1DVIA

Calpain domain vi with calcium bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
b'EEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTSRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALPAIN
publication title Structure of a calpain Ca(2+)-binding domain reveals a novel EF-hand and Ca(2+)-induced conformational changes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-dependent protease
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dviA00
1TNXA 1YVLA 2JTZA 5HKWA 4N5XA 1CDMA 5HLOA 2Q4UA 1TIZA 1QTXA 3BXKA 1NUBA 4GBAA 3SIBA 3KHEA 2JXCA 5JJGA 1QX7A 2LVKA 1DJGA 1SL8A 2FOTA 5CSNA 4PHKA 3CZTX 2F8PA 3A8RA 3BOWB 1B7TZ 1BMOA 1S5GZ 3CR4X 2M1UA 1Y0VH 5CPVA 1LXFC 1ALWA 4A4BA 2ZNDA 1M46A 4MRXA 1YUUA 2SASA 2WCEA 3JVTC 3M0WA 2M9GA 3SG2A 3TDIA 1S36A 5GQQC 3I5HB 1BG1A 1KCYA 3LLEA 1XFXO 1KK7Z 1PALA 2I2RE 2PSRA 2SCPA 5D7FA 4C0LA 1K9UA 3PN7B 4YGCB 3DF0B 3FWBA 2JQ6A 1PVBA 1SYMA 4Q04A 3SG3A 2JT8A 1QX5B 4CLNA 1TN4A 1TRFA 2CXJA 2IS9A 2Q91A 4GGFA 1DJIA 3FS7A 1QVIZ 1N0YA 2FCEA 2KQYA 3TS5C 2LLUA 2LMUA 2WC8A 1YUTA 2KOTA 4N1GA 3CS1A 2F3ZA 5DKQA 3TUYB 1QJTA 2EC6C 1M39A 4CIDA 2CCMA 2LP3A 2BECA 4AQJA 3LCPC 1M63B 4DRWA 3NXAA 1F4QA 1ZUZA 3I5GB 1QXPA 3AKAA 2GGZA 1IQ3A 2CTNA 1S3PA 1J1DA 1NX1A 1PRWA 1B1GA 1L2OC 4E68A 1ZACA 1UHIA 1AHRA 3BUNB 1NYAA 4QJ3B 4ORAB 1SCMC 1DTLA 5HKYA 4GAOA 3PSRA 1JF2A 3CR5X 2L98A 2L0PA 2M7NA 3EKJA 3I5FC 2BCXA 1RFJA 4USLA 1S6JA 2MRDA 1WLZA 2H2KA 4AOMA 5AERA 5AANA 3E3RA 5DKRA 4YGEB 3CTNA 2OS8B 4CFQA 1TNQA 1MUXA 1IQ5A 1NCZA 5J3XA 1SL7A 4GGNA 5ER5A 1SW8A 1YUSA 4A4CA 2KI6D 2PALA 1FW4A 1KWOC 3TZ1A 5DKNA 1JC2A 3KPXA 3O4YA 1LINA 4ICBA 1IH0A 2BKIB 1FF1A 4AQIA 4MZJA 2FCDA 2O60A 4MZLA 1CFFA 2LVVA 1SPYA 1PK0D 3JTDC 2AUCA 2JZIA 3D0YA 2M8UA 4XYNA 5AEQA 2TN4A 3EK4A 1NCXA 2QPTA 4OR9B 2MLFC 4BY4A 4XJKA 5PALA 1JFJA 2BBMA 4D1EA 1LKJA 2L5XB 1XO5A 1TNPA 1QS7A 1J1EA 1TCOB 2KI4B 1XK4A 2LAPA 5HLVA 1BODA 1K9KA 1G4YR 1XFYO 2RGIA 1D1OA 5I2LA 3PLFB 3KO0A 1C07A 2JTTA 3DVEA 2KDHA 1OZSA 1XFVO 1LA3A 1YX7A 2PRUA 3VRRA 3TS5B 1SRAA 3EK8A 1F70A 3BOWA 1XA5A 1IGVA 4HRHA 1B9AA 1UHHA 2V53A 1MXEA 5AXIA 2H61A 2EC6B 2ZN9A 1QIWA 3GK2A 4PALA 1NCYA 2I94A 4OKHA 1L7ZA 2K61A 1A4PA 1ODBA 3OX6A 5HYDA 3K21A 1K2HA 1K9PA 2LHLA 1L2OB 3OB1B 4I5NB 4YI9A 2BE4A 1E8AA 2KBMA 4CPVA 1KQMC 2NLNA 1SCMB 3BYAA 2BE6A 1KSMA 2JWWA 3DF0A 4CFRA 5KTYA 1YRUB 2KQ6A 1DGVA 1CKKA 3I5FB 2LM5A 2LANA 3WXAA 3MSEB 3BUXB 3EVVA 2NCOA 1M31A 4UPGA 5G08A 2LNKA 5I2QA 1F55A 1QATA 1UP5A 3HX4A 2KGBC 3DVJA 1AVSA 1X02A 3AAKA 2LLSA 1AP4A 4GNKB 1A75A 2K0JA 1TNWA 3EVRA 1DGUA 1CDLA 1OE9B 3DVMA 4PHNA 1GGZA 2F2PA 1CFPA 3OX5A 2F2OA 3IF7A 1IWQA 2KAVA 4ETOA 3LK0A 1PVAA 2F33A 5CSJA 1JF0A 2FJUB 2M97A 1GJYA 1UWOA 2B1UA 1KK8B 2ZRTA 1A75B 4TNCA 2QACA 2CBLA 2LP2A 4YRUA 1Y6WA 3RLZA 1BLQA 3A4UB 5CSIA 1F71A 4MN0A 1S1EA 1SR6C 2L51A 1DJZA 1J7RA 1J55A 1WDCB 1EL4A 3BUOB 3ZWHA 1XFUO 1BF5A 2JXLA 1FI6A 5AFPA 3CGAA 2JOJA 2COLB 4WQ3A 3O6BA 3TDZA 4MBEA 4PE1A 1A2XA 4P2YB 3EVUA 2JC2A 4HSZA 4U8DA 3CLNA 2BCAA 1SBJA 3GK4X 3ZNIA 1NP8A 1EG4A 1SL9A 2EGDA 1OMVA 4NDCA 1SMGA 1K94A 1XFZO 1MWNA 3IQOA 2F3YA 2DOQA 4GPLB 3AKBA 1BJFA 4MVFA 4QJ5B 3OB2B 3PFVA 3CR2A 5JOLA 2EHBA 2K7CA 4FQOA 2M7LA 2I7AA 1FBVA 3LK1A 3VRNA 3PALA 4PHJA 1M45A 1CTRA 1UUSA 3I5IC 4MRYA 1OMRA 3SJSA 4BY5A 1IKUA 1MXLC 1EH2A 2KAXA 4GUKA 3FIAA 1KFUS 3EK7A 2NXQA 1HT9A 1F8HA 2ZN8A 2M3WA 4WRIA 1BT6A 1EG3A 3JVTB 4DS7A 4HRGA 1UHNA 2K7BA 3QRXA 4OVNF 3SG6A 1S26D 2BCBA 2BKHB 1OOJA 4YBHB 1B4CA 1RROA 1CLBA 1YRTB 1S6CA 2BL0C 3I5HC 1NWDA 1WRZA 5I8NA 1OMDA 1YTZC 3SG5A 1AJ5A 3VRPA 2ZNEA 1U5IB 1Y1XA 2K7DA 2MBXA 4C0KA 2E30A 5TNCA 1BR1B 1CLLA 1NPQA 1NX3A 1CMGA 1JBAA 2ZFDA 1DF0B 1EXRA 3H4SE 4M2QA 1UHKA 1RJVA 4PE7A 3CWGA 3VROA 2JNXA 3O78A 2KHNA 2JT3A 1C7VA 1QV1A 1JUOA 3GOFA 1SK6D 2KFHA 3OHMB 4ORCB 4QJ4B 1IRJA 1J7PA 3SIAA 1VRKA 4PE4A 1HQVA 1V1GA 1F4OA 2CT9A 4NQGA 5IBWA 3WHTB 1S5GY 2WCFA 3KF9A 4JWQA 4MEWA 3AAJA 1SR6B 1J7QA 1H8BA 1OSAA 2LC5A 1DJWA 2HPSA 2MJWB 3D10A 1C7WA 2LUXA 2Y4QA 5HKZA 5F6TA 1TOPA 1ZOTB 2MHHA 3VRQA 1ZFSA 2HQWA 1B8LA 4PDZA 4I5KA 2KSPA 1Q80A 2MLEC 4GGFC 1TTXA 1SCVA 1JSAA 1KK7Y 3GK1A 1QLKA 4HREE 4YGBB 4ZCUA 1W7IB 3BUMB 2Y1NA 3FWCA 4M2OA 4PE0A 1NSHA 2HETA 2PVBA 1QX2A 3WHUB 3NSKA 4YGAA 4R1EA 1CNPA 5FYXA 1KFUL 3TDUA 3LL8B 3I5IB 1CMFA 1CM1A 2K2FA 1DVIA 1YVHA 1YX8A 2JRFA 2OS8C 4MZKA 4C0JA 2AAOA 1PSBA 1QVIY 1OZOA 3NSIA 1KWOB 2NZ0A 2JULA 1AUIB 5D69A 1CDNA 1WRKA 2AMIA 1BOCA 1PULA 1YURA 2PMYA 1KQVA 1DMOA 4PCWA 1Y1UA 3JTDB 1K90D 3RM1A 1CLMA 1PSRA 2OTGC 1MHOA 1WLMA 1MR8A 2GV5A 1H4BA 1N2DA 2L2EA 5I2OA 2NCPA 1IJ5A 3DD4A 1RTP1 1XYDA 2BL0B 2HQ8A 1BU3A 1FI5A 3IQQA 1NX2A 2E6WA 3SG4A 1S6IA 2P6BB 2M1KB 2JPTA 4YGDB 2O5GA 2OPOA 4M2PA 2KI6C 4PHMA 2LE9B 4FTGA 1MQ1A 1IG5A 1WY9A 2LV7A 4F0ZB 1G8IA 2KI4C 1XVJA 3ICBA 4I5LB 2HF5A 1CDPA 1CM4A 5CSFA 3HCMA 4DCKA 2R2IA 4OCIA 1JWDA 3VGOA 2CNPA 4OV2A 1K95A 4DIRA 2G2BA 1V1FA 4I5JA 4MLWA 1JFKA 2PASA 2LVIA 3OP0A 2MAZA 1J7OA 2M29A 2ZRSA 1B8RA 4IL1A 1AK8A 4MSPA 2VRGA 1XK4C 1SNLA 1KFXL 2ZKMX 2LUCA 1RK9A 1UURA 1UHJA 1QLSA 3O2PA 1Y1AA 1NX0A 2LLTA 2I18A 1KQMB 1QV0A 2KYCA 1SY9A 2KNEA 3NSLA 1U5IA 1A29A 3KEVA 4JPZB 1CFCA 1XFWO 2H61C 1B47A 2JU0A 1RWYA 2KAYA 4NDBA 5K89A 5KU1A 1DF0A 2LVJA 1SKTA 2WCBA 1FPWA 1A03A 1R2UA 2M0RA 1BR4B 1GGWA 2A4JA 5KSZA 1CFDA 1ZMZA 3BUWB 1DJHA 3SG7A 2K7OA 1B8CA 1F54A 4WQ2A 3NSOA 4L9MA 1QIVA 1N65A 3PN7C 3DVKA 2K2AA 2KBIA 2WOSA 2D8NA 2JNFA 2KFFA 3EKHA 1DT7B 3BQ3A 4P5OE 2LCPA 1GQMA 2L4IA 4JQ0D 3WNXB 2BBNA 4NDDA 4YI8A 2OTGB 4DUQA 5BPJA 1DJYA 2LHIA 2Y1MA 1K8UA 2L50A 2LMTA 1R6PA 2L4HA 1KK8C 2LMVA 1B7TY 2GGMA 2MA2A 1KSOA 1YR5A 1EJ3A 1G33A 2ISDA 3C1VA 2KGRA 2JT0A 4ZCVA 1OQPA 4N1FA 3TUYC 2KYFA 1DJXA 1WDCC 1RECA 2M49B 2KFGA 1MF8B 2WORA 4GFTA 1ALVA 3I5GC 1LA0A 1W7JB 2WNDA 3PM8A 1TCFA 2Y5IA 2G9BA 1K93D 3D0YB 2K8MB 1KFXS 1QASA 3F45A 1WRLA 4XJKB 4ORBB 1CB1A 1LVCD 5ER4X 5B8IB 1IJ6A 1NIWA 3PATA 1K96A 1AJ4A
chains in the Genus database with same CATH superfamily
1TNXA 1YVLA 2JTZA 5HKWA 4N5XA 1CDMA 2WC5A 5HLOA 2Q4UA 1TIZA 1QTXA 3BXKA 1NUBA 4GBAA 1OW4A 3SIBA 1DELA 3KHEA 2JXCA 5JJGA 1QX7A 2LVKA 1DJGA 1SL8A 2FOTA 3D74A 4PHKA 3CZTX 5CSNA 2F8PA 3A8RA 3BOWB 1B7TZ 1BMOA 1S5GZ 3CR4X 2M1UA 1Y0VH 5CPVA 1LXFC 1ALWA 4A4BA 2ZNDA 1M46A 3O4XA 4MRXA 1YUUA 2SASA 2WCEA 3JVTC 3OBVA 3M0WA 2M9GA 3SG2A 3TDIA 1S36A 5GQQC 2BNXA 3I5HB 5I94A 1BG1A 1KCYA 3LLEA 1XFXO 1KK7Z 1PALA 2I2RE 2PSRA 2SCPA 5D7FA 4C0LA 3S0AA 1K9UA 3PN7B 4YGCB 3DF0B 4JKTA 3FWBA 2JQ6A 1PVBA 3Q8IA 1SYMA 4Q04A 3SG3A 3DXLA 2JT8A 1QX5B 3CYZA 3D75A 4CLNA 1TN4A 1TRFA 2CXJA 3SS5A 2IS9A 2Q91A 4GGFA 3DYEA 1DJIA 3FS7A 1QVIZ 1N0YA 2FCEA 2KQYA 3TS5C 2LLUA 2LMUA 2WC8A 1YUTA 2KOTA 4N1GA 2WCMA 2P71A 3CS1A 2F3ZA 5DKQA 3TUYB 1QJTA 1C3ZA 2EC6C 1M39A 4CIDA 2CCMA 2LP3A 2BECA 4AQJA 2QEOA 3LCPC 1M63B 4DRWA 3NXAA 1F4QA 1ZUZA 3I5GB 1QXPA 3AKAA 2GGZA 1IQ3A 2CTNA 1S3PA 1J1DA 1NX1A 2WCHA 1PRWA 3NHTA 1B1GA 2WCKA 1L2OC 2L2CA 4E68A 1ZACA 1UHIA 1AHRA 3BUNB 1NYAA 4QJ3B 2WC6A 4ORAB 1SCMC 1DTLA 5HKYA 4GAOA 3PSRA 1JF2A 3NGVA 3CR5X 2L98A 2L0PA 2M7NA 3EKJA 3I5FC 2BCXA 1RFJA 4USLA 1W9ZA 3UNWA 1S6JA 2ERBA 2MRDA 1WLZA 2H2KA 4AOMA 5AERA 5AANA 3E3RA 3R1PA 5DKRA 2QDIA 4YGEB 3CTNA 2OS8B 4CFQA 1TNQA 3S0DA 1MUXA 1IQ5A 1NCZA 5J3XA 2WCJA 1SL7A 4GGNA 5ER5A 1SW8A 1YUSA 4A4CA 2YGUA 2KI6D 2PALA 1FW4A 1KWOC 3TZ1A 5DKNA 3V2LA 1JC2A 3KPXA 3O4YA 1LINA 4ICBA 1IH0A 2BKIB 1FF1A 4AQIA 4MZJA 2FCDA 3QMEA 2O60A 4MZLA 1CFFA 2LVVA 1SPYA 1PK0D 3JTDC 2AUCA 3OGNA 2GTEA 2JZIA 3D0YA 2M8UA 4XYNA 5AEQA 3D78A 2TN4A 3EK4A 1NCXA 2QPTA 4OR9B 2MLFC 4BY4A 4XJKA 5PALA 1JFJA 2BBMA 4D1EA 1LKJA 2L5XB 1XO5A 1TNPA 1QS7A 1J1EA 1TCOB 2KI4B 1XK4A 3S0GA 1DEKA 2LAPA 5HLVA 1BODA 1K9KA 1G4YR 1XFYO 2RGIA 3L4LA 1D1OA 5I2LA 3PLFB 3KO0A 1C07A 3N7HA 2JTTA 3DVEA 2KDHA 1OZSA 1XFVO 1LA3A 1YX7A 2PRUA 3VRRA 2H8VA 3TS5B 1SRAA 3EK8A 1F70A 3BOWA 1XA5A 1IGVA 4HRHA 3B7AA 1B9AA 3FE9A 1UHHA 2V53A 1QWVA 1MXEA 3BFAA 5FI2A 5AXIA 2H61A 2EC6B 3CZ0A 2ZN9A 1QIWA 3GK2A 4PALA 1NCYA 2I94A 4OKHA 1L7ZA 2K61A 1A4PA 1ODBA 3OX6A 5HYDA 4FQTA 3CDNA 3K21A 1K2HA 1K9PA 2LHLA 1L2OB 3OB1B 4I5NB 4YI9A 2BE4A 1E8AA 2KBMA 4CPVA 1KQMC 2NLNA 1SCMB 3BYAA 2BE6A 1KSMA 2JWWA 3DF0A 4CFRA 5KTYA 1YRUB 2KQ6A 1DGVA 1Z2CB 3R1OA 1CKKA 3I5FB 2LM5A 2LANA 3WXAA 3MSEB 3BUXB 3EVVA 2NCOA 1M31A 4UPGA 5G08A 2LNKA 5I2QA 1F55A 1QATA 1UP5A 1C3YA 3S0BA 3HX4A 5DICA 2KGBC 3DVJA 3RZSA 1AVSA 1X02A 3AAKA 2JPOA 2LLSA 1AP4A 4GNKB 1A75A 1TUJA 2K0JA 1TNWA 3EVRA 1DGUA 1CDLA 1OE9B 3DVMA 4PHNA 1GGZA 2F2PA 2QEBA 1CFPA 3OX5A 2F2OA 3IF7A 1IWQA 2KAVA 4ETOA 3LK0A 1PVAA 2F33A 5CSJA 3B6XA 1JF0A 2FJUB 2M97A 1GJYA 1UWOA 2B1UA 1KK8B 2ZRTA 1A75B 3L4AA 4TNCA 2QACA 2CBLA 2KPHA 2L5YA 2LP2A 3CZ2A 3L47A 1Y6WA 3RLZA 4YRUA 5FI6A 1BLQA 3A4UB 5CSIA 4OZDA 1F71A 4MN0A 1S1EA 1SR6C 2L51A 1DJZA 1J7RA 1J55A 1WDCB 1EL4A 3BUOB 3ZWHA 1XFUO 1BF5A 2JXLA 1FI6A 5AFPA 3CGAA 2JOJA 2COLB 4WQ3A 3O6BA 3TDZA 4MBEA 4PE1A 1A2XA 4P2YB 3EVUA 2JC2A 4HSZA 4U8DA 3CLNA 2BCAA 1SBJA 3R72A 3GK4X 3ZNIA 1NP8A 1EG4A 1SL9A 2EGDA 1OMVA 4NDCA 1SMGA 1XFZO 1K94A 1MWNA 3IQOA 2F3YA 2DOQA 4GPLB 3AKBA 1BJFA 4MVFA 1DC1A 4QJ5B 3OB2B 3PFVA 3CR2A 5JOLA 2EHBA 2K7CA 4FQOA 2M7LA 2I7AA 1FBVA 3LK1A 3VRNA 3K1EA 3PALA 4PHJA 1M45A 1CTRA 1Z4HA 1UUSA 3I5IC 4MRYA 3D77A 1OMRA 3SJSA 4BY5A 3VB1A 1IKUA 1MXLC 1EH2A 2KAXA 3UO9A 4GUKA 3FIAA 1KFUS 3EK7A 1DQEA 2NXQA 1HT9A 1F8HA 2ZN8A 2M3WA 4WRIA 1BT6A 1EG3A 3JVTB 4DS7A 4HRGA 1UHNA 2K7BA 3QRXA 4OVNF 3SG6A 1S26D 2BCBA 2BKHB 1OOJA 4YBHB 1B4CA 1RROA 1CLBA 3BFHA 1YRTB 1S6CA 2BL0C 3CZ1A 3I5HC 3EG5B 1NWDA 1WRZA 5I8NA 1OMDA 1YTZC 3SG5A 1AJ5A 3VRPA 2ZNEA 1U5IB 1Y1XA 3D76A 2K7DA 2MBXA 4C0KA 2E30A 3PJIA 5TNCA 1BR1B 1CLLA 1NPQA 1NX3A 1CMGA 1JBAA 2ZFDA 3FE8A 1DF0B 1EXRA 3H4SE 4M2QA 1UHKA 1RJVA 4PE7A 3CWGA 3VROA 2JNXA 3O78A 2KHNA 2JT3A 1C7VA 1QV1A 1JUOA 3GOFA 1SK6D 2KFHA 3OHMB 4ORCB 4QJ4B 1IRJA 1J7PA 3SIAA 1VRKA 4PE4A 1HQVA 1V1GA 2QEVA 1F4OA 2CT9A 4NQGA 5IBWA 3WHTB 3DY9A 1S5GY 2WCFA 3KF9A 4JWQA 4MEWA 3AAJA 4KYNA 1SR6B 1J7QA 1H8BA 1T14A 1OSAA 2LC5A 1DJWA 2HPSA 2MJWB 3D10A 1C7WA 2LUXA 2Y4QA 5HKZA 2QEHA 5F6TA 1TOPA 1ZOTB 2MHHA 3VRQA 1ZFSA 2HQWA 2KLEA 1B8LA 4PDZA 4I5KA 2KSPA 1Q80A 3PM2A 2MLEC 4GGFC 1TTXA 1SCVA 1JSAA 1KK7Y 3GK1A 1QLKA 2FJYA 4HREE 4YGBB 4ZCUA 1W7IB 3BUMB 2Y1NA 3FWCA 4M2OA 4PE0A 1NSHA 2HETA 2PVBA 1QX2A 3B88A 3WHUB 3NSKA 4YGAA 4R1EA 1CNPA 5FYXA 1KFUL 3TDUA 3LL8B 3I5IB 3B87A 1CMFA 1CM1A 2K2FA 1DVIA 1YVHA 1ORGA 1YX8A 2JRFA 2OS8C 4MZKA 4C0JA 2AAOA 1PSBA 1QVIY 2P70A 1OZOA 3R1VA 1OOIX 3NSIA 5HL1A 1KWOB 2NZ0A 2JULA 1AUIB 5D69A 1CDNA 1OOHA 1WRKA 2AMIA 1BOCA 1TUZA 1PULA 1YURA 2PMYA 1KQVA 1DMOA 4PCWA 1Y1UA 3JTDB 1K90D 3RM1A 1CLMA 1PSRA 2OTGC 1MHOA 1WLMA 3BFBA 5FI7A 1MR8A 2GV5A 1H4BA 1N2DA 2L2EA 5I2OA 2NCPA 1IJ5A 3DD4A 1RTP1 1XYDA 2BL0B 3SS3A 2HQ8A 1BU3A 1FI5A 3IQQA 1NX2A 2E6WA 4JD9A 3SG4A 1S6IA 2P6BB 2M1KB 2JPTA 4PT1A 4YGDB 2O5GA 2OPOA 4M2PA 2KI6C 4PHMA 2LE9B 4FTGA 1MQ1A 1IG5A 1WY9A 2LV7A 4F0ZB 1G8IA 2KI4C 1XVJA 3ICBA 4I5LB 2HF5A 1CDPA 1CM4A 3CABA 5CSFA 3HCMA 2BAPA 4DCKA 2R2IA 4OCIA 1JWDA 3VGOA 2CNPA 4OV2A 3BJHA 1K95A 1XFRA 4DIRA 1SSEB 1V1FA 2G2BA 4I5JA 1GM0A 4MLWA 3B86A 1JFKA 2PASA 2K60A 2LVIA 3OP0A 2MAZA 1J7OA 2M29A 2ZRSA 1B8RA 4IL1A 1AK8A 4MSPA 2VRGA 1XK4C 1LS8A 1SNLA 1KFXL 3D73A 2ZKMX 2LUCA 3S0EA 1RK9A 1UURA 3FE6A 1UHJA 1QLSA 3O2PA 1Y1AA 1NX0A 2LLTA 2I18A 1KQMB 1QV0A 2KYCA 4INWA 1SY9A 2KNEA 3NSLA 1U5IA 1A29A 3KEVA 4JPZB 1CFCA 1XFWO 2PYQA 2KLDA 2H61C 1B47A 2JU0A 1RWYA 2KAYA 3DZTA 4NDBA 5K89A 5KU1A 1DF0A 2LVJA 1SKTA 2WCBA 1FPWA 1A03A 1R2UA 2M0RA 1BR4B 1GGWA 2A4JA 4IJ7A 3IVTA 5KSZA 1CFDA 1ZMZA 3BUWB 3NHIA 1DJHA 3SG7A 2K7OA 1B8CA 4F7FA 1F54A 4WQ2A 3NSOA 4L9MA 1IIOA 1QIVA 1N65A 3PN7C 3DVKA 2K2AA 2KBIA 2WOSA 2D8NA 2JNFA 2KFFA 3EKHA 1DT7B 3BQ3A 4P5OE 2LCPA 1GQMA 2L4IA 4JQ0D 3WNXB 2BBNA 4NDDA 4YI8A 2OTGB 4DUQA 5D3OA 5BPJA 1DJYA 2LHIA 2Y1MA 1K8UA 2L50A 2LMTA 1P28A 3SS4A 1R6PA 5EL2A 2L4HA 1KK8C 2LMVA 1B7TY 2GGMA 2MA2A 2PQLA 1KSOA 1OOFA 1YR5A 1EJ3A 1G33A 2ISDA 3C1VA 2KGRA 2JT0A 4ZCVA 1OQPA 4N1FA 3TUYC 2KYFA 1DJXA 1WDCC 3S0FA 1RECA 2M49B 2KFGA 4INXA 1MF8B 2WORA 4GFTA 1ALVA 3I5GC 1LA0A 1W7JB 2WNDA 3PM8A 1TCFA 2Y5IA 2G9BA 1K93D 3D0YB 2K8MB 1KFXS 1QASA 2WCLA 3F45A 1WRLA 4XJKB 4ORBB 1CB1A 1LVCD 5ER4X 5B8IB 1IJ6A 1NIWA 1OOGA 3PATA 1K96A 1AJ4A 1TWOA
chains in the Genus database with same CATH topology
1TNXA 1YVLA 2JTZA 5HKWA 4N5XA 1CDMA 5HLOA 2Q4UA 1TIZA 1QTXA 3BXKA 1NUBA 4GBAA 3SIBA 3KHEA 2JXCA 5JJGA 1QX7A 2LVKA 1DJGA 1SL8A 2FOTA 5CSNA 4PHKA 3CZTX 2F8PA 3A8RA 3BOWB 1B7TZ 1BMOA 1S5GZ 3CR4X 2M1UA 1Y0VH 5CPVA 1LXFC 1ALWA 4A4BA 2ZNDA 1M46A 4MRXA 1YUUA 2SASA 2WCEA 3JVTC 3M0WA 2M9GA 3SG2A 3TDIA 1S36A 5GQQC 3I5HB 1BG1A 1KCYA 3LLEA 1XFXO 1KK7Z 1PALA 2I2RE 2PSRA 2SCPA 5D7FA 4C0LA 1K9UA 3PN7B 4YGCB 3DF0B 3FWBA 2JQ6A 1PVBA 1SYMA 4Q04A 3SG3A 2JT8A 1QX5B 4CLNA 1TN4A 1TRFA 2CXJA 2IS9A 2Q91A 4GGFA 1DJIA 3FS7A 1QVIZ 1N0YA 2FCEA 2KQYA 3TS5C 2LLUA 2LMUA 2WC8A 1YUTA 2KOTA 4N1GA 3CS1A 2F3ZA 5DKQA 3TUYB 1QJTA 2EC6C 1M39A 4CIDA 2CCMA 2LP3A 2BECA 4AQJA 3LCPC 1M63B 4DRWA 3NXAA 1F4QA 1ZUZA 3I5GB 1QXPA 3AKAA 2GGZA 1IQ3A 2CTNA 1S3PA 1J1DA 1NX1A 1PRWA 1B1GA 1L2OC 4E68A 1ZACA 1UHIA 1AHRA 3BUNB 1NYAA 4QJ3B 4ORAB 1SCMC 1DTLA 5HKYA 4GAOA 3PSRA 1JF2A 3CR5X 2L98A 2L0PA 2M7NA 3EKJA 3I5FC 2BCXA 1RFJA 4USLA 1S6JA 2MRDA 1WLZA 2H2KA 4AOMA 5AERA 5AANA 3E3RA 5DKRA 4YGEB 3CTNA 2OS8B 4CFQA 1TNQA 1MUXA 1IQ5A 1NCZA 5J3XA 1SL7A 4GGNA 5ER5A 1SW8A 1YUSA 4A4CA 2KI6D 2PALA 1FW4A 1KWOC 3TZ1A 5DKNA 1JC2A 3KPXA 3O4YA 1LINA 4ICBA 1IH0A 2BKIB 1FF1A 4AQIA 4MZJA 2FCDA 2O60A 4MZLA 1CFFA 2LVVA 1SPYA 1PK0D 3JTDC 2AUCA 2JZIA 3D0YA 2M8UA 4XYNA 5AEQA 2TN4A 3EK4A 1NCXA 2QPTA 4OR9B 2MLFC 4BY4A 4XJKA 5PALA 1JFJA 2BBMA 4D1EA 1LKJA 2L5XB 1XO5A 1TNPA 1QS7A 1J1EA 1TCOB 2KI4B 1XK4A 2LAPA 5HLVA 1BODA 1K9KA 1G4YR 1XFYO 2RGIA 1D1OA 5I2LA 3PLFB 3KO0A 1C07A 2JTTA 3DVEA 2KDHA 1OZSA 1XFVO 1LA3A 1YX7A 2PRUA 3VRRA 3TS5B 1SRAA 3EK8A 1F70A 3BOWA 1XA5A 1IGVA 4HRHA 1B9AA 1UHHA 2V53A 1MXEA 5AXIA 2H61A 2EC6B 2ZN9A 1QIWA 3GK2A 4PALA 1NCYA 2I94A 4OKHA 1L7ZA 2K61A 1A4PA 1ODBA 3OX6A 5HYDA 3K21A 1K2HA 1K9PA 2LHLA 1L2OB 3OB1B 4I5NB 4YI9A 2BE4A 1E8AA 2KBMA 4CPVA 1KQMC 2NLNA 1SCMB 3BYAA 2BE6A 1KSMA 2JWWA 3DF0A 4CFRA 5KTYA 1YRUB 2KQ6A 1DGVA 1CKKA 3I5FB 2LM5A 2LANA 3WXAA 3MSEB 3BUXB 3EVVA 2NCOA 1M31A 4UPGA 5G08A 2LNKA 5I2QA 1F55A 1QATA 1UP5A 3HX4A 2KGBC 3DVJA 1AVSA 1X02A 3AAKA 2LLSA 1AP4A 4GNKB 1A75A 2K0JA 1TNWA 3EVRA 1DGUA 1CDLA 1OE9B 3DVMA 4PHNA 1GGZA 2F2PA 1CFPA 3OX5A 2F2OA 3IF7A 1IWQA 2KAVA 4ETOA 3LK0A 1PVAA 2F33A 5CSJA 1JF0A 2FJUB 2M97A 1GJYA 1UWOA 2B1UA 1KK8B 2ZRTA 1A75B 4TNCA 2QACA 2CBLA 2LP2A 4YRUA 1Y6WA 3RLZA 1BLQA 3A4UB 5CSIA 1F71A 4MN0A 1S1EA 1SR6C 2L51A 1DJZA 1J7RA 1J55A 1WDCB 1EL4A 3BUOB 3ZWHA 1XFUO 1BF5A 2JXLA 1FI6A 5AFPA 3CGAA 2JOJA 2COLB 4WQ3A 3O6BA 3TDZA 4MBEA 4PE1A 1A2XA 4P2YB 3EVUA 2JC2A 4HSZA 4U8DA 3CLNA 2BCAA 1SBJA 3GK4X 3ZNIA 1NP8A 1EG4A 1SL9A 2EGDA 1OMVA 4NDCA 1SMGA 1K94A 1XFZO 1MWNA 3IQOA 2F3YA 2DOQA 4GPLB 3AKBA 1BJFA 4MVFA 4QJ5B 3OB2B 3PFVA 3CR2A 5JOLA 2EHBA 2K7CA 4FQOA 2M7LA 2I7AA 1FBVA 3LK1A 3VRNA 3PALA 4PHJA 1M45A 1CTRA 1UUSA 3I5IC 4MRYA 1OMRA 3SJSA 4BY5A 1IKUA 1MXLC 1EH2A 2KAXA 4GUKA 3FIAA 1KFUS 3EK7A 2NXQA 1HT9A 1F8HA 2ZN8A 2M3WA 4WRIA 1BT6A 1EG3A 3JVTB 4DS7A 4HRGA 1UHNA 2K7BA 3QRXA 4OVNF 3SG6A 1S26D 2BCBA 2BKHB 1OOJA 4YBHB 1B4CA 1RROA 1CLBA 1YRTB 1S6CA 2BL0C 3I5HC 1NWDA 1WRZA 5I8NA 1OMDA 1YTZC 3SG5A 1AJ5A 3VRPA 2ZNEA 1U5IB 1Y1XA 2K7DA 2MBXA 4C0KA 2E30A 5TNCA 1BR1B 1CLLA 1NPQA 1NX3A 1CMGA 1JBAA 2ZFDA 1DF0B 1EXRA 3H4SE 4M2QA 1UHKA 1RJVA 4PE7A 3CWGA 3VROA 2JNXA 3O78A 2KHNA 2JT3A 1C7VA 1QV1A 1JUOA 3GOFA 1SK6D 2KFHA 3OHMB 4ORCB 4QJ4B 1IRJA 1J7PA 3SIAA 1VRKA 4PE4A 1HQVA 1V1GA 1F4OA 2CT9A 4NQGA 5IBWA 3WHTB 1S5GY 2WCFA 3KF9A 4JWQA 4MEWA 3AAJA 1SR6B 1J7QA 1H8BA 1OSAA 2LC5A 1DJWA 2HPSA 2MJWB 3D10A 1C7WA 2LUXA 2Y4QA 5HKZA 5F6TA 1TOPA 1ZOTB 2MHHA 3VRQA 1ZFSA 2HQWA 1B8LA 4PDZA 4I5KA 2KSPA 1Q80A 2MLEC 4GGFC 1TTXA 1SCVA 1JSAA 1KK7Y 3GK1A 1QLKA 4HREE 4YGBB 4ZCUA 1W7IB 3BUMB 2Y1NA 3FWCA 4M2OA 4PE0A 1NSHA 2HETA 2PVBA 1QX2A 3WHUB 3NSKA 4YGAA 4R1EA 1CNPA 5FYXA 1KFUL 3TDUA 3LL8B 3I5IB 1CMFA 1CM1A 2K2FA 1DVIA 1YVHA 1YX8A 2JRFA 2OS8C 4MZKA 4C0JA 2AAOA 1PSBA 1QVIY 1OZOA 3NSIA 1KWOB 2NZ0A 2JULA 1AUIB 5D69A 1CDNA 1WRKA 2AMIA 1BOCA 1PULA 1YURA 2PMYA 1KQVA 1DMOA 4PCWA 1Y1UA 3JTDB 1K90D 3RM1A 1CLMA 1PSRA 2OTGC 1MHOA 1WLMA 1MR8A 2GV5A 1H4BA 1N2DA 2L2EA 5I2OA 2NCPA 1IJ5A 3DD4A 1RTP1 1XYDA 2BL0B 2HQ8A 1BU3A 1FI5A 3IQQA 1NX2A 2E6WA 3SG4A 1S6IA 2P6BB 2M1KB 2JPTA 4YGDB 2O5GA 2OPOA 4M2PA 2KI6C 4PHMA 2LE9B 4FTGA 1MQ1A 1IG5A 1WY9A 2LV7A 4F0ZB 1G8IA 2KI4C 1XVJA 3ICBA 4I5LB 2HF5A 1CDPA 1CM4A 5CSFA 3HCMA 4DCKA 2R2IA 4OCIA 1JWDA 3VGOA 2CNPA 4OV2A 1K95A 4DIRA 2G2BA 1V1FA 4I5JA 4MLWA 1JFKA 2PASA 2LVIA 3OP0A 2MAZA 1J7OA 2M29A 2ZRSA 1B8RA 4IL1A 1AK8A 4MSPA 2VRGA 1XK4C 1SNLA 1KFXL 2ZKMX 2LUCA 1RK9A 1UURA 1UHJA 1QLSA 3O2PA 1Y1AA 1NX0A 2LLTA 2I18A 1KQMB 1QV0A 2KYCA 1SY9A 2KNEA 3NSLA 1U5IA 1A29A 3KEVA 4JPZB 1CFCA 1XFWO 2H61C 1B47A 2JU0A 1RWYA 2KAYA 4NDBA 5K89A 5KU1A 1DF0A 2LVJA 1SKTA 2WCBA 1FPWA 1A03A 1R2UA 2M0RA 1BR4B 1GGWA 2A4JA 5KSZA 1CFDA 1ZMZA 3BUWB 1DJHA 3SG7A 2K7OA 1B8CA 1F54A 4WQ2A 3NSOA 4L9MA 1QIVA 1N65A 3PN7C 3DVKA 2K2AA 2KBIA 2WOSA 2D8NA 2JNFA 2KFFA 3EKHA 1DT7B 3BQ3A 4P5OE 2LCPA 1GQMA 2L4IA 4JQ0D 3WNXB 2BBNA 4NDDA 4YI8A 2OTGB 4DUQA 5BPJA 1DJYA 2LHIA 2Y1MA 1K8UA 2L50A 2LMTA 1R6PA 2L4HA 1KK8C 2LMVA 1B7TY 2GGMA 2MA2A 1KSOA 1YR5A 1EJ3A 1G33A 2ISDA 3C1VA 2KGRA 2JT0A 4ZCVA 1OQPA 4N1FA 3TUYC 2KYFA 1DJXA 1WDCC 1RECA 2M49B 2KFGA 1MF8B 2WORA 4GFTA 1ALVA 3I5GC 1LA0A 1W7JB 2WNDA 3PM8A 1TCFA 2Y5IA 2G9BA 1K93D 3D0YB 2K8MB 1KFXS 1QASA 3F45A 1WRLA 4XJKB 4ORBB 1CB1A 1LVCD 5ER4X 5B8IB 1IJ6A 1NIWA 3PATA 1K96A 1AJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNX A;  1YVL A;  2JTZ A;  5HKW A;  4N5X A;  1CDM A;  5HLO A;  2Q4U A;  1TIZ A;  1QTX A;  3BXK A;  1NUB A;  4GBA A;  3SIB A;  3KHE A;  2JXC A;  5JJG A;  1QX7 A;  2LVK A;  1DJG A;  1SL8 A;  2FOT A;  5CSN A;  4PHK A;  3CZT X;  2F8P A;  3A8R A;  3BOW B;  1B7T Z;  1BMO A;  1S5G Z;  3CR4 X;  2M1U A;  1Y0V H;  5CPV A;  1LXF C;  1ALW A;  4A4B A;  2ZND A;  1M46 A;  4MRX A;  1YUU A;  2SAS A;  2WCE A;  3JVT C;  3M0W A;  2M9G A;  3SG2 A;  3TDI A;  1S36 A;  5GQQ C;  3I5H B;  1BG1 A;  1KCY A;  3LLE A;  1XFX O;  1KK7 Z;  1PAL A;  2I2R E;  2PSR A;  2SCP A;  5D7F A;  4C0L A;  1K9U A;  3PN7 B;  4YGC B;  3DF0 B;  3FWB A;  2JQ6 A;  1PVB A;  1SYM A;  4Q04 A;  3SG3 A;  2JT8 A;  1QX5 B;  4CLN A;  1TN4 A;  1TRF A;  2CXJ A;  2IS9 A;  2Q91 A;  4GGF A;  1DJI A;  3FS7 A;  1QVI Z;  1N0Y A;  2FCE A;  2KQY A;  3TS5 C;  2LLU A;  2LMU A;  2WC8 A;  1YUT A;  2KOT A;  4N1G A;  3CS1 A;  2F3Z A;  5DKQ A;  3TUY B;  1QJT A;  2EC6 C;  1M39 A;  4CID A;  2CCM A;  2LP3 A;  2BEC A;  4AQJ A;  3LCP C;  1M63 B;  4DRW A;  3NXA A;  1F4Q A;  1ZUZ A;  3I5G B;  1QXP A;  3AKA A;  2GGZ A;  1IQ3 A;  2CTN A;  1S3P A;  1J1D A;  1NX1 A;  1PRW A;  1B1G A;  1L2O C;  4E68 A;  1ZAC A;  1UHI A;  1AHR A;  3BUN B;  1NYA A;  4QJ3 B;  4ORA B;  1SCM C;  1DTL A;  5HKY A;  4GAO A;  3PSR A;  1JF2 A;  3CR5 X;  2L98 A;  2L0P A;  2M7N A;  3EKJ A;  3I5F C;  2BCX A;  1RFJ A;  4USL A;  1S6J A;  2MRD A;  1WLZ A;  2H2K A;  4AOM A;  5AER A;  5AAN A;  3E3R A;  5DKR A;  4YGE B;  3CTN A;  2OS8 B;  4CFQ A;  1TNQ A;  1MUX A;  1IQ5 A;  1NCZ A;  5J3X A;  1SL7 A;  4GGN A;  5ER5 A;  1SW8 A;  1YUS A;  4A4C A;  2KI6 D;  2PAL A;  1FW4 A;  1KWO C;  3TZ1 A;  5DKN A;  1JC2 A;  3KPX A;  3O4Y A;  1LIN A;  4ICB A;  1IH0 A;  2BKI B;  1FF1 A;  4AQI A;  4MZJ A;  2FCD A;  2O60 A;  4MZL A;  1CFF A;  2LVV A;  1SPY A;  1PK0 D;  3JTD C;  2AUC A;  2JZI A;  3D0Y A;  2M8U A;  4XYN A;  5AEQ A;  2TN4 A;  3EK4 A;  1NCX A;  2QPT A;  4OR9 B;  2MLF C;  4BY4 A;  4XJK A;  5PAL A;  1JFJ A;  2BBM A;  4D1E A;  1LKJ A;  2L5X B;  1XO5 A;  1TNP A;  1QS7 A;  1J1E A;  1TCO B;  2KI4 B;  1XK4 A;  2LAP A;  5HLV A;  1BOD A;  1K9K A;  1G4Y R;  1XFY O;  2RGI A;  1D1O A;  5I2L A;  3PLF B;  3KO0 A;  1C07 A;  2JTT A;  3DVE A;  2KDH A;  1OZS A;  1XFV O;  1LA3 A;  1YX7 A;  2PRU A;  3VRR A;  3TS5 B;  1SRA A;  3EK8 A;  1F70 A;  3BOW A;  1XA5 A;  1IGV A;  4HRH A;  1B9A A;  1UHH A;  2V53 A;  1MXE A;  5AXI A;  2H61 A;  2EC6 B;  2ZN9 A;  1QIW A;  3GK2 A;  4PAL A;  1NCY A;  2I94 A;  4OKH A;  1L7Z A;  2K61 A;  1A4P A;  1ODB A;  3OX6 A;  5HYD A;  3K21 A;  1K2H A;  1K9P A;  2LHL A;  1L2O B;  3OB1 B;  4I5N B;  4YI9 A;  2BE4 A;  1E8A A;  2KBM A;  4CPV A;  1KQM C;  2NLN A;  1SCM B;  3BYA A;  2BE6 A;  1KSM A;  2JWW A;  3DF0 A;  4CFR A;  5KTY A;  1YRU B;  2KQ6 A;  1DGV A;  1CKK A;  3I5F B;  2LM5 A;  2LAN A;  3WXA A;  3MSE B;  3BUX B;  3EVV A;  2NCO A;  1M31 A;  4UPG A;  5G08 A;  2LNK A;  5I2Q A;  1F55 A;  1QAT A;  1UP5 A;  3HX4 A;  2KGB C;  3DVJ A;  1AVS A;  1X02 A;  3AAK A;  2LLS A;  1AP4 A;  4GNK B;  1A75 A;  2K0J A;  1TNW A;  3EVR A;  1DGU A;  1CDL A;  1OE9 B;  3DVM A;  4PHN A;  1GGZ A;  2F2P A;  1CFP A;  3OX5 A;  2F2O A;  3IF7 A;  1IWQ A;  2KAV A;  4ETO A;  3LK0 A;  1PVA A;  2F33 A;  5CSJ A;  1JF0 A;  2FJU B;  2M97 A;  1GJY A;  1UWO A;  2B1U A;  1KK8 B;  2ZRT A;  1A75 B;  4TNC A;  2QAC A;  2CBL A;  2LP2 A;  4YRU A;  1Y6W A;  3RLZ A;  1BLQ A;  3A4U B;  5CSI A;  1F71 A;  4MN0 A;  1S1E A;  1SR6 C;  2L51 A;  1DJZ A;  1J7R A;  1J55 A;  1WDC B;  1EL4 A;  3BUO B;  3ZWH A;  1XFU O;  1BF5 A;  2JXL A;  1FI6 A;  5AFP A;  3CGA A;  2JOJ A;  2COL B;  4WQ3 A;  3O6B A;  3TDZ A;  4MBE A;  4PE1 A;  1A2X A;  4P2Y B;  3EVU A;  2JC2 A;  4HSZ A;  4U8D A;  3CLN A;  2BCA A;  1SBJ A;  3GK4 X;  3ZNI A;  1NP8 A;  1EG4 A;  1SL9 A;  2EGD A;  1OMV A;  4NDC A;  1SMG A;  1K94 A;  1XFZ O;  1MWN A;  3IQO A;  2F3Y A;  2DOQ A;  4GPL B;  3AKB A;  1BJF A;  4MVF A;  4QJ5 B;  3OB2 B;  3PFV A;  3CR2 A;  5JOL A;  2EHB A;  2K7C A;  4FQO A;  2M7L A;  2I7A A;  1FBV A;  3LK1 A;  3VRN A;  3PAL A;  4PHJ A;  1M45 A;  1CTR A;  1UUS A;  3I5I C;  4MRY A;  1OMR A;  3SJS A;  4BY5 A;  1IKU A;  1MXL C;  1EH2 A;  2KAX A;  4GUK A;  3FIA A;  1KFU S;  3EK7 A;  2NXQ A;  1HT9 A;  1F8H A;  2ZN8 A;  2M3W A;  4WRI A;  1BT6 A;  1EG3 A;  3JVT B;  4DS7 A;  4HRG A;  1UHN A;  2K7B A;  3QRX A;  4OVN F;  3SG6 A;  1S26 D;  2BCB A;  2BKH B;  1OOJ A;  4YBH B;  1B4C A;  1RRO A;  1CLB A;  1YRT B;  1S6C A;  2BL0 C;  3I5H C;  1NWD A;  1WRZ A;  5I8N A;  1OMD A;  1YTZ C;  3SG5 A;  1AJ5 A;  3VRP A;  2ZNE A;  1U5I B;  1Y1X A;  2K7D A;  2MBX A;  4C0K A;  2E30 A;  5TNC A;  1BR1 B;  1CLL A;  1NPQ A;  1NX3 A;  1CMG A;  1JBA A;  2ZFD A;  1DF0 B;  1EXR A;  3H4S E;  4M2Q A;  1UHK A;  1RJV A;  4PE7 A;  3CWG A;  3VRO A;  2JNX A;  3O78 A;  2KHN A;  2JT3 A;  1C7V A;  1QV1 A;  1JUO A;  3GOF A;  1SK6 D;  2KFH A;  3OHM B;  4ORC B;  4QJ4 B;  1IRJ A;  1J7P A;  3SIA A;  1VRK A;  4PE4 A;  1HQV A;  1V1G A;  1F4O A;  2CT9 A;  4NQG A;  5IBW A;  3WHT B;  1S5G Y;  2WCF A;  3KF9 A;  4JWQ A;  4MEW A;  3AAJ A;  1SR6 B;  1J7Q A;  1H8B A;  1OSA A;  2LC5 A;  1DJW A;  2HPS A;  2MJW B;  3D10 A;  1C7W A;  2LUX A;  2Y4Q A;  5HKZ A;  5F6T A;  1TOP A;  1ZOT B;  2MHH A;  3VRQ A;  1ZFS A;  2HQW A;  1B8L A;  4PDZ A;  4I5K A;  2KSP A;  1Q80 A;  2MLE C;  4GGF C;  1TTX A;  1SCV A;  1JSA A;  1KK7 Y;  3GK1 A;  1QLK A;  4HRE E;  4YGB B;  4ZCU A;  1W7I B;  3BUM B;  2Y1N A;  3FWC A;  4M2O A;  4PE0 A;  1NSH A;  2HET A;  2PVB A;  1QX2 A;  3WHU B;  3NSK A;  4YGA A;  4R1E A;  1CNP A;  5FYX A;  1KFU L;  3TDU A;  3LL8 B;  3I5I B;  1CMF A;  1CM1 A;  2K2F A;  1DVI A;  1YVH A;  1YX8 A;  2JRF A;  2OS8 C;  4MZK A;  4C0J A;  2AAO A;  1PSB A;  1QVI Y;  1OZO A;  3NSI A;  1KWO B;  2NZ0 A;  2JUL A;  1AUI B;  5D69 A;  1CDN A;  1WRK A;  2AMI A;  1BOC A;  1PUL A;  1YUR A;  2PMY A;  1KQV A;  1DMO A;  4PCW A;  1Y1U A;  3JTD B;  1K90 D;  3RM1 A;  1CLM A;  1PSR A;  2OTG C;  1MHO A;  1WLM A;  1MR8 A;  2GV5 A;  1H4B A;  1N2D A;  2L2E A;  5I2O A;  2NCP A;  1IJ5 A;  3DD4 A;  1RTP 1;  1XYD A;  2BL0 B;  2HQ8 A;  1BU3 A;  1FI5 A;  3IQQ A;  1NX2 A;  2E6W A;  3SG4 A;  1S6I A;  2P6B B;  2M1K B;  2JPT A;  4YGD B;  2O5G A;  2OPO A;  4M2P A;  2KI6 C;  4PHM A;  2LE9 B;  4FTG A;  1MQ1 A;  1IG5 A;  1WY9 A;  2LV7 A;  4F0Z B;  1G8I A;  2KI4 C;  1XVJ A;  3ICB A;  4I5L B;  2HF5 A;  1CDP A;  1CM4 A;  5CSF A;  3HCM A;  4DCK A;  2R2I A;  4OCI A;  1JWD A;  3VGO A;  2CNP A;  4OV2 A;  1K95 A;  4DIR A;  2G2B A;  1V1F A;  4I5J A;  4MLW A;  1JFK A;  2PAS A;  2LVI A;  3OP0 A;  2MAZ A;  1J7O A;  2M29 A;  2ZRS A;  1B8R A;  4IL1 A;  1AK8 A;  4MSP A;  2VRG A;  1XK4 C;  1SNL A;  1KFX L;  2ZKM X;  2LUC A;  1RK9 A;  1UUR A;  1UHJ A;  1QLS A;  3O2P A;  1Y1A A;  1NX0 A;  2LLT A;  2I18 A;  1KQM B;  1QV0 A;  2KYC A;  1SY9 A;  2KNE A;  3NSL A;  1U5I A;  1A29 A;  3KEV A;  4JPZ B;  1CFC A;  1XFW O;  2H61 C;  1B47 A;  2JU0 A;  1RWY A;  2KAY A;  4NDB A;  5K89 A;  5KU1 A;  1DF0 A;  2LVJ A;  1SKT A;  2WCB A;  1FPW A;  1A03 A;  1R2U A;  2M0R A;  1BR4 B;  1GGW A;  2A4J A;  5KSZ A;  1CFD A;  1ZMZ A;  3BUW B;  1DJH A;  3SG7 A;  2K7O A;  1B8C A;  1F54 A;  4WQ2 A;  3NSO A;  4L9M A;  1QIV A;  1N65 A;  3PN7 C;  3DVK A;  2K2A A;  2KBI A;  2WOS A;  2D8N A;  2JNF A;  2KFF A;  3EKH A;  1DT7 B;  3BQ3 A;  4P5O E;  2LCP A;  1GQM A;  2L4I A;  4JQ0 D;  3WNX B;  2BBN A;  4NDD A;  4YI8 A;  2OTG B;  4DUQ A;  5BPJ A;  1DJY A;  2LHI A;  2Y1M A;  1K8U A;  2L50 A;  2LMT A;  1R6P A;  2L4H A;  1KK8 C;  2LMV A;  1B7T Y;  2GGM A;  2MA2 A;  1KSO A;  1YR5 A;  1EJ3 A;  1G33 A;  2ISD A;  3C1V A;  2KGR A;  2JT0 A;  4ZCV A;  1OQP A;  4N1F A;  3TUY C;  2KYF A;  1DJX A;  1WDC C;  1REC A;  2M49 B;  2KFG A;  1MF8 B;  2WOR A;  4GFT A;  1ALV A;  3I5G C;  1LA0 A;  1W7J B;  2WND A;  3PM8 A;  1TCF A;  2Y5I A;  2G9B A;  1K93 D;  3D0Y B;  2K8M B;  1KFX S;  1QAS A;  3F45 A;  1WRL A;  4XJK B;  4ORB B;  1CB1 A;  1LVC D;  5ER4 X;  5B8I B;  1IJ6 A;  1NIW A;  3PAT A;  1K96 A;  1AJ4 A; 
#chains in the Genus database with same CATH topology
 1TNX A;  1YVL A;  2JTZ A;  5HKW A;  4N5X A;  1CDM A;  2WC5 A;  5HLO A;  2Q4U A;  1TIZ A;  1QTX A;  3BXK A;  1NUB A;  4GBA A;  1OW4 A;  3SIB A;  1DEL A;  3KHE A;  2JXC A;  5JJG A;  1QX7 A;  2LVK A;  1DJG A;  1SL8 A;  2FOT A;  3D74 A;  4PHK A;  3CZT X;  5CSN A;  2F8P A;  3A8R A;  3BOW B;  1B7T Z;  1BMO A;  1S5G Z;  3CR4 X;  2M1U A;  1Y0V H;  5CPV A;  1LXF C;  1ALW A;  4A4B A;  2ZND A;  1M46 A;  3O4X A;  4MRX A;  1YUU A;  2SAS A;  2WCE A;  3JVT C;  3OBV A;  3M0W A;  2M9G A;  3SG2 A;  3TDI A;  1S36 A;  5GQQ C;  2BNX A;  3I5H B;  5I94 A;  1BG1 A;  1KCY A;  3LLE A;  1XFX O;  1KK7 Z;  1PAL A;  2I2R E;  2PSR A;  2SCP A;  5D7F A;  4C0L A;  3S0A A;  1K9U A;  3PN7 B;  4YGC B;  3DF0 B;  4JKT A;  3FWB A;  2JQ6 A;  1PVB A;  3Q8I A;  1SYM A;  4Q04 A;  3SG3 A;  3DXL A;  2JT8 A;  1QX5 B;  3CYZ A;  3D75 A;  4CLN A;  1TN4 A;  1TRF A;  2CXJ A;  3SS5 A;  2IS9 A;  2Q91 A;  4GGF A;  3DYE A;  1DJI A;  3FS7 A;  1QVI Z;  1N0Y A;  2FCE A;  2KQY A;  3TS5 C;  2LLU A;  2LMU A;  2WC8 A;  1YUT A;  2KOT A;  4N1G A;  2WCM A;  2P71 A;  3CS1 A;  2F3Z A;  5DKQ A;  3TUY B;  1QJT A;  1C3Z A;  2EC6 C;  1M39 A;  4CID A;  2CCM A;  2LP3 A;  2BEC A;  4AQJ A;  2QEO A;  3LCP C;  1M63 B;  4DRW A;  3NXA A;  1F4Q A;  1ZUZ A;  3I5G B;  1QXP A;  3AKA A;  2GGZ A;  1IQ3 A;  2CTN A;  1S3P A;  1J1D A;  1NX1 A;  2WCH A;  1PRW A;  3NHT A;  1B1G A;  2WCK A;  1L2O C;  2L2C A;  4E68 A;  1ZAC A;  1UHI A;  1AHR A;  3BUN B;  1NYA A;  4QJ3 B;  2WC6 A;  4ORA B;  1SCM C;  1DTL A;  5HKY A;  4GAO A;  3PSR A;  1JF2 A;  3NGV A;  3CR5 X;  2L98 A;  2L0P A;  2M7N A;  3EKJ A;  3I5F C;  2BCX A;  1RFJ A;  4USL A;  1W9Z A;  3UNW A;  1S6J A;  2ERB A;  2MRD A;  1WLZ A;  2H2K A;  4AOM A;  5AER A;  5AAN A;  3E3R A;  3R1P A;  5DKR A;  2QDI A;  4YGE B;  3CTN A;  2OS8 B;  4CFQ A;  1TNQ A;  3S0D A;  1MUX A;  1IQ5 A;  1NCZ A;  5J3X A;  2WCJ A;  1SL7 A;  4GGN A;  5ER5 A;  1SW8 A;  1YUS A;  4A4C A;  2YGU A;  2KI6 D;  2PAL A;  1FW4 A;  1KWO C;  3TZ1 A;  5DKN A;  3V2L A;  1JC2 A;  3KPX A;  3O4Y A;  1LIN A;  4ICB A;  1IH0 A;  2BKI B;  1FF1 A;  4AQI A;  4MZJ A;  2FCD A;  3QME A;  2O60 A;  4MZL A;  1CFF A;  2LVV A;  1SPY A;  1PK0 D;  3JTD C;  2AUC A;  3OGN A;  2GTE A;  2JZI A;  3D0Y A;  2M8U A;  4XYN A;  5AEQ A;  3D78 A;  2TN4 A;  3EK4 A;  1NCX A;  2QPT A;  4OR9 B;  2MLF C;  4BY4 A;  4XJK A;  5PAL A;  1JFJ A;  2BBM A;  4D1E A;  1LKJ A;  2L5X B;  1XO5 A;  1TNP A;  1QS7 A;  1J1E A;  1TCO B;  2KI4 B;  1XK4 A;  3S0G A;  1DEK A;  2LAP A;  5HLV A;  1BOD A;  1K9K A;  1G4Y R;  1XFY O;  2RGI A;  3L4L A;  1D1O A;  5I2L A;  3PLF B;  3KO0 A;  1C07 A;  3N7H A;  2JTT A;  3DVE A;  2KDH A;  1OZS A;  1XFV O;  1LA3 A;  1YX7 A;  2PRU A;  3VRR A;  2H8V A;  3TS5 B;  1SRA A;  3EK8 A;  1F70 A;  3BOW A;  1XA5 A;  1IGV A;  4HRH A;  3B7A A;  1B9A A;  3FE9 A;  1UHH A;  2V53 A;  1QWV A;  1MXE A;  3BFA A;  5FI2 A;  5AXI A;  2H61 A;  2EC6 B;  3CZ0 A;  2ZN9 A;  1QIW A;  3GK2 A;  4PAL A;  1NCY A;  2I94 A;  4OKH A;  1L7Z A;  2K61 A;  1A4P A;  1ODB A;  3OX6 A;  5HYD A;  4FQT A;  3CDN A;  3K21 A;  1K2H A;  1K9P A;  2LHL A;  1L2O B;  3OB1 B;  4I5N B;  4YI9 A;  2BE4 A;  1E8A A;  2KBM A;  4CPV A;  1KQM C;  2NLN A;  1SCM B;  3BYA A;  2BE6 A;  1KSM A;  2JWW A;  3DF0 A;  4CFR A;  5KTY A;  1YRU B;  2KQ6 A;  1DGV A;  1Z2C B;  3R1O A;  1CKK A;  3I5F B;  2LM5 A;  2LAN A;  3WXA A;  3MSE B;  3BUX B;  3EVV A;  2NCO A;  1M31 A;  4UPG A;  5G08 A;  2LNK A;  5I2Q A;  1F55 A;  1QAT A;  1UP5 A;  1C3Y A;  3S0B A;  3HX4 A;  5DIC A;  2KGB C;  3DVJ A;  3RZS A;  1AVS A;  1X02 A;  3AAK A;  2JPO A;  2LLS A;  1AP4 A;  4GNK B;  1A75 A;  1TUJ A;  2K0J A;  1TNW A;  3EVR A;  1DGU A;  1CDL A;  1OE9 B;  3DVM A;  4PHN A;  1GGZ A;  2F2P A;  2QEB A;  1CFP A;  3OX5 A;  2F2O A;  3IF7 A;  1IWQ A;  2KAV A;  4ETO A;  3LK0 A;  1PVA A;  2F33 A;  5CSJ A;  3B6X A;  1JF0 A;  2FJU B;  2M97 A;  1GJY A;  1UWO A;  2B1U A;  1KK8 B;  2ZRT A;  1A75 B;  3L4A A;  4TNC A;  2QAC A;  2CBL A;  2KPH A;  2L5Y A;  2LP2 A;  3CZ2 A;  3L47 A;  1Y6W A;  3RLZ A;  4YRU A;  5FI6 A;  1BLQ A;  3A4U B;  5CSI A;  4OZD A;  1F71 A;  4MN0 A;  1S1E A;  1SR6 C;  2L51 A;  1DJZ A;  1J7R A;  1J55 A;  1WDC B;  1EL4 A;  3BUO B;  3ZWH A;  1XFU O;  1BF5 A;  2JXL A;  1FI6 A;  5AFP A;  3CGA A;  2JOJ A;  2COL B;  4WQ3 A;  3O6B A;  3TDZ A;  4MBE A;  4PE1 A;  1A2X A;  4P2Y B;  3EVU A;  2JC2 A;  4HSZ A;  4U8D A;  3CLN A;  2BCA A;  1SBJ A;  3R72 A;  3GK4 X;  3ZNI A;  1NP8 A;  1EG4 A;  1SL9 A;  2EGD A;  1OMV A;  4NDC A;  1SMG A;  1XFZ O;  1K94 A;  1MWN A;  3IQO A;  2F3Y A;  2DOQ A;  4GPL B;  3AKB A;  1BJF A;  4MVF A;  1DC1 A;  4QJ5 B;  3OB2 B;  3PFV A;  3CR2 A;  5JOL A;  2EHB A;  2K7C A;  4FQO A;  2M7L A;  2I7A A;  1FBV A;  3LK1 A;  3VRN A;  3K1E A;  3PAL A;  4PHJ A;  1M45 A;  1CTR A;  1Z4H A;  1UUS A;  3I5I C;  4MRY A;  3D77 A;  1OMR A;  3SJS A;  4BY5 A;  3VB1 A;  1IKU A;  1MXL C;  1EH2 A;  2KAX A;  3UO9 A;  4GUK A;  3FIA A;  1KFU S;  3EK7 A;  1DQE A;  2NXQ A;  1HT9 A;  1F8H A;  2ZN8 A;  2M3W A;  4WRI A;  1BT6 A;  1EG3 A;  3JVT B;  4DS7 A;  4HRG A;  1UHN A;  2K7B A;  3QRX A;  4OVN F;  3SG6 A;  1S26 D;  2BCB A;  2BKH B;  1OOJ A;  4YBH B;  1B4C A;  1RRO A;  1CLB A;  3BFH A;  1YRT B;  1S6C A;  2BL0 C;  3CZ1 A;  3I5H C;  3EG5 B;  1NWD A;  1WRZ A;  5I8N A;  1OMD A;  1YTZ C;  3SG5 A;  1AJ5 A;  3VRP A;  2ZNE A;  1U5I B;  1Y1X A;  3D76 A;  2K7D A;  2MBX A;  4C0K A;  2E30 A;  3PJI A;  5TNC A;  1BR1 B;  1CLL A;  1NPQ A;  1NX3 A;  1CMG A;  1JBA A;  2ZFD A;  3FE8 A;  1DF0 B;  1EXR A;  3H4S E;  4M2Q A;  1UHK A;  1RJV A;  4PE7 A;  3CWG A;  3VRO A;  2JNX A;  3O78 A;  2KHN A;  2JT3 A;  1C7V A;  1QV1 A;  1JUO A;  3GOF A;  1SK6 D;  2KFH A;  3OHM B;  4ORC B;  4QJ4 B;  1IRJ A;  1J7P A;  3SIA A;  1VRK A;  4PE4 A;  1HQV A;  1V1G A;  2QEV A;  1F4O A;  2CT9 A;  4NQG A;  5IBW A;  3WHT B;  3DY9 A;  1S5G Y;  2WCF A;  3KF9 A;  4JWQ A;  4MEW A;  3AAJ A;  4KYN A;  1SR6 B;  1J7Q A;  1H8B A;  1T14 A;  1OSA A;  2LC5 A;  1DJW A;  2HPS A;  2MJW B;  3D10 A;  1C7W A;  2LUX A;  2Y4Q A;  5HKZ A;  2QEH A;  5F6T A;  1TOP A;  1ZOT B;  2MHH A;  3VRQ A;  1ZFS A;  2HQW A;  2KLE A;  1B8L A;  4PDZ A;  4I5K A;  2KSP A;  1Q80 A;  3PM2 A;  2MLE C;  4GGF C;  1TTX A;  1SCV A;  1JSA A;  1KK7 Y;  3GK1 A;  1QLK A;  2FJY A;  4HRE E;  4YGB B;  4ZCU A;  1W7I B;  3BUM B;  2Y1N A;  3FWC A;  4M2O A;  4PE0 A;  1NSH A;  2HET A;  2PVB A;  1QX2 A;  3B88 A;  3WHU B;  3NSK A;  4YGA A;  4R1E A;  1CNP A;  5FYX A;  1KFU L;  3TDU A;  3LL8 B;  3I5I B;  3B87 A;  1CMF A;  1CM1 A;  2K2F A;  1DVI A;  1YVH A;  1ORG A;  1YX8 A;  2JRF A;  2OS8 C;  4MZK A;  4C0J A;  2AAO A;  1PSB A;  1QVI Y;  2P70 A;  1OZO A;  3R1V A;  1OOI X;  3NSI A;  5HL1 A;  1KWO B;  2NZ0 A;  2JUL A;  1AUI B;  5D69 A;  1CDN A;  1OOH A;  1WRK A;  2AMI A;  1BOC A;  1TUZ A;  1PUL A;  1YUR A;  2PMY A;  1KQV A;  1DMO A;  4PCW A;  1Y1U A;  3JTD B;  1K90 D;  3RM1 A;  1CLM A;  1PSR A;  2OTG C;  1MHO A;  1WLM A;  3BFB A;  5FI7 A;  1MR8 A;  2GV5 A;  1H4B A;  1N2D A;  2L2E A;  5I2O A;  2NCP A;  1IJ5 A;  3DD4 A;  1RTP 1;  1XYD A;  2BL0 B;  3SS3 A;  2HQ8 A;  1BU3 A;  1FI5 A;  3IQQ A;  1NX2 A;  2E6W A;  4JD9 A;  3SG4 A;  1S6I A;  2P6B B;  2M1K B;  2JPT A;  4PT1 A;  4YGD B;  2O5G A;  2OPO A;  4M2P A;  2KI6 C;  4PHM A;  2LE9 B;  4FTG A;  1MQ1 A;  1IG5 A;  1WY9 A;  2LV7 A;  4F0Z B;  1G8I A;  2KI4 C;  1XVJ A;  3ICB A;  4I5L B;  2HF5 A;  1CDP A;  1CM4 A;  3CAB A;  5CSF A;  3HCM A;  2BAP A;  4DCK A;  2R2I A;  4OCI A;  1JWD A;  3VGO A;  2CNP A;  4OV2 A;  3BJH A;  1K95 A;  1XFR A;  4DIR A;  1SSE B;  1V1F A;  2G2B A;  4I5J A;  1GM0 A;  4MLW A;  3B86 A;  1JFK A;  2PAS A;  2K60 A;  2LVI A;  3OP0 A;  2MAZ A;  1J7O A;  2M29 A;  2ZRS A;  1B8R A;  4IL1 A;  1AK8 A;  4MSP A;  2VRG A;  1XK4 C;  1LS8 A;  1SNL A;  1KFX L;  3D73 A;  2ZKM X;  2LUC A;  3S0E A;  1RK9 A;  1UUR A;  3FE6 A;  1UHJ A;  1QLS A;  3O2P A;  1Y1A A;  1NX0 A;  2LLT A;  2I18 A;  1KQM B;  1QV0 A;  2KYC A;  4INW A;  1SY9 A;  2KNE A;  3NSL A;  1U5I A;  1A29 A;  3KEV A;  4JPZ B;  1CFC A;  1XFW O;  2PYQ A;  2KLD A;  2H61 C;  1B47 A;  2JU0 A;  1RWY A;  2KAY A;  3DZT A;  4NDB A;  5K89 A;  5KU1 A;  1DF0 A;  2LVJ A;  1SKT A;  2WCB A;  1FPW A;  1A03 A;  1R2U A;  2M0R A;  1BR4 B;  1GGW A;  2A4J A;  4IJ7 A;  3IVT A;  5KSZ A;  1CFD A;  1ZMZ A;  3BUW B;  3NHI A;  1DJH A;  3SG7 A;  2K7O A;  1B8C A;  4F7F A;  1F54 A;  4WQ2 A;  3NSO A;  4L9M A;  1IIO A;  1QIV A;  1N65 A;  3PN7 C;  3DVK A;  2K2A A;  2KBI A;  2WOS A;  2D8N A;  2JNF A;  2KFF A;  3EKH A;  1DT7 B;  3BQ3 A;  4P5O E;  2LCP A;  1GQM A;  2L4I A;  4JQ0 D;  3WNX B;  2BBN A;  4NDD A;  4YI8 A;  2OTG B;  4DUQ A;  5D3O A;  5BPJ A;  1DJY A;  2LHI A;  2Y1M A;  1K8U A;  2L50 A;  2LMT A;  1P28 A;  3SS4 A;  1R6P A;  5EL2 A;  2L4H A;  1KK8 C;  2LMV A;  1B7T Y;  2GGM A;  2MA2 A;  2PQL A;  1KSO A;  1OOF A;  1YR5 A;  1EJ3 A;  1G33 A;  2ISD A;  3C1V A;  2KGR A;  2JT0 A;  4ZCV A;  1OQP A;  4N1F A;  3TUY C;  2KYF A;  1DJX A;  1WDC C;  3S0F A;  1REC A;  2M49 B;  2KFG A;  4INX A;  1MF8 B;  2WOR A;  4GFT A;  1ALV A;  3I5G C;  1LA0 A;  1W7J B;  2WND A;  3PM8 A;  1TCF A;  2Y5I A;  2G9B A;  1K93 D;  3D0Y B;  2K8M B;  1KFX S;  1QAS A;  2WCL A;  3F45 A;  1WRL A;  4XJK B;  4ORB B;  1CB1 A;  1LVC D;  5ER4 X;  5B8I B;  1IJ6 A;  1NIW A;  1OOG A;  3PAT A;  1K96 A;  1AJ4 A;  1TWO A; 
#chains in the Genus database with same CATH homology
 1TNX A;  1YVL A;  2JTZ A;  5HKW A;  4N5X A;  1CDM A;  5HLO A;  2Q4U A;  1TIZ A;  1QTX A;  3BXK A;  1NUB A;  4GBA A;  3SIB A;  3KHE A;  2JXC A;  5JJG A;  1QX7 A;  2LVK A;  1DJG A;  1SL8 A;  2FOT A;  5CSN A;  4PHK A;  3CZT X;  2F8P A;  3A8R A;  3BOW B;  1B7T Z;  1BMO A;  1S5G Z;  3CR4 X;  2M1U A;  1Y0V H;  5CPV A;  1LXF C;  1ALW A;  4A4B A;  2ZND A;  1M46 A;  4MRX A;  1YUU A;  2SAS A;  2WCE A;  3JVT C;  3M0W A;  2M9G A;  3SG2 A;  3TDI A;  1S36 A;  5GQQ C;  3I5H B;  1BG1 A;  1KCY A;  3LLE A;  1XFX O;  1KK7 Z;  1PAL A;  2I2R E;  2PSR A;  2SCP A;  5D7F A;  4C0L A;  1K9U A;  3PN7 B;  4YGC B;  3DF0 B;  3FWB A;  2JQ6 A;  1PVB A;  1SYM A;  4Q04 A;  3SG3 A;  2JT8 A;  1QX5 B;  4CLN A;  1TN4 A;  1TRF A;  2CXJ A;  2IS9 A;  2Q91 A;  4GGF A;  1DJI A;  3FS7 A;  1QVI Z;  1N0Y A;  2FCE A;  2KQY A;  3TS5 C;  2LLU A;  2LMU A;  2WC8 A;  1YUT A;  2KOT A;  4N1G A;  3CS1 A;  2F3Z A;  5DKQ A;  3TUY B;  1QJT A;  2EC6 C;  1M39 A;  4CID A;  2CCM A;  2LP3 A;  2BEC A;  4AQJ A;  3LCP C;  1M63 B;  4DRW A;  3NXA A;  1F4Q A;  1ZUZ A;  3I5G B;  1QXP A;  3AKA A;  2GGZ A;  1IQ3 A;  2CTN A;  1S3P A;  1J1D A;  1NX1 A;  1PRW A;  1B1G A;  1L2O C;  4E68 A;  1ZAC A;  1UHI A;  1AHR A;  3BUN B;  1NYA A;  4QJ3 B;  4ORA B;  1SCM C;  1DTL A;  5HKY A;  4GAO A;  3PSR A;  1JF2 A;  3CR5 X;  2L98 A;  2L0P A;  2M7N A;  3EKJ A;  3I5F C;  2BCX A;  1RFJ A;  4USL A;  1S6J A;  2MRD A;  1WLZ A;  2H2K A;  4AOM A;  5AER A;  5AAN A;  3E3R A;  5DKR A;  4YGE B;  3CTN A;  2OS8 B;  4CFQ A;  1TNQ A;  1MUX A;  1IQ5 A;  1NCZ A;  5J3X A;  1SL7 A;  4GGN A;  5ER5 A;  1SW8 A;  1YUS A;  4A4C A;  2KI6 D;  2PAL A;  1FW4 A;  1KWO C;  3TZ1 A;  5DKN A;  1JC2 A;  3KPX A;  3O4Y A;  1LIN A;  4ICB A;  1IH0 A;  2BKI B;  1FF1 A;  4AQI A;  4MZJ A;  2FCD A;  2O60 A;  4MZL A;  1CFF A;  2LVV A;  1SPY A;  1PK0 D;  3JTD C;  2AUC A;  2JZI A;  3D0Y A;  2M8U A;  4XYN A;  5AEQ A;  2TN4 A;  3EK4 A;  1NCX A;  2QPT A;  4OR9 B;  2MLF C;  4BY4 A;  4XJK A;  5PAL A;  1JFJ A;  2BBM A;  4D1E A;  1LKJ A;  2L5X B;  1XO5 A;  1TNP A;  1QS7 A;  1J1E A;  1TCO B;  2KI4 B;  1XK4 A;  2LAP A;  5HLV A;  1BOD A;  1K9K A;  1G4Y R;  1XFY O;  2RGI A;  1D1O A;  5I2L A;  3PLF B;  3KO0 A;  1C07 A;  2JTT A;  3DVE A;  2KDH A;  1OZS A;  1XFV O;  1LA3 A;  1YX7 A;  2PRU A;  3VRR A;  3TS5 B;  1SRA A;  3EK8 A;  1F70 A;  3BOW A;  1XA5 A;  1IGV A;  4HRH A;  1B9A A;  1UHH A;  2V53 A;  1MXE A;  5AXI A;  2H61 A;  2EC6 B;  2ZN9 A;  1QIW A;  3GK2 A;  4PAL A;  1NCY A;  2I94 A;  4OKH A;  1L7Z A;  2K61 A;  1A4P A;  1ODB A;  3OX6 A;  5HYD A;  3K21 A;  1K2H A;  1K9P A;  2LHL A;  1L2O B;  3OB1 B;  4I5N B;  4YI9 A;  2BE4 A;  1E8A A;  2KBM A;  4CPV A;  1KQM C;  2NLN A;  1SCM B;  3BYA A;  2BE6 A;  1KSM A;  2JWW A;  3DF0 A;  4CFR A;  5KTY A;  1YRU B;  2KQ6 A;  1DGV A;  1CKK A;  3I5F B;  2LM5 A;  2LAN A;  3WXA A;  3MSE B;  3BUX B;  3EVV A;  2NCO A;  1M31 A;  4UPG A;  5G08 A;  2LNK A;  5I2Q A;  1F55 A;  1QAT A;  1UP5 A;  3HX4 A;  2KGB C;  3DVJ A;  1AVS A;  1X02 A;  3AAK A;  2LLS A;  1AP4 A;  4GNK B;  1A75 A;  2K0J A;  1TNW A;  3EVR A;  1DGU A;  1CDL A;  1OE9 B;  3DVM A;  4PHN A;  1GGZ A;  2F2P A;  1CFP A;  3OX5 A;  2F2O A;  3IF7 A;  1IWQ A;  2KAV A;  4ETO A;  3LK0 A;  1PVA A;  2F33 A;  5CSJ A;  1JF0 A;  2FJU B;  2M97 A;  1GJY A;  1UWO A;  2B1U A;  1KK8 B;  2ZRT A;  1A75 B;  4TNC A;  2QAC A;  2CBL A;  2LP2 A;  4YRU A;  1Y6W A;  3RLZ A;  1BLQ A;  3A4U B;  5CSI A;  1F71 A;  4MN0 A;  1S1E A;  1SR6 C;  2L51 A;  1DJZ A;  1J7R A;  1J55 A;  1WDC B;  1EL4 A;  3BUO B;  3ZWH A;  1XFU O;  1BF5 A;  2JXL A;  1FI6 A;  5AFP A;  3CGA A;  2JOJ A;  2COL B;  4WQ3 A;  3O6B A;  3TDZ A;  4MBE A;  4PE1 A;  1A2X A;  4P2Y B;  3EVU A;  2JC2 A;  4HSZ A;  4U8D A;  3CLN A;  2BCA A;  1SBJ A;  3GK4 X;  3ZNI A;  1NP8 A;  1EG4 A;  1SL9 A;  2EGD A;  1OMV A;  4NDC A;  1SMG A;  1K94 A;  1XFZ O;  1MWN A;  3IQO A;  2F3Y A;  2DOQ A;  4GPL B;  3AKB A;  1BJF A;  4MVF A;  4QJ5 B;  3OB2 B;  3PFV A;  3CR2 A;  5JOL A;  2EHB A;  2K7C A;  4FQO A;  2M7L A;  2I7A A;  1FBV A;  3LK1 A;  3VRN A;  3PAL A;  4PHJ A;  1M45 A;  1CTR A;  1UUS A;  3I5I C;  4MRY A;  1OMR A;  3SJS A;  4BY5 A;  1IKU A;  1MXL C;  1EH2 A;  2KAX A;  4GUK A;  3FIA A;  1KFU S;  3EK7 A;  2NXQ A;  1HT9 A;  1F8H A;  2ZN8 A;  2M3W A;  4WRI A;  1BT6 A;  1EG3 A;  3JVT B;  4DS7 A;  4HRG A;  1UHN A;  2K7B A;  3QRX A;  4OVN F;  3SG6 A;  1S26 D;  2BCB A;  2BKH B;  1OOJ A;  4YBH B;  1B4C A;  1RRO A;  1CLB A;  1YRT B;  1S6C A;  2BL0 C;  3I5H C;  1NWD A;  1WRZ A;  5I8N A;  1OMD A;  1YTZ C;  3SG5 A;  1AJ5 A;  3VRP A;  2ZNE A;  1U5I B;  1Y1X A;  2K7D A;  2MBX A;  4C0K A;  2E30 A;  5TNC A;  1BR1 B;  1CLL A;  1NPQ A;  1NX3 A;  1CMG A;  1JBA A;  2ZFD A;  1DF0 B;  1EXR A;  3H4S E;  4M2Q A;  1UHK A;  1RJV A;  4PE7 A;  3CWG A;  3VRO A;  2JNX A;  3O78 A;  2KHN A;  2JT3 A;  1C7V A;  1QV1 A;  1JUO A;  3GOF A;  1SK6 D;  2KFH A;  3OHM B;  4ORC B;  4QJ4 B;  1IRJ A;  1J7P A;  3SIA A;  1VRK A;  4PE4 A;  1HQV A;  1V1G A;  1F4O A;  2CT9 A;  4NQG A;  5IBW A;  3WHT B;  1S5G Y;  2WCF A;  3KF9 A;  4JWQ A;  4MEW A;  3AAJ A;  1SR6 B;  1J7Q A;  1H8B A;  1OSA A;  2LC5 A;  1DJW A;  2HPS A;  2MJW B;  3D10 A;  1C7W A;  2LUX A;  2Y4Q A;  5HKZ A;  5F6T A;  1TOP A;  1ZOT B;  2MHH A;  3VRQ A;  1ZFS A;  2HQW A;  1B8L A;  4PDZ A;  4I5K A;  2KSP A;  1Q80 A;  2MLE C;  4GGF C;  1TTX A;  1SCV A;  1JSA A;  1KK7 Y;  3GK1 A;  1QLK A;  4HRE E;  4YGB B;  4ZCU A;  1W7I B;  3BUM B;  2Y1N A;  3FWC A;  4M2O A;  4PE0 A;  1NSH A;  2HET A;  2PVB A;  1QX2 A;  3WHU B;  3NSK A;  4YGA A;  4R1E A;  1CNP A;  5FYX A;  1KFU L;  3TDU A;  3LL8 B;  3I5I B;  1CMF A;  1CM1 A;  2K2F A;  1DVI A;  1YVH A;  1YX8 A;  2JRF A;  2OS8 C;  4MZK A;  4C0J A;  2AAO A;  1PSB A;  1QVI Y;  1OZO A;  3NSI A;  1KWO B;  2NZ0 A;  2JUL A;  1AUI B;  5D69 A;  1CDN A;  1WRK A;  2AMI A;  1BOC A;  1PUL A;  1YUR A;  2PMY A;  1KQV A;  1DMO A;  4PCW A;  1Y1U A;  3JTD B;  1K90 D;  3RM1 A;  1CLM A;  1PSR A;  2OTG C;  1MHO A;  1WLM A;  1MR8 A;  2GV5 A;  1H4B A;  1N2D A;  2L2E A;  5I2O A;  2NCP A;  1IJ5 A;  3DD4 A;  1RTP 1;  1XYD A;  2BL0 B;  2HQ8 A;  1BU3 A;  1FI5 A;  3IQQ A;  1NX2 A;  2E6W A;  3SG4 A;  1S6I A;  2P6B B;  2M1K B;  2JPT A;  4YGD B;  2O5G A;  2OPO A;  4M2P A;  2KI6 C;  4PHM A;  2LE9 B;  4FTG A;  1MQ1 A;  1IG5 A;  1WY9 A;  2LV7 A;  4F0Z B;  1G8I A;  2KI4 C;  1XVJ A;  3ICB A;  4I5L B;  2HF5 A;  1CDP A;  1CM4 A;  5CSF A;  3HCM A;  4DCK A;  2R2I A;  4OCI A;  1JWD A;  3VGO A;  2CNP A;  4OV2 A;  1K95 A;  4DIR A;  2G2B A;  1V1F A;  4I5J A;  4MLW A;  1JFK A;  2PAS A;  2LVI A;  3OP0 A;  2MAZ A;  1J7O A;  2M29 A;  2ZRS A;  1B8R A;  4IL1 A;  1AK8 A;  4MSP A;  2VRG A;  1XK4 C;  1SNL A;  1KFX L;  2ZKM X;  2LUC A;  1RK9 A;  1UUR A;  1UHJ A;  1QLS A;  3O2P A;  1Y1A A;  1NX0 A;  2LLT A;  2I18 A;  1KQM B;  1QV0 A;  2KYC A;  1SY9 A;  2KNE A;  3NSL A;  1U5I A;  1A29 A;  3KEV A;  4JPZ B;  1CFC A;  1XFW O;  2H61 C;  1B47 A;  2JU0 A;  1RWY A;  2KAY A;  4NDB A;  5K89 A;  5KU1 A;  1DF0 A;  2LVJ A;  1SKT A;  2WCB A;  1FPW A;  1A03 A;  1R2U A;  2M0R A;  1BR4 B;  1GGW A;  2A4J A;  5KSZ A;  1CFD A;  1ZMZ A;  3BUW B;  1DJH A;  3SG7 A;  2K7O A;  1B8C A;  1F54 A;  4WQ2 A;  3NSO A;  4L9M A;  1QIV A;  1N65 A;  3PN7 C;  3DVK A;  2K2A A;  2KBI A;  2WOS A;  2D8N A;  2JNF A;  2KFF A;  3EKH A;  1DT7 B;  3BQ3 A;  4P5O E;  2LCP A;  1GQM A;  2L4I A;  4JQ0 D;  3WNX B;  2BBN A;  4NDD A;  4YI8 A;  2OTG B;  4DUQ A;  5BPJ A;  1DJY A;  2LHI A;  2Y1M A;  1K8U A;  2L50 A;  2LMT A;  1R6P A;  2L4H A;  1KK8 C;  2LMV A;  1B7T Y;  2GGM A;  2MA2 A;  1KSO A;  1YR5 A;  1EJ3 A;  1G33 A;  2ISD A;  3C1V A;  2KGR A;  2JT0 A;  4ZCV A;  1OQP A;  4N1F A;  3TUY C;  2KYF A;  1DJX A;  1WDC C;  1REC A;  2M49 B;  2KFG A;  1MF8 B;  2WOR A;  4GFT A;  1ALV A;  3I5G C;  1LA0 A;  1W7J B;  2WND A;  3PM8 A;  1TCF A;  2Y5I A;  2G9B A;  1K93 D;  3D0Y B;  2K8M B;  1KFX S;  1QAS A;  3F45 A;  1WRL A;  4XJK B;  4ORB B;  1CB1 A;  1LVC D;  5ER4 X;  5B8I B;  1IJ6 A;  1NIW A;  3PAT A;  1K96 A;  1AJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...