1DVIA

Calpain domain vi with calcium bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
EEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTSRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALPAIN
publication title Structure of a calpain Ca(2+)-binding domain reveals a novel EF-hand and Ca(2+)-induced conformational changes.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-dependent protease
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dviA00
2BCXA 5DKNA 4QJ5B 1RTP1 1Y1AA 4WQ2A 2JRFA 1KFUL 2ZN8A 1MHOA 2BBNA 1F71A 1KK8C 1KK8B 4C0JA 1Q80A 4YBHB 1IWQA 1U5IA 2L98A 4USLA 2K7CA 1D1OA 3TUYB 1CDNA 1PULA 4DUQA 4YI8A 2H61A 2O5GA 2LCPA 3GK4X 3PATA 2I7AA 3WXAA 3LCPC 4YRUA 5FYXA 1CM4A 2K2AA 2LV7A 1GQMA 2KGBC 2L2EA 4GGFA 1M45A 3OP0A 1YTZC 1B1GA 4JQ0D 4GFTA 1YRUB 3CGAA 4MZJA 1EXRA 2WOSA 3PSRA 1A29A 4P2YB 2BCAA 3GK1A 1NWDA 2K0JA 1KSOA 1TN4A 1F8HA 2L0PA 2Q91A 5DKRA 5AFPA 1K90D 2B1UA 4PCWA 3F45A 4OKHA 1FPWA 5D7FA 1TNXA 4M2PA 3EVRA 4MRYA 3TZ1A 4JPZB 3IF7A 2JULA 4HRHA 2KFFA 1XVJA 2MAZA 1JF2A 1CFDA 3CR5X 3OX6A 2MRDA 1Y0VH 1NCXA 1AHRA 1F70A 1TCOB 2MBXA 4UPGA 1JFJA 2JNXA 3KEVA 2ZRSA 1AJ4A 1NIWA 1ZMZA 3RLZA 1WLZA 1QIWA 2WCFA 2M1KB 2LP2A 2KAYA 3BOWA 4N5XA 1EG3A 1FBVA 1RFJA 4NDDA 1BT6A 4HSZA 1UHIA 2BL0C 2KSPA 1ODBA 4OCIA 3OB1B 1JSAA 1QIVA 2K7OA 1LA0A 4N1FA 5I2LA 1J7OA 4I5KA 1QLKA 1SNLA 3CZTX 1YRTB 3AAJA 4I5NB 2HQ8A 1IJ5A 2KQYA 1BMOA 2LM5A 2MHHA 3DVEA 2LAPA 1UURA 4AOMA 2JTTA 2LHLA 2D8NA 1AUIB 2K7DA 5D69A 1BG1A 3FWCA 1L2OC 1L2OB 2Y5IA 4GGNA 1FI6A 3BUMB 1WLMA 2KGRA 4WRIA 3SG4A 1M63B 2CBLA 2LP3A 4D1EA 3LK1A 4C0KA 1J1EA 3EK8A 1TNQA 2EHBA 3M0WA 1OE9B 1IJ6A 1OZOA 2WORA 1ZOTB 2LVIA 3CR4X 1J7PA 1KK7Z 1X02A 1XA5A 1QX7A 1EL4A 1PSBA 2F2PA 1B9AA 2KYFA 1GGZA 1S6JA 2SASA 1XFXO 2KQ6A 4DCKA 5TNCA 3RM1A 3PN7C 3PN7B 1JF0A 4GUKA 4ICBA 1TNPA 5AANA 2E6WA 5IBWA 4GAOA 4TNCA 5K89A 1GGWA 1A03A 4QJ3B 2LMTA 2PASA 1DGVA 1L7ZA 2WCEA 4E68A 2GGZA 2L5XB 3PFVA 2O60A 1XYDA 3NXAA 2BBMA 5HKWA 4XYNA 1DF0B 2JU0A 2MJWB 1MUXA 3FS7A 1KK7Y 4AQIA 2HPSA 1CFFA 3D0YB 1CDMA 2JQ6A 3CTNA 2Y1MA 3I5HC 2BECA 2MLEC 2KYCA 3H4SE 4IL1A 3SG5A 1K9KA 2NCPA 1C07A 4GPLB 4P5OE 1DJWA 5DKQA 1C7WA 1QS7A 2F2OA 5GQQC 1KFXS 4QJ4B 1SKTA 4CFQA 5AEQA 1RJVA 2MLFC 4YGCB 2OTGC 2OTGB 1IQ3A 3PALA 5JJGA 1YUTA 2NLNA 1W7JB 2LVKA 4YGBB 1CNPA 2Y4QA 1MWNA 2KNEA 3TDUA 3AKBA 1NCZA 4ZCVA 3O2PA 1NP8A 1NUBA 1KCYA 3ICBA 1DJHA 4YGDB 2ISDA 2L4HA 1YVHA 1CDLA 3NSKA 1PSRA 2JWWA 3O4YA 3VRPA 1J7RA 1SY9A 1DJGA 2G2BA 1BODA 2JXLA 1CLBA 2F8PA 2GGMA 2KAXA 1DJIA 1IQ5A 1DTLA 2BE6A 4MBEA 4WQ3A 4MVFA 1UP5A 1KFUS 1UHJA 1J1DA 5ER5A 1XFZO 3BQ3A 2HF5A 1ALWA 2CXJA 3DD4A 3E3RA 3EKHA 4A4CA 1CMGA 1WRLA 2ZRTA 2I2RE 1KQMC 1KQMB 1RECA 1S5GZ 1YURA 2JXCA 1XO5A 3DVMA 4ORBB 1B4CA 1JWDA 3I5FC 3I5FB 1UHKA 1C7VA 4M2QA 4XJKB 4ETOA 2CT9A 1K9PA 2CTNA 2JT0A 2PMYA 3IQQA 5AXIA 5BPJA 1A2XA 3AKAA 2AMIA 1CM1A 1NX2A 5HKZA 1NCYA 4OVNF 1JFKA 1UUSA 3WNXB 2LVVA 2K8MB 1WY9A 3GK2A 1AJ5A 2LMUA 1YUSA 1XFVO 3WHUB 1KWOC 1KWOB 3SIBA 1YUUA 1N65A 2FJUB 1S5GY 4DS7A 1S1EA 2BL0B 4MSPA 1CLMA 5CPVA 2QACA 2VRGA 2ZKMX 1F4OA 1LKJA 2F33A 1BR1B 1PK0D 1OMRA 1B47A 1DVIA 2KBIA 3TDZA 4CLNA 1SW8A 1PALA 2ZN9A 4N1GA 3BUXB 4MN0A 1EG4A 4C0LA 2K7BA 3KPXA 1DF0A 1W7IB 4NDBA 3VGOA 1DJXA 1IRJA 3D10A 3A4UB 3D0YA 1F55A 2AUCA 2FOTA 1CTRA 2HQWA 1CLLA 2K2FA 1ZFSA 5G08A 1QATA 3SG3A 2LLSA 4FQOA 5CSJA 1Y1XA 1BR4B 1QJTA 3CS1A 1QXPA 2PALA 3VROA 2KI6C 2KI6D 3LK0A 2JTZA 1SBJA 2JZIA 2WNDA 3I5IC 3I5IB 2PSRA 1LXFC 2KOTA 3I5GC 1DJZA 1CB1A 5HLVA 2CNPA 3AAKA 2M0RA 3KHEA 1WRZA 3O78A 4DIRA 5I8NA 3VRQA 1SL7A 4MRXA 2OS8C 2OS8B 3IQOA 4YI9A 1UWOA 3EVVA 5F6TA 2WC8A 2BKHB 1GJYA 3PLFB 2DOQA 1N0YA 3LL8B 2LC5A 2LNKA 4MZKA 5PALA 2KHNA 3HCMA 3JTDC 4FTGA 2EGDA 1B7TZ 2LLUA 1QLSA 1R2UA 3BOWB 2M29A 1IKUA 3I5HB 1QTXA 4NDCA 2Q4UA 1J55A 1G8IA 1G33A 2ZNDA 4JWQA 1XFUO 2LANA 1OSAA 1WDCC 1WDCB 1PRWA 2LVJA 3SG7A 1YVLA 3LLEA 4XJKA 1K8UA 2G9BA 2COLB 2LMVA 2AAOA 5B8IB 1LA3A 1MR8A 1SPYA 5KTYA 1V1FA 1UHNA 3FWBA 4A4BA 1SK6D 3SIAA 3TDIA 1JBAA 1S3PA 1RK9A 1N2DA 5CSFA 1B7TY 1VRKA 3EVUA 1FW4A 1OMVA 2PRUA 3EK7A 3QRXA 2OPOA 1E8AA 4CIDA 1S26D 3DF0B 2M3WA 3EKJA 2KFGA 4YGEB 3TS5C 1SR6C 1SR6B 3TS5B 1TRFA 1EJ3A 1QX2A 1RROA 2QPTA 1A75B 2F3ZA 3HX4A 1CFCA 1HQVA 1XFYO 4M2OA 1TNWA 2JNFA 1KSMA 5AERA 3BUOB 4ORCB 2M97A 1B8LA 2JPTA 3VRRA 2NZ0A 3SG6A 4I5JA 2L50A 1AK8A 5KSZA 1DGUA 3TUYC 1FF1A 3CWGA 1AP4A 1SMGA 2K61A 3NSOA 1K2HA 4PALA 2FCEA 1V1GA 1LVCD 4MLWA 3CR2A 1AVSA 1TCFA 5HYDA 1ZACA 1MXEA 2M9GA 3DVJA 2RGIA 1CMFA 1DT7B 1XK4C 4GNKB 4OR9B 2MA2A 4ORAB 1ALVA 1QV1A 2NXQA 4PHJA 1CFPA 2R2IA 1F54A 1F4QA 1YR5A 1K96A 2V53A 2WCBA 1M46A 1OQPA 3OHMB 2L4IA 5KU1A 3ZNIA 3CLNA 4MZLA 1BU3A 1NX1A 3MSEB 1K93D 2HETA 4U8DA 3NSLA 1FI5A 3PM8A 1HT9A 2M49B 1IG5A 2LLTA 4BY4A 4I5LB 1DMOA 1U5IB 1QVIZ 5CSNA 2JT3A 2KAVA 2GV5A 2P6BB 3GOFA 5I2QA 2LHIA 1SCVA 2M7LA 4ZCUA 1IGVA 1K94A 2IS9A 4MEWA 2H61C 3OB2B 4Q04A 3SG2A 1BLQA 1S36A 3DVKA 4BY5A 3VRNA 1NPQA 2BCBA 4GGFC 1H4BA 3BUNB 3JVTC 3JVTB 1B8RA 2JC2A 3K21A 4PE7A 1SL9A 2BE4A 1UHHA 2KDHA 1PVAA 2PVBA 1WRKA 1XFWO 3A8RA 3EK4A 4PDZA 2JT8A 1QVIY 1SYMA 1MXLC 1IH0A 1NX0A 3I5GB 2A4JA 1PVBA 1CDPA 1NX3A 1BOCA 4YGAA 1B8CA 2M1UA 3OX5A 4R1EA 1TOPA 2LUXA 2CCMA 3BUWB 1A4PA 1OZSA 2FCDA 3DF0A 1MQ1A 4F0ZB 1YX7A 2L51A 5J3XA 1SCMC 1SCMB 2F3YA 4L9MA 1MF8B 2E30A 2ZNEA 1BF5A 1A75A 1RWYA 3BXKA 2I18A 2JOJA 2Y1NA 2LUCA 2M8UA 1M31A 1SL8A 4PE0A 1TIZA 2KBMA 3JTDB 4NQGA 1K9UA 1S6IA 5HLOA 1EH2A 1YX8A 1M39A 1S6CA 1KQVA 3NSIA 1QX5B 4PE1A 3FIAA 3KO0A 5ER4X 2H2KA 4PE4A 2NCOA 2SCPA 2EC6C 2EC6B 1Y6WA 2I94A 3C1VA 5CSIA 1KFXL 3KF9A 3BYAA 1JUOA 2KI4C 2KI4B 1OMDA 4HRGA 1J7QA 2LE9B 3SJSA 1JC2A 1NSHA 4PHMA 2TN4A 1H8BA 1SRAA 3WHTB 1LINA 1QV0A 4AQJA 2ZFDA 4CPVA 1XK4A 1OOJA 2BKIB 5I2OA 1CKKA 1R6PA 5HKYA 1NYAA 1BJFA 4PHNA 4OV2A 1QASA 2M7NA 3ZWHA 4GBAA 1DJYA 2KFHA 1Y1UA 3O6BA 5JOLA 4DRWA 1TTXA 4CFRA 1K95A 1G4YR 4HREE 1ZUZA 4PHKA
chains in the Genus database with same CATH superfamily
3SS5A 2BCXA 1TWOA 5DKNA 3UNWA 4QJ5B 1RTP1 1Y1AA 4WQ2A 2JRFA 1KFUL 2ZN8A 1MHOA 2BBNA 3UO9A 1KK8C 1KK8B 1F71A 2QEBA 1C3ZA 4C0JA 5I94A 1Q80A 4YBHB 2WC6A 1IWQA 1U5IA 2L98A 4USLA 2K7CA 3IVTA 1D1OA 3TUYB 3Q8IA 1CDNA 1IIOA 3L4AA 1PULA 4DUQA 2WCMA 4YI8A 2H61A 2O5GA 2LCPA 1XFRA 3GK4X 3PATA 2I7AA 3WXAA 3LCPC 4YRUA 5FYXA 1CM4A 2K2AA 2LV7A 1GQMA 2KGBC 1P28A 2L2EA 4GGFA 1M45A 2QEOA 3CABA 3OP0A 1YTZC 1B1GA 4JQ0D 4GFTA 1OOHA 1YRUB 3CGAA 4MZJA 1EXRA 2WOSA 3PSRA 3S0FA 1A29A 4P2YB 4FQTA 2BCAA 3GK1A 1NWDA 2K0JA 1KSOA 1TN4A 1F8HA 2L0PA 2Q91A 5DKRA 5AFPA 1K90D 2B1UA 4PCWA 3F45A 4OKHA 1FPWA 5D7FA 1TNXA 4M2PA 3EVRA 4MRYA 3TZ1A 4JPZB 3IF7A 2JULA 4HRHA 5FI6A 3FE8A 2KFFA 1XVJA 3S0DA 2MAZA 1JF2A 1CFDA 3B87A 3CR5X 3OX6A 2MRDA 1Y0VH 1NCXA 1AHRA 1F70A 1TCOB 2MBXA 4UPGA 1JFJA 2JNXA 3KEVA 2ZRSA 1AJ4A 1NIWA 1ZMZA 3RLZA 1WLZA 3OBVA 1QIWA 2WCFA 2M1KB 2LP2A 2KAYA 3BOWA 4N5XA 1EG3A 1FBVA 1RFJA 4NDDA 1BT6A 4HSZA 1UHIA 1Z4HA 2BL0C 2KSPA 1ODBA 4OCIA 1OOGA 5D3OA 3OB1B 1JSAA 1QIVA 2K7OA 1LA0A 4N1FA 5I2LA 1J7OA 4I5KA 1QLKA 1SNLA 3CZTX 1YRTB 3AAJA 4I5NB 2HQ8A 1IJ5A 2KQYA 1BMOA 2LM5A 2MHHA 3DVEA 2LAPA 1UURA 2PYQA 4AOMA 2JTTA 2LHLA 2D8NA 1AUIB 2K7DA 5D69A 1BG1A 3FWCA 2KLEA 1L2OC 1L2OB 2Y5IA 4GGNA 4OZDA 4PT1A 1FI6A 3BUMB 1WLMA 2KGRA 4WRIA 3SG4A 1M63B 2CBLA 2LP3A 4D1EA 3LK1A 4C0KA 1J1EA 3EK8A 1TNQA 2EHBA 3M0WA 1OE9B 1IJ6A 1OZOA 2WORA 1ZOTB 2LVIA 3CR4X 3S0AA 1J7PA 1KK7Z 1X02A 1XA5A 1QX7A 1EL4A 1PSBA 2F2PA 1B9AA 2KYFA 3BFBA 3K1EA 1GGZA 1S6JA 2SASA 1XFXO 2KQ6A 3L47A 2P71A 5TNCA 3RM1A 4DCKA 3PN7C 3PN7B 1JF0A 4GUKA 4ICBA 1TNPA 5AANA 3R1VA 2KPHA 2E6WA 5IBWA 4GAOA 4TNCA 5K89A 1GGWA 1A03A 2BAPA 4QJ3B 2LMTA 2PASA 1DGVA 1L7ZA 2WCHA 2WCEA 4E68A 2GGZA 2L5XB 3B88A 3PFVA 2O60A 1XYDA 3NXAA 2BBMA 1OOFA 3N7HA 4XYNA 1DF0B 2JU0A 5HKWA 2MJWB 1MUXA 3FS7A 5HL1A 1KK7Y 4AQIA 2HPSA 1CFFA 3D0YB 1CDMA 2JQ6A 3CTNA 2Y1MA 3I5HC 2BECA 2MLEC 2KYCA 3H4SE 3DY9A 4IL1A 3SG5A 1K9KA 2NCPA 1C07A 4GPLB 4P5OE 1DJWA 5DKQA 1C7WA 1QS7A 2F2OA 5GQQC 1KFXS 4QJ4B 1SKTA 4CFQA 5AEQA 1RJVA 2MLFC 4YGCB 3BFHA 2OTGC 2OTGB 1IQ3A 3PALA 5JJGA 1YUTA 2NLNA 1W7JB 2LVKA 4YGBB 1CNPA 1GM0A 2Y4QA 1MWNA 2KNEA 3BJHA 3AKBA 3TDUA 1NCZA 4ZCVA 3O2PA 1NP8A 1OW4A 1NUBA 1KCYA 3ICBA 1DJHA 4YGDB 2ISDA 2L4HA 1YVHA 1CDLA 3NSKA 1PSRA 2JWWA 3O4YA 3VRPA 1DC1A 5DICA 1J7RA 1SY9A 1DJGA 2G2BA 3SS3A 1BODA 2JXLA 1CLBA 2F8PA 2GGMA 2H8VA 2KAXA 5FI7A 3DZTA 1DJIA 1IQ5A 1DTLA 2BE6A 4MBEA 4WQ3A 4MVFA 1UP5A 1KFUS 1UHJA 1J1DA 5ER5A 1XFZO 3BQ3A 2HF5A 1ALWA 2CXJA 3DD4A 3E3RA 3EKHA 4A4CA 1CMGA 1WRLA 2ZRTA 2I2RE 1KQMC 1KQMB 1RECA 1S5GZ 1YURA 2JXCA 1DQEA 1XO5A 2WCJA 3PM2A 3DVMA 4ORBB 1B4CA 1JWDA 3I5FC 3I5FB 1UHKA 1C7VA 4M2QA 4XJKB 4ETOA 2CT9A 2ERBA 1K9PA 2CTNA 2JT0A 2PMYA 3IQQA 5AXIA 3CDNA 5BPJA 1A2XA 3AKAA 2AMIA 1CM1A 2K60A 1NX2A 5HKZA 3CYZA 1NCYA 4OVNF 1JFKA 1UUSA 3WNXB 2LVVA 2K8MB 1WY9A 3GK2A 1AJ5A 2LMUA 1YUSA 1XFVO 3WHUB 1KWOC 1KWOB 3SIBA 1YUUA 1N65A 2FJUB 1S5GY 4DS7A 1S1EA 2BL0B 4MSPA 1CLMA 1LS8A 2QACA 2VRGA 2ZKMX 1F4OA 1LKJA 5CPVA 2F33A 1BR1B 3D77A 1PK0D 1OMRA 1B47A 1DVIA 2KBIA 3TDZA 4CLNA 3RZSA 1SW8A 1PALA 2L2CA 2ZN9A 4N1GA 3BUXB 3BFAA 4MN0A 1EG4A 3B7AA 3R1OA 4C0LA 1SSEB 3EG5B 2K7BA 3KPXA 3S0BA 1DF0A 3DXLA 1W7IB 4NDBA 3VGOA 1DJXA 1IRJA 3D10A 3A4UB 3D0YA 1F55A 2AUCA 2FOTA 1CTRA 2HQWA 1CLLA 2K2FA 1ZFSA 5G08A 1TUZA 1QATA 3SG3A 2LLSA 4FQOA 3FE6A 5CSJA 1Y1XA 1BR4B 1QJTA 3CS1A 1QXPA 2PALA 3VROA 2KI6C 4INXA 2KI6D 3LK0A 2JTZA 1SBJA 5EL2A 2JZIA 2WCKA 2WNDA 3I5IC 3I5IB 2PSRA 3D78A 3SS4A 1LXFC 2KOTA 3I5GC 1DJZA 1CB1A 5HLVA 2CNPA 3AAKA 2M0RA 3KHEA 1WRZA 3CZ0A 3O78A 3R1PA 4DIRA 5I8NA 3R72A 3VRQA 1SL7A 4MRXA 2OS8C 2OS8B 3IQOA 4YI9A 1UWOA 3EVVA 5F6TA 2WC8A 2BKHB 1GJYA 3PLFB 2DOQA 2YGUA 1N0YA 3LL8B 3VB1A 2LC5A 2LNKA 4MZKA 4JD9A 5PALA 2KHNA 3HCMA 3JTDC 4FTGA 2EGDA 1B7TZ 2LLUA 1QLSA 1R2UA 2L5YA 3BOWB 2M29A 1IKUA 3NHIA 3I5HB 1QTXA 4NDCA 2Q4UA 1J55A 3NHTA 1G8IA 1G33A 2P70A 2ZNDA 4JWQA 1XFUO 2LANA 1OSAA 1WDCC 1WDCB 2QEVA 1PRWA 2LVJA 3SG7A 1YVLA 3LLEA 4XJKA 1K8UA 2G9BA 2COLB 2LMVA 2AAOA 5B8IB 1LA3A 1TUJA 1MR8A 1SPYA 5KTYA 1V1FA 1UHNA 3FWBA 4A4BA 1SK6D 1DELA 3SIAA 3TDIA 1JBAA 1S3PA 1RK9A 1N2DA 5CSFA 1B7TY 1VRKA 3D76A 3EVUA 1FW4A 3OGNA 1OMVA 2PRUA 3EK7A 3QRXA 2OPOA 1E8AA 4CIDA 1S26D 3DF0B 2M3WA 3EKJA 2KFGA 4YGEB 3TS5C 1SR6C 1SR6B 3TS5B 1TRFA 1EJ3A 1QX2A 1RROA 2QPTA 2QEHA 1A75B 3FE9A 2F3ZA 3HX4A 1CFCA 1HQVA 1XFYO 3CZ1A 4M2OA 1TNWA 2JNFA 1KSMA 5AERA 3BUOB 1W9ZA 4ORCB 2M97A 1B8LA 2JPTA 3VRRA 2NZ0A 3SG6A 4I5JA 2L50A 1AK8A 5KSZA 1DGUA 3TUYC 3DYEA 1FF1A 3CWGA 1AP4A 3O4XA 1SMGA 2K61A 3NSOA 1K2HA 4PALA 2FCEA 1V1GA 1LVCD 4MLWA 1QWVA 3CR2A 1AVSA 1TCFA 5HYDA 1ZACA 1MXEA 2M9GA 4JKTA 3DVJA 2RGIA 1CMFA 1DT7B 1XK4C 4GNKB 4OR9B 2MA2A 4ORAB 1ALVA 1QV1A 2NXQA 4PHJA 1CFPA 2R2IA 1F54A 1F4QA 3B86A 1YR5A 1K96A 2V53A 2WCBA 1M46A 1OQPA 3OHMB 2QDIA 2L4IA 2BNXA 3CZ2A 5KU1A 3ZNIA 3CLNA 4MZLA 1BU3A 1NX1A 1OOIX 2FJYA 3MSEB 1K93D 1C3YA 3V2LA 2HETA 4U8DA 3NSLA 1Z2CB 1FI5A 3PM8A 1HT9A 2M49B 3S0EA 1IG5A 2LLTA 4BY4A 4I5LB 2PQLA 4KYNA 1U5IB 1DMOA 1QVIZ 5CSNA 2JT3A 2KAVA 2GV5A 2P6BB 3GOFA 5I2QA 2LHIA 1SCVA 3D73A 2M7LA 4ZCUA 1IGVA 1K94A 2IS9A 4MEWA 2H61C 3OB2B 4Q04A 4INWA 3SG2A 1BLQA 1S36A 3DVKA 4BY5A 3VRNA 1NPQA 2BCBA 4GGFC 1H4BA 3BUNB 3JVTC 3JVTB 1B8RA 2JC2A 3K21A 2GTEA 3QMEA 4PE7A 1SL9A 2BE4A 1UHHA 2KDHA 1PVAA 2PVBA 3PJIA 1WRKA 1XFWO 3A8RA 3L4LA 3EK4A 4PDZA 3S0GA 2JT8A 1QVIY 1SYMA 1MXLC 4IJ7A 1NX0A 3I5GB 5FI2A 1IH0A 2A4JA 1PVBA 1CDPA 1NX3A 1BOCA 4YGAA 1B8CA 1ORGA 2M1UA 3OX5A 4R1EA 1TOPA 2LUXA 2CCMA 3B6XA 1A4PA 1OZSA 2FCDA 2JPOA 3BUWB 3DF0A 1MQ1A 4F0ZB 1YX7A 2L51A 5J3XA 1SCMC 1SCMB 2F3YA 4L9MA 1MF8B 2E30A 2ZNEA 1BF5A 1A75A 1RWYA 3BXKA 2I18A 2JOJA 2Y1NA 2LUCA 2M8UA 1M31A 1SL8A 4PE0A 1TIZA 2KBMA 3JTDB 4NQGA 1K9UA 1DEKA 1S6IA 5HLOA 1EH2A 1YX8A 1M39A 1S6CA 1KQVA 3NSIA 1QX5B 4PE1A 3FIAA 3KO0A 5ER4X 2H2KA 4PE4A 2NCOA 2SCPA 2EC6C 2EC6B 1Y6WA 2I94A 3C1VA 5CSIA 1KFXL 3KF9A 3BYAA 1JUOA 2KI4C 2KI4B 1OMDA 4HRGA 1J7QA 2LE9B 3SJSA 1JC2A 3D74A 1NSHA 3NGVA 2TN4A 4PHMA 1H8BA 2WCLA 3D75A 1SRAA 1T14A 3WHTB 1LINA 1QV0A 2WC5A 4AQJA 2ZFDA 4CPVA 1XK4A 1OOJA 2BKIB 5I2OA 1CKKA 1R6PA 5HKYA 2KLDA 1NYAA 1BJFA 4PHNA 4OV2A 1QASA 2M7NA 3ZWHA 4GBAA 1DJYA 2KFHA 1Y1UA 3O6BA 5JOLA 4DRWA 1TTXA 4CFRA 4F7FA 1K95A 1G4YR 4HREE 1ZUZA 4PHKA
chains in the Genus database with same CATH topology
2BCXA 5DKNA 4QJ5B 1RTP1 1Y1AA 4WQ2A 2JRFA 1KFUL 2ZN8A 1MHOA 2BBNA 1F71A 1KK8C 1KK8B 4C0JA 1Q80A 4YBHB 1IWQA 1U5IA 2L98A 4USLA 2K7CA 1D1OA 3TUYB 1CDNA 1PULA 4DUQA 4YI8A 2H61A 2O5GA 2LCPA 3GK4X 3PATA 2I7AA 3WXAA 3LCPC 4YRUA 5FYXA 1CM4A 2K2AA 2LV7A 1GQMA 2KGBC 2L2EA 4GGFA 1M45A 3OP0A 1YTZC 1B1GA 4JQ0D 4GFTA 1YRUB 3CGAA 4MZJA 1EXRA 2WOSA 3PSRA 1A29A 4P2YB 2BCAA 3GK1A 1NWDA 2K0JA 1KSOA 1TN4A 1F8HA 2L0PA 2Q91A 5DKRA 5AFPA 1K90D 2B1UA 4PCWA 3F45A 4OKHA 1FPWA 5D7FA 1TNXA 4M2PA 3EVRA 4MRYA 3TZ1A 4JPZB 3IF7A 2JULA 4HRHA 2KFFA 1XVJA 2MAZA 1JF2A 1CFDA 3CR5X 3OX6A 2MRDA 1Y0VH 1NCXA 1AHRA 1F70A 1TCOB 2MBXA 4UPGA 1JFJA 2JNXA 3KEVA 2ZRSA 1AJ4A 1NIWA 1ZMZA 3RLZA 1WLZA 1QIWA 2WCFA 2M1KB 2LP2A 2KAYA 3BOWA 4N5XA 1EG3A 1FBVA 1RFJA 4NDDA 1BT6A 4HSZA 1UHIA 2BL0C 2KSPA 1ODBA 4OCIA 3OB1B 1JSAA 1QIVA 2K7OA 1LA0A 4N1FA 5I2LA 1J7OA 4I5KA 1QLKA 1SNLA 3CZTX 1YRTB 3AAJA 4I5NB 2HQ8A 1IJ5A 2KQYA 1BMOA 2LM5A 2MHHA 3DVEA 2LAPA 1UURA 4AOMA 2JTTA 2LHLA 2D8NA 1AUIB 2K7DA 5D69A 1BG1A 3FWCA 1L2OC 1L2OB 2Y5IA 4GGNA 1FI6A 3BUMB 1WLMA 2KGRA 4WRIA 3SG4A 1M63B 2CBLA 2LP3A 4D1EA 3LK1A 4C0KA 1J1EA 3EK8A 1TNQA 2EHBA 3M0WA 1OE9B 1IJ6A 1OZOA 2WORA 1ZOTB 2LVIA 3CR4X 1J7PA 1KK7Z 1X02A 1XA5A 1QX7A 1EL4A 1PSBA 2F2PA 1B9AA 2KYFA 1GGZA 1S6JA 2SASA 1XFXO 2KQ6A 4DCKA 5TNCA 3RM1A 3PN7C 3PN7B 1JF0A 4GUKA 4ICBA 1TNPA 5AANA 2E6WA 5IBWA 4GAOA 4TNCA 5K89A 1GGWA 1A03A 4QJ3B 2LMTA 2PASA 1DGVA 1L7ZA 2WCEA 4E68A 2GGZA 2L5XB 3PFVA 2O60A 1XYDA 3NXAA 2BBMA 5HKWA 4XYNA 1DF0B 2JU0A 2MJWB 1MUXA 3FS7A 1KK7Y 4AQIA 2HPSA 1CFFA 3D0YB 1CDMA 2JQ6A 3CTNA 2Y1MA 3I5HC 2BECA 2MLEC 2KYCA 3H4SE 4IL1A 3SG5A 1K9KA 2NCPA 1C07A 4GPLB 4P5OE 1DJWA 5DKQA 1C7WA 1QS7A 2F2OA 5GQQC 1KFXS 4QJ4B 1SKTA 4CFQA 5AEQA 1RJVA 2MLFC 4YGCB 2OTGC 2OTGB 1IQ3A 3PALA 5JJGA 1YUTA 2NLNA 1W7JB 2LVKA 4YGBB 1CNPA 2Y4QA 1MWNA 2KNEA 3TDUA 3AKBA 1NCZA 4ZCVA 3O2PA 1NP8A 1NUBA 1KCYA 3ICBA 1DJHA 4YGDB 2ISDA 2L4HA 1YVHA 1CDLA 3NSKA 1PSRA 2JWWA 3O4YA 3VRPA 1J7RA 1SY9A 1DJGA 2G2BA 1BODA 2JXLA 1CLBA 2F8PA 2GGMA 2KAXA 1DJIA 1IQ5A 1DTLA 2BE6A 4MBEA 4WQ3A 4MVFA 1UP5A 1KFUS 1UHJA 1J1DA 5ER5A 1XFZO 3BQ3A 2HF5A 1ALWA 2CXJA 3DD4A 3E3RA 3EKHA 4A4CA 1CMGA 1WRLA 2ZRTA 2I2RE 1KQMC 1KQMB 1RECA 1S5GZ 1YURA 2JXCA 1XO5A 3DVMA 4ORBB 1B4CA 1JWDA 3I5FC 3I5FB 1UHKA 1C7VA 4M2QA 4XJKB 4ETOA 2CT9A 1K9PA 2CTNA 2JT0A 2PMYA 3IQQA 5AXIA 5BPJA 1A2XA 3AKAA 2AMIA 1CM1A 1NX2A 5HKZA 1NCYA 4OVNF 1JFKA 1UUSA 3WNXB 2LVVA 2K8MB 1WY9A 3GK2A 1AJ5A 2LMUA 1YUSA 1XFVO 3WHUB 1KWOC 1KWOB 3SIBA 1YUUA 1N65A 2FJUB 1S5GY 4DS7A 1S1EA 2BL0B 4MSPA 1CLMA 5CPVA 2QACA 2VRGA 2ZKMX 1F4OA 1LKJA 2F33A 1BR1B 1PK0D 1OMRA 1B47A 1DVIA 2KBIA 3TDZA 4CLNA 1SW8A 1PALA 2ZN9A 4N1GA 3BUXB 4MN0A 1EG4A 4C0LA 2K7BA 3KPXA 1DF0A 1W7IB 4NDBA 3VGOA 1DJXA 1IRJA 3D10A 3A4UB 3D0YA 1F55A 2AUCA 2FOTA 1CTRA 2HQWA 1CLLA 2K2FA 1ZFSA 5G08A 1QATA 3SG3A 2LLSA 4FQOA 5CSJA 1Y1XA 1BR4B 1QJTA 3CS1A 1QXPA 2PALA 3VROA 2KI6C 2KI6D 3LK0A 2JTZA 1SBJA 2JZIA 2WNDA 3I5IC 3I5IB 2PSRA 1LXFC 2KOTA 3I5GC 1DJZA 1CB1A 5HLVA 2CNPA 3AAKA 2M0RA 3KHEA 1WRZA 3O78A 4DIRA 5I8NA 3VRQA 1SL7A 4MRXA 2OS8C 2OS8B 3IQOA 4YI9A 1UWOA 3EVVA 5F6TA 2WC8A 2BKHB 1GJYA 3PLFB 2DOQA 1N0YA 3LL8B 2LC5A 2LNKA 4MZKA 5PALA 2KHNA 3HCMA 3JTDC 4FTGA 2EGDA 1B7TZ 2LLUA 1QLSA 1R2UA 3BOWB 2M29A 1IKUA 3I5HB 1QTXA 4NDCA 2Q4UA 1J55A 1G8IA 1G33A 2ZNDA 4JWQA 1XFUO 2LANA 1OSAA 1WDCC 1WDCB 1PRWA 2LVJA 3SG7A 1YVLA 3LLEA 4XJKA 1K8UA 2G9BA 2COLB 2LMVA 2AAOA 5B8IB 1LA3A 1MR8A 1SPYA 5KTYA 1V1FA 1UHNA 3FWBA 4A4BA 1SK6D 3SIAA 3TDIA 1JBAA 1S3PA 1RK9A 1N2DA 5CSFA 1B7TY 1VRKA 3EVUA 1FW4A 1OMVA 2PRUA 3EK7A 3QRXA 2OPOA 1E8AA 4CIDA 1S26D 3DF0B 2M3WA 3EKJA 2KFGA 4YGEB 3TS5C 1SR6C 1SR6B 3TS5B 1TRFA 1EJ3A 1QX2A 1RROA 2QPTA 1A75B 2F3ZA 3HX4A 1CFCA 1HQVA 1XFYO 4M2OA 1TNWA 2JNFA 1KSMA 5AERA 3BUOB 4ORCB 2M97A 1B8LA 2JPTA 3VRRA 2NZ0A 3SG6A 4I5JA 2L50A 1AK8A 5KSZA 1DGUA 3TUYC 1FF1A 3CWGA 1AP4A 1SMGA 2K61A 3NSOA 1K2HA 4PALA 2FCEA 1V1GA 1LVCD 4MLWA 3CR2A 1AVSA 1TCFA 5HYDA 1ZACA 1MXEA 2M9GA 3DVJA 2RGIA 1CMFA 1DT7B 1XK4C 4GNKB 4OR9B 2MA2A 4ORAB 1ALVA 1QV1A 2NXQA 4PHJA 1CFPA 2R2IA 1F54A 1F4QA 1YR5A 1K96A 2V53A 2WCBA 1M46A 1OQPA 3OHMB 2L4IA 5KU1A 3ZNIA 3CLNA 4MZLA 1BU3A 1NX1A 3MSEB 1K93D 2HETA 4U8DA 3NSLA 1FI5A 3PM8A 1HT9A 2M49B 1IG5A 2LLTA 4BY4A 4I5LB 1DMOA 1U5IB 1QVIZ 5CSNA 2JT3A 2KAVA 2GV5A 2P6BB 3GOFA 5I2QA 2LHIA 1SCVA 2M7LA 4ZCUA 1IGVA 1K94A 2IS9A 4MEWA 2H61C 3OB2B 4Q04A 3SG2A 1BLQA 1S36A 3DVKA 4BY5A 3VRNA 1NPQA 2BCBA 4GGFC 1H4BA 3BUNB 3JVTC 3JVTB 1B8RA 2JC2A 3K21A 4PE7A 1SL9A 2BE4A 1UHHA 2KDHA 1PVAA 2PVBA 1WRKA 1XFWO 3A8RA 3EK4A 4PDZA 2JT8A 1QVIY 1SYMA 1MXLC 1IH0A 1NX0A 3I5GB 2A4JA 1PVBA 1CDPA 1NX3A 1BOCA 4YGAA 1B8CA 2M1UA 3OX5A 4R1EA 1TOPA 2LUXA 2CCMA 3BUWB 1A4PA 1OZSA 2FCDA 3DF0A 1MQ1A 4F0ZB 1YX7A 2L51A 5J3XA 1SCMC 1SCMB 2F3YA 4L9MA 1MF8B 2E30A 2ZNEA 1BF5A 1A75A 1RWYA 3BXKA 2I18A 2JOJA 2Y1NA 2LUCA 2M8UA 1M31A 1SL8A 4PE0A 1TIZA 2KBMA 3JTDB 4NQGA 1K9UA 1S6IA 5HLOA 1EH2A 1YX8A 1M39A 1S6CA 1KQVA 3NSIA 1QX5B 4PE1A 3FIAA 3KO0A 5ER4X 2H2KA 4PE4A 2NCOA 2SCPA 2EC6C 2EC6B 1Y6WA 2I94A 3C1VA 5CSIA 1KFXL 3KF9A 3BYAA 1JUOA 2KI4C 2KI4B 1OMDA 4HRGA 1J7QA 2LE9B 3SJSA 1JC2A 1NSHA 4PHMA 2TN4A 1H8BA 1SRAA 3WHTB 1LINA 1QV0A 4AQJA 2ZFDA 4CPVA 1XK4A 1OOJA 2BKIB 5I2OA 1CKKA 1R6PA 5HKYA 1NYAA 1BJFA 4PHNA 4OV2A 1QASA 2M7NA 3ZWHA 4GBAA 1DJYA 2KFHA 1Y1UA 3O6BA 5JOLA 4DRWA 1TTXA 4CFRA 1K95A 1G4YR 4HREE 1ZUZA 4PHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCX A;  5DKN A;  4QJ5 B;  1RTP 1;  1Y1A A;  4WQ2 A;  2JRF A;  1KFU L;  2ZN8 A;  1MHO A;  2BBN A;  1F71 A;  1KK8 C;  1KK8 B;  4C0J A;  1Q80 A;  4YBH B;  1IWQ A;  1U5I A;  2L98 A;  4USL A;  2K7C A;  1D1O A;  3TUY B;  1CDN A;  1PUL A;  4DUQ A;  4YI8 A;  2H61 A;  2O5G A;  2LCP A;  3GK4 X;  3PAT A;  2I7A A;  3WXA A;  3LCP C;  4YRU A;  5FYX A;  1CM4 A;  2K2A A;  2LV7 A;  1GQM A;  2KGB C;  2L2E A;  4GGF A;  1M45 A;  3OP0 A;  1YTZ C;  1B1G A;  4JQ0 D;  4GFT A;  1YRU B;  3CGA A;  4MZJ A;  1EXR A;  2WOS A;  3PSR A;  1A29 A;  4P2Y B;  2BCA A;  3GK1 A;  1NWD A;  2K0J A;  1KSO A;  1TN4 A;  1F8H A;  2L0P A;  2Q91 A;  5DKR A;  5AFP A;  1K90 D;  2B1U A;  4PCW A;  3F45 A;  4OKH A;  1FPW A;  5D7F A;  1TNX A;  4M2P A;  3EVR A;  4MRY A;  3TZ1 A;  4JPZ B;  3IF7 A;  2JUL A;  4HRH A;  2KFF A;  1XVJ A;  2MAZ A;  1JF2 A;  1CFD A;  3CR5 X;  3OX6 A;  2MRD A;  1Y0V H;  1NCX A;  1AHR A;  1F70 A;  1TCO B;  2MBX A;  4UPG A;  1JFJ A;  2JNX A;  3KEV A;  2ZRS A;  1AJ4 A;  1NIW A;  1ZMZ A;  3RLZ A;  1WLZ A;  1QIW A;  2WCF A;  2M1K B;  2LP2 A;  2KAY A;  3BOW A;  4N5X A;  1EG3 A;  1FBV A;  1RFJ A;  4NDD A;  1BT6 A;  4HSZ A;  1UHI A;  2BL0 C;  2KSP A;  1ODB A;  4OCI A;  3OB1 B;  1JSA A;  1QIV A;  2K7O A;  1LA0 A;  4N1F A;  5I2L A;  1J7O A;  4I5K A;  1QLK A;  1SNL A;  3CZT X;  1YRT B;  3AAJ A;  4I5N B;  2HQ8 A;  1IJ5 A;  2KQY A;  1BMO A;  2LM5 A;  2MHH A;  3DVE A;  2LAP A;  1UUR A;  4AOM A;  2JTT A;  2LHL A;  2D8N A;  1AUI B;  2K7D A;  5D69 A;  1BG1 A;  3FWC A;  1L2O C;  1L2O B;  2Y5I A;  4GGN A;  1FI6 A;  3BUM B;  1WLM A;  2KGR A;  4WRI A;  3SG4 A;  1M63 B;  2CBL A;  2LP3 A;  4D1E A;  3LK1 A;  4C0K A;  1J1E A;  3EK8 A;  1TNQ A;  2EHB A;  3M0W A;  1OE9 B;  1IJ6 A;  1OZO A;  2WOR A;  1ZOT B;  2LVI A;  3CR4 X;  1J7P A;  1KK7 Z;  1X02 A;  1XA5 A;  1QX7 A;  1EL4 A;  1PSB A;  2F2P A;  1B9A A;  2KYF A;  1GGZ A;  1S6J A;  2SAS A;  1XFX O;  2KQ6 A;  4DCK A;  5TNC A;  3RM1 A;  3PN7 C;  3PN7 B;  1JF0 A;  4GUK A;  4ICB A;  1TNP A;  5AAN A;  2E6W A;  5IBW A;  4GAO A;  4TNC A;  5K89 A;  1GGW A;  1A03 A;  4QJ3 B;  2LMT A;  2PAS A;  1DGV A;  1L7Z A;  2WCE A;  4E68 A;  2GGZ A;  2L5X B;  3PFV A;  2O60 A;  1XYD A;  3NXA A;  2BBM A;  5HKW A;  4XYN A;  1DF0 B;  2JU0 A;  2MJW B;  1MUX A;  3FS7 A;  1KK7 Y;  4AQI A;  2HPS A;  1CFF A;  3D0Y B;  1CDM A;  2JQ6 A;  3CTN A;  2Y1M A;  3I5H C;  2BEC A;  2MLE C;  2KYC A;  3H4S E;  4IL1 A;  3SG5 A;  1K9K A;  2NCP A;  1C07 A;  4GPL B;  4P5O E;  1DJW A;  5DKQ A;  1C7W A;  1QS7 A;  2F2O A;  5GQQ C;  1KFX S;  4QJ4 B;  1SKT A;  4CFQ A;  5AEQ A;  1RJV A;  2MLF C;  4YGC B;  2OTG C;  2OTG B;  1IQ3 A;  3PAL A;  5JJG A;  1YUT A;  2NLN A;  1W7J B;  2LVK A;  4YGB B;  1CNP A;  2Y4Q A;  1MWN A;  2KNE A;  3TDU A;  3AKB A;  1NCZ A;  4ZCV A;  3O2P A;  1NP8 A;  1NUB A;  1KCY A;  3ICB A;  1DJH A;  4YGD B;  2ISD A;  2L4H A;  1YVH A;  1CDL A;  3NSK A;  1PSR A;  2JWW A;  3O4Y A;  3VRP A;  1J7R A;  1SY9 A;  1DJG A;  2G2B A;  1BOD A;  2JXL A;  1CLB A;  2F8P A;  2GGM A;  2KAX A;  1DJI A;  1IQ5 A;  1DTL A;  2BE6 A;  4MBE A;  4WQ3 A;  4MVF A;  1UP5 A;  1KFU S;  1UHJ A;  1J1D A;  5ER5 A;  1XFZ O;  3BQ3 A;  2HF5 A;  1ALW A;  2CXJ A;  3DD4 A;  3E3R A;  3EKH A;  4A4C A;  1CMG A;  1WRL A;  2ZRT A;  2I2R E;  1KQM C;  1KQM B;  1REC A;  1S5G Z;  1YUR A;  2JXC A;  1XO5 A;  3DVM A;  4ORB B;  1B4C A;  1JWD A;  3I5F C;  3I5F B;  1UHK A;  1C7V A;  4M2Q A;  4XJK B;  4ETO A;  2CT9 A;  1K9P A;  2CTN A;  2JT0 A;  2PMY A;  3IQQ A;  5AXI A;  5BPJ A;  1A2X A;  3AKA A;  2AMI A;  1CM1 A;  1NX2 A;  5HKZ A;  1NCY A;  4OVN F;  1JFK A;  1UUS A;  3WNX B;  2LVV A;  2K8M B;  1WY9 A;  3GK2 A;  1AJ5 A;  2LMU A;  1YUS A;  1XFV O;  3WHU B;  1KWO C;  1KWO B;  3SIB A;  1YUU A;  1N65 A;  2FJU B;  1S5G Y;  4DS7 A;  1S1E A;  2BL0 B;  4MSP A;  1CLM A;  5CPV A;  2QAC A;  2VRG A;  2ZKM X;  1F4O A;  1LKJ A;  2F33 A;  1BR1 B;  1PK0 D;  1OMR A;  1B47 A;  1DVI A;  2KBI A;  3TDZ A;  4CLN A;  1SW8 A;  1PAL A;  2ZN9 A;  4N1G A;  3BUX B;  4MN0 A;  1EG4 A;  4C0L A;  2K7B A;  3KPX A;  1DF0 A;  1W7I B;  4NDB A;  3VGO A;  1DJX A;  1IRJ A;  3D10 A;  3A4U B;  3D0Y A;  1F55 A;  2AUC A;  2FOT A;  1CTR A;  2HQW A;  1CLL A;  2K2F A;  1ZFS A;  5G08 A;  1QAT A;  3SG3 A;  2LLS A;  4FQO A;  5CSJ A;  1Y1X A;  1BR4 B;  1QJT A;  3CS1 A;  1QXP A;  2PAL A;  3VRO A;  2KI6 C;  2KI6 D;  3LK0 A;  2JTZ A;  1SBJ A;  2JZI A;  2WND A;  3I5I C;  3I5I B;  2PSR A;  1LXF C;  2KOT A;  3I5G C;  1DJZ A;  1CB1 A;  5HLV A;  2CNP A;  3AAK A;  2M0R A;  3KHE A;  1WRZ A;  3O78 A;  4DIR A;  5I8N A;  3VRQ A;  1SL7 A;  4MRX A;  2OS8 C;  2OS8 B;  3IQO A;  4YI9 A;  1UWO A;  3EVV A;  5F6T A;  2WC8 A;  2BKH B;  1GJY A;  3PLF B;  2DOQ A;  1N0Y A;  3LL8 B;  2LC5 A;  2LNK A;  4MZK A;  5PAL A;  2KHN A;  3HCM A;  3JTD C;  4FTG A;  2EGD A;  1B7T Z;  2LLU A;  1QLS A;  1R2U A;  3BOW B;  2M29 A;  1IKU A;  3I5H B;  1QTX A;  4NDC A;  2Q4U A;  1J55 A;  1G8I A;  1G33 A;  2ZND A;  4JWQ A;  1XFU O;  2LAN A;  1OSA A;  1WDC C;  1WDC B;  1PRW A;  2LVJ A;  3SG7 A;  1YVL A;  3LLE A;  4XJK A;  1K8U A;  2G9B A;  2COL B;  2LMV A;  2AAO A;  5B8I B;  1LA3 A;  1MR8 A;  1SPY A;  5KTY A;  1V1F A;  1UHN A;  3FWB A;  4A4B A;  1SK6 D;  3SIA A;  3TDI A;  1JBA A;  1S3P A;  1RK9 A;  1N2D A;  5CSF A;  1B7T Y;  1VRK A;  3EVU A;  1FW4 A;  1OMV A;  2PRU A;  3EK7 A;  3QRX A;  2OPO A;  1E8A A;  4CID A;  1S26 D;  3DF0 B;  2M3W A;  3EKJ A;  2KFG A;  4YGE B;  3TS5 C;  1SR6 C;  1SR6 B;  3TS5 B;  1TRF A;  1EJ3 A;  1QX2 A;  1RRO A;  2QPT A;  1A75 B;  2F3Z A;  3HX4 A;  1CFC A;  1HQV A;  1XFY O;  4M2O A;  1TNW A;  2JNF A;  1KSM A;  5AER A;  3BUO B;  4ORC B;  2M97 A;  1B8L A;  2JPT A;  3VRR A;  2NZ0 A;  3SG6 A;  4I5J A;  2L50 A;  1AK8 A;  5KSZ A;  1DGU A;  3TUY C;  1FF1 A;  3CWG A;  1AP4 A;  1SMG A;  2K61 A;  3NSO A;  1K2H A;  4PAL A;  2FCE A;  1V1G A;  1LVC D;  4MLW A;  3CR2 A;  1AVS A;  1TCF A;  5HYD A;  1ZAC A;  1MXE A;  2M9G A;  3DVJ A;  2RGI A;  1CMF A;  1DT7 B;  1XK4 C;  4GNK B;  4OR9 B;  2MA2 A;  4ORA B;  1ALV A;  1QV1 A;  2NXQ A;  4PHJ A;  1CFP A;  2R2I A;  1F54 A;  1F4Q A;  1YR5 A;  1K96 A;  2V53 A;  2WCB A;  1M46 A;  1OQP A;  3OHM B;  2L4I A;  5KU1 A;  3ZNI A;  3CLN A;  4MZL A;  1BU3 A;  1NX1 A;  3MSE B;  1K93 D;  2HET A;  4U8D A;  3NSL A;  1FI5 A;  3PM8 A;  1HT9 A;  2M49 B;  1IG5 A;  2LLT A;  4BY4 A;  4I5L B;  1DMO A;  1U5I B;  1QVI Z;  5CSN A;  2JT3 A;  2KAV A;  2GV5 A;  2P6B B;  3GOF A;  5I2Q A;  2LHI A;  1SCV A;  2M7L A;  4ZCU A;  1IGV A;  1K94 A;  2IS9 A;  4MEW A;  2H61 C;  3OB2 B;  4Q04 A;  3SG2 A;  1BLQ A;  1S36 A;  3DVK A;  4BY5 A;  3VRN A;  1NPQ A;  2BCB A;  4GGF C;  1H4B A;  3BUN B;  3JVT C;  3JVT B;  1B8R A;  2JC2 A;  3K21 A;  4PE7 A;  1SL9 A;  2BE4 A;  1UHH A;  2KDH A;  1PVA A;  2PVB A;  1WRK A;  1XFW O;  3A8R A;  3EK4 A;  4PDZ A;  2JT8 A;  1QVI Y;  1SYM A;  1MXL C;  1IH0 A;  1NX0 A;  3I5G B;  2A4J A;  1PVB A;  1CDP A;  1NX3 A;  1BOC A;  4YGA A;  1B8C A;  2M1U A;  3OX5 A;  4R1E A;  1TOP A;  2LUX A;  2CCM A;  3BUW B;  1A4P A;  1OZS A;  2FCD A;  3DF0 A;  1MQ1 A;  4F0Z B;  1YX7 A;  2L51 A;  5J3X A;  1SCM C;  1SCM B;  2F3Y A;  4L9M A;  1MF8 B;  2E30 A;  2ZNE A;  1BF5 A;  1A75 A;  1RWY A;  3BXK A;  2I18 A;  2JOJ A;  2Y1N A;  2LUC A;  2M8U A;  1M31 A;  1SL8 A;  4PE0 A;  1TIZ A;  2KBM A;  3JTD B;  4NQG A;  1K9U A;  1S6I A;  5HLO A;  1EH2 A;  1YX8 A;  1M39 A;  1S6C A;  1KQV A;  3NSI A;  1QX5 B;  4PE1 A;  3FIA A;  3KO0 A;  5ER4 X;  2H2K A;  4PE4 A;  2NCO A;  2SCP A;  2EC6 C;  2EC6 B;  1Y6W A;  2I94 A;  3C1V A;  5CSI A;  1KFX L;  3KF9 A;  3BYA A;  1JUO A;  2KI4 C;  2KI4 B;  1OMD A;  4HRG A;  1J7Q A;  2LE9 B;  3SJS A;  1JC2 A;  1NSH A;  4PHM A;  2TN4 A;  1H8B A;  1SRA A;  3WHT B;  1LIN A;  1QV0 A;  4AQJ A;  2ZFD A;  4CPV A;  1XK4 A;  1OOJ A;  2BKI B;  5I2O A;  1CKK A;  1R6P A;  5HKY A;  1NYA A;  1BJF A;  4PHN A;  4OV2 A;  1QAS A;  2M7N A;  3ZWH A;  4GBA A;  1DJY A;  2KFH A;  1Y1U A;  3O6B A;  5JOL A;  4DRW A;  1TTX A;  4CFR A;  1K95 A;  1G4Y R;  4HRE E;  1ZUZ A;  4PHK A; 
#chains in the Genus database with same CATH topology
 3SS5 A;  2BCX A;  1TWO A;  5DKN A;  3UNW A;  4QJ5 B;  1RTP 1;  1Y1A A;  4WQ2 A;  2JRF A;  1KFU L;  2ZN8 A;  1MHO A;  2BBN A;  3UO9 A;  1KK8 C;  1KK8 B;  1F71 A;  2QEB A;  1C3Z A;  4C0J A;  5I94 A;  1Q80 A;  4YBH B;  2WC6 A;  1IWQ A;  1U5I A;  2L98 A;  4USL A;  2K7C A;  3IVT A;  1D1O A;  3TUY B;  3Q8I A;  1CDN A;  1IIO A;  3L4A A;  1PUL A;  4DUQ A;  2WCM A;  4YI8 A;  2H61 A;  2O5G A;  2LCP A;  1XFR A;  3GK4 X;  3PAT A;  2I7A A;  3WXA A;  3LCP C;  4YRU A;  5FYX A;  1CM4 A;  2K2A A;  2LV7 A;  1GQM A;  2KGB C;  1P28 A;  2L2E A;  4GGF A;  1M45 A;  2QEO A;  3CAB A;  3OP0 A;  1YTZ C;  1B1G A;  4JQ0 D;  4GFT A;  1OOH A;  1YRU B;  3CGA A;  4MZJ A;  1EXR A;  2WOS A;  3PSR A;  3S0F A;  1A29 A;  4P2Y B;  4FQT A;  2BCA A;  3GK1 A;  1NWD A;  2K0J A;  1KSO A;  1TN4 A;  1F8H A;  2L0P A;  2Q91 A;  5DKR A;  5AFP A;  1K90 D;  2B1U A;  4PCW A;  3F45 A;  4OKH A;  1FPW A;  5D7F A;  1TNX A;  4M2P A;  3EVR A;  4MRY A;  3TZ1 A;  4JPZ B;  3IF7 A;  2JUL A;  4HRH A;  5FI6 A;  3FE8 A;  2KFF A;  1XVJ A;  3S0D A;  2MAZ A;  1JF2 A;  1CFD A;  3B87 A;  3CR5 X;  3OX6 A;  2MRD A;  1Y0V H;  1NCX A;  1AHR A;  1F70 A;  1TCO B;  2MBX A;  4UPG A;  1JFJ A;  2JNX A;  3KEV A;  2ZRS A;  1AJ4 A;  1NIW A;  1ZMZ A;  3RLZ A;  1WLZ A;  3OBV A;  1QIW A;  2WCF A;  2M1K B;  2LP2 A;  2KAY A;  3BOW A;  4N5X A;  1EG3 A;  1FBV A;  1RFJ A;  4NDD A;  1BT6 A;  4HSZ A;  1UHI A;  1Z4H A;  2BL0 C;  2KSP A;  1ODB A;  4OCI A;  1OOG A;  5D3O A;  3OB1 B;  1JSA A;  1QIV A;  2K7O A;  1LA0 A;  4N1F A;  5I2L A;  1J7O A;  4I5K A;  1QLK A;  1SNL A;  3CZT X;  1YRT B;  3AAJ A;  4I5N B;  2HQ8 A;  1IJ5 A;  2KQY A;  1BMO A;  2LM5 A;  2MHH A;  3DVE A;  2LAP A;  1UUR A;  2PYQ A;  4AOM A;  2JTT A;  2LHL A;  2D8N A;  1AUI B;  2K7D A;  5D69 A;  1BG1 A;  3FWC A;  2KLE A;  1L2O C;  1L2O B;  2Y5I A;  4GGN A;  4OZD A;  4PT1 A;  1FI6 A;  3BUM B;  1WLM A;  2KGR A;  4WRI A;  3SG4 A;  1M63 B;  2CBL A;  2LP3 A;  4D1E A;  3LK1 A;  4C0K A;  1J1E A;  3EK8 A;  1TNQ A;  2EHB A;  3M0W A;  1OE9 B;  1IJ6 A;  1OZO A;  2WOR A;  1ZOT B;  2LVI A;  3CR4 X;  3S0A A;  1J7P A;  1KK7 Z;  1X02 A;  1XA5 A;  1QX7 A;  1EL4 A;  1PSB A;  2F2P A;  1B9A A;  2KYF A;  3BFB A;  3K1E A;  1GGZ A;  1S6J A;  2SAS A;  1XFX O;  2KQ6 A;  3L47 A;  2P71 A;  5TNC A;  3RM1 A;  4DCK A;  3PN7 C;  3PN7 B;  1JF0 A;  4GUK A;  4ICB A;  1TNP A;  5AAN A;  3R1V A;  2KPH A;  2E6W A;  5IBW A;  4GAO A;  4TNC A;  5K89 A;  1GGW A;  1A03 A;  2BAP A;  4QJ3 B;  2LMT A;  2PAS A;  1DGV A;  1L7Z A;  2WCH A;  2WCE A;  4E68 A;  2GGZ A;  2L5X B;  3B88 A;  3PFV A;  2O60 A;  1XYD A;  3NXA A;  2BBM A;  1OOF A;  3N7H A;  4XYN A;  1DF0 B;  2JU0 A;  5HKW A;  2MJW B;  1MUX A;  3FS7 A;  5HL1 A;  1KK7 Y;  4AQI A;  2HPS A;  1CFF A;  3D0Y B;  1CDM A;  2JQ6 A;  3CTN A;  2Y1M A;  3I5H C;  2BEC A;  2MLE C;  2KYC A;  3H4S E;  3DY9 A;  4IL1 A;  3SG5 A;  1K9K A;  2NCP A;  1C07 A;  4GPL B;  4P5O E;  1DJW A;  5DKQ A;  1C7W A;  1QS7 A;  2F2O A;  5GQQ C;  1KFX S;  4QJ4 B;  1SKT A;  4CFQ A;  5AEQ A;  1RJV A;  2MLF C;  4YGC B;  3BFH A;  2OTG C;  2OTG B;  1IQ3 A;  3PAL A;  5JJG A;  1YUT A;  2NLN A;  1W7J B;  2LVK A;  4YGB B;  1CNP A;  1GM0 A;  2Y4Q A;  1MWN A;  2KNE A;  3BJH A;  3AKB A;  3TDU A;  1NCZ A;  4ZCV A;  3O2P A;  1NP8 A;  1OW4 A;  1NUB A;  1KCY A;  3ICB A;  1DJH A;  4YGD B;  2ISD A;  2L4H A;  1YVH A;  1CDL A;  3NSK A;  1PSR A;  2JWW A;  3O4Y A;  3VRP A;  1DC1 A;  5DIC A;  1J7R A;  1SY9 A;  1DJG A;  2G2B A;  3SS3 A;  1BOD A;  2JXL A;  1CLB A;  2F8P A;  2GGM A;  2H8V A;  2KAX A;  5FI7 A;  3DZT A;  1DJI A;  1IQ5 A;  1DTL A;  2BE6 A;  4MBE A;  4WQ3 A;  4MVF A;  1UP5 A;  1KFU S;  1UHJ A;  1J1D A;  5ER5 A;  1XFZ O;  3BQ3 A;  2HF5 A;  1ALW A;  2CXJ A;  3DD4 A;  3E3R A;  3EKH A;  4A4C A;  1CMG A;  1WRL A;  2ZRT A;  2I2R E;  1KQM C;  1KQM B;  1REC A;  1S5G Z;  1YUR A;  2JXC A;  1DQE A;  1XO5 A;  2WCJ A;  3PM2 A;  3DVM A;  4ORB B;  1B4C A;  1JWD A;  3I5F C;  3I5F B;  1UHK A;  1C7V A;  4M2Q A;  4XJK B;  4ETO A;  2CT9 A;  2ERB A;  1K9P A;  2CTN A;  2JT0 A;  2PMY A;  3IQQ A;  5AXI A;  3CDN A;  5BPJ A;  1A2X A;  3AKA A;  2AMI A;  1CM1 A;  2K60 A;  1NX2 A;  5HKZ A;  3CYZ A;  1NCY A;  4OVN F;  1JFK A;  1UUS A;  3WNX B;  2LVV A;  2K8M B;  1WY9 A;  3GK2 A;  1AJ5 A;  2LMU A;  1YUS A;  1XFV O;  3WHU B;  1KWO C;  1KWO B;  3SIB A;  1YUU A;  1N65 A;  2FJU B;  1S5G Y;  4DS7 A;  1S1E A;  2BL0 B;  4MSP A;  1CLM A;  1LS8 A;  2QAC A;  2VRG A;  2ZKM X;  1F4O A;  1LKJ A;  5CPV A;  2F33 A;  1BR1 B;  3D77 A;  1PK0 D;  1OMR A;  1B47 A;  1DVI A;  2KBI A;  3TDZ A;  4CLN A;  3RZS A;  1SW8 A;  1PAL A;  2L2C A;  2ZN9 A;  4N1G A;  3BUX B;  3BFA A;  4MN0 A;  1EG4 A;  3B7A A;  3R1O A;  4C0L A;  1SSE B;  3EG5 B;  2K7B A;  3KPX A;  3S0B A;  1DF0 A;  3DXL A;  1W7I B;  4NDB A;  3VGO A;  1DJX A;  1IRJ A;  3D10 A;  3A4U B;  3D0Y A;  1F55 A;  2AUC A;  2FOT A;  1CTR A;  2HQW A;  1CLL A;  2K2F A;  1ZFS A;  5G08 A;  1TUZ A;  1QAT A;  3SG3 A;  2LLS A;  4FQO A;  3FE6 A;  5CSJ A;  1Y1X A;  1BR4 B;  1QJT A;  3CS1 A;  1QXP A;  2PAL A;  3VRO A;  2KI6 C;  4INX A;  2KI6 D;  3LK0 A;  2JTZ A;  1SBJ A;  5EL2 A;  2JZI A;  2WCK A;  2WND A;  3I5I C;  3I5I B;  2PSR A;  3D78 A;  3SS4 A;  1LXF C;  2KOT A;  3I5G C;  1DJZ A;  1CB1 A;  5HLV A;  2CNP A;  3AAK A;  2M0R A;  3KHE A;  1WRZ A;  3CZ0 A;  3O78 A;  3R1P A;  4DIR A;  5I8N A;  3R72 A;  3VRQ A;  1SL7 A;  4MRX A;  2OS8 C;  2OS8 B;  3IQO A;  4YI9 A;  1UWO A;  3EVV A;  5F6T A;  2WC8 A;  2BKH B;  1GJY A;  3PLF B;  2DOQ A;  2YGU A;  1N0Y A;  3LL8 B;  3VB1 A;  2LC5 A;  2LNK A;  4MZK A;  4JD9 A;  5PAL A;  2KHN A;  3HCM A;  3JTD C;  4FTG A;  2EGD A;  1B7T Z;  2LLU A;  1QLS A;  1R2U A;  2L5Y A;  3BOW B;  2M29 A;  1IKU A;  3NHI A;  3I5H B;  1QTX A;  4NDC A;  2Q4U A;  1J55 A;  3NHT A;  1G8I A;  1G33 A;  2P70 A;  2ZND A;  4JWQ A;  1XFU O;  2LAN A;  1OSA A;  1WDC C;  1WDC B;  2QEV A;  1PRW A;  2LVJ A;  3SG7 A;  1YVL A;  3LLE A;  4XJK A;  1K8U A;  2G9B A;  2COL B;  2LMV A;  2AAO A;  5B8I B;  1LA3 A;  1TUJ A;  1MR8 A;  1SPY A;  5KTY A;  1V1F A;  1UHN A;  3FWB A;  4A4B A;  1SK6 D;  1DEL A;  3SIA A;  3TDI A;  1JBA A;  1S3P A;  1RK9 A;  1N2D A;  5CSF A;  1B7T Y;  1VRK A;  3D76 A;  3EVU A;  1FW4 A;  3OGN A;  1OMV A;  2PRU A;  3EK7 A;  3QRX A;  2OPO A;  1E8A A;  4CID A;  1S26 D;  3DF0 B;  2M3W A;  3EKJ A;  2KFG A;  4YGE B;  3TS5 C;  1SR6 C;  1SR6 B;  3TS5 B;  1TRF A;  1EJ3 A;  1QX2 A;  1RRO A;  2QPT A;  2QEH A;  1A75 B;  3FE9 A;  2F3Z A;  3HX4 A;  1CFC A;  1HQV A;  1XFY O;  3CZ1 A;  4M2O A;  1TNW A;  2JNF A;  1KSM A;  5AER A;  3BUO B;  1W9Z A;  4ORC B;  2M97 A;  1B8L A;  2JPT A;  3VRR A;  2NZ0 A;  3SG6 A;  4I5J A;  2L50 A;  1AK8 A;  5KSZ A;  1DGU A;  3TUY C;  3DYE A;  1FF1 A;  3CWG A;  1AP4 A;  3O4X A;  1SMG A;  2K61 A;  3NSO A;  1K2H A;  4PAL A;  2FCE A;  1V1G A;  1LVC D;  4MLW A;  1QWV A;  3CR2 A;  1AVS A;  1TCF A;  5HYD A;  1ZAC A;  1MXE A;  2M9G A;  4JKT A;  3DVJ A;  2RGI A;  1CMF A;  1DT7 B;  1XK4 C;  4GNK B;  4OR9 B;  2MA2 A;  4ORA B;  1ALV A;  1QV1 A;  2NXQ A;  4PHJ A;  1CFP A;  2R2I A;  1F54 A;  1F4Q A;  3B86 A;  1YR5 A;  1K96 A;  2V53 A;  2WCB A;  1M46 A;  1OQP A;  3OHM B;  2QDI A;  2L4I A;  2BNX A;  3CZ2 A;  5KU1 A;  3ZNI A;  3CLN A;  4MZL A;  1BU3 A;  1NX1 A;  1OOI X;  2FJY A;  3MSE B;  1K93 D;  1C3Y A;  3V2L A;  2HET A;  4U8D A;  3NSL A;  1Z2C B;  1FI5 A;  3PM8 A;  1HT9 A;  2M49 B;  3S0E A;  1IG5 A;  2LLT A;  4BY4 A;  4I5L B;  2PQL A;  4KYN A;  1U5I B;  1DMO A;  1QVI Z;  5CSN A;  2JT3 A;  2KAV A;  2GV5 A;  2P6B B;  3GOF A;  5I2Q A;  2LHI A;  1SCV A;  3D73 A;  2M7L A;  4ZCU A;  1IGV A;  1K94 A;  2IS9 A;  4MEW A;  2H61 C;  3OB2 B;  4Q04 A;  4INW A;  3SG2 A;  1BLQ A;  1S36 A;  3DVK A;  4BY5 A;  3VRN A;  1NPQ A;  2BCB A;  4GGF C;  1H4B A;  3BUN B;  3JVT C;  3JVT B;  1B8R A;  2JC2 A;  3K21 A;  2GTE A;  3QME A;  4PE7 A;  1SL9 A;  2BE4 A;  1UHH A;  2KDH A;  1PVA A;  2PVB A;  3PJI A;  1WRK A;  1XFW O;  3A8R A;  3L4L A;  3EK4 A;  4PDZ A;  3S0G A;  2JT8 A;  1QVI Y;  1SYM A;  1MXL C;  4IJ7 A;  1NX0 A;  3I5G B;  5FI2 A;  1IH0 A;  2A4J A;  1PVB A;  1CDP A;  1NX3 A;  1BOC A;  4YGA A;  1B8C A;  1ORG A;  2M1U A;  3OX5 A;  4R1E A;  1TOP A;  2LUX A;  2CCM A;  3B6X A;  1A4P A;  1OZS A;  2FCD A;  2JPO A;  3BUW B;  3DF0 A;  1MQ1 A;  4F0Z B;  1YX7 A;  2L51 A;  5J3X A;  1SCM C;  1SCM B;  2F3Y A;  4L9M A;  1MF8 B;  2E30 A;  2ZNE A;  1BF5 A;  1A75 A;  1RWY A;  3BXK A;  2I18 A;  2JOJ A;  2Y1N A;  2LUC A;  2M8U A;  1M31 A;  1SL8 A;  4PE0 A;  1TIZ A;  2KBM A;  3JTD B;  4NQG A;  1K9U A;  1DEK A;  1S6I A;  5HLO A;  1EH2 A;  1YX8 A;  1M39 A;  1S6C A;  1KQV A;  3NSI A;  1QX5 B;  4PE1 A;  3FIA A;  3KO0 A;  5ER4 X;  2H2K A;  4PE4 A;  2NCO A;  2SCP A;  2EC6 C;  2EC6 B;  1Y6W A;  2I94 A;  3C1V A;  5CSI A;  1KFX L;  3KF9 A;  3BYA A;  1JUO A;  2KI4 C;  2KI4 B;  1OMD A;  4HRG A;  1J7Q A;  2LE9 B;  3SJS A;  1JC2 A;  3D74 A;  1NSH A;  3NGV A;  2TN4 A;  4PHM A;  1H8B A;  2WCL A;  3D75 A;  1SRA A;  1T14 A;  3WHT B;  1LIN A;  1QV0 A;  2WC5 A;  4AQJ A;  2ZFD A;  4CPV A;  1XK4 A;  1OOJ A;  2BKI B;  5I2O A;  1CKK A;  1R6P A;  5HKY A;  2KLD A;  1NYA A;  1BJF A;  4PHN A;  4OV2 A;  1QAS A;  2M7N A;  3ZWH A;  4GBA A;  1DJY A;  2KFH A;  1Y1U A;  3O6B A;  5JOL A;  4DRW A;  1TTX A;  4CFR A;  4F7F A;  1K95 A;  1G4Y R;  4HRE E;  1ZUZ A;  4PHK A; 
#chains in the Genus database with same CATH homology
 2BCX A;  5DKN A;  4QJ5 B;  1RTP 1;  1Y1A A;  4WQ2 A;  2JRF A;  1KFU L;  2ZN8 A;  1MHO A;  2BBN A;  1F71 A;  1KK8 C;  1KK8 B;  4C0J A;  1Q80 A;  4YBH B;  1IWQ A;  1U5I A;  2L98 A;  4USL A;  2K7C A;  1D1O A;  3TUY B;  1CDN A;  1PUL A;  4DUQ A;  4YI8 A;  2H61 A;  2O5G A;  2LCP A;  3GK4 X;  3PAT A;  2I7A A;  3WXA A;  3LCP C;  4YRU A;  5FYX A;  1CM4 A;  2K2A A;  2LV7 A;  1GQM A;  2KGB C;  2L2E A;  4GGF A;  1M45 A;  3OP0 A;  1YTZ C;  1B1G A;  4JQ0 D;  4GFT A;  1YRU B;  3CGA A;  4MZJ A;  1EXR A;  2WOS A;  3PSR A;  1A29 A;  4P2Y B;  2BCA A;  3GK1 A;  1NWD A;  2K0J A;  1KSO A;  1TN4 A;  1F8H A;  2L0P A;  2Q91 A;  5DKR A;  5AFP A;  1K90 D;  2B1U A;  4PCW A;  3F45 A;  4OKH A;  1FPW A;  5D7F A;  1TNX A;  4M2P A;  3EVR A;  4MRY A;  3TZ1 A;  4JPZ B;  3IF7 A;  2JUL A;  4HRH A;  2KFF A;  1XVJ A;  2MAZ A;  1JF2 A;  1CFD A;  3CR5 X;  3OX6 A;  2MRD A;  1Y0V H;  1NCX A;  1AHR A;  1F70 A;  1TCO B;  2MBX A;  4UPG A;  1JFJ A;  2JNX A;  3KEV A;  2ZRS A;  1AJ4 A;  1NIW A;  1ZMZ A;  3RLZ A;  1WLZ A;  1QIW A;  2WCF A;  2M1K B;  2LP2 A;  2KAY A;  3BOW A;  4N5X A;  1EG3 A;  1FBV A;  1RFJ A;  4NDD A;  1BT6 A;  4HSZ A;  1UHI A;  2BL0 C;  2KSP A;  1ODB A;  4OCI A;  3OB1 B;  1JSA A;  1QIV A;  2K7O A;  1LA0 A;  4N1F A;  5I2L A;  1J7O A;  4I5K A;  1QLK A;  1SNL A;  3CZT X;  1YRT B;  3AAJ A;  4I5N B;  2HQ8 A;  1IJ5 A;  2KQY A;  1BMO A;  2LM5 A;  2MHH A;  3DVE A;  2LAP A;  1UUR A;  4AOM A;  2JTT A;  2LHL A;  2D8N A;  1AUI B;  2K7D A;  5D69 A;  1BG1 A;  3FWC A;  1L2O C;  1L2O B;  2Y5I A;  4GGN A;  1FI6 A;  3BUM B;  1WLM A;  2KGR A;  4WRI A;  3SG4 A;  1M63 B;  2CBL A;  2LP3 A;  4D1E A;  3LK1 A;  4C0K A;  1J1E A;  3EK8 A;  1TNQ A;  2EHB A;  3M0W A;  1OE9 B;  1IJ6 A;  1OZO A;  2WOR A;  1ZOT B;  2LVI A;  3CR4 X;  1J7P A;  1KK7 Z;  1X02 A;  1XA5 A;  1QX7 A;  1EL4 A;  1PSB A;  2F2P A;  1B9A A;  2KYF A;  1GGZ A;  1S6J A;  2SAS A;  1XFX O;  2KQ6 A;  4DCK A;  5TNC A;  3RM1 A;  3PN7 C;  3PN7 B;  1JF0 A;  4GUK A;  4ICB A;  1TNP A;  5AAN A;  2E6W A;  5IBW A;  4GAO A;  4TNC A;  5K89 A;  1GGW A;  1A03 A;  4QJ3 B;  2LMT A;  2PAS A;  1DGV A;  1L7Z A;  2WCE A;  4E68 A;  2GGZ A;  2L5X B;  3PFV A;  2O60 A;  1XYD A;  3NXA A;  2BBM A;  5HKW A;  4XYN A;  1DF0 B;  2JU0 A;  2MJW B;  1MUX A;  3FS7 A;  1KK7 Y;  4AQI A;  2HPS A;  1CFF A;  3D0Y B;  1CDM A;  2JQ6 A;  3CTN A;  2Y1M A;  3I5H C;  2BEC A;  2MLE C;  2KYC A;  3H4S E;  4IL1 A;  3SG5 A;  1K9K A;  2NCP A;  1C07 A;  4GPL B;  4P5O E;  1DJW A;  5DKQ A;  1C7W A;  1QS7 A;  2F2O A;  5GQQ C;  1KFX S;  4QJ4 B;  1SKT A;  4CFQ A;  5AEQ A;  1RJV A;  2MLF C;  4YGC B;  2OTG C;  2OTG B;  1IQ3 A;  3PAL A;  5JJG A;  1YUT A;  2NLN A;  1W7J B;  2LVK A;  4YGB B;  1CNP A;  2Y4Q A;  1MWN A;  2KNE A;  3TDU A;  3AKB A;  1NCZ A;  4ZCV A;  3O2P A;  1NP8 A;  1NUB A;  1KCY A;  3ICB A;  1DJH A;  4YGD B;  2ISD A;  2L4H A;  1YVH A;  1CDL A;  3NSK A;  1PSR A;  2JWW A;  3O4Y A;  3VRP A;  1J7R A;  1SY9 A;  1DJG A;  2G2B A;  1BOD A;  2JXL A;  1CLB A;  2F8P A;  2GGM A;  2KAX A;  1DJI A;  1IQ5 A;  1DTL A;  2BE6 A;  4MBE A;  4WQ3 A;  4MVF A;  1UP5 A;  1KFU S;  1UHJ A;  1J1D A;  5ER5 A;  1XFZ O;  3BQ3 A;  2HF5 A;  1ALW A;  2CXJ A;  3DD4 A;  3E3R A;  3EKH A;  4A4C A;  1CMG A;  1WRL A;  2ZRT A;  2I2R E;  1KQM C;  1KQM B;  1REC A;  1S5G Z;  1YUR A;  2JXC A;  1XO5 A;  3DVM A;  4ORB B;  1B4C A;  1JWD A;  3I5F C;  3I5F B;  1UHK A;  1C7V A;  4M2Q A;  4XJK B;  4ETO A;  2CT9 A;  1K9P A;  2CTN A;  2JT0 A;  2PMY A;  3IQQ A;  5AXI A;  5BPJ A;  1A2X A;  3AKA A;  2AMI A;  1CM1 A;  1NX2 A;  5HKZ A;  1NCY A;  4OVN F;  1JFK A;  1UUS A;  3WNX B;  2LVV A;  2K8M B;  1WY9 A;  3GK2 A;  1AJ5 A;  2LMU A;  1YUS A;  1XFV O;  3WHU B;  1KWO C;  1KWO B;  3SIB A;  1YUU A;  1N65 A;  2FJU B;  1S5G Y;  4DS7 A;  1S1E A;  2BL0 B;  4MSP A;  1CLM A;  5CPV A;  2QAC A;  2VRG A;  2ZKM X;  1F4O A;  1LKJ A;  2F33 A;  1BR1 B;  1PK0 D;  1OMR A;  1B47 A;  1DVI A;  2KBI A;  3TDZ A;  4CLN A;  1SW8 A;  1PAL A;  2ZN9 A;  4N1G A;  3BUX B;  4MN0 A;  1EG4 A;  4C0L A;  2K7B A;  3KPX A;  1DF0 A;  1W7I B;  4NDB A;  3VGO A;  1DJX A;  1IRJ A;  3D10 A;  3A4U B;  3D0Y A;  1F55 A;  2AUC A;  2FOT A;  1CTR A;  2HQW A;  1CLL A;  2K2F A;  1ZFS A;  5G08 A;  1QAT A;  3SG3 A;  2LLS A;  4FQO A;  5CSJ A;  1Y1X A;  1BR4 B;  1QJT A;  3CS1 A;  1QXP A;  2PAL A;  3VRO A;  2KI6 C;  2KI6 D;  3LK0 A;  2JTZ A;  1SBJ A;  2JZI A;  2WND A;  3I5I C;  3I5I B;  2PSR A;  1LXF C;  2KOT A;  3I5G C;  1DJZ A;  1CB1 A;  5HLV A;  2CNP A;  3AAK A;  2M0R A;  3KHE A;  1WRZ A;  3O78 A;  4DIR A;  5I8N A;  3VRQ A;  1SL7 A;  4MRX A;  2OS8 C;  2OS8 B;  3IQO A;  4YI9 A;  1UWO A;  3EVV A;  5F6T A;  2WC8 A;  2BKH B;  1GJY A;  3PLF B;  2DOQ A;  1N0Y A;  3LL8 B;  2LC5 A;  2LNK A;  4MZK A;  5PAL A;  2KHN A;  3HCM A;  3JTD C;  4FTG A;  2EGD A;  1B7T Z;  2LLU A;  1QLS A;  1R2U A;  3BOW B;  2M29 A;  1IKU A;  3I5H B;  1QTX A;  4NDC A;  2Q4U A;  1J55 A;  1G8I A;  1G33 A;  2ZND A;  4JWQ A;  1XFU O;  2LAN A;  1OSA A;  1WDC C;  1WDC B;  1PRW A;  2LVJ A;  3SG7 A;  1YVL A;  3LLE A;  4XJK A;  1K8U A;  2G9B A;  2COL B;  2LMV A;  2AAO A;  5B8I B;  1LA3 A;  1MR8 A;  1SPY A;  5KTY A;  1V1F A;  1UHN A;  3FWB A;  4A4B A;  1SK6 D;  3SIA A;  3TDI A;  1JBA A;  1S3P A;  1RK9 A;  1N2D A;  5CSF A;  1B7T Y;  1VRK A;  3EVU A;  1FW4 A;  1OMV A;  2PRU A;  3EK7 A;  3QRX A;  2OPO A;  1E8A A;  4CID A;  1S26 D;  3DF0 B;  2M3W A;  3EKJ A;  2KFG A;  4YGE B;  3TS5 C;  1SR6 C;  1SR6 B;  3TS5 B;  1TRF A;  1EJ3 A;  1QX2 A;  1RRO A;  2QPT A;  1A75 B;  2F3Z A;  3HX4 A;  1CFC A;  1HQV A;  1XFY O;  4M2O A;  1TNW A;  2JNF A;  1KSM A;  5AER A;  3BUO B;  4ORC B;  2M97 A;  1B8L A;  2JPT A;  3VRR A;  2NZ0 A;  3SG6 A;  4I5J A;  2L50 A;  1AK8 A;  5KSZ A;  1DGU A;  3TUY C;  1FF1 A;  3CWG A;  1AP4 A;  1SMG A;  2K61 A;  3NSO A;  1K2H A;  4PAL A;  2FCE A;  1V1G A;  1LVC D;  4MLW A;  3CR2 A;  1AVS A;  1TCF A;  5HYD A;  1ZAC A;  1MXE A;  2M9G A;  3DVJ A;  2RGI A;  1CMF A;  1DT7 B;  1XK4 C;  4GNK B;  4OR9 B;  2MA2 A;  4ORA B;  1ALV A;  1QV1 A;  2NXQ A;  4PHJ A;  1CFP A;  2R2I A;  1F54 A;  1F4Q A;  1YR5 A;  1K96 A;  2V53 A;  2WCB A;  1M46 A;  1OQP A;  3OHM B;  2L4I A;  5KU1 A;  3ZNI A;  3CLN A;  4MZL A;  1BU3 A;  1NX1 A;  3MSE B;  1K93 D;  2HET A;  4U8D A;  3NSL A;  1FI5 A;  3PM8 A;  1HT9 A;  2M49 B;  1IG5 A;  2LLT A;  4BY4 A;  4I5L B;  1DMO A;  1U5I B;  1QVI Z;  5CSN A;  2JT3 A;  2KAV A;  2GV5 A;  2P6B B;  3GOF A;  5I2Q A;  2LHI A;  1SCV A;  2M7L A;  4ZCU A;  1IGV A;  1K94 A;  2IS9 A;  4MEW A;  2H61 C;  3OB2 B;  4Q04 A;  3SG2 A;  1BLQ A;  1S36 A;  3DVK A;  4BY5 A;  3VRN A;  1NPQ A;  2BCB A;  4GGF C;  1H4B A;  3BUN B;  3JVT C;  3JVT B;  1B8R A;  2JC2 A;  3K21 A;  4PE7 A;  1SL9 A;  2BE4 A;  1UHH A;  2KDH A;  1PVA A;  2PVB A;  1WRK A;  1XFW O;  3A8R A;  3EK4 A;  4PDZ A;  2JT8 A;  1QVI Y;  1SYM A;  1MXL C;  1IH0 A;  1NX0 A;  3I5G B;  2A4J A;  1PVB A;  1CDP A;  1NX3 A;  1BOC A;  4YGA A;  1B8C A;  2M1U A;  3OX5 A;  4R1E A;  1TOP A;  2LUX A;  2CCM A;  3BUW B;  1A4P A;  1OZS A;  2FCD A;  3DF0 A;  1MQ1 A;  4F0Z B;  1YX7 A;  2L51 A;  5J3X A;  1SCM C;  1SCM B;  2F3Y A;  4L9M A;  1MF8 B;  2E30 A;  2ZNE A;  1BF5 A;  1A75 A;  1RWY A;  3BXK A;  2I18 A;  2JOJ A;  2Y1N A;  2LUC A;  2M8U A;  1M31 A;  1SL8 A;  4PE0 A;  1TIZ A;  2KBM A;  3JTD B;  4NQG A;  1K9U A;  1S6I A;  5HLO A;  1EH2 A;  1YX8 A;  1M39 A;  1S6C A;  1KQV A;  3NSI A;  1QX5 B;  4PE1 A;  3FIA A;  3KO0 A;  5ER4 X;  2H2K A;  4PE4 A;  2NCO A;  2SCP A;  2EC6 C;  2EC6 B;  1Y6W A;  2I94 A;  3C1V A;  5CSI A;  1KFX L;  3KF9 A;  3BYA A;  1JUO A;  2KI4 C;  2KI4 B;  1OMD A;  4HRG A;  1J7Q A;  2LE9 B;  3SJS A;  1JC2 A;  1NSH A;  4PHM A;  2TN4 A;  1H8B A;  1SRA A;  3WHT B;  1LIN A;  1QV0 A;  4AQJ A;  2ZFD A;  4CPV A;  1XK4 A;  1OOJ A;  2BKI B;  5I2O A;  1CKK A;  1R6P A;  5HKY A;  1NYA A;  1BJF A;  4PHN A;  4OV2 A;  1QAS A;  2M7N A;  3ZWH A;  4GBA A;  1DJY A;  2KFH A;  1Y1U A;  3O6B A;  5JOL A;  4DRW A;  1TTX A;  4CFR A;  1K95 A;  1G4Y R;  4HRE E;  1ZUZ A;  4PHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...