3CZ1A

Dimeric crystal structure of a pheromone binding protein from apis mellifera in complex with the n-butyl benzene sulfonamide at ph 7.0
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
b'DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 35
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cz1A00
3K1EA 3BFBA 2QDIA 2WCLA 3VB1A 3FE8A 3D75A 3RZSA 4FQTA 3CZ1A 2WCHA 1ORGA 2PQLA 3BFAA 1OOGA 1GM0A 2QEOA 4INXA 3DZTA 4JD9A 2WCMA 5DICA 2QEBA 2GTEA 1TWOA 3D74A 3S0DA 3NGVA 2FJYA 3D76A 3R1OA 1TUJA 4INWA 1OOFA 2WC6A 3NHIA 2WCKA 3B6XA 4F7FA 3D73A 3B88A 4OZDA 3R1PA 3B87A 1OOHA 3BFHA 3S0BA 3D77A 3CDNA 3L47A 3R1VA 3B7AA 3D78A 5EL2A 1DQEA 1P28A 1QWVA 3N7HA 2ERBA 2QEVA 2L2CA 3DYEA 3B86A 3PJIA 1LS8A 1XFRA 3FE6A 1OW4A 3S0FA 2KPHA 3Q8IA 3V2LA 2WC5A 3BJHA 3FE9A 3CZ2A 3CYZA 3L4AA 3S0GA 3OGNA 3R72A 3S0EA 3L4LA 3QMEA 2JPOA 1T14A 2WCJA 3CABA 1OOIX 3DXLA 2QEHA 3DY9A 1C3ZA 2P70A 3CZ0A 4PT1A 2P71A 3S0AA 1C3YA 3NHTA 2H8VA
chains in the Genus database with same CATH superfamily
1ZMZA 1IJ5A 4MSPA 4YRUA 5HLOA 2CNPA 2WOSA 1J7PA 1NYAA 3K21A 2P6BB 3D75A 4FQTA 2FCEA 2JXCA 1J55A 2LE9B 2H61A 1A29A 2CCMA 2WCFA 3CZ1A 3KPXA 4PHMA 2K61A 3KHEA 2PVBA 1KK7Y 3BUMB 1ORGA 4WQ3A 3I5HB 1YTZC 3VRPA 1YUUA 2F33A 1OOGA 4CPVA 1H4BA 1M39A 1GM0A 1CMFA 4NDDA 1QVIZ 3VGOA 1BG1A 4IL1A 3I5IB 4MRXA 1Z2CB 1YURA 3DZTA 4JD9A 4PHNA 4ZCUA 1UP5A 1DJZA 3D0YA 1DF0A 3SS3A 1XFWO 2KAVA 1GJYA 2BL0C 5D3OA 4CFRA 2MHHA 5PALA 3TZ1A 4N1GA 2E30A 1ZUZA 1N0YA 4I5LB 1DVIA 1KQMC 1CDLA 1UUSA 3I5GC 4GGFC 3IF7A 4A4BA 1YRTB 1DJYA 1K8UA 1BT6A 3EG5B 3NGVA 1RWYA 3BUNB 4C0LA 4M2PA 3DVMA 1QS7A 2FJYA 3M0WA 3IQQA 1K9KA 1L2OB 4BY4A 1A75B 3EK4A 5CSJA 5ER5A 4INWA 2BCXA 5F6TA 5HKZA 2WC6A 1CFPA 1NCXA 1AHRA 4ZCVA 1RFJA 2BBMA 2HPSA 1B1GA 3D73A 2KYCA 1RROA 1AJ5A 3DVJA 1E8AA 4PHJA 1OMVA 1CFFA 1TCOB 3JVTC 4IJ7A 4ICBA 3GOFA 1NUBA 1XYDA 1YR5A 3HX4A 3L47A 4GBAA 3GK2A 2MAZA 1DJXA 1XK4C 2MLFC 1KK8C 1F71A 4DCKA 1EG3A 2JTTA 1TN4A 3OX5A 1B8LA 1WLZA 2ZN8A 5EL2A 1PVBA 4D1EA 1NX1A 2R2IA 1DQEA 1P28A 2OTGC 3N7HA 1LINA 2LNKA 1J7RA 1B8RA 1K95A 1ODBA 1OQPA 1SPYA 4QJ3B 2LANA 1S6JA 1FBVA 3DYEA 3FS7A 3LL8B 3ZWHA 1GGZA 4U8DA 2NCPA 4NDCA 1ZACA 1QXPA 2Y4QA 1OW4A 1M45A 1IKUA 3PN7B 2PALA 1RECA 4MVFA 3O2PA 1NIWA 3TUYB 2G2BA 1CNPA 1A75A 1TNWA 3L4AA 1TOPA 2K8MB 2MJWB 3S0EA 2JPTA 4P2YB 1J7QA 1S1EA 2JPOA 1WDCB 5I8NA 5CPVA 2JULA 3FWCA 1MWNA 1KQVA 1OMRA 2LM5A 2LMVA 2P70A 3CZ0A 2KGRA 3BYAA 2EGDA 2NXQA 1S36A 2L51A 3EKHA 2BAPA 4GAOA 1KWOB 1QLSA 3QRXA 2KLDA 1V1GA 2M9GA 3SG6A 1F70A 2HF5A 2WCLA 2KQ6A 3FE8A 5KSZA 2BCBA 4ORAB 1SW8A 1A03A 2JT3A 1QIWA 1Y1AA 3DD4A 5HKYA 5CSFA 2WCHA 1DEKA 3EVVA 1B47A 1YX7A 4L9MA 1KSMA 1KFXS 2QEOA 3EK8A 2L50A 3CLNA 2F8PA 3O4XA 2CT9A 1OOJA 5HLVA 2K7BA 4C0KA 1C7WA 1KK7Z 2LP3A 2L2EA 2KAXA 1NX0A 2JNFA 3NSOA 5TNCA 3OX6A 1SR6C 2CBLA 1NX3A 1UHHA 2BL0B 1A2XA 2GTEA 2JXLA 2EC6C 4C0JA 1YVHA 5D69A 5CSIA 1QTXA 3EVUA 1ZOTB 3S0DA 1XO5A 2B1UA 2Q4UA 2KI4C 1NX2A 4I5NB 1N65A 3I5GB 5K89A 1DJGA 2GV5A 2BE6A 2JC2A 5AERA 3D76A 3WNXB 3PLFB 3R1OA 1PK0D 4PE1A 2K0JA 2KBMA 3FWBA 5GQQC 3LLEA 4A4CA 1BOCA 1SRAA 1K96A 2KBIA 4UPGA 2MA2A 3NHIA 4M2OA 1IIOA 3B6XA 1TIZA 5D7FA 4YI8A 3B88A 1CLBA 3GK1A 2M7NA 3R1PA 3PALA 1B4CA 2FOTA 2A4JA 1B8CA 1BR1B 1EJ3A 1DTLA 1OOHA 2L0PA 2PASA 3D77A 3CDNA 4HREE 3NSLA 1F4QA 3JVTB 2LVKA 3OP0A 3R1VA 4FTGA 1EH2A 1QX2A 3B7AA 3O6BA 2I7AA 2L5XB 1KK8B 2BKIB 3RM1A 3I5FC 5JOLA 1CFCA 1IWQA 1V1FA 3OBVA 2E6WA 2ERBA 1EXRA 2KHNA 2KI6D 3KF9A 1WRLA 2MLEC 5CSNA 2NCOA 1GQMA 1XFYO 2LV7A 2TN4A 3O78A 2LLTA 1MXLC 3PJIA 4AQJA 3EKJA 4PE4A 1JBAA 1BF5A 4GGNA 2LUCA 1C07A 4HRHA 1B7TY 3Q8IA 3VRRA 4GUKA 4GGFA 4XJKB 2JTZA 3CR5X 3JTDC 2NZ0A 2LVJA 2QPTA 1OMDA 3CYZA 1XVJA 1CM4A 2CTNA 1KFUS 3OGNA 4YGBB 2WC8A 3SS5A 5AEQA 3QMEA 2LAPA 1PSBA 1T14A 2L5YA 2WCJA 4JKTA 1F4OA 2FCDA 2ISDA 4HRGA 2F2OA 4USLA 3TDUA 4BY5A 1Z4HA 1WRZA 4M2QA 2WNDA 1VRKA 3CS1A 1SCMC 3GK4X 1IQ5A 1WY9A 2I2RE 1D1OA 4PE0A 2PSRA 1SCVA 4R1EA 1WLMA 1SSEB 2CXJA 1RK9A 1XK4A 4GPLB 3DF0B 1DC1A 1SL9A 1DELA 1IGVA 2OPOA 3K1EA 2QDIA 4MEWA 3ZNIA 1QATA 2KSPA 2BE4A 3WHTB 2FJUB 4CFQA 1PSRA 2JOJA 1XFVO 1SNLA 4MBEA 1JUOA 3A4UB 1ALVA 1G4YR 1Q80A 2M29A 2ZKMX 4YGEB 1F55A 1IJ6A 1L2OC 1QJTA 5FYXA 2M97A 2DOQA 3CTNA 3EVRA 3UO9A 1BLQA 2LCPA 3PM8A 1QIVA 5AFPA 1LKJA 1NSHA 4XJKA 1AUIB 1PVAA 2KFGA 4F0ZB 1YUSA 1PRWA 4INXA 4ORCB 1SBJA 1Y0VH 3F45A 4OCIA 2RGIA 1CTRA 1QX7A 4N1FA 2M7LA 3SG7A 2KFFA 5I2OA 2WCMA 5I2QA 1F54A 1Y1XA 3VRQA 3LK1A 1IG5A 2WCBA 2AAOA 5DICA 5KU1A 2EHBA 2K7OA 1CFDA 1OZSA 1MHOA 2QEBA 1DJIA 2LHIA 4CIDA 1SR6B 3D74A 3WXAA 1J7OA 2M1KB 4PCWA 1NCZA 2WCEA 2GGZA 3CWGA 1BODA 1UHIA 1UHJA 2HETA 2L4HA 3SIAA 2I94A 2KQYA 4HSZA 2JU0A 4AQIA 2V53A 2KI4B 3DF0A 2I18A 1AVSA 1TUJA 2H2KA 4NQGA 1OOFA 1LXFC 1XFXO 1EL4A 1H8BA 2JNXA 4F7FA 2KAYA 1JFJA 4MLWA 1YUTA 4YGAA 3VROA 3PFVA 5HKWA 2HQWA 2ZFDA 5BPJA 1NCYA 3TUYC 2LMUA 1M63B 3B87A 2PMYA 1AK8A 1QLKA 1C7VA 3S0BA 1JSAA 3SG3A 2BCAA 2QACA 1W7IB 2JRFA 5G08A 4DRWA 3O4YA 1U5IA 4MZLA 1UHKA 2ZNEA 2COLB 1TTXA 2LHLA 1CLLA 4ETOA 1KQMB 3BUXB 5KTYA 2LLSA 2H61C 3TS5C 1J1EA 1QWVA 1JF2A 1ZFSA 1N2DA 4XYNA 1S5GY 1MXEA 3I5FB 2F2PA 4CLNA 2K7CA 1UURA 2JT0A 2L2CA 3NSIA 1K9UA 2Y1NA 2M8UA 4N5XA 3OB2B 2K7DA 3B86A 1LS8A 1XFRA 1MF8B 3CR4X 3FE6A 2KPHA 1XA5A 2ZN9A 2LUXA 1QV1A 4TNCA 2SASA 2BNXA 1KFXL 1RTP1 3V2LA 2O5GA 2WC5A 2OS8C 3FE9A 3CZ2A 1B9AA 2PRUA 1DGUA 2JZIA 2ZRTA 3JTDB 4PHKA 3S0GA 1W9ZA 2GGMA 3OHMB 1QASA 4I5KA 1CMGA 3PSRA 2HQ8A 1Y1UA 1OOIX 2LC5A 1B7TZ 3DY9A 2KDHA 1TCFA 1TNXA 4YGCB 2LLUA 1KCYA 4MZKA 3PM2A 4WQ2A 4PT1A 1YVLA 4PALA 3NXAA 3ICBA 1DMOA 5DKQA 2OTGB 3S0AA 3WHUB 1J1DA 3FIAA 1C3YA 1SCMB 3KO0A 3NHTA 1OZOA 2H8VA 4QJ4B 3E3RA 2SCPA 3BFBA 4MN0A 2BECA 4P5OE 1CLMA 3DVKA 3VB1A 3TDIA 1AP4A 3RZSA 4GNKB 1M46A 1QVIY 2KYFA 1XFZO 3AKAA 1LVCD 3EK7A 4DIRA 2KLEA 2AUCA 3I5HC 3UNWA 1OE9B 1HQVA 2L4IA 1K93D 5ER4X 1MQ1A 1IRJA 2K2AA 2Y1MA 1SL8A 1W7JB 2PQLA 3H4SE 4MZJA 3BFAA 4NDBA 2K2FA 2YGUA 1CDMA 3SG4A 1SK6D 3BUOB 5I2LA 3I5IC 2JQ6A 1BJFA 1NPQA 4KYNA 1DJWA 1PULA 1PALA 4OR9B 3SG5A 2Q91A 1IQ3A 1CM1A 2LVIA 1S3PA 1YRUB 5DKNA 1X02A 1XFUO 1FF1A 5FI7A 1Y6WA 1SYMA 1SL7A 4YGDB 1F8HA 5HL1A 3BOWB 1AJ4A 4DUQA 2M49B 3SIBA 4YBHB 3PATA 5FI6A 1K2HA 1DGVA 1LA3A 5HYDA 1TWOA 5J3XA 4AOMA 1MR8A 1MUXA 2K60A 4E68A 1EG4A 1CB1A 1JWDA 2AMIA 5I94A 4WRIA 1ALWA 3LCPC 2M0RA 1NWDA 2ZRSA 4OV2A 4OKHA 3A8RA 2BBNA 3VRNA 2MBXA 2Y5IA 1JC2A 1FW4A 1KFUL 1BU3A 1BR4B 1RJVA 1R2UA 1YX8A 2WCKA 4ORBB 1U5IB 2F3ZA 1S6CA 2F3YA 4MRYA 3SJSA 4OZDA 1FI6A 1G33A 3BXKA 3NSKA 3BUWB 2JT8A 2MRDA 3SG2A 1CDNA 1SMGA 3IQOA 1QX5B 3BFHA 1FPWA 1BMOA 5DKRA 4Q04A 3AKBA 1DJHA 2ZNDA 1DT7B 1WRKA 2M3WA 1FI5A 5JJGA 1UWOA 4OVNF 5AANA 3HCMA 4JPZB 1A4PA 1S6IA 3D78A 2LVVA 1IH0A 1UHNA 2M1UA 2KFHA 3LK0A 3OB1B 2EC6B 1K94A 3BOWA 4I5JA 4YI9A 3C1VA 1G8IA 1K9PA 1S26D 1TNQA 2BKHB 2QEVA 3DVEA 3KEVA 2KNEA 5AXIA 3BQ3A 1R6PA 1NP8A 3TS5B 4JQ0D 2JWWA 2LP2A 2KI6C 5FI2A 2KGBC 2L98A 3PN7C 2WORA 2LMTA 3S0FA 3CGAA 2G9BA 2VRGA 3SS4A 3MSEB 3CZTX 3CR2A 3BJHA 1S5GZ 5IBWA 1HT9A 1SKTA 2IS9A 1JFKA 1WDCC 1GGWA 3R72A 4GFTA 2OS8B 4PDZA 1QV0A 3L4LA 3D0YB 1TUZA 1DF0B 1M31A 3IVTA 1KSOA 3CABA 1SY9A 3D10A 2QEHA 3DXLA 1L7ZA 4PE7A 5B8IB 2D8NA 2NLNA 3TDZA 1CKKA 2KOTA 1C3ZA 4JWQA 3RLZA 4QJ5B 1LA0A 1TRFA 1KWOC 1CDPA 1TNPA 2PYQA 1JF0A 2O60A 2P71A 1K90D 1OSAA 3AAJA 4DS7A 4FQOA 3AAKA
chains in the Genus database with same CATH topology
3K1EA 3BFBA 2QDIA 2WCLA 3VB1A 3FE8A 3D75A 3RZSA 4FQTA 3CZ1A 2WCHA 1ORGA 2PQLA 3BFAA 1OOGA 1GM0A 2QEOA 4INXA 3DZTA 4JD9A 2WCMA 5DICA 2QEBA 2GTEA 1TWOA 3D74A 3S0DA 3NGVA 2FJYA 3D76A 3R1OA 1TUJA 4INWA 1OOFA 2WC6A 3NHIA 2WCKA 3B6XA 4F7FA 3D73A 3B88A 4OZDA 3R1PA 3B87A 1OOHA 3BFHA 3S0BA 3D77A 3CDNA 3L47A 3R1VA 3B7AA 3D78A 5EL2A 1DQEA 1P28A 1QWVA 3N7HA 2ERBA 2QEVA 2L2CA 3DYEA 3B86A 3PJIA 1LS8A 1XFRA 3FE6A 1OW4A 3S0FA 2KPHA 3Q8IA 3V2LA 2WC5A 3BJHA 3FE9A 3CZ2A 3CYZA 3L4AA 3S0GA 3OGNA 3R72A 3S0EA 3L4LA 3QMEA 2JPOA 1T14A 2WCJA 3CABA 1OOIX 3DXLA 2QEHA 3DY9A 1C3ZA 2P70A 3CZ0A 4PT1A 2P71A 3S0AA 1C3YA 3NHTA 2H8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1E A;  3BFB A;  2QDI A;  2WCL A;  3VB1 A;  3FE8 A;  3D75 A;  3RZS A;  4FQT A;  3CZ1 A;  2WCH A;  1ORG A;  2PQL A;  3BFA A;  1OOG A;  1GM0 A;  2QEO A;  4INX A;  3DZT A;  4JD9 A;  2WCM A;  5DIC A;  2QEB A;  2GTE A;  1TWO A;  3D74 A;  3S0D A;  3NGV A;  2FJY A;  3D76 A;  3R1O A;  1TUJ A;  4INW A;  1OOF A;  2WC6 A;  3NHI A;  2WCK A;  3B6X A;  4F7F A;  3D73 A;  3B88 A;  4OZD A;  3R1P A;  3B87 A;  1OOH A;  3BFH A;  3S0B A;  3D77 A;  3CDN A;  3L47 A;  3R1V A;  3B7A A;  3D78 A;  5EL2 A;  1DQE A;  1P28 A;  1QWV A;  3N7H A;  2ERB A;  2QEV A;  2L2C A;  3DYE A;  3B86 A;  3PJI A;  1LS8 A;  1XFR A;  3FE6 A;  1OW4 A;  3S0F A;  2KPH A;  3Q8I A;  3V2L A;  2WC5 A;  3BJH A;  3FE9 A;  3CZ2 A;  3CYZ A;  3L4A A;  3S0G A;  3OGN A;  3R72 A;  3S0E A;  3L4L A;  3QME A;  2JPO A;  1T14 A;  2WCJ A;  3CAB A;  1OOI X;  3DXL A;  2QEH A;  3DY9 A;  1C3Z A;  2P70 A;  3CZ0 A;  4PT1 A;  2P71 A;  3S0A A;  1C3Y A;  3NHT A;  2H8V A; 
#chains in the Genus database with same CATH topology
 1ZMZ A;  1IJ5 A;  4MSP A;  4YRU A;  5HLO A;  2CNP A;  2WOS A;  1J7P A;  1NYA A;  3K21 A;  2P6B B;  3D75 A;  4FQT A;  2FCE A;  2JXC A;  1J55 A;  2LE9 B;  2H61 A;  1A29 A;  2CCM A;  2WCF A;  3CZ1 A;  3KPX A;  4PHM A;  2K61 A;  3KHE A;  2PVB A;  1KK7 Y;  3BUM B;  1ORG A;  4WQ3 A;  3I5H B;  1YTZ C;  3VRP A;  1YUU A;  2F33 A;  1OOG A;  4CPV A;  1H4B A;  1M39 A;  1GM0 A;  1CMF A;  4NDD A;  1QVI Z;  3VGO A;  1BG1 A;  4IL1 A;  3I5I B;  4MRX A;  1Z2C B;  1YUR A;  3DZT A;  4JD9 A;  4PHN A;  4ZCU A;  1UP5 A;  1DJZ A;  3D0Y A;  1DF0 A;  3SS3 A;  1XFW O;  2KAV A;  1GJY A;  2BL0 C;  5D3O A;  4CFR A;  2MHH A;  5PAL A;  3TZ1 A;  4N1G A;  2E30 A;  1ZUZ A;  1N0Y A;  4I5L B;  1DVI A;  1KQM C;  1CDL A;  1UUS A;  3I5G C;  4GGF C;  3IF7 A;  4A4B A;  1YRT B;  1DJY A;  1K8U A;  1BT6 A;  3EG5 B;  3NGV A;  1RWY A;  3BUN B;  4C0L A;  4M2P A;  3DVM A;  1QS7 A;  2FJY A;  3M0W A;  3IQQ A;  1K9K A;  1L2O B;  4BY4 A;  1A75 B;  3EK4 A;  5CSJ A;  5ER5 A;  4INW A;  2BCX A;  5F6T A;  5HKZ A;  2WC6 A;  1CFP A;  1NCX A;  1AHR A;  4ZCV A;  1RFJ A;  2BBM A;  2HPS A;  1B1G A;  3D73 A;  2KYC A;  1RRO A;  1AJ5 A;  3DVJ A;  1E8A A;  4PHJ A;  1OMV A;  1CFF A;  1TCO B;  3JVT C;  4IJ7 A;  4ICB A;  3GOF A;  1NUB A;  1XYD A;  1YR5 A;  3HX4 A;  3L47 A;  4GBA A;  3GK2 A;  2MAZ A;  1DJX A;  1XK4 C;  2MLF C;  1KK8 C;  1F71 A;  4DCK A;  1EG3 A;  2JTT A;  1TN4 A;  3OX5 A;  1B8L A;  1WLZ A;  2ZN8 A;  5EL2 A;  1PVB A;  4D1E A;  1NX1 A;  2R2I A;  1DQE A;  1P28 A;  2OTG C;  3N7H A;  1LIN A;  2LNK A;  1J7R A;  1B8R A;  1K95 A;  1ODB A;  1OQP A;  1SPY A;  4QJ3 B;  2LAN A;  1S6J A;  1FBV A;  3DYE A;  3FS7 A;  3LL8 B;  3ZWH A;  1GGZ A;  4U8D A;  2NCP A;  4NDC A;  1ZAC A;  1QXP A;  2Y4Q A;  1OW4 A;  1M45 A;  1IKU A;  3PN7 B;  2PAL A;  1REC A;  4MVF A;  3O2P A;  1NIW A;  3TUY B;  2G2B A;  1CNP A;  1A75 A;  1TNW A;  3L4A A;  1TOP A;  2K8M B;  2MJW B;  3S0E A;  2JPT A;  4P2Y B;  1J7Q A;  1S1E A;  2JPO A;  1WDC B;  5I8N A;  5CPV A;  2JUL A;  3FWC A;  1MWN A;  1KQV A;  1OMR A;  2LM5 A;  2LMV A;  2P70 A;  3CZ0 A;  2KGR A;  3BYA A;  2EGD A;  2NXQ A;  1S36 A;  2L51 A;  3EKH A;  2BAP A;  4GAO A;  1KWO B;  1QLS A;  3QRX A;  2KLD A;  1V1G A;  2M9G A;  3SG6 A;  1F70 A;  2HF5 A;  2WCL A;  2KQ6 A;  3FE8 A;  5KSZ A;  2BCB A;  4ORA B;  1SW8 A;  1A03 A;  2JT3 A;  1QIW A;  1Y1A A;  3DD4 A;  5HKY A;  5CSF A;  2WCH A;  1DEK A;  3EVV A;  1B47 A;  1YX7 A;  4L9M A;  1KSM A;  1KFX S;  2QEO A;  3EK8 A;  2L50 A;  3CLN A;  2F8P A;  3O4X A;  2CT9 A;  1OOJ A;  5HLV A;  2K7B A;  4C0K A;  1C7W A;  1KK7 Z;  2LP3 A;  2L2E A;  2KAX A;  1NX0 A;  2JNF A;  3NSO A;  5TNC A;  3OX6 A;  1SR6 C;  2CBL A;  1NX3 A;  1UHH A;  2BL0 B;  1A2X A;  2GTE A;  2JXL A;  2EC6 C;  4C0J A;  1YVH A;  5D69 A;  5CSI A;  1QTX A;  3EVU A;  1ZOT B;  3S0D A;  1XO5 A;  2B1U A;  2Q4U A;  2KI4 C;  1NX2 A;  4I5N B;  1N65 A;  3I5G B;  5K89 A;  1DJG A;  2GV5 A;  2BE6 A;  2JC2 A;  5AER A;  3D76 A;  3WNX B;  3PLF B;  3R1O A;  1PK0 D;  4PE1 A;  2K0J A;  2KBM A;  3FWB A;  5GQQ C;  3LLE A;  4A4C A;  1BOC A;  1SRA A;  1K96 A;  2KBI A;  4UPG A;  2MA2 A;  3NHI A;  4M2O A;  1IIO A;  3B6X A;  1TIZ A;  5D7F A;  4YI8 A;  3B88 A;  1CLB A;  3GK1 A;  2M7N A;  3R1P A;  3PAL A;  1B4C A;  2FOT A;  2A4J A;  1B8C A;  1BR1 B;  1EJ3 A;  1DTL A;  1OOH A;  2L0P A;  2PAS A;  3D77 A;  3CDN A;  4HRE E;  3NSL A;  1F4Q A;  3JVT B;  2LVK A;  3OP0 A;  3R1V A;  4FTG A;  1EH2 A;  1QX2 A;  3B7A A;  3O6B A;  2I7A A;  2L5X B;  1KK8 B;  2BKI B;  3RM1 A;  3I5F C;  5JOL A;  1CFC A;  1IWQ A;  1V1F A;  3OBV A;  2E6W A;  2ERB A;  1EXR A;  2KHN A;  2KI6 D;  3KF9 A;  1WRL A;  2MLE C;  5CSN A;  2NCO A;  1GQM A;  1XFY O;  2LV7 A;  2TN4 A;  3O78 A;  2LLT A;  1MXL C;  3PJI A;  4AQJ A;  3EKJ A;  4PE4 A;  1JBA A;  1BF5 A;  4GGN A;  2LUC A;  1C07 A;  4HRH A;  1B7T Y;  3Q8I A;  3VRR A;  4GUK A;  4GGF A;  4XJK B;  2JTZ A;  3CR5 X;  3JTD C;  2NZ0 A;  2LVJ A;  2QPT A;  1OMD A;  3CYZ A;  1XVJ A;  1CM4 A;  2CTN A;  1KFU S;  3OGN A;  4YGB B;  2WC8 A;  3SS5 A;  5AEQ A;  3QME A;  2LAP A;  1PSB A;  1T14 A;  2L5Y A;  2WCJ A;  4JKT A;  1F4O A;  2FCD A;  2ISD A;  4HRG A;  2F2O A;  4USL A;  3TDU A;  4BY5 A;  1Z4H A;  1WRZ A;  4M2Q A;  2WND A;  1VRK A;  3CS1 A;  1SCM C;  3GK4 X;  1IQ5 A;  1WY9 A;  2I2R E;  1D1O A;  4PE0 A;  2PSR A;  1SCV A;  4R1E A;  1WLM A;  1SSE B;  2CXJ A;  1RK9 A;  1XK4 A;  4GPL B;  3DF0 B;  1DC1 A;  1SL9 A;  1DEL A;  1IGV A;  2OPO A;  3K1E A;  2QDI A;  4MEW A;  3ZNI A;  1QAT A;  2KSP A;  2BE4 A;  3WHT B;  2FJU B;  4CFQ A;  1PSR A;  2JOJ A;  1XFV O;  1SNL A;  4MBE A;  1JUO A;  3A4U B;  1ALV A;  1G4Y R;  1Q80 A;  2M29 A;  2ZKM X;  4YGE B;  1F55 A;  1IJ6 A;  1L2O C;  1QJT A;  5FYX A;  2M97 A;  2DOQ A;  3CTN A;  3EVR A;  3UO9 A;  1BLQ A;  2LCP A;  3PM8 A;  1QIV A;  5AFP A;  1LKJ A;  1NSH A;  4XJK A;  1AUI B;  1PVA A;  2KFG A;  4F0Z B;  1YUS A;  1PRW A;  4INX A;  4ORC B;  1SBJ A;  1Y0V H;  3F45 A;  4OCI A;  2RGI A;  1CTR A;  1QX7 A;  4N1F A;  2M7L A;  3SG7 A;  2KFF A;  5I2O A;  2WCM A;  5I2Q A;  1F54 A;  1Y1X A;  3VRQ A;  3LK1 A;  1IG5 A;  2WCB A;  2AAO A;  5DIC A;  5KU1 A;  2EHB A;  2K7O A;  1CFD A;  1OZS A;  1MHO A;  2QEB A;  1DJI A;  2LHI A;  4CID A;  1SR6 B;  3D74 A;  3WXA A;  1J7O A;  2M1K B;  4PCW A;  1NCZ A;  2WCE A;  2GGZ A;  3CWG A;  1BOD A;  1UHI A;  1UHJ A;  2HET A;  2L4H A;  3SIA A;  2I94 A;  2KQY A;  4HSZ A;  2JU0 A;  4AQI A;  2V53 A;  2KI4 B;  3DF0 A;  2I18 A;  1AVS A;  1TUJ A;  2H2K A;  4NQG A;  1OOF A;  1LXF C;  1XFX O;  1EL4 A;  1H8B A;  2JNX A;  4F7F A;  2KAY A;  1JFJ A;  4MLW A;  1YUT A;  4YGA A;  3VRO A;  3PFV A;  5HKW A;  2HQW A;  2ZFD A;  5BPJ A;  1NCY A;  3TUY C;  2LMU A;  1M63 B;  3B87 A;  2PMY A;  1AK8 A;  1QLK A;  1C7V A;  3S0B A;  1JSA A;  3SG3 A;  2BCA A;  2QAC A;  1W7I B;  2JRF A;  5G08 A;  4DRW A;  3O4Y A;  1U5I A;  4MZL A;  1UHK A;  2ZNE A;  2COL B;  1TTX A;  2LHL A;  1CLL A;  4ETO A;  1KQM B;  3BUX B;  5KTY A;  2LLS A;  2H61 C;  3TS5 C;  1J1E A;  1QWV A;  1JF2 A;  1ZFS A;  1N2D A;  4XYN A;  1S5G Y;  1MXE A;  3I5F B;  2F2P A;  4CLN A;  2K7C A;  1UUR A;  2JT0 A;  2L2C A;  3NSI A;  1K9U A;  2Y1N A;  2M8U A;  4N5X A;  3OB2 B;  2K7D A;  3B86 A;  1LS8 A;  1XFR A;  1MF8 B;  3CR4 X;  3FE6 A;  2KPH A;  1XA5 A;  2ZN9 A;  2LUX A;  1QV1 A;  4TNC A;  2SAS A;  2BNX A;  1KFX L;  1RTP 1;  3V2L A;  2O5G A;  2WC5 A;  2OS8 C;  3FE9 A;  3CZ2 A;  1B9A A;  2PRU A;  1DGU A;  2JZI A;  2ZRT A;  3JTD B;  4PHK A;  3S0G A;  1W9Z A;  2GGM A;  3OHM B;  1QAS A;  4I5K A;  1CMG A;  3PSR A;  2HQ8 A;  1Y1U A;  1OOI X;  2LC5 A;  1B7T Z;  3DY9 A;  2KDH A;  1TCF A;  1TNX A;  4YGC B;  2LLU A;  1KCY A;  4MZK A;  3PM2 A;  4WQ2 A;  4PT1 A;  1YVL A;  4PAL A;  3NXA A;  3ICB A;  1DMO A;  5DKQ A;  2OTG B;  3S0A A;  3WHU B;  1J1D A;  3FIA A;  1C3Y A;  1SCM B;  3KO0 A;  3NHT A;  1OZO A;  2H8V A;  4QJ4 B;  3E3R A;  2SCP A;  3BFB A;  4MN0 A;  2BEC A;  4P5O E;  1CLM A;  3DVK A;  3VB1 A;  3TDI A;  1AP4 A;  3RZS A;  4GNK B;  1M46 A;  1QVI Y;  2KYF A;  1XFZ O;  3AKA A;  1LVC D;  3EK7 A;  4DIR A;  2KLE A;  2AUC A;  3I5H C;  3UNW A;  1OE9 B;  1HQV A;  2L4I A;  1K93 D;  5ER4 X;  1MQ1 A;  1IRJ A;  2K2A A;  2Y1M A;  1SL8 A;  1W7J B;  2PQL A;  3H4S E;  4MZJ A;  3BFA A;  4NDB A;  2K2F A;  2YGU A;  1CDM A;  3SG4 A;  1SK6 D;  3BUO B;  5I2L A;  3I5I C;  2JQ6 A;  1BJF A;  1NPQ A;  4KYN A;  1DJW A;  1PUL A;  1PAL A;  4OR9 B;  3SG5 A;  2Q91 A;  1IQ3 A;  1CM1 A;  2LVI A;  1S3P A;  1YRU B;  5DKN A;  1X02 A;  1XFU O;  1FF1 A;  5FI7 A;  1Y6W A;  1SYM A;  1SL7 A;  4YGD B;  1F8H A;  5HL1 A;  3BOW B;  1AJ4 A;  4DUQ A;  2M49 B;  3SIB A;  4YBH B;  3PAT A;  5FI6 A;  1K2H A;  1DGV A;  1LA3 A;  5HYD A;  1TWO A;  5J3X A;  4AOM A;  1MR8 A;  1MUX A;  2K60 A;  4E68 A;  1EG4 A;  1CB1 A;  1JWD A;  2AMI A;  5I94 A;  4WRI A;  1ALW A;  3LCP C;  2M0R A;  1NWD A;  2ZRS A;  4OV2 A;  4OKH A;  3A8R A;  2BBN A;  3VRN A;  2MBX A;  2Y5I A;  1JC2 A;  1FW4 A;  1KFU L;  1BU3 A;  1BR4 B;  1RJV A;  1R2U A;  1YX8 A;  2WCK A;  4ORB B;  1U5I B;  2F3Z A;  1S6C A;  2F3Y A;  4MRY A;  3SJS A;  4OZD A;  1FI6 A;  1G33 A;  3BXK A;  3NSK A;  3BUW B;  2JT8 A;  2MRD A;  3SG2 A;  1CDN A;  1SMG A;  3IQO A;  1QX5 B;  3BFH A;  1FPW A;  1BMO A;  5DKR A;  4Q04 A;  3AKB A;  1DJH A;  2ZND A;  1DT7 B;  1WRK A;  2M3W A;  1FI5 A;  5JJG A;  1UWO A;  4OVN F;  5AAN A;  3HCM A;  4JPZ B;  1A4P A;  1S6I A;  3D78 A;  2LVV A;  1IH0 A;  1UHN A;  2M1U A;  2KFH A;  3LK0 A;  3OB1 B;  2EC6 B;  1K94 A;  3BOW A;  4I5J A;  4YI9 A;  3C1V A;  1G8I A;  1K9P A;  1S26 D;  1TNQ A;  2BKH B;  2QEV A;  3DVE A;  3KEV A;  2KNE A;  5AXI A;  3BQ3 A;  1R6P A;  1NP8 A;  3TS5 B;  4JQ0 D;  2JWW A;  2LP2 A;  2KI6 C;  5FI2 A;  2KGB C;  2L98 A;  3PN7 C;  2WOR A;  2LMT A;  3S0F A;  3CGA A;  2G9B A;  2VRG A;  3SS4 A;  3MSE B;  3CZT X;  3CR2 A;  3BJH A;  1S5G Z;  5IBW A;  1HT9 A;  1SKT A;  2IS9 A;  1JFK A;  1WDC C;  1GGW A;  3R72 A;  4GFT A;  2OS8 B;  4PDZ A;  1QV0 A;  3L4L A;  3D0Y B;  1TUZ A;  1DF0 B;  1M31 A;  3IVT A;  1KSO A;  3CAB A;  1SY9 A;  3D10 A;  2QEH A;  3DXL A;  1L7Z A;  4PE7 A;  5B8I B;  2D8N A;  2NLN A;  3TDZ A;  1CKK A;  2KOT A;  1C3Z A;  4JWQ A;  3RLZ A;  4QJ5 B;  1LA0 A;  1TRF A;  1KWO C;  1CDP A;  1TNP A;  2PYQ A;  1JF0 A;  2O60 A;  2P71 A;  1K90 D;  1OSA A;  3AAJ A;  4DS7 A;  4FQO A;  3AAK A; 
#chains in the Genus database with same CATH homology
 3K1E A;  3BFB A;  2QDI A;  2WCL A;  3VB1 A;  3FE8 A;  3D75 A;  3RZS A;  4FQT A;  3CZ1 A;  2WCH A;  1ORG A;  2PQL A;  3BFA A;  1OOG A;  1GM0 A;  2QEO A;  4INX A;  3DZT A;  4JD9 A;  2WCM A;  5DIC A;  2QEB A;  2GTE A;  1TWO A;  3D74 A;  3S0D A;  3NGV A;  2FJY A;  3D76 A;  3R1O A;  1TUJ A;  4INW A;  1OOF A;  2WC6 A;  3NHI A;  2WCK A;  3B6X A;  4F7F A;  3D73 A;  3B88 A;  4OZD A;  3R1P A;  3B87 A;  1OOH A;  3BFH A;  3S0B A;  3D77 A;  3CDN A;  3L47 A;  3R1V A;  3B7A A;  3D78 A;  5EL2 A;  1DQE A;  1P28 A;  1QWV A;  3N7H A;  2ERB A;  2QEV A;  2L2C A;  3DYE A;  3B86 A;  3PJI A;  1LS8 A;  1XFR A;  3FE6 A;  1OW4 A;  3S0F A;  2KPH A;  3Q8I A;  3V2L A;  2WC5 A;  3BJH A;  3FE9 A;  3CZ2 A;  3CYZ A;  3L4A A;  3S0G A;  3OGN A;  3R72 A;  3S0E A;  3L4L A;  3QME A;  2JPO A;  1T14 A;  2WCJ A;  3CAB A;  1OOI X;  3DXL A;  2QEH A;  3DY9 A;  1C3Z A;  2P70 A;  3CZ0 A;  4PT1 A;  2P71 A;  3S0A A;  1C3Y A;  3NHT A;  2H8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...