3CZ1A

Dimeric crystal structure of a pheromone binding protein from apis mellifera in complex with the n-butyl benzene sulfonamide at ph 7.0
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
total genus 35
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cz1A00
4PT1A 2P71A 3NHTA 3D76A 1C3ZA 3BFBA 1XFRA 2WC5A 1OOFA 2QEOA 3DYEA 2P70A 3R72A 3FE8A 1OOHA 3S0DA 3D75A 1OOIX 1TWOA 1DQEA 1LS8A 2WCLA 3VB1A 3DY9A 3K1EA 3DZTA 1OOGA 3Q8IA 3S0AA 1TUJA 2JPOA 2WCKA 4FQTA 3CZ1A 2QDIA 1ORGA 3CABA 2ERBA 4JD9A 2H8VA 3N7HA 3CYZA 3NHIA 3D77A 2QEHA 3CDNA 2WC6A 3QMEA 3S0FA 3FE9A 3D74A 2WCHA 3L47A 3L4AA 3BFHA 3D73A 3DXLA 1C3YA 4F7FA 2PQLA 3B88A 3NGVA 3PJIA 3R1PA 2QEVA 3CZ2A 2WCMA 2GTEA 3BFAA 3FE6A 1GM0A 3B87A 2L2CA 1T14A 3S0EA 2FJYA 3S0BA 2KPHA 3CZ0A 4INWA 3B6XA 3V2LA 3RZSA 3R1VA 3BJHA 1P28A 5DICA 3D78A 3B7AA 3R1OA 4INXA 2QEBA 1OW4A 5EL2A 3S0GA 3B86A 3L4LA 2WCJA 3OGNA 1QWVA 4OZDA
chains in the Genus database with same CATH superfamily
5AANA 2LC5A 1Z4HA 1AVSA 3LLEA 3DVMA 1A2XA 1S26D 1MQ1A 3ZNIA 4MRXA 2H2KA 3DVEA 4PE7A 3SG4A 4GGNA 1DC1A 4YGEB 3PN7C 4GGFC 1C3ZA 2QPTA 1GGZA 3NSIA 2H61A 4GNKB 1XFRA 4GBAA 4E68A 4NQGA 1XK4C 1M45A 1DTLA 2LMUA 1TRFA 4M2OA 4PHKA 1B8LA 3KPXA 3CLNA 2KI6D 3SIAA 3O4XA 1QLKA 4YGAA 1AHRA 3OX6A 3FE8A 1RJVA 1YX7A 4ORCB 1S1EA 3SIBA 1BLQA 1IQ5A 1R6PA 3VB1A 1S5GZ 1YUTA 3EK4A 3EVRA 1CMGA 4DCKA 1AJ4A 3DY9A 4I5NB 4PALA 1CFPA 4BY4A 1YUUA 2L50A 4YGDB 2JPOA 3AAJA 1JWDA 1L7ZA 1V1FA 4MEWA 2FJUB 1ORGA 4PHMA 1SBJA 3FWCA 1ZACA 1EG3A 2Q4UA 3IQOA 1Y1AA 1SK6D 2WC8A 1PSRA 1R2UA 3OB2B 4JD9A 5FI6A 1IQ3A 2WCEA 1C07A 1CFDA 3AKBA 1QASA 2DOQA 1NX1A 3MSEB 4MZLA 3OHMB 1C7VA 2NCPA 1SNLA 1DJYA 4TNCA 2I7AA 1JUOA 2LVJA 2KOTA 5B8IB 1L2OC 4NDDA 3BUXB 1Q80A 1S3PA 2K7CA 3CDNA 3PATA 3EK8A 1MHOA 4I5LB 2KHNA 3OBVA 2CNPA 3FWBA 1CLMA 3SG6A 3NSOA 2TN4A 3I5GC 1DEKA 3O6BA 4GPLB 3OX5A 3D73A 2LMVA 4YI9A 1ALWA 1MXLC 1U5IB 1Y1UA 1YUSA 5KU1A 3D0YB 1UURA 3R1PA 2QEVA 3CZ2A 2KFGA 2JULA 2G2BA 2BKIB 1EJ3A 1RECA 2BE4A 2JTZA 3LL8B 3OP0A 4DRWA 1FPWA 1LINA 2FCDA 3BOWA 3O78A 3TUYB 1SCMB 4N5XA 3BFAA 4C0KA 1Y1XA 4MZKA 2O60A 1OMVA 3FE6A 1K96A 1XFWO 1KK7Z 2FCEA 2JC2A 1UHNA 2KBIA 1XFUO 4JQ0D 4PE4A 1B1GA 1NYAA 2KLEA 1MWNA 2KAXA 2KI6C 4INWA 1PVAA 1SCVA 1CMFA 3BUNB 3V2LA 3RZSA 4GAOA 1KSMA 1K9PA 2QACA 4P5OE 1XO5A 4OV2A 1DJZA 4MLWA 1TNPA 1P28A 1W9ZA 3E3RA 1VRKA 5AEQA 4UPGA 1CDNA 1JC2A 1WRKA 5HKZA 2A4JA 2D8NA 1A4PA 4INXA 5EL2A 3K21A 1IIOA 1K9UA 5HKWA 3KEVA 3TS5B 1XA5A 1UHHA 3B86A 2G9BA 2M8UA 4YI8A 3TDUA 1LXFC 1JF0A 3EVUA 3I5HB 3EKHA 1SYMA 2OS8C 1IJ6A 1KCYA 2WCJA 2BCAA 3LCPC 1M63B 2NZ0A 3LK1A 3OGNA 4OZDA 5AERA 3TDZA 4JPZB 3JVTB 3CTNA 1ZMZA 1XFZO 5FYXA 4OR9B 4PT1A 4U8DA 3BFBA 1QJTA 3TDIA 2OTGB 2K8MB 1OOFA 1AJ5A 2KLDA 2WCBA 4QJ3B 1BG1A 5CSFA 1BR1B 1Y6WA 2K61A 1WDCB 3WNXB 2M7NA 2QEOA 2FOTA 1DVIA 1EG4A 2L0PA 3BOWB 1TNQA 1PVBA 1S6IA 1UHKA 2CCMA 2ZN9A 2KYCA 1OOIX 1XFYO 4C0LA 1KFUS 3NSKA 1LS8A 2GGMA 1NWDA 3K1EA 5CPVA 1MUXA 3DZTA 3VGOA 1WRLA 5AFPA 2BAPA 1PRWA 1OOGA 1KSOA 3Q8IA 1TUJA 1W7JB 3JTDC 2Y1NA 1J7QA 2QDIA 2PRUA 4YGBB 1SKTA 2F3YA 2ERBA 3PFVA 2M1UA 1QX2A 1OQPA 2Q91A 2I94A 2H8VA 1QX5B 2HQ8A 2WOSA 1CNPA 3CYZA 1OOJA 4MN0A 2KI4B 1H4BA 2MHHA 2EC6B 4PE1A 5I2LA 1OSAA 2LNKA 1W7IB 1PALA 1NPQA 2AUCA 2LCPA 2M29A 2F8PA 5K89A 3NHIA 4A4CA 4JWQA 1J1EA 1G8IA 2O5GA 4M2PA 2COLB 1C7WA 1XFVO 1WLZA 3S0FA 2JT0A 2MJWB 3D74A 2WCHA 4YGCB 1NX3A 3IF7A 1OZOA 3L47A 2K7DA 5JOLA 1K2HA 1J55A 2JTTA 2ZNEA 1S5GY 1XVJA 2LM5A 1JF2A 3SG2A 1DJIA 3VRRA 2JRFA 3BUMB 1UUSA 3I5HC 1KWOB 1F8HA 3CR4X 3NSLA 4GGFA 1KQMB 3DVKA 5FI2A 5F6TA 1CDPA 1XFXO 1OMRA 2LMTA 2L5XB 1F71A 2KYFA 1QX7A 2NXQA 3B87A 2KQ6A 1A75A 1DF0B 2L4HA 2M9GA 3I5IB 1IG5A 1JBAA 2OPOA 4IL1A 2PMYA 2K2FA 1J7OA 1Y0VH 3SG3A 1YTZC 1DGUA 3I5FB 1S36A 2ISDA 1KQVA 1IWQA 1SSEB 4FQOA 2KAVA 2ZN8A 2LLSA 1TOPA 1K9KA 1K90D 5DICA 1CFCA 3D78A 3PM8A 1QLSA 1X02A 4GUKA 1FI5A 1YVLA 5HLVA 1BOCA 3KO0A 3VRNA 1OW4A 4PDZA 2E6WA 2M49B 2KFHA 3CS1A 1DJHA 1PULA 2L4IA 3TUYC 4BY5A 5GQQC 5PALA 1N0YA 5CSNA 2SCPA 1MXEA 2PYQA 2F33A 3CR2A 1EXRA 3SG5A 4CPVA 1KK7Y 2JXCA 1CM1A 5D7FA 3SS4A 5I8NA 5BPJA 2B1UA 1QWVA 3A8RA 1B7TZ 1GJYA 1WLMA 5ER5A 2KI4C 2LVIA 2EC6C 4CIDA 3FS7A 1KK8B 1FW4A 2P71A 3CGAA 1IH0A 4GFTA 1SPYA 3H4SE 1V1GA 3NXAA 3FIAA 2WC5A 5DKQA 1B8CA 1IJ5A 4YBHB 3DVJA 2Y4QA 2KBMA 3O2PA 3EVVA 3GK4X 3DD4A 1UWOA 1KFUL 1J7RA 3O4YA 3PN7B 4MSPA 1HQVA 2BL0B 4OCIA 3SS5A 1F4QA 1NCYA 1SW8A 2ZKMX 1YRTB 2JPTA 1CM4A 3R72A 1B4CA 2L5YA 1CKKA 1OOHA 3M0WA 3S0DA 3D75A 4CFQA 3UO9A 1IRJA 1N65A 1A75B 1E8AA 3TZ1A 5G08A 1TUZA 4ORAB 4FQTA 2BCBA 2MLFC 3CZ1A 1WRZA 4DS7A 1YR5A 1NCXA 2LHLA 1CB1A 2HF5A 4HRGA 1ZFSA 2HPSA 3N7HA 2LP3A 2KDHA 5CSIA 2LVVA 4QJ4B 3BQ3A 4PHNA 3C1VA 1NX2A 2LLTA 2KFFA 1BJFA 4HSZA 3VRQA 3D10A 2WNDA 4P2YB 1DF0A 5J3XA 1D1OA 2M3WA 1EL4A 5DKRA 2SASA 5I2QA 1JFKA 2WC6A 2E30A 1QIWA 2M7LA 2CT9A 1QV0A 4QJ5B 2EGDA 3L4AA 4Q04A 1TN4A 4MRYA 1B9AA 2MRDA 2JXLA 3DXLA 3EK7A 3BXKA 4WQ2A 2H61C 1SCMC 2KGRA 2PQLA 4F7FA 1C3YA 1KFXL 3GK1A 4C0JA 1S6CA 1LA0A 2K2AA 3I5GB 1DMOA 3KF9A 3AAKA 1WY9A 2HQWA 3OB1B 2K0JA 2JZIA 3ZWHA 2ZRSA 1BODA 4DIRA 3VROA 1BMOA 2JQ6A 3DF0A 2BBNA 2JWWA 1QVIZ 1F55A 2KGBC 1K94A 1YX8A 1KK8C 1T14A 2FJYA 4ZCUA 4KYNA 1JSAA 1BU3A 3CZ0A 5FI7A 1J1DA 4DUQA 3BYAA 3PLFB 3B6XA 1M46A 1XYDA 1QATA 2LLUA 3CZTX 5DKNA 4L9MA 4ORBB 3BJHA 1LKJA 1RROA 4XYNA 1CTRA 2BL0C 2F3ZA 3TS5C 3WHTB 5AXIA 2M0RA 3VRPA 1A29A 2KNEA 2Y1MA 3UNWA 3EG5B 3R1OA 1KFXS 3AKAA 1XK4A 2F2PA 1UP5A 4F0ZB 5ER4X 1N2DA 2BCXA 3JVTC 2LAPA 1BT6A 1K95A 2LUCA 4A4BA 2PALA 3EKJA 1JFJA 1CLLA 2PASA 3L4LA 3QRXA 5D69A 4MBEA 1SY9A 2LHIA 1CFFA 1J7PA 1OMDA 5JJGA 3CWGA 3DYEA 1LVCD 4N1FA 2OTGC 1TIZA 3PM2A 1DELA 2ZRTA 1WDCC 2OS8B 3NHTA 1SRAA 2AAOA 3D76A 1PK0D 1M39A 2ZNDA 4ETOA 2V53A 4NDBA 1AP4A 4M2QA 1TTXA 2KSPA 1DT7B 2L2EA 3IQQA 1F4OA 5IBWA 1MF8B 1CLBA 1RWYA 2P70A 3IVTA 2K60A 4WRIA 1ODBA 1F70A 1A03A 5I94A 1NSHA 3DF0B 2PVBA 2MA2A 1B47A 1TNXA 2BNXA 2KAYA 1TWOA 4I5KA 1DQEA 1FBVA 2WCLA 2WCFA 1OZSA 3HCMA 3KHEA 4HRHA 2JNXA 2I18A 2L98A 1S6JA 3S0AA 2M1KB 1K8UA 2P6BB 2WCKA 3RLZA 3GOFA 4PCWA 1CDMA 2BKHB 1B7TY 1AUIB 2JOJA 2K7OA 3CABA 2AMIA 2CXJA 4OKHA 1ALVA 1SR6B 3SJSA 3F45A 2CBLA 5KTYA 1Z2CB 1QS7A 4XJKA 2RGIA 2R2IA 2I2RE 3JTDB 1NP8A 1RTP1 4JKTA 1TNWA 4PE0A 1IKUA 4FTGA 2LUXA 1CDLA 3BUOB 3SG7A 5HYDA 1QTXA 4AQJA 4WQ3A 1B8RA 1BR4B 3A4UB 1F54A 2JU0A 1NIWA 2K7BA 2YGUA 3D77A 2QEHA 3HX4A 2MAZA 3QMEA 2KQYA 1OE9B 1QXPA 4CLNA 2CTNA 2LV7A 3FE9A 1DJGA 1GQMA 2GGZA 2JT3A 5TNCA 1KWOC 1LA3A 2M97A 3BFHA 1DJWA 5HLOA 1KQMC 2LE9B 3B88A 4ICBA 5D3OA 3NGVA 3PJIA 4AQIA 3RM1A 2WORA 1BF5A 2WCMA 4NDCA 3WXAA 1RFJA 1SL7A 2VRGA 4N1GA 4USLA 1QV1A 2IS9A 1GGWA 3BUWB 4IJ7A 1IGVA 2LVKA 3I5IC 3ICBA 1FI6A 1ZOTB 1AK8A 2GTEA 2Y5IA 2L51A 3PALA 2GV5A 1TCOB 1NCZA 5CSJA 4I5JA 4D1EA 1PSBA 1TCFA 4MVFA 2PSRA 3I5FC 1GM0A 5I2OA 1NUBA 2L2CA 1K93D 2LP2A 3S0EA 1UHJA 2KPHA 1HT9A 3S0BA 3GK2A 5HKYA 1FF1A 2MBXA 2NLNA 3PSRA 1YRUB 1M31A 2NCOA 4ZCVA 1EH2A 4MZJA 1L2OB 4CFRA 4AOMA 2BBMA 1NX0A 4R1EA 3SS3A 3R1VA 1H8BA 1DJXA 5KSZA 1G4YR 3WHUB 2JT8A 2BE6A 1SL8A 2F2OA 1ZUZA 2EHBA 2HETA 1QIVA 2BECA 3B7AA 1MR8A 2QEBA 4YRUA 1UHIA 3S0GA 5HL1A 4OVNF 2JNFA 4XJKB 4HREE 1SL9A 1G33A 1DGVA 1RK9A 3LK0A 3CR5X 1SMGA 1QVIY 1YVHA 2LANA 4PHJA 1U5IA 2MLEC 1SR6C 1YURA 3D0YA 2ZFDA
chains in the Genus database with same CATH topology
4PT1A 2P71A 3NHTA 3D76A 1C3ZA 3BFBA 1XFRA 2WC5A 1OOFA 2QEOA 3DYEA 2P70A 3R72A 3FE8A 1OOHA 3S0DA 3D75A 1OOIX 1TWOA 1DQEA 1LS8A 2WCLA 3VB1A 3DY9A 3K1EA 3DZTA 1OOGA 3Q8IA 3S0AA 1TUJA 2JPOA 2WCKA 4FQTA 3CZ1A 2QDIA 1ORGA 3CABA 2ERBA 4JD9A 2H8VA 3N7HA 3CYZA 3NHIA 3D77A 2QEHA 3CDNA 2WC6A 3QMEA 3S0FA 3FE9A 3D74A 2WCHA 3L47A 3L4AA 3BFHA 3D73A 3DXLA 1C3YA 4F7FA 2PQLA 3B88A 3NGVA 3PJIA 3R1PA 2QEVA 3CZ2A 2WCMA 2GTEA 3BFAA 3FE6A 1GM0A 3B87A 2L2CA 1T14A 3S0EA 2FJYA 3S0BA 2KPHA 3CZ0A 4INWA 3B6XA 3V2LA 3RZSA 3R1VA 3BJHA 1P28A 5DICA 3D78A 3B7AA 3R1OA 4INXA 2QEBA 1OW4A 5EL2A 3S0GA 3B86A 3L4LA 2WCJA 3OGNA 1QWVA 4OZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PT1 A;  2P71 A;  3NHT A;  3D76 A;  1C3Z A;  3BFB A;  1XFR A;  2WC5 A;  1OOF A;  2QEO A;  3DYE A;  2P70 A;  3R72 A;  3FE8 A;  1OOH A;  3S0D A;  3D75 A;  1OOI X;  1TWO A;  1DQE A;  1LS8 A;  2WCL A;  3VB1 A;  3DY9 A;  3K1E A;  3DZT A;  1OOG A;  3Q8I A;  3S0A A;  1TUJ A;  2JPO A;  2WCK A;  4FQT A;  3CZ1 A;  2QDI A;  1ORG A;  3CAB A;  2ERB A;  4JD9 A;  2H8V A;  3N7H A;  3CYZ A;  3NHI A;  3D77 A;  2QEH A;  3CDN A;  2WC6 A;  3QME A;  3S0F A;  3FE9 A;  3D74 A;  2WCH A;  3L47 A;  3L4A A;  3BFH A;  3D73 A;  3DXL A;  1C3Y A;  4F7F A;  2PQL A;  3B88 A;  3NGV A;  3PJI A;  3R1P A;  2QEV A;  3CZ2 A;  2WCM A;  2GTE A;  3BFA A;  3FE6 A;  1GM0 A;  3B87 A;  2L2C A;  1T14 A;  3S0E A;  2FJY A;  3S0B A;  2KPH A;  3CZ0 A;  4INW A;  3B6X A;  3V2L A;  3RZS A;  3R1V A;  3BJH A;  1P28 A;  5DIC A;  3D78 A;  3B7A A;  3R1O A;  4INX A;  2QEB A;  1OW4 A;  5EL2 A;  3S0G A;  3B86 A;  3L4L A;  2WCJ A;  3OGN A;  1QWV A;  4OZD A; 
#chains in the Genus database with same CATH topology
 5AAN A;  2LC5 A;  1Z4H A;  1AVS A;  3LLE A;  3DVM A;  1A2X A;  1S26 D;  1MQ1 A;  3ZNI A;  4MRX A;  2H2K A;  3DVE A;  4PE7 A;  3SG4 A;  4GGN A;  1DC1 A;  4YGE B;  3PN7 C;  4GGF C;  1C3Z A;  2QPT A;  1GGZ A;  3NSI A;  2H61 A;  4GNK B;  1XFR A;  4GBA A;  4E68 A;  4NQG A;  1XK4 C;  1M45 A;  1DTL A;  2LMU A;  1TRF A;  4M2O A;  4PHK A;  1B8L A;  3KPX A;  3CLN A;  2KI6 D;  3SIA A;  3O4X A;  1QLK A;  4YGA A;  1AHR A;  3OX6 A;  3FE8 A;  1RJV A;  1YX7 A;  4ORC B;  1S1E A;  3SIB A;  1BLQ A;  1IQ5 A;  1R6P A;  3VB1 A;  1S5G Z;  1YUT A;  3EK4 A;  3EVR A;  1CMG A;  4DCK A;  1AJ4 A;  3DY9 A;  4I5N B;  4PAL A;  1CFP A;  4BY4 A;  1YUU A;  2L50 A;  4YGD B;  2JPO A;  3AAJ A;  1JWD A;  1L7Z A;  1V1F A;  4MEW A;  2FJU B;  1ORG A;  4PHM A;  1SBJ A;  3FWC A;  1ZAC A;  1EG3 A;  2Q4U A;  3IQO A;  1Y1A A;  1SK6 D;  2WC8 A;  1PSR A;  1R2U A;  3OB2 B;  4JD9 A;  5FI6 A;  1IQ3 A;  2WCE A;  1C07 A;  1CFD A;  3AKB A;  1QAS A;  2DOQ A;  1NX1 A;  3MSE B;  4MZL A;  3OHM B;  1C7V A;  2NCP A;  1SNL A;  1DJY A;  4TNC A;  2I7A A;  1JUO A;  2LVJ A;  2KOT A;  5B8I B;  1L2O C;  4NDD A;  3BUX B;  1Q80 A;  1S3P A;  2K7C A;  3CDN A;  3PAT A;  3EK8 A;  1MHO A;  4I5L B;  2KHN A;  3OBV A;  2CNP A;  3FWB A;  1CLM A;  3SG6 A;  3NSO A;  2TN4 A;  3I5G C;  1DEK A;  3O6B A;  4GPL B;  3OX5 A;  3D73 A;  2LMV A;  4YI9 A;  1ALW A;  1MXL C;  1U5I B;  1Y1U A;  1YUS A;  5KU1 A;  3D0Y B;  1UUR A;  3R1P A;  2QEV A;  3CZ2 A;  2KFG A;  2JUL A;  2G2B A;  2BKI B;  1EJ3 A;  1REC A;  2BE4 A;  2JTZ A;  3LL8 B;  3OP0 A;  4DRW A;  1FPW A;  1LIN A;  2FCD A;  3BOW A;  3O78 A;  3TUY B;  1SCM B;  4N5X A;  3BFA A;  4C0K A;  1Y1X A;  4MZK A;  2O60 A;  1OMV A;  3FE6 A;  1K96 A;  1XFW O;  1KK7 Z;  2FCE A;  2JC2 A;  1UHN A;  2KBI A;  1XFU O;  4JQ0 D;  4PE4 A;  1B1G A;  1NYA A;  2KLE A;  1MWN A;  2KAX A;  2KI6 C;  4INW A;  1PVA A;  1SCV A;  1CMF A;  3BUN B;  3V2L A;  3RZS A;  4GAO A;  1KSM A;  1K9P A;  2QAC A;  4P5O E;  1XO5 A;  4OV2 A;  1DJZ A;  4MLW A;  1TNP A;  1P28 A;  1W9Z A;  3E3R A;  1VRK A;  5AEQ A;  4UPG A;  1CDN A;  1JC2 A;  1WRK A;  5HKZ A;  2A4J A;  2D8N A;  1A4P A;  4INX A;  5EL2 A;  3K21 A;  1IIO A;  1K9U A;  5HKW A;  3KEV A;  3TS5 B;  1XA5 A;  1UHH A;  3B86 A;  2G9B A;  2M8U A;  4YI8 A;  3TDU A;  1LXF C;  1JF0 A;  3EVU A;  3I5H B;  3EKH A;  1SYM A;  2OS8 C;  1IJ6 A;  1KCY A;  2WCJ A;  2BCA A;  3LCP C;  1M63 B;  2NZ0 A;  3LK1 A;  3OGN A;  4OZD A;  5AER A;  3TDZ A;  4JPZ B;  3JVT B;  3CTN A;  1ZMZ A;  1XFZ O;  5FYX A;  4OR9 B;  4PT1 A;  4U8D A;  3BFB A;  1QJT A;  3TDI A;  2OTG B;  2K8M B;  1OOF A;  1AJ5 A;  2KLD A;  2WCB A;  4QJ3 B;  1BG1 A;  5CSF A;  1BR1 B;  1Y6W A;  2K61 A;  1WDC B;  3WNX B;  2M7N A;  2QEO A;  2FOT A;  1DVI A;  1EG4 A;  2L0P A;  3BOW B;  1TNQ A;  1PVB A;  1S6I A;  1UHK A;  2CCM A;  2ZN9 A;  2KYC A;  1OOI X;  1XFY O;  4C0L A;  1KFU S;  3NSK A;  1LS8 A;  2GGM A;  1NWD A;  3K1E A;  5CPV A;  1MUX A;  3DZT A;  3VGO A;  1WRL A;  5AFP A;  2BAP A;  1PRW A;  1OOG A;  1KSO A;  3Q8I A;  1TUJ A;  1W7J B;  3JTD C;  2Y1N A;  1J7Q A;  2QDI A;  2PRU A;  4YGB B;  1SKT A;  2F3Y A;  2ERB A;  3PFV A;  2M1U A;  1QX2 A;  1OQP A;  2Q91 A;  2I94 A;  2H8V A;  1QX5 B;  2HQ8 A;  2WOS A;  1CNP A;  3CYZ A;  1OOJ A;  4MN0 A;  2KI4 B;  1H4B A;  2MHH A;  2EC6 B;  4PE1 A;  5I2L A;  1OSA A;  2LNK A;  1W7I B;  1PAL A;  1NPQ A;  2AUC A;  2LCP A;  2M29 A;  2F8P A;  5K89 A;  3NHI A;  4A4C A;  4JWQ A;  1J1E A;  1G8I A;  2O5G A;  4M2P A;  2COL B;  1C7W A;  1XFV O;  1WLZ A;  3S0F A;  2JT0 A;  2MJW B;  3D74 A;  2WCH A;  4YGC B;  1NX3 A;  3IF7 A;  1OZO A;  3L47 A;  2K7D A;  5JOL A;  1K2H A;  1J55 A;  2JTT A;  2ZNE A;  1S5G Y;  1XVJ A;  2LM5 A;  1JF2 A;  3SG2 A;  1DJI A;  3VRR A;  2JRF A;  3BUM B;  1UUS A;  3I5H C;  1KWO B;  1F8H A;  3CR4 X;  3NSL A;  4GGF A;  1KQM B;  3DVK A;  5FI2 A;  5F6T A;  1CDP A;  1XFX O;  1OMR A;  2LMT A;  2L5X B;  1F71 A;  2KYF A;  1QX7 A;  2NXQ A;  3B87 A;  2KQ6 A;  1A75 A;  1DF0 B;  2L4H A;  2M9G A;  3I5I B;  1IG5 A;  1JBA A;  2OPO A;  4IL1 A;  2PMY A;  2K2F A;  1J7O A;  1Y0V H;  3SG3 A;  1YTZ C;  1DGU A;  3I5F B;  1S36 A;  2ISD A;  1KQV A;  1IWQ A;  1SSE B;  4FQO A;  2KAV A;  2ZN8 A;  2LLS A;  1TOP A;  1K9K A;  1K90 D;  5DIC A;  1CFC A;  3D78 A;  3PM8 A;  1QLS A;  1X02 A;  4GUK A;  1FI5 A;  1YVL A;  5HLV A;  1BOC A;  3KO0 A;  3VRN A;  1OW4 A;  4PDZ A;  2E6W A;  2M49 B;  2KFH A;  3CS1 A;  1DJH A;  1PUL A;  2L4I A;  3TUY C;  4BY5 A;  5GQQ C;  5PAL A;  1N0Y A;  5CSN A;  2SCP A;  1MXE A;  2PYQ A;  2F33 A;  3CR2 A;  1EXR A;  3SG5 A;  4CPV A;  1KK7 Y;  2JXC A;  1CM1 A;  5D7F A;  3SS4 A;  5I8N A;  5BPJ A;  2B1U A;  1QWV A;  3A8R A;  1B7T Z;  1GJY A;  1WLM A;  5ER5 A;  2KI4 C;  2LVI A;  2EC6 C;  4CID A;  3FS7 A;  1KK8 B;  1FW4 A;  2P71 A;  3CGA A;  1IH0 A;  4GFT A;  1SPY A;  3H4S E;  1V1G A;  3NXA A;  3FIA A;  2WC5 A;  5DKQ A;  1B8C A;  1IJ5 A;  4YBH B;  3DVJ A;  2Y4Q A;  2KBM A;  3O2P A;  3EVV A;  3GK4 X;  3DD4 A;  1UWO A;  1KFU L;  1J7R A;  3O4Y A;  3PN7 B;  4MSP A;  1HQV A;  2BL0 B;  4OCI A;  3SS5 A;  1F4Q A;  1NCY A;  1SW8 A;  2ZKM X;  1YRT B;  2JPT A;  1CM4 A;  3R72 A;  1B4C A;  2L5Y A;  1CKK A;  1OOH A;  3M0W A;  3S0D A;  3D75 A;  4CFQ A;  3UO9 A;  1IRJ A;  1N65 A;  1A75 B;  1E8A A;  3TZ1 A;  5G08 A;  1TUZ A;  4ORA B;  4FQT A;  2BCB A;  2MLF C;  3CZ1 A;  1WRZ A;  4DS7 A;  1YR5 A;  1NCX A;  2LHL A;  1CB1 A;  2HF5 A;  4HRG A;  1ZFS A;  2HPS A;  3N7H A;  2LP3 A;  2KDH A;  5CSI A;  2LVV A;  4QJ4 B;  3BQ3 A;  4PHN A;  3C1V A;  1NX2 A;  2LLT A;  2KFF A;  1BJF A;  4HSZ A;  3VRQ A;  3D10 A;  2WND A;  4P2Y B;  1DF0 A;  5J3X A;  1D1O A;  2M3W A;  1EL4 A;  5DKR A;  2SAS A;  5I2Q A;  1JFK A;  2WC6 A;  2E30 A;  1QIW A;  2M7L A;  2CT9 A;  1QV0 A;  4QJ5 B;  2EGD A;  3L4A A;  4Q04 A;  1TN4 A;  4MRY A;  1B9A A;  2MRD A;  2JXL A;  3DXL A;  3EK7 A;  3BXK A;  4WQ2 A;  2H61 C;  1SCM C;  2KGR A;  2PQL A;  4F7F A;  1C3Y A;  1KFX L;  3GK1 A;  4C0J A;  1S6C A;  1LA0 A;  2K2A A;  3I5G B;  1DMO A;  3KF9 A;  3AAK A;  1WY9 A;  2HQW A;  3OB1 B;  2K0J A;  2JZI A;  3ZWH A;  2ZRS A;  1BOD A;  4DIR A;  3VRO A;  1BMO A;  2JQ6 A;  3DF0 A;  2BBN A;  2JWW A;  1QVI Z;  1F55 A;  2KGB C;  1K94 A;  1YX8 A;  1KK8 C;  1T14 A;  2FJY A;  4ZCU A;  4KYN A;  1JSA A;  1BU3 A;  3CZ0 A;  5FI7 A;  1J1D A;  4DUQ A;  3BYA A;  3PLF B;  3B6X A;  1M46 A;  1XYD A;  1QAT A;  2LLU A;  3CZT X;  5DKN A;  4L9M A;  4ORB B;  3BJH A;  1LKJ A;  1RRO A;  4XYN A;  1CTR A;  2BL0 C;  2F3Z A;  3TS5 C;  3WHT B;  5AXI A;  2M0R A;  3VRP A;  1A29 A;  2KNE A;  2Y1M A;  3UNW A;  3EG5 B;  3R1O A;  1KFX S;  3AKA A;  1XK4 A;  2F2P A;  1UP5 A;  4F0Z B;  5ER4 X;  1N2D A;  2BCX A;  3JVT C;  2LAP A;  1BT6 A;  1K95 A;  2LUC A;  4A4B A;  2PAL A;  3EKJ A;  1JFJ A;  1CLL A;  2PAS A;  3L4L A;  3QRX A;  5D69 A;  4MBE A;  1SY9 A;  2LHI A;  1CFF A;  1J7P A;  1OMD A;  5JJG A;  3CWG A;  3DYE A;  1LVC D;  4N1F A;  2OTG C;  1TIZ A;  3PM2 A;  1DEL A;  2ZRT A;  1WDC C;  2OS8 B;  3NHT A;  1SRA A;  2AAO A;  3D76 A;  1PK0 D;  1M39 A;  2ZND A;  4ETO A;  2V53 A;  4NDB A;  1AP4 A;  4M2Q A;  1TTX A;  2KSP A;  1DT7 B;  2L2E A;  3IQQ A;  1F4O A;  5IBW A;  1MF8 B;  1CLB A;  1RWY A;  2P70 A;  3IVT A;  2K60 A;  4WRI A;  1ODB A;  1F70 A;  1A03 A;  5I94 A;  1NSH A;  3DF0 B;  2PVB A;  2MA2 A;  1B47 A;  1TNX A;  2BNX A;  2KAY A;  1TWO A;  4I5K A;  1DQE A;  1FBV A;  2WCL A;  2WCF A;  1OZS A;  3HCM A;  3KHE A;  4HRH A;  2JNX A;  2I18 A;  2L98 A;  1S6J A;  3S0A A;  2M1K B;  1K8U A;  2P6B B;  2WCK A;  3RLZ A;  3GOF A;  4PCW A;  1CDM A;  2BKH B;  1B7T Y;  1AUI B;  2JOJ A;  2K7O A;  3CAB A;  2AMI A;  2CXJ A;  4OKH A;  1ALV A;  1SR6 B;  3SJS A;  3F45 A;  2CBL A;  5KTY A;  1Z2C B;  1QS7 A;  4XJK A;  2RGI A;  2R2I A;  2I2R E;  3JTD B;  1NP8 A;  1RTP 1;  4JKT A;  1TNW A;  4PE0 A;  1IKU A;  4FTG A;  2LUX A;  1CDL A;  3BUO B;  3SG7 A;  5HYD A;  1QTX A;  4AQJ A;  4WQ3 A;  1B8R A;  1BR4 B;  3A4U B;  1F54 A;  2JU0 A;  1NIW A;  2K7B A;  2YGU A;  3D77 A;  2QEH A;  3HX4 A;  2MAZ A;  3QME A;  2KQY A;  1OE9 B;  1QXP A;  4CLN A;  2CTN A;  2LV7 A;  3FE9 A;  1DJG A;  1GQM A;  2GGZ A;  2JT3 A;  5TNC A;  1KWO C;  1LA3 A;  2M97 A;  3BFH A;  1DJW A;  5HLO A;  1KQM C;  2LE9 B;  3B88 A;  4ICB A;  5D3O A;  3NGV A;  3PJI A;  4AQI A;  3RM1 A;  2WOR A;  1BF5 A;  2WCM A;  4NDC A;  3WXA A;  1RFJ A;  1SL7 A;  2VRG A;  4N1G A;  4USL A;  1QV1 A;  2IS9 A;  1GGW A;  3BUW B;  4IJ7 A;  1IGV A;  2LVK A;  3I5I C;  3ICB A;  1FI6 A;  1ZOT B;  1AK8 A;  2GTE A;  2Y5I A;  2L51 A;  3PAL A;  2GV5 A;  1TCO B;  1NCZ A;  5CSJ A;  4I5J A;  4D1E A;  1PSB A;  1TCF A;  4MVF A;  2PSR A;  3I5F C;  1GM0 A;  5I2O A;  1NUB A;  2L2C A;  1K93 D;  2LP2 A;  3S0E A;  1UHJ A;  2KPH A;  1HT9 A;  3S0B A;  3GK2 A;  5HKY A;  1FF1 A;  2MBX A;  2NLN A;  3PSR A;  1YRU B;  1M31 A;  2NCO A;  4ZCV A;  1EH2 A;  4MZJ A;  1L2O B;  4CFR A;  4AOM A;  2BBM A;  1NX0 A;  4R1E A;  3SS3 A;  3R1V A;  1H8B A;  1DJX A;  5KSZ A;  1G4Y R;  3WHU B;  2JT8 A;  2BE6 A;  1SL8 A;  2F2O A;  1ZUZ A;  2EHB A;  2HET A;  1QIV A;  2BEC A;  3B7A A;  1MR8 A;  2QEB A;  4YRU A;  1UHI A;  3S0G A;  5HL1 A;  4OVN F;  2JNF A;  4XJK B;  4HRE E;  1SL9 A;  1G33 A;  1DGV A;  1RK9 A;  3LK0 A;  3CR5 X;  1SMG A;  1QVI Y;  1YVH A;  2LAN A;  4PHJ A;  1U5I A;  2MLE C;  1SR6 C;  1YUR A;  3D0Y A;  2ZFD A; 
#chains in the Genus database with same CATH homology
 4PT1 A;  2P71 A;  3NHT A;  3D76 A;  1C3Z A;  3BFB A;  1XFR A;  2WC5 A;  1OOF A;  2QEO A;  3DYE A;  2P70 A;  3R72 A;  3FE8 A;  1OOH A;  3S0D A;  3D75 A;  1OOI X;  1TWO A;  1DQE A;  1LS8 A;  2WCL A;  3VB1 A;  3DY9 A;  3K1E A;  3DZT A;  1OOG A;  3Q8I A;  3S0A A;  1TUJ A;  2JPO A;  2WCK A;  4FQT A;  3CZ1 A;  2QDI A;  1ORG A;  3CAB A;  2ERB A;  4JD9 A;  2H8V A;  3N7H A;  3CYZ A;  3NHI A;  3D77 A;  2QEH A;  3CDN A;  2WC6 A;  3QME A;  3S0F A;  3FE9 A;  3D74 A;  2WCH A;  3L47 A;  3L4A A;  3BFH A;  3D73 A;  3DXL A;  1C3Y A;  4F7F A;  2PQL A;  3B88 A;  3NGV A;  3PJI A;  3R1P A;  2QEV A;  3CZ2 A;  2WCM A;  2GTE A;  3BFA A;  3FE6 A;  1GM0 A;  3B87 A;  2L2C A;  1T14 A;  3S0E A;  2FJY A;  3S0B A;  2KPH A;  3CZ0 A;  4INW A;  3B6X A;  3V2L A;  3RZS A;  3R1V A;  3BJH A;  1P28 A;  5DIC A;  3D78 A;  3B7A A;  3R1O A;  4INX A;  2QEB A;  1OW4 A;  5EL2 A;  3S0G A;  3B86 A;  3L4L A;  2WCJ A;  3OGN A;  1QWV A;  4OZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...