1DVIA

Calpain domain vi with calcium bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
EEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTSRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a calpain Ca(2+)-binding domain reveals a novel EF-hand and Ca(2+)-induced conformational changes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-dependent protease
molecule keywords CALPAIN
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dviA00
3SIBA 5HLOA 1NCYA 3DF0A 1JF2A 2KBIA 2OTGC 1SRAA 2L4HA 3KO0A 4OCIA 1UURA 1NIWA 4BY4A 1SK6D 1XFVO 1SCMC 2RGIA 1BJFA 3A8RA 1MXLC 2NCOA 1K95A 3PN7B 5ER4X 1A75A 1KSOA 2LANA 4BY5A 1KSMA 1KFUL 4PE4A 1CM1A 1PULA 1IRJA 2AMIA 3AAJA 3EK8A 3VRNA 4GGFC 1KQMC 3O78A 2Y1NA 2V53A 1L2OC 2MRDA 1TRFA 2HETA 1FW4A 1S6JA 1TNWA 1OMRA 1U5IB 1NCZA 2JPTA 1XFUO 1TOPA 1CDMA 4N5XA 3VROA 4DRWA 1RTP1 2BL0B 2Q4UA 1CFCA 3CTNA 1WY9A 1QLSA 2FOTA 2JT8A 3I5FB 1CTRA 2WORA 1BLQA 3EKJA 4NQGA 4HRGA 2PMYA 5D69A 2F2PA 1MF8B 2E6WA 1EXRA 3NSKA 1UP5A 5DKRA 2LV7A 1UWOA 3BYAA 1BMOA 3VGOA 1WLZA 4WQ3A 1XFXO 5HLVA 2HF5A 5J3XA 3LK0A 1GGZA 1WDCC 1YX7A 3D0YB 3EVVA 1DJXA 2HPSA 2OTGB 5AEQA 5PALA 4CFQA 5IBWA 4PE0A 1EL4A 1KK7Z 1LKJA 1S5GZ 4YGAA 1Y6WA 1D1OA 5I2OA 1AHRA 1F71A 3DF0B 3PN7C 3SG7A 2JZIA 1AJ5A 2ZRSA 1ZMZA 4YI8A 1BG1A 4OVNF 3I5IB 3QRXA 5CSFA 1A2XA 2KBMA 2LVJA 1A29A 1EJ3A 1CMGA 1A75B 1ALVA 2AAOA 1SY9A 1EG4A 3DD4A 2A4JA 3O2PA 1SPYA 1DJZA 2ZNDA 3HCMA 3LCPC 2I7AA 1K8UA 1WRZA 4F0ZB 1WLMA 3SG3A 1SL8A 1B1GA 1KK7Y 1H4BA 2L50A 1J7RA 2H61C 2Y4QA 2GGZA 1FF1A 2O60A 3FWCA 5KTYA 3GOFA 1U5IA 4DS7A 1NCXA 1ZUZA 1V1FA 1M63B 2JTTA 1C07A 1XYDA 4HRHA 5I2QA 4YBHB 2BE4A 4NDCA 1NWDA 1EG3A 2SCPA 1ZOTB 3BUNB 3TZ1A 5CSJA 1GQMA 1KK8C 2FJUB 4MVFA 1YVLA 3OP0A 4MRYA 2K0JA 1HT9A 1MQ1A 2EC6C 1KFXS 3NSIA 3SG4A 1DJHA 2E30A 4AQJA 4YRUA 1J1DA 1YURA 1WDCB 3IF7A 1MXEA 1WRKA 2Q91A 1QASA 3KHEA 1FI5A 4HREE 3D0YA 1XFYO 4PHNA 4PHMA 1QIWA 1KQVA 2F3YA 4GPLB 4DIRA 3GK2A 2LLTA 2GV5A 4E68A 2M9GA 4AOMA 1LA0A 3BQ3A 3DVJA 4MN0A 3TDZA 1L2OB 3I5HB 5B8IB 4PE7A 4M2OA 1CFPA 3PLFB 2FCEA 1YRUB 4GGNA 3SG6A 2JULA 4YGDB 3IQQA 4YGEB 2OS8B 2M7LA 3TUYB 1TIZA 2NZ0A 1G4YR 2K7OA 1YTZC 3I5FC 4I5LB 4M2QA 2KFGA 2NLNA 4GGFA 4DUQA 1NX0A 2K2FA 2BE6A 4MZKA 5AANA 1ZFSA 2M8UA 1CLBA 3DVMA 1KCYA 1WRLA 1OZSA 2H2KA 4L9MA 2ZKMX 4WQ2A 1OMVA 1V1GA 3SIAA 3VRQA 1EH2A 1RJVA 2WCEA 4MZJA 1AJ4A 2ZN8A 5DKNA 1IQ5A 2H61A 2MJWB 2ZN9A 3PATA 2ZFDA 1F4QA 2LLUA 1DT7B 3IQOA 1LA3A 2KI4C 4PHKA 3BUOB 1QX5B 1SCVA 1MUXA 1YR5A 1KQMB 1UHJA 1W7IB 2KGRA 2KI6C 1B8LA 1DJYA 1XA5A 4MLWA 3I5IC 1IWQA 2PRUA 4XJKA 4XYNA 5CPVA 1QX7A 3JVTC 1CNPA 2JU0A 5ER5A 1AVSA 2LP3A 2TN4A 4P2YB 1M31A 2L2EA 2B1UA 1UHIA 3I5HC 2KFHA 2M7NA 1JBAA 2JWWA 2KOTA 3O6BA 4ZCUA 1S6CA 2I2RE 2I18A 4U8DA 3WHUB 1UHHA 3O4YA 1XFWO 2CCMA 2PASA 1S6IA 3I5GC 1QV1A 1K2HA 3TDUA 1SMGA 3CWGA 2KI6D 3BOWA 1OSAA 4QJ4B 3WNXB 4PE1A 2ZNEA 2JT3A 1QIVA 1NUBA 1CMFA 1C7WA 3AAKA 1TCFA 4USLA 1SKTA 5G08A 1KWOC 1S3PA 1BOCA 1J7PA 2EGDA 3C1VA 2PSRA 2JT0A 1JWDA 2Y1MA 1R6PA 1XK4C 3LK1A 1F4OA 4TNCA 2HQWA 1BR4B 1DF0B 1G8IA 4UPGA 1PSRA 1NSHA 2JXLA 1TTXA 2R2IA 1RECA 1ZACA 1F55A 1LINA 3BXKA 1BODA 1NX1A 1NYAA 4ORAB 3KPXA 3SG5A 3EVUA 1DJWA 2BCXA 3MSEB 1SL9A 1YRTB 1B9AA 3PSRA 3CS1A 1TNPA 4GNKB 1IG5A 1RROA 1VRKA 2CBLA 2KI4B 2AUCA 1X02A 1SYMA 2KGBC 2K7DA 4YGBB 2K7CA 1TNQA 2JOJA 3AKBA 3RLZA 1L7ZA 3JVTB 3VRPA 4XJKB 2WCBA 1S36A 2LE9B 2K7BA 2OS8C 1IKUA 2EHBA 3ICBA 1E8AA 1MHOA 2IS9A 3EK4A 1PVAA 2LHLA 1N0YA 1M45A 1N2DA 4MEWA 1H8BA 1YUUA 2WCFA 1M39A 3WXAA 4I5KA 1IJ6A 2CTNA 4CFRA 4PALA 5KU1A 1LVCD 2KQYA 2LVVA 3FS7A 1QX2A 2L4IA 1SNLA 1KK8B 3BOWB 5HKZA 1XVJA 2M1UA 4CLNA 3FWBA 1DGVA 2L98A 4GFTA 2F2OA 2M3WA 1JUOA 1NX3A 2QPTA 3H4SE 1C7VA 1OZOA 1JFJA 2EC6B 1B7TZ 5DKQA 4GAOA 1PALA 4A4CA 3PM8A 2KNEA 1UHNA 2HQ8A 2ZRTA 1J1EA 1CLMA 1CFDA 1QLKA 1QV0A 2WOSA 4MBEA 3TDIA 2LP2A 3SG2A 2DOQA 3TS5C 5GQQC 1YX8A 1DF0A 3KEVA 3CZTX 1SR6B 1MWNA 1YVHA 1SL7A 4OR9B 2LUCA 1N65A 3CR4X 1CM4A 1DVIA 1CFFA 4ICBA 2OPOA 1Q80A 3NSLA 1OOJA 5F6TA 2FCDA 2G9BA 2WNDA 4GUKA 4CIDA 1S5GY 2LM5A 5JOLA 4MRXA 1MR8A 1BU3A 3OB2B 4MZLA 2NXQA 1GGWA 3NXAA 5HKWA 4N1FA 2JRFA 4Q04A 2KHNA 1QS7A 1TCOB 1CDPA 1IGVA 3I5GB 1K96A 4IL1A 1OE9B 1AUIB 5AFPA 2BL0C 1CB1A 2L0PA 3EKHA 4ZCVA 3CGAA 1AP4A 1Y1UA 2M1KB 1K9UA 2KYCA 2LHIA 1PSBA 2I94A 2LVKA 2M0RA 2BCBA 3A4UB 2CXJA 1RWYA 1S1EA 5TNCA 4MSPA 2CT9A 1B8RA 3AKAA 1AK8A 1DJIA 1LXFC 1NPQA 3OX6A 3VRRA 4PDZA 2JNXA 3EK7A 2L5XB 1K90D 3CR2A 3LL8B 1QTXA 1K93D 4NDBA 1IJ5A 1DJGA 1BT6A 2WC8A 5CSIA 1RFJA 1IH0A 1G33A 3OB1B 4ORCB 3LLEA 1B47A 4OV2A 2CNPA 2M97A 1GJYA 1KFXL 5K89A 1Y1AA 2F33A 1TNXA 5D7FA 2JXCA 1XFZO 5I2LA 1FBVA 3TS5B 3EVRA 1NP8A 2KQ6A 4C0JA 2BBNA 1J55A 1W7JB 3ZNIA 2O5GA 1K9PA 1XK4A 3OX5A 3BUMB 1CDNA 1BR1B 1YUTA 2JTZA 5AXIA 1JFKA 1SR6C 5BPJA 1CKKA 3CLNA 1CLLA 1NX2A 1ALWA 1S26D 2K61A 2P6BB 3D10A 4I5JA 1QXPA 2BECA 2SASA 3E3RA 5CSNA 3WHTB 1DMOA 5FYXA 1DGUA 2LMVA 1ODBA 2LVIA 4OKHA 1UUSA 4NDDA 1QVIY 4GBAA 4FTGA 2MA2A 5JJGA 2KAXA 1B4CA 4ORBB 3DVKA 2LNKA 1RK9A 1M46A 1K94A 1JC2A 1F8HA 2F8PA 2KDHA 3ZWHA 3OHMB 3PFVA 4R1EA 2M29A 2BCAA 3TUYC 2LMTA 2KSPA 2MLEC 4A4BA 4CPVA 5AERA 3HX4A 5HYDA 3FIAA 2GGMA 4N1GA 1QJTA 1XO5A 2KAYA 3CR5X 3RM1A 1J7QA 1YUSA 3BUWB 3SJSA 3PALA 2QACA 2JNFA 1QATA 1B7TY 1F70A 1SCMB 2LAPA 2LLSA 4AQIA 3DVEA 2BKHB 1J7OA 2PALA 4JPZB 4WRIA 2L51A 4C0KA 1QVIZ 1Y0VH 1PK0D 2VRGA 1B8CA 1KFUS 2F3ZA 3JTDB 1A03A 1K9KA 4DCKA 4HSZA 2ISDA 2K8MB 2G2BA 2MLFC 1CDLA 2PVBA 1OQPA 2BKIB 2LUXA 1TN4A 2Y5IA 3BUXB 3NSOA 2KFFA 3K21A 5HKYA 1PVBA 3JTDC 1F54A 3GK4X 1JSAA 4JWQA 2KAVA 1OMDA 2JC2A 2M49B 4D1EA 3GK1A 1FPWA 2LCPA 1Y1XA 3F45A 4QJ3B 1A4PA 2JQ6A 4M2PA 3M0WA 1SW8A 4JQ0D 4P5OE 4C0LA 4FQOA 2NCPA 1JF0A 1KWOB 2BBMA 2LC5A 3KF9A 1HQVA 4PHJA 5KSZA 4QJ5B 4I5NB 1SBJA 2K2AA 4ETOA 1DTLA 2MAZA 1UHKA 4PCWA 2LMUA 1PRWA 1R2UA 2KYFA 5I8NA 4YI9A 2D8NA 2COLB 1BF5A 2MHHA 1IQ3A 2MBXA 1FI6A 4YGCB
chains in the Genus database with same CATH superfamily
2L5YA 3SIBA 5HLOA 1NCYA 3DF0A 1JF2A 2KBIA 2OTGC 1SRAA 2L4HA 1OOGA 3KO0A 3S0FA 4OCIA 1UURA 1NIWA 4BY4A 1SK6D 1XFVO 1SCMC 2RGIA 1BJFA 3A8RA 1MXLC 2NCOA 4PT1A 3B86A 1K95A 3PN7B 5ER4X 1A75A 1KSOA 2QEOA 3R72A 2LANA 4BY5A 1KSMA 1KFUL 4PE4A 1CM1A 3SS5A 1PULA 1TUZA 1IRJA 2AMIA 3AAJA 3EK8A 3VRNA 4GGFC 1KQMC 3O78A 2Y1NA 2V53A 1L2OC 2MRDA 1TRFA 2HETA 1FW4A 1S6JA 1TNWA 1OMRA 1U5IB 1NCZA 2JPTA 1XFUO 1K2HA 1TOPA 1CDMA 1Z4HA 4N5XA 3VROA 4DRWA 1RTP1 2BL0B 2Q4UA 1CFCA 3CTNA 1WY9A 1QLSA 2FOTA 2JT8A 3I5FB 1CTRA 1AP4A 2WORA 1BLQA 3EKJA 4NQGA 4HRGA 2PMYA 1DELA 5D69A 2F2PA 1MF8B 2E6WA 5D3OA 1EXRA 3NSKA 1UP5A 5DKRA 2LV7A 1UWOA 3BYAA 1BMOA 3VGOA 1WLZA 4WQ3A 1XFXO 5HLVA 2HF5A 5J3XA 3LK0A 2PYQA 1GGZA 1WDCC 1YX7A 3D0YB 3EVVA 1DJXA 2HPSA 2OTGB 5AEQA 5PALA 4CFQA 5IBWA 4PE0A 1EL4A 1KK7Z 1LKJA 1S5GZ 4YGAA 1Y6WA 1D1OA 5I2OA 1AHRA 1F71A 3B87A 1SSEB 3DF0B 3PN7C 3SG7A 2JZIA 1AJ5A 2QDIA 2ZRSA 1ZMZA 3UO9A 4YI8A 1BG1A 4OVNF 3I5IB 3QRXA 5CSFA 1A2XA 5DICA 1P28A 2KBMA 2LVJA 1A29A 1EJ3A 3CABA 4KYNA 1A75B 1CMGA 1ALVA 2AAOA 3Q8IA 1SY9A 1DQEA 1EG4A 3DD4A 2A4JA 3O2PA 1SPYA 1DJZA 2ZNDA 3BFHA 3HCMA 3LCPC 2PQLA 2I7AA 1K8UA 1WRZA 4F0ZB 1WLMA 2YGUA 3SG3A 1SL8A 1B1GA 1KK7Y 1H4BA 2L50A 1J7RA 3CZ0A 2H61C 2Y4QA 2GGZA 4INXA 1FF1A 2O60A 3FWCA 5KTYA 3GOFA 1U5IA 4DS7A 1NCXA 1ZUZA 1V1FA 1M63B 4OZDA 3CZ1A 2JTTA 5I94A 3S0AA 1C07A 1XYDA 4HRHA 5I2QA 4YBHB 2BE4A 4NDCA 1NWDA 1EG3A 2SCPA 1ZOTB 3BUNB 3TZ1A 5CSJA 1GQMA 1KK8C 5HL1A 2FJUB 4MVFA 1YVLA 3DZTA 3OGNA 3OP0A 1OOIX 1LS8A 4MRYA 2K0JA 1T14A 1HT9A 1MQ1A 2EC6C 1KFXS 3NSIA 3SG4A 1DJHA 2E30A 4AQJA 4YRUA 2P71A 2BAPA 1J1DA 1YURA 1WDCB 3IF7A 1MXEA 1WRKA 2Q91A 3V2LA 1QASA 3KHEA 1FI5A 3PM2A 2QEBA 3D0YA 4HREE 1XFYO 4PHNA 4PHMA 1QIWA 1KQVA 2F3YA 4GPLB 4DIRA 2WCMA 2LLTA 2GV5A 3GK2A 2M9GA 4AOMA 4E68A 1LA0A 3BQ3A 3DVJA 4MN0A 3TDZA 1L2OB 3I5HB 5B8IB 4PE7A 4M2OA 1CFPA 3PLFB 2FCEA 1TWOA 1YRUB 4GGNA 3SG6A 2JULA 4YGDB 3IQQA 4YGEB 2OS8B 2M7LA 3TUYB 1TIZA 2NZ0A 3RZSA 1G4YR 1TUJA 2K7OA 1GM0A 1YTZC 1OW4A 3I5FC 4I5LB 4M2QA 2KFGA 2NLNA 4GGFA 4DUQA 1NX0A 2K2FA 3CDNA 2BE6A 4MZKA 5AANA 1ZFSA 2M8UA 1CLBA 3DVMA 1KCYA 1WRLA 1OZSA 2H2KA 1DEKA 3D75A 2ZKMX 4L9MA 4WQ2A 1OMVA 1V1GA 3SIAA 3VRQA 1EH2A 1RJVA 3S0GA 3FE6A 2WCEA 4MZJA 1AJ4A 2ZN8A 5DKNA 1IQ5A 2H61A 2MJWB 2ZN9A 3PATA 2ZFDA 1F4QA 2LLUA 1DT7B 2KPHA 3IQOA 1LA3A 2KI4C 4PHKA 3BUOB 1QX5B 1SCVA 1MUXA 1YR5A 4JKTA 1KQMB 1UHJA 1W7IB 2KGRA 2KI6C 1B8LA 1DJYA 1XA5A 4MLWA 3I5IC 1IWQA 2PRUA 4XJKA 4XYNA 5CPVA 1QX7A 3JVTC 1CNPA 2JU0A 5ER5A 1AVSA 3N7HA 3NHTA 2LP3A 2TN4A 4P2YB 1M31A 3OBVA 2L2EA 2B1UA 3D76A 1UHIA 3QMEA 3R1PA 3I5HC 2KFHA 2M7NA 1JBAA 2JWWA 2KOTA 3O6BA 4ZCUA 1S6CA 3TDIA 2I2RE 1Z2CB 2I18A 4U8DA 3WHUB 1UHHA 3O4YA 1XFWO 2CCMA 2PASA 1S6IA 3I5GC 1QV1A 3BFAA 3TDUA 1SMGA 3CWGA 2KI6D 3BOWA 1OSAA 4QJ4B 3WNXB 4PE1A 2ZNEA 1ORGA 2JT3A 2WC6A 1QIVA 3NGVA 1NUBA 2WCHA 1CMFA 1C7WA 3AAKA 3D77A 1TCFA 4USLA 1SKTA 5G08A 2P70A 5FI7A 1KWOC 1S3PA 3VB1A 1BOCA 1J7PA 2EGDA 2JPOA 3C1VA 2PSRA 2JT0A 1JWDA 2Y1MA 1R6PA 1XK4C 3LK1A 1F4OA 4TNCA 2HQWA 1BR4B 1DF0B 1G8IA 2FJYA 1PSRA 4UPGA 1NSHA 2JXLA 1TTXA 2R2IA 1RECA 1ZACA 1F55A 1LINA 3BXKA 1BODA 1NX1A 1NYAA 4ORAB 3KPXA 3SG5A 3EVUA 1DJWA 2BCXA 3MSEB 1SL9A 1YRTB 1B9AA 3PSRA 3CS1A 1TNPA 4GNKB 1IG5A 1RROA 1VRKA 2CBLA 2KI4B 2AUCA 2GTEA 1X02A 3DYEA 1SYMA 2KGBC 2K7DA 4YGBB 2K7CA 1TNQA 1W9ZA 2JOJA 3AKBA 1L7ZA 3JVTB 3RLZA 3VRPA 4INWA 4XJKB 2WCBA 1S36A 2LE9B 2K7BA 2OS8C 1IKUA 2EHBA 3ICBA 1E8AA 1MHOA 2IS9A 3EK4A 1QWVA 1PVAA 2LHLA 1N0YA 1M45A 1N2DA 4MEWA 1H8BA 1YUUA 2WCFA 1M39A 3WXAA 4I5KA 1IJ6A 2CTNA 4CFRA 4JD9A 4PALA 5KU1A 1LVCD 2KQYA 2LVVA 3FS7A 1QX2A 2L4IA 1SNLA 3D78A 1KK8B 3BOWB 5HKZA 1XVJA 2M1UA 4CLNA 2BNXA 3FWBA 1DGVA 2L98A 4GFTA 2F2OA 2KLDA 1JUOA 1NX3A 2M3WA 2QPTA 3H4SE 1OZOA 1C7VA 1JFJA 2EC6B 3D74A 1B7TZ 5DKQA 1IIOA 4GAOA 3R1OA 1PALA 4A4CA 3PM8A 2KNEA 1UHNA 2HQ8A 2ZRTA 1J1EA 1CLMA 1CFDA 1QLKA 1QV0A 2WOSA 4MBEA 2QEVA 2LP2A 2ERBA 3SG2A 2DOQA 3TS5C 5GQQC 1YX8A 1DF0A 3FE8A 3CZTX 3KEVA 1SR6B 1MWNA 1YVHA 1SL7A 4OR9B 2LUCA 1N65A 5FI6A 3CR4X 1CM4A 1DVIA 3SS4A 4ICBA 1CFFA 2OPOA 1Q80A 3NSLA 1OOJA 5F6TA 2FCDA 2G9BA 2WNDA 4GUKA 4CIDA 1S5GY 2LM5A 5JOLA 1DC1A 4MRXA 1MR8A 1BU3A 3OB2B 4MZLA 2NXQA 1GGWA 3NXAA 5HKWA 4N1FA 2JRFA 4Q04A 2KHNA 1QS7A 1OOHA 1TCOB 1CDPA 1IGVA 3I5GB 1K96A 4IL1A 1OE9B 1AUIB 5AFPA 2BL0C 1CB1A 2L0PA 3EKHA 4ZCVA 3CGAA 3O4XA 4F7FA 1Y1UA 2M1KB 1K9UA 2KYCA 2LHIA 1PSBA 2I94A 2LVKA 2M0RA 2BCBA 3A4UB 3DXLA 3L4LA 2CXJA 1RWYA 1S1EA 5TNCA 4MSPA 2CT9A 1B8RA 3AKAA 1AK8A 1DJIA 1LXFC 1NPQA 3FE9A 3OX6A 3VRRA 3DY9A 4PDZA 2JNXA 3EK7A 3CZ2A 2L5XB 1K90D 3CR2A 3LL8B 1QTXA 1K93D 4NDBA 2L2CA 1IJ5A 1DJGA 1BT6A 5FI2A 2WC8A 5CSIA 1RFJA 1IH0A 1G33A 2KLEA 3OB1B 4ORCB 3LLEA 1B47A 2K60A 4OV2A 3L47A 2CNPA 2M97A 1GJYA 1KFXL 5K89A 1Y1AA 2F33A 1TNXA 5D7FA 3B88A 2JXCA 1XFZO 5I2LA 1FBVA 3TS5B 3EVRA 1NP8A 2KQ6A 4C0JA 2BBNA 1C3ZA 1J55A 1W7JB 3ZNIA 2O5GA 1K9PA 1XK4A 3OX5A 2WCLA 3BUMB 1CDNA 3EG5B 1BR1B 1YUTA 2JTZA 5AXIA 1JFKA 1SR6C 5BPJA 1CKKA 3B7AA 3CLNA 1CLLA 1NX2A 1C3YA 1ALWA 1S26D 2K61A 2P6BB 3D10A 4I5JA 3BFBA 1QXPA 2BECA 2SASA 3E3RA 5CSNA 3WHTB 1DMOA 3BJHA 5FYXA 1DGUA 2LMVA 1ODBA 2LVIA 4OKHA 3NHIA 1UUSA 3PJIA 4NDDA 1QVIY 4GBAA 4FTGA 2MA2A 5JJGA 2KAXA 3UNWA 1B4CA 4ORBB 3DVKA 3S0DA 2LNKA 1RK9A 1M46A 1K94A 1JC2A 1F8HA 2F8PA 2KDHA 3ZWHA 3OHMB 3PFVA 4R1EA 2M29A 2BCAA 3TUYC 2LMTA 2KSPA 2MLEC 3D73A 4A4BA 4CPVA 5AERA 3HX4A 5HYDA 3FIAA 2GGMA 2WC5A 4N1GA 1QJTA 1XO5A 2KAYA 1XFRA 2QEHA 3CR5X 3RM1A 1J7QA 3L4AA 1YUSA 3BUWB 3SJSA 3PALA 4FQTA 1OOFA 2QACA 2JNFA 3SS3A 1QATA 1B7TY 1F70A 1SCMB 2LAPA 2LLSA 3B6XA 4AQIA 3DVEA 2BKHB 1J7OA 2PALA 4JPZB 4WRIA 2L51A 4C0KA 3CYZA 1QVIZ 1Y0VH 1PK0D 2VRGA 1B8CA 1KFUS 2F3ZA 3JTDB 1A03A 1K9KA 2WCKA 3IVTA 3R1VA 2K8MB 4HSZA 2ISDA 2G2BA 2MLFC 4DCKA 1CDLA 3K1EA 2PVBA 1OQPA 2BKIB 2LUXA 1TN4A 2Y5IA 3BUXB 3NSOA 5EL2A 2KFFA 3K21A 3S0BA 1PVBA 3JTDC 5HKYA 2H8VA 3GK4X 4IJ7A 1F54A 4JWQA 1JSAA 2KAVA 1OMDA 2JC2A 2M49B 4D1EA 3GK1A 1FPWA 2LCPA 1Y1XA 3F45A 4QJ3B 1A4PA 2JQ6A 4M2PA 3M0WA 1SW8A 4JQ0D 4P5OE 4C0LA 4FQOA 2NCPA 1JF0A 1KWOB 2BBMA 2LC5A 3KF9A 1HQVA 4PHJA 5KSZA 2WCJA 4QJ5B 4I5NB 1SBJA 2K2AA 4ETOA 1DTLA 2MAZA 1UHKA 4PCWA 2LMUA 1PRWA 1R2UA 2KYFA 5I8NA 4YI9A 3S0EA 2D8NA 2COLB 1BF5A 2MHHA 1IQ3A 2MBXA 1FI6A 4YGCB
chains in the Genus database with same CATH topology
3SIBA 5HLOA 1NCYA 3DF0A 1JF2A 2KBIA 2OTGC 1SRAA 2L4HA 3KO0A 4OCIA 1UURA 1NIWA 4BY4A 1SK6D 1XFVO 1SCMC 2RGIA 1BJFA 3A8RA 1MXLC 2NCOA 1K95A 3PN7B 5ER4X 1A75A 1KSOA 2LANA 4BY5A 1KSMA 1KFUL 4PE4A 1CM1A 1PULA 1IRJA 2AMIA 3AAJA 3EK8A 3VRNA 4GGFC 1KQMC 3O78A 2Y1NA 2V53A 1L2OC 2MRDA 1TRFA 2HETA 1FW4A 1S6JA 1TNWA 1OMRA 1U5IB 1NCZA 2JPTA 1XFUO 1TOPA 1CDMA 4N5XA 3VROA 4DRWA 1RTP1 2BL0B 2Q4UA 1CFCA 3CTNA 1WY9A 1QLSA 2FOTA 2JT8A 3I5FB 1CTRA 2WORA 1BLQA 3EKJA 4NQGA 4HRGA 2PMYA 5D69A 2F2PA 1MF8B 2E6WA 1EXRA 3NSKA 1UP5A 5DKRA 2LV7A 1UWOA 3BYAA 1BMOA 3VGOA 1WLZA 4WQ3A 1XFXO 5HLVA 2HF5A 5J3XA 3LK0A 1GGZA 1WDCC 1YX7A 3D0YB 3EVVA 1DJXA 2HPSA 2OTGB 5AEQA 5PALA 4CFQA 5IBWA 4PE0A 1EL4A 1KK7Z 1LKJA 1S5GZ 4YGAA 1Y6WA 1D1OA 5I2OA 1AHRA 1F71A 3DF0B 3PN7C 3SG7A 2JZIA 1AJ5A 2ZRSA 1ZMZA 4YI8A 1BG1A 4OVNF 3I5IB 3QRXA 5CSFA 1A2XA 2KBMA 2LVJA 1A29A 1EJ3A 1CMGA 1A75B 1ALVA 2AAOA 1SY9A 1EG4A 3DD4A 2A4JA 3O2PA 1SPYA 1DJZA 2ZNDA 3HCMA 3LCPC 2I7AA 1K8UA 1WRZA 4F0ZB 1WLMA 3SG3A 1SL8A 1B1GA 1KK7Y 1H4BA 2L50A 1J7RA 2H61C 2Y4QA 2GGZA 1FF1A 2O60A 3FWCA 5KTYA 3GOFA 1U5IA 4DS7A 1NCXA 1ZUZA 1V1FA 1M63B 2JTTA 1C07A 1XYDA 4HRHA 5I2QA 4YBHB 2BE4A 4NDCA 1NWDA 1EG3A 2SCPA 1ZOTB 3BUNB 3TZ1A 5CSJA 1GQMA 1KK8C 2FJUB 4MVFA 1YVLA 3OP0A 4MRYA 2K0JA 1HT9A 1MQ1A 2EC6C 1KFXS 3NSIA 3SG4A 1DJHA 2E30A 4AQJA 4YRUA 1J1DA 1YURA 1WDCB 3IF7A 1MXEA 1WRKA 2Q91A 1QASA 3KHEA 1FI5A 4HREE 3D0YA 1XFYO 4PHNA 4PHMA 1QIWA 1KQVA 2F3YA 4GPLB 4DIRA 3GK2A 2LLTA 2GV5A 4E68A 2M9GA 4AOMA 1LA0A 3BQ3A 3DVJA 4MN0A 3TDZA 1L2OB 3I5HB 5B8IB 4PE7A 4M2OA 1CFPA 3PLFB 2FCEA 1YRUB 4GGNA 3SG6A 2JULA 4YGDB 3IQQA 4YGEB 2OS8B 2M7LA 3TUYB 1TIZA 2NZ0A 1G4YR 2K7OA 1YTZC 3I5FC 4I5LB 4M2QA 2KFGA 2NLNA 4GGFA 4DUQA 1NX0A 2K2FA 2BE6A 4MZKA 5AANA 1ZFSA 2M8UA 1CLBA 3DVMA 1KCYA 1WRLA 1OZSA 2H2KA 4L9MA 2ZKMX 4WQ2A 1OMVA 1V1GA 3SIAA 3VRQA 1EH2A 1RJVA 2WCEA 4MZJA 1AJ4A 2ZN8A 5DKNA 1IQ5A 2H61A 2MJWB 2ZN9A 3PATA 2ZFDA 1F4QA 2LLUA 1DT7B 3IQOA 1LA3A 2KI4C 4PHKA 3BUOB 1QX5B 1SCVA 1MUXA 1YR5A 1KQMB 1UHJA 1W7IB 2KGRA 2KI6C 1B8LA 1DJYA 1XA5A 4MLWA 3I5IC 1IWQA 2PRUA 4XJKA 4XYNA 5CPVA 1QX7A 3JVTC 1CNPA 2JU0A 5ER5A 1AVSA 2LP3A 2TN4A 4P2YB 1M31A 2L2EA 2B1UA 1UHIA 3I5HC 2KFHA 2M7NA 1JBAA 2JWWA 2KOTA 3O6BA 4ZCUA 1S6CA 2I2RE 2I18A 4U8DA 3WHUB 1UHHA 3O4YA 1XFWO 2CCMA 2PASA 1S6IA 3I5GC 1QV1A 1K2HA 3TDUA 1SMGA 3CWGA 2KI6D 3BOWA 1OSAA 4QJ4B 3WNXB 4PE1A 2ZNEA 2JT3A 1QIVA 1NUBA 1CMFA 1C7WA 3AAKA 1TCFA 4USLA 1SKTA 5G08A 1KWOC 1S3PA 1BOCA 1J7PA 2EGDA 3C1VA 2PSRA 2JT0A 1JWDA 2Y1MA 1R6PA 1XK4C 3LK1A 1F4OA 4TNCA 2HQWA 1BR4B 1DF0B 1G8IA 4UPGA 1PSRA 1NSHA 2JXLA 1TTXA 2R2IA 1RECA 1ZACA 1F55A 1LINA 3BXKA 1BODA 1NX1A 1NYAA 4ORAB 3KPXA 3SG5A 3EVUA 1DJWA 2BCXA 3MSEB 1SL9A 1YRTB 1B9AA 3PSRA 3CS1A 1TNPA 4GNKB 1IG5A 1RROA 1VRKA 2CBLA 2KI4B 2AUCA 1X02A 1SYMA 2KGBC 2K7DA 4YGBB 2K7CA 1TNQA 2JOJA 3AKBA 3RLZA 1L7ZA 3JVTB 3VRPA 4XJKB 2WCBA 1S36A 2LE9B 2K7BA 2OS8C 1IKUA 2EHBA 3ICBA 1E8AA 1MHOA 2IS9A 3EK4A 1PVAA 2LHLA 1N0YA 1M45A 1N2DA 4MEWA 1H8BA 1YUUA 2WCFA 1M39A 3WXAA 4I5KA 1IJ6A 2CTNA 4CFRA 4PALA 5KU1A 1LVCD 2KQYA 2LVVA 3FS7A 1QX2A 2L4IA 1SNLA 1KK8B 3BOWB 5HKZA 1XVJA 2M1UA 4CLNA 3FWBA 1DGVA 2L98A 4GFTA 2F2OA 2M3WA 1JUOA 1NX3A 2QPTA 3H4SE 1C7VA 1OZOA 1JFJA 2EC6B 1B7TZ 5DKQA 4GAOA 1PALA 4A4CA 3PM8A 2KNEA 1UHNA 2HQ8A 2ZRTA 1J1EA 1CLMA 1CFDA 1QLKA 1QV0A 2WOSA 4MBEA 3TDIA 2LP2A 3SG2A 2DOQA 3TS5C 5GQQC 1YX8A 1DF0A 3KEVA 3CZTX 1SR6B 1MWNA 1YVHA 1SL7A 4OR9B 2LUCA 1N65A 3CR4X 1CM4A 1DVIA 1CFFA 4ICBA 2OPOA 1Q80A 3NSLA 1OOJA 5F6TA 2FCDA 2G9BA 2WNDA 4GUKA 4CIDA 1S5GY 2LM5A 5JOLA 4MRXA 1MR8A 1BU3A 3OB2B 4MZLA 2NXQA 1GGWA 3NXAA 5HKWA 4N1FA 2JRFA 4Q04A 2KHNA 1QS7A 1TCOB 1CDPA 1IGVA 3I5GB 1K96A 4IL1A 1OE9B 1AUIB 5AFPA 2BL0C 1CB1A 2L0PA 3EKHA 4ZCVA 3CGAA 1AP4A 1Y1UA 2M1KB 1K9UA 2KYCA 2LHIA 1PSBA 2I94A 2LVKA 2M0RA 2BCBA 3A4UB 2CXJA 1RWYA 1S1EA 5TNCA 4MSPA 2CT9A 1B8RA 3AKAA 1AK8A 1DJIA 1LXFC 1NPQA 3OX6A 3VRRA 4PDZA 2JNXA 3EK7A 2L5XB 1K90D 3CR2A 3LL8B 1QTXA 1K93D 4NDBA 1IJ5A 1DJGA 1BT6A 2WC8A 5CSIA 1RFJA 1IH0A 1G33A 3OB1B 4ORCB 3LLEA 1B47A 4OV2A 2CNPA 2M97A 1GJYA 1KFXL 5K89A 1Y1AA 2F33A 1TNXA 5D7FA 2JXCA 1XFZO 5I2LA 1FBVA 3TS5B 3EVRA 1NP8A 2KQ6A 4C0JA 2BBNA 1J55A 1W7JB 3ZNIA 2O5GA 1K9PA 1XK4A 3OX5A 3BUMB 1CDNA 1BR1B 1YUTA 2JTZA 5AXIA 1JFKA 1SR6C 5BPJA 1CKKA 3CLNA 1CLLA 1NX2A 1ALWA 1S26D 2K61A 2P6BB 3D10A 4I5JA 1QXPA 2BECA 2SASA 3E3RA 5CSNA 3WHTB 1DMOA 5FYXA 1DGUA 2LMVA 1ODBA 2LVIA 4OKHA 1UUSA 4NDDA 1QVIY 4GBAA 4FTGA 2MA2A 5JJGA 2KAXA 1B4CA 4ORBB 3DVKA 2LNKA 1RK9A 1M46A 1K94A 1JC2A 1F8HA 2F8PA 2KDHA 3ZWHA 3OHMB 3PFVA 4R1EA 2M29A 2BCAA 3TUYC 2LMTA 2KSPA 2MLEC 4A4BA 4CPVA 5AERA 3HX4A 5HYDA 3FIAA 2GGMA 4N1GA 1QJTA 1XO5A 2KAYA 3CR5X 3RM1A 1J7QA 1YUSA 3BUWB 3SJSA 3PALA 2QACA 2JNFA 1QATA 1B7TY 1F70A 1SCMB 2LAPA 2LLSA 4AQIA 3DVEA 2BKHB 1J7OA 2PALA 4JPZB 4WRIA 2L51A 4C0KA 1QVIZ 1Y0VH 1PK0D 2VRGA 1B8CA 1KFUS 2F3ZA 3JTDB 1A03A 1K9KA 4DCKA 4HSZA 2ISDA 2K8MB 2G2BA 2MLFC 1CDLA 2PVBA 1OQPA 2BKIB 2LUXA 1TN4A 2Y5IA 3BUXB 3NSOA 2KFFA 3K21A 5HKYA 1PVBA 3JTDC 1F54A 3GK4X 1JSAA 4JWQA 2KAVA 1OMDA 2JC2A 2M49B 4D1EA 3GK1A 1FPWA 2LCPA 1Y1XA 3F45A 4QJ3B 1A4PA 2JQ6A 4M2PA 3M0WA 1SW8A 4JQ0D 4P5OE 4C0LA 4FQOA 2NCPA 1JF0A 1KWOB 2BBMA 2LC5A 3KF9A 1HQVA 4PHJA 5KSZA 4QJ5B 4I5NB 1SBJA 2K2AA 4ETOA 1DTLA 2MAZA 1UHKA 4PCWA 2LMUA 1PRWA 1R2UA 2KYFA 5I8NA 4YI9A 2D8NA 2COLB 1BF5A 2MHHA 1IQ3A 2MBXA 1FI6A 4YGCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIB A;  5HLO A;  1NCY A;  3DF0 A;  1JF2 A;  2KBI A;  2OTG C;  1SRA A;  2L4H A;  3KO0 A;  4OCI A;  1UUR A;  1NIW A;  4BY4 A;  1SK6 D;  1XFV O;  1SCM C;  2RGI A;  1BJF A;  3A8R A;  1MXL C;  2NCO A;  1K95 A;  3PN7 B;  5ER4 X;  1A75 A;  1KSO A;  2LAN A;  4BY5 A;  1KSM A;  1KFU L;  4PE4 A;  1CM1 A;  1PUL A;  1IRJ A;  2AMI A;  3AAJ A;  3EK8 A;  3VRN A;  4GGF C;  1KQM C;  3O78 A;  2Y1N A;  2V53 A;  1L2O C;  2MRD A;  1TRF A;  2HET A;  1FW4 A;  1S6J A;  1TNW A;  1OMR A;  1U5I B;  1NCZ A;  2JPT A;  1XFU O;  1TOP A;  1CDM A;  4N5X A;  3VRO A;  4DRW A;  1RTP 1;  2BL0 B;  2Q4U A;  1CFC A;  3CTN A;  1WY9 A;  1QLS A;  2FOT A;  2JT8 A;  3I5F B;  1CTR A;  2WOR A;  1BLQ A;  3EKJ A;  4NQG A;  4HRG A;  2PMY A;  5D69 A;  2F2P A;  1MF8 B;  2E6W A;  1EXR A;  3NSK A;  1UP5 A;  5DKR A;  2LV7 A;  1UWO A;  3BYA A;  1BMO A;  3VGO A;  1WLZ A;  4WQ3 A;  1XFX O;  5HLV A;  2HF5 A;  5J3X A;  3LK0 A;  1GGZ A;  1WDC C;  1YX7 A;  3D0Y B;  3EVV A;  1DJX A;  2HPS A;  2OTG B;  5AEQ A;  5PAL A;  4CFQ A;  5IBW A;  4PE0 A;  1EL4 A;  1KK7 Z;  1LKJ A;  1S5G Z;  4YGA A;  1Y6W A;  1D1O A;  5I2O A;  1AHR A;  1F71 A;  3DF0 B;  3PN7 C;  3SG7 A;  2JZI A;  1AJ5 A;  2ZRS A;  1ZMZ A;  4YI8 A;  1BG1 A;  4OVN F;  3I5I B;  3QRX A;  5CSF A;  1A2X A;  2KBM A;  2LVJ A;  1A29 A;  1EJ3 A;  1CMG A;  1A75 B;  1ALV A;  2AAO A;  1SY9 A;  1EG4 A;  3DD4 A;  2A4J A;  3O2P A;  1SPY A;  1DJZ A;  2ZND A;  3HCM A;  3LCP C;  2I7A A;  1K8U A;  1WRZ A;  4F0Z B;  1WLM A;  3SG3 A;  1SL8 A;  1B1G A;  1KK7 Y;  1H4B A;  2L50 A;  1J7R A;  2H61 C;  2Y4Q A;  2GGZ A;  1FF1 A;  2O60 A;  3FWC A;  5KTY A;  3GOF A;  1U5I A;  4DS7 A;  1NCX A;  1ZUZ A;  1V1F A;  1M63 B;  2JTT A;  1C07 A;  1XYD A;  4HRH A;  5I2Q A;  4YBH B;  2BE4 A;  4NDC A;  1NWD A;  1EG3 A;  2SCP A;  1ZOT B;  3BUN B;  3TZ1 A;  5CSJ A;  1GQM A;  1KK8 C;  2FJU B;  4MVF A;  1YVL A;  3OP0 A;  4MRY A;  2K0J A;  1HT9 A;  1MQ1 A;  2EC6 C;  1KFX S;  3NSI A;  3SG4 A;  1DJH A;  2E30 A;  4AQJ A;  4YRU A;  1J1D A;  1YUR A;  1WDC B;  3IF7 A;  1MXE A;  1WRK A;  2Q91 A;  1QAS A;  3KHE A;  1FI5 A;  4HRE E;  3D0Y A;  1XFY O;  4PHN A;  4PHM A;  1QIW A;  1KQV A;  2F3Y A;  4GPL B;  4DIR A;  3GK2 A;  2LLT A;  2GV5 A;  4E68 A;  2M9G A;  4AOM A;  1LA0 A;  3BQ3 A;  3DVJ A;  4MN0 A;  3TDZ A;  1L2O B;  3I5H B;  5B8I B;  4PE7 A;  4M2O A;  1CFP A;  3PLF B;  2FCE A;  1YRU B;  4GGN A;  3SG6 A;  2JUL A;  4YGD B;  3IQQ A;  4YGE B;  2OS8 B;  2M7L A;  3TUY B;  1TIZ A;  2NZ0 A;  1G4Y R;  2K7O A;  1YTZ C;  3I5F C;  4I5L B;  4M2Q A;  2KFG A;  2NLN A;  4GGF A;  4DUQ A;  1NX0 A;  2K2F A;  2BE6 A;  4MZK A;  5AAN A;  1ZFS A;  2M8U A;  1CLB A;  3DVM A;  1KCY A;  1WRL A;  1OZS A;  2H2K A;  4L9M A;  2ZKM X;  4WQ2 A;  1OMV A;  1V1G A;  3SIA A;  3VRQ A;  1EH2 A;  1RJV A;  2WCE A;  4MZJ A;  1AJ4 A;  2ZN8 A;  5DKN A;  1IQ5 A;  2H61 A;  2MJW B;  2ZN9 A;  3PAT A;  2ZFD A;  1F4Q A;  2LLU A;  1DT7 B;  3IQO A;  1LA3 A;  2KI4 C;  4PHK A;  3BUO B;  1QX5 B;  1SCV A;  1MUX A;  1YR5 A;  1KQM B;  1UHJ A;  1W7I B;  2KGR A;  2KI6 C;  1B8L A;  1DJY A;  1XA5 A;  4MLW A;  3I5I C;  1IWQ A;  2PRU A;  4XJK A;  4XYN A;  5CPV A;  1QX7 A;  3JVT C;  1CNP A;  2JU0 A;  5ER5 A;  1AVS A;  2LP3 A;  2TN4 A;  4P2Y B;  1M31 A;  2L2E A;  2B1U A;  1UHI A;  3I5H C;  2KFH A;  2M7N A;  1JBA A;  2JWW A;  2KOT A;  3O6B A;  4ZCU A;  1S6C A;  2I2R E;  2I18 A;  4U8D A;  3WHU B;  1UHH A;  3O4Y A;  1XFW O;  2CCM A;  2PAS A;  1S6I A;  3I5G C;  1QV1 A;  1K2H A;  3TDU A;  1SMG A;  3CWG A;  2KI6 D;  3BOW A;  1OSA A;  4QJ4 B;  3WNX B;  4PE1 A;  2ZNE A;  2JT3 A;  1QIV A;  1NUB A;  1CMF A;  1C7W A;  3AAK A;  1TCF A;  4USL A;  1SKT A;  5G08 A;  1KWO C;  1S3P A;  1BOC A;  1J7P A;  2EGD A;  3C1V A;  2PSR A;  2JT0 A;  1JWD A;  2Y1M A;  1R6P A;  1XK4 C;  3LK1 A;  1F4O A;  4TNC A;  2HQW A;  1BR4 B;  1DF0 B;  1G8I A;  4UPG A;  1PSR A;  1NSH A;  2JXL A;  1TTX A;  2R2I A;  1REC A;  1ZAC A;  1F55 A;  1LIN A;  3BXK A;  1BOD A;  1NX1 A;  1NYA A;  4ORA B;  3KPX A;  3SG5 A;  3EVU A;  1DJW A;  2BCX A;  3MSE B;  1SL9 A;  1YRT B;  1B9A A;  3PSR A;  3CS1 A;  1TNP A;  4GNK B;  1IG5 A;  1RRO A;  1VRK A;  2CBL A;  2KI4 B;  2AUC A;  1X02 A;  1SYM A;  2KGB C;  2K7D A;  4YGB B;  2K7C A;  1TNQ A;  2JOJ A;  3AKB A;  3RLZ A;  1L7Z A;  3JVT B;  3VRP A;  4XJK B;  2WCB A;  1S36 A;  2LE9 B;  2K7B A;  2OS8 C;  1IKU A;  2EHB A;  3ICB A;  1E8A A;  1MHO A;  2IS9 A;  3EK4 A;  1PVA A;  2LHL A;  1N0Y A;  1M45 A;  1N2D A;  4MEW A;  1H8B A;  1YUU A;  2WCF A;  1M39 A;  3WXA A;  4I5K A;  1IJ6 A;  2CTN A;  4CFR A;  4PAL A;  5KU1 A;  1LVC D;  2KQY A;  2LVV A;  3FS7 A;  1QX2 A;  2L4I A;  1SNL A;  1KK8 B;  3BOW B;  5HKZ A;  1XVJ A;  2M1U A;  4CLN A;  3FWB A;  1DGV A;  2L98 A;  4GFT A;  2F2O A;  2M3W A;  1JUO A;  1NX3 A;  2QPT A;  3H4S E;  1C7V A;  1OZO A;  1JFJ A;  2EC6 B;  1B7T Z;  5DKQ A;  4GAO A;  1PAL A;  4A4C A;  3PM8 A;  2KNE A;  1UHN A;  2HQ8 A;  2ZRT A;  1J1E A;  1CLM A;  1CFD A;  1QLK A;  1QV0 A;  2WOS A;  4MBE A;  3TDI A;  2LP2 A;  3SG2 A;  2DOQ A;  3TS5 C;  5GQQ C;  1YX8 A;  1DF0 A;  3KEV A;  3CZT X;  1SR6 B;  1MWN A;  1YVH A;  1SL7 A;  4OR9 B;  2LUC A;  1N65 A;  3CR4 X;  1CM4 A;  1DVI A;  1CFF A;  4ICB A;  2OPO A;  1Q80 A;  3NSL A;  1OOJ A;  5F6T A;  2FCD A;  2G9B A;  2WND A;  4GUK A;  4CID A;  1S5G Y;  2LM5 A;  5JOL A;  4MRX A;  1MR8 A;  1BU3 A;  3OB2 B;  4MZL A;  2NXQ A;  1GGW A;  3NXA A;  5HKW A;  4N1F A;  2JRF A;  4Q04 A;  2KHN A;  1QS7 A;  1TCO B;  1CDP A;  1IGV A;  3I5G B;  1K96 A;  4IL1 A;  1OE9 B;  1AUI B;  5AFP A;  2BL0 C;  1CB1 A;  2L0P A;  3EKH A;  4ZCV A;  3CGA A;  1AP4 A;  1Y1U A;  2M1K B;  1K9U A;  2KYC A;  2LHI A;  1PSB A;  2I94 A;  2LVK A;  2M0R A;  2BCB A;  3A4U B;  2CXJ A;  1RWY A;  1S1E A;  5TNC A;  4MSP A;  2CT9 A;  1B8R A;  3AKA A;  1AK8 A;  1DJI A;  1LXF C;  1NPQ A;  3OX6 A;  3VRR A;  4PDZ A;  2JNX A;  3EK7 A;  2L5X B;  1K90 D;  3CR2 A;  3LL8 B;  1QTX A;  1K93 D;  4NDB A;  1IJ5 A;  1DJG A;  1BT6 A;  2WC8 A;  5CSI A;  1RFJ A;  1IH0 A;  1G33 A;  3OB1 B;  4ORC B;  3LLE A;  1B47 A;  4OV2 A;  2CNP A;  2M97 A;  1GJY A;  1KFX L;  5K89 A;  1Y1A A;  2F33 A;  1TNX A;  5D7F A;  2JXC A;  1XFZ O;  5I2L A;  1FBV A;  3TS5 B;  3EVR A;  1NP8 A;  2KQ6 A;  4C0J A;  2BBN A;  1J55 A;  1W7J B;  3ZNI A;  2O5G A;  1K9P A;  1XK4 A;  3OX5 A;  3BUM B;  1CDN A;  1BR1 B;  1YUT A;  2JTZ A;  5AXI A;  1JFK A;  1SR6 C;  5BPJ A;  1CKK A;  3CLN A;  1CLL A;  1NX2 A;  1ALW A;  1S26 D;  2K61 A;  2P6B B;  3D10 A;  4I5J A;  1QXP A;  2BEC A;  2SAS A;  3E3R A;  5CSN A;  3WHT B;  1DMO A;  5FYX A;  1DGU A;  2LMV A;  1ODB A;  2LVI A;  4OKH A;  1UUS A;  4NDD A;  1QVI Y;  4GBA A;  4FTG A;  2MA2 A;  5JJG A;  2KAX A;  1B4C A;  4ORB B;  3DVK A;  2LNK A;  1RK9 A;  1M46 A;  1K94 A;  1JC2 A;  1F8H A;  2F8P A;  2KDH A;  3ZWH A;  3OHM B;  3PFV A;  4R1E A;  2M29 A;  2BCA A;  3TUY C;  2LMT A;  2KSP A;  2MLE C;  4A4B A;  4CPV A;  5AER A;  3HX4 A;  5HYD A;  3FIA A;  2GGM A;  4N1G A;  1QJT A;  1XO5 A;  2KAY A;  3CR5 X;  3RM1 A;  1J7Q A;  1YUS A;  3BUW B;  3SJS A;  3PAL A;  2QAC A;  2JNF A;  1QAT A;  1B7T Y;  1F70 A;  1SCM B;  2LAP A;  2LLS A;  4AQI A;  3DVE A;  2BKH B;  1J7O A;  2PAL A;  4JPZ B;  4WRI A;  2L51 A;  4C0K A;  1QVI Z;  1Y0V H;  1PK0 D;  2VRG A;  1B8C A;  1KFU S;  2F3Z A;  3JTD B;  1A03 A;  1K9K A;  4DCK A;  4HSZ A;  2ISD A;  2K8M B;  2G2B A;  2MLF C;  1CDL A;  2PVB A;  1OQP A;  2BKI B;  2LUX A;  1TN4 A;  2Y5I A;  3BUX B;  3NSO A;  2KFF A;  3K21 A;  5HKY A;  1PVB A;  3JTD C;  1F54 A;  3GK4 X;  1JSA A;  4JWQ A;  2KAV A;  1OMD A;  2JC2 A;  2M49 B;  4D1E A;  3GK1 A;  1FPW A;  2LCP A;  1Y1X A;  3F45 A;  4QJ3 B;  1A4P A;  2JQ6 A;  4M2P A;  3M0W A;  1SW8 A;  4JQ0 D;  4P5O E;  4C0L A;  4FQO A;  2NCP A;  1JF0 A;  1KWO B;  2BBM A;  2LC5 A;  3KF9 A;  1HQV A;  4PHJ A;  5KSZ A;  4QJ5 B;  4I5N B;  1SBJ A;  2K2A A;  4ETO A;  1DTL A;  2MAZ A;  1UHK A;  4PCW A;  2LMU A;  1PRW A;  1R2U A;  2KYF A;  5I8N A;  4YI9 A;  2D8N A;  2COL B;  1BF5 A;  2MHH A;  1IQ3 A;  2MBX A;  1FI6 A;  4YGC B; 
#chains in the Genus database with same CATH topology
 2L5Y A;  3SIB A;  5HLO A;  1NCY A;  3DF0 A;  1JF2 A;  2KBI A;  2OTG C;  1SRA A;  2L4H A;  1OOG A;  3KO0 A;  3S0F A;  4OCI A;  1UUR A;  1NIW A;  4BY4 A;  1SK6 D;  1XFV O;  1SCM C;  2RGI A;  1BJF A;  3A8R A;  1MXL C;  2NCO A;  4PT1 A;  3B86 A;  1K95 A;  3PN7 B;  5ER4 X;  1A75 A;  1KSO A;  2QEO A;  3R72 A;  2LAN A;  4BY5 A;  1KSM A;  1KFU L;  4PE4 A;  1CM1 A;  3SS5 A;  1PUL A;  1TUZ A;  1IRJ A;  2AMI A;  3AAJ A;  3EK8 A;  3VRN A;  4GGF C;  1KQM C;  3O78 A;  2Y1N A;  2V53 A;  1L2O C;  2MRD A;  1TRF A;  2HET A;  1FW4 A;  1S6J A;  1TNW A;  1OMR A;  1U5I B;  1NCZ A;  2JPT A;  1XFU O;  1K2H A;  1TOP A;  1CDM A;  1Z4H A;  4N5X A;  3VRO A;  4DRW A;  1RTP 1;  2BL0 B;  2Q4U A;  1CFC A;  3CTN A;  1WY9 A;  1QLS A;  2FOT A;  2JT8 A;  3I5F B;  1CTR A;  1AP4 A;  2WOR A;  1BLQ A;  3EKJ A;  4NQG A;  4HRG A;  2PMY A;  1DEL A;  5D69 A;  2F2P A;  1MF8 B;  2E6W A;  5D3O A;  1EXR A;  3NSK A;  1UP5 A;  5DKR A;  2LV7 A;  1UWO A;  3BYA A;  1BMO A;  3VGO A;  1WLZ A;  4WQ3 A;  1XFX O;  5HLV A;  2HF5 A;  5J3X A;  3LK0 A;  2PYQ A;  1GGZ A;  1WDC C;  1YX7 A;  3D0Y B;  3EVV A;  1DJX A;  2HPS A;  2OTG B;  5AEQ A;  5PAL A;  4CFQ A;  5IBW A;  4PE0 A;  1EL4 A;  1KK7 Z;  1LKJ A;  1S5G Z;  4YGA A;  1Y6W A;  1D1O A;  5I2O A;  1AHR A;  1F71 A;  3B87 A;  1SSE B;  3DF0 B;  3PN7 C;  3SG7 A;  2JZI A;  1AJ5 A;  2QDI A;  2ZRS A;  1ZMZ A;  3UO9 A;  4YI8 A;  1BG1 A;  4OVN F;  3I5I B;  3QRX A;  5CSF A;  1A2X A;  5DIC A;  1P28 A;  2KBM A;  2LVJ A;  1A29 A;  1EJ3 A;  3CAB A;  4KYN A;  1A75 B;  1CMG A;  1ALV A;  2AAO A;  3Q8I A;  1SY9 A;  1DQE A;  1EG4 A;  3DD4 A;  2A4J A;  3O2P A;  1SPY A;  1DJZ A;  2ZND A;  3BFH A;  3HCM A;  3LCP C;  2PQL A;  2I7A A;  1K8U A;  1WRZ A;  4F0Z B;  1WLM A;  2YGU A;  3SG3 A;  1SL8 A;  1B1G A;  1KK7 Y;  1H4B A;  2L50 A;  1J7R A;  3CZ0 A;  2H61 C;  2Y4Q A;  2GGZ A;  4INX A;  1FF1 A;  2O60 A;  3FWC A;  5KTY A;  3GOF A;  1U5I A;  4DS7 A;  1NCX A;  1ZUZ A;  1V1F A;  1M63 B;  4OZD A;  3CZ1 A;  2JTT A;  5I94 A;  3S0A A;  1C07 A;  1XYD A;  4HRH A;  5I2Q A;  4YBH B;  2BE4 A;  4NDC A;  1NWD A;  1EG3 A;  2SCP A;  1ZOT B;  3BUN B;  3TZ1 A;  5CSJ A;  1GQM A;  1KK8 C;  5HL1 A;  2FJU B;  4MVF A;  1YVL A;  3DZT A;  3OGN A;  3OP0 A;  1OOI X;  1LS8 A;  4MRY A;  2K0J A;  1T14 A;  1HT9 A;  1MQ1 A;  2EC6 C;  1KFX S;  3NSI A;  3SG4 A;  1DJH A;  2E30 A;  4AQJ A;  4YRU A;  2P71 A;  2BAP A;  1J1D A;  1YUR A;  1WDC B;  3IF7 A;  1MXE A;  1WRK A;  2Q91 A;  3V2L A;  1QAS A;  3KHE A;  1FI5 A;  3PM2 A;  2QEB A;  3D0Y A;  4HRE E;  1XFY O;  4PHN A;  4PHM A;  1QIW A;  1KQV A;  2F3Y A;  4GPL B;  4DIR A;  2WCM A;  2LLT A;  2GV5 A;  3GK2 A;  2M9G A;  4AOM A;  4E68 A;  1LA0 A;  3BQ3 A;  3DVJ A;  4MN0 A;  3TDZ A;  1L2O B;  3I5H B;  5B8I B;  4PE7 A;  4M2O A;  1CFP A;  3PLF B;  2FCE A;  1TWO A;  1YRU B;  4GGN A;  3SG6 A;  2JUL A;  4YGD B;  3IQQ A;  4YGE B;  2OS8 B;  2M7L A;  3TUY B;  1TIZ A;  2NZ0 A;  3RZS A;  1G4Y R;  1TUJ A;  2K7O A;  1GM0 A;  1YTZ C;  1OW4 A;  3I5F C;  4I5L B;  4M2Q A;  2KFG A;  2NLN A;  4GGF A;  4DUQ A;  1NX0 A;  2K2F A;  3CDN A;  2BE6 A;  4MZK A;  5AAN A;  1ZFS A;  2M8U A;  1CLB A;  3DVM A;  1KCY A;  1WRL A;  1OZS A;  2H2K A;  1DEK A;  3D75 A;  2ZKM X;  4L9M A;  4WQ2 A;  1OMV A;  1V1G A;  3SIA A;  3VRQ A;  1EH2 A;  1RJV A;  3S0G A;  3FE6 A;  2WCE A;  4MZJ A;  1AJ4 A;  2ZN8 A;  5DKN A;  1IQ5 A;  2H61 A;  2MJW B;  2ZN9 A;  3PAT A;  2ZFD A;  1F4Q A;  2LLU A;  1DT7 B;  2KPH A;  3IQO A;  1LA3 A;  2KI4 C;  4PHK A;  3BUO B;  1QX5 B;  1SCV A;  1MUX A;  1YR5 A;  4JKT A;  1KQM B;  1UHJ A;  1W7I B;  2KGR A;  2KI6 C;  1B8L A;  1DJY A;  1XA5 A;  4MLW A;  3I5I C;  1IWQ A;  2PRU A;  4XJK A;  4XYN A;  5CPV A;  1QX7 A;  3JVT C;  1CNP A;  2JU0 A;  5ER5 A;  1AVS A;  3N7H A;  3NHT A;  2LP3 A;  2TN4 A;  4P2Y B;  1M31 A;  3OBV A;  2L2E A;  2B1U A;  3D76 A;  1UHI A;  3QME A;  3R1P A;  3I5H C;  2KFH A;  2M7N A;  1JBA A;  2JWW A;  2KOT A;  3O6B A;  4ZCU A;  1S6C A;  3TDI A;  2I2R E;  1Z2C B;  2I18 A;  4U8D A;  3WHU B;  1UHH A;  3O4Y A;  1XFW O;  2CCM A;  2PAS A;  1S6I A;  3I5G C;  1QV1 A;  3BFA A;  3TDU A;  1SMG A;  3CWG A;  2KI6 D;  3BOW A;  1OSA A;  4QJ4 B;  3WNX B;  4PE1 A;  2ZNE A;  1ORG A;  2JT3 A;  2WC6 A;  1QIV A;  3NGV A;  1NUB A;  2WCH A;  1CMF A;  1C7W A;  3AAK A;  3D77 A;  1TCF A;  4USL A;  1SKT A;  5G08 A;  2P70 A;  5FI7 A;  1KWO C;  1S3P A;  3VB1 A;  1BOC A;  1J7P A;  2EGD A;  2JPO A;  3C1V A;  2PSR A;  2JT0 A;  1JWD A;  2Y1M A;  1R6P A;  1XK4 C;  3LK1 A;  1F4O A;  4TNC A;  2HQW A;  1BR4 B;  1DF0 B;  1G8I A;  2FJY A;  1PSR A;  4UPG A;  1NSH A;  2JXL A;  1TTX A;  2R2I A;  1REC A;  1ZAC A;  1F55 A;  1LIN A;  3BXK A;  1BOD A;  1NX1 A;  1NYA A;  4ORA B;  3KPX A;  3SG5 A;  3EVU A;  1DJW A;  2BCX A;  3MSE B;  1SL9 A;  1YRT B;  1B9A A;  3PSR A;  3CS1 A;  1TNP A;  4GNK B;  1IG5 A;  1RRO A;  1VRK A;  2CBL A;  2KI4 B;  2AUC A;  2GTE A;  1X02 A;  3DYE A;  1SYM A;  2KGB C;  2K7D A;  4YGB B;  2K7C A;  1TNQ A;  1W9Z A;  2JOJ A;  3AKB A;  1L7Z A;  3JVT B;  3RLZ A;  3VRP A;  4INW A;  4XJK B;  2WCB A;  1S36 A;  2LE9 B;  2K7B A;  2OS8 C;  1IKU A;  2EHB A;  3ICB A;  1E8A A;  1MHO A;  2IS9 A;  3EK4 A;  1QWV A;  1PVA A;  2LHL A;  1N0Y A;  1M45 A;  1N2D A;  4MEW A;  1H8B A;  1YUU A;  2WCF A;  1M39 A;  3WXA A;  4I5K A;  1IJ6 A;  2CTN A;  4CFR A;  4JD9 A;  4PAL A;  5KU1 A;  1LVC D;  2KQY A;  2LVV A;  3FS7 A;  1QX2 A;  2L4I A;  1SNL A;  3D78 A;  1KK8 B;  3BOW B;  5HKZ A;  1XVJ A;  2M1U A;  4CLN A;  2BNX A;  3FWB A;  1DGV A;  2L98 A;  4GFT A;  2F2O A;  2KLD A;  1JUO A;  1NX3 A;  2M3W A;  2QPT A;  3H4S E;  1OZO A;  1C7V A;  1JFJ A;  2EC6 B;  3D74 A;  1B7T Z;  5DKQ A;  1IIO A;  4GAO A;  3R1O A;  1PAL A;  4A4C A;  3PM8 A;  2KNE A;  1UHN A;  2HQ8 A;  2ZRT A;  1J1E A;  1CLM A;  1CFD A;  1QLK A;  1QV0 A;  2WOS A;  4MBE A;  2QEV A;  2LP2 A;  2ERB A;  3SG2 A;  2DOQ A;  3TS5 C;  5GQQ C;  1YX8 A;  1DF0 A;  3FE8 A;  3CZT X;  3KEV A;  1SR6 B;  1MWN A;  1YVH A;  1SL7 A;  4OR9 B;  2LUC A;  1N65 A;  5FI6 A;  3CR4 X;  1CM4 A;  1DVI A;  3SS4 A;  4ICB A;  1CFF A;  2OPO A;  1Q80 A;  3NSL A;  1OOJ A;  5F6T A;  2FCD A;  2G9B A;  2WND A;  4GUK A;  4CID A;  1S5G Y;  2LM5 A;  5JOL A;  1DC1 A;  4MRX A;  1MR8 A;  1BU3 A;  3OB2 B;  4MZL A;  2NXQ A;  1GGW A;  3NXA A;  5HKW A;  4N1F A;  2JRF A;  4Q04 A;  2KHN A;  1QS7 A;  1OOH A;  1TCO B;  1CDP A;  1IGV A;  3I5G B;  1K96 A;  4IL1 A;  1OE9 B;  1AUI B;  5AFP A;  2BL0 C;  1CB1 A;  2L0P A;  3EKH A;  4ZCV A;  3CGA A;  3O4X A;  4F7F A;  1Y1U A;  2M1K B;  1K9U A;  2KYC A;  2LHI A;  1PSB A;  2I94 A;  2LVK A;  2M0R A;  2BCB A;  3A4U B;  3DXL A;  3L4L A;  2CXJ A;  1RWY A;  1S1E A;  5TNC A;  4MSP A;  2CT9 A;  1B8R A;  3AKA A;  1AK8 A;  1DJI A;  1LXF C;  1NPQ A;  3FE9 A;  3OX6 A;  3VRR A;  3DY9 A;  4PDZ A;  2JNX A;  3EK7 A;  3CZ2 A;  2L5X B;  1K90 D;  3CR2 A;  3LL8 B;  1QTX A;  1K93 D;  4NDB A;  2L2C A;  1IJ5 A;  1DJG A;  1BT6 A;  5FI2 A;  2WC8 A;  5CSI A;  1RFJ A;  1IH0 A;  1G33 A;  2KLE A;  3OB1 B;  4ORC B;  3LLE A;  1B47 A;  2K60 A;  4OV2 A;  3L47 A;  2CNP A;  2M97 A;  1GJY A;  1KFX L;  5K89 A;  1Y1A A;  2F33 A;  1TNX A;  5D7F A;  3B88 A;  2JXC A;  1XFZ O;  5I2L A;  1FBV A;  3TS5 B;  3EVR A;  1NP8 A;  2KQ6 A;  4C0J A;  2BBN A;  1C3Z A;  1J55 A;  1W7J B;  3ZNI A;  2O5G A;  1K9P A;  1XK4 A;  3OX5 A;  2WCL A;  3BUM B;  1CDN A;  3EG5 B;  1BR1 B;  1YUT A;  2JTZ A;  5AXI A;  1JFK A;  1SR6 C;  5BPJ A;  1CKK A;  3B7A A;  3CLN A;  1CLL A;  1NX2 A;  1C3Y A;  1ALW A;  1S26 D;  2K61 A;  2P6B B;  3D10 A;  4I5J A;  3BFB A;  1QXP A;  2BEC A;  2SAS A;  3E3R A;  5CSN A;  3WHT B;  1DMO A;  3BJH A;  5FYX A;  1DGU A;  2LMV A;  1ODB A;  2LVI A;  4OKH A;  3NHI A;  1UUS A;  3PJI A;  4NDD A;  1QVI Y;  4GBA A;  4FTG A;  2MA2 A;  5JJG A;  2KAX A;  3UNW A;  1B4C A;  4ORB B;  3DVK A;  3S0D A;  2LNK A;  1RK9 A;  1M46 A;  1K94 A;  1JC2 A;  1F8H A;  2F8P A;  2KDH A;  3ZWH A;  3OHM B;  3PFV A;  4R1E A;  2M29 A;  2BCA A;  3TUY C;  2LMT A;  2KSP A;  2MLE C;  3D73 A;  4A4B A;  4CPV A;  5AER A;  3HX4 A;  5HYD A;  3FIA A;  2GGM A;  2WC5 A;  4N1G A;  1QJT A;  1XO5 A;  2KAY A;  1XFR A;  2QEH A;  3CR5 X;  3RM1 A;  1J7Q A;  3L4A A;  1YUS A;  3BUW B;  3SJS A;  3PAL A;  4FQT A;  1OOF A;  2QAC A;  2JNF A;  3SS3 A;  1QAT A;  1B7T Y;  1F70 A;  1SCM B;  2LAP A;  2LLS A;  3B6X A;  4AQI A;  3DVE A;  2BKH B;  1J7O A;  2PAL A;  4JPZ B;  4WRI A;  2L51 A;  4C0K A;  3CYZ A;  1QVI Z;  1Y0V H;  1PK0 D;  2VRG A;  1B8C A;  1KFU S;  2F3Z A;  3JTD B;  1A03 A;  1K9K A;  2WCK A;  3IVT A;  3R1V A;  2K8M B;  4HSZ A;  2ISD A;  2G2B A;  2MLF C;  4DCK A;  1CDL A;  3K1E A;  2PVB A;  1OQP A;  2BKI B;  2LUX A;  1TN4 A;  2Y5I A;  3BUX B;  3NSO A;  5EL2 A;  2KFF A;  3K21 A;  3S0B A;  1PVB A;  3JTD C;  5HKY A;  2H8V A;  3GK4 X;  4IJ7 A;  1F54 A;  4JWQ A;  1JSA A;  2KAV A;  1OMD A;  2JC2 A;  2M49 B;  4D1E A;  3GK1 A;  1FPW A;  2LCP A;  1Y1X A;  3F45 A;  4QJ3 B;  1A4P A;  2JQ6 A;  4M2P A;  3M0W A;  1SW8 A;  4JQ0 D;  4P5O E;  4C0L A;  4FQO A;  2NCP A;  1JF0 A;  1KWO B;  2BBM A;  2LC5 A;  3KF9 A;  1HQV A;  4PHJ A;  5KSZ A;  2WCJ A;  4QJ5 B;  4I5N B;  1SBJ A;  2K2A A;  4ETO A;  1DTL A;  2MAZ A;  1UHK A;  4PCW A;  2LMU A;  1PRW A;  1R2U A;  2KYF A;  5I8N A;  4YI9 A;  3S0E A;  2D8N A;  2COL B;  1BF5 A;  2MHH A;  1IQ3 A;  2MBX A;  1FI6 A;  4YGC B; 
#chains in the Genus database with same CATH homology
 3SIB A;  5HLO A;  1NCY A;  3DF0 A;  1JF2 A;  2KBI A;  2OTG C;  1SRA A;  2L4H A;  3KO0 A;  4OCI A;  1UUR A;  1NIW A;  4BY4 A;  1SK6 D;  1XFV O;  1SCM C;  2RGI A;  1BJF A;  3A8R A;  1MXL C;  2NCO A;  1K95 A;  3PN7 B;  5ER4 X;  1A75 A;  1KSO A;  2LAN A;  4BY5 A;  1KSM A;  1KFU L;  4PE4 A;  1CM1 A;  1PUL A;  1IRJ A;  2AMI A;  3AAJ A;  3EK8 A;  3VRN A;  4GGF C;  1KQM C;  3O78 A;  2Y1N A;  2V53 A;  1L2O C;  2MRD A;  1TRF A;  2HET A;  1FW4 A;  1S6J A;  1TNW A;  1OMR A;  1U5I B;  1NCZ A;  2JPT A;  1XFU O;  1TOP A;  1CDM A;  4N5X A;  3VRO A;  4DRW A;  1RTP 1;  2BL0 B;  2Q4U A;  1CFC A;  3CTN A;  1WY9 A;  1QLS A;  2FOT A;  2JT8 A;  3I5F B;  1CTR A;  2WOR A;  1BLQ A;  3EKJ A;  4NQG A;  4HRG A;  2PMY A;  5D69 A;  2F2P A;  1MF8 B;  2E6W A;  1EXR A;  3NSK A;  1UP5 A;  5DKR A;  2LV7 A;  1UWO A;  3BYA A;  1BMO A;  3VGO A;  1WLZ A;  4WQ3 A;  1XFX O;  5HLV A;  2HF5 A;  5J3X A;  3LK0 A;  1GGZ A;  1WDC C;  1YX7 A;  3D0Y B;  3EVV A;  1DJX A;  2HPS A;  2OTG B;  5AEQ A;  5PAL A;  4CFQ A;  5IBW A;  4PE0 A;  1EL4 A;  1KK7 Z;  1LKJ A;  1S5G Z;  4YGA A;  1Y6W A;  1D1O A;  5I2O A;  1AHR A;  1F71 A;  3DF0 B;  3PN7 C;  3SG7 A;  2JZI A;  1AJ5 A;  2ZRS A;  1ZMZ A;  4YI8 A;  1BG1 A;  4OVN F;  3I5I B;  3QRX A;  5CSF A;  1A2X A;  2KBM A;  2LVJ A;  1A29 A;  1EJ3 A;  1CMG A;  1A75 B;  1ALV A;  2AAO A;  1SY9 A;  1EG4 A;  3DD4 A;  2A4J A;  3O2P A;  1SPY A;  1DJZ A;  2ZND A;  3HCM A;  3LCP C;  2I7A A;  1K8U A;  1WRZ A;  4F0Z B;  1WLM A;  3SG3 A;  1SL8 A;  1B1G A;  1KK7 Y;  1H4B A;  2L50 A;  1J7R A;  2H61 C;  2Y4Q A;  2GGZ A;  1FF1 A;  2O60 A;  3FWC A;  5KTY A;  3GOF A;  1U5I A;  4DS7 A;  1NCX A;  1ZUZ A;  1V1F A;  1M63 B;  2JTT A;  1C07 A;  1XYD A;  4HRH A;  5I2Q A;  4YBH B;  2BE4 A;  4NDC A;  1NWD A;  1EG3 A;  2SCP A;  1ZOT B;  3BUN B;  3TZ1 A;  5CSJ A;  1GQM A;  1KK8 C;  2FJU B;  4MVF A;  1YVL A;  3OP0 A;  4MRY A;  2K0J A;  1HT9 A;  1MQ1 A;  2EC6 C;  1KFX S;  3NSI A;  3SG4 A;  1DJH A;  2E30 A;  4AQJ A;  4YRU A;  1J1D A;  1YUR A;  1WDC B;  3IF7 A;  1MXE A;  1WRK A;  2Q91 A;  1QAS A;  3KHE A;  1FI5 A;  4HRE E;  3D0Y A;  1XFY O;  4PHN A;  4PHM A;  1QIW A;  1KQV A;  2F3Y A;  4GPL B;  4DIR A;  3GK2 A;  2LLT A;  2GV5 A;  4E68 A;  2M9G A;  4AOM A;  1LA0 A;  3BQ3 A;  3DVJ A;  4MN0 A;  3TDZ A;  1L2O B;  3I5H B;  5B8I B;  4PE7 A;  4M2O A;  1CFP A;  3PLF B;  2FCE A;  1YRU B;  4GGN A;  3SG6 A;  2JUL A;  4YGD B;  3IQQ A;  4YGE B;  2OS8 B;  2M7L A;  3TUY B;  1TIZ A;  2NZ0 A;  1G4Y R;  2K7O A;  1YTZ C;  3I5F C;  4I5L B;  4M2Q A;  2KFG A;  2NLN A;  4GGF A;  4DUQ A;  1NX0 A;  2K2F A;  2BE6 A;  4MZK A;  5AAN A;  1ZFS A;  2M8U A;  1CLB A;  3DVM A;  1KCY A;  1WRL A;  1OZS A;  2H2K A;  4L9M A;  2ZKM X;  4WQ2 A;  1OMV A;  1V1G A;  3SIA A;  3VRQ A;  1EH2 A;  1RJV A;  2WCE A;  4MZJ A;  1AJ4 A;  2ZN8 A;  5DKN A;  1IQ5 A;  2H61 A;  2MJW B;  2ZN9 A;  3PAT A;  2ZFD A;  1F4Q A;  2LLU A;  1DT7 B;  3IQO A;  1LA3 A;  2KI4 C;  4PHK A;  3BUO B;  1QX5 B;  1SCV A;  1MUX A;  1YR5 A;  1KQM B;  1UHJ A;  1W7I B;  2KGR A;  2KI6 C;  1B8L A;  1DJY A;  1XA5 A;  4MLW A;  3I5I C;  1IWQ A;  2PRU A;  4XJK A;  4XYN A;  5CPV A;  1QX7 A;  3JVT C;  1CNP A;  2JU0 A;  5ER5 A;  1AVS A;  2LP3 A;  2TN4 A;  4P2Y B;  1M31 A;  2L2E A;  2B1U A;  1UHI A;  3I5H C;  2KFH A;  2M7N A;  1JBA A;  2JWW A;  2KOT A;  3O6B A;  4ZCU A;  1S6C A;  2I2R E;  2I18 A;  4U8D A;  3WHU B;  1UHH A;  3O4Y A;  1XFW O;  2CCM A;  2PAS A;  1S6I A;  3I5G C;  1QV1 A;  1K2H A;  3TDU A;  1SMG A;  3CWG A;  2KI6 D;  3BOW A;  1OSA A;  4QJ4 B;  3WNX B;  4PE1 A;  2ZNE A;  2JT3 A;  1QIV A;  1NUB A;  1CMF A;  1C7W A;  3AAK A;  1TCF A;  4USL A;  1SKT A;  5G08 A;  1KWO C;  1S3P A;  1BOC A;  1J7P A;  2EGD A;  3C1V A;  2PSR A;  2JT0 A;  1JWD A;  2Y1M A;  1R6P A;  1XK4 C;  3LK1 A;  1F4O A;  4TNC A;  2HQW A;  1BR4 B;  1DF0 B;  1G8I A;  4UPG A;  1PSR A;  1NSH A;  2JXL A;  1TTX A;  2R2I A;  1REC A;  1ZAC A;  1F55 A;  1LIN A;  3BXK A;  1BOD A;  1NX1 A;  1NYA A;  4ORA B;  3KPX A;  3SG5 A;  3EVU A;  1DJW A;  2BCX A;  3MSE B;  1SL9 A;  1YRT B;  1B9A A;  3PSR A;  3CS1 A;  1TNP A;  4GNK B;  1IG5 A;  1RRO A;  1VRK A;  2CBL A;  2KI4 B;  2AUC A;  1X02 A;  1SYM A;  2KGB C;  2K7D A;  4YGB B;  2K7C A;  1TNQ A;  2JOJ A;  3AKB A;  3RLZ A;  1L7Z A;  3JVT B;  3VRP A;  4XJK B;  2WCB A;  1S36 A;  2LE9 B;  2K7B A;  2OS8 C;  1IKU A;  2EHB A;  3ICB A;  1E8A A;  1MHO A;  2IS9 A;  3EK4 A;  1PVA A;  2LHL A;  1N0Y A;  1M45 A;  1N2D A;  4MEW A;  1H8B A;  1YUU A;  2WCF A;  1M39 A;  3WXA A;  4I5K A;  1IJ6 A;  2CTN A;  4CFR A;  4PAL A;  5KU1 A;  1LVC D;  2KQY A;  2LVV A;  3FS7 A;  1QX2 A;  2L4I A;  1SNL A;  1KK8 B;  3BOW B;  5HKZ A;  1XVJ A;  2M1U A;  4CLN A;  3FWB A;  1DGV A;  2L98 A;  4GFT A;  2F2O A;  2M3W A;  1JUO A;  1NX3 A;  2QPT A;  3H4S E;  1C7V A;  1OZO A;  1JFJ A;  2EC6 B;  1B7T Z;  5DKQ A;  4GAO A;  1PAL A;  4A4C A;  3PM8 A;  2KNE A;  1UHN A;  2HQ8 A;  2ZRT A;  1J1E A;  1CLM A;  1CFD A;  1QLK A;  1QV0 A;  2WOS A;  4MBE A;  3TDI A;  2LP2 A;  3SG2 A;  2DOQ A;  3TS5 C;  5GQQ C;  1YX8 A;  1DF0 A;  3KEV A;  3CZT X;  1SR6 B;  1MWN A;  1YVH A;  1SL7 A;  4OR9 B;  2LUC A;  1N65 A;  3CR4 X;  1CM4 A;  1DVI A;  1CFF A;  4ICB A;  2OPO A;  1Q80 A;  3NSL A;  1OOJ A;  5F6T A;  2FCD A;  2G9B A;  2WND A;  4GUK A;  4CID A;  1S5G Y;  2LM5 A;  5JOL A;  4MRX A;  1MR8 A;  1BU3 A;  3OB2 B;  4MZL A;  2NXQ A;  1GGW A;  3NXA A;  5HKW A;  4N1F A;  2JRF A;  4Q04 A;  2KHN A;  1QS7 A;  1TCO B;  1CDP A;  1IGV A;  3I5G B;  1K96 A;  4IL1 A;  1OE9 B;  1AUI B;  5AFP A;  2BL0 C;  1CB1 A;  2L0P A;  3EKH A;  4ZCV A;  3CGA A;  1AP4 A;  1Y1U A;  2M1K B;  1K9U A;  2KYC A;  2LHI A;  1PSB A;  2I94 A;  2LVK A;  2M0R A;  2BCB A;  3A4U B;  2CXJ A;  1RWY A;  1S1E A;  5TNC A;  4MSP A;  2CT9 A;  1B8R A;  3AKA A;  1AK8 A;  1DJI A;  1LXF C;  1NPQ A;  3OX6 A;  3VRR A;  4PDZ A;  2JNX A;  3EK7 A;  2L5X B;  1K90 D;  3CR2 A;  3LL8 B;  1QTX A;  1K93 D;  4NDB A;  1IJ5 A;  1DJG A;  1BT6 A;  2WC8 A;  5CSI A;  1RFJ A;  1IH0 A;  1G33 A;  3OB1 B;  4ORC B;  3LLE A;  1B47 A;  4OV2 A;  2CNP A;  2M97 A;  1GJY A;  1KFX L;  5K89 A;  1Y1A A;  2F33 A;  1TNX A;  5D7F A;  2JXC A;  1XFZ O;  5I2L A;  1FBV A;  3TS5 B;  3EVR A;  1NP8 A;  2KQ6 A;  4C0J A;  2BBN A;  1J55 A;  1W7J B;  3ZNI A;  2O5G A;  1K9P A;  1XK4 A;  3OX5 A;  3BUM B;  1CDN A;  1BR1 B;  1YUT A;  2JTZ A;  5AXI A;  1JFK A;  1SR6 C;  5BPJ A;  1CKK A;  3CLN A;  1CLL A;  1NX2 A;  1ALW A;  1S26 D;  2K61 A;  2P6B B;  3D10 A;  4I5J A;  1QXP A;  2BEC A;  2SAS A;  3E3R A;  5CSN A;  3WHT B;  1DMO A;  5FYX A;  1DGU A;  2LMV A;  1ODB A;  2LVI A;  4OKH A;  1UUS A;  4NDD A;  1QVI Y;  4GBA A;  4FTG A;  2MA2 A;  5JJG A;  2KAX A;  1B4C A;  4ORB B;  3DVK A;  2LNK A;  1RK9 A;  1M46 A;  1K94 A;  1JC2 A;  1F8H A;  2F8P A;  2KDH A;  3ZWH A;  3OHM B;  3PFV A;  4R1E A;  2M29 A;  2BCA A;  3TUY C;  2LMT A;  2KSP A;  2MLE C;  4A4B A;  4CPV A;  5AER A;  3HX4 A;  5HYD A;  3FIA A;  2GGM A;  4N1G A;  1QJT A;  1XO5 A;  2KAY A;  3CR5 X;  3RM1 A;  1J7Q A;  1YUS A;  3BUW B;  3SJS A;  3PAL A;  2QAC A;  2JNF A;  1QAT A;  1B7T Y;  1F70 A;  1SCM B;  2LAP A;  2LLS A;  4AQI A;  3DVE A;  2BKH B;  1J7O A;  2PAL A;  4JPZ B;  4WRI A;  2L51 A;  4C0K A;  1QVI Z;  1Y0V H;  1PK0 D;  2VRG A;  1B8C A;  1KFU S;  2F3Z A;  3JTD B;  1A03 A;  1K9K A;  4DCK A;  4HSZ A;  2ISD A;  2K8M B;  2G2B A;  2MLF C;  1CDL A;  2PVB A;  1OQP A;  2BKI B;  2LUX A;  1TN4 A;  2Y5I A;  3BUX B;  3NSO A;  2KFF A;  3K21 A;  5HKY A;  1PVB A;  3JTD C;  1F54 A;  3GK4 X;  1JSA A;  4JWQ A;  2KAV A;  1OMD A;  2JC2 A;  2M49 B;  4D1E A;  3GK1 A;  1FPW A;  2LCP A;  1Y1X A;  3F45 A;  4QJ3 B;  1A4P A;  2JQ6 A;  4M2P A;  3M0W A;  1SW8 A;  4JQ0 D;  4P5O E;  4C0L A;  4FQO A;  2NCP A;  1JF0 A;  1KWO B;  2BBM A;  2LC5 A;  3KF9 A;  1HQV A;  4PHJ A;  5KSZ A;  4QJ5 B;  4I5N B;  1SBJ A;  2K2A A;  4ETO A;  1DTL A;  2MAZ A;  1UHK A;  4PCW A;  2LMU A;  1PRW A;  1R2U A;  2KYF A;  5I8N A;  4YI9 A;  2D8N A;  2COL B;  1BF5 A;  2MHH A;  1IQ3 A;  2MBX A;  1FI6 A;  4YGC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...