2F8PA

Crystal structure of obelin following ca2+ triggered bioluminescence suggests neutral coelenteramide as the primary excited state
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
190
structure length
190
Chain Sequence
ASKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Crystal structure of obelin after Ca2+-triggered bioluminescence suggests neutral coelenteramide as the primary excited state.
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 84
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2f8pA00
5HKYA 4MVFA 1PVBA 2ZNEA 2SCPA 4PHKA 1J55A 2LVIA 1NX3A 3D10A 4NDCA 1B9AA 2HQWA 5K89A 5B8IB 4DUQA 1F4OA 2K7CA 1B8CA 1L2OB 1TCOB 1NX1A 3OB1B 4OCIA 2NCPA 1TCFA 3I5HC 2COLB 1S5GY 2TN4A 3DVKA 1B1GA 1G33A 1H8BA 3BUNB 1A75A 4CPVA 5KSZA 3MSEB 1L2OC 1QATA 1GJYA 1NCZA 1RROA 1YVLA 1EL4A 2KFFA 3O2PA 4FQOA 1A4PA 2D8NA 4YGAA 1V1GA 1QXPA 1K90D 3AAKA 1WLMA 1YRUB 1IG5A 2MLEC 1MF8B 4D1EA 1KQMB 3WHTB 1LA3A 2NZ0A 3ICBA 4GPLB 1DJGA 2M9GA 3RLZA 3KEVA 5HYDA 2K7OA 3BUWB 2QACA 2KBMA 3KPXA 1KK7Z 3KF9A 1RJVA 1PSBA 2CT9A 2L4IA 1NX0A 3CGAA 3SG4A 5AEQA 1D1OA 2JWWA 1DT7B 3VROA 4DCKA 1B8LA 2JULA 3SIAA 3PLFB 2BKHB 1BJFA 3I5GC 1OMDA 2ZN8A 3TDIA 4U8DA 1OMRA 2LLSA 1SR6B 1H4BA 1B7TY 1RWYA 1IKUA 2V53A 2F3YA 3DD4A 1B4CA 1S6CA 1S5GZ 2JQ6A 5D69A 1KFUS 1N0YA 1SR6C 2WCFA 4XJKA 1B47A 1BG1A 2Y1NA 1M39A 1DF0B 2K2AA 1DVIA 3NSOA 3OX5A 1IQ5A 2BCBA 4PE1A 1U5IA 2LUXA 4C0LA 1QV0A 1NIWA 2JT8A 2K61A 1KQVA 1IGVA 2Y4QA 1FBVA 1BLQA 1J7QA 4USLA 5CSFA 4JPZB 2K7DA 5DKQA 1UWOA 5DKRA 3CWGA 1NP8A 2A4JA 1WRLA 4BY5A 4ORAB 1Y1XA 3BUXB 1UHHA 2LP2A 3E3RA 4CFQA 1HT9A 1CFPA 1DJXA 5AANA 2PSRA 5HKZA 4DS7A 1J7OA 1SCVA 3SJSA 1OE9B 3SIBA 1NCXA 2ZFDA 4QJ5B 2BE4A 2MRDA 3TZ1A 2LHLA 4FTGA 1TOPA 4Q04A 2L98A 2WOSA 5I2OA 1ZFSA 1B7TZ 1DGVA 4QJ4B 1C7VA 2KHNA 1W7JB 2KQ6A 3GK2A 1MXLC 1R2UA 2KI4B 2G9BA 2MLFC 3O6BA 3QRXA 3EK7A 1BF5A 4P2YB 1MQ1A 2FJUB 2JC2A 3TDUA 1XFZO 1K93D 2KFHA 3BUOB 4GNKB 3VRRA 2WORA 4PE0A 4ZCVA 3TDZA 3WXAA 2QPTA 1UHKA 1JUOA 4A4CA 4GUKA 3PSRA 1MXEA 2EGDA 1OMVA 2I7AA 1RK9A 1EG3A 1B8RA 1IJ6A 1DGUA 1CTRA 3PALA 3WHUB 1F71A 4NDBA 2WCEA 2BBMA 2CBLA 3IF7A 3EKHA 4E68A 5CSIA 2L5XB 2LVJA 4PE7A 2I2RE 2KYFA 3CR4X 2KSPA 3SG3A 2M8UA 1KSMA 4CFRA 1JFJA 1AJ4A 2BL0B 1SNLA 1F54A 2PRUA 5I2QA 2M7NA 3AKAA 2MAZA 1Y1AA 1QLSA 1AP4A 2LCPA 5I8NA 1JF0A 3SG7A 4YRUA 1K9UA 2BL0C 3CR5X 2BCXA 2K7BA 1CKKA 2KGRA 3AAJA 1WDCB 3A8RA 2HQ8A 5JOLA 1QIVA 4C0KA 3VRPA 1LKJA 2OTGB 5F6TA 1SRAA 1XVJA 3DVJA 3LCPC 3TS5B 1A2XA 3BYAA 1WDCC 2M29A 1LXFC 2I18A 3BOWB 3VRNA 1EG4A 1SK6D 1XO5A 4OVNF 1YX8A 4GGFA 4AOMA 3TS5C 1CDPA 2ZKMX 4N5XA 3ZNIA 1OOJA 2JPTA 2VRGA 1SL7A 2LHIA 2PALA 1OSAA 2KAYA 3EKJA 3HCMA 5CSJA 1K8UA 2FOTA 5KU1A 2RGIA 2Q4UA 1NWDA 3IQQA 4MLWA 2LMTA 2JNFA 4N1FA 1KQMC 2M1UA 1HQVA 1J1DA 1M46A 3EVVA 4AQJA 2WNDA 1SY9A 1C7WA 3IQOA 1GGZA 1TIZA 5CSNA 1ZOTB 1DF0A 4MN0A 1K95A 1XFWO 2CTNA 1J7PA 2K2FA 2PVBA 2K0JA 4PHMA 3SG5A 4HREE 1NUBA 3GK1A 1OZOA 2F3ZA 3C1VA 1TNQA 1YUTA 4GGFC 2E6WA 1OZSA 1A03A 1SPYA 5HLOA 5HLVA 2LE9B 2LM5A 4HRGA 2NCOA 4MBEA 1E8AA 3FIAA 4TNCA 3KHEA 2LAPA 4GGNA 4OV2A 4QJ3B 3OHMB 4OKHA 4PE4A 2CCMA 3H4SE 4M2QA 4JQ0D 5BPJA 2H2KA 3CR2A 2L2EA 4CIDA 5FYXA 2AMIA 4ORCB 1TNPA 4IL1A 4NDDA 5J3XA 1NCYA 3LLEA 1CLBA 1PRWA 2R2IA 1CM1A 2KAVA 4I5LB 4PHNA 2LNKA 1KCYA 4HRHA 3M0WA 2M1KB 4BY4A 2HF5A 1K2HA 4R1EA 4DRWA 1K96A 2ZN9A 1FI5A 4A4BA 1NYAA 4I5KA 4WQ3A 4M2OA 4DIRA 2JT3A 3PM8A 4F0ZB 1XFUO 3DF0B 1UURA 1XA5A 1YUSA 2BE6A 4WRIA 5DKNA 2KOTA 1CNPA 2EHBA 1F55A 1DJYA 2LC5A 3CZTX 5PALA 1S3PA 1BOCA 2IS9A 1IQ3A 1UHNA 1UP5A 3PFVA 2L0PA 1C07A 3NXAA 1JF2A 1AK8A 2MA2A 1XK4A 1M63B 1DJZA 2LLUA 3DVMA 1GQMA 1BU3A 1W7IB 2KYCA 3K21A 3VGOA 1IWQA 1V1FA 1JSAA 1DJIA 4MEWA 2P6BB 2KI4C 5JJGA 1CFCA 1QASA 2LVKA 2M7LA 2B1UA 3CLNA 2ZNDA 2BECA 4YGDB 2M3WA 4MZJA 4MSPA 1CM4A 1VRKA 1Y6WA 3EK4A 1WRZA 1S6JA 2OS8B 3EVUA 1PK0D 4PDZA 3BXKA 5ER5A 2L4HA 3EVRA 3PN7B 1M45A 2F2OA 2JXLA 2JZIA 2LMUA 3CTNA 3I5IB 1DMOA 1S6IA 1SKTA 2FCDA 1TN4A 2OS8C 1N65A 3OP0A 2PMYA 2JXCA 3NSIA 2O60A 1XK4C 4ZCUA 3BOWA 1CLLA 1UHJA 3D0YB 2G2BA 4CLNA 4C0JA 1WRKA 1WLZA 3GOFA 3KO0A 2BKIB 2GGZA 2JRFA 1M31A 2KI6D 2M97A 1TTXA 1KFXL 1NPQA 2FCEA 2H61A 1PALA 2L51A 4YI8A 2F8PA 4MRXA 3O4YA 1MWNA 1XFXO 1SBJA 1IH0A 1TNXA 1MUXA 1SL8A 2M0RA 2EC6B 1QVIY 3BQ3A 3I5HB 1QX5B 2OTGC 4GFTA 1NX2A 2JU0A 2GGMA 1IJ5A 2JT0A 1FI6A 2NXQA 2HPSA 1Y0VH 2EC6C 1BR4B 1UHIA 3NSLA 1LINA 1JBAA 4WQ2A 1YRTB 1KK8B 4MZLA 1SCMB 1R6PA 1F70A 3FS7A 1GGWA 1CFFA 2Y1MA 2JTTA 1EXRA 2GV5A 2PASA 3EK8A 3PATA 2KFGA 4GAOA 1K9KA 2H61C 3GK4X 1CMFA 3A4UB 2L50A 1KK8C 1YVHA 1SCMC 1LA0A 5G08A 1ZMZA 1FPWA 5KTYA 1XYDA 2LP3A 3FWCA 1F4QA 2I94A 1MHOA 5TNCA 4I5NB 4XYNA 1RFJA 3OB2B 1N2DA 2MHHA 4P5OE 2F2PA 1SL9A 4ICBA 1Q80A 1CLMA 3CS1A 4JWQA 2M49B 1RECA 1A75B 2Q91A 2KBIA 2KAXA 3HX4A 3I5GB 1KWOB 1K94A 4MZKA 1Y1UA 1BR1B 2JOJA 4YGEB 1A29A 3AKBA 4PALA 5HKWA 1BT6A 1QVIZ 1JC2A 1KWOC 2KQYA 1RTP1 2BCAA 2JNXA 1CDLA 4M2PA 1ODBA 2LMVA 3DF0A 3RM1A 2AAOA 5AERA 1AHRA 1ZUZA 1G8IA 2WC8A 1CDMA 1L7ZA 1QX7A 1QIWA 1YR5A 2Y5IA 5I2LA 1KSOA 1ALWA 1JFKA 2LVVA 5AXIA 1QLKA 2CNPA 1X02A 1FW4A 1KFUL 1SW8A 1DJHA 1CDNA 1CB1A 1S36A 1YURA 2ISDA 1XFYO 2LV7A 3JVTB 2E30A 5ER4X 2MBXA 3O78A 1SMGA 4GBAA 1MR8A 5CPVA 2BBNA 2CXJA 3FWBA 4YGCB 3WNXB 1FF1A 5AFPA 2OPOA 1K9PA 4PCWA 1DJWA 1OQPA 1S1EA 1QX2A 3JVTC 3LL8B 3VRQA 4XJKB 2HETA 2LUCA 1JWDA 3ZWHA 1DTLA 1AJ5A 1YTZC 1U5IB 3F45A 2KNEA 2KGBC 4ORBB 3I5FB 1SYMA 4I5JA 1BODA 1YUUA 1QV1A 4ETOA 4AQIA 1WY9A 1TNWA 2KI6C 2O5GA 5D7FA 1ZACA 1QTXA 2AUCA 3TUYB 3NSKA 4PHJA 2WCBA 1J7RA 4YGBB 1ALVA 3D0YA 3I5FC 4OR9B 1TRFA 1QS7A 2DOQA 1S26D 5IBWA 1UUSA 1XFVO 3DVEA 2MJWB 2JTZA 4MRYA 1J1EA 3OX6A 2K8MB 4UPGA 3TUYC 2NLNA 1PSRA 4L9MA 2ZRSA 2ZRTA 1AVSA 2SASA 3PN7C 4YI9A 1PVAA 3SG2A 1CFDA 3BUMB 1LVCD 1BMOA 3I5IC 3JTDB 1YX7A 1QJTA 1CMGA 2LLTA 4YBHB 5GQQC 4N1GA 1NSHA 2LANA 2KDHA 1G4YR 4HSZA 1EH2A 2F33A 1KFXS 3JTDC 1KK7Y 1AUIB 4NQGA 1F8HA 1EJ3A 1IRJA 1PULA 3LK0A 3SG6A 3LK1A
chains in the Genus database with same CATH superfamily
5HKYA 4MVFA 1PVBA 2ZNEA 2SCPA 4PHKA 1J55A 3S0BA 2FJYA 1NX3A 2LVIA 2KLDA 3D10A 4NDCA 1B9AA 2HQWA 5K89A 5B8IB 2PQLA 4DUQA 1F4OA 2K7CA 1B8CA 3EG5B 1L2OB 1TCOB 1NX1A 3OB1B 4OCIA 3DY9A 2NCPA 1TCFA 3I5HC 2COLB 1S5GY 2TN4A 3DVKA 1B1GA 1G33A 1H8BA 3BUNB 1A75A 4CPVA 1LS8A 5KSZA 1IIOA 3MSEB 1L2OC 1QATA 1GJYA 1NCZA 1RROA 1YVLA 1EL4A 2KFFA 2QEBA 3O2PA 1A4PA 2D8NA 4FQOA 1V1GA 4YGAA 1QXPA 1K90D 3NHIA 1TWOA 3AAKA 2WC5A 1WLMA 1YRUB 1IG5A 2MLEC 1MF8B 4D1EA 1KQMB 3B88A 3WHTB 1LA3A 2NZ0A 3ICBA 5DICA 4GPLB 1DJGA 2M9GA 3RLZA 3KEVA 5HL1A 5HYDA 2K7OA 3BUWB 2QACA 2KBMA 3KPXA 1KK7Z 2KLEA 3KF9A 1RJVA 1PSBA 2CT9A 2L4IA 1NX0A 3CGAA 3SG4A 5AEQA 1D1OA 2JWWA 1DT7B 3VROA 2WCKA 4DCKA 1B8LA 2JULA 3SIAA 3PLFB 2BKHB 1BJFA 3I5GC 1OMDA 3R1OA 2ZN8A 3TDIA 2PYQA 3FE9A 4U8DA 1OMRA 3L47A 2LLSA 1SR6B 1H4BA 1B7TY 1RWYA 1IKUA 2V53A 2F3YA 3DD4A 1B4CA 1S6CA 1S5GZ 1W9ZA 2JQ6A 2P70A 5D69A 1KFUS 1N0YA 1SR6C 2WCFA 3D75A 1B47A 2QEOA 4XJKA 1BG1A 2Y1NA 1M39A 1DF0B 2K2AA 1DVIA 3NSOA 3OX5A 1IQ5A 2BCBA 4PE1A 1U5IA 2LUXA 4PT1A 4C0LA 1QV0A 1NIWA 2JT8A 2K61A 3CABA 1KQVA 1IGVA 2Y4QA 1FBVA 4JKTA 1BLQA 1J7QA 4USLA 5CSFA 3DYEA 4JPZB 2K7DA 3CZ0A 2WCHA 1UWOA 5DKRA 5DKQA 3CWGA 1NP8A 3D78A 2A4JA 1WRLA 4BY5A 4ORAB 1Y1XA 1OOHA 3BUXB 1UHHA 2LP2A 3E3RA 4CFQA 3B6XA 1HT9A 1CFPA 1DJXA 5AANA 2PSRA 5HKZA 4DS7A 3BFBA 1SCVA 1J7OA 3SJSA 1OE9B 3SIBA 1NCXA 2ZFDA 4QJ5B 2BE4A 2MRDA 3TZ1A 2LHLA 4FTGA 1TOPA 4Q04A 2L98A 2WOSA 5I2OA 1ZFSA 1B7TZ 1DGVA 1DEKA 4QJ4B 1C7VA 2KHNA 1W7JB 2KQ6A 3GK2A 3OBVA 3CZ2A 1MXLC 1R2UA 2KI4B 2G9BA 2MLFC 3O6BA 3QRXA 3EK7A 1BF5A 4P2YB 1MQ1A 2FJUB 2JC2A 3TDUA 1XFZO 1K93D 2KFHA 3BFHA 3BUOB 4GNKB 3VRRA 2WORA 4PE0A 4ZCVA 3TDZA 3WXAA 2QPTA 1UHKA 1JUOA 4A4CA 4GUKA 3PSRA 1MXEA 2EGDA 1OMVA 2I7AA 1RK9A 1EG3A 1B8RA 1IJ6A 1DGUA 1CTRA 3PALA 3Q8IA 3WHUB 1F71A 3BFAA 4NDBA 4OZDA 2WCEA 2BBMA 2CBLA 3IF7A 3EKHA 4E68A 5CSIA 2L5XB 2LVJA 4PE7A 2I2RE 2KYFA 3D74A 3CR4X 2KSPA 3SG3A 2M8UA 1KSMA 5EL2A 4CFRA 1AJ4A 2BL0B 1JFJA 1P28A 1SNLA 1F54A 2PRUA 5I2QA 2M7NA 3AKAA 2MAZA 1Y1AA 1QLSA 1AP4A 1OOIX 2LCPA 5I8NA 1JF0A 3R1VA 3SG7A 3CZ1A 3D77A 1K9UA 2BL0C 4YRUA 3CR5X 2BCXA 2K7BA 1CKKA 2KGRA 3AAJA 1WDCB 3A8RA 2HQ8A 5JOLA 1QIVA 4C0KA 3S0FA 3VRPA 1LKJA 2OTGB 5F6TA 1DELA 1SRAA 1XVJA 3DVJA 3LCPC 3TS5B 1A2XA 2H8VA 3BYAA 1WDCC 2M29A 1LXFC 2I18A 3BOWB 3VRNA 1EG4A 1SK6D 1XO5A 4OVNF 1YX8A 4GGFA 4AOMA 3TS5C 1CDPA 2ZKMX 4N5XA 3ZNIA 1OOJA 2JPTA 2VRGA 1SL7A 2LHIA 2PALA 1OSAA 2KAYA 3EKJA 3HCMA 5CSJA 1K8UA 2FOTA 5KU1A 2RGIA 2Q4UA 1NWDA 3IQQA 4MLWA 2LMTA 2JNFA 4N1FA 3DXLA 1KQMC 2M1UA 1HQVA 1J1DA 1M46A 3EVVA 4AQJA 2WNDA 1SY9A 1C7WA 3L4LA 3IQOA 1GGZA 1T14A 1TIZA 5CSNA 1ZOTB 1DF0A 4MN0A 1K95A 1XFWO 2CTNA 1J7PA 2K2FA 2PVBA 2K0JA 4PHMA 3SG5A 4HREE 1NUBA 2L2CA 3GK1A 1OZOA 2F3ZA 3C1VA 1TNQA 1YUTA 4GGFC 3B87A 2E6WA 1OZSA 1A03A 1SPYA 5HLOA 5HLVA 2LE9B 2LM5A 4HRGA 2NCOA 4MBEA 1E8AA 3FIAA 4TNCA 3B7AA 3KHEA 2LAPA 2GTEA 1C3ZA 4GGNA 4OV2A 4QJ3B 1DC1A 3OHMB 4OKHA 4PE4A 2CCMA 3H4SE 4M2QA 4JQ0D 5BPJA 2H2KA 3CR2A 2L2EA 3R1PA 1TUJA 5FYXA 4CIDA 3CDNA 2AMIA 3FE6A 4ORCB 1TNPA 4IL1A 4NDDA 5J3XA 1NCYA 3LLEA 1CLBA 1PRWA 2R2IA 1CM1A 2KAVA 1TUZA 4I5LB 4PHNA 2LNKA 1KCYA 4HRHA 3M0WA 2M1KB 4BY4A 2HF5A 1K2HA 4R1EA 4DRWA 1K96A 4INXA 2ZN9A 1FI5A 4A4BA 1DQEA 1NYAA 4I5KA 4WQ3A 4M2OA 4DIRA 2JT3A 4FQTA 3PM8A 4F0ZB 3L4AA 1XFUO 3DF0B 1UURA 1XA5A 1YUSA 2BE6A 4WRIA 5DKNA 2KOTA 2WCJA 2EHBA 3S0EA 1CNPA 1F55A 1DJYA 2LC5A 3CZTX 5PALA 1S3PA 1BOCA 2IS9A 1IQ3A 1UHNA 1UP5A 3PFVA 2L0PA 1C07A 2WCLA 3NXAA 1JF2A 1AK8A 2MA2A 1XK4A 1M63B 1DJZA 2LLUA 3DVMA 1GQMA 1BU3A 1W7IB 2KYCA 3K21A 3VGOA 1IWQA 1V1FA 1JSAA 2WC6A 3UNWA 1DJIA 4MEWA 2P6BB 2KI4C 5JJGA 1CFCA 3S0GA 1QASA 2LVKA 2M7LA 3O4XA 2B1UA 3CLNA 2ZNDA 2BECA 4YGDB 2M3WA 4MZJA 4MSPA 1CM4A 3SS3A 1VRKA 1Y6WA 3EK4A 1WRZA 1S6JA 2OS8B 3BJHA 3EVUA 1PK0D 4PDZA 3CYZA 3BXKA 5ER5A 2L4HA 3EVRA 3PM2A 3PN7B 1M45A 2F2OA 2JXLA 2JZIA 2LMUA 3CTNA 3I5IB 1DMOA 3VB1A 1S6IA 1SKTA 4INWA 2FCDA 2K60A 1TN4A 2OS8C 1N65A 3OP0A 2PMYA 2JXCA 3NSIA 2O60A 4JD9A 1XK4C 4ZCUA 4KYNA 3BOWA 1CLLA 1UHJA 3N7HA 3D0YB 2G2BA 4CLNA 4C0JA 1WRKA 1WLZA 3GOFA 3KO0A 2BKIB 5I94A 2GGZA 2JRFA 1M31A 1OOGA 2KI6D 2M97A 1TTXA 1KFXL 1NPQA 2FCEA 2H61A 1PALA 2L51A 3B86A 2F8PA 4YI8A 1OOFA 4MRXA 3O4YA 1MWNA 1XFXO 1SBJA 1IH0A 1Z2CB 1QWVA 3S0AA 1GM0A 1TNXA 1MUXA 1SL8A 2M0RA 2EC6B 1QVIY 3BQ3A 3I5HB 5FI7A 1QX5B 2OTGC 4GFTA 1NX2A 2JU0A 3FE8A 2GGMA 1IJ5A 2JT0A 1FI6A 2NXQA 2HPSA 1Y0VH 2EC6C 1BR4B 1UHIA 3NSLA 1LINA 1JBAA 4WQ2A 1YRTB 1KK8B 4MZLA 1SCMB 1XFRA 3SS5A 1R6PA 1F70A 2JPOA 3FS7A 1GGWA 1CFFA 2Y1MA 2JTTA 1EXRA 2GV5A 2PASA 3EK8A 3PATA 2KFGA 4GAOA 1K9KA 2H61C 3GK4X 1CMFA 3A4UB 2L50A 1KK8C 1YVHA 1SCMC 1LA0A 5G08A 1ZMZA 5D3OA 1FPWA 5KTYA 1XYDA 2LP3A 3FWCA 1F4QA 2I94A 1MHOA 5TNCA 4I5NB 4XYNA 1RFJA 3OB2B 1N2DA 2MHHA 4P5OE 2F2PA 1SL9A 4ICBA 1Q80A 1CLMA 2QEVA 3CS1A 4JWQA 2M49B 1RECA 1A75B 2Q91A 2KBIA 2KAXA 3HX4A 3I5GB 1KWOB 1K94A 2KPHA 4MZKA 1Y1UA 1BR1B 2JOJA 3DZTA 3S0DA 5FI6A 4YGEB 1A29A 3AKBA 4PALA 5HKWA 1BT6A 1QVIZ 1Z4HA 1JC2A 1KWOC 2KQYA 1RTP1 2BCAA 2JNXA 3UO9A 1CDLA 4M2PA 1ODBA 2LMVA 3DF0A 3RM1A 2AAOA 5AERA 1AHRA 1ZUZA 1G8IA 2WC8A 1CDMA 1L7ZA 1QX7A 2QDIA 2BAPA 1QIWA 1YR5A 2Y5IA 5I2LA 1KSOA 1ALWA 1JFKA 2LVVA 4IJ7A 5AXIA 1QLKA 2CNPA 1X02A 1FW4A 1KFUL 2YGUA 1SW8A 1DJHA 1CDNA 1CB1A 1S36A 1YURA 2ISDA 1XFYO 2LV7A 3JVTB 2E30A 5ER4X 2MBXA 3QMEA 1ORGA 3O78A 1SMGA 4GBAA 1MR8A 5CPVA 3SS4A 2BBNA 2CXJA 3FWBA 4YGCB 3WNXB 1FF1A 5AFPA 3NHTA 1SSEB 3V2LA 2OPOA 1K9PA 4PCWA 1DJWA 1OQPA 1S1EA 1QX2A 3D73A 3JVTC 3LL8B 3VRQA 4XJKB 2HETA 2LUCA 1JWDA 3ZWHA 1DTLA 1OW4A 2ERBA 1AJ5A 1YTZC 1U5IB 3F45A 2KNEA 2KGBC 4ORBB 3I5FB 1SYMA 4I5JA 1BODA 1YUUA 1QV1A 4ETOA 4AQIA 1WY9A 1TNWA 2KI6C 3IVTA 2O5GA 5D7FA 1ZACA 1QTXA 2AUCA 3NGVA 4F7FA 3TUYB 3NSKA 4PHJA 2WCBA 1J7RA 4YGBB 1ALVA 3D0YA 3I5FC 4OR9B 1TRFA 1QS7A 2DOQA 1S26D 5IBWA 1UUSA 1XFVO 3DVEA 3R72A 2MJWB 2JTZA 3OGNA 1C3YA 3D76A 4MRYA 1J1EA 3OX6A 2K8MB 4UPGA 3TUYC 2NLNA 3K1EA 1PSRA 4L9MA 2ZRSA 2ZRTA 1AVSA 2BNXA 2SASA 3PN7C 2L5YA 4YI9A 1PVAA 3SG2A 1CFDA 3BUMB 1LVCD 1BMOA 3I5IC 3JTDB 1YX7A 1QJTA 1CMGA 2LLTA 4YBHB 5GQQC 4N1GA 1NSHA 2LANA 2KDHA 1G4YR 2QEHA 3PJIA 4HSZA 1EH2A 2F33A 5FI2A 1KFXS 3JTDC 1KK7Y 1AUIB 4NQGA 1F8HA 1EJ3A 1IRJA 2WCMA 2P71A 1PULA 3LK0A 3RZSA 3SG6A 3LK1A
chains in the Genus database with same CATH topology
5HKYA 4MVFA 1PVBA 2ZNEA 2SCPA 4PHKA 1J55A 2LVIA 1NX3A 3D10A 4NDCA 1B9AA 2HQWA 5K89A 5B8IB 4DUQA 1F4OA 2K7CA 1B8CA 1L2OB 1TCOB 1NX1A 3OB1B 4OCIA 2NCPA 1TCFA 3I5HC 2COLB 1S5GY 2TN4A 3DVKA 1B1GA 1G33A 1H8BA 3BUNB 1A75A 4CPVA 5KSZA 3MSEB 1L2OC 1QATA 1GJYA 1NCZA 1RROA 1YVLA 1EL4A 2KFFA 3O2PA 4FQOA 1A4PA 2D8NA 4YGAA 1V1GA 1QXPA 1K90D 3AAKA 1WLMA 1YRUB 1IG5A 2MLEC 1MF8B 4D1EA 1KQMB 3WHTB 1LA3A 2NZ0A 3ICBA 4GPLB 1DJGA 2M9GA 3RLZA 3KEVA 5HYDA 2K7OA 3BUWB 2QACA 2KBMA 3KPXA 1KK7Z 3KF9A 1RJVA 1PSBA 2CT9A 2L4IA 1NX0A 3CGAA 3SG4A 5AEQA 1D1OA 2JWWA 1DT7B 3VROA 4DCKA 1B8LA 2JULA 3SIAA 3PLFB 2BKHB 1BJFA 3I5GC 1OMDA 2ZN8A 3TDIA 4U8DA 1OMRA 2LLSA 1SR6B 1H4BA 1B7TY 1RWYA 1IKUA 2V53A 2F3YA 3DD4A 1B4CA 1S6CA 1S5GZ 2JQ6A 5D69A 1KFUS 1N0YA 1SR6C 2WCFA 4XJKA 1B47A 1BG1A 2Y1NA 1M39A 1DF0B 2K2AA 1DVIA 3NSOA 3OX5A 1IQ5A 2BCBA 4PE1A 1U5IA 2LUXA 4C0LA 1QV0A 1NIWA 2JT8A 2K61A 1KQVA 1IGVA 2Y4QA 1FBVA 1BLQA 1J7QA 4USLA 5CSFA 4JPZB 2K7DA 5DKQA 1UWOA 5DKRA 3CWGA 1NP8A 2A4JA 1WRLA 4BY5A 4ORAB 1Y1XA 3BUXB 1UHHA 2LP2A 3E3RA 4CFQA 1HT9A 1CFPA 1DJXA 5AANA 2PSRA 5HKZA 4DS7A 1J7OA 1SCVA 3SJSA 1OE9B 3SIBA 1NCXA 2ZFDA 4QJ5B 2BE4A 2MRDA 3TZ1A 2LHLA 4FTGA 1TOPA 4Q04A 2L98A 2WOSA 5I2OA 1ZFSA 1B7TZ 1DGVA 4QJ4B 1C7VA 2KHNA 1W7JB 2KQ6A 3GK2A 1MXLC 1R2UA 2KI4B 2G9BA 2MLFC 3O6BA 3QRXA 3EK7A 1BF5A 4P2YB 1MQ1A 2FJUB 2JC2A 3TDUA 1XFZO 1K93D 2KFHA 3BUOB 4GNKB 3VRRA 2WORA 4PE0A 4ZCVA 3TDZA 3WXAA 2QPTA 1UHKA 1JUOA 4A4CA 4GUKA 3PSRA 1MXEA 2EGDA 1OMVA 2I7AA 1RK9A 1EG3A 1B8RA 1IJ6A 1DGUA 1CTRA 3PALA 3WHUB 1F71A 4NDBA 2WCEA 2BBMA 2CBLA 3IF7A 3EKHA 4E68A 5CSIA 2L5XB 2LVJA 4PE7A 2I2RE 2KYFA 3CR4X 2KSPA 3SG3A 2M8UA 1KSMA 4CFRA 1JFJA 1AJ4A 2BL0B 1SNLA 1F54A 2PRUA 5I2QA 2M7NA 3AKAA 2MAZA 1Y1AA 1QLSA 1AP4A 2LCPA 5I8NA 1JF0A 3SG7A 4YRUA 1K9UA 2BL0C 3CR5X 2BCXA 2K7BA 1CKKA 2KGRA 3AAJA 1WDCB 3A8RA 2HQ8A 5JOLA 1QIVA 4C0KA 3VRPA 1LKJA 2OTGB 5F6TA 1SRAA 1XVJA 3DVJA 3LCPC 3TS5B 1A2XA 3BYAA 1WDCC 2M29A 1LXFC 2I18A 3BOWB 3VRNA 1EG4A 1SK6D 1XO5A 4OVNF 1YX8A 4GGFA 4AOMA 3TS5C 1CDPA 2ZKMX 4N5XA 3ZNIA 1OOJA 2JPTA 2VRGA 1SL7A 2LHIA 2PALA 1OSAA 2KAYA 3EKJA 3HCMA 5CSJA 1K8UA 2FOTA 5KU1A 2RGIA 2Q4UA 1NWDA 3IQQA 4MLWA 2LMTA 2JNFA 4N1FA 1KQMC 2M1UA 1HQVA 1J1DA 1M46A 3EVVA 4AQJA 2WNDA 1SY9A 1C7WA 3IQOA 1GGZA 1TIZA 5CSNA 1ZOTB 1DF0A 4MN0A 1K95A 1XFWO 2CTNA 1J7PA 2K2FA 2PVBA 2K0JA 4PHMA 3SG5A 4HREE 1NUBA 3GK1A 1OZOA 2F3ZA 3C1VA 1TNQA 1YUTA 4GGFC 2E6WA 1OZSA 1A03A 1SPYA 5HLOA 5HLVA 2LE9B 2LM5A 4HRGA 2NCOA 4MBEA 1E8AA 3FIAA 4TNCA 3KHEA 2LAPA 4GGNA 4OV2A 4QJ3B 3OHMB 4OKHA 4PE4A 2CCMA 3H4SE 4M2QA 4JQ0D 5BPJA 2H2KA 3CR2A 2L2EA 4CIDA 5FYXA 2AMIA 4ORCB 1TNPA 4IL1A 4NDDA 5J3XA 1NCYA 3LLEA 1CLBA 1PRWA 2R2IA 1CM1A 2KAVA 4I5LB 4PHNA 2LNKA 1KCYA 4HRHA 3M0WA 2M1KB 4BY4A 2HF5A 1K2HA 4R1EA 4DRWA 1K96A 2ZN9A 1FI5A 4A4BA 1NYAA 4I5KA 4WQ3A 4M2OA 4DIRA 2JT3A 3PM8A 4F0ZB 1XFUO 3DF0B 1UURA 1XA5A 1YUSA 2BE6A 4WRIA 5DKNA 2KOTA 1CNPA 2EHBA 1F55A 1DJYA 2LC5A 3CZTX 5PALA 1S3PA 1BOCA 2IS9A 1IQ3A 1UHNA 1UP5A 3PFVA 2L0PA 1C07A 3NXAA 1JF2A 1AK8A 2MA2A 1XK4A 1M63B 1DJZA 2LLUA 3DVMA 1GQMA 1BU3A 1W7IB 2KYCA 3K21A 3VGOA 1IWQA 1V1FA 1JSAA 1DJIA 4MEWA 2P6BB 2KI4C 5JJGA 1CFCA 1QASA 2LVKA 2M7LA 2B1UA 3CLNA 2ZNDA 2BECA 4YGDB 2M3WA 4MZJA 4MSPA 1CM4A 1VRKA 1Y6WA 3EK4A 1WRZA 1S6JA 2OS8B 3EVUA 1PK0D 4PDZA 3BXKA 5ER5A 2L4HA 3EVRA 3PN7B 1M45A 2F2OA 2JXLA 2JZIA 2LMUA 3CTNA 3I5IB 1DMOA 1S6IA 1SKTA 2FCDA 1TN4A 2OS8C 1N65A 3OP0A 2PMYA 2JXCA 3NSIA 2O60A 1XK4C 4ZCUA 3BOWA 1CLLA 1UHJA 3D0YB 2G2BA 4CLNA 4C0JA 1WRKA 1WLZA 3GOFA 3KO0A 2BKIB 2GGZA 2JRFA 1M31A 2KI6D 2M97A 1TTXA 1KFXL 1NPQA 2FCEA 2H61A 1PALA 2L51A 4YI8A 2F8PA 4MRXA 3O4YA 1MWNA 1XFXO 1SBJA 1IH0A 1TNXA 1MUXA 1SL8A 2M0RA 2EC6B 1QVIY 3BQ3A 3I5HB 1QX5B 2OTGC 4GFTA 1NX2A 2JU0A 2GGMA 1IJ5A 2JT0A 1FI6A 2NXQA 2HPSA 1Y0VH 2EC6C 1BR4B 1UHIA 3NSLA 1LINA 1JBAA 4WQ2A 1YRTB 1KK8B 4MZLA 1SCMB 1R6PA 1F70A 3FS7A 1GGWA 1CFFA 2Y1MA 2JTTA 1EXRA 2GV5A 2PASA 3EK8A 3PATA 2KFGA 4GAOA 1K9KA 2H61C 3GK4X 1CMFA 3A4UB 2L50A 1KK8C 1YVHA 1SCMC 1LA0A 5G08A 1ZMZA 1FPWA 5KTYA 1XYDA 2LP3A 3FWCA 1F4QA 2I94A 1MHOA 5TNCA 4I5NB 4XYNA 1RFJA 3OB2B 1N2DA 2MHHA 4P5OE 2F2PA 1SL9A 4ICBA 1Q80A 1CLMA 3CS1A 4JWQA 2M49B 1RECA 1A75B 2Q91A 2KBIA 2KAXA 3HX4A 3I5GB 1KWOB 1K94A 4MZKA 1Y1UA 1BR1B 2JOJA 4YGEB 1A29A 3AKBA 4PALA 5HKWA 1BT6A 1QVIZ 1JC2A 1KWOC 2KQYA 1RTP1 2BCAA 2JNXA 1CDLA 4M2PA 1ODBA 2LMVA 3DF0A 3RM1A 2AAOA 5AERA 1AHRA 1ZUZA 1G8IA 2WC8A 1CDMA 1L7ZA 1QX7A 1QIWA 1YR5A 2Y5IA 5I2LA 1KSOA 1ALWA 1JFKA 2LVVA 5AXIA 1QLKA 2CNPA 1X02A 1FW4A 1KFUL 1SW8A 1DJHA 1CDNA 1CB1A 1S36A 1YURA 2ISDA 1XFYO 2LV7A 3JVTB 2E30A 5ER4X 2MBXA 3O78A 1SMGA 4GBAA 1MR8A 5CPVA 2BBNA 2CXJA 3FWBA 4YGCB 3WNXB 1FF1A 5AFPA 2OPOA 1K9PA 4PCWA 1DJWA 1OQPA 1S1EA 1QX2A 3JVTC 3LL8B 3VRQA 4XJKB 2HETA 2LUCA 1JWDA 3ZWHA 1DTLA 1AJ5A 1YTZC 1U5IB 3F45A 2KNEA 2KGBC 4ORBB 3I5FB 1SYMA 4I5JA 1BODA 1YUUA 1QV1A 4ETOA 4AQIA 1WY9A 1TNWA 2KI6C 2O5GA 5D7FA 1ZACA 1QTXA 2AUCA 3TUYB 3NSKA 4PHJA 2WCBA 1J7RA 4YGBB 1ALVA 3D0YA 3I5FC 4OR9B 1TRFA 1QS7A 2DOQA 1S26D 5IBWA 1UUSA 1XFVO 3DVEA 2MJWB 2JTZA 4MRYA 1J1EA 3OX6A 2K8MB 4UPGA 3TUYC 2NLNA 1PSRA 4L9MA 2ZRSA 2ZRTA 1AVSA 2SASA 3PN7C 4YI9A 1PVAA 3SG2A 1CFDA 3BUMB 1LVCD 1BMOA 3I5IC 3JTDB 1YX7A 1QJTA 1CMGA 2LLTA 4YBHB 5GQQC 4N1GA 1NSHA 2LANA 2KDHA 1G4YR 4HSZA 1EH2A 2F33A 1KFXS 3JTDC 1KK7Y 1AUIB 4NQGA 1F8HA 1EJ3A 1IRJA 1PULA 3LK0A 3SG6A 3LK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKY A;  4MVF A;  1PVB A;  2ZNE A;  2SCP A;  4PHK A;  1J55 A;  2LVI A;  1NX3 A;  3D10 A;  4NDC A;  1B9A A;  2HQW A;  5K89 A;  5B8I B;  4DUQ A;  1F4O A;  2K7C A;  1B8C A;  1L2O B;  1TCO B;  1NX1 A;  3OB1 B;  4OCI A;  2NCP A;  1TCF A;  3I5H C;  2COL B;  1S5G Y;  2TN4 A;  3DVK A;  1B1G A;  1G33 A;  1H8B A;  3BUN B;  1A75 A;  4CPV A;  5KSZ A;  3MSE B;  1L2O C;  1QAT A;  1GJY A;  1NCZ A;  1RRO A;  1YVL A;  1EL4 A;  2KFF A;  3O2P A;  4FQO A;  1A4P A;  2D8N A;  4YGA A;  1V1G A;  1QXP A;  1K90 D;  3AAK A;  1WLM A;  1YRU B;  1IG5 A;  2MLE C;  1MF8 B;  4D1E A;  1KQM B;  3WHT B;  1LA3 A;  2NZ0 A;  3ICB A;  4GPL B;  1DJG A;  2M9G A;  3RLZ A;  3KEV A;  5HYD A;  2K7O A;  3BUW B;  2QAC A;  2KBM A;  3KPX A;  1KK7 Z;  3KF9 A;  1RJV A;  1PSB A;  2CT9 A;  2L4I A;  1NX0 A;  3CGA A;  3SG4 A;  5AEQ A;  1D1O A;  2JWW A;  1DT7 B;  3VRO A;  4DCK A;  1B8L A;  2JUL A;  3SIA A;  3PLF B;  2BKH B;  1BJF A;  3I5G C;  1OMD A;  2ZN8 A;  3TDI A;  4U8D A;  1OMR A;  2LLS A;  1SR6 B;  1H4B A;  1B7T Y;  1RWY A;  1IKU A;  2V53 A;  2F3Y A;  3DD4 A;  1B4C A;  1S6C A;  1S5G Z;  2JQ6 A;  5D69 A;  1KFU S;  1N0Y A;  1SR6 C;  2WCF A;  4XJK A;  1B47 A;  1BG1 A;  2Y1N A;  1M39 A;  1DF0 B;  2K2A A;  1DVI A;  3NSO A;  3OX5 A;  1IQ5 A;  2BCB A;  4PE1 A;  1U5I A;  2LUX A;  4C0L A;  1QV0 A;  1NIW A;  2JT8 A;  2K61 A;  1KQV A;  1IGV A;  2Y4Q A;  1FBV A;  1BLQ A;  1J7Q A;  4USL A;  5CSF A;  4JPZ B;  2K7D A;  5DKQ A;  1UWO A;  5DKR A;  3CWG A;  1NP8 A;  2A4J A;  1WRL A;  4BY5 A;  4ORA B;  1Y1X A;  3BUX B;  1UHH A;  2LP2 A;  3E3R A;  4CFQ A;  1HT9 A;  1CFP A;  1DJX A;  5AAN A;  2PSR A;  5HKZ A;  4DS7 A;  1J7O A;  1SCV A;  3SJS A;  1OE9 B;  3SIB A;  1NCX A;  2ZFD A;  4QJ5 B;  2BE4 A;  2MRD A;  3TZ1 A;  2LHL A;  4FTG A;  1TOP A;  4Q04 A;  2L98 A;  2WOS A;  5I2O A;  1ZFS A;  1B7T Z;  1DGV A;  4QJ4 B;  1C7V A;  2KHN A;  1W7J B;  2KQ6 A;  3GK2 A;  1MXL C;  1R2U A;  2KI4 B;  2G9B A;  2MLF C;  3O6B A;  3QRX A;  3EK7 A;  1BF5 A;  4P2Y B;  1MQ1 A;  2FJU B;  2JC2 A;  3TDU A;  1XFZ O;  1K93 D;  2KFH A;  3BUO B;  4GNK B;  3VRR A;  2WOR A;  4PE0 A;  4ZCV A;  3TDZ A;  3WXA A;  2QPT A;  1UHK A;  1JUO A;  4A4C A;  4GUK A;  3PSR A;  1MXE A;  2EGD A;  1OMV A;  2I7A A;  1RK9 A;  1EG3 A;  1B8R A;  1IJ6 A;  1DGU A;  1CTR A;  3PAL A;  3WHU B;  1F71 A;  4NDB A;  2WCE A;  2BBM A;  2CBL A;  3IF7 A;  3EKH A;  4E68 A;  5CSI A;  2L5X B;  2LVJ A;  4PE7 A;  2I2R E;  2KYF A;  3CR4 X;  2KSP A;  3SG3 A;  2M8U A;  1KSM A;  4CFR A;  1JFJ A;  1AJ4 A;  2BL0 B;  1SNL A;  1F54 A;  2PRU A;  5I2Q A;  2M7N A;  3AKA A;  2MAZ A;  1Y1A A;  1QLS A;  1AP4 A;  2LCP A;  5I8N A;  1JF0 A;  3SG7 A;  4YRU A;  1K9U A;  2BL0 C;  3CR5 X;  2BCX A;  2K7B A;  1CKK A;  2KGR A;  3AAJ A;  1WDC B;  3A8R A;  2HQ8 A;  5JOL A;  1QIV A;  4C0K A;  3VRP A;  1LKJ A;  2OTG B;  5F6T A;  1SRA A;  1XVJ A;  3DVJ A;  3LCP C;  3TS5 B;  1A2X A;  3BYA A;  1WDC C;  2M29 A;  1LXF C;  2I18 A;  3BOW B;  3VRN A;  1EG4 A;  1SK6 D;  1XO5 A;  4OVN F;  1YX8 A;  4GGF A;  4AOM A;  3TS5 C;  1CDP A;  2ZKM X;  4N5X A;  3ZNI A;  1OOJ A;  2JPT A;  2VRG A;  1SL7 A;  2LHI A;  2PAL A;  1OSA A;  2KAY A;  3EKJ A;  3HCM A;  5CSJ A;  1K8U A;  2FOT A;  5KU1 A;  2RGI A;  2Q4U A;  1NWD A;  3IQQ A;  4MLW A;  2LMT A;  2JNF A;  4N1F A;  1KQM C;  2M1U A;  1HQV A;  1J1D A;  1M46 A;  3EVV A;  4AQJ A;  2WND A;  1SY9 A;  1C7W A;  3IQO A;  1GGZ A;  1TIZ A;  5CSN A;  1ZOT B;  1DF0 A;  4MN0 A;  1K95 A;  1XFW O;  2CTN A;  1J7P A;  2K2F A;  2PVB A;  2K0J A;  4PHM A;  3SG5 A;  4HRE E;  1NUB A;  3GK1 A;  1OZO A;  2F3Z A;  3C1V A;  1TNQ A;  1YUT A;  4GGF C;  2E6W A;  1OZS A;  1A03 A;  1SPY A;  5HLO A;  5HLV A;  2LE9 B;  2LM5 A;  4HRG A;  2NCO A;  4MBE A;  1E8A A;  3FIA A;  4TNC A;  3KHE A;  2LAP A;  4GGN A;  4OV2 A;  4QJ3 B;  3OHM B;  4OKH A;  4PE4 A;  2CCM A;  3H4S E;  4M2Q A;  4JQ0 D;  5BPJ A;  2H2K A;  3CR2 A;  2L2E A;  4CID A;  5FYX A;  2AMI A;  4ORC B;  1TNP A;  4IL1 A;  4NDD A;  5J3X A;  1NCY A;  3LLE A;  1CLB A;  1PRW A;  2R2I A;  1CM1 A;  2KAV A;  4I5L B;  4PHN A;  2LNK A;  1KCY A;  4HRH A;  3M0W A;  2M1K B;  4BY4 A;  2HF5 A;  1K2H A;  4R1E A;  4DRW A;  1K96 A;  2ZN9 A;  1FI5 A;  4A4B A;  1NYA A;  4I5K A;  4WQ3 A;  4M2O A;  4DIR A;  2JT3 A;  3PM8 A;  4F0Z B;  1XFU O;  3DF0 B;  1UUR A;  1XA5 A;  1YUS A;  2BE6 A;  4WRI A;  5DKN A;  2KOT A;  1CNP A;  2EHB A;  1F55 A;  1DJY A;  2LC5 A;  3CZT X;  5PAL A;  1S3P A;  1BOC A;  2IS9 A;  1IQ3 A;  1UHN A;  1UP5 A;  3PFV A;  2L0P A;  1C07 A;  3NXA A;  1JF2 A;  1AK8 A;  2MA2 A;  1XK4 A;  1M63 B;  1DJZ A;  2LLU A;  3DVM A;  1GQM A;  1BU3 A;  1W7I B;  2KYC A;  3K21 A;  3VGO A;  1IWQ A;  1V1F A;  1JSA A;  1DJI A;  4MEW A;  2P6B B;  2KI4 C;  5JJG A;  1CFC A;  1QAS A;  2LVK A;  2M7L A;  2B1U A;  3CLN A;  2ZND A;  2BEC A;  4YGD B;  2M3W A;  4MZJ A;  4MSP A;  1CM4 A;  1VRK A;  1Y6W A;  3EK4 A;  1WRZ A;  1S6J A;  2OS8 B;  3EVU A;  1PK0 D;  4PDZ A;  3BXK A;  5ER5 A;  2L4H A;  3EVR A;  3PN7 B;  1M45 A;  2F2O A;  2JXL A;  2JZI A;  2LMU A;  3CTN A;  3I5I B;  1DMO A;  1S6I A;  1SKT A;  2FCD A;  1TN4 A;  2OS8 C;  1N65 A;  3OP0 A;  2PMY A;  2JXC A;  3NSI A;  2O60 A;  1XK4 C;  4ZCU A;  3BOW A;  1CLL A;  1UHJ A;  3D0Y B;  2G2B A;  4CLN A;  4C0J A;  1WRK A;  1WLZ A;  3GOF A;  3KO0 A;  2BKI B;  2GGZ A;  2JRF A;  1M31 A;  2KI6 D;  2M97 A;  1TTX A;  1KFX L;  1NPQ A;  2FCE A;  2H61 A;  1PAL A;  2L51 A;  4YI8 A;  2F8P A;  4MRX A;  3O4Y A;  1MWN A;  1XFX O;  1SBJ A;  1IH0 A;  1TNX A;  1MUX A;  1SL8 A;  2M0R A;  2EC6 B;  1QVI Y;  3BQ3 A;  3I5H B;  1QX5 B;  2OTG C;  4GFT A;  1NX2 A;  2JU0 A;  2GGM A;  1IJ5 A;  2JT0 A;  1FI6 A;  2NXQ A;  2HPS A;  1Y0V H;  2EC6 C;  1BR4 B;  1UHI A;  3NSL A;  1LIN A;  1JBA A;  4WQ2 A;  1YRT B;  1KK8 B;  4MZL A;  1SCM B;  1R6P A;  1F70 A;  3FS7 A;  1GGW A;  1CFF A;  2Y1M A;  2JTT A;  1EXR A;  2GV5 A;  2PAS A;  3EK8 A;  3PAT A;  2KFG A;  4GAO A;  1K9K A;  2H61 C;  3GK4 X;  1CMF A;  3A4U B;  2L50 A;  1KK8 C;  1YVH A;  1SCM C;  1LA0 A;  5G08 A;  1ZMZ A;  1FPW A;  5KTY A;  1XYD A;  2LP3 A;  3FWC A;  1F4Q A;  2I94 A;  1MHO A;  5TNC A;  4I5N B;  4XYN A;  1RFJ A;  3OB2 B;  1N2D A;  2MHH A;  4P5O E;  2F2P A;  1SL9 A;  4ICB A;  1Q80 A;  1CLM A;  3CS1 A;  4JWQ A;  2M49 B;  1REC A;  1A75 B;  2Q91 A;  2KBI A;  2KAX A;  3HX4 A;  3I5G B;  1KWO B;  1K94 A;  4MZK A;  1Y1U A;  1BR1 B;  2JOJ A;  4YGE B;  1A29 A;  3AKB A;  4PAL A;  5HKW A;  1BT6 A;  1QVI Z;  1JC2 A;  1KWO C;  2KQY A;  1RTP 1;  2BCA A;  2JNX A;  1CDL A;  4M2P A;  1ODB A;  2LMV A;  3DF0 A;  3RM1 A;  2AAO A;  5AER A;  1AHR A;  1ZUZ A;  1G8I A;  2WC8 A;  1CDM A;  1L7Z A;  1QX7 A;  1QIW A;  1YR5 A;  2Y5I A;  5I2L A;  1KSO A;  1ALW A;  1JFK A;  2LVV A;  5AXI A;  1QLK A;  2CNP A;  1X02 A;  1FW4 A;  1KFU L;  1SW8 A;  1DJH A;  1CDN A;  1CB1 A;  1S36 A;  1YUR A;  2ISD A;  1XFY O;  2LV7 A;  3JVT B;  2E30 A;  5ER4 X;  2MBX A;  3O78 A;  1SMG A;  4GBA A;  1MR8 A;  5CPV A;  2BBN A;  2CXJ A;  3FWB A;  4YGC B;  3WNX B;  1FF1 A;  5AFP A;  2OPO A;  1K9P A;  4PCW A;  1DJW A;  1OQP A;  1S1E A;  1QX2 A;  3JVT C;  3LL8 B;  3VRQ A;  4XJK B;  2HET A;  2LUC A;  1JWD A;  3ZWH A;  1DTL A;  1AJ5 A;  1YTZ C;  1U5I B;  3F45 A;  2KNE A;  2KGB C;  4ORB B;  3I5F B;  1SYM A;  4I5J A;  1BOD A;  1YUU A;  1QV1 A;  4ETO A;  4AQI A;  1WY9 A;  1TNW A;  2KI6 C;  2O5G A;  5D7F A;  1ZAC A;  1QTX A;  2AUC A;  3TUY B;  3NSK A;  4PHJ A;  2WCB A;  1J7R A;  4YGB B;  1ALV A;  3D0Y A;  3I5F C;  4OR9 B;  1TRF A;  1QS7 A;  2DOQ A;  1S26 D;  5IBW A;  1UUS A;  1XFV O;  3DVE A;  2MJW B;  2JTZ A;  4MRY A;  1J1E A;  3OX6 A;  2K8M B;  4UPG A;  3TUY C;  2NLN A;  1PSR A;  4L9M A;  2ZRS A;  2ZRT A;  1AVS A;  2SAS A;  3PN7 C;  4YI9 A;  1PVA A;  3SG2 A;  1CFD A;  3BUM B;  1LVC D;  1BMO A;  3I5I C;  3JTD B;  1YX7 A;  1QJT A;  1CMG A;  2LLT A;  4YBH B;  5GQQ C;  4N1G A;  1NSH A;  2LAN A;  2KDH A;  1G4Y R;  4HSZ A;  1EH2 A;  2F33 A;  1KFX S;  3JTD C;  1KK7 Y;  1AUI B;  4NQG A;  1F8H A;  1EJ3 A;  1IRJ A;  1PUL A;  3LK0 A;  3SG6 A;  3LK1 A; 
#chains in the Genus database with same CATH topology
 5HKY A;  4MVF A;  1PVB A;  2ZNE A;  2SCP A;  4PHK A;  1J55 A;  3S0B A;  2FJY A;  1NX3 A;  2LVI A;  2KLD A;  3D10 A;  4NDC A;  1B9A A;  2HQW A;  5K89 A;  5B8I B;  2PQL A;  4DUQ A;  1F4O A;  2K7C A;  1B8C A;  3EG5 B;  1L2O B;  1TCO B;  1NX1 A;  3OB1 B;  4OCI A;  3DY9 A;  2NCP A;  1TCF A;  3I5H C;  2COL B;  1S5G Y;  2TN4 A;  3DVK A;  1B1G A;  1G33 A;  1H8B A;  3BUN B;  1A75 A;  4CPV A;  1LS8 A;  5KSZ A;  1IIO A;  3MSE B;  1L2O C;  1QAT A;  1GJY A;  1NCZ A;  1RRO A;  1YVL A;  1EL4 A;  2KFF A;  2QEB A;  3O2P A;  1A4P A;  2D8N A;  4FQO A;  1V1G A;  4YGA A;  1QXP A;  1K90 D;  3NHI A;  1TWO A;  3AAK A;  2WC5 A;  1WLM A;  1YRU B;  1IG5 A;  2MLE C;  1MF8 B;  4D1E A;  1KQM B;  3B88 A;  3WHT B;  1LA3 A;  2NZ0 A;  3ICB A;  5DIC A;  4GPL B;  1DJG A;  2M9G A;  3RLZ A;  3KEV A;  5HL1 A;  5HYD A;  2K7O A;  3BUW B;  2QAC A;  2KBM A;  3KPX A;  1KK7 Z;  2KLE A;  3KF9 A;  1RJV A;  1PSB A;  2CT9 A;  2L4I A;  1NX0 A;  3CGA A;  3SG4 A;  5AEQ A;  1D1O A;  2JWW A;  1DT7 B;  3VRO A;  2WCK A;  4DCK A;  1B8L A;  2JUL A;  3SIA A;  3PLF B;  2BKH B;  1BJF A;  3I5G C;  1OMD A;  3R1O A;  2ZN8 A;  3TDI A;  2PYQ A;  3FE9 A;  4U8D A;  1OMR A;  3L47 A;  2LLS A;  1SR6 B;  1H4B A;  1B7T Y;  1RWY A;  1IKU A;  2V53 A;  2F3Y A;  3DD4 A;  1B4C A;  1S6C A;  1S5G Z;  1W9Z A;  2JQ6 A;  2P70 A;  5D69 A;  1KFU S;  1N0Y A;  1SR6 C;  2WCF A;  3D75 A;  1B47 A;  2QEO A;  4XJK A;  1BG1 A;  2Y1N A;  1M39 A;  1DF0 B;  2K2A A;  1DVI A;  3NSO A;  3OX5 A;  1IQ5 A;  2BCB A;  4PE1 A;  1U5I A;  2LUX A;  4PT1 A;  4C0L A;  1QV0 A;  1NIW A;  2JT8 A;  2K61 A;  3CAB A;  1KQV A;  1IGV A;  2Y4Q A;  1FBV A;  4JKT A;  1BLQ A;  1J7Q A;  4USL A;  5CSF A;  3DYE A;  4JPZ B;  2K7D A;  3CZ0 A;  2WCH A;  1UWO A;  5DKR A;  5DKQ A;  3CWG A;  1NP8 A;  3D78 A;  2A4J A;  1WRL A;  4BY5 A;  4ORA B;  1Y1X A;  1OOH A;  3BUX B;  1UHH A;  2LP2 A;  3E3R A;  4CFQ A;  3B6X A;  1HT9 A;  1CFP A;  1DJX A;  5AAN A;  2PSR A;  5HKZ A;  4DS7 A;  3BFB A;  1SCV A;  1J7O A;  3SJS A;  1OE9 B;  3SIB A;  1NCX A;  2ZFD A;  4QJ5 B;  2BE4 A;  2MRD A;  3TZ1 A;  2LHL A;  4FTG A;  1TOP A;  4Q04 A;  2L98 A;  2WOS A;  5I2O A;  1ZFS A;  1B7T Z;  1DGV A;  1DEK A;  4QJ4 B;  1C7V A;  2KHN A;  1W7J B;  2KQ6 A;  3GK2 A;  3OBV A;  3CZ2 A;  1MXL C;  1R2U A;  2KI4 B;  2G9B A;  2MLF C;  3O6B A;  3QRX A;  3EK7 A;  1BF5 A;  4P2Y B;  1MQ1 A;  2FJU B;  2JC2 A;  3TDU A;  1XFZ O;  1K93 D;  2KFH A;  3BFH A;  3BUO B;  4GNK B;  3VRR A;  2WOR A;  4PE0 A;  4ZCV A;  3TDZ A;  3WXA A;  2QPT A;  1UHK A;  1JUO A;  4A4C A;  4GUK A;  3PSR A;  1MXE A;  2EGD A;  1OMV A;  2I7A A;  1RK9 A;  1EG3 A;  1B8R A;  1IJ6 A;  1DGU A;  1CTR A;  3PAL A;  3Q8I A;  3WHU B;  1F71 A;  3BFA A;  4NDB A;  4OZD A;  2WCE A;  2BBM A;  2CBL A;  3IF7 A;  3EKH A;  4E68 A;  5CSI A;  2L5X B;  2LVJ A;  4PE7 A;  2I2R E;  2KYF A;  3D74 A;  3CR4 X;  2KSP A;  3SG3 A;  2M8U A;  1KSM A;  5EL2 A;  4CFR A;  1AJ4 A;  2BL0 B;  1JFJ A;  1P28 A;  1SNL A;  1F54 A;  2PRU A;  5I2Q A;  2M7N A;  3AKA A;  2MAZ A;  1Y1A A;  1QLS A;  1AP4 A;  1OOI X;  2LCP A;  5I8N A;  1JF0 A;  3R1V A;  3SG7 A;  3CZ1 A;  3D77 A;  1K9U A;  2BL0 C;  4YRU A;  3CR5 X;  2BCX A;  2K7B A;  1CKK A;  2KGR A;  3AAJ A;  1WDC B;  3A8R A;  2HQ8 A;  5JOL A;  1QIV A;  4C0K A;  3S0F A;  3VRP A;  1LKJ A;  2OTG B;  5F6T A;  1DEL A;  1SRA A;  1XVJ A;  3DVJ A;  3LCP C;  3TS5 B;  1A2X A;  2H8V A;  3BYA A;  1WDC C;  2M29 A;  1LXF C;  2I18 A;  3BOW B;  3VRN A;  1EG4 A;  1SK6 D;  1XO5 A;  4OVN F;  1YX8 A;  4GGF A;  4AOM A;  3TS5 C;  1CDP A;  2ZKM X;  4N5X A;  3ZNI A;  1OOJ A;  2JPT A;  2VRG A;  1SL7 A;  2LHI A;  2PAL A;  1OSA A;  2KAY A;  3EKJ A;  3HCM A;  5CSJ A;  1K8U A;  2FOT A;  5KU1 A;  2RGI A;  2Q4U A;  1NWD A;  3IQQ A;  4MLW A;  2LMT A;  2JNF A;  4N1F A;  3DXL A;  1KQM C;  2M1U A;  1HQV A;  1J1D A;  1M46 A;  3EVV A;  4AQJ A;  2WND A;  1SY9 A;  1C7W A;  3L4L A;  3IQO A;  1GGZ A;  1T14 A;  1TIZ A;  5CSN A;  1ZOT B;  1DF0 A;  4MN0 A;  1K95 A;  1XFW O;  2CTN A;  1J7P A;  2K2F A;  2PVB A;  2K0J A;  4PHM A;  3SG5 A;  4HRE E;  1NUB A;  2L2C A;  3GK1 A;  1OZO A;  2F3Z A;  3C1V A;  1TNQ A;  1YUT A;  4GGF C;  3B87 A;  2E6W A;  1OZS A;  1A03 A;  1SPY A;  5HLO A;  5HLV A;  2LE9 B;  2LM5 A;  4HRG A;  2NCO A;  4MBE A;  1E8A A;  3FIA A;  4TNC A;  3B7A A;  3KHE A;  2LAP A;  2GTE A;  1C3Z A;  4GGN A;  4OV2 A;  4QJ3 B;  1DC1 A;  3OHM B;  4OKH A;  4PE4 A;  2CCM A;  3H4S E;  4M2Q A;  4JQ0 D;  5BPJ A;  2H2K A;  3CR2 A;  2L2E A;  3R1P A;  1TUJ A;  5FYX A;  4CID A;  3CDN A;  2AMI A;  3FE6 A;  4ORC B;  1TNP A;  4IL1 A;  4NDD A;  5J3X A;  1NCY A;  3LLE A;  1CLB A;  1PRW A;  2R2I A;  1CM1 A;  2KAV A;  1TUZ A;  4I5L B;  4PHN A;  2LNK A;  1KCY A;  4HRH A;  3M0W A;  2M1K B;  4BY4 A;  2HF5 A;  1K2H A;  4R1E A;  4DRW A;  1K96 A;  4INX A;  2ZN9 A;  1FI5 A;  4A4B A;  1DQE A;  1NYA A;  4I5K A;  4WQ3 A;  4M2O A;  4DIR A;  2JT3 A;  4FQT A;  3PM8 A;  4F0Z B;  3L4A A;  1XFU O;  3DF0 B;  1UUR A;  1XA5 A;  1YUS A;  2BE6 A;  4WRI A;  5DKN A;  2KOT A;  2WCJ A;  2EHB A;  3S0E A;  1CNP A;  1F55 A;  1DJY A;  2LC5 A;  3CZT X;  5PAL A;  1S3P A;  1BOC A;  2IS9 A;  1IQ3 A;  1UHN A;  1UP5 A;  3PFV A;  2L0P A;  1C07 A;  2WCL A;  3NXA A;  1JF2 A;  1AK8 A;  2MA2 A;  1XK4 A;  1M63 B;  1DJZ A;  2LLU A;  3DVM A;  1GQM A;  1BU3 A;  1W7I B;  2KYC A;  3K21 A;  3VGO A;  1IWQ A;  1V1F A;  1JSA A;  2WC6 A;  3UNW A;  1DJI A;  4MEW A;  2P6B B;  2KI4 C;  5JJG A;  1CFC A;  3S0G A;  1QAS A;  2LVK A;  2M7L A;  3O4X A;  2B1U A;  3CLN A;  2ZND A;  2BEC A;  4YGD B;  2M3W A;  4MZJ A;  4MSP A;  1CM4 A;  3SS3 A;  1VRK A;  1Y6W A;  3EK4 A;  1WRZ A;  1S6J A;  2OS8 B;  3BJH A;  3EVU A;  1PK0 D;  4PDZ A;  3CYZ A;  3BXK A;  5ER5 A;  2L4H A;  3EVR A;  3PM2 A;  3PN7 B;  1M45 A;  2F2O A;  2JXL A;  2JZI A;  2LMU A;  3CTN A;  3I5I B;  1DMO A;  3VB1 A;  1S6I A;  1SKT A;  4INW A;  2FCD A;  2K60 A;  1TN4 A;  2OS8 C;  1N65 A;  3OP0 A;  2PMY A;  2JXC A;  3NSI A;  2O60 A;  4JD9 A;  1XK4 C;  4ZCU A;  4KYN A;  3BOW A;  1CLL A;  1UHJ A;  3N7H A;  3D0Y B;  2G2B A;  4CLN A;  4C0J A;  1WRK A;  1WLZ A;  3GOF A;  3KO0 A;  2BKI B;  5I94 A;  2GGZ A;  2JRF A;  1M31 A;  1OOG A;  2KI6 D;  2M97 A;  1TTX A;  1KFX L;  1NPQ A;  2FCE A;  2H61 A;  1PAL A;  2L51 A;  3B86 A;  2F8P A;  4YI8 A;  1OOF A;  4MRX A;  3O4Y A;  1MWN A;  1XFX O;  1SBJ A;  1IH0 A;  1Z2C B;  1QWV A;  3S0A A;  1GM0 A;  1TNX A;  1MUX A;  1SL8 A;  2M0R A;  2EC6 B;  1QVI Y;  3BQ3 A;  3I5H B;  5FI7 A;  1QX5 B;  2OTG C;  4GFT A;  1NX2 A;  2JU0 A;  3FE8 A;  2GGM A;  1IJ5 A;  2JT0 A;  1FI6 A;  2NXQ A;  2HPS A;  1Y0V H;  2EC6 C;  1BR4 B;  1UHI A;  3NSL A;  1LIN A;  1JBA A;  4WQ2 A;  1YRT B;  1KK8 B;  4MZL A;  1SCM B;  1XFR A;  3SS5 A;  1R6P A;  1F70 A;  2JPO A;  3FS7 A;  1GGW A;  1CFF A;  2Y1M A;  2JTT A;  1EXR A;  2GV5 A;  2PAS A;  3EK8 A;  3PAT A;  2KFG A;  4GAO A;  1K9K A;  2H61 C;  3GK4 X;  1CMF A;  3A4U B;  2L50 A;  1KK8 C;  1YVH A;  1SCM C;  1LA0 A;  5G08 A;  1ZMZ A;  5D3O A;  1FPW A;  5KTY A;  1XYD A;  2LP3 A;  3FWC A;  1F4Q A;  2I94 A;  1MHO A;  5TNC A;  4I5N B;  4XYN A;  1RFJ A;  3OB2 B;  1N2D A;  2MHH A;  4P5O E;  2F2P A;  1SL9 A;  4ICB A;  1Q80 A;  1CLM A;  2QEV A;  3CS1 A;  4JWQ A;  2M49 B;  1REC A;  1A75 B;  2Q91 A;  2KBI A;  2KAX A;  3HX4 A;  3I5G B;  1KWO B;  1K94 A;  2KPH A;  4MZK A;  1Y1U A;  1BR1 B;  2JOJ A;  3DZT A;  3S0D A;  5FI6 A;  4YGE B;  1A29 A;  3AKB A;  4PAL A;  5HKW A;  1BT6 A;  1QVI Z;  1Z4H A;  1JC2 A;  1KWO C;  2KQY A;  1RTP 1;  2BCA A;  2JNX A;  3UO9 A;  1CDL A;  4M2P A;  1ODB A;  2LMV A;  3DF0 A;  3RM1 A;  2AAO A;  5AER A;  1AHR A;  1ZUZ A;  1G8I A;  2WC8 A;  1CDM A;  1L7Z A;  1QX7 A;  2QDI A;  2BAP A;  1QIW A;  1YR5 A;  2Y5I A;  5I2L A;  1KSO A;  1ALW A;  1JFK A;  2LVV A;  4IJ7 A;  5AXI A;  1QLK A;  2CNP A;  1X02 A;  1FW4 A;  1KFU L;  2YGU A;  1SW8 A;  1DJH A;  1CDN A;  1CB1 A;  1S36 A;  1YUR A;  2ISD A;  1XFY O;  2LV7 A;  3JVT B;  2E30 A;  5ER4 X;  2MBX A;  3QME A;  1ORG A;  3O78 A;  1SMG A;  4GBA A;  1MR8 A;  5CPV A;  3SS4 A;  2BBN A;  2CXJ A;  3FWB A;  4YGC B;  3WNX B;  1FF1 A;  5AFP A;  3NHT A;  1SSE B;  3V2L A;  2OPO A;  1K9P A;  4PCW A;  1DJW A;  1OQP A;  1S1E A;  1QX2 A;  3D73 A;  3JVT C;  3LL8 B;  3VRQ A;  4XJK B;  2HET A;  2LUC A;  1JWD A;  3ZWH A;  1DTL A;  1OW4 A;  2ERB A;  1AJ5 A;  1YTZ C;  1U5I B;  3F45 A;  2KNE A;  2KGB C;  4ORB B;  3I5F B;  1SYM A;  4I5J A;  1BOD A;  1YUU A;  1QV1 A;  4ETO A;  4AQI A;  1WY9 A;  1TNW A;  2KI6 C;  3IVT A;  2O5G A;  5D7F A;  1ZAC A;  1QTX A;  2AUC A;  3NGV A;  4F7F A;  3TUY B;  3NSK A;  4PHJ A;  2WCB A;  1J7R A;  4YGB B;  1ALV A;  3D0Y A;  3I5F C;  4OR9 B;  1TRF A;  1QS7 A;  2DOQ A;  1S26 D;  5IBW A;  1UUS A;  1XFV O;  3DVE A;  3R72 A;  2MJW B;  2JTZ A;  3OGN A;  1C3Y A;  3D76 A;  4MRY A;  1J1E A;  3OX6 A;  2K8M B;  4UPG A;  3TUY C;  2NLN A;  3K1E A;  1PSR A;  4L9M A;  2ZRS A;  2ZRT A;  1AVS A;  2BNX A;  2SAS A;  3PN7 C;  2L5Y A;  4YI9 A;  1PVA A;  3SG2 A;  1CFD A;  3BUM B;  1LVC D;  1BMO A;  3I5I C;  3JTD B;  1YX7 A;  1QJT A;  1CMG A;  2LLT A;  4YBH B;  5GQQ C;  4N1G A;  1NSH A;  2LAN A;  2KDH A;  1G4Y R;  2QEH A;  3PJI A;  4HSZ A;  1EH2 A;  2F33 A;  5FI2 A;  1KFX S;  3JTD C;  1KK7 Y;  1AUI B;  4NQG A;  1F8H A;  1EJ3 A;  1IRJ A;  2WCM A;  2P71 A;  1PUL A;  3LK0 A;  3RZS A;  3SG6 A;  3LK1 A; 
#chains in the Genus database with same CATH homology
 5HKY A;  4MVF A;  1PVB A;  2ZNE A;  2SCP A;  4PHK A;  1J55 A;  2LVI A;  1NX3 A;  3D10 A;  4NDC A;  1B9A A;  2HQW A;  5K89 A;  5B8I B;  4DUQ A;  1F4O A;  2K7C A;  1B8C A;  1L2O B;  1TCO B;  1NX1 A;  3OB1 B;  4OCI A;  2NCP A;  1TCF A;  3I5H C;  2COL B;  1S5G Y;  2TN4 A;  3DVK A;  1B1G A;  1G33 A;  1H8B A;  3BUN B;  1A75 A;  4CPV A;  5KSZ A;  3MSE B;  1L2O C;  1QAT A;  1GJY A;  1NCZ A;  1RRO A;  1YVL A;  1EL4 A;  2KFF A;  3O2P A;  4FQO A;  1A4P A;  2D8N A;  4YGA A;  1V1G A;  1QXP A;  1K90 D;  3AAK A;  1WLM A;  1YRU B;  1IG5 A;  2MLE C;  1MF8 B;  4D1E A;  1KQM B;  3WHT B;  1LA3 A;  2NZ0 A;  3ICB A;  4GPL B;  1DJG A;  2M9G A;  3RLZ A;  3KEV A;  5HYD A;  2K7O A;  3BUW B;  2QAC A;  2KBM A;  3KPX A;  1KK7 Z;  3KF9 A;  1RJV A;  1PSB A;  2CT9 A;  2L4I A;  1NX0 A;  3CGA A;  3SG4 A;  5AEQ A;  1D1O A;  2JWW A;  1DT7 B;  3VRO A;  4DCK A;  1B8L A;  2JUL A;  3SIA A;  3PLF B;  2BKH B;  1BJF A;  3I5G C;  1OMD A;  2ZN8 A;  3TDI A;  4U8D A;  1OMR A;  2LLS A;  1SR6 B;  1H4B A;  1B7T Y;  1RWY A;  1IKU A;  2V53 A;  2F3Y A;  3DD4 A;  1B4C A;  1S6C A;  1S5G Z;  2JQ6 A;  5D69 A;  1KFU S;  1N0Y A;  1SR6 C;  2WCF A;  4XJK A;  1B47 A;  1BG1 A;  2Y1N A;  1M39 A;  1DF0 B;  2K2A A;  1DVI A;  3NSO A;  3OX5 A;  1IQ5 A;  2BCB A;  4PE1 A;  1U5I A;  2LUX A;  4C0L A;  1QV0 A;  1NIW A;  2JT8 A;  2K61 A;  1KQV A;  1IGV A;  2Y4Q A;  1FBV A;  1BLQ A;  1J7Q A;  4USL A;  5CSF A;  4JPZ B;  2K7D A;  5DKQ A;  1UWO A;  5DKR A;  3CWG A;  1NP8 A;  2A4J A;  1WRL A;  4BY5 A;  4ORA B;  1Y1X A;  3BUX B;  1UHH A;  2LP2 A;  3E3R A;  4CFQ A;  1HT9 A;  1CFP A;  1DJX A;  5AAN A;  2PSR A;  5HKZ A;  4DS7 A;  1J7O A;  1SCV A;  3SJS A;  1OE9 B;  3SIB A;  1NCX A;  2ZFD A;  4QJ5 B;  2BE4 A;  2MRD A;  3TZ1 A;  2LHL A;  4FTG A;  1TOP A;  4Q04 A;  2L98 A;  2WOS A;  5I2O A;  1ZFS A;  1B7T Z;  1DGV A;  4QJ4 B;  1C7V A;  2KHN A;  1W7J B;  2KQ6 A;  3GK2 A;  1MXL C;  1R2U A;  2KI4 B;  2G9B A;  2MLF C;  3O6B A;  3QRX A;  3EK7 A;  1BF5 A;  4P2Y B;  1MQ1 A;  2FJU B;  2JC2 A;  3TDU A;  1XFZ O;  1K93 D;  2KFH A;  3BUO B;  4GNK B;  3VRR A;  2WOR A;  4PE0 A;  4ZCV A;  3TDZ A;  3WXA A;  2QPT A;  1UHK A;  1JUO A;  4A4C A;  4GUK A;  3PSR A;  1MXE A;  2EGD A;  1OMV A;  2I7A A;  1RK9 A;  1EG3 A;  1B8R A;  1IJ6 A;  1DGU A;  1CTR A;  3PAL A;  3WHU B;  1F71 A;  4NDB A;  2WCE A;  2BBM A;  2CBL A;  3IF7 A;  3EKH A;  4E68 A;  5CSI A;  2L5X B;  2LVJ A;  4PE7 A;  2I2R E;  2KYF A;  3CR4 X;  2KSP A;  3SG3 A;  2M8U A;  1KSM A;  4CFR A;  1JFJ A;  1AJ4 A;  2BL0 B;  1SNL A;  1F54 A;  2PRU A;  5I2Q A;  2M7N A;  3AKA A;  2MAZ A;  1Y1A A;  1QLS A;  1AP4 A;  2LCP A;  5I8N A;  1JF0 A;  3SG7 A;  4YRU A;  1K9U A;  2BL0 C;  3CR5 X;  2BCX A;  2K7B A;  1CKK A;  2KGR A;  3AAJ A;  1WDC B;  3A8R A;  2HQ8 A;  5JOL A;  1QIV A;  4C0K A;  3VRP A;  1LKJ A;  2OTG B;  5F6T A;  1SRA A;  1XVJ A;  3DVJ A;  3LCP C;  3TS5 B;  1A2X A;  3BYA A;  1WDC C;  2M29 A;  1LXF C;  2I18 A;  3BOW B;  3VRN A;  1EG4 A;  1SK6 D;  1XO5 A;  4OVN F;  1YX8 A;  4GGF A;  4AOM A;  3TS5 C;  1CDP A;  2ZKM X;  4N5X A;  3ZNI A;  1OOJ A;  2JPT A;  2VRG A;  1SL7 A;  2LHI A;  2PAL A;  1OSA A;  2KAY A;  3EKJ A;  3HCM A;  5CSJ A;  1K8U A;  2FOT A;  5KU1 A;  2RGI A;  2Q4U A;  1NWD A;  3IQQ A;  4MLW A;  2LMT A;  2JNF A;  4N1F A;  1KQM C;  2M1U A;  1HQV A;  1J1D A;  1M46 A;  3EVV A;  4AQJ A;  2WND A;  1SY9 A;  1C7W A;  3IQO A;  1GGZ A;  1TIZ A;  5CSN A;  1ZOT B;  1DF0 A;  4MN0 A;  1K95 A;  1XFW O;  2CTN A;  1J7P A;  2K2F A;  2PVB A;  2K0J A;  4PHM A;  3SG5 A;  4HRE E;  1NUB A;  3GK1 A;  1OZO A;  2F3Z A;  3C1V A;  1TNQ A;  1YUT A;  4GGF C;  2E6W A;  1OZS A;  1A03 A;  1SPY A;  5HLO A;  5HLV A;  2LE9 B;  2LM5 A;  4HRG A;  2NCO A;  4MBE A;  1E8A A;  3FIA A;  4TNC A;  3KHE A;  2LAP A;  4GGN A;  4OV2 A;  4QJ3 B;  3OHM B;  4OKH A;  4PE4 A;  2CCM A;  3H4S E;  4M2Q A;  4JQ0 D;  5BPJ A;  2H2K A;  3CR2 A;  2L2E A;  4CID A;  5FYX A;  2AMI A;  4ORC B;  1TNP A;  4IL1 A;  4NDD A;  5J3X A;  1NCY A;  3LLE A;  1CLB A;  1PRW A;  2R2I A;  1CM1 A;  2KAV A;  4I5L B;  4PHN A;  2LNK A;  1KCY A;  4HRH A;  3M0W A;  2M1K B;  4BY4 A;  2HF5 A;  1K2H A;  4R1E A;  4DRW A;  1K96 A;  2ZN9 A;  1FI5 A;  4A4B A;  1NYA A;  4I5K A;  4WQ3 A;  4M2O A;  4DIR A;  2JT3 A;  3PM8 A;  4F0Z B;  1XFU O;  3DF0 B;  1UUR A;  1XA5 A;  1YUS A;  2BE6 A;  4WRI A;  5DKN A;  2KOT A;  1CNP A;  2EHB A;  1F55 A;  1DJY A;  2LC5 A;  3CZT X;  5PAL A;  1S3P A;  1BOC A;  2IS9 A;  1IQ3 A;  1UHN A;  1UP5 A;  3PFV A;  2L0P A;  1C07 A;  3NXA A;  1JF2 A;  1AK8 A;  2MA2 A;  1XK4 A;  1M63 B;  1DJZ A;  2LLU A;  3DVM A;  1GQM A;  1BU3 A;  1W7I B;  2KYC A;  3K21 A;  3VGO A;  1IWQ A;  1V1F A;  1JSA A;  1DJI A;  4MEW A;  2P6B B;  2KI4 C;  5JJG A;  1CFC A;  1QAS A;  2LVK A;  2M7L A;  2B1U A;  3CLN A;  2ZND A;  2BEC A;  4YGD B;  2M3W A;  4MZJ A;  4MSP A;  1CM4 A;  1VRK A;  1Y6W A;  3EK4 A;  1WRZ A;  1S6J A;  2OS8 B;  3EVU A;  1PK0 D;  4PDZ A;  3BXK A;  5ER5 A;  2L4H A;  3EVR A;  3PN7 B;  1M45 A;  2F2O A;  2JXL A;  2JZI A;  2LMU A;  3CTN A;  3I5I B;  1DMO A;  1S6I A;  1SKT A;  2FCD A;  1TN4 A;  2OS8 C;  1N65 A;  3OP0 A;  2PMY A;  2JXC A;  3NSI A;  2O60 A;  1XK4 C;  4ZCU A;  3BOW A;  1CLL A;  1UHJ A;  3D0Y B;  2G2B A;  4CLN A;  4C0J A;  1WRK A;  1WLZ A;  3GOF A;  3KO0 A;  2BKI B;  2GGZ A;  2JRF A;  1M31 A;  2KI6 D;  2M97 A;  1TTX A;  1KFX L;  1NPQ A;  2FCE A;  2H61 A;  1PAL A;  2L51 A;  4YI8 A;  2F8P A;  4MRX A;  3O4Y A;  1MWN A;  1XFX O;  1SBJ A;  1IH0 A;  1TNX A;  1MUX A;  1SL8 A;  2M0R A;  2EC6 B;  1QVI Y;  3BQ3 A;  3I5H B;  1QX5 B;  2OTG C;  4GFT A;  1NX2 A;  2JU0 A;  2GGM A;  1IJ5 A;  2JT0 A;  1FI6 A;  2NXQ A;  2HPS A;  1Y0V H;  2EC6 C;  1BR4 B;  1UHI A;  3NSL A;  1LIN A;  1JBA A;  4WQ2 A;  1YRT B;  1KK8 B;  4MZL A;  1SCM B;  1R6P A;  1F70 A;  3FS7 A;  1GGW A;  1CFF A;  2Y1M A;  2JTT A;  1EXR A;  2GV5 A;  2PAS A;  3EK8 A;  3PAT A;  2KFG A;  4GAO A;  1K9K A;  2H61 C;  3GK4 X;  1CMF A;  3A4U B;  2L50 A;  1KK8 C;  1YVH A;  1SCM C;  1LA0 A;  5G08 A;  1ZMZ A;  1FPW A;  5KTY A;  1XYD A;  2LP3 A;  3FWC A;  1F4Q A;  2I94 A;  1MHO A;  5TNC A;  4I5N B;  4XYN A;  1RFJ A;  3OB2 B;  1N2D A;  2MHH A;  4P5O E;  2F2P A;  1SL9 A;  4ICB A;  1Q80 A;  1CLM A;  3CS1 A;  4JWQ A;  2M49 B;  1REC A;  1A75 B;  2Q91 A;  2KBI A;  2KAX A;  3HX4 A;  3I5G B;  1KWO B;  1K94 A;  4MZK A;  1Y1U A;  1BR1 B;  2JOJ A;  4YGE B;  1A29 A;  3AKB A;  4PAL A;  5HKW A;  1BT6 A;  1QVI Z;  1JC2 A;  1KWO C;  2KQY A;  1RTP 1;  2BCA A;  2JNX A;  1CDL A;  4M2P A;  1ODB A;  2LMV A;  3DF0 A;  3RM1 A;  2AAO A;  5AER A;  1AHR A;  1ZUZ A;  1G8I A;  2WC8 A;  1CDM A;  1L7Z A;  1QX7 A;  1QIW A;  1YR5 A;  2Y5I A;  5I2L A;  1KSO A;  1ALW A;  1JFK A;  2LVV A;  5AXI A;  1QLK A;  2CNP A;  1X02 A;  1FW4 A;  1KFU L;  1SW8 A;  1DJH A;  1CDN A;  1CB1 A;  1S36 A;  1YUR A;  2ISD A;  1XFY O;  2LV7 A;  3JVT B;  2E30 A;  5ER4 X;  2MBX A;  3O78 A;  1SMG A;  4GBA A;  1MR8 A;  5CPV A;  2BBN A;  2CXJ A;  3FWB A;  4YGC B;  3WNX B;  1FF1 A;  5AFP A;  2OPO A;  1K9P A;  4PCW A;  1DJW A;  1OQP A;  1S1E A;  1QX2 A;  3JVT C;  3LL8 B;  3VRQ A;  4XJK B;  2HET A;  2LUC A;  1JWD A;  3ZWH A;  1DTL A;  1AJ5 A;  1YTZ C;  1U5I B;  3F45 A;  2KNE A;  2KGB C;  4ORB B;  3I5F B;  1SYM A;  4I5J A;  1BOD A;  1YUU A;  1QV1 A;  4ETO A;  4AQI A;  1WY9 A;  1TNW A;  2KI6 C;  2O5G A;  5D7F A;  1ZAC A;  1QTX A;  2AUC A;  3TUY B;  3NSK A;  4PHJ A;  2WCB A;  1J7R A;  4YGB B;  1ALV A;  3D0Y A;  3I5F C;  4OR9 B;  1TRF A;  1QS7 A;  2DOQ A;  1S26 D;  5IBW A;  1UUS A;  1XFV O;  3DVE A;  2MJW B;  2JTZ A;  4MRY A;  1J1E A;  3OX6 A;  2K8M B;  4UPG A;  3TUY C;  2NLN A;  1PSR A;  4L9M A;  2ZRS A;  2ZRT A;  1AVS A;  2SAS A;  3PN7 C;  4YI9 A;  1PVA A;  3SG2 A;  1CFD A;  3BUM B;  1LVC D;  1BMO A;  3I5I C;  3JTD B;  1YX7 A;  1QJT A;  1CMG A;  2LLT A;  4YBH B;  5GQQ C;  4N1G A;  1NSH A;  2LAN A;  2KDH A;  1G4Y R;  4HSZ A;  1EH2 A;  2F33 A;  1KFX S;  3JTD C;  1KK7 Y;  1AUI B;  4NQG A;  1F8H A;  1EJ3 A;  1IRJ A;  1PUL A;  3LK0 A;  3SG6 A;  3LK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...