2F8PA

Crystal structure of obelin following ca2+ triggered bioluminescence suggests neutral coelenteramide as the primary excited state
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
190
structure length
190
Chain Sequence
ASKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Crystal structure of obelin after Ca2+-triggered bioluminescence suggests neutral coelenteramide as the primary excited state.
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 84
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2f8pA00
1IQ3A 2PRUA 5CSIA 3BOWA 1M39A 5JOLA 1JFJA 1PSBA 4ICBA 2MHHA 2HQWA 4PE0A 2LVJA 1UHKA 2OPOA 5AERA 2F8PA 2L0PA 4JWQA 2BBMA 1UHJA 2OTGC 2JXLA 2JOJA 1DJHA 4MZKA 4OR9B 1OZSA 1K9UA 3O78A 1DJYA 4FTGA 1SL7A 2MAZA 2KSPA 3SG4A 2QACA 2VRGA 2JTTA 1RK9A 1C7VA 1AVSA 1SY9A 2L5XB 3CS1A 2A4JA 2H61C 1B8RA 5KSZA 2M3WA 2MLEC 2LM5A 1SR6B 1KK7Z 1YVHA 5F6TA 1QS7A 1GGWA 3K21A 5HLOA 2E6WA 3GK1A 2LP2A 1PVBA 3NXAA 1GGZA 4FQOA 1A03A 1SCMB 2PMYA 3I5IC 2Y4QA 4AQJA 2JNFA 2K2FA 2COLB 2ZRSA 1QVIY 2JXCA 2LC5A 2LV7A 2ZNDA 3OB1B 3WXAA 1PRWA 5PALA 1N0YA 1NCZA 1KSOA 4YGEB 1AJ4A 2BBNA 3EVVA 1MXLC 4Q04A 1AUIB 2I94A 1NX3A 5I2QA 1CMFA 3DVKA 3LLEA 2OS8C 1IJ5A 2KAVA 3DF0B 5DKQA 5I2OA 2QPTA 4WQ2A 2CTNA 1ZMZA 3OHMB 2BE4A 2G2BA 5AXIA 5KU1A 1N65A 4PALA 1SL8A 1K93D 2LMUA 3MSEB 2PVBA 3PATA 1RJVA 1H8BA 1W7JB 5HYDA 1B4CA 2Y1NA 1SK6D 2HF5A 1DF0A 1MHOA 1SNLA 3JTDB 2KNEA 2L4HA 2TN4A 1SPYA 3DVMA 1RROA 1SKTA 3RLZA 1CLBA 1PALA 1N2DA 1OQPA 4GGFA 1BLQA 1QV0A 2K7CA 2EC6B 2LLSA 1S6JA 4GBAA 4MEWA 4PHJA 1A75B 2FJUB 1ODBA 4NDDA 1BT6A 1HQVA 2BE6A 2JTZA 2K2AA 1KFXS 3CR2A 1YRTB 3I5GB 4BY4A 1ZUZA 1YR5A 3EKHA 1CFDA 2M9GA 4OV2A 4A4BA 4R1EA 1BU3A 2JQ6A 1J55A 1SBJA 2EGDA 2M0RA 4OCIA 1R2UA 1V1GA 2LNKA 1E8AA 1XFYO 1Y1XA 2LVIA 1RFJA 1YURA 1B7TZ 3BXKA 2FCEA 1KK8B 1X02A 2KQYA 1SW8A 3QRXA 4ORCB 4PDZA 2KYCA 1NYAA 1RTP1 4AOMA 3O2PA 2GGMA 2BL0C 3AAKA 1L7ZA 4MRXA 4DUQA 2F2PA 3BOWB 3DVEA 1BF5A 3TZ1A 1Y1UA 3A8RA 1WDCB 5DKNA 2K7DA 1KWOB 1YTZC 1UURA 1CM1A 3PN7B 1CFFA 2JNXA 1TN4A 1WRKA 2LANA 3JVTC 1KCYA 1MR8A 4PCWA 1SCVA 2SCPA 1ZOTB 4CLNA 3IQQA 2PSRA 2L50A 1AJ5A 3GK4X 1BJFA 2M29A 3BUMB 4YBHB 1S5GZ 3TUYC 2FCDA 1FF1A 2H61A 4GFTA 1SMGA 1AP4A 1XK4C 4MN0A 1JSAA 3KF9A 3M0WA 2JULA 1QIVA 2WNDA 1YX8A 2V53A 2WOSA 1YVLA 2Y1MA 5BPJA 3EVRA 2CT9A 4M2PA 3LK1A 1XFVO 2KI4B 5G08A 1L2OC 1CDPA 2WC8A 1OSAA 3NSIA 4L9MA 1KQMC 1K94A 5I2LA 1UUSA 2D8NA 2ZFDA 3SG2A 1F71A 1K9KA 3I5FB 2ZN8A 1YRUB 1BOCA 1U5IA 3VGOA 2LMVA 4GAOA 1DVIA 3AAJA 4GUKA 2ZKMX 3D10A 1Y1AA 3TDZA 1YUSA 3OX5A 2I2RE 2LHIA 5K89A 1DJWA 2MLFC 4M2OA 4YGDB 1F55A 4YI9A 1JF2A 1PK0D 4N5XA 1PVAA 1XFUO 3EK8A 2JC2A 1QX7A 2WCBA 3VRNA 4AQIA 2NCPA 2BKHB 2HPSA 1GQMA 2ZNEA 3DVJA 1A2XA 1MWNA 2KBIA 1F4QA 1DF0B 1K90D 2CBLA 2MA2A 4I5NB 4F0ZB 2KAXA 1TNXA 3O4YA 1CMGA 4YRUA 3IF7A 3CGAA 1OMVA 5TNCA 2FOTA 2NLNA 4DIRA 3TDIA 5AFPA 1EL4A 1F8HA 4QJ4B 5CSJA 3PM8A 1CKKA 1J7RA 4PHKA 2KQ6A 1YUUA 2KOTA 3TS5B 5JJGA 3FIAA 5HKZA 1FW4A 3CZTX 4TNCA 3GOFA 5HKWA 4MVFA 5AEQA 1OMRA 4A4CA 1JBAA 2H2KA 2LLTA 3VRPA 1WLMA 3I5HB 2KGBC 4N1GA 5CSFA 3CTNA 1SRAA 3FWCA 1DGVA 3PLFB 1DT7B 2JRFA 3HCMA 1CDLA 4HRGA 4YI8A 5HLVA 1KK7Y 3SG6A 1IJ6A 1QV1A 4XJKA 2KI6C 5ER5A 3RM1A 1JUOA 3ICBA 1CLLA 3PFVA 2WCEA 2CXJA 1XA5A 3ZWHA 3NSLA 1UHNA 3EKJA 2KFFA 1Y6WA 4I5JA 1RECA 3PALA 1DJIA 4NQGA 4P5OE 1ALVA 1M63B 2BCXA 2JT3A 1OOJA 1NX1A 5IBWA 2F33A 4BY5A 2OTGB 1TCOB 1IWQA 4DRWA 2WORA 2LHLA 4NDCA 3NSKA 2LMTA 1QTXA 1V1FA 3PSRA 3D0YA 1JC2A 2I18A 5ER4X 1OZOA 4NDBA 3FS7A 1SR6C 1EG3A 1TNQA 2LLUA 5HKYA 2AMIA 2M7NA 2JU0A 3KPXA 1SCMC 4MSPA 2KYFA 3OX6A 2E30A 2KI6D 1J1EA 4WRIA 4ZCUA 1KQVA 4HREE 3I5IB 1RWYA 4ZCVA 1IRJA 1FI5A 3EVUA 4MZLA 3KEVA 3DD4A 2Q91A 3LK0A 1M46A 1WLZA 3KO0A 3A4UB 2HQ8A 1GJYA 2JT0A 2K0JA 2LP3A 1B9AA 1UHHA 2ZN9A 1U5IB 1J7PA 4DCKA 4MRYA 2MJWB 1TTXA 2JWWA 3AKBA 4CFRA 1BG1A 1D1OA 1IG5A 2ZRTA 2IS9A 5CPVA 1NUBA 1QIWA 4C0LA 1J7OA 1J1DA 2OS8B 1C07A 1K96A 2AAOA 1S36A 3GK2A 4PE7A 2F2OA 1MUXA 4HRHA 1BODA 1Y0VH 1B7TY 3CLNA 1IH0A 2M8UA 1C7WA 2HETA 5DKRA 5I8NA 1W7IB 2M7LA 1QJTA 1XO5A 1DJGA 3VROA 2EHBA 1QX2A 3JTDC 2B1UA 1QVIZ 2L98A 2SASA 2M97A 2NXQA 3SIAA 3SG3A 4QJ3B 3LCPC 1UHIA 2BCBA 4USLA 5FYXA 2EC6C 2F3YA 3AKAA 4ORAB 1HT9A 1S26D 3BUNB 2GGZA 1WRLA 1EJ3A 1G4YR 3WNXB 5D69A 3I5GC 4YGCB 2BECA 1QLKA 1CM4A 4JQ0D 1LINA 5GQQC 4IL1A 2KBMA 4N1FA 1CLMA 1YX7A 2MBXA 2JPTA 2L51A 1KK8C 1S5GY 4PE1A 1CNPA 1Q80A 1FBVA 4CFQA 1TNWA 5J3XA 2CCMA 3O6BA 2WCFA 1MF8B 1TNPA 3HX4A 1LXFC 3TDUA 4XJKB 3SG5A 1CFPA 1JWDA 4QJ5B 1K8UA 4C0KA 1AHRA 1AK8A 1FI6A 5CSNA 4I5KA 1PSRA 2NCOA 3NSOA 1R6PA 1A29A 3CR5X 1K95A 2BL0B 3OP0A 1G33A 1OMDA 1TIZA 2O60A 1WDCC 1G8IA 1WY9A 4PHMA 3PN7C 1KWOC 4U8DA 1UP5A 4UPGA 1CFCA 3SG7A 1OE9B 2DOQA 1NX2A 1FPWA 1BR1B 2KGRA 1B1GA 1IQ5A 2G9BA 3JVTB 3VRRA 1CDNA 2M1KB 1KFUL 4M2QA 1XFZO 1K2HA 3LL8B 1TOPA 2JT8A 4HSZA 4C0JA 2LCPA 4GPLB 4OVNF 1NCYA 3D0YB 4CPVA 2KDHA 3TUYB 2PASA 1ZACA 1JFKA 4WQ3A 1SYMA 2BCAA 1DGUA 1KSMA 1NSHA 4ORBB 1DTLA 1SL9A 2L4IA 1NP8A 1K9PA 1LA3A 1NWDA 1QXPA 1LKJA 4JPZB 3SJSA 5B8IB 2Q4UA 1QATA 2KI4C 3WHTB 4I5LB 4P2YB 1NIWA 5D7FA 1L2OB 1ZFSA 1M31A 1EG4A 1XFWO 1KQMB 2RGIA 3I5FC 4YGAA 3VRQA 1TCFA 3BUOB 3F45A 1XFXO 4GGNA 2CNPA 3CR4X 2P6BB 5KTYA 2K7BA 2Y5IA 1BR4B 1IGVA 2BKIB 1ALWA 2LAPA 1EXRA 1NPQA 3DF0A 1PULA 2KAYA 1XK4A 4YGBB 1CB1A 3OB2B 3BUXB 3IQOA 3KHEA 4GNKB 1QX5B 1S1EA 1F4OA 1MXEA 2JZIA 3BYAA 4OKHA 3CWGA 4E68A 1S6IA 1S6CA 4DS7A 2K7OA 1S3PA 1TRFA 2F3ZA 3BQ3A 2LE9B 2LUXA 1A4PA 1IKUA 1XVJA 2PALA 4ETOA 4CIDA 1DJZA 3FWBA 2LVVA 3C1VA 2AUCA 1NX0A 1VRKA 1XYDA 1M45A 1B8LA 1YUTA 2NZ0A 4MLWA 1H4BA 2KHNA 4MZJA 4GGFC 1DMOA 3H4SE 2I7AA 1QASA 1A75A 3WHUB 2M49B 2LUCA 1EH2A 3TS5C 1F54A 2R2IA 1LVCD 2MRDA 1B8CA 1DJXA 2KFGA 3BUWB 2M1UA 3EK4A 1MQ1A 3I5HC 1B47A 4PE4A 3EK7A 2ISDA 4D1EA 4PHNA 2LVKA 1JF0A 3E3RA 1LA0A 4MBEA 1WRZA 1CDMA 2O5GA 1BMOA 1F70A 2K61A 2KFHA 5AANA 1UWOA 1CTRA 1NCXA 1QLSA 2L2EA 4XYNA 1J7QA 3ZNIA 1KFXL 1KFUS 2K8MB 3SIBA 2GV5A
chains in the Genus database with same CATH superfamily
1IQ3A 2PRUA 5CSIA 3BOWA 1M39A 5JOLA 1JFJA 1PSBA 3OGNA 2MHHA 2HQWA 4ICBA 4PE0A 2LVJA 1UHKA 2OPOA 5AERA 2F8PA 3S0FA 2L0PA 4JKTA 3SS4A 4JWQA 2BBMA 1UHJA 2OTGC 2JXLA 2JOJA 1DJHA 4MZKA 4OR9B 1OZSA 1K9UA 3B88A 3O78A 1DJYA 4FTGA 1SL7A 2MAZA 2KSPA 3SG4A 2QACA 2VRGA 2JTTA 1RK9A 1C7VA 1OW4A 1AVSA 1SY9A 2L5XB 3CS1A 2A4JA 2H61C 1B8RA 5KSZA 2M3WA 2MLEC 2LM5A 1SR6B 1KK7Z 1YVHA 5F6TA 1QS7A 1GGWA 3K21A 5HLOA 2E6WA 3GK1A 2LP2A 1PVBA 3B7AA 1GGZA 3CZ1A 3NXAA 4FQOA 1A03A 1SCMB 2PMYA 3I5IC 4KYNA 2Y4QA 4AQJA 2JNFA 1C3YA 2K2FA 2COLB 2ZRSA 4JD9A 1QVIY 2JXCA 2LC5A 2LV7A 2ZNDA 3OB1B 5FI6A 1LS8A 3WXAA 1PRWA 5PALA 1N0YA 1NCZA 1KSOA 4YGEB 1AJ4A 2BBNA 3EVVA 3S0BA 1MXLC 3SS3A 3DY9A 4Q04A 2WC5A 1AUIB 2I94A 1NX3A 5I2QA 3R72A 1CMFA 2BAPA 3DVKA 3LLEA 3R1OA 1DELA 2OS8C 1IJ5A 2KAVA 3DF0B 5DKQA 5I2OA 1TUJA 2QPTA 4WQ2A 2CTNA 1ZMZA 3OHMB 2BE4A 2G2BA 5AXIA 5KU1A 1N65A 4PALA 1SL8A 1K93D 2LMUA 3MSEB 2PVBA 3PATA 1RJVA 1H8BA 1W7JB 5HYDA 1B4CA 2Y1NA 1SK6D 2HF5A 1DF0A 1MHOA 1SNLA 3JTDB 2KNEA 2L4HA 2TN4A 1SPYA 3DVMA 1RROA 1SKTA 3RLZA 1CLBA 1PALA 1N2DA 1OQPA 4GGFA 1BLQA 1QV0A 2K7CA 2EC6B 3S0GA 2LLSA 1S6JA 4GBAA 4MEWA 1DQEA 4PHJA 1A75B 2FJUB 1ODBA 4NDDA 1BT6A 1HQVA 2BE6A 2JTZA 2K2AA 1KFXS 3CR2A 1YRTB 2WCKA 3I5GB 4BY4A 1ZUZA 1YR5A 3EKHA 1CFDA 3S0DA 2M9GA 4OV2A 4A4BA 4R1EA 1BU3A 2JQ6A 1J55A 1SBJA 2EGDA 2M0RA 4OCIA 5I94A 1R2UA 1V1GA 3UNWA 1Z4HA 2LNKA 1E8AA 1XFYO 1Y1XA 2LVIA 1RFJA 1YURA 1B7TZ 3BXKA 2GTEA 2FCEA 1KK8B 1X02A 2KQYA 1SW8A 3QRXA 4ORCB 4PDZA 3FE6A 2KYCA 1NYAA 3D76A 1RTP1 4AOMA 5D3OA 3DYEA 3O2PA 2GGMA 2BL0C 3AAKA 1L7ZA 3NHTA 3FE8A 4MRXA 4DUQA 2F2PA 3BOWB 3DVEA 1OOIX 3R1VA 2PQLA 3TZ1A 1BF5A 1Y1UA 2QDIA 3A8RA 1WDCB 5DICA 5DKNA 2K7DA 1KWOB 1YTZC 1UURA 1CM1A 3PN7B 1CFFA 2JNXA 1TN4A 1WRKA 2LANA 3JVTC 1KCYA 1MR8A 4PCWA 1SCVA 2SCPA 1ZOTB 4CLNA 3IQQA 2PSRA 2L50A 1AJ5A 3GK4X 1BJFA 2M29A 3QMEA 3BUMB 4YBHB 1S5GZ 3TUYC 2FCDA 1FF1A 2H61A 4GFTA 1SMGA 1AP4A 1XK4C 4MN0A 1JSAA 3KF9A 3M0WA 2JULA 1QIVA 2WNDA 1YX8A 2V53A 2WOSA 1YVLA 2Y1MA 5BPJA 3EVRA 2CT9A 4M2PA 3LK1A 1XFVO 2KI4B 5G08A 1L2OC 1CDPA 2WC8A 1OSAA 3O4XA 3NSIA 4L9MA 1KQMC 1K94A 5I2LA 3UO9A 1UUSA 2D8NA 2ZFDA 3S0AA 3SG2A 1F71A 1K9KA 3I5FB 2ZN8A 1YRUB 1BOCA 1U5IA 3VGOA 2LMVA 4GAOA 1DVIA 4INWA 3AAJA 4GUKA 2ZKMX 3D10A 1Y1AA 3BJHA 3TDZA 1YUSA 3OX5A 2I2RE 2LHIA 5K89A 1DJWA 2MLFC 4M2OA 1Z2CB 4YGDB 1F55A 4YI9A 1JF2A 1PK0D 2WCLA 2H8VA 4N5XA 1PVAA 1XFUO 3EK8A 3Q8IA 2JC2A 1QX7A 2WCBA 4PT1A 3VRNA 2YGUA 4AQIA 5FI7A 2NCPA 2BKHB 2HPSA 1GQMA 2ZNEA 3DVJA 1A2XA 1MWNA 3D75A 2KBIA 1F4QA 1DF0B 1K90D 2CBLA 2MA2A 4I5NB 4F0ZB 2KAXA 1TNXA 3O4YA 1CMGA 4YRUA 3IF7A 3CGAA 1OMVA 5TNCA 2FOTA 2NLNA 4DIRA 3TDIA 5AFPA 1EL4A 3B86A 1F8HA 4QJ4B 5CSJA 3PM8A 1CKKA 1J7RA 1QWVA 4PHKA 2KQ6A 1YUUA 2KOTA 3TS5B 5JJGA 3FIAA 5HKZA 1FW4A 3CZTX 4TNCA 3GOFA 5HKWA 4MVFA 5AEQA 1OMRA 3CZ2A 4A4CA 1JBAA 2H2KA 2LLTA 3VRPA 1WLMA 3I5HB 2KGBC 4N1GA 2WCMA 5CSFA 3CTNA 1SRAA 3FWCA 1DGVA 3PLFB 1DT7B 2JRFA 3HCMA 1CDLA 4HRGA 4YI8A 5HLVA 1KK7Y 3SG6A 1IJ6A 1QV1A 4XJKA 2KI6C 5ER5A 3R1PA 1JUOA 3ICBA 3RM1A 1CLLA 3PFVA 2WCEA 3BFHA 2CXJA 1XA5A 3ZWHA 3NSLA 1UHNA 4IJ7A 3EKJA 2KFFA 1Y6WA 4I5JA 1RECA 3PALA 1DJIA 4NQGA 4P5OE 1ALVA 3OBVA 1OOHA 1M63B 2BCXA 2JT3A 1OOJA 1NX1A 5IBWA 2F33A 4BY5A 2OTGB 3CZ0A 1TCOB 1IWQA 3DXLA 4DRWA 2P70A 2WORA 2LHLA 3D74A 3NSKA 4NDCA 2LMTA 1QTXA 1V1FA 3PSRA 3D0YA 3B6XA 1JC2A 1XFRA 2I18A 5ER4X 1OZOA 4NDBA 3FS7A 1SR6C 1EG3A 1TNQA 2LLUA 1C3ZA 5HKYA 2AMIA 2M7NA 2JU0A 3KPXA 4INXA 1SCMC 4MSPA 2KYFA 3OX6A 2E30A 2KI6D 1J1EA 4WRIA 4ZCUA 1KQVA 4HREE 3I5IB 1RWYA 4ZCVA 1IRJA 1FI5A 3EVUA 4MZLA 3KEVA 3K1EA 3DD4A 2Q91A 3LK0A 1M46A 1WLZA 3KO0A 3A4UB 2HQ8A 1GJYA 2JT0A 4OZDA 2K0JA 2LP3A 3DZTA 1B9AA 1UHHA 2ZN9A 3NHIA 1U5IB 1J7PA 4DCKA 4MRYA 2P71A 2MJWB 1TTXA 2KPHA 2JWWA 3AKBA 4CFRA 1BG1A 1D1OA 1IG5A 2ZRTA 1SSEB 2IS9A 3PJIA 5CPVA 5EL2A 1NUBA 1QIWA 4C0LA 1J7OA 1J1DA 2OS8B 1C07A 1K96A 2AAOA 1S36A 3GK2A 4PE7A 2F2OA 1MUXA 4HRHA 1W9ZA 1BODA 1Y0VH 1B7TY 3CLNA 1IH0A 2M8UA 1C7WA 2HETA 5DKRA 5I8NA 1OOFA 1W7IB 2M7LA 1QJTA 1XO5A 1DJGA 3VROA 2EHBA 2PYQA 1QX2A 1T14A 3JTDC 2B1UA 1QVIZ 2L98A 2SASA 2M97A 2NXQA 3SIAA 3IVTA 3SG3A 4QJ3B 3LCPC 1DEKA 1UHIA 2BCBA 4USLA 5FYXA 2EC6C 2F3YA 3AKAA 4ORAB 1HT9A 1S26D 3BUNB 2GGZA 1WRLA 1EJ3A 1G4YR 3WNXB 5D69A 3SS5A 2KLEA 3I5GC 4YGCB 2BECA 3NGVA 1QLKA 1CM4A 4JQ0D 1LINA 3L4LA 5GQQC 4IL1A 5FI2A 1DC1A 2KBMA 4N1FA 1CLMA 1YX7A 2MBXA 2JPTA 3CDNA 2L51A 3B87A 3D78A 1KK8C 1S5GY 2L5YA 4PE1A 1CNPA 1Q80A 1FBVA 2WCJA 4CFQA 1TNWA 5J3XA 2CCMA 3O6BA 2WCFA 1MF8B 1TNPA 3HX4A 1LXFC 2QEOA 4XJKB 3SG5A 3TDUA 1CFPA 1JWDA 4QJ5B 1K8UA 4C0KA 1AHRA 2WC6A 1AK8A 5CSNA 4I5KA 1FI6A 1PSRA 2NCOA 3NSOA 1R6PA 1A29A 3CR5X 1K95A 2BL0B 3OP0A 1G33A 2JPOA 1OMDA 1TIZA 2O60A 1WDCC 1G8IA 1WY9A 4PHMA 3PN7C 1KWOC 4U8DA 1UP5A 4UPGA 1CFCA 3SG7A 1OE9B 2DOQA 1NX2A 4F7FA 1FPWA 1BR1B 2KGRA 1B1GA 1IQ5A 2G9BA 3JVTB 3VRRA 1CDNA 2M1KB 1KFUL 4M2QA 1XFZO 1K2HA 3LL8B 1TOPA 2JT8A 4HSZA 4C0JA 2LCPA 4GPLB 4OVNF 1IIOA 1NCYA 3D0YB 4CPVA 1P28A 2KDHA 3TUYB 2PASA 3N7HA 1ZACA 1JFKA 4WQ3A 1SYMA 2BCAA 1DGUA 2BNXA 1KSMA 1NSHA 4ORBB 1DTLA 1SL9A 2L4IA 1NP8A 1K9PA 1LA3A 1NWDA 1QXPA 1LKJA 3CABA 4JPZB 3SJSA 5B8IB 5HL1A 2Q4UA 1QATA 2KI4C 3WHTB 4I5LB 4P2YB 1GM0A 1NIWA 2L2CA 5D7FA 3BFAA 3L47A 1L2OB 1ZFSA 3RZSA 1M31A 1EG4A 1XFWO 2QEBA 1OOGA 1KQMB 2RGIA 3I5FC 4YGAA 3VRQA 1TCFA 3BUOB 3F45A 1XFXO 4GGNA 2KLDA 2CNPA 3CR4X 4FQTA 2P6BB 2QEHA 5KTYA 2K7BA 2Y5IA 1BR4B 1IGVA 2BKIB 1ALWA 2LAPA 1EXRA 1NPQA 3DF0A 1PULA 2KAYA 1XK4A 4YGBB 1CB1A 3OB2B 3BUXB 3IQOA 3KHEA 4GNKB 3S0EA 1QX5B 3EG5B 1S1EA 1F4OA 1MXEA 2JZIA 3BYAA 4OKHA 3CWGA 4E68A 1S6IA 3D77A 1S6CA 4DS7A 2K7OA 1S3PA 1TRFA 2F3ZA 2FJYA 2LE9B 3BQ3A 3L4AA 2LUXA 1A4PA 1IKUA 1XVJA 1ORGA 2PALA 4ETOA 3BFBA 4CIDA 1DJZA 3FWBA 2LVVA 3C1VA 3PM2A 2AUCA 1NX0A 1VRKA 1XYDA 1M45A 1B8LA 1YUTA 2NZ0A 4MLWA 1H4BA 2KHNA 4MZJA 2ERBA 4GGFC 1DMOA 2K60A 3H4SE 2I7AA 3VB1A 1QASA 1A75A 3FE9A 3WHUB 2M49B 2LUCA 1EH2A 2WCHA 3TS5C 1F54A 1TUZA 2R2IA 1LVCD 2MRDA 3CYZA 3V2LA 1B8CA 1DJXA 2KFGA 3BUWB 2M1UA 3EK4A 1MQ1A 3I5HC 1B47A 4PE4A 3EK7A 3D73A 2ISDA 4D1EA 4PHNA 2LVKA 1JF0A 3E3RA 1LA0A 4MBEA 1WRZA 1CDMA 2O5GA 1BMOA 1TWOA 1F70A 2K61A 2KFHA 2QEVA 5AANA 1UWOA 1CTRA 1NCXA 1QLSA 2L2EA 4XYNA 1J7QA 3ZNIA 1KFXL 1KFUS 2K8MB 3SIBA 2GV5A
chains in the Genus database with same CATH topology
1IQ3A 2PRUA 5CSIA 3BOWA 1M39A 5JOLA 1JFJA 1PSBA 4ICBA 2MHHA 2HQWA 4PE0A 2LVJA 1UHKA 2OPOA 5AERA 2F8PA 2L0PA 4JWQA 2BBMA 1UHJA 2OTGC 2JXLA 2JOJA 1DJHA 4MZKA 4OR9B 1OZSA 1K9UA 3O78A 1DJYA 4FTGA 1SL7A 2MAZA 2KSPA 3SG4A 2QACA 2VRGA 2JTTA 1RK9A 1C7VA 1AVSA 1SY9A 2L5XB 3CS1A 2A4JA 2H61C 1B8RA 5KSZA 2M3WA 2MLEC 2LM5A 1SR6B 1KK7Z 1YVHA 5F6TA 1QS7A 1GGWA 3K21A 5HLOA 2E6WA 3GK1A 2LP2A 1PVBA 3NXAA 1GGZA 4FQOA 1A03A 1SCMB 2PMYA 3I5IC 2Y4QA 4AQJA 2JNFA 2K2FA 2COLB 2ZRSA 1QVIY 2JXCA 2LC5A 2LV7A 2ZNDA 3OB1B 3WXAA 1PRWA 5PALA 1N0YA 1NCZA 1KSOA 4YGEB 1AJ4A 2BBNA 3EVVA 1MXLC 4Q04A 1AUIB 2I94A 1NX3A 5I2QA 1CMFA 3DVKA 3LLEA 2OS8C 1IJ5A 2KAVA 3DF0B 5DKQA 5I2OA 2QPTA 4WQ2A 2CTNA 1ZMZA 3OHMB 2BE4A 2G2BA 5AXIA 5KU1A 1N65A 4PALA 1SL8A 1K93D 2LMUA 3MSEB 2PVBA 3PATA 1RJVA 1H8BA 1W7JB 5HYDA 1B4CA 2Y1NA 1SK6D 2HF5A 1DF0A 1MHOA 1SNLA 3JTDB 2KNEA 2L4HA 2TN4A 1SPYA 3DVMA 1RROA 1SKTA 3RLZA 1CLBA 1PALA 1N2DA 1OQPA 4GGFA 1BLQA 1QV0A 2K7CA 2EC6B 2LLSA 1S6JA 4GBAA 4MEWA 4PHJA 1A75B 2FJUB 1ODBA 4NDDA 1BT6A 1HQVA 2BE6A 2JTZA 2K2AA 1KFXS 3CR2A 1YRTB 3I5GB 4BY4A 1ZUZA 1YR5A 3EKHA 1CFDA 2M9GA 4OV2A 4A4BA 4R1EA 1BU3A 2JQ6A 1J55A 1SBJA 2EGDA 2M0RA 4OCIA 1R2UA 1V1GA 2LNKA 1E8AA 1XFYO 1Y1XA 2LVIA 1RFJA 1YURA 1B7TZ 3BXKA 2FCEA 1KK8B 1X02A 2KQYA 1SW8A 3QRXA 4ORCB 4PDZA 2KYCA 1NYAA 1RTP1 4AOMA 3O2PA 2GGMA 2BL0C 3AAKA 1L7ZA 4MRXA 4DUQA 2F2PA 3BOWB 3DVEA 1BF5A 3TZ1A 1Y1UA 3A8RA 1WDCB 5DKNA 2K7DA 1KWOB 1YTZC 1UURA 1CM1A 3PN7B 1CFFA 2JNXA 1TN4A 1WRKA 2LANA 3JVTC 1KCYA 1MR8A 4PCWA 1SCVA 2SCPA 1ZOTB 4CLNA 3IQQA 2PSRA 2L50A 1AJ5A 3GK4X 1BJFA 2M29A 3BUMB 4YBHB 1S5GZ 3TUYC 2FCDA 1FF1A 2H61A 4GFTA 1SMGA 1AP4A 1XK4C 4MN0A 1JSAA 3KF9A 3M0WA 2JULA 1QIVA 2WNDA 1YX8A 2V53A 2WOSA 1YVLA 2Y1MA 5BPJA 3EVRA 2CT9A 4M2PA 3LK1A 1XFVO 2KI4B 5G08A 1L2OC 1CDPA 2WC8A 1OSAA 3NSIA 4L9MA 1KQMC 1K94A 5I2LA 1UUSA 2D8NA 2ZFDA 3SG2A 1F71A 1K9KA 3I5FB 2ZN8A 1YRUB 1BOCA 1U5IA 3VGOA 2LMVA 4GAOA 1DVIA 3AAJA 4GUKA 2ZKMX 3D10A 1Y1AA 3TDZA 1YUSA 3OX5A 2I2RE 2LHIA 5K89A 1DJWA 2MLFC 4M2OA 4YGDB 1F55A 4YI9A 1JF2A 1PK0D 4N5XA 1PVAA 1XFUO 3EK8A 2JC2A 1QX7A 2WCBA 3VRNA 4AQIA 2NCPA 2BKHB 2HPSA 1GQMA 2ZNEA 3DVJA 1A2XA 1MWNA 2KBIA 1F4QA 1DF0B 1K90D 2CBLA 2MA2A 4I5NB 4F0ZB 2KAXA 1TNXA 3O4YA 1CMGA 4YRUA 3IF7A 3CGAA 1OMVA 5TNCA 2FOTA 2NLNA 4DIRA 3TDIA 5AFPA 1EL4A 1F8HA 4QJ4B 5CSJA 3PM8A 1CKKA 1J7RA 4PHKA 2KQ6A 1YUUA 2KOTA 3TS5B 5JJGA 3FIAA 5HKZA 1FW4A 3CZTX 4TNCA 3GOFA 5HKWA 4MVFA 5AEQA 1OMRA 4A4CA 1JBAA 2H2KA 2LLTA 3VRPA 1WLMA 3I5HB 2KGBC 4N1GA 5CSFA 3CTNA 1SRAA 3FWCA 1DGVA 3PLFB 1DT7B 2JRFA 3HCMA 1CDLA 4HRGA 4YI8A 5HLVA 1KK7Y 3SG6A 1IJ6A 1QV1A 4XJKA 2KI6C 5ER5A 3RM1A 1JUOA 3ICBA 1CLLA 3PFVA 2WCEA 2CXJA 1XA5A 3ZWHA 3NSLA 1UHNA 3EKJA 2KFFA 1Y6WA 4I5JA 1RECA 3PALA 1DJIA 4NQGA 4P5OE 1ALVA 1M63B 2BCXA 2JT3A 1OOJA 1NX1A 5IBWA 2F33A 4BY5A 2OTGB 1TCOB 1IWQA 4DRWA 2WORA 2LHLA 4NDCA 3NSKA 2LMTA 1QTXA 1V1FA 3PSRA 3D0YA 1JC2A 2I18A 5ER4X 1OZOA 4NDBA 3FS7A 1SR6C 1EG3A 1TNQA 2LLUA 5HKYA 2AMIA 2M7NA 2JU0A 3KPXA 1SCMC 4MSPA 2KYFA 3OX6A 2E30A 2KI6D 1J1EA 4WRIA 4ZCUA 1KQVA 4HREE 3I5IB 1RWYA 4ZCVA 1IRJA 1FI5A 3EVUA 4MZLA 3KEVA 3DD4A 2Q91A 3LK0A 1M46A 1WLZA 3KO0A 3A4UB 2HQ8A 1GJYA 2JT0A 2K0JA 2LP3A 1B9AA 1UHHA 2ZN9A 1U5IB 1J7PA 4DCKA 4MRYA 2MJWB 1TTXA 2JWWA 3AKBA 4CFRA 1BG1A 1D1OA 1IG5A 2ZRTA 2IS9A 5CPVA 1NUBA 1QIWA 4C0LA 1J7OA 1J1DA 2OS8B 1C07A 1K96A 2AAOA 1S36A 3GK2A 4PE7A 2F2OA 1MUXA 4HRHA 1BODA 1Y0VH 1B7TY 3CLNA 1IH0A 2M8UA 1C7WA 2HETA 5DKRA 5I8NA 1W7IB 2M7LA 1QJTA 1XO5A 1DJGA 3VROA 2EHBA 1QX2A 3JTDC 2B1UA 1QVIZ 2L98A 2SASA 2M97A 2NXQA 3SIAA 3SG3A 4QJ3B 3LCPC 1UHIA 2BCBA 4USLA 5FYXA 2EC6C 2F3YA 3AKAA 4ORAB 1HT9A 1S26D 3BUNB 2GGZA 1WRLA 1EJ3A 1G4YR 3WNXB 5D69A 3I5GC 4YGCB 2BECA 1QLKA 1CM4A 4JQ0D 1LINA 5GQQC 4IL1A 2KBMA 4N1FA 1CLMA 1YX7A 2MBXA 2JPTA 2L51A 1KK8C 1S5GY 4PE1A 1CNPA 1Q80A 1FBVA 4CFQA 1TNWA 5J3XA 2CCMA 3O6BA 2WCFA 1MF8B 1TNPA 3HX4A 1LXFC 3TDUA 4XJKB 3SG5A 1CFPA 1JWDA 4QJ5B 1K8UA 4C0KA 1AHRA 1AK8A 1FI6A 5CSNA 4I5KA 1PSRA 2NCOA 3NSOA 1R6PA 1A29A 3CR5X 1K95A 2BL0B 3OP0A 1G33A 1OMDA 1TIZA 2O60A 1WDCC 1G8IA 1WY9A 4PHMA 3PN7C 1KWOC 4U8DA 1UP5A 4UPGA 1CFCA 3SG7A 1OE9B 2DOQA 1NX2A 1FPWA 1BR1B 2KGRA 1B1GA 1IQ5A 2G9BA 3JVTB 3VRRA 1CDNA 2M1KB 1KFUL 4M2QA 1XFZO 1K2HA 3LL8B 1TOPA 2JT8A 4HSZA 4C0JA 2LCPA 4GPLB 4OVNF 1NCYA 3D0YB 4CPVA 2KDHA 3TUYB 2PASA 1ZACA 1JFKA 4WQ3A 1SYMA 2BCAA 1DGUA 1KSMA 1NSHA 4ORBB 1DTLA 1SL9A 2L4IA 1NP8A 1K9PA 1LA3A 1NWDA 1QXPA 1LKJA 4JPZB 3SJSA 5B8IB 2Q4UA 1QATA 2KI4C 3WHTB 4I5LB 4P2YB 1NIWA 5D7FA 1L2OB 1ZFSA 1M31A 1EG4A 1XFWO 1KQMB 2RGIA 3I5FC 4YGAA 3VRQA 1TCFA 3BUOB 3F45A 1XFXO 4GGNA 2CNPA 3CR4X 2P6BB 5KTYA 2K7BA 2Y5IA 1BR4B 1IGVA 2BKIB 1ALWA 2LAPA 1EXRA 1NPQA 3DF0A 1PULA 2KAYA 1XK4A 4YGBB 1CB1A 3OB2B 3BUXB 3IQOA 3KHEA 4GNKB 1QX5B 1S1EA 1F4OA 1MXEA 2JZIA 3BYAA 4OKHA 3CWGA 4E68A 1S6IA 1S6CA 4DS7A 2K7OA 1S3PA 1TRFA 2F3ZA 3BQ3A 2LE9B 2LUXA 1A4PA 1IKUA 1XVJA 2PALA 4ETOA 4CIDA 1DJZA 3FWBA 2LVVA 3C1VA 2AUCA 1NX0A 1VRKA 1XYDA 1M45A 1B8LA 1YUTA 2NZ0A 4MLWA 1H4BA 2KHNA 4MZJA 4GGFC 1DMOA 3H4SE 2I7AA 1QASA 1A75A 3WHUB 2M49B 2LUCA 1EH2A 3TS5C 1F54A 2R2IA 1LVCD 2MRDA 1B8CA 1DJXA 2KFGA 3BUWB 2M1UA 3EK4A 1MQ1A 3I5HC 1B47A 4PE4A 3EK7A 2ISDA 4D1EA 4PHNA 2LVKA 1JF0A 3E3RA 1LA0A 4MBEA 1WRZA 1CDMA 2O5GA 1BMOA 1F70A 2K61A 2KFHA 5AANA 1UWOA 1CTRA 1NCXA 1QLSA 2L2EA 4XYNA 1J7QA 3ZNIA 1KFXL 1KFUS 2K8MB 3SIBA 2GV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQ3 A;  2PRU A;  5CSI A;  3BOW A;  1M39 A;  5JOL A;  1JFJ A;  1PSB A;  4ICB A;  2MHH A;  2HQW A;  4PE0 A;  2LVJ A;  1UHK A;  2OPO A;  5AER A;  2F8P A;  2L0P A;  4JWQ A;  2BBM A;  1UHJ A;  2OTG C;  2JXL A;  2JOJ A;  1DJH A;  4MZK A;  4OR9 B;  1OZS A;  1K9U A;  3O78 A;  1DJY A;  4FTG A;  1SL7 A;  2MAZ A;  2KSP A;  3SG4 A;  2QAC A;  2VRG A;  2JTT A;  1RK9 A;  1C7V A;  1AVS A;  1SY9 A;  2L5X B;  3CS1 A;  2A4J A;  2H61 C;  1B8R A;  5KSZ A;  2M3W A;  2MLE C;  2LM5 A;  1SR6 B;  1KK7 Z;  1YVH A;  5F6T A;  1QS7 A;  1GGW A;  3K21 A;  5HLO A;  2E6W A;  3GK1 A;  2LP2 A;  1PVB A;  3NXA A;  1GGZ A;  4FQO A;  1A03 A;  1SCM B;  2PMY A;  3I5I C;  2Y4Q A;  4AQJ A;  2JNF A;  2K2F A;  2COL B;  2ZRS A;  1QVI Y;  2JXC A;  2LC5 A;  2LV7 A;  2ZND A;  3OB1 B;  3WXA A;  1PRW A;  5PAL A;  1N0Y A;  1NCZ A;  1KSO A;  4YGE B;  1AJ4 A;  2BBN A;  3EVV A;  1MXL C;  4Q04 A;  1AUI B;  2I94 A;  1NX3 A;  5I2Q A;  1CMF A;  3DVK A;  3LLE A;  2OS8 C;  1IJ5 A;  2KAV A;  3DF0 B;  5DKQ A;  5I2O A;  2QPT A;  4WQ2 A;  2CTN A;  1ZMZ A;  3OHM B;  2BE4 A;  2G2B A;  5AXI A;  5KU1 A;  1N65 A;  4PAL A;  1SL8 A;  1K93 D;  2LMU A;  3MSE B;  2PVB A;  3PAT A;  1RJV A;  1H8B A;  1W7J B;  5HYD A;  1B4C A;  2Y1N A;  1SK6 D;  2HF5 A;  1DF0 A;  1MHO A;  1SNL A;  3JTD B;  2KNE A;  2L4H A;  2TN4 A;  1SPY A;  3DVM A;  1RRO A;  1SKT A;  3RLZ A;  1CLB A;  1PAL A;  1N2D A;  1OQP A;  4GGF A;  1BLQ A;  1QV0 A;  2K7C A;  2EC6 B;  2LLS A;  1S6J A;  4GBA A;  4MEW A;  4PHJ A;  1A75 B;  2FJU B;  1ODB A;  4NDD A;  1BT6 A;  1HQV A;  2BE6 A;  2JTZ A;  2K2A A;  1KFX S;  3CR2 A;  1YRT B;  3I5G B;  4BY4 A;  1ZUZ A;  1YR5 A;  3EKH A;  1CFD A;  2M9G A;  4OV2 A;  4A4B A;  4R1E A;  1BU3 A;  2JQ6 A;  1J55 A;  1SBJ A;  2EGD A;  2M0R A;  4OCI A;  1R2U A;  1V1G A;  2LNK A;  1E8A A;  1XFY O;  1Y1X A;  2LVI A;  1RFJ A;  1YUR A;  1B7T Z;  3BXK A;  2FCE A;  1KK8 B;  1X02 A;  2KQY A;  1SW8 A;  3QRX A;  4ORC B;  4PDZ A;  2KYC A;  1NYA A;  1RTP 1;  4AOM A;  3O2P A;  2GGM A;  2BL0 C;  3AAK A;  1L7Z A;  4MRX A;  4DUQ A;  2F2P A;  3BOW B;  3DVE A;  1BF5 A;  3TZ1 A;  1Y1U A;  3A8R A;  1WDC B;  5DKN A;  2K7D A;  1KWO B;  1YTZ C;  1UUR A;  1CM1 A;  3PN7 B;  1CFF A;  2JNX A;  1TN4 A;  1WRK A;  2LAN A;  3JVT C;  1KCY A;  1MR8 A;  4PCW A;  1SCV A;  2SCP A;  1ZOT B;  4CLN A;  3IQQ A;  2PSR A;  2L50 A;  1AJ5 A;  3GK4 X;  1BJF A;  2M29 A;  3BUM B;  4YBH B;  1S5G Z;  3TUY C;  2FCD A;  1FF1 A;  2H61 A;  4GFT A;  1SMG A;  1AP4 A;  1XK4 C;  4MN0 A;  1JSA A;  3KF9 A;  3M0W A;  2JUL A;  1QIV A;  2WND A;  1YX8 A;  2V53 A;  2WOS A;  1YVL A;  2Y1M A;  5BPJ A;  3EVR A;  2CT9 A;  4M2P A;  3LK1 A;  1XFV O;  2KI4 B;  5G08 A;  1L2O C;  1CDP A;  2WC8 A;  1OSA A;  3NSI A;  4L9M A;  1KQM C;  1K94 A;  5I2L A;  1UUS A;  2D8N A;  2ZFD A;  3SG2 A;  1F71 A;  1K9K A;  3I5F B;  2ZN8 A;  1YRU B;  1BOC A;  1U5I A;  3VGO A;  2LMV A;  4GAO A;  1DVI A;  3AAJ A;  4GUK A;  2ZKM X;  3D10 A;  1Y1A A;  3TDZ A;  1YUS A;  3OX5 A;  2I2R E;  2LHI A;  5K89 A;  1DJW A;  2MLF C;  4M2O A;  4YGD B;  1F55 A;  4YI9 A;  1JF2 A;  1PK0 D;  4N5X A;  1PVA A;  1XFU O;  3EK8 A;  2JC2 A;  1QX7 A;  2WCB A;  3VRN A;  4AQI A;  2NCP A;  2BKH B;  2HPS A;  1GQM A;  2ZNE A;  3DVJ A;  1A2X A;  1MWN A;  2KBI A;  1F4Q A;  1DF0 B;  1K90 D;  2CBL A;  2MA2 A;  4I5N B;  4F0Z B;  2KAX A;  1TNX A;  3O4Y A;  1CMG A;  4YRU A;  3IF7 A;  3CGA A;  1OMV A;  5TNC A;  2FOT A;  2NLN A;  4DIR A;  3TDI A;  5AFP A;  1EL4 A;  1F8H A;  4QJ4 B;  5CSJ A;  3PM8 A;  1CKK A;  1J7R A;  4PHK A;  2KQ6 A;  1YUU A;  2KOT A;  3TS5 B;  5JJG A;  3FIA A;  5HKZ A;  1FW4 A;  3CZT X;  4TNC A;  3GOF A;  5HKW A;  4MVF A;  5AEQ A;  1OMR A;  4A4C A;  1JBA A;  2H2K A;  2LLT A;  3VRP A;  1WLM A;  3I5H B;  2KGB C;  4N1G A;  5CSF A;  3CTN A;  1SRA A;  3FWC A;  1DGV A;  3PLF B;  1DT7 B;  2JRF A;  3HCM A;  1CDL A;  4HRG A;  4YI8 A;  5HLV A;  1KK7 Y;  3SG6 A;  1IJ6 A;  1QV1 A;  4XJK A;  2KI6 C;  5ER5 A;  3RM1 A;  1JUO A;  3ICB A;  1CLL A;  3PFV A;  2WCE A;  2CXJ A;  1XA5 A;  3ZWH A;  3NSL A;  1UHN A;  3EKJ A;  2KFF A;  1Y6W A;  4I5J A;  1REC A;  3PAL A;  1DJI A;  4NQG A;  4P5O E;  1ALV A;  1M63 B;  2BCX A;  2JT3 A;  1OOJ A;  1NX1 A;  5IBW A;  2F33 A;  4BY5 A;  2OTG B;  1TCO B;  1IWQ A;  4DRW A;  2WOR A;  2LHL A;  4NDC A;  3NSK A;  2LMT A;  1QTX A;  1V1F A;  3PSR A;  3D0Y A;  1JC2 A;  2I18 A;  5ER4 X;  1OZO A;  4NDB A;  3FS7 A;  1SR6 C;  1EG3 A;  1TNQ A;  2LLU A;  5HKY A;  2AMI A;  2M7N A;  2JU0 A;  3KPX A;  1SCM C;  4MSP A;  2KYF A;  3OX6 A;  2E30 A;  2KI6 D;  1J1E A;  4WRI A;  4ZCU A;  1KQV A;  4HRE E;  3I5I B;  1RWY A;  4ZCV A;  1IRJ A;  1FI5 A;  3EVU A;  4MZL A;  3KEV A;  3DD4 A;  2Q91 A;  3LK0 A;  1M46 A;  1WLZ A;  3KO0 A;  3A4U B;  2HQ8 A;  1GJY A;  2JT0 A;  2K0J A;  2LP3 A;  1B9A A;  1UHH A;  2ZN9 A;  1U5I B;  1J7P A;  4DCK A;  4MRY A;  2MJW B;  1TTX A;  2JWW A;  3AKB A;  4CFR A;  1BG1 A;  1D1O A;  1IG5 A;  2ZRT A;  2IS9 A;  5CPV A;  1NUB A;  1QIW A;  4C0L A;  1J7O A;  1J1D A;  2OS8 B;  1C07 A;  1K96 A;  2AAO A;  1S36 A;  3GK2 A;  4PE7 A;  2F2O A;  1MUX A;  4HRH A;  1BOD A;  1Y0V H;  1B7T Y;  3CLN A;  1IH0 A;  2M8U A;  1C7W A;  2HET A;  5DKR A;  5I8N A;  1W7I B;  2M7L A;  1QJT A;  1XO5 A;  1DJG A;  3VRO A;  2EHB A;  1QX2 A;  3JTD C;  2B1U A;  1QVI Z;  2L98 A;  2SAS A;  2M97 A;  2NXQ A;  3SIA A;  3SG3 A;  4QJ3 B;  3LCP C;  1UHI A;  2BCB A;  4USL A;  5FYX A;  2EC6 C;  2F3Y A;  3AKA A;  4ORA B;  1HT9 A;  1S26 D;  3BUN B;  2GGZ A;  1WRL A;  1EJ3 A;  1G4Y R;  3WNX B;  5D69 A;  3I5G C;  4YGC B;  2BEC A;  1QLK A;  1CM4 A;  4JQ0 D;  1LIN A;  5GQQ C;  4IL1 A;  2KBM A;  4N1F A;  1CLM A;  1YX7 A;  2MBX A;  2JPT A;  2L51 A;  1KK8 C;  1S5G Y;  4PE1 A;  1CNP A;  1Q80 A;  1FBV A;  4CFQ A;  1TNW A;  5J3X A;  2CCM A;  3O6B A;  2WCF A;  1MF8 B;  1TNP A;  3HX4 A;  1LXF C;  3TDU A;  4XJK B;  3SG5 A;  1CFP A;  1JWD A;  4QJ5 B;  1K8U A;  4C0K A;  1AHR A;  1AK8 A;  1FI6 A;  5CSN A;  4I5K A;  1PSR A;  2NCO A;  3NSO A;  1R6P A;  1A29 A;  3CR5 X;  1K95 A;  2BL0 B;  3OP0 A;  1G33 A;  1OMD A;  1TIZ A;  2O60 A;  1WDC C;  1G8I A;  1WY9 A;  4PHM A;  3PN7 C;  1KWO C;  4U8D A;  1UP5 A;  4UPG A;  1CFC A;  3SG7 A;  1OE9 B;  2DOQ A;  1NX2 A;  1FPW A;  1BR1 B;  2KGR A;  1B1G A;  1IQ5 A;  2G9B A;  3JVT B;  3VRR A;  1CDN A;  2M1K B;  1KFU L;  4M2Q A;  1XFZ O;  1K2H A;  3LL8 B;  1TOP A;  2JT8 A;  4HSZ A;  4C0J A;  2LCP A;  4GPL B;  4OVN F;  1NCY A;  3D0Y B;  4CPV A;  2KDH A;  3TUY B;  2PAS A;  1ZAC A;  1JFK A;  4WQ3 A;  1SYM A;  2BCA A;  1DGU A;  1KSM A;  1NSH A;  4ORB B;  1DTL A;  1SL9 A;  2L4I A;  1NP8 A;  1K9P A;  1LA3 A;  1NWD A;  1QXP A;  1LKJ A;  4JPZ B;  3SJS A;  5B8I B;  2Q4U A;  1QAT A;  2KI4 C;  3WHT B;  4I5L B;  4P2Y B;  1NIW A;  5D7F A;  1L2O B;  1ZFS A;  1M31 A;  1EG4 A;  1XFW O;  1KQM B;  2RGI A;  3I5F C;  4YGA A;  3VRQ A;  1TCF A;  3BUO B;  3F45 A;  1XFX O;  4GGN A;  2CNP A;  3CR4 X;  2P6B B;  5KTY A;  2K7B A;  2Y5I A;  1BR4 B;  1IGV A;  2BKI B;  1ALW A;  2LAP A;  1EXR A;  1NPQ A;  3DF0 A;  1PUL A;  2KAY A;  1XK4 A;  4YGB B;  1CB1 A;  3OB2 B;  3BUX B;  3IQO A;  3KHE A;  4GNK B;  1QX5 B;  1S1E A;  1F4O A;  1MXE A;  2JZI A;  3BYA A;  4OKH A;  3CWG A;  4E68 A;  1S6I A;  1S6C A;  4DS7 A;  2K7O A;  1S3P A;  1TRF A;  2F3Z A;  3BQ3 A;  2LE9 B;  2LUX A;  1A4P A;  1IKU A;  1XVJ A;  2PAL A;  4ETO A;  4CID A;  1DJZ A;  3FWB A;  2LVV A;  3C1V A;  2AUC A;  1NX0 A;  1VRK A;  1XYD A;  1M45 A;  1B8L A;  1YUT A;  2NZ0 A;  4MLW A;  1H4B A;  2KHN A;  4MZJ A;  4GGF C;  1DMO A;  3H4S E;  2I7A A;  1QAS A;  1A75 A;  3WHU B;  2M49 B;  2LUC A;  1EH2 A;  3TS5 C;  1F54 A;  2R2I A;  1LVC D;  2MRD A;  1B8C A;  1DJX A;  2KFG A;  3BUW B;  2M1U A;  3EK4 A;  1MQ1 A;  3I5H C;  1B47 A;  4PE4 A;  3EK7 A;  2ISD A;  4D1E A;  4PHN A;  2LVK A;  1JF0 A;  3E3R A;  1LA0 A;  4MBE A;  1WRZ A;  1CDM A;  2O5G A;  1BMO A;  1F70 A;  2K61 A;  2KFH A;  5AAN A;  1UWO A;  1CTR A;  1NCX A;  1QLS A;  2L2E A;  4XYN A;  1J7Q A;  3ZNI A;  1KFX L;  1KFU S;  2K8M B;  3SIB A;  2GV5 A; 
#chains in the Genus database with same CATH topology
 1IQ3 A;  2PRU A;  5CSI A;  3BOW A;  1M39 A;  5JOL A;  1JFJ A;  1PSB A;  3OGN A;  2MHH A;  2HQW A;  4ICB A;  4PE0 A;  2LVJ A;  1UHK A;  2OPO A;  5AER A;  2F8P A;  3S0F A;  2L0P A;  4JKT A;  3SS4 A;  4JWQ A;  2BBM A;  1UHJ A;  2OTG C;  2JXL A;  2JOJ A;  1DJH A;  4MZK A;  4OR9 B;  1OZS A;  1K9U A;  3B88 A;  3O78 A;  1DJY A;  4FTG A;  1SL7 A;  2MAZ A;  2KSP A;  3SG4 A;  2QAC A;  2VRG A;  2JTT A;  1RK9 A;  1C7V A;  1OW4 A;  1AVS A;  1SY9 A;  2L5X B;  3CS1 A;  2A4J A;  2H61 C;  1B8R A;  5KSZ A;  2M3W A;  2MLE C;  2LM5 A;  1SR6 B;  1KK7 Z;  1YVH A;  5F6T A;  1QS7 A;  1GGW A;  3K21 A;  5HLO A;  2E6W A;  3GK1 A;  2LP2 A;  1PVB A;  3B7A A;  1GGZ A;  3CZ1 A;  3NXA A;  4FQO A;  1A03 A;  1SCM B;  2PMY A;  3I5I C;  4KYN A;  2Y4Q A;  4AQJ A;  2JNF A;  1C3Y A;  2K2F A;  2COL B;  2ZRS A;  4JD9 A;  1QVI Y;  2JXC A;  2LC5 A;  2LV7 A;  2ZND A;  3OB1 B;  5FI6 A;  1LS8 A;  3WXA A;  1PRW A;  5PAL A;  1N0Y A;  1NCZ A;  1KSO A;  4YGE B;  1AJ4 A;  2BBN A;  3EVV A;  3S0B A;  1MXL C;  3SS3 A;  3DY9 A;  4Q04 A;  2WC5 A;  1AUI B;  2I94 A;  1NX3 A;  5I2Q A;  3R72 A;  1CMF A;  2BAP A;  3DVK A;  3LLE A;  3R1O A;  1DEL A;  2OS8 C;  1IJ5 A;  2KAV A;  3DF0 B;  5DKQ A;  5I2O A;  1TUJ A;  2QPT A;  4WQ2 A;  2CTN A;  1ZMZ A;  3OHM B;  2BE4 A;  2G2B A;  5AXI A;  5KU1 A;  1N65 A;  4PAL A;  1SL8 A;  1K93 D;  2LMU A;  3MSE B;  2PVB A;  3PAT A;  1RJV A;  1H8B A;  1W7J B;  5HYD A;  1B4C A;  2Y1N A;  1SK6 D;  2HF5 A;  1DF0 A;  1MHO A;  1SNL A;  3JTD B;  2KNE A;  2L4H A;  2TN4 A;  1SPY A;  3DVM A;  1RRO A;  1SKT A;  3RLZ A;  1CLB A;  1PAL A;  1N2D A;  1OQP A;  4GGF A;  1BLQ A;  1QV0 A;  2K7C A;  2EC6 B;  3S0G A;  2LLS A;  1S6J A;  4GBA A;  4MEW A;  1DQE A;  4PHJ A;  1A75 B;  2FJU B;  1ODB A;  4NDD A;  1BT6 A;  1HQV A;  2BE6 A;  2JTZ A;  2K2A A;  1KFX S;  3CR2 A;  1YRT B;  2WCK A;  3I5G B;  4BY4 A;  1ZUZ A;  1YR5 A;  3EKH A;  1CFD A;  3S0D A;  2M9G A;  4OV2 A;  4A4B A;  4R1E A;  1BU3 A;  2JQ6 A;  1J55 A;  1SBJ A;  2EGD A;  2M0R A;  4OCI A;  5I94 A;  1R2U A;  1V1G A;  3UNW A;  1Z4H A;  2LNK A;  1E8A A;  1XFY O;  1Y1X A;  2LVI A;  1RFJ A;  1YUR A;  1B7T Z;  3BXK A;  2GTE A;  2FCE A;  1KK8 B;  1X02 A;  2KQY A;  1SW8 A;  3QRX A;  4ORC B;  4PDZ A;  3FE6 A;  2KYC A;  1NYA A;  3D76 A;  1RTP 1;  4AOM A;  5D3O A;  3DYE A;  3O2P A;  2GGM A;  2BL0 C;  3AAK A;  1L7Z A;  3NHT A;  3FE8 A;  4MRX A;  4DUQ A;  2F2P A;  3BOW B;  3DVE A;  1OOI X;  3R1V A;  2PQL A;  3TZ1 A;  1BF5 A;  1Y1U A;  2QDI A;  3A8R A;  1WDC B;  5DIC A;  5DKN A;  2K7D A;  1KWO B;  1YTZ C;  1UUR A;  1CM1 A;  3PN7 B;  1CFF A;  2JNX A;  1TN4 A;  1WRK A;  2LAN A;  3JVT C;  1KCY A;  1MR8 A;  4PCW A;  1SCV A;  2SCP A;  1ZOT B;  4CLN A;  3IQQ A;  2PSR A;  2L50 A;  1AJ5 A;  3GK4 X;  1BJF A;  2M29 A;  3QME A;  3BUM B;  4YBH B;  1S5G Z;  3TUY C;  2FCD A;  1FF1 A;  2H61 A;  4GFT A;  1SMG A;  1AP4 A;  1XK4 C;  4MN0 A;  1JSA A;  3KF9 A;  3M0W A;  2JUL A;  1QIV A;  2WND A;  1YX8 A;  2V53 A;  2WOS A;  1YVL A;  2Y1M A;  5BPJ A;  3EVR A;  2CT9 A;  4M2P A;  3LK1 A;  1XFV O;  2KI4 B;  5G08 A;  1L2O C;  1CDP A;  2WC8 A;  1OSA A;  3O4X A;  3NSI A;  4L9M A;  1KQM C;  1K94 A;  5I2L A;  3UO9 A;  1UUS A;  2D8N A;  2ZFD A;  3S0A A;  3SG2 A;  1F71 A;  1K9K A;  3I5F B;  2ZN8 A;  1YRU B;  1BOC A;  1U5I A;  3VGO A;  2LMV A;  4GAO A;  1DVI A;  4INW A;  3AAJ A;  4GUK A;  2ZKM X;  3D10 A;  1Y1A A;  3BJH A;  3TDZ A;  1YUS A;  3OX5 A;  2I2R E;  2LHI A;  5K89 A;  1DJW A;  2MLF C;  4M2O A;  1Z2C B;  4YGD B;  1F55 A;  4YI9 A;  1JF2 A;  1PK0 D;  2WCL A;  2H8V A;  4N5X A;  1PVA A;  1XFU O;  3EK8 A;  3Q8I A;  2JC2 A;  1QX7 A;  2WCB A;  4PT1 A;  3VRN A;  2YGU A;  4AQI A;  5FI7 A;  2NCP A;  2BKH B;  2HPS A;  1GQM A;  2ZNE A;  3DVJ A;  1A2X A;  1MWN A;  3D75 A;  2KBI A;  1F4Q A;  1DF0 B;  1K90 D;  2CBL A;  2MA2 A;  4I5N B;  4F0Z B;  2KAX A;  1TNX A;  3O4Y A;  1CMG A;  4YRU A;  3IF7 A;  3CGA A;  1OMV A;  5TNC A;  2FOT A;  2NLN A;  4DIR A;  3TDI A;  5AFP A;  1EL4 A;  3B86 A;  1F8H A;  4QJ4 B;  5CSJ A;  3PM8 A;  1CKK A;  1J7R A;  1QWV A;  4PHK A;  2KQ6 A;  1YUU A;  2KOT A;  3TS5 B;  5JJG A;  3FIA A;  5HKZ A;  1FW4 A;  3CZT X;  4TNC A;  3GOF A;  5HKW A;  4MVF A;  5AEQ A;  1OMR A;  3CZ2 A;  4A4C A;  1JBA A;  2H2K A;  2LLT A;  3VRP A;  1WLM A;  3I5H B;  2KGB C;  4N1G A;  2WCM A;  5CSF A;  3CTN A;  1SRA A;  3FWC A;  1DGV A;  3PLF B;  1DT7 B;  2JRF A;  3HCM A;  1CDL A;  4HRG A;  4YI8 A;  5HLV A;  1KK7 Y;  3SG6 A;  1IJ6 A;  1QV1 A;  4XJK A;  2KI6 C;  5ER5 A;  3R1P A;  1JUO A;  3ICB A;  3RM1 A;  1CLL A;  3PFV A;  2WCE A;  3BFH A;  2CXJ A;  1XA5 A;  3ZWH A;  3NSL A;  1UHN A;  4IJ7 A;  3EKJ A;  2KFF A;  1Y6W A;  4I5J A;  1REC A;  3PAL A;  1DJI A;  4NQG A;  4P5O E;  1ALV A;  3OBV A;  1OOH A;  1M63 B;  2BCX A;  2JT3 A;  1OOJ A;  1NX1 A;  5IBW A;  2F33 A;  4BY5 A;  2OTG B;  3CZ0 A;  1TCO B;  1IWQ A;  3DXL A;  4DRW A;  2P70 A;  2WOR A;  2LHL A;  3D74 A;  3NSK A;  4NDC A;  2LMT A;  1QTX A;  1V1F A;  3PSR A;  3D0Y A;  3B6X A;  1JC2 A;  1XFR A;  2I18 A;  5ER4 X;  1OZO A;  4NDB A;  3FS7 A;  1SR6 C;  1EG3 A;  1TNQ A;  2LLU A;  1C3Z A;  5HKY A;  2AMI A;  2M7N A;  2JU0 A;  3KPX A;  4INX A;  1SCM C;  4MSP A;  2KYF A;  3OX6 A;  2E30 A;  2KI6 D;  1J1E A;  4WRI A;  4ZCU A;  1KQV A;  4HRE E;  3I5I B;  1RWY A;  4ZCV A;  1IRJ A;  1FI5 A;  3EVU A;  4MZL A;  3KEV A;  3K1E A;  3DD4 A;  2Q91 A;  3LK0 A;  1M46 A;  1WLZ A;  3KO0 A;  3A4U B;  2HQ8 A;  1GJY A;  2JT0 A;  4OZD A;  2K0J A;  2LP3 A;  3DZT A;  1B9A A;  1UHH A;  2ZN9 A;  3NHI A;  1U5I B;  1J7P A;  4DCK A;  4MRY A;  2P71 A;  2MJW B;  1TTX A;  2KPH A;  2JWW A;  3AKB A;  4CFR A;  1BG1 A;  1D1O A;  1IG5 A;  2ZRT A;  1SSE B;  2IS9 A;  3PJI A;  5CPV A;  5EL2 A;  1NUB A;  1QIW A;  4C0L A;  1J7O A;  1J1D A;  2OS8 B;  1C07 A;  1K96 A;  2AAO A;  1S36 A;  3GK2 A;  4PE7 A;  2F2O A;  1MUX A;  4HRH A;  1W9Z A;  1BOD A;  1Y0V H;  1B7T Y;  3CLN A;  1IH0 A;  2M8U A;  1C7W A;  2HET A;  5DKR A;  5I8N A;  1OOF A;  1W7I B;  2M7L A;  1QJT A;  1XO5 A;  1DJG A;  3VRO A;  2EHB A;  2PYQ A;  1QX2 A;  1T14 A;  3JTD C;  2B1U A;  1QVI Z;  2L98 A;  2SAS A;  2M97 A;  2NXQ A;  3SIA A;  3IVT A;  3SG3 A;  4QJ3 B;  3LCP C;  1DEK A;  1UHI A;  2BCB A;  4USL A;  5FYX A;  2EC6 C;  2F3Y A;  3AKA A;  4ORA B;  1HT9 A;  1S26 D;  3BUN B;  2GGZ A;  1WRL A;  1EJ3 A;  1G4Y R;  3WNX B;  5D69 A;  3SS5 A;  2KLE A;  3I5G C;  4YGC B;  2BEC A;  3NGV A;  1QLK A;  1CM4 A;  4JQ0 D;  1LIN A;  3L4L A;  5GQQ C;  4IL1 A;  5FI2 A;  1DC1 A;  2KBM A;  4N1F A;  1CLM A;  1YX7 A;  2MBX A;  2JPT A;  3CDN A;  2L51 A;  3B87 A;  3D78 A;  1KK8 C;  1S5G Y;  2L5Y A;  4PE1 A;  1CNP A;  1Q80 A;  1FBV A;  2WCJ A;  4CFQ A;  1TNW A;  5J3X A;  2CCM A;  3O6B A;  2WCF A;  1MF8 B;  1TNP A;  3HX4 A;  1LXF C;  2QEO A;  4XJK B;  3SG5 A;  3TDU A;  1CFP A;  1JWD A;  4QJ5 B;  1K8U A;  4C0K A;  1AHR A;  2WC6 A;  1AK8 A;  5CSN A;  4I5K A;  1FI6 A;  1PSR A;  2NCO A;  3NSO A;  1R6P A;  1A29 A;  3CR5 X;  1K95 A;  2BL0 B;  3OP0 A;  1G33 A;  2JPO A;  1OMD A;  1TIZ A;  2O60 A;  1WDC C;  1G8I A;  1WY9 A;  4PHM A;  3PN7 C;  1KWO C;  4U8D A;  1UP5 A;  4UPG A;  1CFC A;  3SG7 A;  1OE9 B;  2DOQ A;  1NX2 A;  4F7F A;  1FPW A;  1BR1 B;  2KGR A;  1B1G A;  1IQ5 A;  2G9B A;  3JVT B;  3VRR A;  1CDN A;  2M1K B;  1KFU L;  4M2Q A;  1XFZ O;  1K2H A;  3LL8 B;  1TOP A;  2JT8 A;  4HSZ A;  4C0J A;  2LCP A;  4GPL B;  4OVN F;  1IIO A;  1NCY A;  3D0Y B;  4CPV A;  1P28 A;  2KDH A;  3TUY B;  2PAS A;  3N7H A;  1ZAC A;  1JFK A;  4WQ3 A;  1SYM A;  2BCA A;  1DGU A;  2BNX A;  1KSM A;  1NSH A;  4ORB B;  1DTL A;  1SL9 A;  2L4I A;  1NP8 A;  1K9P A;  1LA3 A;  1NWD A;  1QXP A;  1LKJ A;  3CAB A;  4JPZ B;  3SJS A;  5B8I B;  5HL1 A;  2Q4U A;  1QAT A;  2KI4 C;  3WHT B;  4I5L B;  4P2Y B;  1GM0 A;  1NIW A;  2L2C A;  5D7F A;  3BFA A;  3L47 A;  1L2O B;  1ZFS A;  3RZS A;  1M31 A;  1EG4 A;  1XFW O;  2QEB A;  1OOG A;  1KQM B;  2RGI A;  3I5F C;  4YGA A;  3VRQ A;  1TCF A;  3BUO B;  3F45 A;  1XFX O;  4GGN A;  2KLD A;  2CNP A;  3CR4 X;  4FQT A;  2P6B B;  2QEH A;  5KTY A;  2K7B A;  2Y5I A;  1BR4 B;  1IGV A;  2BKI B;  1ALW A;  2LAP A;  1EXR A;  1NPQ A;  3DF0 A;  1PUL A;  2KAY A;  1XK4 A;  4YGB B;  1CB1 A;  3OB2 B;  3BUX B;  3IQO A;  3KHE A;  4GNK B;  3S0E A;  1QX5 B;  3EG5 B;  1S1E A;  1F4O A;  1MXE A;  2JZI A;  3BYA A;  4OKH A;  3CWG A;  4E68 A;  1S6I A;  3D77 A;  1S6C A;  4DS7 A;  2K7O A;  1S3P A;  1TRF A;  2F3Z A;  2FJY A;  2LE9 B;  3BQ3 A;  3L4A A;  2LUX A;  1A4P A;  1IKU A;  1XVJ A;  1ORG A;  2PAL A;  4ETO A;  3BFB A;  4CID A;  1DJZ A;  3FWB A;  2LVV A;  3C1V A;  3PM2 A;  2AUC A;  1NX0 A;  1VRK A;  1XYD A;  1M45 A;  1B8L A;  1YUT A;  2NZ0 A;  4MLW A;  1H4B A;  2KHN A;  4MZJ A;  2ERB A;  4GGF C;  1DMO A;  2K60 A;  3H4S E;  2I7A A;  3VB1 A;  1QAS A;  1A75 A;  3FE9 A;  3WHU B;  2M49 B;  2LUC A;  1EH2 A;  2WCH A;  3TS5 C;  1F54 A;  1TUZ A;  2R2I A;  1LVC D;  2MRD A;  3CYZ A;  3V2L A;  1B8C A;  1DJX A;  2KFG A;  3BUW B;  2M1U A;  3EK4 A;  1MQ1 A;  3I5H C;  1B47 A;  4PE4 A;  3EK7 A;  3D73 A;  2ISD A;  4D1E A;  4PHN A;  2LVK A;  1JF0 A;  3E3R A;  1LA0 A;  4MBE A;  1WRZ A;  1CDM A;  2O5G A;  1BMO A;  1TWO A;  1F70 A;  2K61 A;  2KFH A;  2QEV A;  5AAN A;  1UWO A;  1CTR A;  1NCX A;  1QLS A;  2L2E A;  4XYN A;  1J7Q A;  3ZNI A;  1KFX L;  1KFU S;  2K8M B;  3SIB A;  2GV5 A; 
#chains in the Genus database with same CATH homology
 1IQ3 A;  2PRU A;  5CSI A;  3BOW A;  1M39 A;  5JOL A;  1JFJ A;  1PSB A;  4ICB A;  2MHH A;  2HQW A;  4PE0 A;  2LVJ A;  1UHK A;  2OPO A;  5AER A;  2F8P A;  2L0P A;  4JWQ A;  2BBM A;  1UHJ A;  2OTG C;  2JXL A;  2JOJ A;  1DJH A;  4MZK A;  4OR9 B;  1OZS A;  1K9U A;  3O78 A;  1DJY A;  4FTG A;  1SL7 A;  2MAZ A;  2KSP A;  3SG4 A;  2QAC A;  2VRG A;  2JTT A;  1RK9 A;  1C7V A;  1AVS A;  1SY9 A;  2L5X B;  3CS1 A;  2A4J A;  2H61 C;  1B8R A;  5KSZ A;  2M3W A;  2MLE C;  2LM5 A;  1SR6 B;  1KK7 Z;  1YVH A;  5F6T A;  1QS7 A;  1GGW A;  3K21 A;  5HLO A;  2E6W A;  3GK1 A;  2LP2 A;  1PVB A;  3NXA A;  1GGZ A;  4FQO A;  1A03 A;  1SCM B;  2PMY A;  3I5I C;  2Y4Q A;  4AQJ A;  2JNF A;  2K2F A;  2COL B;  2ZRS A;  1QVI Y;  2JXC A;  2LC5 A;  2LV7 A;  2ZND A;  3OB1 B;  3WXA A;  1PRW A;  5PAL A;  1N0Y A;  1NCZ A;  1KSO A;  4YGE B;  1AJ4 A;  2BBN A;  3EVV A;  1MXL C;  4Q04 A;  1AUI B;  2I94 A;  1NX3 A;  5I2Q A;  1CMF A;  3DVK A;  3LLE A;  2OS8 C;  1IJ5 A;  2KAV A;  3DF0 B;  5DKQ A;  5I2O A;  2QPT A;  4WQ2 A;  2CTN A;  1ZMZ A;  3OHM B;  2BE4 A;  2G2B A;  5AXI A;  5KU1 A;  1N65 A;  4PAL A;  1SL8 A;  1K93 D;  2LMU A;  3MSE B;  2PVB A;  3PAT A;  1RJV A;  1H8B A;  1W7J B;  5HYD A;  1B4C A;  2Y1N A;  1SK6 D;  2HF5 A;  1DF0 A;  1MHO A;  1SNL A;  3JTD B;  2KNE A;  2L4H A;  2TN4 A;  1SPY A;  3DVM A;  1RRO A;  1SKT A;  3RLZ A;  1CLB A;  1PAL A;  1N2D A;  1OQP A;  4GGF A;  1BLQ A;  1QV0 A;  2K7C A;  2EC6 B;  2LLS A;  1S6J A;  4GBA A;  4MEW A;  4PHJ A;  1A75 B;  2FJU B;  1ODB A;  4NDD A;  1BT6 A;  1HQV A;  2BE6 A;  2JTZ A;  2K2A A;  1KFX S;  3CR2 A;  1YRT B;  3I5G B;  4BY4 A;  1ZUZ A;  1YR5 A;  3EKH A;  1CFD A;  2M9G A;  4OV2 A;  4A4B A;  4R1E A;  1BU3 A;  2JQ6 A;  1J55 A;  1SBJ A;  2EGD A;  2M0R A;  4OCI A;  1R2U A;  1V1G A;  2LNK A;  1E8A A;  1XFY O;  1Y1X A;  2LVI A;  1RFJ A;  1YUR A;  1B7T Z;  3BXK A;  2FCE A;  1KK8 B;  1X02 A;  2KQY A;  1SW8 A;  3QRX A;  4ORC B;  4PDZ A;  2KYC A;  1NYA A;  1RTP 1;  4AOM A;  3O2P A;  2GGM A;  2BL0 C;  3AAK A;  1L7Z A;  4MRX A;  4DUQ A;  2F2P A;  3BOW B;  3DVE A;  1BF5 A;  3TZ1 A;  1Y1U A;  3A8R A;  1WDC B;  5DKN A;  2K7D A;  1KWO B;  1YTZ C;  1UUR A;  1CM1 A;  3PN7 B;  1CFF A;  2JNX A;  1TN4 A;  1WRK A;  2LAN A;  3JVT C;  1KCY A;  1MR8 A;  4PCW A;  1SCV A;  2SCP A;  1ZOT B;  4CLN A;  3IQQ A;  2PSR A;  2L50 A;  1AJ5 A;  3GK4 X;  1BJF A;  2M29 A;  3BUM B;  4YBH B;  1S5G Z;  3TUY C;  2FCD A;  1FF1 A;  2H61 A;  4GFT A;  1SMG A;  1AP4 A;  1XK4 C;  4MN0 A;  1JSA A;  3KF9 A;  3M0W A;  2JUL A;  1QIV A;  2WND A;  1YX8 A;  2V53 A;  2WOS A;  1YVL A;  2Y1M A;  5BPJ A;  3EVR A;  2CT9 A;  4M2P A;  3LK1 A;  1XFV O;  2KI4 B;  5G08 A;  1L2O C;  1CDP A;  2WC8 A;  1OSA A;  3NSI A;  4L9M A;  1KQM C;  1K94 A;  5I2L A;  1UUS A;  2D8N A;  2ZFD A;  3SG2 A;  1F71 A;  1K9K A;  3I5F B;  2ZN8 A;  1YRU B;  1BOC A;  1U5I A;  3VGO A;  2LMV A;  4GAO A;  1DVI A;  3AAJ A;  4GUK A;  2ZKM X;  3D10 A;  1Y1A A;  3TDZ A;  1YUS A;  3OX5 A;  2I2R E;  2LHI A;  5K89 A;  1DJW A;  2MLF C;  4M2O A;  4YGD B;  1F55 A;  4YI9 A;  1JF2 A;  1PK0 D;  4N5X A;  1PVA A;  1XFU O;  3EK8 A;  2JC2 A;  1QX7 A;  2WCB A;  3VRN A;  4AQI A;  2NCP A;  2BKH B;  2HPS A;  1GQM A;  2ZNE A;  3DVJ A;  1A2X A;  1MWN A;  2KBI A;  1F4Q A;  1DF0 B;  1K90 D;  2CBL A;  2MA2 A;  4I5N B;  4F0Z B;  2KAX A;  1TNX A;  3O4Y A;  1CMG A;  4YRU A;  3IF7 A;  3CGA A;  1OMV A;  5TNC A;  2FOT A;  2NLN A;  4DIR A;  3TDI A;  5AFP A;  1EL4 A;  1F8H A;  4QJ4 B;  5CSJ A;  3PM8 A;  1CKK A;  1J7R A;  4PHK A;  2KQ6 A;  1YUU A;  2KOT A;  3TS5 B;  5JJG A;  3FIA A;  5HKZ A;  1FW4 A;  3CZT X;  4TNC A;  3GOF A;  5HKW A;  4MVF A;  5AEQ A;  1OMR A;  4A4C A;  1JBA A;  2H2K A;  2LLT A;  3VRP A;  1WLM A;  3I5H B;  2KGB C;  4N1G A;  5CSF A;  3CTN A;  1SRA A;  3FWC A;  1DGV A;  3PLF B;  1DT7 B;  2JRF A;  3HCM A;  1CDL A;  4HRG A;  4YI8 A;  5HLV A;  1KK7 Y;  3SG6 A;  1IJ6 A;  1QV1 A;  4XJK A;  2KI6 C;  5ER5 A;  3RM1 A;  1JUO A;  3ICB A;  1CLL A;  3PFV A;  2WCE A;  2CXJ A;  1XA5 A;  3ZWH A;  3NSL A;  1UHN A;  3EKJ A;  2KFF A;  1Y6W A;  4I5J A;  1REC A;  3PAL A;  1DJI A;  4NQG A;  4P5O E;  1ALV A;  1M63 B;  2BCX A;  2JT3 A;  1OOJ A;  1NX1 A;  5IBW A;  2F33 A;  4BY5 A;  2OTG B;  1TCO B;  1IWQ A;  4DRW A;  2WOR A;  2LHL A;  4NDC A;  3NSK A;  2LMT A;  1QTX A;  1V1F A;  3PSR A;  3D0Y A;  1JC2 A;  2I18 A;  5ER4 X;  1OZO A;  4NDB A;  3FS7 A;  1SR6 C;  1EG3 A;  1TNQ A;  2LLU A;  5HKY A;  2AMI A;  2M7N A;  2JU0 A;  3KPX A;  1SCM C;  4MSP A;  2KYF A;  3OX6 A;  2E30 A;  2KI6 D;  1J1E A;  4WRI A;  4ZCU A;  1KQV A;  4HRE E;  3I5I B;  1RWY A;  4ZCV A;  1IRJ A;  1FI5 A;  3EVU A;  4MZL A;  3KEV A;  3DD4 A;  2Q91 A;  3LK0 A;  1M46 A;  1WLZ A;  3KO0 A;  3A4U B;  2HQ8 A;  1GJY A;  2JT0 A;  2K0J A;  2LP3 A;  1B9A A;  1UHH A;  2ZN9 A;  1U5I B;  1J7P A;  4DCK A;  4MRY A;  2MJW B;  1TTX A;  2JWW A;  3AKB A;  4CFR A;  1BG1 A;  1D1O A;  1IG5 A;  2ZRT A;  2IS9 A;  5CPV A;  1NUB A;  1QIW A;  4C0L A;  1J7O A;  1J1D A;  2OS8 B;  1C07 A;  1K96 A;  2AAO A;  1S36 A;  3GK2 A;  4PE7 A;  2F2O A;  1MUX A;  4HRH A;  1BOD A;  1Y0V H;  1B7T Y;  3CLN A;  1IH0 A;  2M8U A;  1C7W A;  2HET A;  5DKR A;  5I8N A;  1W7I B;  2M7L A;  1QJT A;  1XO5 A;  1DJG A;  3VRO A;  2EHB A;  1QX2 A;  3JTD C;  2B1U A;  1QVI Z;  2L98 A;  2SAS A;  2M97 A;  2NXQ A;  3SIA A;  3SG3 A;  4QJ3 B;  3LCP C;  1UHI A;  2BCB A;  4USL A;  5FYX A;  2EC6 C;  2F3Y A;  3AKA A;  4ORA B;  1HT9 A;  1S26 D;  3BUN B;  2GGZ A;  1WRL A;  1EJ3 A;  1G4Y R;  3WNX B;  5D69 A;  3I5G C;  4YGC B;  2BEC A;  1QLK A;  1CM4 A;  4JQ0 D;  1LIN A;  5GQQ C;  4IL1 A;  2KBM A;  4N1F A;  1CLM A;  1YX7 A;  2MBX A;  2JPT A;  2L51 A;  1KK8 C;  1S5G Y;  4PE1 A;  1CNP A;  1Q80 A;  1FBV A;  4CFQ A;  1TNW A;  5J3X A;  2CCM A;  3O6B A;  2WCF A;  1MF8 B;  1TNP A;  3HX4 A;  1LXF C;  3TDU A;  4XJK B;  3SG5 A;  1CFP A;  1JWD A;  4QJ5 B;  1K8U A;  4C0K A;  1AHR A;  1AK8 A;  1FI6 A;  5CSN A;  4I5K A;  1PSR A;  2NCO A;  3NSO A;  1R6P A;  1A29 A;  3CR5 X;  1K95 A;  2BL0 B;  3OP0 A;  1G33 A;  1OMD A;  1TIZ A;  2O60 A;  1WDC C;  1G8I A;  1WY9 A;  4PHM A;  3PN7 C;  1KWO C;  4U8D A;  1UP5 A;  4UPG A;  1CFC A;  3SG7 A;  1OE9 B;  2DOQ A;  1NX2 A;  1FPW A;  1BR1 B;  2KGR A;  1B1G A;  1IQ5 A;  2G9B A;  3JVT B;  3VRR A;  1CDN A;  2M1K B;  1KFU L;  4M2Q A;  1XFZ O;  1K2H A;  3LL8 B;  1TOP A;  2JT8 A;  4HSZ A;  4C0J A;  2LCP A;  4GPL B;  4OVN F;  1NCY A;  3D0Y B;  4CPV A;  2KDH A;  3TUY B;  2PAS A;  1ZAC A;  1JFK A;  4WQ3 A;  1SYM A;  2BCA A;  1DGU A;  1KSM A;  1NSH A;  4ORB B;  1DTL A;  1SL9 A;  2L4I A;  1NP8 A;  1K9P A;  1LA3 A;  1NWD A;  1QXP A;  1LKJ A;  4JPZ B;  3SJS A;  5B8I B;  2Q4U A;  1QAT A;  2KI4 C;  3WHT B;  4I5L B;  4P2Y B;  1NIW A;  5D7F A;  1L2O B;  1ZFS A;  1M31 A;  1EG4 A;  1XFW O;  1KQM B;  2RGI A;  3I5F C;  4YGA A;  3VRQ A;  1TCF A;  3BUO B;  3F45 A;  1XFX O;  4GGN A;  2CNP A;  3CR4 X;  2P6B B;  5KTY A;  2K7B A;  2Y5I A;  1BR4 B;  1IGV A;  2BKI B;  1ALW A;  2LAP A;  1EXR A;  1NPQ A;  3DF0 A;  1PUL A;  2KAY A;  1XK4 A;  4YGB B;  1CB1 A;  3OB2 B;  3BUX B;  3IQO A;  3KHE A;  4GNK B;  1QX5 B;  1S1E A;  1F4O A;  1MXE A;  2JZI A;  3BYA A;  4OKH A;  3CWG A;  4E68 A;  1S6I A;  1S6C A;  4DS7 A;  2K7O A;  1S3P A;  1TRF A;  2F3Z A;  3BQ3 A;  2LE9 B;  2LUX A;  1A4P A;  1IKU A;  1XVJ A;  2PAL A;  4ETO A;  4CID A;  1DJZ A;  3FWB A;  2LVV A;  3C1V A;  2AUC A;  1NX0 A;  1VRK A;  1XYD A;  1M45 A;  1B8L A;  1YUT A;  2NZ0 A;  4MLW A;  1H4B A;  2KHN A;  4MZJ A;  4GGF C;  1DMO A;  3H4S E;  2I7A A;  1QAS A;  1A75 A;  3WHU B;  2M49 B;  2LUC A;  1EH2 A;  3TS5 C;  1F54 A;  2R2I A;  1LVC D;  2MRD A;  1B8C A;  1DJX A;  2KFG A;  3BUW B;  2M1U A;  3EK4 A;  1MQ1 A;  3I5H C;  1B47 A;  4PE4 A;  3EK7 A;  2ISD A;  4D1E A;  4PHN A;  2LVK A;  1JF0 A;  3E3R A;  1LA0 A;  4MBE A;  1WRZ A;  1CDM A;  2O5G A;  1BMO A;  1F70 A;  2K61 A;  2KFH A;  5AAN A;  1UWO A;  1CTR A;  1NCX A;  1QLS A;  2L2E A;  4XYN A;  1J7Q A;  3ZNI A;  1KFX L;  1KFU S;  2K8M B;  3SIB A;  2GV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...