1ORGA 2KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE8 A;  3R1P A;  3S0D A;  3QME A;  3S0B A;  1XFR A;  3BFH A;  4INX A;  2GTE A;  2QEB A;  2QDI A;  1OW4 A;  3FE6 A;  3B6X A;  2WCM A;  5DIC A;  3R1O A;  3K1E A;  3L47 A;  2WC5 A;  2WC6 A;  3D76 A;  3DXL A;  3S0E A;  3BFA A;  3D78 A;  3CAB A;  3S0G A;  3CYZ A;  1TWO A;  3N7H A;  3R72 A;  5EL2 A;  1C3Z A;  4OZD A;  2WCH A;  2FJY A;  3B88 A;  3D77 A;  2ERB A;  3CZ1 A;  3D75 A;  1C3Y A;  2P71 A;  3Q8I A;  1LS8 A;  3S0A A;  3R1V A;  3D73 A;  2PQL A;  3NHI A;  1DQE A;  1P28 A;  3NGV A;  3DZT A;  4INW A;  2WCK A;  2WCL A;  3DYE A;  2L2C A;  2P70 A;  3S0F A;  1OOG A;  2QEV A;  4PT1 A;  3V2L A;  3DY9 A;  2QEO A;  3B7A A;  1QWV A;  1TUJ A;  1OOI X;  2H8V A;  3L4A A;  3CZ0 A;  3VB1 A;  2QEH A;  3RZS A;  3D74 A;  3BFB A;  4JD9 A;  2JPO A;  3BJH A;  3PJI A;  2WCJ A;  3B87 A;  4F7F A;  1OOH A;  4FQT A;  3CDN A;  1OOF A;  3OGN A;  3FE9 A;  1T14 A;  3B86 A;  3NHT A;  3L4L A;  1GM0 A;  3CZ2 A;  1ORG A;  2KPH A; 
#chains in the Genus database with same CATH topology
 1N65 A;  1EL4 A;  2M8U A;  1B1G A;  1Y6W A;  1A75 A;  1RTP 1;  1S6C A;  1H4B A;  1DJX A;  1K96 A;  3BFH A;  2NZ0 A;  4MZJ A;  4DIR A;  1C07 A;  1EH2 A;  2NLN A;  1WRK A;  2GTE A;  3A8R A;  1VRK A;  4YI8 A;  3EVU A;  2PMY A;  3KF9 A;  3PM8 A;  1S36 A;  3B6X A;  1AVS A;  1K93 D;  3MSE B;  1KSM A;  1PVB A;  1YRT B;  5DIC A;  4A4B A;  1G4Y R;  1X02 A;  1ZMZ A;  2LMT A;  3BUM B;  5D3O A;  5HL1 A;  2HPS A;  3SG2 A;  2BNX A;  1S3P A;  3EK7 A;  3K1E A;  1G8I A;  5J3X A;  1QJT A;  3BUO B;  4ORA B;  4UPG A;  1SY9 A;  2BE6 A;  5I2Q A;  2AAO A;  2I7A A;  2EHB A;  4GGN A;  3D76 A;  4YGD B;  1DEK A;  2OTG B;  3BFA A;  3I5G B;  4BY4 A;  1CDM A;  1KK8 C;  1N0Y A;  1KFU L;  4N1G A;  2LLS A;  3JTD B;  3TZ1 A;  2IS9 A;  2GGZ A;  2KFF A;  4JWQ A;  3LCP C;  3N7H A;  1Z4H A;  5EL2 A;  1C3Z A;  1DF0 B;  2I2R E;  4PAL A;  3PFV A;  4HRH A;  2Y1N A;  1D1O A;  4D1E A;  3B88 A;  3EG5 B;  1MXL C;  1DJG A;  2ERB A;  3FWB A;  3D75 A;  1JFK A;  1OZO A;  3I5I C;  3RM1 A;  2P71 A;  3D10 A;  2KNE A;  2Y5I A;  3BUW B;  2BL0 C;  1SRA A;  2AMI A;  3S0A A;  1A2X A;  1BMO A;  1DTL A;  1DVI A;  1Y0V H;  2JTZ A;  5IBW A;  1IKU A;  4PE4 A;  1K9P A;  2L2E A;  1ALW A;  1J55 A;  3VRR A;  2ZRS A;  2MLF C;  2VRG A;  2K2A A;  3SG4 A;  3DZT A;  1PK0 D;  3SG5 A;  4WQ3 A;  1SYM A;  1MXE A;  3DYE A;  3BXK A;  3NSO A;  1XVJ A;  1BJF A;  1B47 A;  3K21 A;  2KI6 D;  2LAN A;  1PUL A;  2BCA A;  2TN4 A;  1XK4 A;  3B7A A;  1QWV A;  1JUO A;  2LLT A;  4MRY A;  1OQP A;  1TCO B;  4ORB B;  2ZN8 A;  3PN7 C;  1RJV A;  1CLL A;  2D8N A;  2LVJ A;  1CMG A;  1KWO B;  2JRF A;  4KYN A;  4JD9 A;  3BFB A;  4NDC A;  2LMU A;  4GNK B;  1QX2 A;  4Q04 A;  2JPO A;  2K8M B;  4ETO A;  3BJH A;  2BE4 A;  4JPZ B;  4YI9 A;  2F2O A;  2KHN A;  1BOC A;  2JT8 A;  2WCJ A;  5I94 A;  5KU1 A;  1LIN A;  1NCX A;  3B87 A;  3LK1 A;  5FI7 A;  2F3Y A;  2KSP A;  5AEQ A;  4I5K A;  1DGV A;  3CGA A;  2ZN9 A;  4FQT A;  2JOJ A;  1SW8 A;  2K0J A;  3PM2 A;  4C0J A;  1KK7 Z;  1M31 A;  4I5N B;  4YBH B;  4P2Y B;  1QVI Z;  4P5O E;  1EG4 A;  2KGR A;  1DJW A;  1S26 D;  3PSR A;  4MN0 A;  4PCW A;  1NX0 A;  1LVC D;  5CPV A;  1FPW A;  3FE9 A;  2A4J A;  4F0Z B;  1J7Q A;  3LK0 A;  2LP3 A;  2GV5 A;  3CZ2 A;  3KPX A;  2F33 A;  2WCB A;  1UUR A;  1PRW A;  1JWD A;  2MRD A;  1ORG A;  3TDZ A;  2JPT A;  1ZFS A;  3GK1 A;  1S1E A;  3BUX B;  3R1P A;  3QME A;  1AK8 A;  3OP0 A;  4OKH A;  1C7W A;  5D7F A;  4XJK A;  1E8A A;  3D0Y A;  2LP2 A;  1TRF A;  2JNF A;  2KI6 C;  2MBX A;  1XFW O;  3FE6 A;  1SMG A;  1H8B A;  1W9Z A;  1MHO A;  1Y1A A;  4CPV A;  2KLD A;  4PDZ A;  1QV0 A;  1SR6 C;  1QAS A;  1YUT A;  2LHI A;  3PLF B;  3R1O A;  3AAK A;  3BOW B;  2QPT A;  2LNK A;  1RK9 A;  4OV2 A;  1CB1 A;  2WC5 A;  3VRN A;  4MEW A;  4ZCU A;  3D78 A;  4OR9 B;  4TNC A;  4OVN F;  1UHJ A;  1YUR A;  1A29 A;  2Y4Q A;  4FQO A;  3TDU A;  4E68 A;  3CLN A;  3EK4 A;  3TS5 B;  1TUZ A;  2M3W A;  1S6I A;  4JKT A;  3KO0 A;  4GFT A;  2WOR A;  1PAL A;  4IL1 A;  1FBV A;  4NQG A;  2WCH A;  4OZD A;  1QX5 B;  3EKH A;  1IG5 A;  2KFH A;  3F45 A;  3D77 A;  5ER5 A;  5CSF A;  5I2L A;  2NXQ A;  1NCZ A;  3LL8 B;  1C3Y A;  1CM1 A;  2ZFD A;  2K7C A;  2JQ6 A;  5AER A;  1CNP A;  2KI4 B;  3R1V A;  5G08 A;  4DUQ A;  3I5G C;  1B7T Z;  2KBI A;  2B1U A;  2E30 A;  4MSP A;  5TNC A;  1BT6 A;  1QS7 A;  1YX8 A;  2H2K A;  1K9U A;  2ZND A;  1HQV A;  1QAT A;  2OS8 B;  3H4S E;  3JTD C;  5FI6 A;  1JF0 A;  1CTR A;  2KOT A;  2K7O A;  2KLE A;  2MHH A;  3AKA A;  3NGV A;  3SG7 A;  1KQM B;  1SL7 A;  2H61 C;  1MF8 B;  1PVA A;  3DF0 B;  3I5H B;  1MUX A;  3SG6 A;  2L2C A;  1J7O A;  1FF1 A;  1K2H A;  4N1F A;  2HQW A;  1YUS A;  2P70 A;  2LCP A;  3HX4 A;  1V1F A;  1NX1 A;  1OOG A;  3CTN A;  4HSZ A;  3AAJ A;  1RFJ A;  2QEO A;  5HLO A;  2LM5 A;  1S5G Y;  1AUI B;  2V53 A;  1XFU O;  4YRU A;  2BKH B;  2P6B B;  1OOI X;  2Y1M A;  4GAO A;  2ZRT A;  2E6W A;  4A4C A;  3L4A A;  2LUX A;  1J1D A;  1XFX O;  2HQ8 A;  2M1U A;  2QEH A;  5AXI A;  1DMO A;  2LV7 A;  4PE7 A;  2CXJ A;  3EVV A;  4WRI A;  3EK8 A;  4GGF C;  1DJI A;  1CLB A;  2L50 A;  2M0R A;  4MRX A;  2KQY A;  1LKJ A;  4YGB B;  1L2O B;  2K2F A;  1IGV A;  4ICB A;  1JBA A;  5AAN A;  2I18 A;  2KBM A;  3DVE A;  4DS7 A;  5PAL A;  2MJW B;  1DEL A;  4AQJ A;  1QX7 A;  4F7F A;  1MQ1 A;  2BBN A;  4PHJ A;  2LMV A;  2JZI A;  2COL B;  4GUK A;  1CFD A;  1TOP A;  3A4U B;  2BCB A;  2YGU A;  3M0W A;  1SL9 A;  1WDC B;  3NSK A;  1KWO C;  3CDN A;  5B8I B;  2OPO A;  4R1E A;  2O60 A;  1JSA A;  2I94 A;  1ZAC A;  4C0L A;  1CMF A;  1KFX S;  5F6T A;  1XFZ O;  4PHK A;  1HT9 A;  1SL8 A;  1UP5 A;  1U5I B;  2KAY A;  2M97 A;  4MVF A;  1GM0 A;  1MWN A;  3FWC A;  4XYN A;  5FI2 A;  1QV1 A;  3OX6 A;  1GJY A;  1J7R A;  2KAV A;  3DVK A;  3EKJ A;  3EVR A;  4QJ3 B;  3AKB A;  3ZNI A;  1EXR A;  3FE8 A;  3I5F B;  4N5X A;  5I2O A;  1ZOT B;  3JVT B;  5HYD A;  4QJ4 B;  1B8C A;  2NCO A;  4INX A;  3SIA A;  2KFG A;  2KAX A;  2QEB A;  2JT0 A;  1K95 A;  1OW4 A;  2MLE C;  2EC6 B;  2QDI A;  3PAL A;  1XFV O;  2KYC A;  1A03 A;  1N2D A;  4WQ2 A;  4I5J A;  4PE0 A;  1FI5 A;  1SCM B;  4CFR A;  1DF0 A;  2H61 A;  4MLW A;  1FW4 A;  1K90 D;  2BCX A;  1ALV A;  3CZT X;  4MBE A;  3ZWH A;  3O4X A;  4M2Q A;  3TUY B;  1SPY A;  1TNQ A;  2Q91 A;  5BPJ A;  1A75 B;  4NDB A;  4OCI A;  1NX2 A;  2WOS A;  4M2O A;  5DKN A;  1K9K A;  2LC5 A;  1JF2 A;  1BU3 A;  1CDP A;  1CFC A;  1OMD A;  2GGM A;  3CAB A;  2WND A;  1NIW A;  3FS7 A;  3HCM A;  1XYD A;  1XA5 A;  1BOD A;  1UWO A;  4FTG A;  4GGF A;  1TWO A;  2JT3 A;  4ORC B;  1MR8 A;  1REC A;  3WHU B;  1TCF A;  2L5Y A;  4QJ5 B;  1OOJ A;  3KEV A;  1M39 A;  4NDD A;  1F4Q A;  1QTX A;  1M63 B;  2FJY A;  4PHN A;  2BBM A;  4HRG A;  4MZK A;  5CSN A;  3LLE A;  1NX3 A;  2KGB C;  5CSJ A;  4M2P A;  1EG3 A;  3GK2 A;  2L98 A;  3SIB A;  1QIV A;  1R6P A;  2M9G A;  5HKW A;  1OE9 B;  2O5G A;  3D73 A;  2CNP A;  3VRO A;  2BAP A;  1NPQ A;  2FJU B;  2SCP A;  3NXA A;  3QRX A;  5D69 A;  2JXL A;  2PAS A;  3NHI A;  1DQE A;  1P28 A;  1LA3 A;  2K61 A;  3TS5 C;  4DCK A;  1YVL A;  3CR2 A;  1DC1 A;  4INW A;  3BYA A;  1XFY O;  2WCF A;  1J7P A;  4MZL A;  1M45 A;  2K7D A;  3SJS A;  3OB2 B;  3S0F A;  2LVV A;  3KHE A;  3FIA A;  2JUL A;  2M1K B;  2QEV A;  2RGI A;  4PT1 A;  1C7V A;  1Q80 A;  2L4H A;  2KI4 C;  2JU0 A;  1S6J A;  3PAT A;  1CKK A;  5HKZ A;  1NSH A;  4AQI A;  1F54 A;  1QLK A;  3CS1 A;  3UNW A;  4GPL B;  3CWG A;  3VB1 A;  2K7B A;  3RZS A;  1K8U A;  4JQ0 D;  1TN4 A;  1KQM C;  5I8N A;  1LXF C;  2DOQ A;  2OTG C;  3OX5 A;  2M29 A;  3I5H C;  1Y1U A;  4CLN A;  1F70 A;  2WC8 A;  2K60 A;  1SR6 B;  3NSI A;  2NCP A;  2LLU A;  5FYX A;  1DJY A;  2G9B A;  1YVH A;  3VRQ A;  2ZNE A;  1OOH A;  1IIO A;  2EGD A;  1V1G A;  2MA2 A;  1J1E A;  1R2U A;  4YGC B;  2L0P A;  1BR4 B;  1OOF A;  2QAC A;  4USL A;  2LVI A;  4YGE B;  1YX7 A;  2CT9 A;  2LAP A;  1NP8 A;  3IQQ A;  3OGN A;  3VRP A;  1L2O C;  1OMR A;  1SSE B;  1T14 A;  1B8L A;  5KSZ A;  4PHM A;  1SCV A;  1AJ4 A;  3L4L A;  4ZCV A;  1UHI A;  3IF7 A;  2PYQ A;  1IQ5 A;  3GK4 X;  1F71 A;  2MAZ A;  1KCY A;  4YGA A;  1NYA A;  1BR1 B;  1QLS A;  3BOW A;  3C1V A;  4CFQ A;  3S0D A;  3S0B A;  1WDC C;  5AFP A;  2JTT A;  2JWW A;  4CID A;  1XFR A;  1BG1 A;  1CDN A;  1TNW A;  1KFX L;  1B8R A;  2F3Z A;  1W7J B;  1YR5 A;  1F8H A;  3WXA A;  1RWY A;  2R2I A;  3DVM A;  2G2B A;  1WY9 A;  1KK8 B;  1YUU A;  2AUC A;  1FI6 A;  2JXC A;  1B9A A;  1UUS A;  2FCD A;  3SG3 A;  1GGZ A;  3E3R A;  5K89 A;  1GGW A;  3VGO A;  1KFU S;  5HKY A;  2WCM A;  2CTN A;  3SS3 A;  1S5G Z;  3CR4 X;  2PVB A;  3I5F C;  2M49 B;  3L47 A;  3JVT C;  2M7L A;  1IRJ A;  3I5I B;  1TIZ A;  2LHL A;  3IQO A;  4I5L B;  1JC2 A;  2WC6 A;  2BL0 B;  3DXL A;  2LUC A;  4XJK B;  3S0E A;  3RLZ A;  3D0Y B;  1IJ6 A;  1KK7 Y;  2L51 A;  3WNX B;  3O4Y A;  1YRU B;  2EC6 C;  1QVI Y;  3S0G A;  1DJZ A;  1M46 A;  1WLZ A;  3CYZ A;  1IQ3 A;  1SCM C;  1SBJ A;  4AOM A;  3OB1 B;  3R72 A;  5DKR A;  1G33 A;  3DF0 A;  1AJ5 A;  4DRW A;  1CDL A;  1WRL A;  4L9M A;  1DJH A;  1KQV A;  3SS5 A;  3WHT B;  2CBL A;  1F55 A;  3TUY C;  1Y1X A;  1AP4 A;  2KQ6 A;  3CZ1 A;  3GOF A;  2LE9 B;  5HLV A;  5CSI A;  1DGU A;  2FOT A;  5JOL A;  3O6B A;  3Q8I A;  5KTY A;  2JC2 A;  1LS8 A;  2L5X B;  1NCY A;  3DD4 A;  2HET A;  1SK6 D;  3PN7 B;  1JFJ A;  1RRO A;  2PQL A;  1PSB A;  5JJG A;  1F4O A;  2FCE A;  2BEC A;  1K94 A;  2WCK A;  1LA0 A;  1ODB A;  2WCL A;  2M7N A;  2ISD A;  1UHH A;  4C0K A;  1TTX A;  3SS4 A;  4BY5 A;  2WCE A;  1CLM A;  1CFF A;  1KSO A;  3V2L A;  3IVT A;  3BUN B;  3DY9 A;  1XO5 A;  2PAL A;  2ZKM X;  1SNL A;  3DVJ A;  2PRU A;  3O2P A;  2BKI B;  3OHM B;  1TUJ A;  5ER4 X;  1BF5 A;  1TNX A;  2KDH A;  1NWD A;  2H8V A;  2PSR A;  3CZ0 A;  1OSA A;  1IWQ A;  3O78 A;  1W7I B;  3D74 A;  1QXP A;  3BQ3 A;  1IH0 A;  2KYF A;  1U5I A;  2F8P A;  1IJ5 A;  4HRE E;  3PJI A;  1L7Z A;  1AHR A;  2SAS A;  3ICB A;  3NSL A;  1BLQ A;  5GQQ C;  1ZUZ A;  3TDI A;  1EJ3 A;  4IJ7 A;  2F2P A;  2JNX A;  5DKQ A;  3OBV A;  1GQM A;  2Q4U A;  1SKT A;  1UHN A;  1OMV A;  1A4P A;  1OZS A;  2HF5 A;  4PE1 A;  1CFP A;  1QIW A;  1Z2C B;  1B7T Y;  1YTZ C;  2L4I A;  3UO9 A;  1CM4 A;  1UHK A;  1WRZ A;  4GBA A;  4U8D A;  1DT7 B;  3B86 A;  1B4C A;  2OS8 C;  3NHT A;  1TNP A;  1WLM A;  2CCM A;  1PSR A;  2LVK A;  1NUB A;  3CR5 X;  2KPH A;  1XK4 C; 
#chains in the Genus database with same CATH homology
 3FE8 A;  3R1P A;  3S0D A;  3QME A;  3S0B A;  1XFR A;  3BFH A;  4INX A;  2GTE A;  2QEB A;  2QDI A;  1OW4 A;  3FE6 A;  3B6X A;  2WCM A;  5DIC A;  3R1O A;  3K1E A;  3L47 A;  2WC5 A;  2WC6 A;  3D76 A;  3DXL A;  3S0E A;  3BFA A;  3D78 A;  3CAB A;  3S0G A;  3CYZ A;  1TWO A;  3N7H A;  3R72 A;  5EL2 A;  1C3Z A;  4OZD A;  2WCH A;  2FJY A;  3B88 A;  3D77 A;  2ERB A;  3CZ1 A;  3D75 A;  1C3Y A;  2P71 A;  3Q8I A;  1LS8 A;  3S0A A;  3R1V A;  3D73 A;  2PQL A;  3NHI A;  1DQE A;  1P28 A;  3NGV A;  3DZT A;  4INW A;  2WCK A;  2WCL A;  3DYE A;  2L2C A;  2P70 A;  3S0F A;  1OOG A;  2QEV A;  4PT1 A;  3V2L A;  3DY9 A;  2QEO A;  3B7A A;  1QWV A;  1TUJ A;  1OOI X;  2H8V A;  3L4A A;  3CZ0 A;  3VB1 A;  2QEH A;  3RZS A;  3D74 A;  3BFB A;  4JD9 A;  2JPO A;  3BJH A;  3PJI A;  2WCJ A;  3B87 A;  4F7F A;  1OOH A;  4FQT A;  3CDN A;  1OOF A;  3OGN A;  3FE9 A;  1T14 A;  3B86 A;  3NHT A;  3L4L A;  1GM0 A;  3CZ2 A;  1ORG A;  2KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...