1DVIA

Calpain domain vi with calcium bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
EEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTSRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-dependent protease
molecule keywords CALPAIN
publication title Structure of a calpain Ca(2+)-binding domain reveals a novel EF-hand and Ca(2+)-induced conformational changes.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dviA00
2KI4C 2Y4QA 5KTYA 1KSMA 1TNQA 1SNLA 3CGAA 1KWOC 2ZNDA 3WXAA 5CSNA 1U5IB 1JC2A 1VRKA 2BCBA 1EH2A 2ZNEA 4D1EA 3A8RA 1ZACA 2FCEA 4L9MA 1QASA 1MR8A 1YVHA 2NLNA 1NX2A 1F70A 2K7BA 2LHIA 3M0WA 2JXCA 2PVBA 1ALWA 2MJWB 4CLNA 4BY5A 5CPVA 5FYXA 1R2UA 2HQ8A 2AMIA 2MA2A 4CFRA 3VRNA 1OOJA 2F33A 2OS8C 1IH0A 1DVIA 1SPYA 2LLUA 1C07A 3I5GC 1LA0A 1A2XA 2KBIA 2Y5IA 4ZCUA 3TDUA 3CZTX 1LVCD 1H4BA 4GGNA 2EGDA 1S5GZ 2JZIA 3HX4A 1NCXA 1D1OA 1C7WA 2HPSA 1S6JA 2JNFA 1B8RA 1XK4C 1ZFSA 3LLEA 1EG4A 1IGVA 1DGUA 1DJHA 1UHIA 3AKAA 4FTGA 5JOLA 2JC2A 5I2LA 2GGZA 2LE9B 3TDZA 1FW4A 3BUXB 5F6TA 2PASA 2VRGA 3D0YB 2LVKA 2ZFDA 1CFDA 4ORAB 2LC5A 2I18A 2H61C 2F3ZA 2JRFA 2CBLA 4PHMA 2GGMA 3NSOA 1XFWO 1QIVA 1ZMZA 2LMVA 2F3YA 2M1UA 4IL1A 1B7TY 1W7IB 1OZSA 4CPVA 4GBAA 1G33A 2SASA 1EXRA 4N5XA 3AKBA 2QACA 3CS1A 2L98A 5DKNA 2JWWA 1TNXA 4HRGA 1SYMA 1XA5A 4A4CA 1LA3A 1ALVA 2KFHA 4CFQA 3C1VA 3VRQA 3EK7A 3DD4A 3QRXA 3DVJA 2L4IA 5CSIA 1FBVA 4WQ2A 1NPQA 4GNKB 4PHKA 1YUUA 2K0JA 5JJGA 3GK1A 1DT7B 1L2OB 1BF5A 1SMGA 4CIDA 2BL0C 1FF1A 1K93D 1TNPA 1CLMA 3EVVA 1J55A 1IJ5A 2PMYA 2FJUB 3EK4A 4N1GA 1ODBA 4MZKA 1F4QA 2ZN8A 4NQGA 1SKTA 4R1EA 1TIZA 1NUBA 1QX5B 2AAOA 1IKUA 2KFFA 5PALA 4AOMA 3BUOB 1MXEA 2KYCA 4I5LB 4PE0A 4OR9B 5I8NA 4U8DA 4E68A 2M0RA 4UPGA 2MBXA 2G9BA 2HETA 1SR6B 4OVNF 1HT9A 2LP2A 1PALA 1FI5A 5AEQA 1WDCB 2LHLA 3BUMB 3FIAA 1SRAA 1RJVA 1DGVA 2FOTA 3PN7B 2DOQA 1UHJA 2JNXA 1RECA 1CDLA 3I5HC 1DJIA 3CWGA 1K9UA 1S6CA 1K9PA 1PVAA 4P5OE 1YRTB 3IQQA 1CDPA 2LANA 3JTDB 1S3PA 1KQMC 1AK8A 1KCYA 1OQPA 2BE6A 1BT6A 3EVUA 1XO5A 2LLSA 1QV1A 1OSAA 2NCOA 2CCMA 3SG5A 1JWDA 2MRDA 2P6BB 3CLNA 1JBAA 1Y1UA 2CNPA 2JPTA 2LVVA 4I5KA 4BY4A 2SCPA 1RK9A 2JQ6A 1M45A 1QTXA 1F4OA 1V1GA 1OE9B 3KO0A 1S5GY 2KI4B 4Q04A 1KWOB 2WORA 1N0YA 1IRJA 2F2PA 3IF7A 2JT8A 3KEVA 3FWBA 2BBNA 2G2BA 2QPTA 3VRRA 1NX3A 4WQ3A 5DKQA 3O2PA 4XJKB 2KAXA 2ISDA 1B9AA 1B1GA 1SL9A 2KQYA 1QATA 2TN4A 1M39A 3TS5C 1BU3A 1GQMA 1SCMC 2I7AA 2M3WA 2ZRSA 3PALA 4I5NB 4YI8A 5AFPA 1DMOA 1DJWA 1PSRA 3E3RA 1DTLA 3LCPC 1CFCA 3TDIA 2JT0A 2JTZA 4USLA 1YRUB 3RM1A 4ZCVA 3SG2A 3LL8B 4AQJA 4PE7A 2Y1MA 2KGRA 4ORCB 1F71A 2KDHA 4QJ3B 1SL7A 1Q80A 3LK0A 1F54A 3BUWB 1CM4A 4PCWA 1TRFA 4A4BA 2OTGB 1AVSA 1DJZA 1TOPA 1TTXA 2KNEA 3GK2A 4ICBA 5J3XA 1KFUS 2BCXA 2M7NA 2LMUA 2COLB 3CR5X 2L5XB 1UURA 5AERA 3CR2A 1FI6A 4GFTA 1M63B 4M2OA 4YI9A 1GGWA 3GK4X 1IJ6A 1YUTA 1KFXL 1QLKA 1CLLA 4MRXA 2K8MB 2E6WA 3A4UB 1SY9A 1JSAA 1BODA 2WOSA 2LV7A 2M29A 1PSBA 2BBMA 4MLWA 2KI6D 1BJFA 4F0ZB 5I2OA 4GAOA 4PE1A 1JUOA 3PATA 4WRIA 1JFJA 5CSFA 1IQ5A 1W7JB 1NIWA 2LCPA 2WCBA 2KBMA 1R6PA 1G4YR 1WRZA 4YGBB 1KSOA 4XJKA 1OMRA 1YX7A 2GV5A 5IBWA 3OX6A 2L50A 1WY9A 4TNCA 4N1FA 1IG5A 1B4CA 1EJ3A 1B8CA 3OHMB 2JXLA 1XFZO 4YGDB 1NX0A 3EVRA 2BL0B 4DUQA 3BXKA 5BPJA 1K2HA 2LAPA 1QLSA 1K94A 1QX2A 3I5FC 3SIBA 5ER4X 1WLZA 1PK0D 4MN0A 2LUCA 3SG3A 1AP4A 3LK1A 1Y1AA 1TCOB 3KPXA 1YUSA 2KGBC 1XK4A 3TUYC 4GGFC 1CMFA 3JVTC 1L2OC 3VGOA 2L2EA 4C0JA 5HLVA 1K90D 4GPLB 1A75A 2K2FA 4MZJA 1RTP1 2RGIA 1PRWA 2HF5A 4DCKA 3FS7A 1H8BA 1HQVA 4JQ0D 1FPWA 3SG6A 1XFVO 3D10A 2IS9A 1RFJA 2K61A 2LNKA 2PALA 2H61A 3OB2B 5HKYA 3MSEB 2CXJA 5I2QA 1WRLA 2L51A 1CB1A 2EHBA 3EKHA 1TN4A 1Y6WA 3DVKA 1MF8B 1Y1XA 1YVLA 4AQIA 1XFYO 2BCAA 4C0KA 1CNPA 2EC6B 1KQVA 4QJ5B 1M31A 2K7DA 1QV0A 1XFXO 2D8NA 2KHNA 1OZOA 1NWDA 1JFKA 1N65A 1S26D 3NSIA 2KAVA 3DF0B 3PM8A 3PSRA 5CSJA 3WNXB 1MHOA 1NYAA 2LUXA 1KK8B 2KFGA 1GGZA 3CTNA 3NSKA 1CKKA 5KU1A 1TNWA 3DVEA 1CLBA 2JULA 3JTDC 1DJXA 2Q91A 1JF2A 3OB1B 1K8UA 1YX8A 2MLEC 3ZNIA 1CDNA 1RWYA 3I5IC 5K89A 1RROA 2PRUA 1SK6D 4PHJA 5ER5A 1X02A 1Y0VH 2WCEA 1QJTA 1J7QA 2M8UA 2BKHB 2JT3A 1CTRA 3CR4X 1BMOA 4HSZA 1CDMA 2OS8B 1EL4A 2K7CA 3O78A 4YGAA 1MXLC 4YRUA 1ZOTB 1A4PA 3I5GB 4MZLA 4MBEA 3AAJA 4P2YB 2M1KB 3KF9A 1LXFC 1TCFA 1UWOA 2JTTA 4M2QA 1AUIB 2ZRTA 1G8IA 2NXQA 5HKWA 3EKJA 1S1EA 1KK7Z 3OX5A 2KQ6A 4ORBB 3GOFA 1IQ3A 2HQWA 3WHUB 4NDDA 3SJSA 1SW8A 5GQQC 2M9GA 2V53A 4HRHA 1A75B 1IWQA 3IQOA 2LLTA 2ZKMX 1OMDA 3BOWA 1S6IA 1JF0A 3PFVA 1K96A 2F2OA 3FWCA 1WRKA 4QJ4B 1CMGA 1BOCA 4MEWA 5AANA 2OTGC 1LINA 2Y1NA 5HKZA 2O60A 4HREE 3DF0A 5KSZA 2ZN9A 1CFPA 1J7OA 4NDBA 2L0PA 1XYDA 2E30A 2M7LA 1BR1B 1DJYA 3OP0A 2NZ0A 4JPZB 1QXPA 2LVJA 1DJGA 3VROA 1NCZA 1CFFA 4OKHA 4OCIA 1QX7A 2A4JA 2I2RE 2LMTA 1GJYA 2MHHA 2LP3A 4ETOA 1OMVA 4PDZA 1J7RA 1L7ZA 1DF0A 5HYDA 4YGCB 1J1DA 1A03A 1KFXS 4YGEB 3I5FB 1AJ4A 2MLFC 4I5JA 1U5IA 4NDCA 1MWNA 2I94A 4PHNA 1AHRA 2K7OA 2OPOA 1QIWA 2MAZA 1S36A 2KI6C 1M46A 1NX1A 4DRWA 1B8LA 2B1UA 2CT9A 3SG4A 1K9KA 3K21A 3TUYB 5HLOA 3RLZA 1UHHA 4MRYA 3PLFB 4GUKA 3WHTB 2JOJA 3HCMA 3JVTB 1XVJA 3VRPA 2BKIB 2WC8A 5D7FA 2KYFA 1A29A 3TZ1A 4DS7A 1C7VA 1NCYA 1UHNA 4XYNA 1NP8A 1PVBA 1YR5A 1B7TZ 1SCVA 2FCDA 3KHEA 3ICBA 3I5HB 1PULA 1BR4B 3BQ3A 3H4SE 2JU0A 4MVFA 4PE4A 1QS7A 2M49B 1E8AA 2Q4UA 3ZWHA 1NSHA 4MSPA 1V1FA 2KAYA 2WCFA 3O6BA 1F55A 1UP5A 1KQMB 1QVIY 3BYAA 4JWQA 3BOWB 4DIRA 1N2DA 2L4HA 2LVIA 1SR6C 2WNDA 1EG3A 1WDCC 1CM1A 3D0YA 4PALA 1ZUZA 4YBHB 2R2IA 2NCPA 1YTZC 1J1EA 3PN7C 5DKRA 2CTNA 4FQOA 5G08A 1LKJA 1UUSA 2PSRA 1SL8A 1YURA 5TNCA 3SG7A 2BE4A 3AAKA 2O5GA 3BUNB 2LM5A 4OV2A 5B8IB 3EK8A 1AJ5A 5D69A 2K2AA 1KK7Y 3DVMA 1BLQA 3SIAA 1B47A 1MQ1A 2EC6C 3F45A 4M2PA 1F8HA 1K95A 1MUXA 1WLMA 2M97A 3I5IB 2F8PA 3O4YA 5AXIA 1QVIZ 2KSPA 1SBJA 3NXAA 3NSLA 1BG1A 3TS5B 1UHKA 4C0LA 1SCMB 2H2KA 1XFUO 1J7PA 2AUCA 4GGFA 1DF0B 1KFUL 1KK8C 2KOTA 2BECA
chains in the Genus database with same CATH superfamily
2QDIA 2KI4C 2Y4QA 5KTYA 1XFRA 1KSMA 1TNQA 1SNLA 3CGAA 1KWOC 2ZNDA 3WXAA 5CSNA 1U5IB 1JC2A 1VRKA 2BCBA 1EH2A 2ZNEA 3CZ1A 3A8RA 1ZACA 2FCEA 2WCHA 4D1EA 4L9MA 1QASA 1MR8A 1YVHA 4OZDA 2NLNA 1NX2A 1F70A 2K7BA 2QEHA 1C3YA 2LHIA 3M0WA 2JXCA 2PVBA 1ALWA 2BAPA 2MJWB 4CLNA 1P28A 4BY5A 1IIOA 2PYQA 4JKTA 5CPVA 5FYXA 1R2UA 2HQ8A 2AMIA 2MA2A 4CFRA 3VRNA 1OOJA 2F33A 2OS8C 1IH0A 1DVIA 1QWVA 1SPYA 2LLUA 1LS8A 3I5GC 1C07A 1LA0A 3S0DA 1A2XA 2KBIA 2Y5IA 4ZCUA 3TDUA 3N7HA 3CZTX 1LVCD 1H4BA 4GGNA 2EGDA 1S5GZ 2JZIA 3HX4A 1NCXA 1D1OA 1C7WA 2L5YA 2HPSA 1S6JA 2JNFA 1B8RA 1XK4C 1ZFSA 3D77A 3LLEA 1EG4A 1IGVA 1DGUA 1DJHA 4PT1A 1UHIA 3AKAA 4FTGA 5JOLA 2JC2A 5I2LA 2GGZA 2LE9B 3TDZA 1FW4A 3BUXB 5F6TA 1SSEB 2PASA 2VRGA 3D0YB 2LVKA 5FI2A 2ZFDA 1CFDA 4ORAB 5I94A 2LC5A 1TWOA 2I18A 2H61C 2F3ZA 2JRFA 2CBLA 4PHMA 3OBVA 2GGMA 3NSOA 1XFWO 1QIVA 1ZMZA 2LMVA 2F3YA 2M1UA 4IL1A 1B7TY 1W7IB 2H8VA 1OZSA 4CPVA 4GBAA 1G33A 2SASA 1KQVA 1EXRA 4N5XA 3AKBA 2QACA 3CS1A 2L98A 5DKNA 2JWWA 1TNXA 4HRGA 1SYMA 1XA5A 4A4CA 1LA3A 1ALVA 2KFHA 4CFQA 3C1VA 3CDNA 3VRQA 3EK7A 3NHTA 3QMEA 3DD4A 3QRXA 3B87A 3DVJA 2L4IA 5CSIA 1FBVA 4WQ2A 1NPQA 4GNKB 4PHKA 1YUUA 2K0JA 5JJGA 3GK1A 1DT7B 1L2OB 1BF5A 1SMGA 4CIDA 3L4LA 2BL0C 1FF1A 1K93D 1TNPA 1CLMA 1OW4A 3EVVA 3Q8IA 1J55A 1IJ5A 2PMYA 2FJUB 3EK4A 4N1GA 1ODBA 3D75A 4MZKA 1F4QA 2ZN8A 4NQGA 1SKTA 3B6XA 4R1EA 1TIZA 1NUBA 1QX5B 1TUJA 4IJ7A 2AAOA 1IKUA 2KFFA 5PALA 4AOMA 2K60A 1MXEA 2KYCA 3BUOB 4I5LB 4PE0A 4OR9B 5I8NA 1ORGA 4U8DA 4E68A 2M0RA 2WCLA 4UPGA 2MBXA 2G9BA 2HETA 5FI6A 1SR6B 2FJYA 1HT9A 2LP2A 1PALA 4OVNF 1FI5A 5EL2A 1WDCB 2LHLA 5AEQA 3BUMB 3FIAA 1SRAA 1RJVA 1DGVA 2FOTA 3PN7B 4INWA 2DOQA 1UHJA 2JNXA 1RECA 1CDLA 2L2CA 3I5HC 3EG5B 1DJIA 3CWGA 1K9UA 1S6CA 1K9PA 1PVAA 4P5OE 1YRTB 3IQQA 1CDPA 2LANA 3JTDB 1S3PA 1KQMC 1AK8A 1KCYA 1OQPA 2BE6A 1BT6A 3EVUA 1XO5A 2LLSA 1QV1A 1OSAA 2NCOA 2CCMA 3SG5A 1JWDA 2MRDA 2P6BB 3CLNA 3L4AA 1JBAA 1Y1UA 2CNPA 2JPTA 2LVVA 4I5KA 4BY4A 2SCPA 1RK9A 2JQ6A 1M45A 1QTXA 3R1VA 3S0AA 1F4OA 1V1GA 1OE9B 3KO0A 1DELA 1S5GY 2KI4B 3UO9A 3D76A 2PQLA 1KWOB 2WORA 1N0YA 1IRJA 2F2PA 3IF7A 4Q04A 2JT8A 1TUZA 3KEVA 3K1EA 3FWBA 2BBNA 2G2BA 2QPTA 3VRRA 1OOHA 1NX3A 4WQ3A 5DKQA 3O2PA 4XJKB 2KAXA 2ISDA 1B9AA 1OOIX 1B1GA 1SL9A 2KQYA 1QATA 2TN4A 1M39A 3TS5C 1BU3A 1GQMA 1SCMC 2I7AA 2M3WA 2ZRSA 3PALA 4I5NB 4YI8A 5AFPA 1DMOA 1DJWA 1PSRA 3E3RA 1DTLA 3LCPC 1CFCA 3TDIA 2JT0A 2JTZA 4USLA 1YRUB 3RM1A 4ZCVA 3SG2A 3LL8B 4AQJA 4PE7A 2Y1MA 2KGRA 4ORCB 3DYEA 1F71A 2KDHA 4QJ3B 1SL7A 1Q80A 3LK0A 1F54A 3BUWB 1CM4A 4PCWA 1TRFA 4A4BA 2OTGB 1AVSA 1DJZA 1TOPA 1TTXA 2KNEA 3GK2A 4ICBA 5J3XA 1KFUS 2BCXA 2M7NA 2ERBA 2LMUA 2COLB 2KPHA 3CR5X 3SS5A 2L5XB 3R1PA 1UURA 5AERA 3CR2A 1FI6A 4GFTA 1M63B 4M2OA 4YI9A 1GGWA 3D74A 3GK4X 1IJ6A 1YUTA 5HL1A 3B88A 1KFXL 3CYZA 1QLKA 1CLLA 4MRXA 2K8MB 2E6WA 3A4UB 1SY9A 1JSAA 1BODA 2WOSA 2LV7A 2M29A 2WC6A 1PSBA 2BBMA 2KLDA 4MLWA 2KI6D 1BJFA 4F0ZB 5I2OA 4GAOA 4PE1A 1JUOA 3PATA 4WRIA 3S0BA 2JPOA 1JFJA 5CSFA 1IQ5A 1W7JB 1NIWA 1GM0A 2LCPA 2WCBA 3FE8A 5DICA 2KBMA 1R6PA 1G4YR 1WRZA 4YGBB 1KSOA 4XJKA 1OMRA 1YX7A 2GV5A 3S0GA 5IBWA 3OX6A 2L50A 1WY9A 4TNCA 4N1FA 1IG5A 1B4CA 1EJ3A 1B8CA 3OHMB 3PJIA 1Z4HA 2JXLA 1XFZO 4YGDB 1NX0A 3EVRA 2BL0B 4DUQA 3BXKA 3FE6A 5BPJA 1K2HA 2LAPA 1QLSA 1K94A 1QX2A 3I5FC 3SIBA 5ER4X 2GTEA 1WLZA 1PK0D 4MN0A 2LUCA 3SG3A 1AP4A 3LK1A 1Y1AA 1TCOB 3KPXA 1YUSA 2KGBC 1XK4A 3TUYC 4GGFC 1CMFA 3V2LA 2WCJA 3BJHA 3JVTC 1L2OC 3VGOA 2L2EA 4C0JA 5HLVA 1K90D 4GPLB 1A75A 2K2FA 4MZJA 3B86A 3RZSA 1RTP1 2RGIA 1PRWA 2HF5A 5FI7A 4DCKA 3FS7A 1H8BA 1HQVA 4JQ0D 1FPWA 3SG6A 1XFVO 3D10A 2IS9A 3D73A 1RFJA 2K61A 2LNKA 2PALA 2H61A 3OB2B 5HKYA 3MSEB 2CXJA 5I2QA 1WRLA 2L51A 1CB1A 2EHBA 3EKHA 5D3OA 4F7FA 1TN4A 1Y6WA 3DVKA 1OOFA 1MF8B 3B7AA 1YVLA 1Y1XA 4AQIA 1XFYO 2BCAA 3BFHA 4C0KA 2EC6B 1CNPA 4QJ5B 1M31A 3S0EA 3SS4A 3SS3A 2K7DA 1QV0A 1XFXO 2D8NA 2KHNA 1OZOA 3PM2A 1NWDA 1JFKA 1N65A 1S26D 3NSIA 2KAVA 3DF0B 3PM8A 3PSRA 5CSJA 3WNXB 1MHOA 1NYAA 2LUXA 1KK8B 1W9ZA 2KFGA 1GGZA 3CTNA 3NSKA 1CKKA 5KU1A 1TNWA 3DVEA 1CLBA 2JULA 3JTDC 1DJXA 2Q91A 1JF2A 3OB1B 1K8UA 1YX8A 2MLEC 3DZTA 3R72A 3ZNIA 1CDNA 1RWYA 3I5IC 5K89A 1RROA 2PRUA 1SK6D 2QEBA 4PHJA 5ER5A 1X02A 1Y0VH 2WCEA 1QJTA 3BFBA 1J7QA 2M8UA 2BKHB 2JT3A 1CTRA 3CR4X 3L47A 2KLEA 2YGUA 1BMOA 4HSZA 1CDMA 2OS8B 1EL4A 2K7CA 3O78A 4YGAA 1MXLC 4YRUA 1ZOTB 1A4PA 3I5GB 4MZLA 4JD9A 4MBEA 3AAJA 4P2YB 2M1KB 3KF9A 1LXFC 1TCFA 1UWOA 2JTTA 4M2QA 1AUIB 2ZRTA 1G8IA 2NXQA 5HKWA 3EKJA 1S1EA 1KK7Z 3OX5A 2KQ6A 4ORBB 3GOFA 1IQ3A 1Z2CB 2HQWA 3WHUB 4NDDA 3SJSA 1SW8A 5GQQC 2M9GA 2V53A 4HRHA 1A75B 1IWQA 3CZ0A 3IQOA 2LLTA 2ZKMX 1OMDA 3BOWA 3NHIA 1S6IA 1JF0A 3PFVA 1K96A 2F2OA 3BFAA 1WRKA 3FWCA 4QJ4B 1CMGA 1BOCA 4MEWA 5AANA 3OGNA 2OTGC 1LINA 2P71A 2Y1NA 5HKZA 2O60A 4HREE 3DF0A 1DQEA 5KSZA 2ZN9A 3S0FA 1CFPA 1J7OA 4NDBA 2BNXA 2L0PA 1XYDA 2E30A 1C3ZA 2M7LA 1BR1B 1DJYA 3R1OA 3OP0A 2NZ0A 4JPZB 1QXPA 2LVJA 1DJGA 3VROA 2QEOA 4FQTA 1NCZA 1CFFA 4OKHA 4OCIA 1QX7A 2A4JA 2I2RE 2LMTA 1GJYA 2MHHA 3UNWA 2LP3A 4ETOA 1OMVA 4PDZA 1J7RA 1L7ZA 1DF0A 3O4XA 5HYDA 1OOGA 4YGCB 1J1DA 1A03A 1KFXS 4YGEB 1DEKA 3I5FB 1AJ4A 2MLFC 4I5JA 1U5IA 4NDCA 1MWNA 2I94A 4PHNA 3CABA 1AHRA 2K7OA 2OPOA 1QIWA 2MAZA 1S36A 2KI6C 1M46A 1NX1A 4DRWA 1B8LA 2B1UA 2CT9A 3SG4A 1K9KA 3K21A 3TUYB 5HLOA 3RLZA 1UHHA 4MRYA 3PLFB 4GUKA 3WHTB 2JOJA 3HCMA 3JVTB 1XVJA 3VRPA 3IVTA 2BKIB 2WC8A 5D7FA 2KYFA 1A29A 3TZ1A 4DS7A 1C7VA 1NCYA 1UHNA 2WCMA 4XYNA 1NP8A 2WCKA 4INXA 1PVBA 1YR5A 1B7TZ 1SCVA 2FCDA 3KHEA 3ICBA 3I5HB 1PULA 1BR4B 3BQ3A 3H4SE 2JU0A 4MVFA 2QEVA 4PE4A 1QS7A 2M49B 1E8AA 2Q4UA 4KYNA 3D78A 3ZWHA 1NSHA 4MSPA 1V1FA 2KAYA 3VB1A 2WCFA 3O6BA 1F55A 1UP5A 1KQMB 1QVIY 3BYAA 4JWQA 3BOWB 4DIRA 1N2DA 2L4HA 2LVIA 1SR6C 2WNDA 1EG3A 1WDCC 1CM1A 1T14A 3D0YA 4PALA 1ZUZA 4YBHB 2R2IA 2NCPA 1YTZC 1J1EA 3PN7C 5DKRA 2CTNA 3FE9A 4FQOA 5G08A 1LKJA 1DC1A 1UUSA 2PSRA 3NGVA 1SL8A 1YURA 3DY9A 3CZ2A 5TNCA 3SG7A 2BE4A 3AAKA 2O5GA 3DXLA 3BUNB 2LM5A 4OV2A 5B8IB 3EK8A 1AJ5A 5D69A 2K2AA 1KK7Y 3DVMA 1BLQA 3SIAA 2P70A 1B47A 1MQ1A 2EC6C 3F45A 4M2PA 1F8HA 1K95A 1MUXA 1WLMA 2M97A 3I5IB 2F8PA 3O4YA 5AXIA 1QVIZ 2KSPA 1SBJA 2WC5A 3NSLA 3NXAA 1BG1A 3TS5B 1UHKA 4C0LA 1SCMB 2H2KA 1XFUO 1J7PA 2AUCA 4GGFA 1DF0B 1KFUL 1KK8C 2KOTA 2BECA
chains in the Genus database with same CATH topology
2KI4C 2Y4QA 5KTYA 1KSMA 1TNQA 1SNLA 3CGAA 1KWOC 2ZNDA 3WXAA 5CSNA 1U5IB 1JC2A 1VRKA 2BCBA 1EH2A 2ZNEA 4D1EA 3A8RA 1ZACA 2FCEA 4L9MA 1QASA 1MR8A 1YVHA 2NLNA 1NX2A 1F70A 2K7BA 2LHIA 3M0WA 2JXCA 2PVBA 1ALWA 2MJWB 4CLNA 4BY5A 5CPVA 5FYXA 1R2UA 2HQ8A 2AMIA 2MA2A 4CFRA 3VRNA 1OOJA 2F33A 2OS8C 1IH0A 1DVIA 1SPYA 2LLUA 1C07A 3I5GC 1LA0A 1A2XA 2KBIA 2Y5IA 4ZCUA 3TDUA 3CZTX 1LVCD 1H4BA 4GGNA 2EGDA 1S5GZ 2JZIA 3HX4A 1NCXA 1D1OA 1C7WA 2HPSA 1S6JA 2JNFA 1B8RA 1XK4C 1ZFSA 3LLEA 1EG4A 1IGVA 1DGUA 1DJHA 1UHIA 3AKAA 4FTGA 5JOLA 2JC2A 5I2LA 2GGZA 2LE9B 3TDZA 1FW4A 3BUXB 5F6TA 2PASA 2VRGA 3D0YB 2LVKA 2ZFDA 1CFDA 4ORAB 2LC5A 2I18A 2H61C 2F3ZA 2JRFA 2CBLA 4PHMA 2GGMA 3NSOA 1XFWO 1QIVA 1ZMZA 2LMVA 2F3YA 2M1UA 4IL1A 1B7TY 1W7IB 1OZSA 4CPVA 4GBAA 1G33A 2SASA 1EXRA 4N5XA 3AKBA 2QACA 3CS1A 2L98A 5DKNA 2JWWA 1TNXA 4HRGA 1SYMA 1XA5A 4A4CA 1LA3A 1ALVA 2KFHA 4CFQA 3C1VA 3VRQA 3EK7A 3DD4A 3QRXA 3DVJA 2L4IA 5CSIA 1FBVA 4WQ2A 1NPQA 4GNKB 4PHKA 1YUUA 2K0JA 5JJGA 3GK1A 1DT7B 1L2OB 1BF5A 1SMGA 4CIDA 2BL0C 1FF1A 1K93D 1TNPA 1CLMA 3EVVA 1J55A 1IJ5A 2PMYA 2FJUB 3EK4A 4N1GA 1ODBA 4MZKA 1F4QA 2ZN8A 4NQGA 1SKTA 4R1EA 1TIZA 1NUBA 1QX5B 2AAOA 1IKUA 2KFFA 5PALA 4AOMA 3BUOB 1MXEA 2KYCA 4I5LB 4PE0A 4OR9B 5I8NA 4U8DA 4E68A 2M0RA 4UPGA 2MBXA 2G9BA 2HETA 1SR6B 4OVNF 1HT9A 2LP2A 1PALA 1FI5A 5AEQA 1WDCB 2LHLA 3BUMB 3FIAA 1SRAA 1RJVA 1DGVA 2FOTA 3PN7B 2DOQA 1UHJA 2JNXA 1RECA 1CDLA 3I5HC 1DJIA 3CWGA 1K9UA 1S6CA 1K9PA 1PVAA 4P5OE 1YRTB 3IQQA 1CDPA 2LANA 3JTDB 1S3PA 1KQMC 1AK8A 1KCYA 1OQPA 2BE6A 1BT6A 3EVUA 1XO5A 2LLSA 1QV1A 1OSAA 2NCOA 2CCMA 3SG5A 1JWDA 2MRDA 2P6BB 3CLNA 1JBAA 1Y1UA 2CNPA 2JPTA 2LVVA 4I5KA 4BY4A 2SCPA 1RK9A 2JQ6A 1M45A 1QTXA 1F4OA 1V1GA 1OE9B 3KO0A 1S5GY 2KI4B 4Q04A 1KWOB 2WORA 1N0YA 1IRJA 2F2PA 3IF7A 2JT8A 3KEVA 3FWBA 2BBNA 2G2BA 2QPTA 3VRRA 1NX3A 4WQ3A 5DKQA 3O2PA 4XJKB 2KAXA 2ISDA 1B9AA 1B1GA 1SL9A 2KQYA 1QATA 2TN4A 1M39A 3TS5C 1BU3A 1GQMA 1SCMC 2I7AA 2M3WA 2ZRSA 3PALA 4I5NB 4YI8A 5AFPA 1DMOA 1DJWA 1PSRA 3E3RA 1DTLA 3LCPC 1CFCA 3TDIA 2JT0A 2JTZA 4USLA 1YRUB 3RM1A 4ZCVA 3SG2A 3LL8B 4AQJA 4PE7A 2Y1MA 2KGRA 4ORCB 1F71A 2KDHA 4QJ3B 1SL7A 1Q80A 3LK0A 1F54A 3BUWB 1CM4A 4PCWA 1TRFA 4A4BA 2OTGB 1AVSA 1DJZA 1TOPA 1TTXA 2KNEA 3GK2A 4ICBA 5J3XA 1KFUS 2BCXA 2M7NA 2LMUA 2COLB 3CR5X 2L5XB 1UURA 5AERA 3CR2A 1FI6A 4GFTA 1M63B 4M2OA 4YI9A 1GGWA 3GK4X 1IJ6A 1YUTA 1KFXL 1QLKA 1CLLA 4MRXA 2K8MB 2E6WA 3A4UB 1SY9A 1JSAA 1BODA 2WOSA 2LV7A 2M29A 1PSBA 2BBMA 4MLWA 2KI6D 1BJFA 4F0ZB 5I2OA 4GAOA 4PE1A 1JUOA 3PATA 4WRIA 1JFJA 5CSFA 1IQ5A 1W7JB 1NIWA 2LCPA 2WCBA 2KBMA 1R6PA 1G4YR 1WRZA 4YGBB 1KSOA 4XJKA 1OMRA 1YX7A 2GV5A 5IBWA 3OX6A 2L50A 1WY9A 4TNCA 4N1FA 1IG5A 1B4CA 1EJ3A 1B8CA 3OHMB 2JXLA 1XFZO 4YGDB 1NX0A 3EVRA 2BL0B 4DUQA 3BXKA 5BPJA 1K2HA 2LAPA 1QLSA 1K94A 1QX2A 3I5FC 3SIBA 5ER4X 1WLZA 1PK0D 4MN0A 2LUCA 3SG3A 1AP4A 3LK1A 1Y1AA 1TCOB 3KPXA 1YUSA 2KGBC 1XK4A 3TUYC 4GGFC 1CMFA 3JVTC 1L2OC 3VGOA 2L2EA 4C0JA 5HLVA 1K90D 4GPLB 1A75A 2K2FA 4MZJA 1RTP1 2RGIA 1PRWA 2HF5A 4DCKA 3FS7A 1H8BA 1HQVA 4JQ0D 1FPWA 3SG6A 1XFVO 3D10A 2IS9A 1RFJA 2K61A 2LNKA 2PALA 2H61A 3OB2B 5HKYA 3MSEB 2CXJA 5I2QA 1WRLA 2L51A 1CB1A 2EHBA 3EKHA 1TN4A 1Y6WA 3DVKA 1MF8B 1Y1XA 1YVLA 4AQIA 1XFYO 2BCAA 4C0KA 1CNPA 2EC6B 1KQVA 4QJ5B 1M31A 2K7DA 1QV0A 1XFXO 2D8NA 2KHNA 1OZOA 1NWDA 1JFKA 1N65A 1S26D 3NSIA 2KAVA 3DF0B 3PM8A 3PSRA 5CSJA 3WNXB 1MHOA 1NYAA 2LUXA 1KK8B 2KFGA 1GGZA 3CTNA 3NSKA 1CKKA 5KU1A 1TNWA 3DVEA 1CLBA 2JULA 3JTDC 1DJXA 2Q91A 1JF2A 3OB1B 1K8UA 1YX8A 2MLEC 3ZNIA 1CDNA 1RWYA 3I5IC 5K89A 1RROA 2PRUA 1SK6D 4PHJA 5ER5A 1X02A 1Y0VH 2WCEA 1QJTA 1J7QA 2M8UA 2BKHB 2JT3A 1CTRA 3CR4X 1BMOA 4HSZA 1CDMA 2OS8B 1EL4A 2K7CA 3O78A 4YGAA 1MXLC 4YRUA 1ZOTB 1A4PA 3I5GB 4MZLA 4MBEA 3AAJA 4P2YB 2M1KB 3KF9A 1LXFC 1TCFA 1UWOA 2JTTA 4M2QA 1AUIB 2ZRTA 1G8IA 2NXQA 5HKWA 3EKJA 1S1EA 1KK7Z 3OX5A 2KQ6A 4ORBB 3GOFA 1IQ3A 2HQWA 3WHUB 4NDDA 3SJSA 1SW8A 5GQQC 2M9GA 2V53A 4HRHA 1A75B 1IWQA 3IQOA 2LLTA 2ZKMX 1OMDA 3BOWA 1S6IA 1JF0A 3PFVA 1K96A 2F2OA 3FWCA 1WRKA 4QJ4B 1CMGA 1BOCA 4MEWA 5AANA 2OTGC 1LINA 2Y1NA 5HKZA 2O60A 4HREE 3DF0A 5KSZA 2ZN9A 1CFPA 1J7OA 4NDBA 2L0PA 1XYDA 2E30A 2M7LA 1BR1B 1DJYA 3OP0A 2NZ0A 4JPZB 1QXPA 2LVJA 1DJGA 3VROA 1NCZA 1CFFA 4OKHA 4OCIA 1QX7A 2A4JA 2I2RE 2LMTA 1GJYA 2MHHA 2LP3A 4ETOA 1OMVA 4PDZA 1J7RA 1L7ZA 1DF0A 5HYDA 4YGCB 1J1DA 1A03A 1KFXS 4YGEB 3I5FB 1AJ4A 2MLFC 4I5JA 1U5IA 4NDCA 1MWNA 2I94A 4PHNA 1AHRA 2K7OA 2OPOA 1QIWA 2MAZA 1S36A 2KI6C 1M46A 1NX1A 4DRWA 1B8LA 2B1UA 2CT9A 3SG4A 1K9KA 3K21A 3TUYB 5HLOA 3RLZA 1UHHA 4MRYA 3PLFB 4GUKA 3WHTB 2JOJA 3HCMA 3JVTB 1XVJA 3VRPA 2BKIB 2WC8A 5D7FA 2KYFA 1A29A 3TZ1A 4DS7A 1C7VA 1NCYA 1UHNA 4XYNA 1NP8A 1PVBA 1YR5A 1B7TZ 1SCVA 2FCDA 3KHEA 3ICBA 3I5HB 1PULA 1BR4B 3BQ3A 3H4SE 2JU0A 4MVFA 4PE4A 1QS7A 2M49B 1E8AA 2Q4UA 3ZWHA 1NSHA 4MSPA 1V1FA 2KAYA 2WCFA 3O6BA 1F55A 1UP5A 1KQMB 1QVIY 3BYAA 4JWQA 3BOWB 4DIRA 1N2DA 2L4HA 2LVIA 1SR6C 2WNDA 1EG3A 1WDCC 1CM1A 3D0YA 4PALA 1ZUZA 4YBHB 2R2IA 2NCPA 1YTZC 1J1EA 3PN7C 5DKRA 2CTNA 4FQOA 5G08A 1LKJA 1UUSA 2PSRA 1SL8A 1YURA 5TNCA 3SG7A 2BE4A 3AAKA 2O5GA 3BUNB 2LM5A 4OV2A 5B8IB 3EK8A 1AJ5A 5D69A 2K2AA 1KK7Y 3DVMA 1BLQA 3SIAA 1B47A 1MQ1A 2EC6C 3F45A 4M2PA 1F8HA 1K95A 1MUXA 1WLMA 2M97A 3I5IB 2F8PA 3O4YA 5AXIA 1QVIZ 2KSPA 1SBJA 3NXAA 3NSLA 1BG1A 3TS5B 1UHKA 4C0LA 1SCMB 2H2KA 1XFUO 1J7PA 2AUCA 4GGFA 1DF0B 1KFUL 1KK8C 2KOTA 2BECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI4 C;  2Y4Q A;  5KTY A;  1KSM A;  1TNQ A;  1SNL A;  3CGA A;  1KWO C;  2ZND A;  3WXA A;  5CSN A;  1U5I B;  1JC2 A;  1VRK A;  2BCB A;  1EH2 A;  2ZNE A;  4D1E A;  3A8R A;  1ZAC A;  2FCE A;  4L9M A;  1QAS A;  1MR8 A;  1YVH A;  2NLN A;  1NX2 A;  1F70 A;  2K7B A;  2LHI A;  3M0W A;  2JXC A;  2PVB A;  1ALW A;  2MJW B;  4CLN A;  4BY5 A;  5CPV A;  5FYX A;  1R2U A;  2HQ8 A;  2AMI A;  2MA2 A;  4CFR A;  3VRN A;  1OOJ A;  2F33 A;  2OS8 C;  1IH0 A;  1DVI A;  1SPY A;  2LLU A;  1C07 A;  3I5G C;  1LA0 A;  1A2X A;  2KBI A;  2Y5I A;  4ZCU A;  3TDU A;  3CZT X;  1LVC D;  1H4B A;  4GGN A;  2EGD A;  1S5G Z;  2JZI A;  3HX4 A;  1NCX A;  1D1O A;  1C7W A;  2HPS A;  1S6J A;  2JNF A;  1B8R A;  1XK4 C;  1ZFS A;  3LLE A;  1EG4 A;  1IGV A;  1DGU A;  1DJH A;  1UHI A;  3AKA A;  4FTG A;  5JOL A;  2JC2 A;  5I2L A;  2GGZ A;  2LE9 B;  3TDZ A;  1FW4 A;  3BUX B;  5F6T A;  2PAS A;  2VRG A;  3D0Y B;  2LVK A;  2ZFD A;  1CFD A;  4ORA B;  2LC5 A;  2I18 A;  2H61 C;  2F3Z A;  2JRF A;  2CBL A;  4PHM A;  2GGM A;  3NSO A;  1XFW O;  1QIV A;  1ZMZ A;  2LMV A;  2F3Y A;  2M1U A;  4IL1 A;  1B7T Y;  1W7I B;  1OZS A;  4CPV A;  4GBA A;  1G33 A;  2SAS A;  1EXR A;  4N5X A;  3AKB A;  2QAC A;  3CS1 A;  2L98 A;  5DKN A;  2JWW A;  1TNX A;  4HRG A;  1SYM A;  1XA5 A;  4A4C A;  1LA3 A;  1ALV A;  2KFH A;  4CFQ A;  3C1V A;  3VRQ A;  3EK7 A;  3DD4 A;  3QRX A;  3DVJ A;  2L4I A;  5CSI A;  1FBV A;  4WQ2 A;  1NPQ A;  4GNK B;  4PHK A;  1YUU A;  2K0J A;  5JJG A;  3GK1 A;  1DT7 B;  1L2O B;  1BF5 A;  1SMG A;  4CID A;  2BL0 C;  1FF1 A;  1K93 D;  1TNP A;  1CLM A;  3EVV A;  1J55 A;  1IJ5 A;  2PMY A;  2FJU B;  3EK4 A;  4N1G A;  1ODB A;  4MZK A;  1F4Q A;  2ZN8 A;  4NQG A;  1SKT A;  4R1E A;  1TIZ A;  1NUB A;  1QX5 B;  2AAO A;  1IKU A;  2KFF A;  5PAL A;  4AOM A;  3BUO B;  1MXE A;  2KYC A;  4I5L B;  4PE0 A;  4OR9 B;  5I8N A;  4U8D A;  4E68 A;  2M0R A;  4UPG A;  2MBX A;  2G9B A;  2HET A;  1SR6 B;  4OVN F;  1HT9 A;  2LP2 A;  1PAL A;  1FI5 A;  5AEQ A;  1WDC B;  2LHL A;  3BUM B;  3FIA A;  1SRA A;  1RJV A;  1DGV A;  2FOT A;  3PN7 B;  2DOQ A;  1UHJ A;  2JNX A;  1REC A;  1CDL A;  3I5H C;  1DJI A;  3CWG A;  1K9U A;  1S6C A;  1K9P A;  1PVA A;  4P5O E;  1YRT B;  3IQQ A;  1CDP A;  2LAN A;  3JTD B;  1S3P A;  1KQM C;  1AK8 A;  1KCY A;  1OQP A;  2BE6 A;  1BT6 A;  3EVU A;  1XO5 A;  2LLS A;  1QV1 A;  1OSA A;  2NCO A;  2CCM A;  3SG5 A;  1JWD A;  2MRD A;  2P6B B;  3CLN A;  1JBA A;  1Y1U A;  2CNP A;  2JPT A;  2LVV A;  4I5K A;  4BY4 A;  2SCP A;  1RK9 A;  2JQ6 A;  1M45 A;  1QTX A;  1F4O A;  1V1G A;  1OE9 B;  3KO0 A;  1S5G Y;  2KI4 B;  4Q04 A;  1KWO B;  2WOR A;  1N0Y A;  1IRJ A;  2F2P A;  3IF7 A;  2JT8 A;  3KEV A;  3FWB A;  2BBN A;  2G2B A;  2QPT A;  3VRR A;  1NX3 A;  4WQ3 A;  5DKQ A;  3O2P A;  4XJK B;  2KAX A;  2ISD A;  1B9A A;  1B1G A;  1SL9 A;  2KQY A;  1QAT A;  2TN4 A;  1M39 A;  3TS5 C;  1BU3 A;  1GQM A;  1SCM C;  2I7A A;  2M3W A;  2ZRS A;  3PAL A;  4I5N B;  4YI8 A;  5AFP A;  1DMO A;  1DJW A;  1PSR A;  3E3R A;  1DTL A;  3LCP C;  1CFC A;  3TDI A;  2JT0 A;  2JTZ A;  4USL A;  1YRU B;  3RM1 A;  4ZCV A;  3SG2 A;  3LL8 B;  4AQJ A;  4PE7 A;  2Y1M A;  2KGR A;  4ORC B;  1F71 A;  2KDH A;  4QJ3 B;  1SL7 A;  1Q80 A;  3LK0 A;  1F54 A;  3BUW B;  1CM4 A;  4PCW A;  1TRF A;  4A4B A;  2OTG B;  1AVS A;  1DJZ A;  1TOP A;  1TTX A;  2KNE A;  3GK2 A;  4ICB A;  5J3X A;  1KFU S;  2BCX A;  2M7N A;  2LMU A;  2COL B;  3CR5 X;  2L5X B;  1UUR A;  5AER A;  3CR2 A;  1FI6 A;  4GFT A;  1M63 B;  4M2O A;  4YI9 A;  1GGW A;  3GK4 X;  1IJ6 A;  1YUT A;  1KFX L;  1QLK A;  1CLL A;  4MRX A;  2K8M B;  2E6W A;  3A4U B;  1SY9 A;  1JSA A;  1BOD A;  2WOS A;  2LV7 A;  2M29 A;  1PSB A;  2BBM A;  4MLW A;  2KI6 D;  1BJF A;  4F0Z B;  5I2O A;  4GAO A;  4PE1 A;  1JUO A;  3PAT A;  4WRI A;  1JFJ A;  5CSF A;  1IQ5 A;  1W7J B;  1NIW A;  2LCP A;  2WCB A;  2KBM A;  1R6P A;  1G4Y R;  1WRZ A;  4YGB B;  1KSO A;  4XJK A;  1OMR A;  1YX7 A;  2GV5 A;  5IBW A;  3OX6 A;  2L50 A;  1WY9 A;  4TNC A;  4N1F A;  1IG5 A;  1B4C A;  1EJ3 A;  1B8C A;  3OHM B;  2JXL A;  1XFZ O;  4YGD B;  1NX0 A;  3EVR A;  2BL0 B;  4DUQ A;  3BXK A;  5BPJ A;  1K2H A;  2LAP A;  1QLS A;  1K94 A;  1QX2 A;  3I5F C;  3SIB A;  5ER4 X;  1WLZ A;  1PK0 D;  4MN0 A;  2LUC A;  3SG3 A;  1AP4 A;  3LK1 A;  1Y1A A;  1TCO B;  3KPX A;  1YUS A;  2KGB C;  1XK4 A;  3TUY C;  4GGF C;  1CMF A;  3JVT C;  1L2O C;  3VGO A;  2L2E A;  4C0J A;  5HLV A;  1K90 D;  4GPL B;  1A75 A;  2K2F A;  4MZJ A;  1RTP 1;  2RGI A;  1PRW A;  2HF5 A;  4DCK A;  3FS7 A;  1H8B A;  1HQV A;  4JQ0 D;  1FPW A;  3SG6 A;  1XFV O;  3D10 A;  2IS9 A;  1RFJ A;  2K61 A;  2LNK A;  2PAL A;  2H61 A;  3OB2 B;  5HKY A;  3MSE B;  2CXJ A;  5I2Q A;  1WRL A;  2L51 A;  1CB1 A;  2EHB A;  3EKH A;  1TN4 A;  1Y6W A;  3DVK A;  1MF8 B;  1Y1X A;  1YVL A;  4AQI A;  1XFY O;  2BCA A;  4C0K A;  1CNP A;  2EC6 B;  1KQV A;  4QJ5 B;  1M31 A;  2K7D A;  1QV0 A;  1XFX O;  2D8N A;  2KHN A;  1OZO A;  1NWD A;  1JFK A;  1N65 A;  1S26 D;  3NSI A;  2KAV A;  3DF0 B;  3PM8 A;  3PSR A;  5CSJ A;  3WNX B;  1MHO A;  1NYA A;  2LUX A;  1KK8 B;  2KFG A;  1GGZ A;  3CTN A;  3NSK A;  1CKK A;  5KU1 A;  1TNW A;  3DVE A;  1CLB A;  2JUL A;  3JTD C;  1DJX A;  2Q91 A;  1JF2 A;  3OB1 B;  1K8U A;  1YX8 A;  2MLE C;  3ZNI A;  1CDN A;  1RWY A;  3I5I C;  5K89 A;  1RRO A;  2PRU A;  1SK6 D;  4PHJ A;  5ER5 A;  1X02 A;  1Y0V H;  2WCE A;  1QJT A;  1J7Q A;  2M8U A;  2BKH B;  2JT3 A;  1CTR A;  3CR4 X;  1BMO A;  4HSZ A;  1CDM A;  2OS8 B;  1EL4 A;  2K7C A;  3O78 A;  4YGA A;  1MXL C;  4YRU A;  1ZOT B;  1A4P A;  3I5G B;  4MZL A;  4MBE A;  3AAJ A;  4P2Y B;  2M1K B;  3KF9 A;  1LXF C;  1TCF A;  1UWO A;  2JTT A;  4M2Q A;  1AUI B;  2ZRT A;  1G8I A;  2NXQ A;  5HKW A;  3EKJ A;  1S1E A;  1KK7 Z;  3OX5 A;  2KQ6 A;  4ORB B;  3GOF A;  1IQ3 A;  2HQW A;  3WHU B;  4NDD A;  3SJS A;  1SW8 A;  5GQQ C;  2M9G A;  2V53 A;  4HRH A;  1A75 B;  1IWQ A;  3IQO A;  2LLT A;  2ZKM X;  1OMD A;  3BOW A;  1S6I A;  1JF0 A;  3PFV A;  1K96 A;  2F2O A;  3FWC A;  1WRK A;  4QJ4 B;  1CMG A;  1BOC A;  4MEW A;  5AAN A;  2OTG C;  1LIN A;  2Y1N A;  5HKZ A;  2O60 A;  4HRE E;  3DF0 A;  5KSZ A;  2ZN9 A;  1CFP A;  1J7O A;  4NDB A;  2L0P A;  1XYD A;  2E30 A;  2M7L A;  1BR1 B;  1DJY A;  3OP0 A;  2NZ0 A;  4JPZ B;  1QXP A;  2LVJ A;  1DJG A;  3VRO A;  1NCZ A;  1CFF A;  4OKH A;  4OCI A;  1QX7 A;  2A4J A;  2I2R E;  2LMT A;  1GJY A;  2MHH A;  2LP3 A;  4ETO A;  1OMV A;  4PDZ A;  1J7R A;  1L7Z A;  1DF0 A;  5HYD A;  4YGC B;  1J1D A;  1A03 A;  1KFX S;  4YGE B;  3I5F B;  1AJ4 A;  2MLF C;  4I5J A;  1U5I A;  4NDC A;  1MWN A;  2I94 A;  4PHN A;  1AHR A;  2K7O A;  2OPO A;  1QIW A;  2MAZ A;  1S36 A;  2KI6 C;  1M46 A;  1NX1 A;  4DRW A;  1B8L A;  2B1U A;  2CT9 A;  3SG4 A;  1K9K A;  3K21 A;  3TUY B;  5HLO A;  3RLZ A;  1UHH A;  4MRY A;  3PLF B;  4GUK A;  3WHT B;  2JOJ A;  3HCM A;  3JVT B;  1XVJ A;  3VRP A;  2BKI B;  2WC8 A;  5D7F A;  2KYF A;  1A29 A;  3TZ1 A;  4DS7 A;  1C7V A;  1NCY A;  1UHN A;  4XYN A;  1NP8 A;  1PVB A;  1YR5 A;  1B7T Z;  1SCV A;  2FCD A;  3KHE A;  3ICB A;  3I5H B;  1PUL A;  1BR4 B;  3BQ3 A;  3H4S E;  2JU0 A;  4MVF A;  4PE4 A;  1QS7 A;  2M49 B;  1E8A A;  2Q4U A;  3ZWH A;  1NSH A;  4MSP A;  1V1F A;  2KAY A;  2WCF A;  3O6B A;  1F55 A;  1UP5 A;  1KQM B;  1QVI Y;  3BYA A;  4JWQ A;  3BOW B;  4DIR A;  1N2D A;  2L4H A;  2LVI A;  1SR6 C;  2WND A;  1EG3 A;  1WDC C;  1CM1 A;  3D0Y A;  4PAL A;  1ZUZ A;  4YBH B;  2R2I A;  2NCP A;  1YTZ C;  1J1E A;  3PN7 C;  5DKR A;  2CTN A;  4FQO A;  5G08 A;  1LKJ A;  1UUS A;  2PSR A;  1SL8 A;  1YUR A;  5TNC A;  3SG7 A;  2BE4 A;  3AAK A;  2O5G A;  3BUN B;  2LM5 A;  4OV2 A;  5B8I B;  3EK8 A;  1AJ5 A;  5D69 A;  2K2A A;  1KK7 Y;  3DVM A;  1BLQ A;  3SIA A;  1B47 A;  1MQ1 A;  2EC6 C;  3F45 A;  4M2P A;  1F8H A;  1K95 A;  1MUX A;  1WLM A;  2M97 A;  3I5I B;  2F8P A;  3O4Y A;  5AXI A;  1QVI Z;  2KSP A;  1SBJ A;  3NXA A;  3NSL A;  1BG1 A;  3TS5 B;  1UHK A;  4C0L A;  1SCM B;  2H2K A;  1XFU O;  1J7P A;  2AUC A;  4GGF A;  1DF0 B;  1KFU L;  1KK8 C;  2KOT A;  2BEC A; 
#chains in the Genus database with same CATH topology
 2QDI A;  2KI4 C;  2Y4Q A;  5KTY A;  1XFR A;  1KSM A;  1TNQ A;  1SNL A;  3CGA A;  1KWO C;  2ZND A;  3WXA A;  5CSN A;  1U5I B;  1JC2 A;  1VRK A;  2BCB A;  1EH2 A;  2ZNE A;  3CZ1 A;  3A8R A;  1ZAC A;  2FCE A;  2WCH A;  4D1E A;  4L9M A;  1QAS A;  1MR8 A;  1YVH A;  4OZD A;  2NLN A;  1NX2 A;  1F70 A;  2K7B A;  2QEH A;  1C3Y A;  2LHI A;  3M0W A;  2JXC A;  2PVB A;  1ALW A;  2BAP A;  2MJW B;  4CLN A;  1P28 A;  4BY5 A;  1IIO A;  2PYQ A;  4JKT A;  5CPV A;  5FYX A;  1R2U A;  2HQ8 A;  2AMI A;  2MA2 A;  4CFR A;  3VRN A;  1OOJ A;  2F33 A;  2OS8 C;  1IH0 A;  1DVI A;  1QWV A;  1SPY A;  2LLU A;  1LS8 A;  3I5G C;  1C07 A;  1LA0 A;  3S0D A;  1A2X A;  2KBI A;  2Y5I A;  4ZCU A;  3TDU A;  3N7H A;  3CZT X;  1LVC D;  1H4B A;  4GGN A;  2EGD A;  1S5G Z;  2JZI A;  3HX4 A;  1NCX A;  1D1O A;  1C7W A;  2L5Y A;  2HPS A;  1S6J A;  2JNF A;  1B8R A;  1XK4 C;  1ZFS A;  3D77 A;  3LLE A;  1EG4 A;  1IGV A;  1DGU A;  1DJH A;  4PT1 A;  1UHI A;  3AKA A;  4FTG A;  5JOL A;  2JC2 A;  5I2L A;  2GGZ A;  2LE9 B;  3TDZ A;  1FW4 A;  3BUX B;  5F6T A;  1SSE B;  2PAS A;  2VRG A;  3D0Y B;  2LVK A;  5FI2 A;  2ZFD A;  1CFD A;  4ORA B;  5I94 A;  2LC5 A;  1TWO A;  2I18 A;  2H61 C;  2F3Z A;  2JRF A;  2CBL A;  4PHM A;  3OBV A;  2GGM A;  3NSO A;  1XFW O;  1QIV A;  1ZMZ A;  2LMV A;  2F3Y A;  2M1U A;  4IL1 A;  1B7T Y;  1W7I B;  2H8V A;  1OZS A;  4CPV A;  4GBA A;  1G33 A;  2SAS A;  1KQV A;  1EXR A;  4N5X A;  3AKB A;  2QAC A;  3CS1 A;  2L98 A;  5DKN A;  2JWW A;  1TNX A;  4HRG A;  1SYM A;  1XA5 A;  4A4C A;  1LA3 A;  1ALV A;  2KFH A;  4CFQ A;  3C1V A;  3CDN A;  3VRQ A;  3EK7 A;  3NHT A;  3QME A;  3DD4 A;  3QRX A;  3B87 A;  3DVJ A;  2L4I A;  5CSI A;  1FBV A;  4WQ2 A;  1NPQ A;  4GNK B;  4PHK A;  1YUU A;  2K0J A;  5JJG A;  3GK1 A;  1DT7 B;  1L2O B;  1BF5 A;  1SMG A;  4CID A;  3L4L A;  2BL0 C;  1FF1 A;  1K93 D;  1TNP A;  1CLM A;  1OW4 A;  3EVV A;  3Q8I A;  1J55 A;  1IJ5 A;  2PMY A;  2FJU B;  3EK4 A;  4N1G A;  1ODB A;  3D75 A;  4MZK A;  1F4Q A;  2ZN8 A;  4NQG A;  1SKT A;  3B6X A;  4R1E A;  1TIZ A;  1NUB A;  1QX5 B;  1TUJ A;  4IJ7 A;  2AAO A;  1IKU A;  2KFF A;  5PAL A;  4AOM A;  2K60 A;  1MXE A;  2KYC A;  3BUO B;  4I5L B;  4PE0 A;  4OR9 B;  5I8N A;  1ORG A;  4U8D A;  4E68 A;  2M0R A;  2WCL A;  4UPG A;  2MBX A;  2G9B A;  2HET A;  5FI6 A;  1SR6 B;  2FJY A;  1HT9 A;  2LP2 A;  1PAL A;  4OVN F;  1FI5 A;  5EL2 A;  1WDC B;  2LHL A;  5AEQ A;  3BUM B;  3FIA A;  1SRA A;  1RJV A;  1DGV A;  2FOT A;  3PN7 B;  4INW A;  2DOQ A;  1UHJ A;  2JNX A;  1REC A;  1CDL A;  2L2C A;  3I5H C;  3EG5 B;  1DJI A;  3CWG A;  1K9U A;  1S6C A;  1K9P A;  1PVA A;  4P5O E;  1YRT B;  3IQQ A;  1CDP A;  2LAN A;  3JTD B;  1S3P A;  1KQM C;  1AK8 A;  1KCY A;  1OQP A;  2BE6 A;  1BT6 A;  3EVU A;  1XO5 A;  2LLS A;  1QV1 A;  1OSA A;  2NCO A;  2CCM A;  3SG5 A;  1JWD A;  2MRD A;  2P6B B;  3CLN A;  3L4A A;  1JBA A;  1Y1U A;  2CNP A;  2JPT A;  2LVV A;  4I5K A;  4BY4 A;  2SCP A;  1RK9 A;  2JQ6 A;  1M45 A;  1QTX A;  3R1V A;  3S0A A;  1F4O A;  1V1G A;  1OE9 B;  3KO0 A;  1DEL A;  1S5G Y;  2KI4 B;  3UO9 A;  3D76 A;  2PQL A;  1KWO B;  2WOR A;  1N0Y A;  1IRJ A;  2F2P A;  3IF7 A;  4Q04 A;  2JT8 A;  1TUZ A;  3KEV A;  3K1E A;  3FWB A;  2BBN A;  2G2B A;  2QPT A;  3VRR A;  1OOH A;  1NX3 A;  4WQ3 A;  5DKQ A;  3O2P A;  4XJK B;  2KAX A;  2ISD A;  1B9A A;  1OOI X;  1B1G A;  1SL9 A;  2KQY A;  1QAT A;  2TN4 A;  1M39 A;  3TS5 C;  1BU3 A;  1GQM A;  1SCM C;  2I7A A;  2M3W A;  2ZRS A;  3PAL A;  4I5N B;  4YI8 A;  5AFP A;  1DMO A;  1DJW A;  1PSR A;  3E3R A;  1DTL A;  3LCP C;  1CFC A;  3TDI A;  2JT0 A;  2JTZ A;  4USL A;  1YRU B;  3RM1 A;  4ZCV A;  3SG2 A;  3LL8 B;  4AQJ A;  4PE7 A;  2Y1M A;  2KGR A;  4ORC B;  3DYE A;  1F71 A;  2KDH A;  4QJ3 B;  1SL7 A;  1Q80 A;  3LK0 A;  1F54 A;  3BUW B;  1CM4 A;  4PCW A;  1TRF A;  4A4B A;  2OTG B;  1AVS A;  1DJZ A;  1TOP A;  1TTX A;  2KNE A;  3GK2 A;  4ICB A;  5J3X A;  1KFU S;  2BCX A;  2M7N A;  2ERB A;  2LMU A;  2COL B;  2KPH A;  3CR5 X;  3SS5 A;  2L5X B;  3R1P A;  1UUR A;  5AER A;  3CR2 A;  1FI6 A;  4GFT A;  1M63 B;  4M2O A;  4YI9 A;  1GGW A;  3D74 A;  3GK4 X;  1IJ6 A;  1YUT A;  5HL1 A;  3B88 A;  1KFX L;  3CYZ A;  1QLK A;  1CLL A;  4MRX A;  2K8M B;  2E6W A;  3A4U B;  1SY9 A;  1JSA A;  1BOD A;  2WOS A;  2LV7 A;  2M29 A;  2WC6 A;  1PSB A;  2BBM A;  2KLD A;  4MLW A;  2KI6 D;  1BJF A;  4F0Z B;  5I2O A;  4GAO A;  4PE1 A;  1JUO A;  3PAT A;  4WRI A;  3S0B A;  2JPO A;  1JFJ A;  5CSF A;  1IQ5 A;  1W7J B;  1NIW A;  1GM0 A;  2LCP A;  2WCB A;  3FE8 A;  5DIC A;  2KBM A;  1R6P A;  1G4Y R;  1WRZ A;  4YGB B;  1KSO A;  4XJK A;  1OMR A;  1YX7 A;  2GV5 A;  3S0G A;  5IBW A;  3OX6 A;  2L50 A;  1WY9 A;  4TNC A;  4N1F A;  1IG5 A;  1B4C A;  1EJ3 A;  1B8C A;  3OHM B;  3PJI A;  1Z4H A;  2JXL A;  1XFZ O;  4YGD B;  1NX0 A;  3EVR A;  2BL0 B;  4DUQ A;  3BXK A;  3FE6 A;  5BPJ A;  1K2H A;  2LAP A;  1QLS A;  1K94 A;  1QX2 A;  3I5F C;  3SIB A;  5ER4 X;  2GTE A;  1WLZ A;  1PK0 D;  4MN0 A;  2LUC A;  3SG3 A;  1AP4 A;  3LK1 A;  1Y1A A;  1TCO B;  3KPX A;  1YUS A;  2KGB C;  1XK4 A;  3TUY C;  4GGF C;  1CMF A;  3V2L A;  2WCJ A;  3BJH A;  3JVT C;  1L2O C;  3VGO A;  2L2E A;  4C0J A;  5HLV A;  1K90 D;  4GPL B;  1A75 A;  2K2F A;  4MZJ A;  3B86 A;  3RZS A;  1RTP 1;  2RGI A;  1PRW A;  2HF5 A;  5FI7 A;  4DCK A;  3FS7 A;  1H8B A;  1HQV A;  4JQ0 D;  1FPW A;  3SG6 A;  1XFV O;  3D10 A;  2IS9 A;  3D73 A;  1RFJ A;  2K61 A;  2LNK A;  2PAL A;  2H61 A;  3OB2 B;  5HKY A;  3MSE B;  2CXJ A;  5I2Q A;  1WRL A;  2L51 A;  1CB1 A;  2EHB A;  3EKH A;  5D3O A;  4F7F A;  1TN4 A;  1Y6W A;  3DVK A;  1OOF A;  1MF8 B;  3B7A A;  1YVL A;  1Y1X A;  4AQI A;  1XFY O;  2BCA A;  3BFH A;  4C0K A;  2EC6 B;  1CNP A;  4QJ5 B;  1M31 A;  3S0E A;  3SS4 A;  3SS3 A;  2K7D A;  1QV0 A;  1XFX O;  2D8N A;  2KHN A;  1OZO A;  3PM2 A;  1NWD A;  1JFK A;  1N65 A;  1S26 D;  3NSI A;  2KAV A;  3DF0 B;  3PM8 A;  3PSR A;  5CSJ A;  3WNX B;  1MHO A;  1NYA A;  2LUX A;  1KK8 B;  1W9Z A;  2KFG A;  1GGZ A;  3CTN A;  3NSK A;  1CKK A;  5KU1 A;  1TNW A;  3DVE A;  1CLB A;  2JUL A;  3JTD C;  1DJX A;  2Q91 A;  1JF2 A;  3OB1 B;  1K8U A;  1YX8 A;  2MLE C;  3DZT A;  3R72 A;  3ZNI A;  1CDN A;  1RWY A;  3I5I C;  5K89 A;  1RRO A;  2PRU A;  1SK6 D;  2QEB A;  4PHJ A;  5ER5 A;  1X02 A;  1Y0V H;  2WCE A;  1QJT A;  3BFB A;  1J7Q A;  2M8U A;  2BKH B;  2JT3 A;  1CTR A;  3CR4 X;  3L47 A;  2KLE A;  2YGU A;  1BMO A;  4HSZ A;  1CDM A;  2OS8 B;  1EL4 A;  2K7C A;  3O78 A;  4YGA A;  1MXL C;  4YRU A;  1ZOT B;  1A4P A;  3I5G B;  4MZL A;  4JD9 A;  4MBE A;  3AAJ A;  4P2Y B;  2M1K B;  3KF9 A;  1LXF C;  1TCF A;  1UWO A;  2JTT A;  4M2Q A;  1AUI B;  2ZRT A;  1G8I A;  2NXQ A;  5HKW A;  3EKJ A;  1S1E A;  1KK7 Z;  3OX5 A;  2KQ6 A;  4ORB B;  3GOF A;  1IQ3 A;  1Z2C B;  2HQW A;  3WHU B;  4NDD A;  3SJS A;  1SW8 A;  5GQQ C;  2M9G A;  2V53 A;  4HRH A;  1A75 B;  1IWQ A;  3CZ0 A;  3IQO A;  2LLT A;  2ZKM X;  1OMD A;  3BOW A;  3NHI A;  1S6I A;  1JF0 A;  3PFV A;  1K96 A;  2F2O A;  3BFA A;  1WRK A;  3FWC A;  4QJ4 B;  1CMG A;  1BOC A;  4MEW A;  5AAN A;  3OGN A;  2OTG C;  1LIN A;  2P71 A;  2Y1N A;  5HKZ A;  2O60 A;  4HRE E;  3DF0 A;  1DQE A;  5KSZ A;  2ZN9 A;  3S0F A;  1CFP A;  1J7O A;  4NDB A;  2BNX A;  2L0P A;  1XYD A;  2E30 A;  1C3Z A;  2M7L A;  1BR1 B;  1DJY A;  3R1O A;  3OP0 A;  2NZ0 A;  4JPZ B;  1QXP A;  2LVJ A;  1DJG A;  3VRO A;  2QEO A;  4FQT A;  1NCZ A;  1CFF A;  4OKH A;  4OCI A;  1QX7 A;  2A4J A;  2I2R E;  2LMT A;  1GJY A;  2MHH A;  3UNW A;  2LP3 A;  4ETO A;  1OMV A;  4PDZ A;  1J7R A;  1L7Z A;  1DF0 A;  3O4X A;  5HYD A;  1OOG A;  4YGC B;  1J1D A;  1A03 A;  1KFX S;  4YGE B;  1DEK A;  3I5F B;  1AJ4 A;  2MLF C;  4I5J A;  1U5I A;  4NDC A;  1MWN A;  2I94 A;  4PHN A;  3CAB A;  1AHR A;  2K7O A;  2OPO A;  1QIW A;  2MAZ A;  1S36 A;  2KI6 C;  1M46 A;  1NX1 A;  4DRW A;  1B8L A;  2B1U A;  2CT9 A;  3SG4 A;  1K9K A;  3K21 A;  3TUY B;  5HLO A;  3RLZ A;  1UHH A;  4MRY A;  3PLF B;  4GUK A;  3WHT B;  2JOJ A;  3HCM A;  3JVT B;  1XVJ A;  3VRP A;  3IVT A;  2BKI B;  2WC8 A;  5D7F A;  2KYF A;  1A29 A;  3TZ1 A;  4DS7 A;  1C7V A;  1NCY A;  1UHN A;  2WCM A;  4XYN A;  1NP8 A;  2WCK A;  4INX A;  1PVB A;  1YR5 A;  1B7T Z;  1SCV A;  2FCD A;  3KHE A;  3ICB A;  3I5H B;  1PUL A;  1BR4 B;  3BQ3 A;  3H4S E;  2JU0 A;  4MVF A;  2QEV A;  4PE4 A;  1QS7 A;  2M49 B;  1E8A A;  2Q4U A;  4KYN A;  3D78 A;  3ZWH A;  1NSH A;  4MSP A;  1V1F A;  2KAY A;  3VB1 A;  2WCF A;  3O6B A;  1F55 A;  1UP5 A;  1KQM B;  1QVI Y;  3BYA A;  4JWQ A;  3BOW B;  4DIR A;  1N2D A;  2L4H A;  2LVI A;  1SR6 C;  2WND A;  1EG3 A;  1WDC C;  1CM1 A;  1T14 A;  3D0Y A;  4PAL A;  1ZUZ A;  4YBH B;  2R2I A;  2NCP A;  1YTZ C;  1J1E A;  3PN7 C;  5DKR A;  2CTN A;  3FE9 A;  4FQO A;  5G08 A;  1LKJ A;  1DC1 A;  1UUS A;  2PSR A;  3NGV A;  1SL8 A;  1YUR A;  3DY9 A;  3CZ2 A;  5TNC A;  3SG7 A;  2BE4 A;  3AAK A;  2O5G A;  3DXL A;  3BUN B;  2LM5 A;  4OV2 A;  5B8I B;  3EK8 A;  1AJ5 A;  5D69 A;  2K2A A;  1KK7 Y;  3DVM A;  1BLQ A;  3SIA A;  2P70 A;  1B47 A;  1MQ1 A;  2EC6 C;  3F45 A;  4M2P A;  1F8H A;  1K95 A;  1MUX A;  1WLM A;  2M97 A;  3I5I B;  2F8P A;  3O4Y A;  5AXI A;  1QVI Z;  2KSP A;  1SBJ A;  2WC5 A;  3NSL A;  3NXA A;  1BG1 A;  3TS5 B;  1UHK A;  4C0L A;  1SCM B;  2H2K A;  1XFU O;  1J7P A;  2AUC A;  4GGF A;  1DF0 B;  1KFU L;  1KK8 C;  2KOT A;  2BEC A; 
#chains in the Genus database with same CATH homology
 2KI4 C;  2Y4Q A;  5KTY A;  1KSM A;  1TNQ A;  1SNL A;  3CGA A;  1KWO C;  2ZND A;  3WXA A;  5CSN A;  1U5I B;  1JC2 A;  1VRK A;  2BCB A;  1EH2 A;  2ZNE A;  4D1E A;  3A8R A;  1ZAC A;  2FCE A;  4L9M A;  1QAS A;  1MR8 A;  1YVH A;  2NLN A;  1NX2 A;  1F70 A;  2K7B A;  2LHI A;  3M0W A;  2JXC A;  2PVB A;  1ALW A;  2MJW B;  4CLN A;  4BY5 A;  5CPV A;  5FYX A;  1R2U A;  2HQ8 A;  2AMI A;  2MA2 A;  4CFR A;  3VRN A;  1OOJ A;  2F33 A;  2OS8 C;  1IH0 A;  1DVI A;  1SPY A;  2LLU A;  1C07 A;  3I5G C;  1LA0 A;  1A2X A;  2KBI A;  2Y5I A;  4ZCU A;  3TDU A;  3CZT X;  1LVC D;  1H4B A;  4GGN A;  2EGD A;  1S5G Z;  2JZI A;  3HX4 A;  1NCX A;  1D1O A;  1C7W A;  2HPS A;  1S6J A;  2JNF A;  1B8R A;  1XK4 C;  1ZFS A;  3LLE A;  1EG4 A;  1IGV A;  1DGU A;  1DJH A;  1UHI A;  3AKA A;  4FTG A;  5JOL A;  2JC2 A;  5I2L A;  2GGZ A;  2LE9 B;  3TDZ A;  1FW4 A;  3BUX B;  5F6T A;  2PAS A;  2VRG A;  3D0Y B;  2LVK A;  2ZFD A;  1CFD A;  4ORA B;  2LC5 A;  2I18 A;  2H61 C;  2F3Z A;  2JRF A;  2CBL A;  4PHM A;  2GGM A;  3NSO A;  1XFW O;  1QIV A;  1ZMZ A;  2LMV A;  2F3Y A;  2M1U A;  4IL1 A;  1B7T Y;  1W7I B;  1OZS A;  4CPV A;  4GBA A;  1G33 A;  2SAS A;  1EXR A;  4N5X A;  3AKB A;  2QAC A;  3CS1 A;  2L98 A;  5DKN A;  2JWW A;  1TNX A;  4HRG A;  1SYM A;  1XA5 A;  4A4C A;  1LA3 A;  1ALV A;  2KFH A;  4CFQ A;  3C1V A;  3VRQ A;  3EK7 A;  3DD4 A;  3QRX A;  3DVJ A;  2L4I A;  5CSI A;  1FBV A;  4WQ2 A;  1NPQ A;  4GNK B;  4PHK A;  1YUU A;  2K0J A;  5JJG A;  3GK1 A;  1DT7 B;  1L2O B;  1BF5 A;  1SMG A;  4CID A;  2BL0 C;  1FF1 A;  1K93 D;  1TNP A;  1CLM A;  3EVV A;  1J55 A;  1IJ5 A;  2PMY A;  2FJU B;  3EK4 A;  4N1G A;  1ODB A;  4MZK A;  1F4Q A;  2ZN8 A;  4NQG A;  1SKT A;  4R1E A;  1TIZ A;  1NUB A;  1QX5 B;  2AAO A;  1IKU A;  2KFF A;  5PAL A;  4AOM A;  3BUO B;  1MXE A;  2KYC A;  4I5L B;  4PE0 A;  4OR9 B;  5I8N A;  4U8D A;  4E68 A;  2M0R A;  4UPG A;  2MBX A;  2G9B A;  2HET A;  1SR6 B;  4OVN F;  1HT9 A;  2LP2 A;  1PAL A;  1FI5 A;  5AEQ A;  1WDC B;  2LHL A;  3BUM B;  3FIA A;  1SRA A;  1RJV A;  1DGV A;  2FOT A;  3PN7 B;  2DOQ A;  1UHJ A;  2JNX A;  1REC A;  1CDL A;  3I5H C;  1DJI A;  3CWG A;  1K9U A;  1S6C A;  1K9P A;  1PVA A;  4P5O E;  1YRT B;  3IQQ A;  1CDP A;  2LAN A;  3JTD B;  1S3P A;  1KQM C;  1AK8 A;  1KCY A;  1OQP A;  2BE6 A;  1BT6 A;  3EVU A;  1XO5 A;  2LLS A;  1QV1 A;  1OSA A;  2NCO A;  2CCM A;  3SG5 A;  1JWD A;  2MRD A;  2P6B B;  3CLN A;  1JBA A;  1Y1U A;  2CNP A;  2JPT A;  2LVV A;  4I5K A;  4BY4 A;  2SCP A;  1RK9 A;  2JQ6 A;  1M45 A;  1QTX A;  1F4O A;  1V1G A;  1OE9 B;  3KO0 A;  1S5G Y;  2KI4 B;  4Q04 A;  1KWO B;  2WOR A;  1N0Y A;  1IRJ A;  2F2P A;  3IF7 A;  2JT8 A;  3KEV A;  3FWB A;  2BBN A;  2G2B A;  2QPT A;  3VRR A;  1NX3 A;  4WQ3 A;  5DKQ A;  3O2P A;  4XJK B;  2KAX A;  2ISD A;  1B9A A;  1B1G A;  1SL9 A;  2KQY A;  1QAT A;  2TN4 A;  1M39 A;  3TS5 C;  1BU3 A;  1GQM A;  1SCM C;  2I7A A;  2M3W A;  2ZRS A;  3PAL A;  4I5N B;  4YI8 A;  5AFP A;  1DMO A;  1DJW A;  1PSR A;  3E3R A;  1DTL A;  3LCP C;  1CFC A;  3TDI A;  2JT0 A;  2JTZ A;  4USL A;  1YRU B;  3RM1 A;  4ZCV A;  3SG2 A;  3LL8 B;  4AQJ A;  4PE7 A;  2Y1M A;  2KGR A;  4ORC B;  1F71 A;  2KDH A;  4QJ3 B;  1SL7 A;  1Q80 A;  3LK0 A;  1F54 A;  3BUW B;  1CM4 A;  4PCW A;  1TRF A;  4A4B A;  2OTG B;  1AVS A;  1DJZ A;  1TOP A;  1TTX A;  2KNE A;  3GK2 A;  4ICB A;  5J3X A;  1KFU S;  2BCX A;  2M7N A;  2LMU A;  2COL B;  3CR5 X;  2L5X B;  1UUR A;  5AER A;  3CR2 A;  1FI6 A;  4GFT A;  1M63 B;  4M2O A;  4YI9 A;  1GGW A;  3GK4 X;  1IJ6 A;  1YUT A;  1KFX L;  1QLK A;  1CLL A;  4MRX A;  2K8M B;  2E6W A;  3A4U B;  1SY9 A;  1JSA A;  1BOD A;  2WOS A;  2LV7 A;  2M29 A;  1PSB A;  2BBM A;  4MLW A;  2KI6 D;  1BJF A;  4F0Z B;  5I2O A;  4GAO A;  4PE1 A;  1JUO A;  3PAT A;  4WRI A;  1JFJ A;  5CSF A;  1IQ5 A;  1W7J B;  1NIW A;  2LCP A;  2WCB A;  2KBM A;  1R6P A;  1G4Y R;  1WRZ A;  4YGB B;  1KSO A;  4XJK A;  1OMR A;  1YX7 A;  2GV5 A;  5IBW A;  3OX6 A;  2L50 A;  1WY9 A;  4TNC A;  4N1F A;  1IG5 A;  1B4C A;  1EJ3 A;  1B8C A;  3OHM B;  2JXL A;  1XFZ O;  4YGD B;  1NX0 A;  3EVR A;  2BL0 B;  4DUQ A;  3BXK A;  5BPJ A;  1K2H A;  2LAP A;  1QLS A;  1K94 A;  1QX2 A;  3I5F C;  3SIB A;  5ER4 X;  1WLZ A;  1PK0 D;  4MN0 A;  2LUC A;  3SG3 A;  1AP4 A;  3LK1 A;  1Y1A A;  1TCO B;  3KPX A;  1YUS A;  2KGB C;  1XK4 A;  3TUY C;  4GGF C;  1CMF A;  3JVT C;  1L2O C;  3VGO A;  2L2E A;  4C0J A;  5HLV A;  1K90 D;  4GPL B;  1A75 A;  2K2F A;  4MZJ A;  1RTP 1;  2RGI A;  1PRW A;  2HF5 A;  4DCK A;  3FS7 A;  1H8B A;  1HQV A;  4JQ0 D;  1FPW A;  3SG6 A;  1XFV O;  3D10 A;  2IS9 A;  1RFJ A;  2K61 A;  2LNK A;  2PAL A;  2H61 A;  3OB2 B;  5HKY A;  3MSE B;  2CXJ A;  5I2Q A;  1WRL A;  2L51 A;  1CB1 A;  2EHB A;  3EKH A;  1TN4 A;  1Y6W A;  3DVK A;  1MF8 B;  1Y1X A;  1YVL A;  4AQI A;  1XFY O;  2BCA A;  4C0K A;  1CNP A;  2EC6 B;  1KQV A;  4QJ5 B;  1M31 A;  2K7D A;  1QV0 A;  1XFX O;  2D8N A;  2KHN A;  1OZO A;  1NWD A;  1JFK A;  1N65 A;  1S26 D;  3NSI A;  2KAV A;  3DF0 B;  3PM8 A;  3PSR A;  5CSJ A;  3WNX B;  1MHO A;  1NYA A;  2LUX A;  1KK8 B;  2KFG A;  1GGZ A;  3CTN A;  3NSK A;  1CKK A;  5KU1 A;  1TNW A;  3DVE A;  1CLB A;  2JUL A;  3JTD C;  1DJX A;  2Q91 A;  1JF2 A;  3OB1 B;  1K8U A;  1YX8 A;  2MLE C;  3ZNI A;  1CDN A;  1RWY A;  3I5I C;  5K89 A;  1RRO A;  2PRU A;  1SK6 D;  4PHJ A;  5ER5 A;  1X02 A;  1Y0V H;  2WCE A;  1QJT A;  1J7Q A;  2M8U A;  2BKH B;  2JT3 A;  1CTR A;  3CR4 X;  1BMO A;  4HSZ A;  1CDM A;  2OS8 B;  1EL4 A;  2K7C A;  3O78 A;  4YGA A;  1MXL C;  4YRU A;  1ZOT B;  1A4P A;  3I5G B;  4MZL A;  4MBE A;  3AAJ A;  4P2Y B;  2M1K B;  3KF9 A;  1LXF C;  1TCF A;  1UWO A;  2JTT A;  4M2Q A;  1AUI B;  2ZRT A;  1G8I A;  2NXQ A;  5HKW A;  3EKJ A;  1S1E A;  1KK7 Z;  3OX5 A;  2KQ6 A;  4ORB B;  3GOF A;  1IQ3 A;  2HQW A;  3WHU B;  4NDD A;  3SJS A;  1SW8 A;  5GQQ C;  2M9G A;  2V53 A;  4HRH A;  1A75 B;  1IWQ A;  3IQO A;  2LLT A;  2ZKM X;  1OMD A;  3BOW A;  1S6I A;  1JF0 A;  3PFV A;  1K96 A;  2F2O A;  3FWC A;  1WRK A;  4QJ4 B;  1CMG A;  1BOC A;  4MEW A;  5AAN A;  2OTG C;  1LIN A;  2Y1N A;  5HKZ A;  2O60 A;  4HRE E;  3DF0 A;  5KSZ A;  2ZN9 A;  1CFP A;  1J7O A;  4NDB A;  2L0P A;  1XYD A;  2E30 A;  2M7L A;  1BR1 B;  1DJY A;  3OP0 A;  2NZ0 A;  4JPZ B;  1QXP A;  2LVJ A;  1DJG A;  3VRO A;  1NCZ A;  1CFF A;  4OKH A;  4OCI A;  1QX7 A;  2A4J A;  2I2R E;  2LMT A;  1GJY A;  2MHH A;  2LP3 A;  4ETO A;  1OMV A;  4PDZ A;  1J7R A;  1L7Z A;  1DF0 A;  5HYD A;  4YGC B;  1J1D A;  1A03 A;  1KFX S;  4YGE B;  3I5F B;  1AJ4 A;  2MLF C;  4I5J A;  1U5I A;  4NDC A;  1MWN A;  2I94 A;  4PHN A;  1AHR A;  2K7O A;  2OPO A;  1QIW A;  2MAZ A;  1S36 A;  2KI6 C;  1M46 A;  1NX1 A;  4DRW A;  1B8L A;  2B1U A;  2CT9 A;  3SG4 A;  1K9K A;  3K21 A;  3TUY B;  5HLO A;  3RLZ A;  1UHH A;  4MRY A;  3PLF B;  4GUK A;  3WHT B;  2JOJ A;  3HCM A;  3JVT B;  1XVJ A;  3VRP A;  2BKI B;  2WC8 A;  5D7F A;  2KYF A;  1A29 A;  3TZ1 A;  4DS7 A;  1C7V A;  1NCY A;  1UHN A;  4XYN A;  1NP8 A;  1PVB A;  1YR5 A;  1B7T Z;  1SCV A;  2FCD A;  3KHE A;  3ICB A;  3I5H B;  1PUL A;  1BR4 B;  3BQ3 A;  3H4S E;  2JU0 A;  4MVF A;  4PE4 A;  1QS7 A;  2M49 B;  1E8A A;  2Q4U A;  3ZWH A;  1NSH A;  4MSP A;  1V1F A;  2KAY A;  2WCF A;  3O6B A;  1F55 A;  1UP5 A;  1KQM B;  1QVI Y;  3BYA A;  4JWQ A;  3BOW B;  4DIR A;  1N2D A;  2L4H A;  2LVI A;  1SR6 C;  2WND A;  1EG3 A;  1WDC C;  1CM1 A;  3D0Y A;  4PAL A;  1ZUZ A;  4YBH B;  2R2I A;  2NCP A;  1YTZ C;  1J1E A;  3PN7 C;  5DKR A;  2CTN A;  4FQO A;  5G08 A;  1LKJ A;  1UUS A;  2PSR A;  1SL8 A;  1YUR A;  5TNC A;  3SG7 A;  2BE4 A;  3AAK A;  2O5G A;  3BUN B;  2LM5 A;  4OV2 A;  5B8I B;  3EK8 A;  1AJ5 A;  5D69 A;  2K2A A;  1KK7 Y;  3DVM A;  1BLQ A;  3SIA A;  1B47 A;  1MQ1 A;  2EC6 C;  3F45 A;  4M2P A;  1F8H A;  1K95 A;  1MUX A;  1WLM A;  2M97 A;  3I5I B;  2F8P A;  3O4Y A;  5AXI A;  1QVI Z;  2KSP A;  1SBJ A;  3NXA A;  3NSL A;  1BG1 A;  3TS5 B;  1UHK A;  4C0L A;  1SCM B;  2H2K A;  1XFU O;  1J7P A;  2AUC A;  4GGF A;  1DF0 B;  1KFU L;  1KK8 C;  2KOT A;  2BEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...