3CZ1A

Dimeric crystal structure of a pheromone binding protein from apis mellifera in complex with the n-butyl benzene sulfonamide at ph 7.0
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
117
structure length
117
Chain Sequence
DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 35
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3cz1A00
4FQTA 2P70A 1XFRA 2WC6A 3L47A 2QEVA 3NHTA 1OOFA 3BJHA 3PJIA 3R72A 1QWVA 4INWA 1T14A 3R1OA 1C3YA 2WCMA 2H8VA 3K1EA 1OOHA 3FE8A 3S0EA 3D76A 3B87A 2QEOA 2PQLA 1TWOA 3BFAA 4OZDA 2FJYA 3S0GA 2WCKA 3DYEA 3D77A 3Q8IA 2WCHA 3D78A 3S0DA 3B6XA 3FE9A 4JD9A 1TUJA 3VB1A 2WCLA 3N7HA 1GM0A 2L2CA 2JPOA 2QDIA 3L4AA 1P28A 3CABA 3BFHA 1C3ZA 1LS8A 3D73A 2ERBA 3QMEA 3L4LA 3CDNA 3BFBA 3RZSA 3CZ1A 1OOIX 1OW4A 3CYZA 4INXA 2QEHA 1OOGA 3DZTA 3DXLA 3S0BA 5EL2A 3OGNA 3DY9A 1DQEA 3R1VA 3R1PA 3S0FA 2P71A 3CZ0A 4F7FA 1ORGA 2WCJA 3B86A 3D75A 2GTEA 3NGVA 5DICA 4PT1A 3CZ2A 3B88A 3NHIA 3S0AA 2KPHA 2QEBA 2WC5A 3D74A 3B7AA 3FE6A 3V2LA
chains in the Genus database with same CATH superfamily
1WLZA 1DT7B 1OMDA 2JXCA 3EVRA 1FBVA 1K9KA 2JWWA 1SY9A 2ZFDA 1B7TZ 1R2UA 2B1UA 2FOTA 1AP4A 1H4BA 2LLUA 1KFXL 1FI6A 2M49B 2LMTA 3VRPA 1XFVO 4IL1A 2E6WA 2PALA 5D7FA 4QJ5B 2SCPA 1GJYA 2F33A 2BKHB 3EVUA 3PJIA 3SG5A 1QWVA 5KU1A 2FJUB 2KSPA 1WRLA 1CFDA 2L0PA 1YVHA 4P5OE 2K7BA 1IRJA 1NUBA 2OS8B 1J7QA 3A8RA 2COLB 2EC6C 2BE4A 2G2BA 4HRGA 2DOQA 1AUIB 4D1EA 1YRUB 1B9AA 3RLZA 1OOHA 4IJ7A 4L9MA 3VRRA 1HQVA 5FYXA 1B4CA 1TOPA 3S0EA 2ZRTA 3FIAA 1RFJA 2Y4QA 1TTXA 2MHHA 2PQLA 1TWOA 3O2PA 1PVAA 2ZNDA 1OMRA 2KLDA 4JKTA 3S0GA 3CWGA 3DYEA 1FPWA 2KQYA 3D77A 3Q8IA 3CGAA 4GGNA 3OHMB 2I94A 2LP2A 2WCHA 3D78A 2KAYA 3LL8B 4I5JA 1QATA 1KWOC 3NSIA 1F70A 3VB1A 1QASA 5CSJA 2I18A 3LLEA 2FCEA 4I5LB 3E3RA 3N7HA 1AHRA 5BPJA 1EXRA 5DKQA 1XVJA 1TNQA 2KI4B 2JC2A 1K94A 1PSBA 1XFUO 1TRFA 4CFQA 1G8IA 1JUOA 3BUMB 5DKRA 3KPXA 1P28A 2WCEA 3BFHA 2K2FA 3D73A 4F0ZB 2ERBA 1NCZA 2BAPA 1SCMC 2D8NA 3TS5B 3L4LA 2GGMA 2F3ZA 2F2OA 3BFBA 2KYCA 2K8MB 3AKBA 2F2PA 3PM8A 1B1GA 3D0YA 2KDHA 1QV1A 2K7OA 2BL0B 5I94A 4YI8A 2BBNA 1NPQA 5F6TA 1Y1AA 4XJKA 5B8IB 1QVIY 3I5HC 4I5NB 4YGCB 4INXA 1QXPA 1FW4A 2M1UA 1K96A 1C7WA 5HLOA 2NLNA 3WNXB 1SYMA 2H2KA 3TUYC 2PRUA 1UP5A 1XFZO 4P2YB 1KFUS 5AEQA 1X02A 2JTTA 1AVSA 1NX1A 1RJVA 4Q04A 1XA5A 1L2OB 2VRGA 1TNPA 3SS5A 3PN7B 4DUQA 4ICBA 1KK8C 1ZMZA 1SPYA 4ORBB 1ZOTB 2WORA 3A4UB 3EK4A 3D75A 1KK7Y 3O78A 3PATA 3FS7A 3FWBA 4PHKA 2LMVA 4PT1A 1LA3A 2LE9B 1SR6C 1BR4B 1SK6D 1KK7Z 1Z4HA 2H61A 3SIAA 3S0AA 1KFUL 4MZKA 1F55A 2LHLA 4R1EA 1V1FA 3K21A 2PYQA 2WNDA 3EKJA 4PE0A 2Y1MA 3B7AA 2CXJA 1DC1A 2BCXA 2LHIA 4QJ4B 1G33A 3H4SE 2KBMA 1ALVA 1YURA 1KQMC 3BXKA 3WXAA 4CLNA 1A75B 1BMOA 2P6BB 2NCPA 4ZCUA 2PVBA 3JVTC 1SMGA 4ETOA 3GK2A 4JWQA 4DCKA 3OX5A 4YRUA 1K9PA 1TIZA 4PHJA 3VGOA 3BJHA 3R72A 1CFPA 1BR1B 4GNKB 2M8UA 1QLSA 1XK4A 2EGDA 1QS7A 3TDZA 4PE7A 1IH0A 1S6JA 1BT6A 1YUTA 2FCDA 4PCWA 2MLEC 1LINA 1TNWA 1JFKA 3R1OA 4GGFC 3SG3A 2WCMA 3CR2A 1C3YA 1IIOA 2L50A 1NCXA 1CKKA 3EK7A 1F4OA 1S6IA 3PFVA 3JTDC 4OR9B 4AQJA 5JJGA 2L4HA 5FI6A 1DEKA 2LUXA 2Q91A 3B87A 1Y1XA 3F45A 3O4YA 3SJSA 1YRTB 4AQIA 5I2QA 2LC5A 2HQ8A 1SBJA 2CCMA 1B8RA 2NXQA 3CS1A 2FJYA 3O6BA 1UUSA 1RWYA 3EG5B 3QRXA 5TNCA 1CFFA 5AANA 2OTGC 3DVKA 3LK1A 2LLTA 1PSRA 2L5YA 3S0DA 3B6XA 2JT8A 1J7PA 4AOMA 3O4XA 1SNLA 5HLVA 1OQPA 1MF8B 1TUJA 1RTP1 2WCLA 4TNCA 3SG4A 1A2XA 1R6PA 1S1EA 1A4PA 3OB1B 2EC6B 5G08A 2HQWA 1S26D 3NXAA 1NYAA 1RROA 1RECA 4M2QA 3L4AA 3VRNA 1F71A 4YGBB 2BNXA 1LXFC 3PSRA 3CABA 4DIRA 1KSMA 4WRIA 1XO5A 1GGWA 3DF0B 1UWOA 4OKHA 5J3XA 4ZCVA 2LM5A 4BY5A 4HREE 3EKHA 5D69A 1CDMA 1DGUA 2WC8A 3I5GC 4ORAB 1SW8A 2F3YA 1EG4A 3RZSA 2KI6C 3CZ1A 1DJGA 1MR8A 1TNXA 1DF0B 1S3PA 3OX6A 3CZTX 5HYDA 1ZUZA 1MWNA 1Q80A 3CYZA 1J1DA 1QIVA 2WCBA 2LMUA 2QEHA 1TN4A 3SG6A 1OOGA 1M39A 2MRDA 3DXLA 1HT9A 1KWOB 1KCYA 3RM1A 1CFCA 1W7IB 1QX2A 3BQ3A 3OGNA 4UPGA 1C7VA 2K2AA 1N2DA 3R1VA 4PALA 1DJHA 1JF2A 1YUUA 5HL1A 5I8NA 1Y0VH 1MHOA 3I5IC 2BE6A 2MJWB 1B47A 1OZSA 1BJFA 1UHKA 2JT3A 5HKWA 1GGZA 4YGAA 3BOWB 2WCJA 1OZOA 1DVIA 1N65A 2JQ6A 2JZIA 2ZRSA 3DVMA 4QJ3B 2BBMA 1KQVA 2LNKA 2JRFA 2CBLA 2KBIA 3CTNA 5IBWA 2KGRA 1NCYA 1SL9A 3NHIA 3I5HB 3KO0A 4N5XA 3D74A 1QVIZ 2L98A 1IWQA 1MXLC 3AAJA 1K8UA 2L2EA 1YX8A 2O5GA 1IQ5A 4MVFA 4CPVA 4JPZB 1DTLA 4NDCA 2ZNEA 2P70A 1LVCD 3OB2B 3L47A 4YI9A 3FWCA 2CNPA 2AAOA 2QEVA 2I2RE 3NHTA 4CFRA 1JSAA 1WDCB 3BYAA 4NDDA 1QJTA 2M1KB 3PM2A 4INWA 1YUSA 2KFGA 1CM4A 1QLKA 3GK1A 1XYDA 4N1GA 4M2PA 1SCVA 2M3WA 1JC2A 4GPLB 1GQMA 2H61C 1JF0A 1T14A 3IVTA 5I2OA 4NDBA 1OOJA 1SR6B 2LVKA 3LCPC 5CSNA 1EH2A 5FI2A 3CR5X 2H8VA 1IG5A 3K1EA 2M97A 1DJWA 1M63B 3KHEA 4N1FA 3FE8A 1JFJA 1C07A 2NZ0A 1WRKA 2JNFA 5AXIA 2LLSA 1DJYA 1EL4A 1KQMB 4I5KA 2QEOA 1QTXA 1KSOA 3BFAA 1J1EA 1V1GA 1CDLA 2JTZA 1AJ4A 5GQQC 2G9BA 2LUCA 2SASA 3JVTB 2BECA 5CSIA 2CTNA 2KLEA 5JOLA 1W9ZA 2KGBC 3UNWA 2LP3A 1NWDA 2MLFC 3I5FC 1XK4C 4USLA 2KYFA 1M46A 3FE9A 4C0KA 1SKTA 4JD9A 1NP8A 1M45A 1FF1A 4MRYA 1W7JB 1K2HA 4MSPA 1LKJA 4GAOA 1YR5A 1BU3A 3AAKA 4OV2A 3ZWHA 2LCPA 1A75A 5AFPA 1CDNA 3DVEA 1EG3A 1DMOA 1L7ZA 1U5IB 1CDPA 5ER4X 3TZ1A 1J7OA 1ZACA 2R2IA 4FQOA 3ICBA 5KTYA 2ZN9A 2TN4A 1LS8A 3JTDB 2KNEA 2JT0A 2AMIA 2E30A 2WCFA 1OE9B 3GK4X 1IGVA 2F8PA 1IJ5A 2M7LA 2BKIB 2JU0A 4HSZA 4PHMA 1OOIX 1PULA 1S6CA 2BCAA 2KQ6A 1ODBA 3M0WA 1OW4A 1UHJA 2OTGB 2K60A 3HX4A 3SIBA 1G4YR 2KFFA 2LAPA 3SS3A 3BUWB 3DZTA 2IS9A 3D10A 2K7CA 5I2LA 3SG2A 3VRQA 4GBAA 1DJZA 4PHNA 1UURA 2LVVA 1N0YA 3DY9A 1E8AA 2MBXA 3UO9A 1YX7A 1CNPA 1K95A 3R1PA 3S0FA 1LA0A 2P71A 1A03A 2M9GA 1YTZC 1MQ1A 2BCBA 2HF5A 2GTEA 2OS8C 3PALA 1NX2A 2K7DA 1SSEB 3GOFA 1EJ3A 1Z2CB 3NGVA 3I5GB 5HKYA 3AKAA 2KAVA 1Y1UA 3LK0A 2ISDA 3CZ2A 4JQ0D 1BOCA 3NSOA 2KPHA 3NSLA 1RK9A 3BUXB 1UHIA 2QEBA 4PE4A 1WY9A 4YGDB 1ALWA 1SL8A 4KYNA 1J55A 1AK8A 1PRWA 3FE6A 2LV7A 5PALA 3DF0A 4FQTA 4WQ2A 2CT9A 1F54A 4MZLA 2L5XB 1SRAA 3IF7A 3TDUA 4E68A 1XFRA 2K0JA 2WC6A 4ORCB 1CLBA 1CLLA 1MUXA 4YGEB 1BODA 1JWDA 4M2OA 1TCOB 1OOFA 2LVJA 2ZN8A 1BF5A 1DF0A 2M7NA 1MXEA 2JNXA 5CSFA 4A4BA 4BY4A 2K61A 3I5IB 4MLWA 4PDZA 5K89A 1SCMB 1DJIA 4MEWA 4GFTA 1Y6WA 3D0YB 3NSKA 1IKUA 4OVNF 2KAXA 2LVIA 2YGUA 2KI4C 3HCMA 4HRHA 4XJKB 2KI6D 1UHHA 2M29A 4GUKA 4A4CA 2GGZA 1FI5A 1CM1A 4XYNA 5HKZA 4DRWA 2Q4UA 2V53A 3TS5C 1B8CA 2GV5A 2JULA 3D76A 1D1OA 3C1VA 3TUYB 1XFWO 1SL7A 2JOJA 3BOWA 2NCOA 4C0JA 4U8DA 3VROA 2QACA 4OZDA 2RGIA 2BL0C 4NQGA 2KOTA 1AJ5A 1S36A 3CLNA 1XFYO 2WCKA 1PALA 1B8LA 5ER5A 3SG7A 1H8BA 1YVLA 1TCFA 1KK8B 2I7AA 3EK8A 2M0RA 1QIWA 2ZKMX 2MAZA 1IQ3A 4WQ3A 1OSAA 1CMFA 1F4QA 1K9UA 1IJ6A 2PMYA 2HETA 2Y5IA 5KSZA 1CB1A 1J7RA 1GM0A 5D3OA 2L2CA 3PLFB 2A4JA 1OMVA 2JPOA 2QDIA 1PK0D 1L2OC 1UHNA 1WDCC 5DKNA 3PN7C 3KF9A 4CIDA 3OP0A 1NIWA 1C3ZA 1K90D 4C0LA 1F8HA 2HPSA 1NX3A 3ZNIA 3QMEA 2O60A 2QPTA 5FI7A 3SS4A 1BG1A 1DJXA 4PE1A 3CDNA 1S5GY 2OPOA 1XFXO 4MN0A 1K93D 1QX7A 1TUZA 3BUOB 3CR4X 1S5GZ 1WRZA 1BLQA 2KFHA 3DD4A 4FTGA 3OBVA 1NSHA 2AUCA 3I5FB 3EVVA 3MSEB 1PVBA 3DVJA 1QV0A 4MRXA 3S0BA 2L4IA 1A29A 4MZJA 5EL2A 1QX5B 5AERA 1DQEA 1JBAA 2PSRA 3WHTB 3IQOA 2KHNA 3KEVA 3CZ0A 1CLMA 4F7FA 1ORGA 1DELA 1VRKA 3B86A 4MBEA 1CMGA 2JXLA 1ZFSA 1M31A 4OCIA 5CPVA 5DICA 1KFXS 1WLMA 1CTRA 1NX0A 2EHBA 2JPTA 3B88A 2Y1NA 3IQQA 3TDIA 3BUNB 4DS7A 1DGVA 2MA2A 2WC5A 2PASA 2WOSA 1U5IA 2LANA 4GGFA 4YBHB 3WHUB 2L51A 3V2LA 1B7TY
chains in the Genus database with same CATH topology
4FQTA 2P70A 1XFRA 2WC6A 3L47A 2QEVA 3NHTA 1OOFA 3BJHA 3PJIA 3R72A 1QWVA 4INWA 1T14A 3R1OA 1C3YA 2WCMA 2H8VA 3K1EA 1OOHA 3FE8A 3S0EA 3D76A 3B87A 2QEOA 2PQLA 1TWOA 3BFAA 4OZDA 2FJYA 3S0GA 2WCKA 3DYEA 3D77A 3Q8IA 2WCHA 3D78A 3S0DA 3B6XA 3FE9A 4JD9A 1TUJA 3VB1A 2WCLA 3N7HA 1GM0A 2L2CA 2JPOA 2QDIA 3L4AA 1P28A 3CABA 3BFHA 1C3ZA 1LS8A 3D73A 2ERBA 3QMEA 3L4LA 3CDNA 3BFBA 3RZSA 3CZ1A 1OOIX 1OW4A 3CYZA 4INXA 2QEHA 1OOGA 3DZTA 3DXLA 3S0BA 5EL2A 3OGNA 3DY9A 1DQEA 3R1VA 3R1PA 3S0FA 2P71A 3CZ0A 4F7FA 1ORGA 2WCJA 3B86A 3D75A 2GTEA 3NGVA 5DICA 4PT1A 3CZ2A 3B88A 3NHIA 3S0AA 2KPHA 2QEBA 2WC5A 3D74A 3B7AA 3FE6A 3V2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FQT A;  2P70 A;  1XFR A;  2WC6 A;  3L47 A;  2QEV A;  3NHT A;  1OOF A;  3BJH A;  3PJI A;  3R72 A;  1QWV A;  4INW A;  1T14 A;  3R1O A;  1C3Y A;  2WCM A;  2H8V A;  3K1E A;  1OOH A;  3FE8 A;  3S0E A;  3D76 A;  3B87 A;  2QEO A;  2PQL A;  1TWO A;  3BFA A;  4OZD A;  2FJY A;  3S0G A;  2WCK A;  3DYE A;  3D77 A;  3Q8I A;  2WCH A;  3D78 A;  3S0D A;  3B6X A;  3FE9 A;  4JD9 A;  1TUJ A;  3VB1 A;  2WCL A;  3N7H A;  1GM0 A;  2L2C A;  2JPO A;  2QDI A;  3L4A A;  1P28 A;  3CAB A;  3BFH A;  1C3Z A;  1LS8 A;  3D73 A;  2ERB A;  3QME A;  3L4L A;  3CDN A;  3BFB A;  3RZS A;  3CZ1 A;  1OOI X;  1OW4 A;  3CYZ A;  4INX A;  2QEH A;  1OOG A;  3DZT A;  3DXL A;  3S0B A;  5EL2 A;  3OGN A;  3DY9 A;  1DQE A;  3R1V A;  3R1P A;  3S0F A;  2P71 A;  3CZ0 A;  4F7F A;  1ORG A;  2WCJ A;  3B86 A;  3D75 A;  2GTE A;  3NGV A;  5DIC A;  4PT1 A;  3CZ2 A;  3B88 A;  3NHI A;  3S0A A;  2KPH A;  2QEB A;  2WC5 A;  3D74 A;  3B7A A;  3FE6 A;  3V2L A; 
#chains in the Genus database with same CATH topology
 1WLZ A;  1DT7 B;  1OMD A;  2JXC A;  3EVR A;  1FBV A;  1K9K A;  2JWW A;  1SY9 A;  2ZFD A;  1B7T Z;  1R2U A;  2B1U A;  2FOT A;  1AP4 A;  1H4B A;  2LLU A;  1KFX L;  1FI6 A;  2M49 B;  2LMT A;  3VRP A;  1XFV O;  4IL1 A;  2E6W A;  2PAL A;  5D7F A;  4QJ5 B;  2SCP A;  1GJY A;  2F33 A;  2BKH B;  3EVU A;  3PJI A;  3SG5 A;  1QWV A;  5KU1 A;  2FJU B;  2KSP A;  1WRL A;  1CFD A;  2L0P A;  1YVH A;  4P5O E;  2K7B A;  1IRJ A;  1NUB A;  2OS8 B;  1J7Q A;  3A8R A;  2COL B;  2EC6 C;  2BE4 A;  2G2B A;  4HRG A;  2DOQ A;  1AUI B;  4D1E A;  1YRU B;  1B9A A;  3RLZ A;  1OOH A;  4IJ7 A;  4L9M A;  3VRR A;  1HQV A;  5FYX A;  1B4C A;  1TOP A;  3S0E A;  2ZRT A;  3FIA A;  1RFJ A;  2Y4Q A;  1TTX A;  2MHH A;  2PQL A;  1TWO A;  3O2P A;  1PVA A;  2ZND A;  1OMR A;  2KLD A;  4JKT A;  3S0G A;  3CWG A;  3DYE A;  1FPW A;  2KQY A;  3D77 A;  3Q8I A;  3CGA A;  4GGN A;  3OHM B;  2I94 A;  2LP2 A;  2WCH A;  3D78 A;  2KAY A;  3LL8 B;  4I5J A;  1QAT A;  1KWO C;  3NSI A;  1F70 A;  3VB1 A;  1QAS A;  5CSJ A;  2I18 A;  3LLE A;  2FCE A;  4I5L B;  3E3R A;  3N7H A;  1AHR A;  5BPJ A;  1EXR A;  5DKQ A;  1XVJ A;  1TNQ A;  2KI4 B;  2JC2 A;  1K94 A;  1PSB A;  1XFU O;  1TRF A;  4CFQ A;  1G8I A;  1JUO A;  3BUM B;  5DKR A;  3KPX A;  1P28 A;  2WCE A;  3BFH A;  2K2F A;  3D73 A;  4F0Z B;  2ERB A;  1NCZ A;  2BAP A;  1SCM C;  2D8N A;  3TS5 B;  3L4L A;  2GGM A;  2F3Z A;  2F2O A;  3BFB A;  2KYC A;  2K8M B;  3AKB A;  2F2P A;  3PM8 A;  1B1G A;  3D0Y A;  2KDH A;  1QV1 A;  2K7O A;  2BL0 B;  5I94 A;  4YI8 A;  2BBN A;  1NPQ A;  5F6T A;  1Y1A A;  4XJK A;  5B8I B;  1QVI Y;  3I5H C;  4I5N B;  4YGC B;  4INX A;  1QXP A;  1FW4 A;  2M1U A;  1K96 A;  1C7W A;  5HLO A;  2NLN A;  3WNX B;  1SYM A;  2H2K A;  3TUY C;  2PRU A;  1UP5 A;  1XFZ O;  4P2Y B;  1KFU S;  5AEQ A;  1X02 A;  2JTT A;  1AVS A;  1NX1 A;  1RJV A;  4Q04 A;  1XA5 A;  1L2O B;  2VRG A;  1TNP A;  3SS5 A;  3PN7 B;  4DUQ A;  4ICB A;  1KK8 C;  1ZMZ A;  1SPY A;  4ORB B;  1ZOT B;  2WOR A;  3A4U B;  3EK4 A;  3D75 A;  1KK7 Y;  3O78 A;  3PAT A;  3FS7 A;  3FWB A;  4PHK A;  2LMV A;  4PT1 A;  1LA3 A;  2LE9 B;  1SR6 C;  1BR4 B;  1SK6 D;  1KK7 Z;  1Z4H A;  2H61 A;  3SIA A;  3S0A A;  1KFU L;  4MZK A;  1F55 A;  2LHL A;  4R1E A;  1V1F A;  3K21 A;  2PYQ A;  2WND A;  3EKJ A;  4PE0 A;  2Y1M A;  3B7A A;  2CXJ A;  1DC1 A;  2BCX A;  2LHI A;  4QJ4 B;  1G33 A;  3H4S E;  2KBM A;  1ALV A;  1YUR A;  1KQM C;  3BXK A;  3WXA A;  4CLN A;  1A75 B;  1BMO A;  2P6B B;  2NCP A;  4ZCU A;  2PVB A;  3JVT C;  1SMG A;  4ETO A;  3GK2 A;  4JWQ A;  4DCK A;  3OX5 A;  4YRU A;  1K9P A;  1TIZ A;  4PHJ A;  3VGO A;  3BJH A;  3R72 A;  1CFP A;  1BR1 B;  4GNK B;  2M8U A;  1QLS A;  1XK4 A;  2EGD A;  1QS7 A;  3TDZ A;  4PE7 A;  1IH0 A;  1S6J A;  1BT6 A;  1YUT A;  2FCD A;  4PCW A;  2MLE C;  1LIN A;  1TNW A;  1JFK A;  3R1O A;  4GGF C;  3SG3 A;  2WCM A;  3CR2 A;  1C3Y A;  1IIO A;  2L50 A;  1NCX A;  1CKK A;  3EK7 A;  1F4O A;  1S6I A;  3PFV A;  3JTD C;  4OR9 B;  4AQJ A;  5JJG A;  2L4H A;  5FI6 A;  1DEK A;  2LUX A;  2Q91 A;  3B87 A;  1Y1X A;  3F45 A;  3O4Y A;  3SJS A;  1YRT B;  4AQI A;  5I2Q A;  2LC5 A;  2HQ8 A;  1SBJ A;  2CCM A;  1B8R A;  2NXQ A;  3CS1 A;  2FJY A;  3O6B A;  1UUS A;  1RWY A;  3EG5 B;  3QRX A;  5TNC A;  1CFF A;  5AAN A;  2OTG C;  3DVK A;  3LK1 A;  2LLT A;  1PSR A;  2L5Y A;  3S0D A;  3B6X A;  2JT8 A;  1J7P A;  4AOM A;  3O4X A;  1SNL A;  5HLV A;  1OQP A;  1MF8 B;  1TUJ A;  1RTP 1;  2WCL A;  4TNC A;  3SG4 A;  1A2X A;  1R6P A;  1S1E A;  1A4P A;  3OB1 B;  2EC6 B;  5G08 A;  2HQW A;  1S26 D;  3NXA A;  1NYA A;  1RRO A;  1REC A;  4M2Q A;  3L4A A;  3VRN A;  1F71 A;  4YGB B;  2BNX A;  1LXF C;  3PSR A;  3CAB A;  4DIR A;  1KSM A;  4WRI A;  1XO5 A;  1GGW A;  3DF0 B;  1UWO A;  4OKH A;  5J3X A;  4ZCV A;  2LM5 A;  4BY5 A;  4HRE E;  3EKH A;  5D69 A;  1CDM A;  1DGU A;  2WC8 A;  3I5G C;  4ORA B;  1SW8 A;  2F3Y A;  1EG4 A;  3RZS A;  2KI6 C;  3CZ1 A;  1DJG A;  1MR8 A;  1TNX A;  1DF0 B;  1S3P A;  3OX6 A;  3CZT X;  5HYD A;  1ZUZ A;  1MWN A;  1Q80 A;  3CYZ A;  1J1D A;  1QIV A;  2WCB A;  2LMU A;  2QEH A;  1TN4 A;  3SG6 A;  1OOG A;  1M39 A;  2MRD A;  3DXL A;  1HT9 A;  1KWO B;  1KCY A;  3RM1 A;  1CFC A;  1W7I B;  1QX2 A;  3BQ3 A;  3OGN A;  4UPG A;  1C7V A;  2K2A A;  1N2D A;  3R1V A;  4PAL A;  1DJH A;  1JF2 A;  1YUU A;  5HL1 A;  5I8N A;  1Y0V H;  1MHO A;  3I5I C;  2BE6 A;  2MJW B;  1B47 A;  1OZS A;  1BJF A;  1UHK A;  2JT3 A;  5HKW A;  1GGZ A;  4YGA A;  3BOW B;  2WCJ A;  1OZO A;  1DVI A;  1N65 A;  2JQ6 A;  2JZI A;  2ZRS A;  3DVM A;  4QJ3 B;  2BBM A;  1KQV A;  2LNK A;  2JRF A;  2CBL A;  2KBI A;  3CTN A;  5IBW A;  2KGR A;  1NCY A;  1SL9 A;  3NHI A;  3I5H B;  3KO0 A;  4N5X A;  3D74 A;  1QVI Z;  2L98 A;  1IWQ A;  1MXL C;  3AAJ A;  1K8U A;  2L2E A;  1YX8 A;  2O5G A;  1IQ5 A;  4MVF A;  4CPV A;  4JPZ B;  1DTL A;  4NDC A;  2ZNE A;  2P70 A;  1LVC D;  3OB2 B;  3L47 A;  4YI9 A;  3FWC A;  2CNP A;  2AAO A;  2QEV A;  2I2R E;  3NHT A;  4CFR A;  1JSA A;  1WDC B;  3BYA A;  4NDD A;  1QJT A;  2M1K B;  3PM2 A;  4INW A;  1YUS A;  2KFG A;  1CM4 A;  1QLK A;  3GK1 A;  1XYD A;  4N1G A;  4M2P A;  1SCV A;  2M3W A;  1JC2 A;  4GPL B;  1GQM A;  2H61 C;  1JF0 A;  1T14 A;  3IVT A;  5I2O A;  4NDB A;  1OOJ A;  1SR6 B;  2LVK A;  3LCP C;  5CSN A;  1EH2 A;  5FI2 A;  3CR5 X;  2H8V A;  1IG5 A;  3K1E A;  2M97 A;  1DJW A;  1M63 B;  3KHE A;  4N1F A;  3FE8 A;  1JFJ A;  1C07 A;  2NZ0 A;  1WRK A;  2JNF A;  5AXI A;  2LLS A;  1DJY A;  1EL4 A;  1KQM B;  4I5K A;  2QEO A;  1QTX A;  1KSO A;  3BFA A;  1J1E A;  1V1G A;  1CDL A;  2JTZ A;  1AJ4 A;  5GQQ C;  2G9B A;  2LUC A;  2SAS A;  3JVT B;  2BEC A;  5CSI A;  2CTN A;  2KLE A;  5JOL A;  1W9Z A;  2KGB C;  3UNW A;  2LP3 A;  1NWD A;  2MLF C;  3I5F C;  1XK4 C;  4USL A;  2KYF A;  1M46 A;  3FE9 A;  4C0K A;  1SKT A;  4JD9 A;  1NP8 A;  1M45 A;  1FF1 A;  4MRY A;  1W7J B;  1K2H A;  4MSP A;  1LKJ A;  4GAO A;  1YR5 A;  1BU3 A;  3AAK A;  4OV2 A;  3ZWH A;  2LCP A;  1A75 A;  5AFP A;  1CDN A;  3DVE A;  1EG3 A;  1DMO A;  1L7Z A;  1U5I B;  1CDP A;  5ER4 X;  3TZ1 A;  1J7O A;  1ZAC A;  2R2I A;  4FQO A;  3ICB A;  5KTY A;  2ZN9 A;  2TN4 A;  1LS8 A;  3JTD B;  2KNE A;  2JT0 A;  2AMI A;  2E30 A;  2WCF A;  1OE9 B;  3GK4 X;  1IGV A;  2F8P A;  1IJ5 A;  2M7L A;  2BKI B;  2JU0 A;  4HSZ A;  4PHM A;  1OOI X;  1PUL A;  1S6C A;  2BCA A;  2KQ6 A;  1ODB A;  3M0W A;  1OW4 A;  1UHJ A;  2OTG B;  2K60 A;  3HX4 A;  3SIB A;  1G4Y R;  2KFF A;  2LAP A;  3SS3 A;  3BUW B;  3DZT A;  2IS9 A;  3D10 A;  2K7C A;  5I2L A;  3SG2 A;  3VRQ A;  4GBA A;  1DJZ A;  4PHN A;  1UUR A;  2LVV A;  1N0Y A;  3DY9 A;  1E8A A;  2MBX A;  3UO9 A;  1YX7 A;  1CNP A;  1K95 A;  3R1P A;  3S0F A;  1LA0 A;  2P71 A;  1A03 A;  2M9G A;  1YTZ C;  1MQ1 A;  2BCB A;  2HF5 A;  2GTE A;  2OS8 C;  3PAL A;  1NX2 A;  2K7D A;  1SSE B;  3GOF A;  1EJ3 A;  1Z2C B;  3NGV A;  3I5G B;  5HKY A;  3AKA A;  2KAV A;  1Y1U A;  3LK0 A;  2ISD A;  3CZ2 A;  4JQ0 D;  1BOC A;  3NSO A;  2KPH A;  3NSL A;  1RK9 A;  3BUX B;  1UHI A;  2QEB A;  4PE4 A;  1WY9 A;  4YGD B;  1ALW A;  1SL8 A;  4KYN A;  1J55 A;  1AK8 A;  1PRW A;  3FE6 A;  2LV7 A;  5PAL A;  3DF0 A;  4FQT A;  4WQ2 A;  2CT9 A;  1F54 A;  4MZL A;  2L5X B;  1SRA A;  3IF7 A;  3TDU A;  4E68 A;  1XFR A;  2K0J A;  2WC6 A;  4ORC B;  1CLB A;  1CLL A;  1MUX A;  4YGE B;  1BOD A;  1JWD A;  4M2O A;  1TCO B;  1OOF A;  2LVJ A;  2ZN8 A;  1BF5 A;  1DF0 A;  2M7N A;  1MXE A;  2JNX A;  5CSF A;  4A4B A;  4BY4 A;  2K61 A;  3I5I B;  4MLW A;  4PDZ A;  5K89 A;  1SCM B;  1DJI A;  4MEW A;  4GFT A;  1Y6W A;  3D0Y B;  3NSK A;  1IKU A;  4OVN F;  2KAX A;  2LVI A;  2YGU A;  2KI4 C;  3HCM A;  4HRH A;  4XJK B;  2KI6 D;  1UHH A;  2M29 A;  4GUK A;  4A4C A;  2GGZ A;  1FI5 A;  1CM1 A;  4XYN A;  5HKZ A;  4DRW A;  2Q4U A;  2V53 A;  3TS5 C;  1B8C A;  2GV5 A;  2JUL A;  3D76 A;  1D1O A;  3C1V A;  3TUY B;  1XFW O;  1SL7 A;  2JOJ A;  3BOW A;  2NCO A;  4C0J A;  4U8D A;  3VRO A;  2QAC A;  4OZD A;  2RGI A;  2BL0 C;  4NQG A;  2KOT A;  1AJ5 A;  1S36 A;  3CLN A;  1XFY O;  2WCK A;  1PAL A;  1B8L A;  5ER5 A;  3SG7 A;  1H8B A;  1YVL A;  1TCF A;  1KK8 B;  2I7A A;  3EK8 A;  2M0R A;  1QIW A;  2ZKM X;  2MAZ A;  1IQ3 A;  4WQ3 A;  1OSA A;  1CMF A;  1F4Q A;  1K9U A;  1IJ6 A;  2PMY A;  2HET A;  2Y5I A;  5KSZ A;  1CB1 A;  1J7R A;  1GM0 A;  5D3O A;  2L2C A;  3PLF B;  2A4J A;  1OMV A;  2JPO A;  2QDI A;  1PK0 D;  1L2O C;  1UHN A;  1WDC C;  5DKN A;  3PN7 C;  3KF9 A;  4CID A;  3OP0 A;  1NIW A;  1C3Z A;  1K90 D;  4C0L A;  1F8H A;  2HPS A;  1NX3 A;  3ZNI A;  3QME A;  2O60 A;  2QPT A;  5FI7 A;  3SS4 A;  1BG1 A;  1DJX A;  4PE1 A;  3CDN A;  1S5G Y;  2OPO A;  1XFX O;  4MN0 A;  1K93 D;  1QX7 A;  1TUZ A;  3BUO B;  3CR4 X;  1S5G Z;  1WRZ A;  1BLQ A;  2KFH A;  3DD4 A;  4FTG A;  3OBV A;  1NSH A;  2AUC A;  3I5F B;  3EVV A;  3MSE B;  1PVB A;  3DVJ A;  1QV0 A;  4MRX A;  3S0B A;  2L4I A;  1A29 A;  4MZJ A;  5EL2 A;  1QX5 B;  5AER A;  1DQE A;  1JBA A;  2PSR A;  3WHT B;  3IQO A;  2KHN A;  3KEV A;  3CZ0 A;  1CLM A;  4F7F A;  1ORG A;  1DEL A;  1VRK A;  3B86 A;  4MBE A;  1CMG A;  2JXL A;  1ZFS A;  1M31 A;  4OCI A;  5CPV A;  5DIC A;  1KFX S;  1WLM A;  1CTR A;  1NX0 A;  2EHB A;  2JPT A;  3B88 A;  2Y1N A;  3IQQ A;  3TDI A;  3BUN B;  4DS7 A;  1DGV A;  2MA2 A;  2WC5 A;  2PAS A;  2WOS A;  1U5I A;  2LAN A;  4GGF A;  4YBH B;  3WHU B;  2L51 A;  3V2L A;  1B7T Y; 
#chains in the Genus database with same CATH homology
 4FQT A;  2P70 A;  1XFR A;  2WC6 A;  3L47 A;  2QEV A;  3NHT A;  1OOF A;  3BJH A;  3PJI A;  3R72 A;  1QWV A;  4INW A;  1T14 A;  3R1O A;  1C3Y A;  2WCM A;  2H8V A;  3K1E A;  1OOH A;  3FE8 A;  3S0E A;  3D76 A;  3B87 A;  2QEO A;  2PQL A;  1TWO A;  3BFA A;  4OZD A;  2FJY A;  3S0G A;  2WCK A;  3DYE A;  3D77 A;  3Q8I A;  2WCH A;  3D78 A;  3S0D A;  3B6X A;  3FE9 A;  4JD9 A;  1TUJ A;  3VB1 A;  2WCL A;  3N7H A;  1GM0 A;  2L2C A;  2JPO A;  2QDI A;  3L4A A;  1P28 A;  3CAB A;  3BFH A;  1C3Z A;  1LS8 A;  3D73 A;  2ERB A;  3QME A;  3L4L A;  3CDN A;  3BFB A;  3RZS A;  3CZ1 A;  1OOI X;  1OW4 A;  3CYZ A;  4INX A;  2QEH A;  1OOG A;  3DZT A;  3DXL A;  3S0B A;  5EL2 A;  3OGN A;  3DY9 A;  1DQE A;  3R1V A;  3R1P A;  3S0F A;  2P71 A;  3CZ0 A;  4F7F A;  1ORG A;  2WCJ A;  3B86 A;  3D75 A;  2GTE A;  3NGV A;  5DIC A;  4PT1 A;  3CZ2 A;  3B88 A;  3NHI A;  3S0A A;  2KPH A;  2QEB A;  2WC5 A;  3D74 A;  3B7A A;  3FE6 A;  3V2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...