2F8PA

Crystal structure of obelin following ca2+ triggered bioluminescence suggests neutral coelenteramide as the primary excited state
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
190
structure length
190
Chain Sequence
ASKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Obelin
publication title Crystal structure of obelin after Ca2+-triggered bioluminescence suggests neutral coelenteramide as the primary excited state.
pubmed doi rcsb
source organism Obelia longissima
total genus 84
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2005-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2f8pA00
3JVTC 2JRFA 2EHBA 3LLEA 3CR5X 1TNWA 2VRGA 2H61A 1R6PA 3F45A 3A8RA 3IQQA 4QJ5B 1NCYA 2LLUA 1A29A 2B1UA 3FIAA 1UHIA 3NSLA 4IL1A 2PSRA 1WLMA 1NUBA 2ZRTA 2SASA 2Y1NA 5HLVA 2M7LA 3WHTB 1JC2A 1NIWA 1BU3A 5DKQA 1J7OA 3D10A 1IJ5A 1EL4A 1K8UA 1BR1B 1FPWA 1JFKA 4CFQA 1B8RA 2GV5A 1TNXA 1YX8A 2KAXA 1RFJA 4AQJA 2FJUB 1HQVA 3DVMA 2L4HA 2M8UA 3PATA 2CTNA 1NWDA 2JPTA 2BCAA 5AERA 1WLZA 1DGUA 3VGOA 2L0PA 3PSRA 2ISDA 4A4CA 1IKUA 2KI4C 3PFVA 1LKJA 1UUSA 1L2OC 5DKNA 2QACA 1SYMA 1DGVA 1J55A 1DJHA 1SCMC 1W7IB 4PE7A 3SG2A 3CZTX 3NSIA 5KU1A 1AVSA 4DS7A 3QRXA 2ZNDA 1NX2A 3ZNIA 5AEQA 4BY5A 1NPQA 3AKBA 1KK7Z 1PSRA 1K95A 2KOTA 4GGFA 1CMGA 1V1GA 3BUWB 1TTXA 1M39A 2HQ8A 1B47A 2PASA 2COLB 4QJ3B 5FYXA 1UHHA 1VRKA 3KHEA 1W7JB 2LVJA 2I2RE 3K21A 3SIAA 1YX7A 4ZCVA 4I5LB 3OX6A 1LVCD 2LLSA 3DD4A 4Q04A 2MA2A 4YRUA 1B1GA 2LHLA 1XVJA 4XYNA 4D1EA 2K2AA 1X02A 2LMUA 3GOFA 1ZUZA 2F2PA 5JJGA 1CLLA 3EKHA 4YI8A 1OMRA 4YGCB 1K90D 2L50A 1BOCA 4PDZA 2BE4A 2WC8A 1A2XA 3BUOB 1QIVA 3BUXB 1SNLA 2JT3A 1S1EA 3TZ1A 1K94A 2AMIA 4I5JA 4C0LA 3C1VA 1CB1A 1JFJA 3CR4X 4GNKB 3FWBA 1IJ6A 1AJ4A 2F8PA 1WRLA 1FF1A 2LP3A 2SCPA 4MRXA 3ICBA 1KCYA 1A75A 1M63B 3LL8B 1KFXS 1UHNA 2K7BA 1B9AA 1TN4A 5PALA 1RROA 2MLFC 2R2IA 1NCXA 2PALA 1PULA 1F55A 1OE9B 3PN7B 2I18A 5AFPA 1B4CA 5GQQC 2O5GA 3DF0B 5I2LA 1G33A 4PHMA 2WCBA 4PCWA 2QPTA 3BUNB 2JWWA 1MF8B 2WCFA 3LCPC 4AQIA 1CM4A 4BY4A 2KI6C 5D69A 2L2EA 1AK8A 1JBAA 3DF0A 3BUMB 2JT0A 4DUQA 2K0JA 3KPXA 3OX5A 2PRUA 1F70A 1DJIA 2HQWA 4NDDA 1FBVA 1ALWA 2LM5A 4GUKA 5TNCA 3SG6A 2MHHA 3VRPA 1AP4A 5DKRA 1B7TZ 1WDCB 1CDNA 4M2OA 2Y4QA 1QLKA 2JOJA 3OHMB 1XK4A 3HCMA 1DJYA 3JTDB 3VRNA 3FWCA 1MR8A 1MXLC 2BCXA 1KWOC 4YBHB 5HKYA 3TDIA 1QLSA 3O6BA 1QX7A 4MBEA 1N0YA 4N1GA 2M0RA 3H4SE 1WRKA 1ZOTB 1Q80A 1GJYA 1KSMA 2L98A 5K89A 1ZMZA 3VRQA 3WXAA 2KAYA 2K2FA 1QV0A 3I5GC 1LXFC 1Y1UA 4OVNF 1S3PA 2KGBC 2GGZA 1RJVA 1K9PA 1CDLA 1IG5A 5HKZA 1KQMB 3EKJA 1CNPA 2KBIA 2JXLA 2K7CA 4MZKA 1KFUL 3PLFB 1F4QA 2JNFA 1YRUB 1E8AA 2V53A 2OS8B 3I5IB 2JTTA 4JWQA 2DOQA 5I8NA 2LUXA 3RM1A 2PVBA 4HRHA 2EC6C 2JNXA 5I2QA 3TS5B 1MHOA 2JU0A 2HETA 2KNEA 3SJSA 3CGAA 1XFVO 2WNDA 3I5FB 4ETOA 4MN0A 4OCIA 1CFPA 4GAOA 1DTLA 3KEVA 4HSZA 1EH2A 1XFZO 2LE9B 1CKKA 2F3YA 1EXRA 1OSAA 2JQ6A 3TUYB 1K9KA 1PK0D 1S36A 1MWNA 1OZOA 1N65A 1NX0A 3NSKA 2M49B 2BL0C 1JF0A 1RK9A 1XYDA 5JOLA 4F0ZB 2OTGC 5BPJA 1KK8C 2ZN9A 3I5HC 3JVTB 4ICBA 1YUTA 1OMDA 4M2PA 4I5KA 2AUCA 4FTGA 1C7VA 1UHKA 1K9UA 2JC2A 2JTZA 2KI6D 3BYAA 3O78A 1LINA 3BQ3A 3FS7A 2EGDA 1QIWA 2CBLA 4NQGA 1NYAA 5AANA 3ZWHA 1K2HA 4HRGA 5D7FA 1BG1A 1J7QA 2G2BA 2L51A 4PALA 1A03A 1D1OA 1G4YR 1DF0A 3EVUA 2MJWB 3SG3A 2A4JA 5HYDA 1G8IA 1NX1A 1WRZA 4MLWA 2Q91A 5CSNA 2P6BB 1SK6D 2M3WA 3GK4X 1A75B 5I2OA 1Y1AA 2Q4UA 5HKWA 2E6WA 2H61C 2HF5A 2E30A 4N1FA 1XFUO 4YGAA 2CCMA 4P2YB 2K7DA 1KK7Y 1IH0A 2KI4B 1RWYA 4ZCUA 4UPGA 2KYCA 2O60A 2K7OA 1L2OB 4CPVA 3AKAA 1MXEA 5HLOA 2M9GA 1FI5A 1IQ3A 1H8BA 2ZFDA 3SG7A 1J7RA 1RECA 4GPLB 2L4IA 2M1KB 1DT7B 4GFTA 1IGVA 1SW8A 3SG4A 1PRWA 2BKIB 4AOMA 4HREE 2AAOA 1NX3A 2F3ZA 1BODA 5KSZA 4P5OE 4I5NB 2LMTA 5B8IB 1BLQA 1HT9A 1RTP1 1S5GZ 3TDUA 1J1DA 3OB2B 1IWQA 2ZNEA 4WQ3A 1YVHA 1BMOA 2G9BA 1TIZA 1KQMC 3AAJA 1SL7A 1LA0A 1ZFSA 4ORBB 2D8NA 1DMOA 1NCZA 4PHNA 1YUUA 3I5IC 1AHRA 3GK2A 5ER5A 2BCBA 5IBWA 1S6CA 1Y0VH 1TNQA 1TNPA 2KFHA 1BJFA 2Y5IA 3EVRA 4GGNA 1B8CA 4PE4A 3VRRA 1YUSA 2LLTA 2M1UA 3CR2A 4U8DA 3BOWA 2KHNA 1H4BA 1YURA 1QX2A 1TCOB 1XFWO 2L5XB 1KFXL 5CPVA 1AJ5A 1KSOA 1TCFA 1KFUS 3GK1A 1LA3A 2FCEA 1S26D 4GGFC 4MEWA 1CTRA 4CLNA 5G08A 2BECA 3A4UB 2LP2A 4JQ0D 1PVBA 3DVKA 4NDBA 1ZACA 5ER4X 1JWDA 2BBMA 4PE0A 2JZIA 2LVIA 2MAZA 1CDMA 3OB1B 4QJ4B 1QATA 1F4OA 1SKTA 2KSPA 3D0YB 3EK4A 1CLMA 1S5GY 3IQOA 3KO0A 3M0WA 4JPZB 1WY9A 1GGWA 2MLEC 5CSFA 2KFFA 1U5IA 1CLBA 1NP8A 1FI6A 4MZLA 1SCVA 2KQYA 3PALA 1SR6B 1JUOA 3D0YA 3EVVA 3LK1A 2JT8A 1M31A 4R1EA 2I94A 2KBMA 4XJKB 2K61A 1R2UA 2LMVA 2NZ0A 2JULA 1OZSA 1B7TY 1M46A 1UP5A 1XFXO 1CMFA 1DJXA 3E3RA 2LV7A 1IRJA 3O2PA 4XJKA 4L9MA 1GGZA 3EK8A 2CXJA 2WOSA 1XO5A 3CWGA 1J7PA 2FCDA 2LNKA 4NDCA 1SL8A 1M45A 3CS1A 3WHUB 1CDPA 1PALA 1UWOA 4USLA 2H2KA 3SG5A 1ALVA 2BBNA 4DIRA 1SY9A 1CM1A 2FOTA 2KAVA 2ZN8A 5CSIA 4M2QA 2NCOA 4N5XA 2NXQA 1SBJA 4MSPA 1F71A 1KWOB 5CSJA 2OPOA 5KTYA 2WORA 4OR9B 1DF0B 2PMYA 2CNPA 5AXIA 3WNXB 3CTNA 2ZKMX 3PN7C 1QASA 2Y1MA 2LUCA 2LC5A 3I5GB 4WQ2A 2M97A 1CFDA 3DVJA 1DJZA 4MVFA 1QXPA 4GBAA 1UHJA 4C0KA 4YI9A 1UURA 3VROA 2LVVA 4DCKA 4C0JA 2BE6A 2NLNA 3NSOA 4CFRA 1QJTA 1EG4A 1C7WA 2LAPA 5J3XA 4WRIA 1Y6WA 4FQOA 4MZJA 1CFFA 1NSHA 1YVLA 1OQPA 1XK4C 1YR5A 2M29A 3SIBA 2EC6B 3MSEB 2MBXA 1JSAA 2GGMA 1QVIZ 4TNCA 1WDCC 4OKHA 1DJGA 3RLZA 1KQVA 1IQ5A 1J1EA 2ZRSA 3JTDC 1SCMB 1YTZC 3OP0A 3AAKA 1SMGA 1SRAA 2LVKA 1ODBA 4MRYA 3DVEA 1QX5B 2BL0B 2LHIA 2RGIA 1QS7A 1OOJA 1QTXA 2OTGB 4ORAB 1KK8B 1TRFA 1YRTB 1S6JA 3I5HB 3IF7A 4CIDA 4OV2A 4PE1A 2I7AA 3NXAA 4ORCB 2KGRA 1Y1XA 1TOPA 1L7ZA 1SL9A 1SPYA 1BR4B 4DRWA 4YGDB 2KYFA 2BKHB 2IS9A 2MRDA 1OMVA 2KQ6A 2OS8C 1N2DA 3BOWB 1GQMA 3HX4A 3TDZA 1A4PA 1K96A 1F8HA 1XA5A 3EK7A 2M7NA 1SR6C 2KDHA 4A4BA 1QV1A 3O4YA 3BXKA 1AUIB 1MQ1A 2TN4A 2F33A 3TS5C 3CLNA 4E68A 2K8MB 2NCPA 2WCEA 1C07A 1QVIY 1CFCA 3PM8A 2JXCA 2F2OA 3I5FC 1FW4A 5F6TA 1B8LA 1MUXA 3KF9A 1V1FA 1BF5A 1PVAA 2LCPA 2LANA 4PHKA 3LK0A 4YGEB 1K93D 2HPSA 3TUYC 1BT6A 4PHJA 1DJWA 1EG3A 1JF2A 1F54A 1XFYO 2KFGA 1EJ3A 1PSBA 1DVIA 1U5IB 4YGBB 2CT9A 1S6IA
chains in the Genus database with same CATH superfamily
3JVTC 2KLEA 2JRFA 2WC5A 2EHBA 3LLEA 2PQLA 3CR5X 1TNWA 2VRGA 4IJ7A 2H61A 3B88A 1R6PA 3F45A 3A8RA 3IQQA 4QJ5B 1NCYA 2LLUA 1A29A 2B1UA 3FIAA 1UHIA 3NSLA 4IL1A 2PSRA 1WLMA 1NUBA 2ZRTA 2SASA 2Y1NA 5HLVA 2M7LA 3WHTB 3IVTA 1NIWA 1BU3A 1JC2A 5DKQA 1J7OA 3D10A 1IJ5A 1EL4A 1K8UA 1BR1B 1FPWA 1JFKA 4CFQA 1B8RA 2GV5A 1TNXA 1YX8A 2KAXA 3DZTA 1RFJA 4AQJA 2FJUB 4PT1A 3S0GA 1HQVA 3DVMA 2L4HA 2M8UA 3PATA 2CTNA 1NWDA 2JPTA 2BCAA 5AERA 1WLZA 1DGUA 3VGOA 2L0PA 3PSRA 2ISDA 3D74A 4A4CA 1IKUA 3UNWA 3R1VA 2KI4C 2WCJA 3PFVA 1LKJA 1UUSA 1L2OC 4JKTA 5DKNA 2QACA 1SYMA 1DGVA 2KPHA 5D3OA 1J55A 1DJHA 1SCMC 1W7IB 4PE7A 3SG2A 3CZTX 3NSIA 2QDIA 5KU1A 1C3YA 1AVSA 4DS7A 3QRXA 2ZNDA 2K60A 1NX2A 3ZNIA 5AEQA 4BY5A 1NPQA 3AKBA 3CZ2A 1KK7Z 3S0FA 1OOGA 1PSRA 3R72A 1K95A 2KOTA 4GGFA 1DQEA 1CMGA 1V1GA 3BUWB 1TTXA 1M39A 2HQ8A 1B47A 2PASA 3RZSA 2COLB 3D77A 4QJ3B 5FYXA 4INXA 1UHHA 1VRKA 2FJYA 3KHEA 1W7JB 3S0DA 2LVJA 2I2RE 3K21A 3SIAA 1YX7A 4ZCVA 4I5LB 3OX6A 1LVCD 2LLSA 3DD4A 4Q04A 2MA2A 4YRUA 1B1GA 2LHLA 1XVJA 4XYNA 4D1EA 2K2AA 1X02A 2LMUA 3GOFA 1ZUZA 1OOFA 2QEVA 3NHTA 2F2PA 5JJGA 1CLLA 3EKHA 4YI8A 1OMRA 5FI6A 4YGCB 1K90D 2L50A 1BOCA 4PDZA 2BE4A 1DC1A 2WC8A 1A2XA 3BUOB 1QIVA 3BUXB 1SNLA 2JT3A 1LS8A 1S1EA 3VB1A 3TZ1A 1K94A 2AMIA 4I5JA 4C0LA 3C1VA 1CB1A 1JFJA 3CR4X 4GNKB 3FWBA 1IJ6A 1AJ4A 2F8PA 5FI2A 1WRLA 1FF1A 2LP3A 1GM0A 2SCPA 1C3ZA 4MRXA 3ICBA 2YGUA 1KCYA 1A75A 1M63B 3LL8B 1KFXS 1UHNA 2K7BA 1B9AA 1TN4A 5PALA 1RROA 2MLFC 2R2IA 1NCXA 2PALA 1PULA 1F55A 3CYZA 1OE9B 2QEBA 3DYEA 3PM2A 3PN7B 2I18A 5AFPA 1B4CA 5GQQC 2O5GA 3DF0B 5I2LA 1G33A 4PHMA 2WCBA 4PCWA 2QPTA 3BUNB 2JWWA 1MF8B 2WCFA 3LCPC 3SS5A 4AQIA 1CM4A 4BY4A 2KI6C 5D69A 2L2EA 1AK8A 3SS3A 1JBAA 2JPOA 3DF0A 3BUMB 2JT0A 4DUQA 2K0JA 3KPXA 3OX5A 2PRUA 1F70A 1DJIA 2HQWA 4NDDA 1FBVA 1ALWA 2LM5A 5HL1A 4GUKA 5TNCA 3SG6A 3CZ1A 2MHHA 3VRPA 3D78A 2PYQA 1AP4A 5DKRA 1B7TZ 1WDCB 1CDNA 4M2OA 3DY9A 2Y4QA 1QLKA 2JOJA 3OHMB 1XK4A 3HCMA 1DJYA 3JTDB 3VRNA 2BNXA 3FWCA 1MR8A 1MXLC 1T14A 2BCXA 1KWOC 4YBHB 3S0EA 5HKYA 3TDIA 1QLSA 3O6BA 1QX7A 4INWA 4MBEA 1N0YA 4N1GA 2M0RA 3H4SE 1WRKA 1ZOTB 5I94A 1Q80A 1GJYA 1KSMA 2L98A 5K89A 3S0AA 2H8VA 1ZMZA 3QMEA 3VRQA 3WXAA 2KAYA 2K2FA 1QV0A 3I5GC 3BFAA 3K1EA 1LXFC 1Y1UA 4OVNF 1S3PA 2KGBC 3BFBA 2GGZA 1RJVA 1K9PA 1CDLA 3EG5B 1IG5A 5HKZA 1KQMB 3EKJA 3L47A 1CNPA 2KBIA 2JXLA 2K7CA 4MZKA 3S0BA 1KFUL 3PLFB 1F4QA 2JNFA 1YRUB 1E8AA 1TWOA 2V53A 2OS8B 3I5IB 2JTTA 3DXLA 4JWQA 2DOQA 5I8NA 2LUXA 2BAPA 3RM1A 2PVBA 4HRHA 2EC6C 2JNXA 5I2QA 3TS5B 1MHOA 2JU0A 2HETA 2KNEA 3SJSA 3CGAA 1XFVO 2WNDA 3I5FB 4ETOA 3CZ0A 4MN0A 4OCIA 1CFPA 4GAOA 1DTLA 3KEVA 4HSZA 1EH2A 1XFZO 2LE9B 1CKKA 2F3YA 1EXRA 1OSAA 1DEKA 2JQ6A 3TUYB 1K9KA 1PK0D 1S36A 1MWNA 1OZOA 1N65A 1NX0A 3NSKA 2M49B 2BL0C 1JF0A 1RK9A 1XYDA 5JOLA 4F0ZB 2QEHA 2OTGC 5BPJA 1KK8C 2ZN9A 3I5HC 3JVTB 4ICBA 1YUTA 1OMDA 4M2PA 4I5KA 2AUCA 1OOHA 4FTGA 1C7VA 1UHKA 1K9UA 2JC2A 2JTZA 2KI6D 3BYAA 3O78A 1LINA 3BQ3A 3FS7A 2EGDA 1QIWA 2CBLA 4NQGA 1NYAA 5AANA 3ZWHA 4F7FA 1K2HA 4HRGA 5D7FA 2WC6A 1BG1A 1J7QA 2G2BA 2L5YA 2L51A 4PALA 1A03A 1D1OA 1G4YR 1DF0A 3EVUA 2MJWB 1TUZA 3SG3A 2A4JA 5HYDA 1G8IA 3FE9A 1NX1A 1WRZA 4MLWA 2Q91A 5CSNA 3B6XA 2P6BB 1SK6D 2M3WA 3GK4X 1A75B 5I2OA 1Y1AA 2Q4UA 5HKWA 2E6WA 1Z4HA 2H61C 2E30A 2HF5A 4N1FA 1XFUO 4YGAA 2CCMA 2ERBA 2K7DA 4P2YB 1W9ZA 1KK7Y 1IH0A 2KI4B 1RWYA 4ZCUA 4UPGA 2KYCA 2O60A 2K7OA 1L2OB 4CPVA 3AKAA 1MXEA 5HLOA 2M9GA 1FI5A 1IQ3A 1H8BA 2ZFDA 3SG7A 3OGNA 1J7RA 1RECA 4GPLB 2L4IA 2M1KB 1DT7B 3V2LA 3CDNA 4GFTA 1IGVA 1SW8A 3SG4A 1PRWA 2BKIB 4AOMA 4HREE 2AAOA 1NX3A 2F3ZA 3NGVA 1BODA 3UO9A 5KSZA 4P5OE 4I5NB 2LMTA 5B8IB 1TUJA 1BLQA 1HT9A 1RTP1 1S5GZ 3TDUA 1J1DA 3OB2B 1IWQA 2ZNEA 4WQ3A 1YVHA 1BMOA 2G9BA 1TIZA 4KYNA 1KQMC 3AAJA 1SL7A 1LA0A 1ZFSA 3BJHA 4ORBB 3D76A 2D8NA 1DMOA 1NCZA 4PHNA 1YUUA 3I5IC 3OBVA 1AHRA 3GK2A 5DICA 2BCBA 5ER5A 5IBWA 1S6CA 1Y0VH 1TNQA 1TNPA 2KFHA 1BJFA 2Y5IA 3EVRA 4GGNA 1B8CA 4PE4A 3VRRA 1YUSA 2LLTA 3L4LA 2GTEA 2M1UA 3CR2A 3BOWA 4U8DA 2KHNA 1H4BA 1YURA 1QX2A 1TCOB 1XFWO 2L5XB 1KFXL 3BFHA 5CPVA 2WCLA 1AJ5A 1KSOA 1TCFA 1KFUS 3GK1A 1LA3A 1QWVA 1S26D 2FCEA 4GGFC 1CTRA 4MEWA 4CLNA 3N7HA 5G08A 2BECA 3A4UB 2LP2A 4JQ0D 1PVBA 3DVKA 4NDBA 1ZACA 5ER4X 1JWDA 2BBMA 1DELA 4PE0A 2JZIA 2LVIA 3D73A 2MAZA 1CDMA 3OB1B 4QJ4B 1QATA 1F4OA 1SKTA 2KSPA 3D0YB 3EK4A 1CLMA 1S5GY 3IQOA 3KO0A 3M0WA 4JPZB 1WY9A 1GGWA 2MLEC 5CSFA 2KFFA 1U5IA 1CLBA 1NP8A 1ORGA 4MZLA 1FI6A 1SCVA 2KQYA 3NHIA 3PALA 1SR6B 1JUOA 3D0YA 3EVVA 3LK1A 2JT8A 1M31A 4R1EA 2I94A 2KBMA 3B7AA 4XJKB 2K61A 1R2UA 3FE8A 2LMVA 2NZ0A 2JULA 1OZSA 2WCHA 1B7TY 1M46A 1UP5A 1XFXO 1CMFA 1DJXA 3E3RA 2LV7A 1IRJA 3O2PA 4XJKA 4JD9A 1GGZA 4L9MA 3EK8A 2CXJA 2WOSA 1XO5A 3CWGA 5EL2A 2FCDA 1J7PA 3Q8IA 2LNKA 4NDCA 1SL8A 1M45A 3CS1A 5FI7A 3WHUB 1CDPA 1PALA 1UWOA 4USLA 2H2KA 2WCKA 1ALVA 2BBNA 3SG5A 2WCMA 4DIRA 1SY9A 1CM1A 2FOTA 2KAVA 2ZN8A 5CSIA 4M2QA 2NCOA 4N5XA 2NXQA 1SBJA 4MSPA 1F71A 1KWOB 5CSJA 1P28A 2OPOA 2KLDA 2WORA 4OR9B 5KTYA 1DF0B 1OOIX 2PMYA 2CNPA 5AXIA 1IIOA 3WNXB 2QEOA 3CTNA 2ZKMX 3PN7C 1QASA 2Y1MA 3R1OA 2LUCA 2LC5A 3I5GB 4WQ2A 2M97A 1OW4A 3R1PA 1CFDA 3DVJA 1DJZA 4MVFA 1QXPA 4GBAA 1UHJA 4C0KA 3L4AA 4YI9A 4FQTA 1UURA 3VROA 2LVVA 4DCKA 4C0JA 2BE6A 2NLNA 3NSOA 4CFRA 1QJTA 1EG4A 1C7WA 2LAPA 5J3XA 2P71A 4WRIA 2P70A 1Y6WA 4FQOA 4MZJA 1CFFA 1NSHA 1YVLA 1OQPA 1XK4C 1YR5A 2M29A 3SIBA 2EC6B 3MSEB 2MBXA 1JSAA 2GGMA 1QVIZ 4TNCA 1WDCC 4OKHA 1DJGA 3RLZA 1KQVA 1IQ5A 1J1EA 2ZRSA 3JTDC 2L2CA 1SCMB 1YTZC 3PJIA 3OP0A 3D75A 3AAKA 1SMGA 1SRAA 2LVKA 1ODBA 3FE6A 1Z2CB 4MRYA 3DVEA 1QX5B 3CABA 2BL0B 2LHIA 2RGIA 1QS7A 1OOJA 1QTXA 2OTGB 4ORAB 1KK8B 1TRFA 1YRTB 1S6JA 3I5HB 3IF7A 3O4XA 4CIDA 4OV2A 4PE1A 2I7AA 3NXAA 4ORCB 2KGRA 1Y1XA 1TOPA 1L7ZA 1SL9A 1SPYA 3B87A 1BR4B 4DRWA 4YGDB 2KYFA 1XFRA 2BKHB 4OZDA 2IS9A 2MRDA 1OMVA 1SSEB 2KQ6A 1N2DA 2OS8C 1GQMA 3BOWB 3HX4A 1A4PA 1K96A 3TDZA 1XA5A 3EK7A 2M7NA 1SR6C 2KDHA 4A4BA 1QV1A 3O4YA 3SS4A 3BXKA 1AUIB 1MQ1A 2TN4A 2F33A 3TS5C 3CLNA 4E68A 2K8MB 2NCPA 2WCEA 1C07A 1QVIY 1CFCA 3PM8A 2JXCA 2F2OA 3I5FC 1FW4A 5F6TA 1B8LA 1MUXA 3KF9A 1V1FA 1BF5A 1PVAA 2LCPA 2LANA 4PHKA 3LK0A 4YGEB 1K93D 2HPSA 3TUYC 1F8HA 3B86A 1BT6A 4PHJA 1DJWA 1JF2A 1EG3A 1F54A 1XFYO 2KFGA 1EJ3A 1PSBA 1DVIA 1U5IB 4YGBB 2CT9A 1S6IA
chains in the Genus database with same CATH topology
3JVTC 2JRFA 2EHBA 3LLEA 3CR5X 1TNWA 2VRGA 2H61A 1R6PA 3F45A 3A8RA 3IQQA 4QJ5B 1NCYA 2LLUA 1A29A 2B1UA 3FIAA 1UHIA 3NSLA 4IL1A 2PSRA 1WLMA 1NUBA 2ZRTA 2SASA 2Y1NA 5HLVA 2M7LA 3WHTB 1JC2A 1NIWA 1BU3A 5DKQA 1J7OA 3D10A 1IJ5A 1EL4A 1K8UA 1BR1B 1FPWA 1JFKA 4CFQA 1B8RA 2GV5A 1TNXA 1YX8A 2KAXA 1RFJA 4AQJA 2FJUB 1HQVA 3DVMA 2L4HA 2M8UA 3PATA 2CTNA 1NWDA 2JPTA 2BCAA 5AERA 1WLZA 1DGUA 3VGOA 2L0PA 3PSRA 2ISDA 4A4CA 1IKUA 2KI4C 3PFVA 1LKJA 1UUSA 1L2OC 5DKNA 2QACA 1SYMA 1DGVA 1J55A 1DJHA 1SCMC 1W7IB 4PE7A 3SG2A 3CZTX 3NSIA 5KU1A 1AVSA 4DS7A 3QRXA 2ZNDA 1NX2A 3ZNIA 5AEQA 4BY5A 1NPQA 3AKBA 1KK7Z 1PSRA 1K95A 2KOTA 4GGFA 1CMGA 1V1GA 3BUWB 1TTXA 1M39A 2HQ8A 1B47A 2PASA 2COLB 4QJ3B 5FYXA 1UHHA 1VRKA 3KHEA 1W7JB 2LVJA 2I2RE 3K21A 3SIAA 1YX7A 4ZCVA 4I5LB 3OX6A 1LVCD 2LLSA 3DD4A 4Q04A 2MA2A 4YRUA 1B1GA 2LHLA 1XVJA 4XYNA 4D1EA 2K2AA 1X02A 2LMUA 3GOFA 1ZUZA 2F2PA 5JJGA 1CLLA 3EKHA 4YI8A 1OMRA 4YGCB 1K90D 2L50A 1BOCA 4PDZA 2BE4A 2WC8A 1A2XA 3BUOB 1QIVA 3BUXB 1SNLA 2JT3A 1S1EA 3TZ1A 1K94A 2AMIA 4I5JA 4C0LA 3C1VA 1CB1A 1JFJA 3CR4X 4GNKB 3FWBA 1IJ6A 1AJ4A 2F8PA 1WRLA 1FF1A 2LP3A 2SCPA 4MRXA 3ICBA 1KCYA 1A75A 1M63B 3LL8B 1KFXS 1UHNA 2K7BA 1B9AA 1TN4A 5PALA 1RROA 2MLFC 2R2IA 1NCXA 2PALA 1PULA 1F55A 1OE9B 3PN7B 2I18A 5AFPA 1B4CA 5GQQC 2O5GA 3DF0B 5I2LA 1G33A 4PHMA 2WCBA 4PCWA 2QPTA 3BUNB 2JWWA 1MF8B 2WCFA 3LCPC 4AQIA 1CM4A 4BY4A 2KI6C 5D69A 2L2EA 1AK8A 1JBAA 3DF0A 3BUMB 2JT0A 4DUQA 2K0JA 3KPXA 3OX5A 2PRUA 1F70A 1DJIA 2HQWA 4NDDA 1FBVA 1ALWA 2LM5A 4GUKA 5TNCA 3SG6A 2MHHA 3VRPA 1AP4A 5DKRA 1B7TZ 1WDCB 1CDNA 4M2OA 2Y4QA 1QLKA 2JOJA 3OHMB 1XK4A 3HCMA 1DJYA 3JTDB 3VRNA 3FWCA 1MR8A 1MXLC 2BCXA 1KWOC 4YBHB 5HKYA 3TDIA 1QLSA 3O6BA 1QX7A 4MBEA 1N0YA 4N1GA 2M0RA 3H4SE 1WRKA 1ZOTB 1Q80A 1GJYA 1KSMA 2L98A 5K89A 1ZMZA 3VRQA 3WXAA 2KAYA 2K2FA 1QV0A 3I5GC 1LXFC 1Y1UA 4OVNF 1S3PA 2KGBC 2GGZA 1RJVA 1K9PA 1CDLA 1IG5A 5HKZA 1KQMB 3EKJA 1CNPA 2KBIA 2JXLA 2K7CA 4MZKA 1KFUL 3PLFB 1F4QA 2JNFA 1YRUB 1E8AA 2V53A 2OS8B 3I5IB 2JTTA 4JWQA 2DOQA 5I8NA 2LUXA 3RM1A 2PVBA 4HRHA 2EC6C 2JNXA 5I2QA 3TS5B 1MHOA 2JU0A 2HETA 2KNEA 3SJSA 3CGAA 1XFVO 2WNDA 3I5FB 4ETOA 4MN0A 4OCIA 1CFPA 4GAOA 1DTLA 3KEVA 4HSZA 1EH2A 1XFZO 2LE9B 1CKKA 2F3YA 1EXRA 1OSAA 2JQ6A 3TUYB 1K9KA 1PK0D 1S36A 1MWNA 1OZOA 1N65A 1NX0A 3NSKA 2M49B 2BL0C 1JF0A 1RK9A 1XYDA 5JOLA 4F0ZB 2OTGC 5BPJA 1KK8C 2ZN9A 3I5HC 3JVTB 4ICBA 1YUTA 1OMDA 4M2PA 4I5KA 2AUCA 4FTGA 1C7VA 1UHKA 1K9UA 2JC2A 2JTZA 2KI6D 3BYAA 3O78A 1LINA 3BQ3A 3FS7A 2EGDA 1QIWA 2CBLA 4NQGA 1NYAA 5AANA 3ZWHA 1K2HA 4HRGA 5D7FA 1BG1A 1J7QA 2G2BA 2L51A 4PALA 1A03A 1D1OA 1G4YR 1DF0A 3EVUA 2MJWB 3SG3A 2A4JA 5HYDA 1G8IA 1NX1A 1WRZA 4MLWA 2Q91A 5CSNA 2P6BB 1SK6D 2M3WA 3GK4X 1A75B 5I2OA 1Y1AA 2Q4UA 5HKWA 2E6WA 2H61C 2HF5A 2E30A 4N1FA 1XFUO 4YGAA 2CCMA 4P2YB 2K7DA 1KK7Y 1IH0A 2KI4B 1RWYA 4ZCUA 4UPGA 2KYCA 2O60A 2K7OA 1L2OB 4CPVA 3AKAA 1MXEA 5HLOA 2M9GA 1FI5A 1IQ3A 1H8BA 2ZFDA 3SG7A 1J7RA 1RECA 4GPLB 2L4IA 2M1KB 1DT7B 4GFTA 1IGVA 1SW8A 3SG4A 1PRWA 2BKIB 4AOMA 4HREE 2AAOA 1NX3A 2F3ZA 1BODA 5KSZA 4P5OE 4I5NB 2LMTA 5B8IB 1BLQA 1HT9A 1RTP1 1S5GZ 3TDUA 1J1DA 3OB2B 1IWQA 2ZNEA 4WQ3A 1YVHA 1BMOA 2G9BA 1TIZA 1KQMC 3AAJA 1SL7A 1LA0A 1ZFSA 4ORBB 2D8NA 1DMOA 1NCZA 4PHNA 1YUUA 3I5IC 1AHRA 3GK2A 5ER5A 2BCBA 5IBWA 1S6CA 1Y0VH 1TNQA 1TNPA 2KFHA 1BJFA 2Y5IA 3EVRA 4GGNA 1B8CA 4PE4A 3VRRA 1YUSA 2LLTA 2M1UA 3CR2A 4U8DA 3BOWA 2KHNA 1H4BA 1YURA 1QX2A 1TCOB 1XFWO 2L5XB 1KFXL 5CPVA 1AJ5A 1KSOA 1TCFA 1KFUS 3GK1A 1LA3A 2FCEA 1S26D 4GGFC 4MEWA 1CTRA 4CLNA 5G08A 2BECA 3A4UB 2LP2A 4JQ0D 1PVBA 3DVKA 4NDBA 1ZACA 5ER4X 1JWDA 2BBMA 4PE0A 2JZIA 2LVIA 2MAZA 1CDMA 3OB1B 4QJ4B 1QATA 1F4OA 1SKTA 2KSPA 3D0YB 3EK4A 1CLMA 1S5GY 3IQOA 3KO0A 3M0WA 4JPZB 1WY9A 1GGWA 2MLEC 5CSFA 2KFFA 1U5IA 1CLBA 1NP8A 1FI6A 4MZLA 1SCVA 2KQYA 3PALA 1SR6B 1JUOA 3D0YA 3EVVA 3LK1A 2JT8A 1M31A 4R1EA 2I94A 2KBMA 4XJKB 2K61A 1R2UA 2LMVA 2NZ0A 2JULA 1OZSA 1B7TY 1M46A 1UP5A 1XFXO 1CMFA 1DJXA 3E3RA 2LV7A 1IRJA 3O2PA 4XJKA 4L9MA 1GGZA 3EK8A 2CXJA 2WOSA 1XO5A 3CWGA 1J7PA 2FCDA 2LNKA 4NDCA 1SL8A 1M45A 3CS1A 3WHUB 1CDPA 1PALA 1UWOA 4USLA 2H2KA 3SG5A 1ALVA 2BBNA 4DIRA 1SY9A 1CM1A 2FOTA 2KAVA 2ZN8A 5CSIA 4M2QA 2NCOA 4N5XA 2NXQA 1SBJA 4MSPA 1F71A 1KWOB 5CSJA 2OPOA 5KTYA 2WORA 4OR9B 1DF0B 2PMYA 2CNPA 5AXIA 3WNXB 3CTNA 2ZKMX 3PN7C 1QASA 2Y1MA 2LUCA 2LC5A 3I5GB 4WQ2A 2M97A 1CFDA 3DVJA 1DJZA 4MVFA 1QXPA 4GBAA 1UHJA 4C0KA 4YI9A 1UURA 3VROA 2LVVA 4DCKA 4C0JA 2BE6A 2NLNA 3NSOA 4CFRA 1QJTA 1EG4A 1C7WA 2LAPA 5J3XA 4WRIA 1Y6WA 4FQOA 4MZJA 1CFFA 1NSHA 1YVLA 1OQPA 1XK4C 1YR5A 2M29A 3SIBA 2EC6B 3MSEB 2MBXA 1JSAA 2GGMA 1QVIZ 4TNCA 1WDCC 4OKHA 1DJGA 3RLZA 1KQVA 1IQ5A 1J1EA 2ZRSA 3JTDC 1SCMB 1YTZC 3OP0A 3AAKA 1SMGA 1SRAA 2LVKA 1ODBA 4MRYA 3DVEA 1QX5B 2BL0B 2LHIA 2RGIA 1QS7A 1OOJA 1QTXA 2OTGB 4ORAB 1KK8B 1TRFA 1YRTB 1S6JA 3I5HB 3IF7A 4CIDA 4OV2A 4PE1A 2I7AA 3NXAA 4ORCB 2KGRA 1Y1XA 1TOPA 1L7ZA 1SL9A 1SPYA 1BR4B 4DRWA 4YGDB 2KYFA 2BKHB 2IS9A 2MRDA 1OMVA 2KQ6A 2OS8C 1N2DA 3BOWB 1GQMA 3HX4A 3TDZA 1A4PA 1K96A 1F8HA 1XA5A 3EK7A 2M7NA 1SR6C 2KDHA 4A4BA 1QV1A 3O4YA 3BXKA 1AUIB 1MQ1A 2TN4A 2F33A 3TS5C 3CLNA 4E68A 2K8MB 2NCPA 2WCEA 1C07A 1QVIY 1CFCA 3PM8A 2JXCA 2F2OA 3I5FC 1FW4A 5F6TA 1B8LA 1MUXA 3KF9A 1V1FA 1BF5A 1PVAA 2LCPA 2LANA 4PHKA 3LK0A 4YGEB 1K93D 2HPSA 3TUYC 1BT6A 4PHJA 1DJWA 1EG3A 1JF2A 1F54A 1XFYO 2KFGA 1EJ3A 1PSBA 1DVIA 1U5IB 4YGBB 2CT9A 1S6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVT C;  2JRF A;  2EHB A;  3LLE A;  3CR5 X;  1TNW A;  2VRG A;  2H61 A;  1R6P A;  3F45 A;  3A8R A;  3IQQ A;  4QJ5 B;  1NCY A;  2LLU A;  1A29 A;  2B1U A;  3FIA A;  1UHI A;  3NSL A;  4IL1 A;  2PSR A;  1WLM A;  1NUB A;  2ZRT A;  2SAS A;  2Y1N A;  5HLV A;  2M7L A;  3WHT B;  1JC2 A;  1NIW A;  1BU3 A;  5DKQ A;  1J7O A;  3D10 A;  1IJ5 A;  1EL4 A;  1K8U A;  1BR1 B;  1FPW A;  1JFK A;  4CFQ A;  1B8R A;  2GV5 A;  1TNX A;  1YX8 A;  2KAX A;  1RFJ A;  4AQJ A;  2FJU B;  1HQV A;  3DVM A;  2L4H A;  2M8U A;  3PAT A;  2CTN A;  1NWD A;  2JPT A;  2BCA A;  5AER A;  1WLZ A;  1DGU A;  3VGO A;  2L0P A;  3PSR A;  2ISD A;  4A4C A;  1IKU A;  2KI4 C;  3PFV A;  1LKJ A;  1UUS A;  1L2O C;  5DKN A;  2QAC A;  1SYM A;  1DGV A;  1J55 A;  1DJH A;  1SCM C;  1W7I B;  4PE7 A;  3SG2 A;  3CZT X;  3NSI A;  5KU1 A;  1AVS A;  4DS7 A;  3QRX A;  2ZND A;  1NX2 A;  3ZNI A;  5AEQ A;  4BY5 A;  1NPQ A;  3AKB A;  1KK7 Z;  1PSR A;  1K95 A;  2KOT A;  4GGF A;  1CMG A;  1V1G A;  3BUW B;  1TTX A;  1M39 A;  2HQ8 A;  1B47 A;  2PAS A;  2COL B;  4QJ3 B;  5FYX A;  1UHH A;  1VRK A;  3KHE A;  1W7J B;  2LVJ A;  2I2R E;  3K21 A;  3SIA A;  1YX7 A;  4ZCV A;  4I5L B;  3OX6 A;  1LVC D;  2LLS A;  3DD4 A;  4Q04 A;  2MA2 A;  4YRU A;  1B1G A;  2LHL A;  1XVJ A;  4XYN A;  4D1E A;  2K2A A;  1X02 A;  2LMU A;  3GOF A;  1ZUZ A;  2F2P A;  5JJG A;  1CLL A;  3EKH A;  4YI8 A;  1OMR A;  4YGC B;  1K90 D;  2L50 A;  1BOC A;  4PDZ A;  2BE4 A;  2WC8 A;  1A2X A;  3BUO B;  1QIV A;  3BUX B;  1SNL A;  2JT3 A;  1S1E A;  3TZ1 A;  1K94 A;  2AMI A;  4I5J A;  4C0L A;  3C1V A;  1CB1 A;  1JFJ A;  3CR4 X;  4GNK B;  3FWB A;  1IJ6 A;  1AJ4 A;  2F8P A;  1WRL A;  1FF1 A;  2LP3 A;  2SCP A;  4MRX A;  3ICB A;  1KCY A;  1A75 A;  1M63 B;  3LL8 B;  1KFX S;  1UHN A;  2K7B A;  1B9A A;  1TN4 A;  5PAL A;  1RRO A;  2MLF C;  2R2I A;  1NCX A;  2PAL A;  1PUL A;  1F55 A;  1OE9 B;  3PN7 B;  2I18 A;  5AFP A;  1B4C A;  5GQQ C;  2O5G A;  3DF0 B;  5I2L A;  1G33 A;  4PHM A;  2WCB A;  4PCW A;  2QPT A;  3BUN B;  2JWW A;  1MF8 B;  2WCF A;  3LCP C;  4AQI A;  1CM4 A;  4BY4 A;  2KI6 C;  5D69 A;  2L2E A;  1AK8 A;  1JBA A;  3DF0 A;  3BUM B;  2JT0 A;  4DUQ A;  2K0J A;  3KPX A;  3OX5 A;  2PRU A;  1F70 A;  1DJI A;  2HQW A;  4NDD A;  1FBV A;  1ALW A;  2LM5 A;  4GUK A;  5TNC A;  3SG6 A;  2MHH A;  3VRP A;  1AP4 A;  5DKR A;  1B7T Z;  1WDC B;  1CDN A;  4M2O A;  2Y4Q A;  1QLK A;  2JOJ A;  3OHM B;  1XK4 A;  3HCM A;  1DJY A;  3JTD B;  3VRN A;  3FWC A;  1MR8 A;  1MXL C;  2BCX A;  1KWO C;  4YBH B;  5HKY A;  3TDI A;  1QLS A;  3O6B A;  1QX7 A;  4MBE A;  1N0Y A;  4N1G A;  2M0R A;  3H4S E;  1WRK A;  1ZOT B;  1Q80 A;  1GJY A;  1KSM A;  2L98 A;  5K89 A;  1ZMZ A;  3VRQ A;  3WXA A;  2KAY A;  2K2F A;  1QV0 A;  3I5G C;  1LXF C;  1Y1U A;  4OVN F;  1S3P A;  2KGB C;  2GGZ A;  1RJV A;  1K9P A;  1CDL A;  1IG5 A;  5HKZ A;  1KQM B;  3EKJ A;  1CNP A;  2KBI A;  2JXL A;  2K7C A;  4MZK A;  1KFU L;  3PLF B;  1F4Q A;  2JNF A;  1YRU B;  1E8A A;  2V53 A;  2OS8 B;  3I5I B;  2JTT A;  4JWQ A;  2DOQ A;  5I8N A;  2LUX A;  3RM1 A;  2PVB A;  4HRH A;  2EC6 C;  2JNX A;  5I2Q A;  3TS5 B;  1MHO A;  2JU0 A;  2HET A;  2KNE A;  3SJS A;  3CGA A;  1XFV O;  2WND A;  3I5F B;  4ETO A;  4MN0 A;  4OCI A;  1CFP A;  4GAO A;  1DTL A;  3KEV A;  4HSZ A;  1EH2 A;  1XFZ O;  2LE9 B;  1CKK A;  2F3Y A;  1EXR A;  1OSA A;  2JQ6 A;  3TUY B;  1K9K A;  1PK0 D;  1S36 A;  1MWN A;  1OZO A;  1N65 A;  1NX0 A;  3NSK A;  2M49 B;  2BL0 C;  1JF0 A;  1RK9 A;  1XYD A;  5JOL A;  4F0Z B;  2OTG C;  5BPJ A;  1KK8 C;  2ZN9 A;  3I5H C;  3JVT B;  4ICB A;  1YUT A;  1OMD A;  4M2P A;  4I5K A;  2AUC A;  4FTG A;  1C7V A;  1UHK A;  1K9U A;  2JC2 A;  2JTZ A;  2KI6 D;  3BYA A;  3O78 A;  1LIN A;  3BQ3 A;  3FS7 A;  2EGD A;  1QIW A;  2CBL A;  4NQG A;  1NYA A;  5AAN A;  3ZWH A;  1K2H A;  4HRG A;  5D7F A;  1BG1 A;  1J7Q A;  2G2B A;  2L51 A;  4PAL A;  1A03 A;  1D1O A;  1G4Y R;  1DF0 A;  3EVU A;  2MJW B;  3SG3 A;  2A4J A;  5HYD A;  1G8I A;  1NX1 A;  1WRZ A;  4MLW A;  2Q91 A;  5CSN A;  2P6B B;  1SK6 D;  2M3W A;  3GK4 X;  1A75 B;  5I2O A;  1Y1A A;  2Q4U A;  5HKW A;  2E6W A;  2H61 C;  2HF5 A;  2E30 A;  4N1F A;  1XFU O;  4YGA A;  2CCM A;  4P2Y B;  2K7D A;  1KK7 Y;  1IH0 A;  2KI4 B;  1RWY A;  4ZCU A;  4UPG A;  2KYC A;  2O60 A;  2K7O A;  1L2O B;  4CPV A;  3AKA A;  1MXE A;  5HLO A;  2M9G A;  1FI5 A;  1IQ3 A;  1H8B A;  2ZFD A;  3SG7 A;  1J7R A;  1REC A;  4GPL B;  2L4I A;  2M1K B;  1DT7 B;  4GFT A;  1IGV A;  1SW8 A;  3SG4 A;  1PRW A;  2BKI B;  4AOM A;  4HRE E;  2AAO A;  1NX3 A;  2F3Z A;  1BOD A;  5KSZ A;  4P5O E;  4I5N B;  2LMT A;  5B8I B;  1BLQ A;  1HT9 A;  1RTP 1;  1S5G Z;  3TDU A;  1J1D A;  3OB2 B;  1IWQ A;  2ZNE A;  4WQ3 A;  1YVH A;  1BMO A;  2G9B A;  1TIZ A;  1KQM C;  3AAJ A;  1SL7 A;  1LA0 A;  1ZFS A;  4ORB B;  2D8N A;  1DMO A;  1NCZ A;  4PHN A;  1YUU A;  3I5I C;  1AHR A;  3GK2 A;  5ER5 A;  2BCB A;  5IBW A;  1S6C A;  1Y0V H;  1TNQ A;  1TNP A;  2KFH A;  1BJF A;  2Y5I A;  3EVR A;  4GGN A;  1B8C A;  4PE4 A;  3VRR A;  1YUS A;  2LLT A;  2M1U A;  3CR2 A;  4U8D A;  3BOW A;  2KHN A;  1H4B A;  1YUR A;  1QX2 A;  1TCO B;  1XFW O;  2L5X B;  1KFX L;  5CPV A;  1AJ5 A;  1KSO A;  1TCF A;  1KFU S;  3GK1 A;  1LA3 A;  2FCE A;  1S26 D;  4GGF C;  4MEW A;  1CTR A;  4CLN A;  5G08 A;  2BEC A;  3A4U B;  2LP2 A;  4JQ0 D;  1PVB A;  3DVK A;  4NDB A;  1ZAC A;  5ER4 X;  1JWD A;  2BBM A;  4PE0 A;  2JZI A;  2LVI A;  2MAZ A;  1CDM A;  3OB1 B;  4QJ4 B;  1QAT A;  1F4O A;  1SKT A;  2KSP A;  3D0Y B;  3EK4 A;  1CLM A;  1S5G Y;  3IQO A;  3KO0 A;  3M0W A;  4JPZ B;  1WY9 A;  1GGW A;  2MLE C;  5CSF A;  2KFF A;  1U5I A;  1CLB A;  1NP8 A;  1FI6 A;  4MZL A;  1SCV A;  2KQY A;  3PAL A;  1SR6 B;  1JUO A;  3D0Y A;  3EVV A;  3LK1 A;  2JT8 A;  1M31 A;  4R1E A;  2I94 A;  2KBM A;  4XJK B;  2K61 A;  1R2U A;  2LMV A;  2NZ0 A;  2JUL A;  1OZS A;  1B7T Y;  1M46 A;  1UP5 A;  1XFX O;  1CMF A;  1DJX A;  3E3R A;  2LV7 A;  1IRJ A;  3O2P A;  4XJK A;  4L9M A;  1GGZ A;  3EK8 A;  2CXJ A;  2WOS A;  1XO5 A;  3CWG A;  1J7P A;  2FCD A;  2LNK A;  4NDC A;  1SL8 A;  1M45 A;  3CS1 A;  3WHU B;  1CDP A;  1PAL A;  1UWO A;  4USL A;  2H2K A;  3SG5 A;  1ALV A;  2BBN A;  4DIR A;  1SY9 A;  1CM1 A;  2FOT A;  2KAV A;  2ZN8 A;  5CSI A;  4M2Q A;  2NCO A;  4N5X A;  2NXQ A;  1SBJ A;  4MSP A;  1F71 A;  1KWO B;  5CSJ A;  2OPO A;  5KTY A;  2WOR A;  4OR9 B;  1DF0 B;  2PMY A;  2CNP A;  5AXI A;  3WNX B;  3CTN A;  2ZKM X;  3PN7 C;  1QAS A;  2Y1M A;  2LUC A;  2LC5 A;  3I5G B;  4WQ2 A;  2M97 A;  1CFD A;  3DVJ A;  1DJZ A;  4MVF A;  1QXP A;  4GBA A;  1UHJ A;  4C0K A;  4YI9 A;  1UUR A;  3VRO A;  2LVV A;  4DCK A;  4C0J A;  2BE6 A;  2NLN A;  3NSO A;  4CFR A;  1QJT A;  1EG4 A;  1C7W A;  2LAP A;  5J3X A;  4WRI A;  1Y6W A;  4FQO A;  4MZJ A;  1CFF A;  1NSH A;  1YVL A;  1OQP A;  1XK4 C;  1YR5 A;  2M29 A;  3SIB A;  2EC6 B;  3MSE B;  2MBX A;  1JSA A;  2GGM A;  1QVI Z;  4TNC A;  1WDC C;  4OKH A;  1DJG A;  3RLZ A;  1KQV A;  1IQ5 A;  1J1E A;  2ZRS A;  3JTD C;  1SCM B;  1YTZ C;  3OP0 A;  3AAK A;  1SMG A;  1SRA A;  2LVK A;  1ODB A;  4MRY A;  3DVE A;  1QX5 B;  2BL0 B;  2LHI A;  2RGI A;  1QS7 A;  1OOJ A;  1QTX A;  2OTG B;  4ORA B;  1KK8 B;  1TRF A;  1YRT B;  1S6J A;  3I5H B;  3IF7 A;  4CID A;  4OV2 A;  4PE1 A;  2I7A A;  3NXA A;  4ORC B;  2KGR A;  1Y1X A;  1TOP A;  1L7Z A;  1SL9 A;  1SPY A;  1BR4 B;  4DRW A;  4YGD B;  2KYF A;  2BKH B;  2IS9 A;  2MRD A;  1OMV A;  2KQ6 A;  2OS8 C;  1N2D A;  3BOW B;  1GQM A;  3HX4 A;  3TDZ A;  1A4P A;  1K96 A;  1F8H A;  1XA5 A;  3EK7 A;  2M7N A;  1SR6 C;  2KDH A;  4A4B A;  1QV1 A;  3O4Y A;  3BXK A;  1AUI B;  1MQ1 A;  2TN4 A;  2F33 A;  3TS5 C;  3CLN A;  4E68 A;  2K8M B;  2NCP A;  2WCE A;  1C07 A;  1QVI Y;  1CFC A;  3PM8 A;  2JXC A;  2F2O A;  3I5F C;  1FW4 A;  5F6T A;  1B8L A;  1MUX A;  3KF9 A;  1V1F A;  1BF5 A;  1PVA A;  2LCP A;  2LAN A;  4PHK A;  3LK0 A;  4YGE B;  1K93 D;  2HPS A;  3TUY C;  1BT6 A;  4PHJ A;  1DJW A;  1EG3 A;  1JF2 A;  1F54 A;  1XFY O;  2KFG A;  1EJ3 A;  1PSB A;  1DVI A;  1U5I B;  4YGB B;  2CT9 A;  1S6I A; 
#chains in the Genus database with same CATH topology
 3JVT C;  2KLE A;  2JRF A;  2WC5 A;  2EHB A;  3LLE A;  2PQL A;  3CR5 X;  1TNW A;  2VRG A;  4IJ7 A;  2H61 A;  3B88 A;  1R6P A;  3F45 A;  3A8R A;  3IQQ A;  4QJ5 B;  1NCY A;  2LLU A;  1A29 A;  2B1U A;  3FIA A;  1UHI A;  3NSL A;  4IL1 A;  2PSR A;  1WLM A;  1NUB A;  2ZRT A;  2SAS A;  2Y1N A;  5HLV A;  2M7L A;  3WHT B;  3IVT A;  1NIW A;  1BU3 A;  1JC2 A;  5DKQ A;  1J7O A;  3D10 A;  1IJ5 A;  1EL4 A;  1K8U A;  1BR1 B;  1FPW A;  1JFK A;  4CFQ A;  1B8R A;  2GV5 A;  1TNX A;  1YX8 A;  2KAX A;  3DZT A;  1RFJ A;  4AQJ A;  2FJU B;  4PT1 A;  3S0G A;  1HQV A;  3DVM A;  2L4H A;  2M8U A;  3PAT A;  2CTN A;  1NWD A;  2JPT A;  2BCA A;  5AER A;  1WLZ A;  1DGU A;  3VGO A;  2L0P A;  3PSR A;  2ISD A;  3D74 A;  4A4C A;  1IKU A;  3UNW A;  3R1V A;  2KI4 C;  2WCJ A;  3PFV A;  1LKJ A;  1UUS A;  1L2O C;  4JKT A;  5DKN A;  2QAC A;  1SYM A;  1DGV A;  2KPH A;  5D3O A;  1J55 A;  1DJH A;  1SCM C;  1W7I B;  4PE7 A;  3SG2 A;  3CZT X;  3NSI A;  2QDI A;  5KU1 A;  1C3Y A;  1AVS A;  4DS7 A;  3QRX A;  2ZND A;  2K60 A;  1NX2 A;  3ZNI A;  5AEQ A;  4BY5 A;  1NPQ A;  3AKB A;  3CZ2 A;  1KK7 Z;  3S0F A;  1OOG A;  1PSR A;  3R72 A;  1K95 A;  2KOT A;  4GGF A;  1DQE A;  1CMG A;  1V1G A;  3BUW B;  1TTX A;  1M39 A;  2HQ8 A;  1B47 A;  2PAS A;  3RZS A;  2COL B;  3D77 A;  4QJ3 B;  5FYX A;  4INX A;  1UHH A;  1VRK A;  2FJY A;  3KHE A;  1W7J B;  3S0D A;  2LVJ A;  2I2R E;  3K21 A;  3SIA A;  1YX7 A;  4ZCV A;  4I5L B;  3OX6 A;  1LVC D;  2LLS A;  3DD4 A;  4Q04 A;  2MA2 A;  4YRU A;  1B1G A;  2LHL A;  1XVJ A;  4XYN A;  4D1E A;  2K2A A;  1X02 A;  2LMU A;  3GOF A;  1ZUZ A;  1OOF A;  2QEV A;  3NHT A;  2F2P A;  5JJG A;  1CLL A;  3EKH A;  4YI8 A;  1OMR A;  5FI6 A;  4YGC B;  1K90 D;  2L50 A;  1BOC A;  4PDZ A;  2BE4 A;  1DC1 A;  2WC8 A;  1A2X A;  3BUO B;  1QIV A;  3BUX B;  1SNL A;  2JT3 A;  1LS8 A;  1S1E A;  3VB1 A;  3TZ1 A;  1K94 A;  2AMI A;  4I5J A;  4C0L A;  3C1V A;  1CB1 A;  1JFJ A;  3CR4 X;  4GNK B;  3FWB A;  1IJ6 A;  1AJ4 A;  2F8P A;  5FI2 A;  1WRL A;  1FF1 A;  2LP3 A;  1GM0 A;  2SCP A;  1C3Z A;  4MRX A;  3ICB A;  2YGU A;  1KCY A;  1A75 A;  1M63 B;  3LL8 B;  1KFX S;  1UHN A;  2K7B A;  1B9A A;  1TN4 A;  5PAL A;  1RRO A;  2MLF C;  2R2I A;  1NCX A;  2PAL A;  1PUL A;  1F55 A;  3CYZ A;  1OE9 B;  2QEB A;  3DYE A;  3PM2 A;  3PN7 B;  2I18 A;  5AFP A;  1B4C A;  5GQQ C;  2O5G A;  3DF0 B;  5I2L A;  1G33 A;  4PHM A;  2WCB A;  4PCW A;  2QPT A;  3BUN B;  2JWW A;  1MF8 B;  2WCF A;  3LCP C;  3SS5 A;  4AQI A;  1CM4 A;  4BY4 A;  2KI6 C;  5D69 A;  2L2E A;  1AK8 A;  3SS3 A;  1JBA A;  2JPO A;  3DF0 A;  3BUM B;  2JT0 A;  4DUQ A;  2K0J A;  3KPX A;  3OX5 A;  2PRU A;  1F70 A;  1DJI A;  2HQW A;  4NDD A;  1FBV A;  1ALW A;  2LM5 A;  5HL1 A;  4GUK A;  5TNC A;  3SG6 A;  3CZ1 A;  2MHH A;  3VRP A;  3D78 A;  2PYQ A;  1AP4 A;  5DKR A;  1B7T Z;  1WDC B;  1CDN A;  4M2O A;  3DY9 A;  2Y4Q A;  1QLK A;  2JOJ A;  3OHM B;  1XK4 A;  3HCM A;  1DJY A;  3JTD B;  3VRN A;  2BNX A;  3FWC A;  1MR8 A;  1MXL C;  1T14 A;  2BCX A;  1KWO C;  4YBH B;  3S0E A;  5HKY A;  3TDI A;  1QLS A;  3O6B A;  1QX7 A;  4INW A;  4MBE A;  1N0Y A;  4N1G A;  2M0R A;  3H4S E;  1WRK A;  1ZOT B;  5I94 A;  1Q80 A;  1GJY A;  1KSM A;  2L98 A;  5K89 A;  3S0A A;  2H8V A;  1ZMZ A;  3QME A;  3VRQ A;  3WXA A;  2KAY A;  2K2F A;  1QV0 A;  3I5G C;  3BFA A;  3K1E A;  1LXF C;  1Y1U A;  4OVN F;  1S3P A;  2KGB C;  3BFB A;  2GGZ A;  1RJV A;  1K9P A;  1CDL A;  3EG5 B;  1IG5 A;  5HKZ A;  1KQM B;  3EKJ A;  3L47 A;  1CNP A;  2KBI A;  2JXL A;  2K7C A;  4MZK A;  3S0B A;  1KFU L;  3PLF B;  1F4Q A;  2JNF A;  1YRU B;  1E8A A;  1TWO A;  2V53 A;  2OS8 B;  3I5I B;  2JTT A;  3DXL A;  4JWQ A;  2DOQ A;  5I8N A;  2LUX A;  2BAP A;  3RM1 A;  2PVB A;  4HRH A;  2EC6 C;  2JNX A;  5I2Q A;  3TS5 B;  1MHO A;  2JU0 A;  2HET A;  2KNE A;  3SJS A;  3CGA A;  1XFV O;  2WND A;  3I5F B;  4ETO A;  3CZ0 A;  4MN0 A;  4OCI A;  1CFP A;  4GAO A;  1DTL A;  3KEV A;  4HSZ A;  1EH2 A;  1XFZ O;  2LE9 B;  1CKK A;  2F3Y A;  1EXR A;  1OSA A;  1DEK A;  2JQ6 A;  3TUY B;  1K9K A;  1PK0 D;  1S36 A;  1MWN A;  1OZO A;  1N65 A;  1NX0 A;  3NSK A;  2M49 B;  2BL0 C;  1JF0 A;  1RK9 A;  1XYD A;  5JOL A;  4F0Z B;  2QEH A;  2OTG C;  5BPJ A;  1KK8 C;  2ZN9 A;  3I5H C;  3JVT B;  4ICB A;  1YUT A;  1OMD A;  4M2P A;  4I5K A;  2AUC A;  1OOH A;  4FTG A;  1C7V A;  1UHK A;  1K9U A;  2JC2 A;  2JTZ A;  2KI6 D;  3BYA A;  3O78 A;  1LIN A;  3BQ3 A;  3FS7 A;  2EGD A;  1QIW A;  2CBL A;  4NQG A;  1NYA A;  5AAN A;  3ZWH A;  4F7F A;  1K2H A;  4HRG A;  5D7F A;  2WC6 A;  1BG1 A;  1J7Q A;  2G2B A;  2L5Y A;  2L51 A;  4PAL A;  1A03 A;  1D1O A;  1G4Y R;  1DF0 A;  3EVU A;  2MJW B;  1TUZ A;  3SG3 A;  2A4J A;  5HYD A;  1G8I A;  3FE9 A;  1NX1 A;  1WRZ A;  4MLW A;  2Q91 A;  5CSN A;  3B6X A;  2P6B B;  1SK6 D;  2M3W A;  3GK4 X;  1A75 B;  5I2O A;  1Y1A A;  2Q4U A;  5HKW A;  2E6W A;  1Z4H A;  2H61 C;  2E30 A;  2HF5 A;  4N1F A;  1XFU O;  4YGA A;  2CCM A;  2ERB A;  2K7D A;  4P2Y B;  1W9Z A;  1KK7 Y;  1IH0 A;  2KI4 B;  1RWY A;  4ZCU A;  4UPG A;  2KYC A;  2O60 A;  2K7O A;  1L2O B;  4CPV A;  3AKA A;  1MXE A;  5HLO A;  2M9G A;  1FI5 A;  1IQ3 A;  1H8B A;  2ZFD A;  3SG7 A;  3OGN A;  1J7R A;  1REC A;  4GPL B;  2L4I A;  2M1K B;  1DT7 B;  3V2L A;  3CDN A;  4GFT A;  1IGV A;  1SW8 A;  3SG4 A;  1PRW A;  2BKI B;  4AOM A;  4HRE E;  2AAO A;  1NX3 A;  2F3Z A;  3NGV A;  1BOD A;  3UO9 A;  5KSZ A;  4P5O E;  4I5N B;  2LMT A;  5B8I B;  1TUJ A;  1BLQ A;  1HT9 A;  1RTP 1;  1S5G Z;  3TDU A;  1J1D A;  3OB2 B;  1IWQ A;  2ZNE A;  4WQ3 A;  1YVH A;  1BMO A;  2G9B A;  1TIZ A;  4KYN A;  1KQM C;  3AAJ A;  1SL7 A;  1LA0 A;  1ZFS A;  3BJH A;  4ORB B;  3D76 A;  2D8N A;  1DMO A;  1NCZ A;  4PHN A;  1YUU A;  3I5I C;  3OBV A;  1AHR A;  3GK2 A;  5DIC A;  2BCB A;  5ER5 A;  5IBW A;  1S6C A;  1Y0V H;  1TNQ A;  1TNP A;  2KFH A;  1BJF A;  2Y5I A;  3EVR A;  4GGN A;  1B8C A;  4PE4 A;  3VRR A;  1YUS A;  2LLT A;  3L4L A;  2GTE A;  2M1U A;  3CR2 A;  3BOW A;  4U8D A;  2KHN A;  1H4B A;  1YUR A;  1QX2 A;  1TCO B;  1XFW O;  2L5X B;  1KFX L;  3BFH A;  5CPV A;  2WCL A;  1AJ5 A;  1KSO A;  1TCF A;  1KFU S;  3GK1 A;  1LA3 A;  1QWV A;  1S26 D;  2FCE A;  4GGF C;  1CTR A;  4MEW A;  4CLN A;  3N7H A;  5G08 A;  2BEC A;  3A4U B;  2LP2 A;  4JQ0 D;  1PVB A;  3DVK A;  4NDB A;  1ZAC A;  5ER4 X;  1JWD A;  2BBM A;  1DEL A;  4PE0 A;  2JZI A;  2LVI A;  3D73 A;  2MAZ A;  1CDM A;  3OB1 B;  4QJ4 B;  1QAT A;  1F4O A;  1SKT A;  2KSP A;  3D0Y B;  3EK4 A;  1CLM A;  1S5G Y;  3IQO A;  3KO0 A;  3M0W A;  4JPZ B;  1WY9 A;  1GGW A;  2MLE C;  5CSF A;  2KFF A;  1U5I A;  1CLB A;  1NP8 A;  1ORG A;  4MZL A;  1FI6 A;  1SCV A;  2KQY A;  3NHI A;  3PAL A;  1SR6 B;  1JUO A;  3D0Y A;  3EVV A;  3LK1 A;  2JT8 A;  1M31 A;  4R1E A;  2I94 A;  2KBM A;  3B7A A;  4XJK B;  2K61 A;  1R2U A;  3FE8 A;  2LMV A;  2NZ0 A;  2JUL A;  1OZS A;  2WCH A;  1B7T Y;  1M46 A;  1UP5 A;  1XFX O;  1CMF A;  1DJX A;  3E3R A;  2LV7 A;  1IRJ A;  3O2P A;  4XJK A;  4JD9 A;  1GGZ A;  4L9M A;  3EK8 A;  2CXJ A;  2WOS A;  1XO5 A;  3CWG A;  5EL2 A;  2FCD A;  1J7P A;  3Q8I A;  2LNK A;  4NDC A;  1SL8 A;  1M45 A;  3CS1 A;  5FI7 A;  3WHU B;  1CDP A;  1PAL A;  1UWO A;  4USL A;  2H2K A;  2WCK A;  1ALV A;  2BBN A;  3SG5 A;  2WCM A;  4DIR A;  1SY9 A;  1CM1 A;  2FOT A;  2KAV A;  2ZN8 A;  5CSI A;  4M2Q A;  2NCO A;  4N5X A;  2NXQ A;  1SBJ A;  4MSP A;  1F71 A;  1KWO B;  5CSJ A;  1P28 A;  2OPO A;  2KLD A;  2WOR A;  4OR9 B;  5KTY A;  1DF0 B;  1OOI X;  2PMY A;  2CNP A;  5AXI A;  1IIO A;  3WNX B;  2QEO A;  3CTN A;  2ZKM X;  3PN7 C;  1QAS A;  2Y1M A;  3R1O A;  2LUC A;  2LC5 A;  3I5G B;  4WQ2 A;  2M97 A;  1OW4 A;  3R1P A;  1CFD A;  3DVJ A;  1DJZ A;  4MVF A;  1QXP A;  4GBA A;  1UHJ A;  4C0K A;  3L4A A;  4YI9 A;  4FQT A;  1UUR A;  3VRO A;  2LVV A;  4DCK A;  4C0J A;  2BE6 A;  2NLN A;  3NSO A;  4CFR A;  1QJT A;  1EG4 A;  1C7W A;  2LAP A;  5J3X A;  2P71 A;  4WRI A;  2P70 A;  1Y6W A;  4FQO A;  4MZJ A;  1CFF A;  1NSH A;  1YVL A;  1OQP A;  1XK4 C;  1YR5 A;  2M29 A;  3SIB A;  2EC6 B;  3MSE B;  2MBX A;  1JSA A;  2GGM A;  1QVI Z;  4TNC A;  1WDC C;  4OKH A;  1DJG A;  3RLZ A;  1KQV A;  1IQ5 A;  1J1E A;  2ZRS A;  3JTD C;  2L2C A;  1SCM B;  1YTZ C;  3PJI A;  3OP0 A;  3D75 A;  3AAK A;  1SMG A;  1SRA A;  2LVK A;  1ODB A;  3FE6 A;  1Z2C B;  4MRY A;  3DVE A;  1QX5 B;  3CAB A;  2BL0 B;  2LHI A;  2RGI A;  1QS7 A;  1OOJ A;  1QTX A;  2OTG B;  4ORA B;  1KK8 B;  1TRF A;  1YRT B;  1S6J A;  3I5H B;  3IF7 A;  3O4X A;  4CID A;  4OV2 A;  4PE1 A;  2I7A A;  3NXA A;  4ORC B;  2KGR A;  1Y1X A;  1TOP A;  1L7Z A;  1SL9 A;  1SPY A;  3B87 A;  1BR4 B;  4DRW A;  4YGD B;  2KYF A;  1XFR A;  2BKH B;  4OZD A;  2IS9 A;  2MRD A;  1OMV A;  1SSE B;  2KQ6 A;  1N2D A;  2OS8 C;  1GQM A;  3BOW B;  3HX4 A;  1A4P A;  1K96 A;  3TDZ A;  1XA5 A;  3EK7 A;  2M7N A;  1SR6 C;  2KDH A;  4A4B A;  1QV1 A;  3O4Y A;  3SS4 A;  3BXK A;  1AUI B;  1MQ1 A;  2TN4 A;  2F33 A;  3TS5 C;  3CLN A;  4E68 A;  2K8M B;  2NCP A;  2WCE A;  1C07 A;  1QVI Y;  1CFC A;  3PM8 A;  2JXC A;  2F2O A;  3I5F C;  1FW4 A;  5F6T A;  1B8L A;  1MUX A;  3KF9 A;  1V1F A;  1BF5 A;  1PVA A;  2LCP A;  2LAN A;  4PHK A;  3LK0 A;  4YGE B;  1K93 D;  2HPS A;  3TUY C;  1F8H A;  3B86 A;  1BT6 A;  4PHJ A;  1DJW A;  1JF2 A;  1EG3 A;  1F54 A;  1XFY O;  2KFG A;  1EJ3 A;  1PSB A;  1DVI A;  1U5I B;  4YGB B;  2CT9 A;  1S6I A; 
#chains in the Genus database with same CATH homology
 3JVT C;  2JRF A;  2EHB A;  3LLE A;  3CR5 X;  1TNW A;  2VRG A;  2H61 A;  1R6P A;  3F45 A;  3A8R A;  3IQQ A;  4QJ5 B;  1NCY A;  2LLU A;  1A29 A;  2B1U A;  3FIA A;  1UHI A;  3NSL A;  4IL1 A;  2PSR A;  1WLM A;  1NUB A;  2ZRT A;  2SAS A;  2Y1N A;  5HLV A;  2M7L A;  3WHT B;  1JC2 A;  1NIW A;  1BU3 A;  5DKQ A;  1J7O A;  3D10 A;  1IJ5 A;  1EL4 A;  1K8U A;  1BR1 B;  1FPW A;  1JFK A;  4CFQ A;  1B8R A;  2GV5 A;  1TNX A;  1YX8 A;  2KAX A;  1RFJ A;  4AQJ A;  2FJU B;  1HQV A;  3DVM A;  2L4H A;  2M8U A;  3PAT A;  2CTN A;  1NWD A;  2JPT A;  2BCA A;  5AER A;  1WLZ A;  1DGU A;  3VGO A;  2L0P A;  3PSR A;  2ISD A;  4A4C A;  1IKU A;  2KI4 C;  3PFV A;  1LKJ A;  1UUS A;  1L2O C;  5DKN A;  2QAC A;  1SYM A;  1DGV A;  1J55 A;  1DJH A;  1SCM C;  1W7I B;  4PE7 A;  3SG2 A;  3CZT X;  3NSI A;  5KU1 A;  1AVS A;  4DS7 A;  3QRX A;  2ZND A;  1NX2 A;  3ZNI A;  5AEQ A;  4BY5 A;  1NPQ A;  3AKB A;  1KK7 Z;  1PSR A;  1K95 A;  2KOT A;  4GGF A;  1CMG A;  1V1G A;  3BUW B;  1TTX A;  1M39 A;  2HQ8 A;  1B47 A;  2PAS A;  2COL B;  4QJ3 B;  5FYX A;  1UHH A;  1VRK A;  3KHE A;  1W7J B;  2LVJ A;  2I2R E;  3K21 A;  3SIA A;  1YX7 A;  4ZCV A;  4I5L B;  3OX6 A;  1LVC D;  2LLS A;  3DD4 A;  4Q04 A;  2MA2 A;  4YRU A;  1B1G A;  2LHL A;  1XVJ A;  4XYN A;  4D1E A;  2K2A A;  1X02 A;  2LMU A;  3GOF A;  1ZUZ A;  2F2P A;  5JJG A;  1CLL A;  3EKH A;  4YI8 A;  1OMR A;  4YGC B;  1K90 D;  2L50 A;  1BOC A;  4PDZ A;  2BE4 A;  2WC8 A;  1A2X A;  3BUO B;  1QIV A;  3BUX B;  1SNL A;  2JT3 A;  1S1E A;  3TZ1 A;  1K94 A;  2AMI A;  4I5J A;  4C0L A;  3C1V A;  1CB1 A;  1JFJ A;  3CR4 X;  4GNK B;  3FWB A;  1IJ6 A;  1AJ4 A;  2F8P A;  1WRL A;  1FF1 A;  2LP3 A;  2SCP A;  4MRX A;  3ICB A;  1KCY A;  1A75 A;  1M63 B;  3LL8 B;  1KFX S;  1UHN A;  2K7B A;  1B9A A;  1TN4 A;  5PAL A;  1RRO A;  2MLF C;  2R2I A;  1NCX A;  2PAL A;  1PUL A;  1F55 A;  1OE9 B;  3PN7 B;  2I18 A;  5AFP A;  1B4C A;  5GQQ C;  2O5G A;  3DF0 B;  5I2L A;  1G33 A;  4PHM A;  2WCB A;  4PCW A;  2QPT A;  3BUN B;  2JWW A;  1MF8 B;  2WCF A;  3LCP C;  4AQI A;  1CM4 A;  4BY4 A;  2KI6 C;  5D69 A;  2L2E A;  1AK8 A;  1JBA A;  3DF0 A;  3BUM B;  2JT0 A;  4DUQ A;  2K0J A;  3KPX A;  3OX5 A;  2PRU A;  1F70 A;  1DJI A;  2HQW A;  4NDD A;  1FBV A;  1ALW A;  2LM5 A;  4GUK A;  5TNC A;  3SG6 A;  2MHH A;  3VRP A;  1AP4 A;  5DKR A;  1B7T Z;  1WDC B;  1CDN A;  4M2O A;  2Y4Q A;  1QLK A;  2JOJ A;  3OHM B;  1XK4 A;  3HCM A;  1DJY A;  3JTD B;  3VRN A;  3FWC A;  1MR8 A;  1MXL C;  2BCX A;  1KWO C;  4YBH B;  5HKY A;  3TDI A;  1QLS A;  3O6B A;  1QX7 A;  4MBE A;  1N0Y A;  4N1G A;  2M0R A;  3H4S E;  1WRK A;  1ZOT B;  1Q80 A;  1GJY A;  1KSM A;  2L98 A;  5K89 A;  1ZMZ A;  3VRQ A;  3WXA A;  2KAY A;  2K2F A;  1QV0 A;  3I5G C;  1LXF C;  1Y1U A;  4OVN F;  1S3P A;  2KGB C;  2GGZ A;  1RJV A;  1K9P A;  1CDL A;  1IG5 A;  5HKZ A;  1KQM B;  3EKJ A;  1CNP A;  2KBI A;  2JXL A;  2K7C A;  4MZK A;  1KFU L;  3PLF B;  1F4Q A;  2JNF A;  1YRU B;  1E8A A;  2V53 A;  2OS8 B;  3I5I B;  2JTT A;  4JWQ A;  2DOQ A;  5I8N A;  2LUX A;  3RM1 A;  2PVB A;  4HRH A;  2EC6 C;  2JNX A;  5I2Q A;  3TS5 B;  1MHO A;  2JU0 A;  2HET A;  2KNE A;  3SJS A;  3CGA A;  1XFV O;  2WND A;  3I5F B;  4ETO A;  4MN0 A;  4OCI A;  1CFP A;  4GAO A;  1DTL A;  3KEV A;  4HSZ A;  1EH2 A;  1XFZ O;  2LE9 B;  1CKK A;  2F3Y A;  1EXR A;  1OSA A;  2JQ6 A;  3TUY B;  1K9K A;  1PK0 D;  1S36 A;  1MWN A;  1OZO A;  1N65 A;  1NX0 A;  3NSK A;  2M49 B;  2BL0 C;  1JF0 A;  1RK9 A;  1XYD A;  5JOL A;  4F0Z B;  2OTG C;  5BPJ A;  1KK8 C;  2ZN9 A;  3I5H C;  3JVT B;  4ICB A;  1YUT A;  1OMD A;  4M2P A;  4I5K A;  2AUC A;  4FTG A;  1C7V A;  1UHK A;  1K9U A;  2JC2 A;  2JTZ A;  2KI6 D;  3BYA A;  3O78 A;  1LIN A;  3BQ3 A;  3FS7 A;  2EGD A;  1QIW A;  2CBL A;  4NQG A;  1NYA A;  5AAN A;  3ZWH A;  1K2H A;  4HRG A;  5D7F A;  1BG1 A;  1J7Q A;  2G2B A;  2L51 A;  4PAL A;  1A03 A;  1D1O A;  1G4Y R;  1DF0 A;  3EVU A;  2MJW B;  3SG3 A;  2A4J A;  5HYD A;  1G8I A;  1NX1 A;  1WRZ A;  4MLW A;  2Q91 A;  5CSN A;  2P6B B;  1SK6 D;  2M3W A;  3GK4 X;  1A75 B;  5I2O A;  1Y1A A;  2Q4U A;  5HKW A;  2E6W A;  2H61 C;  2HF5 A;  2E30 A;  4N1F A;  1XFU O;  4YGA A;  2CCM A;  4P2Y B;  2K7D A;  1KK7 Y;  1IH0 A;  2KI4 B;  1RWY A;  4ZCU A;  4UPG A;  2KYC A;  2O60 A;  2K7O A;  1L2O B;  4CPV A;  3AKA A;  1MXE A;  5HLO A;  2M9G A;  1FI5 A;  1IQ3 A;  1H8B A;  2ZFD A;  3SG7 A;  1J7R A;  1REC A;  4GPL B;  2L4I A;  2M1K B;  1DT7 B;  4GFT A;  1IGV A;  1SW8 A;  3SG4 A;  1PRW A;  2BKI B;  4AOM A;  4HRE E;  2AAO A;  1NX3 A;  2F3Z A;  1BOD A;  5KSZ A;  4P5O E;  4I5N B;  2LMT A;  5B8I B;  1BLQ A;  1HT9 A;  1RTP 1;  1S5G Z;  3TDU A;  1J1D A;  3OB2 B;  1IWQ A;  2ZNE A;  4WQ3 A;  1YVH A;  1BMO A;  2G9B A;  1TIZ A;  1KQM C;  3AAJ A;  1SL7 A;  1LA0 A;  1ZFS A;  4ORB B;  2D8N A;  1DMO A;  1NCZ A;  4PHN A;  1YUU A;  3I5I C;  1AHR A;  3GK2 A;  5ER5 A;  2BCB A;  5IBW A;  1S6C A;  1Y0V H;  1TNQ A;  1TNP A;  2KFH A;  1BJF A;  2Y5I A;  3EVR A;  4GGN A;  1B8C A;  4PE4 A;  3VRR A;  1YUS A;  2LLT A;  2M1U A;  3CR2 A;  4U8D A;  3BOW A;  2KHN A;  1H4B A;  1YUR A;  1QX2 A;  1TCO B;  1XFW O;  2L5X B;  1KFX L;  5CPV A;  1AJ5 A;  1KSO A;  1TCF A;  1KFU S;  3GK1 A;  1LA3 A;  2FCE A;  1S26 D;  4GGF C;  4MEW A;  1CTR A;  4CLN A;  5G08 A;  2BEC A;  3A4U B;  2LP2 A;  4JQ0 D;  1PVB A;  3DVK A;  4NDB A;  1ZAC A;  5ER4 X;  1JWD A;  2BBM A;  4PE0 A;  2JZI A;  2LVI A;  2MAZ A;  1CDM A;  3OB1 B;  4QJ4 B;  1QAT A;  1F4O A;  1SKT A;  2KSP A;  3D0Y B;  3EK4 A;  1CLM A;  1S5G Y;  3IQO A;  3KO0 A;  3M0W A;  4JPZ B;  1WY9 A;  1GGW A;  2MLE C;  5CSF A;  2KFF A;  1U5I A;  1CLB A;  1NP8 A;  1FI6 A;  4MZL A;  1SCV A;  2KQY A;  3PAL A;  1SR6 B;  1JUO A;  3D0Y A;  3EVV A;  3LK1 A;  2JT8 A;  1M31 A;  4R1E A;  2I94 A;  2KBM A;  4XJK B;  2K61 A;  1R2U A;  2LMV A;  2NZ0 A;  2JUL A;  1OZS A;  1B7T Y;  1M46 A;  1UP5 A;  1XFX O;  1CMF A;  1DJX A;  3E3R A;  2LV7 A;  1IRJ A;  3O2P A;  4XJK A;  4L9M A;  1GGZ A;  3EK8 A;  2CXJ A;  2WOS A;  1XO5 A;  3CWG A;  1J7P A;  2FCD A;  2LNK A;  4NDC A;  1SL8 A;  1M45 A;  3CS1 A;  3WHU B;  1CDP A;  1PAL A;  1UWO A;  4USL A;  2H2K A;  3SG5 A;  1ALV A;  2BBN A;  4DIR A;  1SY9 A;  1CM1 A;  2FOT A;  2KAV A;  2ZN8 A;  5CSI A;  4M2Q A;  2NCO A;  4N5X A;  2NXQ A;  1SBJ A;  4MSP A;  1F71 A;  1KWO B;  5CSJ A;  2OPO A;  5KTY A;  2WOR A;  4OR9 B;  1DF0 B;  2PMY A;  2CNP A;  5AXI A;  3WNX B;  3CTN A;  2ZKM X;  3PN7 C;  1QAS A;  2Y1M A;  2LUC A;  2LC5 A;  3I5G B;  4WQ2 A;  2M97 A;  1CFD A;  3DVJ A;  1DJZ A;  4MVF A;  1QXP A;  4GBA A;  1UHJ A;  4C0K A;  4YI9 A;  1UUR A;  3VRO A;  2LVV A;  4DCK A;  4C0J A;  2BE6 A;  2NLN A;  3NSO A;  4CFR A;  1QJT A;  1EG4 A;  1C7W A;  2LAP A;  5J3X A;  4WRI A;  1Y6W A;  4FQO A;  4MZJ A;  1CFF A;  1NSH A;  1YVL A;  1OQP A;  1XK4 C;  1YR5 A;  2M29 A;  3SIB A;  2EC6 B;  3MSE B;  2MBX A;  1JSA A;  2GGM A;  1QVI Z;  4TNC A;  1WDC C;  4OKH A;  1DJG A;  3RLZ A;  1KQV A;  1IQ5 A;  1J1E A;  2ZRS A;  3JTD C;  1SCM B;  1YTZ C;  3OP0 A;  3AAK A;  1SMG A;  1SRA A;  2LVK A;  1ODB A;  4MRY A;  3DVE A;  1QX5 B;  2BL0 B;  2LHI A;  2RGI A;  1QS7 A;  1OOJ A;  1QTX A;  2OTG B;  4ORA B;  1KK8 B;  1TRF A;  1YRT B;  1S6J A;  3I5H B;  3IF7 A;  4CID A;  4OV2 A;  4PE1 A;  2I7A A;  3NXA A;  4ORC B;  2KGR A;  1Y1X A;  1TOP A;  1L7Z A;  1SL9 A;  1SPY A;  1BR4 B;  4DRW A;  4YGD B;  2KYF A;  2BKH B;  2IS9 A;  2MRD A;  1OMV A;  2KQ6 A;  2OS8 C;  1N2D A;  3BOW B;  1GQM A;  3HX4 A;  3TDZ A;  1A4P A;  1K96 A;  1F8H A;  1XA5 A;  3EK7 A;  2M7N A;  1SR6 C;  2KDH A;  4A4B A;  1QV1 A;  3O4Y A;  3BXK A;  1AUI B;  1MQ1 A;  2TN4 A;  2F33 A;  3TS5 C;  3CLN A;  4E68 A;  2K8M B;  2NCP A;  2WCE A;  1C07 A;  1QVI Y;  1CFC A;  3PM8 A;  2JXC A;  2F2O A;  3I5F C;  1FW4 A;  5F6T A;  1B8L A;  1MUX A;  3KF9 A;  1V1F A;  1BF5 A;  1PVA A;  2LCP A;  2LAN A;  4PHK A;  3LK0 A;  4YGE B;  1K93 D;  2HPS A;  3TUY C;  1BT6 A;  4PHJ A;  1DJW A;  1EG3 A;  1JF2 A;  1F54 A;  1XFY O;  2KFG A;  1EJ3 A;  1PSB A;  1DVI A;  1U5I B;  4YGB B;  2CT9 A;  1S6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...