1DVIA

Calpain domain vi with calcium bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
EEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTSRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALPAIN
publication title Structure of a calpain Ca(2+)-binding domain reveals a novel EF-hand and Ca(2+)-induced conformational changes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-dependent protease
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dviA00
3VRRA 3FS7A 3DF0A 1J7PA 2ZRSA 3JTDB 1S6CA 1RJVA 2LHIA 1Y1UA 4IL1A 1BOCA 5AANA 2E30A 1CLLA 1V1FA 1XK4C 3BOWB 4ZCVA 1YUUA 3LK1A 2F8PA 1SBJA 1DJZA 1CMFA 5DKQA 1YUSA 1Y0VH 2LP2A 1CDPA 4PDZA 5ER5A 1QX2A 2ZFDA 3RM1A 1XFWO 4DRWA 3QRXA 2JTZA 3BUMB 3I5FC 2K7CA 1K9UA 4YGEB 2H2KA 1EG4A 3I5FB 5HYDA 2K2AA 2HPSA 2LUXA 3D0YA 5AERA 5B8IB 2JT0A 1BJFA 2M97A 1J7OA 5FYXA 2KI6D 2I18A 1D1OA 3BUWB 1PULA 2MHHA 2WCFA 1ODBA 4HRGA 1SCVA 1NCYA 2CCMA 4N1FA 5CSJA 1NPQA 1FBVA 2D8NA 4MRYA 1SMGA 1CDMA 3PM8A 1AK8A 2KQYA 2MRDA 4MLWA 4HRHA 4NDCA 1HQVA 1OE9B 1WLZA 2KSPA 3A8RA 5I8NA 2PRUA 1JFJA 4USLA 1QATA 2JPTA 3LCPC 4MSPA 1KK8C 1H4BA 2M3WA 3LL8B 3EK4A 1LINA 1Q80A 2M8UA 1SYMA 2KAXA 3MSEB 1KK8B 1S5GZ 2Y4QA 1BU3A 1C07A 4D1EA 4A4BA 1RECA 1XA5A 4ETOA 1CFFA 3ZNIA 2KBIA 2LMVA 3GK2A 1B8RA 2ZKMX 1CM4A 3SG4A 2L50A 3CTNA 1B7TY 1NX0A 3AAJA 1N2DA 4HREE 2BKIB 5J3XA 1OOJA 3TDIA 1KSOA 5HKYA 4M2OA 3O78A 2BCBA 5D69A 2GV5A 1RWYA 1A4PA 1J7RA 1SK6D 1K90D 4UPGA 2M0RA 1XVJA 3NSKA 1K95A 2K7DA 1IQ3A 2F3ZA 4ZCUA 4XJKB 1E8AA 2MLEC 3I5HB 2K61A 2BCXA 4BY4A 4OR9B 2PALA 1SNLA 2F3YA 2L51A 1F8HA 3FWBA 2LNKA 2KYFA 1XFUO 1QX5B 4YGBB 1XFVO 1QXPA 1UHIA 3KF9A 2Q4UA 1OQPA 2G2BA 2LHLA 1JUOA 1XFXO 2MAZA 2H61A 5JOLA 3DVKA 1YR5A 3DF0B 3OB1B 3BXKA 4NDBA 1BT6A 3JVTC 2ZNDA 3EK7A 1WY9A 3OHMB 3ZWHA 3JVTB 2OS8C 3EVVA 1A75A 2HETA 1B1GA 3CR2A 1NWDA 1WDCB 4PE7A 1NX1A 2K0JA 2OS8B 1EL4A 1OZOA 1YUTA 2LVVA 2NCOA 4Q04A 3NSIA 1A2XA 2JRFA 1JF2A 2FJUB 3K21A 1WRZA 3PLFB 4PALA 4WQ3A 1SR6B 2CTNA 2B1UA 1LXFC 4L9MA 4YBHB 1M63B 1SL8A 1SY9A 2HQ8A 3AAKA 3SIAA 1CFPA 1NCXA 2TN4A 3TUYC 4GNKB 2LUCA 3WNXB 2CXJA 2JULA 2KHNA 2JWWA 5CPVA 2K7OA 1M46A 3TUYB 3M0WA 1EJ3A 1GQMA 4PE1A 3PALA 1ZACA 2WNDA 2NCPA 2WCBA 3OB2B 1DJGA 1OMRA 1QVIY 1L2OC 3BQ3A 1F71A 1MXLC 1F54A 3OP0A 1KK7Y 1UURA 1L2OB 2KAVA 5IBWA 1KQVA 1WRKA 4PE4A 2BBNA 2JT3A 4QJ5B 3LLEA 1SRAA 1DGVA 4F0ZB 3CS1A 1GGZA 3WXAA 2LAPA 3VRPA 1DTLA 1QV0A 3DVJA 2JZIA 2KNEA 3WHTB 4MRXA 1Y1XA 3PSRA 3D10A 1XFYO 3IQQA 2AAOA 1NIWA 2JNFA 1CFCA 3SG3A 2ZRTA 4R1EA 2KGBC 1AJ4A 1JSAA 2EHBA 1DMOA 3CZTX 1KFXL 3KO0A 1HT9A 1CB1A 1J55A 1WRLA 4P5OE 1SPYA 3DVMA 1H8BA 3C1VA 1V1GA 1CDNA 2F2OA 1RFJA 3ICBA 1JWDA 1UHHA 1U5IA 1M39A 2K8MB 5F6TA 1BF5A 2L4IA 2MA2A 1AJ5A 3NSLA 2HF5A 4MN0A 1MWNA 1OZSA 2JTTA 2LLTA 2PASA 2SASA 4MZJA 3O4YA 3KEVA 4AQIA 1SL9A 4M2PA 1QIWA 2CT9A 2WORA 1LA3A 2LANA 3VRNA 3DVEA 1SW8A 5G08A 2M9GA 4CLNA 2P6BB 1KFUL 2ZNEA 1YTZC 2NZ0A 4MZLA 1BG1A 2JXCA 1IQ5A 1MHOA 2L0PA 2H61C 5CSNA 1TNPA 3BYAA 3BOWA 4C0JA 1M45A 2DOQA 2BL0C 2BE6A 3NSOA 3WHUB 4OKHA 2HQWA 4CFRA 5KU1A 1TRFA 3H4SE 4TNCA 1C7WA 1PVAA 4GAOA 1YX8A 4MEWA 4JPZB 1RTP1 2CBLA 2GGZA 1WLMA 2FCDA 4AQJA 3F45A 1SCMC 2F2PA 2WC8A 3DD4A 2MJWB 2NXQA 1F4OA 1Y6WA 1L7ZA 2MBXA 1DT7B 1CM1A 1MUXA 1KQMC 5TNCA 1RROA 4ORBB 4E68A 1OSAA 5DKNA 2BE4A 1FI5A 4P2YB 2FCEA 1TN4A 3SG6A 1IH0A 3AKBA 3E3RA 2M7LA 1MF8B 1S1EA 5AFPA 4HSZA 1K94A 3IQOA 1PRWA 1B8LA 1XFZO 3EKJA 1B7TZ 2LVKA 2WOSA 2JQ6A 1IRJA 1SKTA 1CNPA 1IGVA 1YVLA 1TNXA 1TNQA 2I2RE 2JC2A 1OMVA 3CR4X 4PHKA 5D7FA 1BR4B 4PHJA 1NCZA 4DUQA 2LMUA 2AUCA 3OX5A 1CTRA 4GGNA 1DJHA 5I2QA 2KOTA 1UUSA 1K93D 1IJ5A 3EK8A 3SG2A 2KFHA 2EGDA 4ICBA 3OX6A 5BPJA 1QX7A 2I94A 2KFGA 2Y1NA 2KI4C 2Y5IA 4ORCB 5HKZA 2JNXA 5K89A 3D0YB 1QLSA 1PVBA 1QS7A 2LLSA 2KI4B 3CWGA 2E6WA 1R6PA 3TDUA 4CFQA 2WCEA 4NDDA 2KAYA 4A4CA 4OCIA 3TDZA 2SCPA 1BLQA 1KWOC 1CFDA 1KFXS 1G8IA 1FPWA 1KWOB 1YRTB 3KHEA 2A4JA 2JOJA 4FTGA 1DF0A 1J1DA 1VRKA 5AXIA 1FF1A 1JFKA 2OTGC 4DCKA 4C0KA 1PSBA 1RK9A 2QPTA 1XO5A 2K2FA 4YI9A 1A03A 2OTGB 1QASA 5DKRA 4GPLB 2LCPA 1QIVA 3IF7A 2L98A 1AHRA 2PSRA 1TOPA 1NP8A 2KBMA 5I2LA 3HX4A 2JT8A 2BKHB 3BUNB 3JTDC 1G33A 1K8UA 1ZFSA 1B9AA 3O2PA 3HCMA 3VRQA 1M31A 2KDHA 1KFUS 1PALA 1S26D 2NLNA 2QACA 4MZKA 2Y1MA 4I5LB 2ZN9A 4N1GA 3NXAA 2COLB 1CLBA 1S6IA 1X02A 5GQQC 1J1EA 4PCWA 1SL7A 1CLMA 1MQ1A 4AOMA 2KYCA 1MXEA 1S5GY 2LM5A 1ALVA 1AP4A 1DJIA 3GOFA 5HKWA 1QVIZ 1NSHA 1NX3A 3BUXB 1KK7Z 3PN7C 2LC5A 5KSZA 1Y1AA 1B47A 3CLNA 5I2OA 3AKAA 2BBMA 1MR8A 1K96A 1PSRA 3PN7B 4WQ2A 1F55A 1IWQA 1TNWA 2RGIA 1ZMZA 2Q91A 4I5NB 2PMYA 5ER4X 1LA0A 2V53A 1YVHA 2LLUA 2BECA 1ALWA 1GGWA 1KSMA 1TCFA 2VRGA 4JQ0D 1B8CA 4PHNA 4WRIA 1FW4A 1IJ6A 1IG5A 1QV1A 4YGCB 1TTXA 3I5GC 1GJYA 1LVCD 2L5XB 3EKHA 2AMIA 1JF0A 5CSIA 1XK4A 4I5JA 3I5GB 1W7IB 4YI8A 4CIDA 1TCOB 2BL0B 4QJ3B 1IKUA 2IS9A 2K7BA 1A75B 1CMGA 3VGOA 2LVIA 1C7VA 4GGFC 1JC2A 3BUOB 4YRUA 2L4HA 1DGUA 4MVFA 3I5IC 3EVRA 1UP5A 2I7AA 2MLFC 1NX2A 1BODA 3I5IB 1EG3A 1SCMB 2LMTA 3RLZA 2ZN8A 3O6BA 1N65A 4QJ4B 2KQ6A 1FI6A 1UHNA 1KCYA 2JU0A 1QLKA 4JWQA 1B4CA 4XYNA 4DIRA 1W7JB 1KQMB 1DJYA 1S36A 5HLVA 3SIBA 2LP3A 1YX7A 3SG7A 1NUBA 3TS5C 4PE0A 4NQGA 1LKJA 1J7QA 4OVNF 1OMDA 1UHKA 3TS5B 1QJTA 1AVSA 1S6JA 3I5HC 2L2EA 1DF0B 2M29A 1F4QA 4FQOA 3GK1A 4GBAA 2KI6C 4U8DA 3TZ1A 3VROA 5JJGA 1UWOA 2BCAA 3CGAA 4OV2A 1QTXA 1ZUZA 1R2UA 5KTYA 4GGFA 1DJXA 3LK0A 4CPVA 1ZOTB 1BR1B 5PALA 2PVBA 4N5XA 1K9PA 2M49B 1XYDA 2KFFA 3SG5A 3FWCA 3FIAA 4YGAA 1BMOA 1CKKA 1DVIA 2LE9B 2M1UA 2O60A 1UHJA 3PFVA 4BY5A 4GFTA 1WDCC 4ORAB 5CSFA 2O5GA 1DJWA 1S3PA 2EC6C 1A29A 1YURA 1EH2A 2M1KB 3EVUA 1NYAA 1TIZA 1N0YA 2LVJA 1EXRA 2EC6B 4YGDB 1JBAA 4DS7A 3CR5X 4MBEA 5AEQA 2KGRA 1PK0D 2CNPA 1SR6C 2JXLA 1K2HA 1YRUB 4XJKA 2R2IA 5HLOA 1U5IB 2G9BA 4M2QA 3SJSA 4I5KA 3PATA 2ISDA 3GK4X 1F70A 1CDLA 2M7NA 2F33A 4C0LA 1G4YR 2FOTA 3A4UB 3KPXA 1K9KA 2LV7A 4PHMA 4GUKA 2OPOA 2GGMA 1AUIB
chains in the Genus database with same CATH superfamily
3VRRA 3FS7A 3DF0A 1J7PA 2ZRSA 3JTDB 1S6CA 1RJVA 2LHIA 1Y1UA 4IL1A 1BOCA 5AANA 2E30A 1CLLA 1V1FA 1XK4C 3BOWB 4ZCVA 1YUUA 3LK1A 5EL2A 1OOGA 2F8PA 1SBJA 1DJZA 1CMFA 5DKQA 1YUSA 1TWOA 1Y0VH 2LP2A 1CDPA 4PDZA 5ER5A 1QX2A 2ZFDA 3RM1A 1XFWO 4DRWA 3QRXA 2JTZA 3BUMB 3I5FC 2K7CA 1K9UA 3OGNA 2H2KA 4YGEB 1EG4A 1OW4A 3I5FB 5HYDA 2K2AA 2HPSA 2LUXA 3D0YA 5AERA 5B8IB 1IIOA 1T14A 2JT0A 1BJFA 3O4XA 2M97A 1J7OA 5FYXA 2KI6D 2I18A 1D1OA 3FE9A 3BUWB 1PULA 2MHHA 2WCFA 1ODBA 4HRGA 1SCVA 1NCYA 2CCMA 4N1FA 5CSJA 1NPQA 1FBVA 2D8NA 4MRYA 1SMGA 1CDMA 3PM8A 1AK8A 2KQYA 2MRDA 4MLWA 4HRHA 4NDCA 1HQVA 1OE9B 1WLZA 2KSPA 3A8RA 5D3OA 5I8NA 2PRUA 1JFJA 1DELA 4USLA 1QATA 2JPTA 3LCPC 4MSPA 1KK8C 1H4BA 2M3WA 3LL8B 3EK4A 1LINA 1Q80A 2M8UA 1SYMA 2KAXA 3BJHA 3MSEB 1KK8B 1S5GZ 2Y4QA 1BU3A 1C07A 4D1EA 4A4BA 3OBVA 1RECA 1XA5A 4ETOA 1CFFA 3ZNIA 2KBIA 2LMVA 2KPHA 3GK2A 1B8RA 2ZKMX 1CM4A 3D76A 3S0GA 2L50A 3NGVA 3CTNA 3SG4A 1B7TY 1NX0A 3AAJA 2JPOA 1N2DA 4HREE 4KYNA 2BKIB 5J3XA 1OOJA 3TDIA 1KSOA 3V2LA 5HKYA 4M2OA 3O78A 2BCBA 5D69A 3B86A 2GV5A 1RWYA 3QMEA 1A4PA 1J7RA 1SK6D 1K90D 4UPGA 2L2CA 2M0RA 3Q8IA 3D77A 2QDIA 1XVJA 3NSKA 5FI2A 1K95A 2K7DA 1IQ3A 2F3ZA 4ZCUA 4XJKB 1E8AA 5HL1A 2MLEC 3I5HB 2K61A 3DY9A 2BCXA 4BY4A 4OR9B 2PALA 1SNLA 2F3YA 2L51A 1F8HA 3FWBA 2LNKA 2KYFA 1XFUO 1QX5B 4YGBB 1XFVO 1QXPA 1UHIA 3KF9A 3B6XA 2Q4UA 1OQPA 2WCHA 2G2BA 3EG5B 2LHLA 1JUOA 1XFXO 2MAZA 2H61A 5JOLA 3DVKA 1YR5A 3DF0B 3OB1B 3BXKA 4NDBA 1BT6A 3JVTC 2ZNDA 3EK7A 1WY9A 3OHMB 3ZWHA 3B88A 4PT1A 1QWVA 3JVTB 2OS8C 3EVVA 1A75A 2HETA 1B1GA 3CR2A 1NWDA 1WDCB 4PE7A 1NX1A 2BNXA 2K0JA 2OS8B 1EL4A 1OZOA 1YUTA 2LVVA 2NCOA 4Q04A 3NSIA 1A2XA 2JRFA 1JF2A 2FJUB 3K21A 1WRZA 3PLFB 4PALA 4WQ3A 1SR6B 2CTNA 2B1UA 1LXFC 4L9MA 4YBHB 1M63B 1SL8A 1SY9A 2HQ8A 3AAKA 3SIAA 2BAPA 1NCXA 2TN4A 3D74A 3R1PA 4GNKB 2LUCA 3WNXB 2CXJA 2JULA 3TUYC 2KHNA 2JWWA 5CPVA 2K7OA 1M46A 3TUYB 3M0WA 1EJ3A 1GQMA 4PE1A 3PALA 4FQTA 1ZACA 2WNDA 1SSEB 2NCPA 2WCBA 3D73A 3N7HA 3OB2B 1DJGA 1OMRA 1QVIY 1L2OC 3BQ3A 3UO9A 1F71A 1MXLC 1F54A 3OP0A 1KK7Y 1UURA 2WCKA 1L2OB 2KAVA 5IBWA 1KQVA 1WRKA 5DICA 5FI6A 4PE4A 2BBNA 2JT3A 4QJ5B 3LLEA 1SRAA 1DGVA 4F0ZB 2PYQA 3CS1A 1GGZA 3WXAA 2LAPA 3VRPA 1DTLA 3FE6A 1QV0A 3DVJA 2JZIA 2KNEA 3WHTB 4MRXA 1Y1XA 3PSRA 3D10A 1XFYO 3IQQA 2AAOA 3BFBA 1NIWA 2JNFA 1CFCA 3SG3A 2ZRTA 4R1EA 3PM2A 2KGBC 1AJ4A 1JSAA 3CZ2A 2EHBA 1DMOA 3CZTX 4IJ7A 1KFXL 3KO0A 1HT9A 1CB1A 1J55A 1WRLA 4P5OE 1SPYA 3DVMA 4JKTA 1H8BA 3C1VA 1V1GA 1CDNA 2F2OA 1RFJA 3ICBA 1JWDA 3SS5A 1UHHA 1U5IA 1M39A 2K8MB 3R1OA 5F6TA 3B7AA 1BF5A 2L4IA 2QEBA 1GM0A 2MA2A 1AJ5A 3NSLA 2HF5A 4MN0A 1MWNA 1OZSA 2JTTA 2LLTA 2PASA 2SASA 4MZJA 3O4YA 3KEVA 4AQIA 1SL9A 4M2PA 1QIWA 2CT9A 2WORA 3DXLA 1LA3A 2LANA 3VRNA 3DVEA 1SW8A 5G08A 2M9GA 1ORGA 4CLNA 2P6BB 1KFUL 2ZNEA 1YTZC 2NZ0A 4INXA 4MZLA 1BG1A 2JXCA 1IQ5A 1MHOA 2L0PA 2YGUA 2H61C 5CSNA 1TNPA 3BYAA 3BOWA 4C0JA 1M45A 1DQEA 2DOQA 2BL0C 1CFPA 2BE6A 3NSOA 3S0BA 3WHUB 4OKHA 2HQWA 4CFRA 5KU1A 1TRFA 1DEKA 3H4SE 4TNCA 1C7WA 1PVAA 4GAOA 1YX8A 4MEWA 4JPZB 1XFRA 1RTP1 2CBLA 2GGZA 1WLMA 2FCDA 4AQJA 3F45A 1SCMC 2F2PA 1OOIX 2WC8A 3DD4A 2MJWB 2NXQA 1F4OA 1Y6WA 1L7ZA 2MBXA 1DT7B 1CM1A 1MUXA 1KQMC 1TUZA 5TNCA 1RROA 4ORBB 4E68A 1OSAA 5DKNA 2BE4A 1FI5A 4P2YB 2FCEA 1TN4A 1C3ZA 3SG6A 3AKBA 1IH0A 3E3RA 2M7LA 1MF8B 1S1EA 5AFPA 4HSZA 3S0EA 1K94A 3IQOA 1PRWA 1B8LA 2FJYA 1XFZO 3EKJA 1B7TZ 2LVKA 2WOSA 2JQ6A 1IRJA 1SKTA 1CNPA 1IGVA 1YVLA 1TNXA 1TNQA 2I2RE 2JC2A 1OMVA 3CR4X 4PHKA 5D7FA 1BR4B 3IVTA 4PHJA 3L4AA 4JD9A 1NCZA 4DUQA 2LMUA 2AUCA 3OX5A 1CTRA 3NHIA 4GGNA 1DJHA 5I2QA 2KOTA 1UUSA 1K93D 1IJ5A 3EK8A 3SG2A 2KFHA 2EGDA 3CYZA 3OX6A 4ICBA 5BPJA 1QX7A 2I94A 2KFGA 2Y1NA 2KI4C 2Y5IA 4ORCB 5HKZA 2JNXA 5K89A 3D0YB 5FI7A 1QLSA 1PVBA 1QS7A 2LLSA 2KI4B 2WCLA 3BFAA 3CWGA 3CDNA 2E6WA 1R6PA 3TDUA 4CFQA 2WCEA 4NDDA 2KAYA 2QEOA 4OCIA 3TDZA 2SCPA 4A4CA 1KWOC 1BLQA 1CFDA 1KFXS 1G8IA 2WCJA 1FPWA 1KWOB 1YRTB 3KHEA 2A4JA 2JOJA 4FTGA 1DF0A 1J1DA 1VRKA 5AXIA 3RZSA 1FF1A 1JFKA 2OTGC 4DCKA 4C0KA 1P28A 1PSBA 1RK9A 2QPTA 2L5YA 3SS3A 1XO5A 2K2FA 4YI9A 1A03A 2OTGB 1QASA 3CABA 5DKRA 4GPLB 2LCPA 1QIVA 3IF7A 1Z2CB 2L98A 1AHRA 2PSRA 1TOPA 1NP8A 2KBMA 5I2LA 3HX4A 2JT8A 2P70A 3B87A 2BKHB 3BUNB 3JTDC 1G33A 1K8UA 1ZFSA 1OOFA 1B9AA 3O2PA 3HCMA 3VRQA 1M31A 3SS4A 2KDHA 1KFUS 1PALA 1S26D 2NLNA 2QACA 4MZKA 2Y1MA 4I5LB 1C3YA 2GTEA 2ZN9A 4N1GA 3NXAA 2COLB 1CLBA 1S6IA 1X02A 5GQQC 1J1EA 3D78A 4PCWA 1SL7A 1CLMA 1MQ1A 4AOMA 2KYCA 1MXEA 1S5GY 2LM5A 2QEVA 1ALVA 1AP4A 1DJIA 3GOFA 3NHTA 5HKWA 1QVIZ 1NSHA 1NX3A 3BUXB 1KK7Z 3PN7C 2LC5A 5KSZA 1W9ZA 1Y1AA 1B47A 3CLNA 5I2OA 3BFHA 3S0AA 3AKAA 4F7FA 2BBMA 1MR8A 1K96A 1PSRA 2QEHA 3L47A 3PN7B 4WQ2A 1IWQA 1TNWA 1F55A 2RGIA 1ZMZA 2Q91A 4I5NB 2PMYA 3FE8A 1TUJA 3R1VA 5ER4X 1LA0A 3DYEA 2V53A 1YVHA 2LLUA 2BECA 1ALWA 2P71A 1GGWA 1KSMA 1TCFA 2VRGA 4JQ0D 1B8CA 2WC6A 4PHNA 4WRIA 1FW4A 1IJ6A 1IG5A 1QV1A 4YGCB 1TTXA 3I5GC 1GJYA 1LVCD 2L5XB 3EKHA 2AMIA 3L4LA 1JF0A 5CSIA 1XK4A 4I5JA 3I5GB 1W7IB 4YI8A 4CIDA 1TCOB 2BL0B 4QJ3B 1IKUA 2IS9A 2K7BA 1A75B 1CMGA 3VGOA 2LVIA 1C7VA 4GGFC 1JC2A 3BUOB 4YRUA 2L4HA 1DGUA 4MVFA 3I5IC 3EVRA 1UP5A 2I7AA 2MLFC 1NX2A 1BODA 2K60A 3I5IB 1EG3A 1SCMB 1LS8A 2LMTA 3CZ0A 3RLZA 2ZN8A 3O6BA 1N65A 4QJ4B 2KQ6A 1FI6A 1UHNA 1KCYA 2JU0A 1QLKA 4JWQA 1B4CA 4XYNA 4DIRA 1W7JB 1KQMB 1DJYA 1S36A 5HLVA 3SIBA 2LP3A 2WC5A 1YX7A 3SG7A 1NUBA 2ERBA 3TS5C 4PE0A 4NQGA 1LKJA 3K1EA 4OVNF 1J7QA 1OMDA 1UHKA 3TS5B 1QJTA 1AVSA 1S6JA 3CZ1A 3S0FA 3I5HC 2L2EA 1DF0B 2M29A 1F4QA 4FQOA 3GK1A 4GBAA 2KI6C 4U8DA 3TZ1A 3VB1A 3VROA 5JJGA 1UWOA 2BCAA 3CGAA 4OV2A 1QTXA 1ZUZA 1R2UA 4OZDA 5KTYA 4INWA 4GGFA 3R72A 1DJXA 3LK0A 4CPVA 1ZOTB 2KLEA 1BR1B 1Z4HA 2PVBA 4N5XA 5PALA 5I94A 1K9PA 2M49B 1DC1A 1XYDA 2WCMA 3PJIA 2KFFA 3SG5A 1OOHA 3FIAA 2H8VA 3FWCA 1BMOA 4YGAA 1CKKA 1DVIA 2LE9B 2M1UA 2O60A 1UHJA 3PFVA 4BY5A 4GFTA 1WDCC 4ORAB 5CSFA 2O5GA 1DJWA 1S3PA 2EC6C 1A29A 1YURA 1EH2A 2M1KB 3EVUA 1NYAA 1TIZA 1N0YA 2LVJA 1EXRA 2EC6B 4YGDB 1JBAA 4DS7A 3CR5X 4MBEA 5AEQA 2KGRA 1PK0D 2CNPA 1SR6C 2JXLA 1K2HA 1YRUB 4XJKA 2R2IA 3DZTA 1U5IB 5HLOA 2G9BA 4M2QA 3SJSA 4I5KA 3PATA 2ISDA 2PQLA 3GK4X 1F70A 1CDLA 2M7NA 2F33A 2KLDA 3S0DA 4C0LA 1G4YR 2FOTA 3A4UB 3KPXA 1K9KA 2LV7A 4PHMA 3UNWA 4GUKA 2OPOA 2GGMA 3D75A 1AUIB
chains in the Genus database with same CATH topology
3VRRA 3FS7A 3DF0A 1J7PA 2ZRSA 3JTDB 1S6CA 1RJVA 2LHIA 1Y1UA 4IL1A 1BOCA 5AANA 2E30A 1CLLA 1V1FA 1XK4C 3BOWB 4ZCVA 1YUUA 3LK1A 2F8PA 1SBJA 1DJZA 1CMFA 5DKQA 1YUSA 1Y0VH 2LP2A 1CDPA 4PDZA 5ER5A 1QX2A 2ZFDA 3RM1A 1XFWO 4DRWA 3QRXA 2JTZA 3BUMB 3I5FC 2K7CA 1K9UA 4YGEB 2H2KA 1EG4A 3I5FB 5HYDA 2K2AA 2HPSA 2LUXA 3D0YA 5AERA 5B8IB 2JT0A 1BJFA 2M97A 1J7OA 5FYXA 2KI6D 2I18A 1D1OA 3BUWB 1PULA 2MHHA 2WCFA 1ODBA 4HRGA 1SCVA 1NCYA 2CCMA 4N1FA 5CSJA 1NPQA 1FBVA 2D8NA 4MRYA 1SMGA 1CDMA 3PM8A 1AK8A 2KQYA 2MRDA 4MLWA 4HRHA 4NDCA 1HQVA 1OE9B 1WLZA 2KSPA 3A8RA 5I8NA 2PRUA 1JFJA 4USLA 1QATA 2JPTA 3LCPC 4MSPA 1KK8C 1H4BA 2M3WA 3LL8B 3EK4A 1LINA 1Q80A 2M8UA 1SYMA 2KAXA 3MSEB 1KK8B 1S5GZ 2Y4QA 1BU3A 1C07A 4D1EA 4A4BA 1RECA 1XA5A 4ETOA 1CFFA 3ZNIA 2KBIA 2LMVA 3GK2A 1B8RA 2ZKMX 1CM4A 3SG4A 2L50A 3CTNA 1B7TY 1NX0A 3AAJA 1N2DA 4HREE 2BKIB 5J3XA 1OOJA 3TDIA 1KSOA 5HKYA 4M2OA 3O78A 2BCBA 5D69A 2GV5A 1RWYA 1A4PA 1J7RA 1SK6D 1K90D 4UPGA 2M0RA 1XVJA 3NSKA 1K95A 2K7DA 1IQ3A 2F3ZA 4ZCUA 4XJKB 1E8AA 2MLEC 3I5HB 2K61A 2BCXA 4BY4A 4OR9B 2PALA 1SNLA 2F3YA 2L51A 1F8HA 3FWBA 2LNKA 2KYFA 1XFUO 1QX5B 4YGBB 1XFVO 1QXPA 1UHIA 3KF9A 2Q4UA 1OQPA 2G2BA 2LHLA 1JUOA 1XFXO 2MAZA 2H61A 5JOLA 3DVKA 1YR5A 3DF0B 3OB1B 3BXKA 4NDBA 1BT6A 3JVTC 2ZNDA 3EK7A 1WY9A 3OHMB 3ZWHA 3JVTB 2OS8C 3EVVA 1A75A 2HETA 1B1GA 3CR2A 1NWDA 1WDCB 4PE7A 1NX1A 2K0JA 2OS8B 1EL4A 1OZOA 1YUTA 2LVVA 2NCOA 4Q04A 3NSIA 1A2XA 2JRFA 1JF2A 2FJUB 3K21A 1WRZA 3PLFB 4PALA 4WQ3A 1SR6B 2CTNA 2B1UA 1LXFC 4L9MA 4YBHB 1M63B 1SL8A 1SY9A 2HQ8A 3AAKA 3SIAA 1CFPA 1NCXA 2TN4A 3TUYC 4GNKB 2LUCA 3WNXB 2CXJA 2JULA 2KHNA 2JWWA 5CPVA 2K7OA 1M46A 3TUYB 3M0WA 1EJ3A 1GQMA 4PE1A 3PALA 1ZACA 2WNDA 2NCPA 2WCBA 3OB2B 1DJGA 1OMRA 1QVIY 1L2OC 3BQ3A 1F71A 1MXLC 1F54A 3OP0A 1KK7Y 1UURA 1L2OB 2KAVA 5IBWA 1KQVA 1WRKA 4PE4A 2BBNA 2JT3A 4QJ5B 3LLEA 1SRAA 1DGVA 4F0ZB 3CS1A 1GGZA 3WXAA 2LAPA 3VRPA 1DTLA 1QV0A 3DVJA 2JZIA 2KNEA 3WHTB 4MRXA 1Y1XA 3PSRA 3D10A 1XFYO 3IQQA 2AAOA 1NIWA 2JNFA 1CFCA 3SG3A 2ZRTA 4R1EA 2KGBC 1AJ4A 1JSAA 2EHBA 1DMOA 3CZTX 1KFXL 3KO0A 1HT9A 1CB1A 1J55A 1WRLA 4P5OE 1SPYA 3DVMA 1H8BA 3C1VA 1V1GA 1CDNA 2F2OA 1RFJA 3ICBA 1JWDA 1UHHA 1U5IA 1M39A 2K8MB 5F6TA 1BF5A 2L4IA 2MA2A 1AJ5A 3NSLA 2HF5A 4MN0A 1MWNA 1OZSA 2JTTA 2LLTA 2PASA 2SASA 4MZJA 3O4YA 3KEVA 4AQIA 1SL9A 4M2PA 1QIWA 2CT9A 2WORA 1LA3A 2LANA 3VRNA 3DVEA 1SW8A 5G08A 2M9GA 4CLNA 2P6BB 1KFUL 2ZNEA 1YTZC 2NZ0A 4MZLA 1BG1A 2JXCA 1IQ5A 1MHOA 2L0PA 2H61C 5CSNA 1TNPA 3BYAA 3BOWA 4C0JA 1M45A 2DOQA 2BL0C 2BE6A 3NSOA 3WHUB 4OKHA 2HQWA 4CFRA 5KU1A 1TRFA 3H4SE 4TNCA 1C7WA 1PVAA 4GAOA 1YX8A 4MEWA 4JPZB 1RTP1 2CBLA 2GGZA 1WLMA 2FCDA 4AQJA 3F45A 1SCMC 2F2PA 2WC8A 3DD4A 2MJWB 2NXQA 1F4OA 1Y6WA 1L7ZA 2MBXA 1DT7B 1CM1A 1MUXA 1KQMC 5TNCA 1RROA 4ORBB 4E68A 1OSAA 5DKNA 2BE4A 1FI5A 4P2YB 2FCEA 1TN4A 3SG6A 1IH0A 3AKBA 3E3RA 2M7LA 1MF8B 1S1EA 5AFPA 4HSZA 1K94A 3IQOA 1PRWA 1B8LA 1XFZO 3EKJA 1B7TZ 2LVKA 2WOSA 2JQ6A 1IRJA 1SKTA 1CNPA 1IGVA 1YVLA 1TNXA 1TNQA 2I2RE 2JC2A 1OMVA 3CR4X 4PHKA 5D7FA 1BR4B 4PHJA 1NCZA 4DUQA 2LMUA 2AUCA 3OX5A 1CTRA 4GGNA 1DJHA 5I2QA 2KOTA 1UUSA 1K93D 1IJ5A 3EK8A 3SG2A 2KFHA 2EGDA 4ICBA 3OX6A 5BPJA 1QX7A 2I94A 2KFGA 2Y1NA 2KI4C 2Y5IA 4ORCB 5HKZA 2JNXA 5K89A 3D0YB 1QLSA 1PVBA 1QS7A 2LLSA 2KI4B 3CWGA 2E6WA 1R6PA 3TDUA 4CFQA 2WCEA 4NDDA 2KAYA 4A4CA 4OCIA 3TDZA 2SCPA 1BLQA 1KWOC 1CFDA 1KFXS 1G8IA 1FPWA 1KWOB 1YRTB 3KHEA 2A4JA 2JOJA 4FTGA 1DF0A 1J1DA 1VRKA 5AXIA 1FF1A 1JFKA 2OTGC 4DCKA 4C0KA 1PSBA 1RK9A 2QPTA 1XO5A 2K2FA 4YI9A 1A03A 2OTGB 1QASA 5DKRA 4GPLB 2LCPA 1QIVA 3IF7A 2L98A 1AHRA 2PSRA 1TOPA 1NP8A 2KBMA 5I2LA 3HX4A 2JT8A 2BKHB 3BUNB 3JTDC 1G33A 1K8UA 1ZFSA 1B9AA 3O2PA 3HCMA 3VRQA 1M31A 2KDHA 1KFUS 1PALA 1S26D 2NLNA 2QACA 4MZKA 2Y1MA 4I5LB 2ZN9A 4N1GA 3NXAA 2COLB 1CLBA 1S6IA 1X02A 5GQQC 1J1EA 4PCWA 1SL7A 1CLMA 1MQ1A 4AOMA 2KYCA 1MXEA 1S5GY 2LM5A 1ALVA 1AP4A 1DJIA 3GOFA 5HKWA 1QVIZ 1NSHA 1NX3A 3BUXB 1KK7Z 3PN7C 2LC5A 5KSZA 1Y1AA 1B47A 3CLNA 5I2OA 3AKAA 2BBMA 1MR8A 1K96A 1PSRA 3PN7B 4WQ2A 1F55A 1IWQA 1TNWA 2RGIA 1ZMZA 2Q91A 4I5NB 2PMYA 5ER4X 1LA0A 2V53A 1YVHA 2LLUA 2BECA 1ALWA 1GGWA 1KSMA 1TCFA 2VRGA 4JQ0D 1B8CA 4PHNA 4WRIA 1FW4A 1IJ6A 1IG5A 1QV1A 4YGCB 1TTXA 3I5GC 1GJYA 1LVCD 2L5XB 3EKHA 2AMIA 1JF0A 5CSIA 1XK4A 4I5JA 3I5GB 1W7IB 4YI8A 4CIDA 1TCOB 2BL0B 4QJ3B 1IKUA 2IS9A 2K7BA 1A75B 1CMGA 3VGOA 2LVIA 1C7VA 4GGFC 1JC2A 3BUOB 4YRUA 2L4HA 1DGUA 4MVFA 3I5IC 3EVRA 1UP5A 2I7AA 2MLFC 1NX2A 1BODA 3I5IB 1EG3A 1SCMB 2LMTA 3RLZA 2ZN8A 3O6BA 1N65A 4QJ4B 2KQ6A 1FI6A 1UHNA 1KCYA 2JU0A 1QLKA 4JWQA 1B4CA 4XYNA 4DIRA 1W7JB 1KQMB 1DJYA 1S36A 5HLVA 3SIBA 2LP3A 1YX7A 3SG7A 1NUBA 3TS5C 4PE0A 4NQGA 1LKJA 1J7QA 4OVNF 1OMDA 1UHKA 3TS5B 1QJTA 1AVSA 1S6JA 3I5HC 2L2EA 1DF0B 2M29A 1F4QA 4FQOA 3GK1A 4GBAA 2KI6C 4U8DA 3TZ1A 3VROA 5JJGA 1UWOA 2BCAA 3CGAA 4OV2A 1QTXA 1ZUZA 1R2UA 5KTYA 4GGFA 1DJXA 3LK0A 4CPVA 1ZOTB 1BR1B 5PALA 2PVBA 4N5XA 1K9PA 2M49B 1XYDA 2KFFA 3SG5A 3FWCA 3FIAA 4YGAA 1BMOA 1CKKA 1DVIA 2LE9B 2M1UA 2O60A 1UHJA 3PFVA 4BY5A 4GFTA 1WDCC 4ORAB 5CSFA 2O5GA 1DJWA 1S3PA 2EC6C 1A29A 1YURA 1EH2A 2M1KB 3EVUA 1NYAA 1TIZA 1N0YA 2LVJA 1EXRA 2EC6B 4YGDB 1JBAA 4DS7A 3CR5X 4MBEA 5AEQA 2KGRA 1PK0D 2CNPA 1SR6C 2JXLA 1K2HA 1YRUB 4XJKA 2R2IA 5HLOA 1U5IB 2G9BA 4M2QA 3SJSA 4I5KA 3PATA 2ISDA 3GK4X 1F70A 1CDLA 2M7NA 2F33A 4C0LA 1G4YR 2FOTA 3A4UB 3KPXA 1K9KA 2LV7A 4PHMA 4GUKA 2OPOA 2GGMA 1AUIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRR A;  3FS7 A;  3DF0 A;  1J7P A;  2ZRS A;  3JTD B;  1S6C A;  1RJV A;  2LHI A;  1Y1U A;  4IL1 A;  1BOC A;  5AAN A;  2E30 A;  1CLL A;  1V1F A;  1XK4 C;  3BOW B;  4ZCV A;  1YUU A;  3LK1 A;  2F8P A;  1SBJ A;  1DJZ A;  1CMF A;  5DKQ A;  1YUS A;  1Y0V H;  2LP2 A;  1CDP A;  4PDZ A;  5ER5 A;  1QX2 A;  2ZFD A;  3RM1 A;  1XFW O;  4DRW A;  3QRX A;  2JTZ A;  3BUM B;  3I5F C;  2K7C A;  1K9U A;  4YGE B;  2H2K A;  1EG4 A;  3I5F B;  5HYD A;  2K2A A;  2HPS A;  2LUX A;  3D0Y A;  5AER A;  5B8I B;  2JT0 A;  1BJF A;  2M97 A;  1J7O A;  5FYX A;  2KI6 D;  2I18 A;  1D1O A;  3BUW B;  1PUL A;  2MHH A;  2WCF A;  1ODB A;  4HRG A;  1SCV A;  1NCY A;  2CCM A;  4N1F A;  5CSJ A;  1NPQ A;  1FBV A;  2D8N A;  4MRY A;  1SMG A;  1CDM A;  3PM8 A;  1AK8 A;  2KQY A;  2MRD A;  4MLW A;  4HRH A;  4NDC A;  1HQV A;  1OE9 B;  1WLZ A;  2KSP A;  3A8R A;  5I8N A;  2PRU A;  1JFJ A;  4USL A;  1QAT A;  2JPT A;  3LCP C;  4MSP A;  1KK8 C;  1H4B A;  2M3W A;  3LL8 B;  3EK4 A;  1LIN A;  1Q80 A;  2M8U A;  1SYM A;  2KAX A;  3MSE B;  1KK8 B;  1S5G Z;  2Y4Q A;  1BU3 A;  1C07 A;  4D1E A;  4A4B A;  1REC A;  1XA5 A;  4ETO A;  1CFF A;  3ZNI A;  2KBI A;  2LMV A;  3GK2 A;  1B8R A;  2ZKM X;  1CM4 A;  3SG4 A;  2L50 A;  3CTN A;  1B7T Y;  1NX0 A;  3AAJ A;  1N2D A;  4HRE E;  2BKI B;  5J3X A;  1OOJ A;  3TDI A;  1KSO A;  5HKY A;  4M2O A;  3O78 A;  2BCB A;  5D69 A;  2GV5 A;  1RWY A;  1A4P A;  1J7R A;  1SK6 D;  1K90 D;  4UPG A;  2M0R A;  1XVJ A;  3NSK A;  1K95 A;  2K7D A;  1IQ3 A;  2F3Z A;  4ZCU A;  4XJK B;  1E8A A;  2MLE C;  3I5H B;  2K61 A;  2BCX A;  4BY4 A;  4OR9 B;  2PAL A;  1SNL A;  2F3Y A;  2L51 A;  1F8H A;  3FWB A;  2LNK A;  2KYF A;  1XFU O;  1QX5 B;  4YGB B;  1XFV O;  1QXP A;  1UHI A;  3KF9 A;  2Q4U A;  1OQP A;  2G2B A;  2LHL A;  1JUO A;  1XFX O;  2MAZ A;  2H61 A;  5JOL A;  3DVK A;  1YR5 A;  3DF0 B;  3OB1 B;  3BXK A;  4NDB A;  1BT6 A;  3JVT C;  2ZND A;  3EK7 A;  1WY9 A;  3OHM B;  3ZWH A;  3JVT B;  2OS8 C;  3EVV A;  1A75 A;  2HET A;  1B1G A;  3CR2 A;  1NWD A;  1WDC B;  4PE7 A;  1NX1 A;  2K0J A;  2OS8 B;  1EL4 A;  1OZO A;  1YUT A;  2LVV A;  2NCO A;  4Q04 A;  3NSI A;  1A2X A;  2JRF A;  1JF2 A;  2FJU B;  3K21 A;  1WRZ A;  3PLF B;  4PAL A;  4WQ3 A;  1SR6 B;  2CTN A;  2B1U A;  1LXF C;  4L9M A;  4YBH B;  1M63 B;  1SL8 A;  1SY9 A;  2HQ8 A;  3AAK A;  3SIA A;  1CFP A;  1NCX A;  2TN4 A;  3TUY C;  4GNK B;  2LUC A;  3WNX B;  2CXJ A;  2JUL A;  2KHN A;  2JWW A;  5CPV A;  2K7O A;  1M46 A;  3TUY B;  3M0W A;  1EJ3 A;  1GQM A;  4PE1 A;  3PAL A;  1ZAC A;  2WND A;  2NCP A;  2WCB A;  3OB2 B;  1DJG A;  1OMR A;  1QVI Y;  1L2O C;  3BQ3 A;  1F71 A;  1MXL C;  1F54 A;  3OP0 A;  1KK7 Y;  1UUR A;  1L2O B;  2KAV A;  5IBW A;  1KQV A;  1WRK A;  4PE4 A;  2BBN A;  2JT3 A;  4QJ5 B;  3LLE A;  1SRA A;  1DGV A;  4F0Z B;  3CS1 A;  1GGZ A;  3WXA A;  2LAP A;  3VRP A;  1DTL A;  1QV0 A;  3DVJ A;  2JZI A;  2KNE A;  3WHT B;  4MRX A;  1Y1X A;  3PSR A;  3D10 A;  1XFY O;  3IQQ A;  2AAO A;  1NIW A;  2JNF A;  1CFC A;  3SG3 A;  2ZRT A;  4R1E A;  2KGB C;  1AJ4 A;  1JSA A;  2EHB A;  1DMO A;  3CZT X;  1KFX L;  3KO0 A;  1HT9 A;  1CB1 A;  1J55 A;  1WRL A;  4P5O E;  1SPY A;  3DVM A;  1H8B A;  3C1V A;  1V1G A;  1CDN A;  2F2O A;  1RFJ A;  3ICB A;  1JWD A;  1UHH A;  1U5I A;  1M39 A;  2K8M B;  5F6T A;  1BF5 A;  2L4I A;  2MA2 A;  1AJ5 A;  3NSL A;  2HF5 A;  4MN0 A;  1MWN A;  1OZS A;  2JTT A;  2LLT A;  2PAS A;  2SAS A;  4MZJ A;  3O4Y A;  3KEV A;  4AQI A;  1SL9 A;  4M2P A;  1QIW A;  2CT9 A;  2WOR A;  1LA3 A;  2LAN A;  3VRN A;  3DVE A;  1SW8 A;  5G08 A;  2M9G A;  4CLN A;  2P6B B;  1KFU L;  2ZNE A;  1YTZ C;  2NZ0 A;  4MZL A;  1BG1 A;  2JXC A;  1IQ5 A;  1MHO A;  2L0P A;  2H61 C;  5CSN A;  1TNP A;  3BYA A;  3BOW A;  4C0J A;  1M45 A;  2DOQ A;  2BL0 C;  2BE6 A;  3NSO A;  3WHU B;  4OKH A;  2HQW A;  4CFR A;  5KU1 A;  1TRF A;  3H4S E;  4TNC A;  1C7W A;  1PVA A;  4GAO A;  1YX8 A;  4MEW A;  4JPZ B;  1RTP 1;  2CBL A;  2GGZ A;  1WLM A;  2FCD A;  4AQJ A;  3F45 A;  1SCM C;  2F2P A;  2WC8 A;  3DD4 A;  2MJW B;  2NXQ A;  1F4O A;  1Y6W A;  1L7Z A;  2MBX A;  1DT7 B;  1CM1 A;  1MUX A;  1KQM C;  5TNC A;  1RRO A;  4ORB B;  4E68 A;  1OSA A;  5DKN A;  2BE4 A;  1FI5 A;  4P2Y B;  2FCE A;  1TN4 A;  3SG6 A;  1IH0 A;  3AKB A;  3E3R A;  2M7L A;  1MF8 B;  1S1E A;  5AFP A;  4HSZ A;  1K94 A;  3IQO A;  1PRW A;  1B8L A;  1XFZ O;  3EKJ A;  1B7T Z;  2LVK A;  2WOS A;  2JQ6 A;  1IRJ A;  1SKT A;  1CNP A;  1IGV A;  1YVL A;  1TNX A;  1TNQ A;  2I2R E;  2JC2 A;  1OMV A;  3CR4 X;  4PHK A;  5D7F A;  1BR4 B;  4PHJ A;  1NCZ A;  4DUQ A;  2LMU A;  2AUC A;  3OX5 A;  1CTR A;  4GGN A;  1DJH A;  5I2Q A;  2KOT A;  1UUS A;  1K93 D;  1IJ5 A;  3EK8 A;  3SG2 A;  2KFH A;  2EGD A;  4ICB A;  3OX6 A;  5BPJ A;  1QX7 A;  2I94 A;  2KFG A;  2Y1N A;  2KI4 C;  2Y5I A;  4ORC B;  5HKZ A;  2JNX A;  5K89 A;  3D0Y B;  1QLS A;  1PVB A;  1QS7 A;  2LLS A;  2KI4 B;  3CWG A;  2E6W A;  1R6P A;  3TDU A;  4CFQ A;  2WCE A;  4NDD A;  2KAY A;  4A4C A;  4OCI A;  3TDZ A;  2SCP A;  1BLQ A;  1KWO C;  1CFD A;  1KFX S;  1G8I A;  1FPW A;  1KWO B;  1YRT B;  3KHE A;  2A4J A;  2JOJ A;  4FTG A;  1DF0 A;  1J1D A;  1VRK A;  5AXI A;  1FF1 A;  1JFK A;  2OTG C;  4DCK A;  4C0K A;  1PSB A;  1RK9 A;  2QPT A;  1XO5 A;  2K2F A;  4YI9 A;  1A03 A;  2OTG B;  1QAS A;  5DKR A;  4GPL B;  2LCP A;  1QIV A;  3IF7 A;  2L98 A;  1AHR A;  2PSR A;  1TOP A;  1NP8 A;  2KBM A;  5I2L A;  3HX4 A;  2JT8 A;  2BKH B;  3BUN B;  3JTD C;  1G33 A;  1K8U A;  1ZFS A;  1B9A A;  3O2P A;  3HCM A;  3VRQ A;  1M31 A;  2KDH A;  1KFU S;  1PAL A;  1S26 D;  2NLN A;  2QAC A;  4MZK A;  2Y1M A;  4I5L B;  2ZN9 A;  4N1G A;  3NXA A;  2COL B;  1CLB A;  1S6I A;  1X02 A;  5GQQ C;  1J1E A;  4PCW A;  1SL7 A;  1CLM A;  1MQ1 A;  4AOM A;  2KYC A;  1MXE A;  1S5G Y;  2LM5 A;  1ALV A;  1AP4 A;  1DJI A;  3GOF A;  5HKW A;  1QVI Z;  1NSH A;  1NX3 A;  3BUX B;  1KK7 Z;  3PN7 C;  2LC5 A;  5KSZ A;  1Y1A A;  1B47 A;  3CLN A;  5I2O A;  3AKA A;  2BBM A;  1MR8 A;  1K96 A;  1PSR A;  3PN7 B;  4WQ2 A;  1F55 A;  1IWQ A;  1TNW A;  2RGI A;  1ZMZ A;  2Q91 A;  4I5N B;  2PMY A;  5ER4 X;  1LA0 A;  2V53 A;  1YVH A;  2LLU A;  2BEC A;  1ALW A;  1GGW A;  1KSM A;  1TCF A;  2VRG A;  4JQ0 D;  1B8C A;  4PHN A;  4WRI A;  1FW4 A;  1IJ6 A;  1IG5 A;  1QV1 A;  4YGC B;  1TTX A;  3I5G C;  1GJY A;  1LVC D;  2L5X B;  3EKH A;  2AMI A;  1JF0 A;  5CSI A;  1XK4 A;  4I5J A;  3I5G B;  1W7I B;  4YI8 A;  4CID A;  1TCO B;  2BL0 B;  4QJ3 B;  1IKU A;  2IS9 A;  2K7B A;  1A75 B;  1CMG A;  3VGO A;  2LVI A;  1C7V A;  4GGF C;  1JC2 A;  3BUO B;  4YRU A;  2L4H A;  1DGU A;  4MVF A;  3I5I C;  3EVR A;  1UP5 A;  2I7A A;  2MLF C;  1NX2 A;  1BOD A;  3I5I B;  1EG3 A;  1SCM B;  2LMT A;  3RLZ A;  2ZN8 A;  3O6B A;  1N65 A;  4QJ4 B;  2KQ6 A;  1FI6 A;  1UHN A;  1KCY A;  2JU0 A;  1QLK A;  4JWQ A;  1B4C A;  4XYN A;  4DIR A;  1W7J B;  1KQM B;  1DJY A;  1S36 A;  5HLV A;  3SIB A;  2LP3 A;  1YX7 A;  3SG7 A;  1NUB A;  3TS5 C;  4PE0 A;  4NQG A;  1LKJ A;  1J7Q A;  4OVN F;  1OMD A;  1UHK A;  3TS5 B;  1QJT A;  1AVS A;  1S6J A;  3I5H C;  2L2E A;  1DF0 B;  2M29 A;  1F4Q A;  4FQO A;  3GK1 A;  4GBA A;  2KI6 C;  4U8D A;  3TZ1 A;  3VRO A;  5JJG A;  1UWO A;  2BCA A;  3CGA A;  4OV2 A;  1QTX A;  1ZUZ A;  1R2U A;  5KTY A;  4GGF A;  1DJX A;  3LK0 A;  4CPV A;  1ZOT B;  1BR1 B;  5PAL A;  2PVB A;  4N5X A;  1K9P A;  2M49 B;  1XYD A;  2KFF A;  3SG5 A;  3FWC A;  3FIA A;  4YGA A;  1BMO A;  1CKK A;  1DVI A;  2LE9 B;  2M1U A;  2O60 A;  1UHJ A;  3PFV A;  4BY5 A;  4GFT A;  1WDC C;  4ORA B;  5CSF A;  2O5G A;  1DJW A;  1S3P A;  2EC6 C;  1A29 A;  1YUR A;  1EH2 A;  2M1K B;  3EVU A;  1NYA A;  1TIZ A;  1N0Y A;  2LVJ A;  1EXR A;  2EC6 B;  4YGD B;  1JBA A;  4DS7 A;  3CR5 X;  4MBE A;  5AEQ A;  2KGR A;  1PK0 D;  2CNP A;  1SR6 C;  2JXL A;  1K2H A;  1YRU B;  4XJK A;  2R2I A;  5HLO A;  1U5I B;  2G9B A;  4M2Q A;  3SJS A;  4I5K A;  3PAT A;  2ISD A;  3GK4 X;  1F70 A;  1CDL A;  2M7N A;  2F33 A;  4C0L A;  1G4Y R;  2FOT A;  3A4U B;  3KPX A;  1K9K A;  2LV7 A;  4PHM A;  4GUK A;  2OPO A;  2GGM A;  1AUI B; 
#chains in the Genus database with same CATH topology
 3VRR A;  3FS7 A;  3DF0 A;  1J7P A;  2ZRS A;  3JTD B;  1S6C A;  1RJV A;  2LHI A;  1Y1U A;  4IL1 A;  1BOC A;  5AAN A;  2E30 A;  1CLL A;  1V1F A;  1XK4 C;  3BOW B;  4ZCV A;  1YUU A;  3LK1 A;  5EL2 A;  1OOG A;  2F8P A;  1SBJ A;  1DJZ A;  1CMF A;  5DKQ A;  1YUS A;  1TWO A;  1Y0V H;  2LP2 A;  1CDP A;  4PDZ A;  5ER5 A;  1QX2 A;  2ZFD A;  3RM1 A;  1XFW O;  4DRW A;  3QRX A;  2JTZ A;  3BUM B;  3I5F C;  2K7C A;  1K9U A;  3OGN A;  2H2K A;  4YGE B;  1EG4 A;  1OW4 A;  3I5F B;  5HYD A;  2K2A A;  2HPS A;  2LUX A;  3D0Y A;  5AER A;  5B8I B;  1IIO A;  1T14 A;  2JT0 A;  1BJF A;  3O4X A;  2M97 A;  1J7O A;  5FYX A;  2KI6 D;  2I18 A;  1D1O A;  3FE9 A;  3BUW B;  1PUL A;  2MHH A;  2WCF A;  1ODB A;  4HRG A;  1SCV A;  1NCY A;  2CCM A;  4N1F A;  5CSJ A;  1NPQ A;  1FBV A;  2D8N A;  4MRY A;  1SMG A;  1CDM A;  3PM8 A;  1AK8 A;  2KQY A;  2MRD A;  4MLW A;  4HRH A;  4NDC A;  1HQV A;  1OE9 B;  1WLZ A;  2KSP A;  3A8R A;  5D3O A;  5I8N A;  2PRU A;  1JFJ A;  1DEL A;  4USL A;  1QAT A;  2JPT A;  3LCP C;  4MSP A;  1KK8 C;  1H4B A;  2M3W A;  3LL8 B;  3EK4 A;  1LIN A;  1Q80 A;  2M8U A;  1SYM A;  2KAX A;  3BJH A;  3MSE B;  1KK8 B;  1S5G Z;  2Y4Q A;  1BU3 A;  1C07 A;  4D1E A;  4A4B A;  3OBV A;  1REC A;  1XA5 A;  4ETO A;  1CFF A;  3ZNI A;  2KBI A;  2LMV A;  2KPH A;  3GK2 A;  1B8R A;  2ZKM X;  1CM4 A;  3D76 A;  3S0G A;  2L50 A;  3NGV A;  3CTN A;  3SG4 A;  1B7T Y;  1NX0 A;  3AAJ A;  2JPO A;  1N2D A;  4HRE E;  4KYN A;  2BKI B;  5J3X A;  1OOJ A;  3TDI A;  1KSO A;  3V2L A;  5HKY A;  4M2O A;  3O78 A;  2BCB A;  5D69 A;  3B86 A;  2GV5 A;  1RWY A;  3QME A;  1A4P A;  1J7R A;  1SK6 D;  1K90 D;  4UPG A;  2L2C A;  2M0R A;  3Q8I A;  3D77 A;  2QDI A;  1XVJ A;  3NSK A;  5FI2 A;  1K95 A;  2K7D A;  1IQ3 A;  2F3Z A;  4ZCU A;  4XJK B;  1E8A A;  5HL1 A;  2MLE C;  3I5H B;  2K61 A;  3DY9 A;  2BCX A;  4BY4 A;  4OR9 B;  2PAL A;  1SNL A;  2F3Y A;  2L51 A;  1F8H A;  3FWB A;  2LNK A;  2KYF A;  1XFU O;  1QX5 B;  4YGB B;  1XFV O;  1QXP A;  1UHI A;  3KF9 A;  3B6X A;  2Q4U A;  1OQP A;  2WCH A;  2G2B A;  3EG5 B;  2LHL A;  1JUO A;  1XFX O;  2MAZ A;  2H61 A;  5JOL A;  3DVK A;  1YR5 A;  3DF0 B;  3OB1 B;  3BXK A;  4NDB A;  1BT6 A;  3JVT C;  2ZND A;  3EK7 A;  1WY9 A;  3OHM B;  3ZWH A;  3B88 A;  4PT1 A;  1QWV A;  3JVT B;  2OS8 C;  3EVV A;  1A75 A;  2HET A;  1B1G A;  3CR2 A;  1NWD A;  1WDC B;  4PE7 A;  1NX1 A;  2BNX A;  2K0J A;  2OS8 B;  1EL4 A;  1OZO A;  1YUT A;  2LVV A;  2NCO A;  4Q04 A;  3NSI A;  1A2X A;  2JRF A;  1JF2 A;  2FJU B;  3K21 A;  1WRZ A;  3PLF B;  4PAL A;  4WQ3 A;  1SR6 B;  2CTN A;  2B1U A;  1LXF C;  4L9M A;  4YBH B;  1M63 B;  1SL8 A;  1SY9 A;  2HQ8 A;  3AAK A;  3SIA A;  2BAP A;  1NCX A;  2TN4 A;  3D74 A;  3R1P A;  4GNK B;  2LUC A;  3WNX B;  2CXJ A;  2JUL A;  3TUY C;  2KHN A;  2JWW A;  5CPV A;  2K7O A;  1M46 A;  3TUY B;  3M0W A;  1EJ3 A;  1GQM A;  4PE1 A;  3PAL A;  4FQT A;  1ZAC A;  2WND A;  1SSE B;  2NCP A;  2WCB A;  3D73 A;  3N7H A;  3OB2 B;  1DJG A;  1OMR A;  1QVI Y;  1L2O C;  3BQ3 A;  3UO9 A;  1F71 A;  1MXL C;  1F54 A;  3OP0 A;  1KK7 Y;  1UUR A;  2WCK A;  1L2O B;  2KAV A;  5IBW A;  1KQV A;  1WRK A;  5DIC A;  5FI6 A;  4PE4 A;  2BBN A;  2JT3 A;  4QJ5 B;  3LLE A;  1SRA A;  1DGV A;  4F0Z B;  2PYQ A;  3CS1 A;  1GGZ A;  3WXA A;  2LAP A;  3VRP A;  1DTL A;  3FE6 A;  1QV0 A;  3DVJ A;  2JZI A;  2KNE A;  3WHT B;  4MRX A;  1Y1X A;  3PSR A;  3D10 A;  1XFY O;  3IQQ A;  2AAO A;  3BFB A;  1NIW A;  2JNF A;  1CFC A;  3SG3 A;  2ZRT A;  4R1E A;  3PM2 A;  2KGB C;  1AJ4 A;  1JSA A;  3CZ2 A;  2EHB A;  1DMO A;  3CZT X;  4IJ7 A;  1KFX L;  3KO0 A;  1HT9 A;  1CB1 A;  1J55 A;  1WRL A;  4P5O E;  1SPY A;  3DVM A;  4JKT A;  1H8B A;  3C1V A;  1V1G A;  1CDN A;  2F2O A;  1RFJ A;  3ICB A;  1JWD A;  3SS5 A;  1UHH A;  1U5I A;  1M39 A;  2K8M B;  3R1O A;  5F6T A;  3B7A A;  1BF5 A;  2L4I A;  2QEB A;  1GM0 A;  2MA2 A;  1AJ5 A;  3NSL A;  2HF5 A;  4MN0 A;  1MWN A;  1OZS A;  2JTT A;  2LLT A;  2PAS A;  2SAS A;  4MZJ A;  3O4Y A;  3KEV A;  4AQI A;  1SL9 A;  4M2P A;  1QIW A;  2CT9 A;  2WOR A;  3DXL A;  1LA3 A;  2LAN A;  3VRN A;  3DVE A;  1SW8 A;  5G08 A;  2M9G A;  1ORG A;  4CLN A;  2P6B B;  1KFU L;  2ZNE A;  1YTZ C;  2NZ0 A;  4INX A;  4MZL A;  1BG1 A;  2JXC A;  1IQ5 A;  1MHO A;  2L0P A;  2YGU A;  2H61 C;  5CSN A;  1TNP A;  3BYA A;  3BOW A;  4C0J A;  1M45 A;  1DQE A;  2DOQ A;  2BL0 C;  1CFP A;  2BE6 A;  3NSO A;  3S0B A;  3WHU B;  4OKH A;  2HQW A;  4CFR A;  5KU1 A;  1TRF A;  1DEK A;  3H4S E;  4TNC A;  1C7W A;  1PVA A;  4GAO A;  1YX8 A;  4MEW A;  4JPZ B;  1XFR A;  1RTP 1;  2CBL A;  2GGZ A;  1WLM A;  2FCD A;  4AQJ A;  3F45 A;  1SCM C;  2F2P A;  1OOI X;  2WC8 A;  3DD4 A;  2MJW B;  2NXQ A;  1F4O A;  1Y6W A;  1L7Z A;  2MBX A;  1DT7 B;  1CM1 A;  1MUX A;  1KQM C;  1TUZ A;  5TNC A;  1RRO A;  4ORB B;  4E68 A;  1OSA A;  5DKN A;  2BE4 A;  1FI5 A;  4P2Y B;  2FCE A;  1TN4 A;  1C3Z A;  3SG6 A;  3AKB A;  1IH0 A;  3E3R A;  2M7L A;  1MF8 B;  1S1E A;  5AFP A;  4HSZ A;  3S0E A;  1K94 A;  3IQO A;  1PRW A;  1B8L A;  2FJY A;  1XFZ O;  3EKJ A;  1B7T Z;  2LVK A;  2WOS A;  2JQ6 A;  1IRJ A;  1SKT A;  1CNP A;  1IGV A;  1YVL A;  1TNX A;  1TNQ A;  2I2R E;  2JC2 A;  1OMV A;  3CR4 X;  4PHK A;  5D7F A;  1BR4 B;  3IVT A;  4PHJ A;  3L4A A;  4JD9 A;  1NCZ A;  4DUQ A;  2LMU A;  2AUC A;  3OX5 A;  1CTR A;  3NHI A;  4GGN A;  1DJH A;  5I2Q A;  2KOT A;  1UUS A;  1K93 D;  1IJ5 A;  3EK8 A;  3SG2 A;  2KFH A;  2EGD A;  3CYZ A;  3OX6 A;  4ICB A;  5BPJ A;  1QX7 A;  2I94 A;  2KFG A;  2Y1N A;  2KI4 C;  2Y5I A;  4ORC B;  5HKZ A;  2JNX A;  5K89 A;  3D0Y B;  5FI7 A;  1QLS A;  1PVB A;  1QS7 A;  2LLS A;  2KI4 B;  2WCL A;  3BFA A;  3CWG A;  3CDN A;  2E6W A;  1R6P A;  3TDU A;  4CFQ A;  2WCE A;  4NDD A;  2KAY A;  2QEO A;  4OCI A;  3TDZ A;  2SCP A;  4A4C A;  1KWO C;  1BLQ A;  1CFD A;  1KFX S;  1G8I A;  2WCJ A;  1FPW A;  1KWO B;  1YRT B;  3KHE A;  2A4J A;  2JOJ A;  4FTG A;  1DF0 A;  1J1D A;  1VRK A;  5AXI A;  3RZS A;  1FF1 A;  1JFK A;  2OTG C;  4DCK A;  4C0K A;  1P28 A;  1PSB A;  1RK9 A;  2QPT A;  2L5Y A;  3SS3 A;  1XO5 A;  2K2F A;  4YI9 A;  1A03 A;  2OTG B;  1QAS A;  3CAB A;  5DKR A;  4GPL B;  2LCP A;  1QIV A;  3IF7 A;  1Z2C B;  2L98 A;  1AHR A;  2PSR A;  1TOP A;  1NP8 A;  2KBM A;  5I2L A;  3HX4 A;  2JT8 A;  2P70 A;  3B87 A;  2BKH B;  3BUN B;  3JTD C;  1G33 A;  1K8U A;  1ZFS A;  1OOF A;  1B9A A;  3O2P A;  3HCM A;  3VRQ A;  1M31 A;  3SS4 A;  2KDH A;  1KFU S;  1PAL A;  1S26 D;  2NLN A;  2QAC A;  4MZK A;  2Y1M A;  4I5L B;  1C3Y A;  2GTE A;  2ZN9 A;  4N1G A;  3NXA A;  2COL B;  1CLB A;  1S6I A;  1X02 A;  5GQQ C;  1J1E A;  3D78 A;  4PCW A;  1SL7 A;  1CLM A;  1MQ1 A;  4AOM A;  2KYC A;  1MXE A;  1S5G Y;  2LM5 A;  2QEV A;  1ALV A;  1AP4 A;  1DJI A;  3GOF A;  3NHT A;  5HKW A;  1QVI Z;  1NSH A;  1NX3 A;  3BUX B;  1KK7 Z;  3PN7 C;  2LC5 A;  5KSZ A;  1W9Z A;  1Y1A A;  1B47 A;  3CLN A;  5I2O A;  3BFH A;  3S0A A;  3AKA A;  4F7F A;  2BBM A;  1MR8 A;  1K96 A;  1PSR A;  2QEH A;  3L47 A;  3PN7 B;  4WQ2 A;  1IWQ A;  1TNW A;  1F55 A;  2RGI A;  1ZMZ A;  2Q91 A;  4I5N B;  2PMY A;  3FE8 A;  1TUJ A;  3R1V A;  5ER4 X;  1LA0 A;  3DYE A;  2V53 A;  1YVH A;  2LLU A;  2BEC A;  1ALW A;  2P71 A;  1GGW A;  1KSM A;  1TCF A;  2VRG A;  4JQ0 D;  1B8C A;  2WC6 A;  4PHN A;  4WRI A;  1FW4 A;  1IJ6 A;  1IG5 A;  1QV1 A;  4YGC B;  1TTX A;  3I5G C;  1GJY A;  1LVC D;  2L5X B;  3EKH A;  2AMI A;  3L4L A;  1JF0 A;  5CSI A;  1XK4 A;  4I5J A;  3I5G B;  1W7I B;  4YI8 A;  4CID A;  1TCO B;  2BL0 B;  4QJ3 B;  1IKU A;  2IS9 A;  2K7B A;  1A75 B;  1CMG A;  3VGO A;  2LVI A;  1C7V A;  4GGF C;  1JC2 A;  3BUO B;  4YRU A;  2L4H A;  1DGU A;  4MVF A;  3I5I C;  3EVR A;  1UP5 A;  2I7A A;  2MLF C;  1NX2 A;  1BOD A;  2K60 A;  3I5I B;  1EG3 A;  1SCM B;  1LS8 A;  2LMT A;  3CZ0 A;  3RLZ A;  2ZN8 A;  3O6B A;  1N65 A;  4QJ4 B;  2KQ6 A;  1FI6 A;  1UHN A;  1KCY A;  2JU0 A;  1QLK A;  4JWQ A;  1B4C A;  4XYN A;  4DIR A;  1W7J B;  1KQM B;  1DJY A;  1S36 A;  5HLV A;  3SIB A;  2LP3 A;  2WC5 A;  1YX7 A;  3SG7 A;  1NUB A;  2ERB A;  3TS5 C;  4PE0 A;  4NQG A;  1LKJ A;  3K1E A;  4OVN F;  1J7Q A;  1OMD A;  1UHK A;  3TS5 B;  1QJT A;  1AVS A;  1S6J A;  3CZ1 A;  3S0F A;  3I5H C;  2L2E A;  1DF0 B;  2M29 A;  1F4Q A;  4FQO A;  3GK1 A;  4GBA A;  2KI6 C;  4U8D A;  3TZ1 A;  3VB1 A;  3VRO A;  5JJG A;  1UWO A;  2BCA A;  3CGA A;  4OV2 A;  1QTX A;  1ZUZ A;  1R2U A;  4OZD A;  5KTY A;  4INW A;  4GGF A;  3R72 A;  1DJX A;  3LK0 A;  4CPV A;  1ZOT B;  2KLE A;  1BR1 B;  1Z4H A;  2PVB A;  4N5X A;  5PAL A;  5I94 A;  1K9P A;  2M49 B;  1DC1 A;  1XYD A;  2WCM A;  3PJI A;  2KFF A;  3SG5 A;  1OOH A;  3FIA A;  2H8V A;  3FWC A;  1BMO A;  4YGA A;  1CKK A;  1DVI A;  2LE9 B;  2M1U A;  2O60 A;  1UHJ A;  3PFV A;  4BY5 A;  4GFT A;  1WDC C;  4ORA B;  5CSF A;  2O5G A;  1DJW A;  1S3P A;  2EC6 C;  1A29 A;  1YUR A;  1EH2 A;  2M1K B;  3EVU A;  1NYA A;  1TIZ A;  1N0Y A;  2LVJ A;  1EXR A;  2EC6 B;  4YGD B;  1JBA A;  4DS7 A;  3CR5 X;  4MBE A;  5AEQ A;  2KGR A;  1PK0 D;  2CNP A;  1SR6 C;  2JXL A;  1K2H A;  1YRU B;  4XJK A;  2R2I A;  3DZT A;  1U5I B;  5HLO A;  2G9B A;  4M2Q A;  3SJS A;  4I5K A;  3PAT A;  2ISD A;  2PQL A;  3GK4 X;  1F70 A;  1CDL A;  2M7N A;  2F33 A;  2KLD A;  3S0D A;  4C0L A;  1G4Y R;  2FOT A;  3A4U B;  3KPX A;  1K9K A;  2LV7 A;  4PHM A;  3UNW A;  4GUK A;  2OPO A;  2GGM A;  3D75 A;  1AUI B; 
#chains in the Genus database with same CATH homology
 3VRR A;  3FS7 A;  3DF0 A;  1J7P A;  2ZRS A;  3JTD B;  1S6C A;  1RJV A;  2LHI A;  1Y1U A;  4IL1 A;  1BOC A;  5AAN A;  2E30 A;  1CLL A;  1V1F A;  1XK4 C;  3BOW B;  4ZCV A;  1YUU A;  3LK1 A;  2F8P A;  1SBJ A;  1DJZ A;  1CMF A;  5DKQ A;  1YUS A;  1Y0V H;  2LP2 A;  1CDP A;  4PDZ A;  5ER5 A;  1QX2 A;  2ZFD A;  3RM1 A;  1XFW O;  4DRW A;  3QRX A;  2JTZ A;  3BUM B;  3I5F C;  2K7C A;  1K9U A;  4YGE B;  2H2K A;  1EG4 A;  3I5F B;  5HYD A;  2K2A A;  2HPS A;  2LUX A;  3D0Y A;  5AER A;  5B8I B;  2JT0 A;  1BJF A;  2M97 A;  1J7O A;  5FYX A;  2KI6 D;  2I18 A;  1D1O A;  3BUW B;  1PUL A;  2MHH A;  2WCF A;  1ODB A;  4HRG A;  1SCV A;  1NCY A;  2CCM A;  4N1F A;  5CSJ A;  1NPQ A;  1FBV A;  2D8N A;  4MRY A;  1SMG A;  1CDM A;  3PM8 A;  1AK8 A;  2KQY A;  2MRD A;  4MLW A;  4HRH A;  4NDC A;  1HQV A;  1OE9 B;  1WLZ A;  2KSP A;  3A8R A;  5I8N A;  2PRU A;  1JFJ A;  4USL A;  1QAT A;  2JPT A;  3LCP C;  4MSP A;  1KK8 C;  1H4B A;  2M3W A;  3LL8 B;  3EK4 A;  1LIN A;  1Q80 A;  2M8U A;  1SYM A;  2KAX A;  3MSE B;  1KK8 B;  1S5G Z;  2Y4Q A;  1BU3 A;  1C07 A;  4D1E A;  4A4B A;  1REC A;  1XA5 A;  4ETO A;  1CFF A;  3ZNI A;  2KBI A;  2LMV A;  3GK2 A;  1B8R A;  2ZKM X;  1CM4 A;  3SG4 A;  2L50 A;  3CTN A;  1B7T Y;  1NX0 A;  3AAJ A;  1N2D A;  4HRE E;  2BKI B;  5J3X A;  1OOJ A;  3TDI A;  1KSO A;  5HKY A;  4M2O A;  3O78 A;  2BCB A;  5D69 A;  2GV5 A;  1RWY A;  1A4P A;  1J7R A;  1SK6 D;  1K90 D;  4UPG A;  2M0R A;  1XVJ A;  3NSK A;  1K95 A;  2K7D A;  1IQ3 A;  2F3Z A;  4ZCU A;  4XJK B;  1E8A A;  2MLE C;  3I5H B;  2K61 A;  2BCX A;  4BY4 A;  4OR9 B;  2PAL A;  1SNL A;  2F3Y A;  2L51 A;  1F8H A;  3FWB A;  2LNK A;  2KYF A;  1XFU O;  1QX5 B;  4YGB B;  1XFV O;  1QXP A;  1UHI A;  3KF9 A;  2Q4U A;  1OQP A;  2G2B A;  2LHL A;  1JUO A;  1XFX O;  2MAZ A;  2H61 A;  5JOL A;  3DVK A;  1YR5 A;  3DF0 B;  3OB1 B;  3BXK A;  4NDB A;  1BT6 A;  3JVT C;  2ZND A;  3EK7 A;  1WY9 A;  3OHM B;  3ZWH A;  3JVT B;  2OS8 C;  3EVV A;  1A75 A;  2HET A;  1B1G A;  3CR2 A;  1NWD A;  1WDC B;  4PE7 A;  1NX1 A;  2K0J A;  2OS8 B;  1EL4 A;  1OZO A;  1YUT A;  2LVV A;  2NCO A;  4Q04 A;  3NSI A;  1A2X A;  2JRF A;  1JF2 A;  2FJU B;  3K21 A;  1WRZ A;  3PLF B;  4PAL A;  4WQ3 A;  1SR6 B;  2CTN A;  2B1U A;  1LXF C;  4L9M A;  4YBH B;  1M63 B;  1SL8 A;  1SY9 A;  2HQ8 A;  3AAK A;  3SIA A;  1CFP A;  1NCX A;  2TN4 A;  3TUY C;  4GNK B;  2LUC A;  3WNX B;  2CXJ A;  2JUL A;  2KHN A;  2JWW A;  5CPV A;  2K7O A;  1M46 A;  3TUY B;  3M0W A;  1EJ3 A;  1GQM A;  4PE1 A;  3PAL A;  1ZAC A;  2WND A;  2NCP A;  2WCB A;  3OB2 B;  1DJG A;  1OMR A;  1QVI Y;  1L2O C;  3BQ3 A;  1F71 A;  1MXL C;  1F54 A;  3OP0 A;  1KK7 Y;  1UUR A;  1L2O B;  2KAV A;  5IBW A;  1KQV A;  1WRK A;  4PE4 A;  2BBN A;  2JT3 A;  4QJ5 B;  3LLE A;  1SRA A;  1DGV A;  4F0Z B;  3CS1 A;  1GGZ A;  3WXA A;  2LAP A;  3VRP A;  1DTL A;  1QV0 A;  3DVJ A;  2JZI A;  2KNE A;  3WHT B;  4MRX A;  1Y1X A;  3PSR A;  3D10 A;  1XFY O;  3IQQ A;  2AAO A;  1NIW A;  2JNF A;  1CFC A;  3SG3 A;  2ZRT A;  4R1E A;  2KGB C;  1AJ4 A;  1JSA A;  2EHB A;  1DMO A;  3CZT X;  1KFX L;  3KO0 A;  1HT9 A;  1CB1 A;  1J55 A;  1WRL A;  4P5O E;  1SPY A;  3DVM A;  1H8B A;  3C1V A;  1V1G A;  1CDN A;  2F2O A;  1RFJ A;  3ICB A;  1JWD A;  1UHH A;  1U5I A;  1M39 A;  2K8M B;  5F6T A;  1BF5 A;  2L4I A;  2MA2 A;  1AJ5 A;  3NSL A;  2HF5 A;  4MN0 A;  1MWN A;  1OZS A;  2JTT A;  2LLT A;  2PAS A;  2SAS A;  4MZJ A;  3O4Y A;  3KEV A;  4AQI A;  1SL9 A;  4M2P A;  1QIW A;  2CT9 A;  2WOR A;  1LA3 A;  2LAN A;  3VRN A;  3DVE A;  1SW8 A;  5G08 A;  2M9G A;  4CLN A;  2P6B B;  1KFU L;  2ZNE A;  1YTZ C;  2NZ0 A;  4MZL A;  1BG1 A;  2JXC A;  1IQ5 A;  1MHO A;  2L0P A;  2H61 C;  5CSN A;  1TNP A;  3BYA A;  3BOW A;  4C0J A;  1M45 A;  2DOQ A;  2BL0 C;  2BE6 A;  3NSO A;  3WHU B;  4OKH A;  2HQW A;  4CFR A;  5KU1 A;  1TRF A;  3H4S E;  4TNC A;  1C7W A;  1PVA A;  4GAO A;  1YX8 A;  4MEW A;  4JPZ B;  1RTP 1;  2CBL A;  2GGZ A;  1WLM A;  2FCD A;  4AQJ A;  3F45 A;  1SCM C;  2F2P A;  2WC8 A;  3DD4 A;  2MJW B;  2NXQ A;  1F4O A;  1Y6W A;  1L7Z A;  2MBX A;  1DT7 B;  1CM1 A;  1MUX A;  1KQM C;  5TNC A;  1RRO A;  4ORB B;  4E68 A;  1OSA A;  5DKN A;  2BE4 A;  1FI5 A;  4P2Y B;  2FCE A;  1TN4 A;  3SG6 A;  1IH0 A;  3AKB A;  3E3R A;  2M7L A;  1MF8 B;  1S1E A;  5AFP A;  4HSZ A;  1K94 A;  3IQO A;  1PRW A;  1B8L A;  1XFZ O;  3EKJ A;  1B7T Z;  2LVK A;  2WOS A;  2JQ6 A;  1IRJ A;  1SKT A;  1CNP A;  1IGV A;  1YVL A;  1TNX A;  1TNQ A;  2I2R E;  2JC2 A;  1OMV A;  3CR4 X;  4PHK A;  5D7F A;  1BR4 B;  4PHJ A;  1NCZ A;  4DUQ A;  2LMU A;  2AUC A;  3OX5 A;  1CTR A;  4GGN A;  1DJH A;  5I2Q A;  2KOT A;  1UUS A;  1K93 D;  1IJ5 A;  3EK8 A;  3SG2 A;  2KFH A;  2EGD A;  4ICB A;  3OX6 A;  5BPJ A;  1QX7 A;  2I94 A;  2KFG A;  2Y1N A;  2KI4 C;  2Y5I A;  4ORC B;  5HKZ A;  2JNX A;  5K89 A;  3D0Y B;  1QLS A;  1PVB A;  1QS7 A;  2LLS A;  2KI4 B;  3CWG A;  2E6W A;  1R6P A;  3TDU A;  4CFQ A;  2WCE A;  4NDD A;  2KAY A;  4A4C A;  4OCI A;  3TDZ A;  2SCP A;  1BLQ A;  1KWO C;  1CFD A;  1KFX S;  1G8I A;  1FPW A;  1KWO B;  1YRT B;  3KHE A;  2A4J A;  2JOJ A;  4FTG A;  1DF0 A;  1J1D A;  1VRK A;  5AXI A;  1FF1 A;  1JFK A;  2OTG C;  4DCK A;  4C0K A;  1PSB A;  1RK9 A;  2QPT A;  1XO5 A;  2K2F A;  4YI9 A;  1A03 A;  2OTG B;  1QAS A;  5DKR A;  4GPL B;  2LCP A;  1QIV A;  3IF7 A;  2L98 A;  1AHR A;  2PSR A;  1TOP A;  1NP8 A;  2KBM A;  5I2L A;  3HX4 A;  2JT8 A;  2BKH B;  3BUN B;  3JTD C;  1G33 A;  1K8U A;  1ZFS A;  1B9A A;  3O2P A;  3HCM A;  3VRQ A;  1M31 A;  2KDH A;  1KFU S;  1PAL A;  1S26 D;  2NLN A;  2QAC A;  4MZK A;  2Y1M A;  4I5L B;  2ZN9 A;  4N1G A;  3NXA A;  2COL B;  1CLB A;  1S6I A;  1X02 A;  5GQQ C;  1J1E A;  4PCW A;  1SL7 A;  1CLM A;  1MQ1 A;  4AOM A;  2KYC A;  1MXE A;  1S5G Y;  2LM5 A;  1ALV A;  1AP4 A;  1DJI A;  3GOF A;  5HKW A;  1QVI Z;  1NSH A;  1NX3 A;  3BUX B;  1KK7 Z;  3PN7 C;  2LC5 A;  5KSZ A;  1Y1A A;  1B47 A;  3CLN A;  5I2O A;  3AKA A;  2BBM A;  1MR8 A;  1K96 A;  1PSR A;  3PN7 B;  4WQ2 A;  1F55 A;  1IWQ A;  1TNW A;  2RGI A;  1ZMZ A;  2Q91 A;  4I5N B;  2PMY A;  5ER4 X;  1LA0 A;  2V53 A;  1YVH A;  2LLU A;  2BEC A;  1ALW A;  1GGW A;  1KSM A;  1TCF A;  2VRG A;  4JQ0 D;  1B8C A;  4PHN A;  4WRI A;  1FW4 A;  1IJ6 A;  1IG5 A;  1QV1 A;  4YGC B;  1TTX A;  3I5G C;  1GJY A;  1LVC D;  2L5X B;  3EKH A;  2AMI A;  1JF0 A;  5CSI A;  1XK4 A;  4I5J A;  3I5G B;  1W7I B;  4YI8 A;  4CID A;  1TCO B;  2BL0 B;  4QJ3 B;  1IKU A;  2IS9 A;  2K7B A;  1A75 B;  1CMG A;  3VGO A;  2LVI A;  1C7V A;  4GGF C;  1JC2 A;  3BUO B;  4YRU A;  2L4H A;  1DGU A;  4MVF A;  3I5I C;  3EVR A;  1UP5 A;  2I7A A;  2MLF C;  1NX2 A;  1BOD A;  3I5I B;  1EG3 A;  1SCM B;  2LMT A;  3RLZ A;  2ZN8 A;  3O6B A;  1N65 A;  4QJ4 B;  2KQ6 A;  1FI6 A;  1UHN A;  1KCY A;  2JU0 A;  1QLK A;  4JWQ A;  1B4C A;  4XYN A;  4DIR A;  1W7J B;  1KQM B;  1DJY A;  1S36 A;  5HLV A;  3SIB A;  2LP3 A;  1YX7 A;  3SG7 A;  1NUB A;  3TS5 C;  4PE0 A;  4NQG A;  1LKJ A;  1J7Q A;  4OVN F;  1OMD A;  1UHK A;  3TS5 B;  1QJT A;  1AVS A;  1S6J A;  3I5H C;  2L2E A;  1DF0 B;  2M29 A;  1F4Q A;  4FQO A;  3GK1 A;  4GBA A;  2KI6 C;  4U8D A;  3TZ1 A;  3VRO A;  5JJG A;  1UWO A;  2BCA A;  3CGA A;  4OV2 A;  1QTX A;  1ZUZ A;  1R2U A;  5KTY A;  4GGF A;  1DJX A;  3LK0 A;  4CPV A;  1ZOT B;  1BR1 B;  5PAL A;  2PVB A;  4N5X A;  1K9P A;  2M49 B;  1XYD A;  2KFF A;  3SG5 A;  3FWC A;  3FIA A;  4YGA A;  1BMO A;  1CKK A;  1DVI A;  2LE9 B;  2M1U A;  2O60 A;  1UHJ A;  3PFV A;  4BY5 A;  4GFT A;  1WDC C;  4ORA B;  5CSF A;  2O5G A;  1DJW A;  1S3P A;  2EC6 C;  1A29 A;  1YUR A;  1EH2 A;  2M1K B;  3EVU A;  1NYA A;  1TIZ A;  1N0Y A;  2LVJ A;  1EXR A;  2EC6 B;  4YGD B;  1JBA A;  4DS7 A;  3CR5 X;  4MBE A;  5AEQ A;  2KGR A;  1PK0 D;  2CNP A;  1SR6 C;  2JXL A;  1K2H A;  1YRU B;  4XJK A;  2R2I A;  5HLO A;  1U5I B;  2G9B A;  4M2Q A;  3SJS A;  4I5K A;  3PAT A;  2ISD A;  3GK4 X;  1F70 A;  1CDL A;  2M7N A;  2F33 A;  4C0L A;  1G4Y R;  2FOT A;  3A4U B;  3KPX A;  1K9K A;  2LV7 A;  4PHM A;  4GUK A;  2OPO A;  2GGM A;  1AUI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...