2WNDA

Structure of an s100a7 triple mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLAGVFEKKDKNEDKKIDFSEFLSLMGDIATDYHKKSHGAAPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A7
publication title Structural and Functional Characterization of a Triple Mutant Form of S100A7 Defective for Jab1 Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 38
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2wndA00
3CGAA 2EGDA 3PSRA 5K89A 4GPLB 2BBNA 4I5LB 1AHRA 4YBHB 1K8UA 1DGVA 2VRGA 1KK8C 4MZLA 2K7BA 3SG7A 1IWQA 2HQ8A 4JWQA 5ER5A 1WLZA 3PM8A 1KCYA 2Q91A 1HT9A 1EJ3A 3EVRA 1BR4B 2V53A 1UURA 4L9MA 4YGAA 1S5GY 4PCWA 1WDCC 3WHTB 1S1EA 2LVVA 2KYCA 2CT9A 3DVMA 4MSPA 2OTGC 4PE0A 1N65A 5CSFA 1TCOB 4NDCA 3SG3A 2F8PA 2KSPA 4ZCUA 3TDZA 1FBVA 1MR8A 4USLA 4DIRA 1JBAA 1RTP1 5TNCA 1KSOA 3VRQA 4QJ3B 1CM1A 1XK4C 1C7WA 1K9KA 3AKAA 1DVIA 3VRNA 1NX2A 4YGDB 3NSKA 2K8MB 2RGIA 1UHHA 1BJFA 1YRUB 1Y1XA 1Y1AA 2M1UA 3KPXA 1J1DA 1ZACA 2AAOA 1SR6C 3BUXB 1OZOA 3OX5A 1F54A 1WY9A 3EK4A 4PHJA 2KDHA 1UWOA 4AQIA 1JWDA 1J7RA 1M63B 1A4PA 1SPYA 1CM4A 2M9GA 5AERA 3PLFB 1CLMA 4ORAB 4WQ3A 1XK4A 4MZJA 3DF0A 2B1UA 2COLB 3SG5A 1BLQA 4DRWA 1SCMC 1CFPA 2JTTA 1F71A 1TCFA 2LMTA 1YVLA 1PSRA 2GGMA 2JT0A 1J55A 2JULA 1RFJA 3I5IC 2BCBA 1NX3A 2LNKA 3NXAA 1H8BA 2JQ6A 2Y1MA 1SRAA 2MLFC 1OMVA 2ZRTA 1JFKA 1MXLC 1Y6WA 3JVTC 4C0JA 1WRKA 2KQYA 2K2FA 1WRZA 2K61A 3ZWHA 1JC2A 1DJGA 1W7JB 3BXKA 1L7ZA 4M2QA 2MJWB 2KI4C 4GNKB 2L0PA 2WOSA 2LMVA 2JT8A 1LA0A 1S6IA 1AJ4A 1CDPA 3DD4A 5J3XA 2O5GA 3KEVA 4AOMA 5FYXA 3D0YA 3E3RA 1EH2A 4OKHA 2LE9B 3KO0A 1TTXA 1IQ3A 3DF0B 1SBJA 1GGWA 2F3ZA 1KSMA 4C0LA 1G8IA 2NCOA 5I8NA 2FCEA 1K90D 1SR6B 2WNDA 3K21A 3I5HB 5HKYA 2BBMA 1CTRA 3BUMB 1QVIZ 1OOJA 4Q04A 1K2HA 5CSIA 2KGRA 5G08A 4DS7A 2L4HA 2L50A 4P5OE 2H61C 4CLNA 2BE4A 1KWOB 2LVJA 2LLUA 1SCMB 2MHHA 2GGZA 2KBIA 3PFVA 5AEQA 1JUOA 2FOTA 3VRPA 1OZSA 1PULA 1ODBA 1X02A 1W7IB 4I5NB 1QIVA 2WCFA 1NSHA 2ZKMX 2LANA 1KFXS 2ZRSA 3VRRA 4PHNA 2L5XB 1JF2A 3ICBA 1S6CA 1PVAA 1R6PA 3D0YB 1GGZA 2H61A 2K0JA 1YX8A 1B7TZ 5DKQA 2KAVA 1TIZA 1NCXA 1NUBA 4JQ0D 4MLWA 3RM1A 2IS9A 3PN7B 1CFCA 1C07A 1DJZA 3CR5X 4D1EA 5BPJA 1BF5A 1DJWA 1EXRA 1TNWA 2HETA 2K7CA 2BKIB 2Q4UA 1IJ5A 1AK8A 1GQMA 1J7OA 1TNPA 3NSIA 5AFPA 1YUUA 1S6JA 1DJHA 4ETOA 3AKBA 1XFZO 4CPVA 1B8RA 2P6BB 4I5KA 5CPVA 4AQJA 3NSLA 1BR1B 1QS7A 1QV0A 2JTZA 1XVJA 3I5FB 2KNEA 2Y4QA 2GV5A 3O6BA 2LC5A 1N0YA 4PDZA 1S3PA 3KF9A 1KK7Y 1UUSA 3IF7A 3GK4X 4FQOA 4QJ4B 5KSZA 1QLKA 2BECA 3EVUA 4CIDA 1TNXA 2F2PA 1K9PA 1R2UA 1XFWO 5CSNA 2LMUA 2CNPA 1IG5A 5D69A 3I5HC 4WQ2A 5HLVA 3O78A 1DMOA 2LLSA 4GUKA 4M2PA 1YUSA 2KHNA 3BYAA 2CCMA 1XFYO 4MRXA 1K95A 2LM5A 2JXLA 3CR2A 3LLEA 2I7AA 1PALA 2PVBA 1TNQA 5HYDA 1KWOC 3BUWB 4U8DA 1S26D 3OP0A 1CDMA 1K9UA 2F33A 2I18A 3DVEA 4HREE 4ICBA 1XFVO 5DKRA 1OQPA 1F4QA 4GBAA 3GK2A 5KU1A 1DF0A 1MUXA 3IQQA 2JWWA 4NDBA 2L51A 1QV1A 2WC8A 1CFDA 2LP2A 1QLSA 2K2AA 2MAZA 1CFFA 1NIWA 1SW8A 1MXEA 4HRGA 2LHIA 4P2YB 1J1EA 2JU0A 4JPZB 4ORCB 1PVBA 1BMOA 2K7DA 2LLTA 2KOTA 3PN7C 5JOLA 1QVIY 1M45A 1XFXO 2CBLA 4HSZA 2G9BA 4PALA 3ZNIA 1LA3A 1J7PA 3TDUA 4XJKA 1WLMA 4R1EA 1CB1A 1CNPA 1BT6A 3EK8A 1SK6D 4PE1A 3DVJA 1B4CA 1QATA 4PHKA 5PALA 2KGBC 1IKUA 3TS5B 5KTYA 2M97A 3FS7A 1CDNA 2ZN8A 3CTNA 4A4CA 2JT3A 4QJ5B 3FWBA 1XO5A 3BQ3A 1F4OA 1DF0B 2WORA 3TUYB 1C7VA 3OB2B 3I5FC 5AANA 1JSAA 1B9AA 3O2PA 2AMIA 1NX1A 2I94A 5B8IB 1UHKA 1MQ1A 2FJUB 1B7TY 3TDIA 2ZNEA 1AUIB 1SNLA 1OMRA 3EKJA 4GAOA 3I5GB 3M0WA 1OSAA 1ZMZA 4M2OA 5I2OA 3EVVA 5DKNA 1DJXA 2E6WA 1YR5A 2LV7A 4OCIA 4PE4A 2HF5A 2SCPA 2KI6C 1E8AA 1L2OB 2CXJA 3WNXB 1Y1UA 3C1VA 1N2DA 4XJKB 2PMYA 5IBWA 3IQOA 4YI9A 2BCAA 1YURA 5I2QA 1GJYA 3JTDB 4GGFA 2LCPA 2M0RA 4ORBB 3NSOA 1XA5A 2M29A 1XYDA 2ZN9A 5HKWA 2KFHA 1DTLA 1WRLA 2JXCA 5CSJA 1HQVA 3QRXA 2M3WA 1EG3A 2TN4A 1YUTA 2I2RE 2M49B 4HRHA 3OHMB 1IH0A 1JFJA 2LUXA 2LHLA 1FW4A 2LVKA 1ALWA 3CWGA 1A29A 1MF8B 1OMDA 2NLNA 1QX2A 2QPTA 4OR9B 1SCVA 1QASA 1K94A 2LVIA 3CR4X 1B1GA 1K96A 1LXFC 1IJ6A 2CTNA 5F6TA 3VROA 4CFRA 1AVSA 1NYAA 3BOWB 1YVHA 3AAJA 1AP4A 2ZFDA 2HQWA 3GK1A 1QJTA 1AJ5A 1EG4A 1M46A 1VRKA 2L98A 4E68A 4BY4A 1XFUO 2JOJA 4TNCA 2WCBA 4A4BA 5GQQC 3BUOB 3DVKA 2JZIA 3GOFA 3CZTX 3FIAA 4OV2A 2KFFA 4OVNF 4BY5A 2MLEC 2A4JA 4N1FA 5I2LA 1YTZC 5ER4X 1QTXA 2ISDA 1QX7A 2BL0B 3TS5C 2M1KB 1SL9A 2NCPA 2OS8B 4YI8A 1TOPA 1QX5B 3SIAA 1F8HA 1OE9B 3SG6A 1KQVA 1ALVA 3TUYC 1YX7A 2BCXA 2KQ6A 3LK0A 3LL8B 2MBXA 1NCYA 3LCPC 1U5IA 1NP8A 1A75A 1LVCD 4NDDA 1JF0A 1RK9A 1V1FA 1DGUA 2F3YA 2BE6A 2ZNDA 3I5GC 5HLOA 1B8LA 2R2IA 1BOCA 4PE7A 1PRWA 1CLBA 3MSEB 3EKHA 3SG2A 4MEWA 4N5XA 2MA2A 1Q80A 1CMFA 1L2OC 4YGBB 1S5GZ 1V1GA 2H2KA 2DOQA 5JJGA 1KFUL 2KAXA 4DCKA 3HX4A 2JRFA 1F70A 4CFQA 1UHJA 2KBMA 4DUQA 2G2BA 1QXPA 3JTDC 1UHNA 1KK7Z 2EC6B 4YGEB 3VGOA 1RROA 4NQGA 4F0ZB 2JC2A 1KFUS 1NPQA 1KQMB 3BUNB 5AXIA 1TRFA 1LKJA 1K93D 4GFTA 2PASA 4MZKA 2E30A 2EHBA 2K7OA 2PRUA 1FPWA 1U5IB 1Y0VH 4YRUA 1A75B 2HPSA 1BU3A 1KK8B 2AUCA 4MRYA 4XYNA 1UHIA 2LP3A 1RECA 3CLNA 3AAKA 2F2OA 3OX6A 1DJIA 2PALA 4FTGA 2JNXA 2L4IA 1NWDA 2Y5IA 1PK0D 1IRJA 1WDCB 2JNFA 2FCDA 3F45A 2WCEA 2OTGB 1G4YR 4YGCB 2KFGA 2LUCA 4ZCVA 3O4YA 1PSBA 1TN4A 1SYMA 4N1GA 1BODA 2M8UA 1A2XA 3A4UB 2KI6D 2PSRA 3KHEA 4GGFC 1LINA 3PALA 4IL1A 4MBEA 1RWYA 1DJYA 1ZUZA 2BL0C 3BOWA 3RLZA 1IQ5A 3SG4A 2OS8C 1F55A 1MWNA 4C0KA 1FF1A 1UP5A 1M31A 1CDLA 1QIWA 3LK1A 2M7LA 1ZFSA 1J7QA 1SL7A 3D10A 1B47A 2Y1NA 3FWCA 2SASA 5D7FA 4UPGA 1S36A 1ZOTB 3SJSA 4I5JA 1IGVA 1DT7B 1CMGA 1KFXL 3A8RA 3H4SE 4WRIA 4MVFA 2BKHB 2KYFA 3CS1A 1D1OA 1NCZA 1YRTB 2MRDA 1CLLA 2KAYA 3SIBA 1FI5A 2OPOA 3WXAA 3TZ1A 3I5IB 1B8CA 2JPTA 3WHUB 1CKKA 4GGNA 2NXQA 1H4BA 1EL4A 1SMGA 3OB1B 2L2EA 3PATA 2D8NA 1G33A 1FI6A 1SKTA 1A03A 3EK7A 2O60A 3JVTB 1BG1A 1NX0A 2M7NA 2EC6C 1M39A 1SL8A 1SY9A 2LAPA 2NZ0A 2QACA 3HCMA 4PHMA 1MHOA 1RJVA 5HKZA 4MN0A 2KI4B 1KQMC
chains in the Genus database with same CATH superfamily
3CGAA 2EGDA 3PSRA 2KLDA 4GPLB 2BBNA 5K89A 2P70A 3NGVA 4I5LB 1AHRA 4YBHB 5D3OA 5FI2A 1K8UA 1DGVA 2VRGA 3OBVA 1KK8C 4MZLA 2K7BA 3SG7A 1IWQA 3B86A 2HQ8A 4JWQA 5ER5A 1WLZA 2KLEA 3PM8A 1KCYA 2Q91A 1HT9A 1EJ3A 3EVRA 1BR4B 2V53A 1UURA 3BFAA 4L9MA 4YGAA 1S5GY 4PCWA 1WDCC 1LS8A 3WHTB 1S1EA 2ERBA 2LVVA 2KYCA 2CT9A 3DVMA 4MSPA 2OTGC 3R1OA 1N65A 4PE0A 5CSFA 5DICA 1TCOB 4NDCA 3SG3A 2F8PA 2KSPA 4ZCUA 3TDZA 1FBVA 1MR8A 4USLA 4DIRA 1JBAA 3SS5A 1RTP1 5TNCA 1KSOA 3VRQA 4QJ3B 1CM1A 1XK4C 1C7WA 1K9KA 2PYQA 1DVIA 3AKAA 3N7HA 3VRNA 1NX2A 4YGDB 3NSKA 2K8MB 2RGIA 1TUZA 1UHHA 1BJFA 1YRUB 1Y1XA 3D74A 1QWVA 1Y1AA 2M1UA 1J1DA 1ZACA 2AAOA 3KPXA 1SR6C 3BUXB 1OZOA 3OX5A 1F54A 1WY9A 3EK4A 1ORGA 4PHJA 2KDHA 1UWOA 4AQIA 2KPHA 1DQEA 1TUJA 2H8VA 1JWDA 1J7RA 1M63B 1A4PA 1SPYA 1CM4A 2M9GA 5AERA 3PLFB 1CLMA 4ORAB 4WQ3A 1XK4A 4MZJA 3DF0A 2B1UA 2COLB 3SG5A 1BLQA 4DRWA 1SCMC 1CFPA 2JTTA 1F71A 1TCFA 2LMTA 1DELA 1YVLA 1PSRA 2GGMA 2JT0A 1J55A 2JULA 1RFJA 3I5IC 2BCBA 1NX3A 2LNKA 3NXAA 1H8BA 2JQ6A 3D78A 2Y1MA 1SRAA 2MLFC 3CZ0A 1OMVA 2ZRTA 1JFKA 1MXLC 1Y6WA 3JVTC 4C0JA 1WRKA 2KQYA 2K2FA 1WRZA 2K61A 1IIOA 3ZWHA 1JC2A 1DJGA 1W7JB 3BXKA 1L7ZA 4M2QA 2MJWB 2KI4C 4GNKB 2L0PA 2WOSA 2LMVA 2JT8A 4JKTA 1LA0A 1S6IA 1AJ4A 3NHTA 1CDPA 3DD4A 5J3XA 2O5GA 3KEVA 4INXA 4AOMA 5FYXA 3D0YA 3E3RA 3EG5B 1EH2A 4OKHA 2LE9B 3KO0A 1TTXA 1IQ3A 3DF0B 1SBJA 1GGWA 2F3ZA 1KSMA 4C0LA 1G8IA 3B88A 2NCOA 2WC6A 5I8NA 2FCEA 1K90D 1SR6B 2WNDA 2K60A 2QEBA 3K21A 3I5HB 5HKYA 2BBMA 1CTRA 3BUMB 1QVIZ 4OZDA 1OOJA 3NHIA 4Q04A 1K2HA 5CSIA 2KGRA 5G08A 4DS7A 3CZ1A 2L4HA 2L50A 4P5OE 1C3ZA 3PM2A 2H61C 1OW4A 4CLNA 2BE4A 1KWOB 2LVJA 2LLUA 3OGNA 1SCMB 3K1EA 2MHHA 2GGZA 2KBIA 3PFVA 5AEQA 1C3YA 1JUOA 2FOTA 3VRPA 2WC5A 1OZSA 1PULA 1Z4HA 1ODBA 1X02A 1W7IB 4I5NB 1QIVA 3DXLA 2WCFA 1NSHA 2ZKMX 2LANA 1KFXS 2ZRSA 3VRRA 5HL1A 4PHNA 2L5XB 1JF2A 3ICBA 1S6CA 1PVAA 1R6PA 3D0YB 1GGZA 2H61A 2K0JA 1YX8A 1B7TZ 5DKQA 2KAVA 1TIZA 1NCXA 1NUBA 2WCKA 4JQ0D 4MLWA 3RM1A 2IS9A 3PN7B 1CFCA 1C07A 3SS4A 1DJZA 1DEKA 3CR5X 4D1EA 5BPJA 1BF5A 1DJWA 1EXRA 1TNWA 2HETA 2K7CA 2BKIB 2Q4UA 1IJ5A 1AK8A 1GQMA 1J7OA 1TNPA 3NSIA 5AFPA 1YUUA 3B6XA 1S6JA 1DJHA 5EL2A 3VB1A 3AKBA 4ETOA 1XFZO 4CPVA 1B8RA 2P6BB 4I5KA 1Z2CB 5CPVA 4AQJA 3NSLA 1BR1B 1QS7A 1QV0A 2JTZA 1XVJA 3I5FB 5FI6A 2KNEA 2Y4QA 2GV5A 3O6BA 2LC5A 3L4LA 1N0YA 4PDZA 1S3PA 2YGUA 3KF9A 1KK7Y 1UUSA 3D73A 3IF7A 3GK4X 4FQOA 4QJ4B 5KSZA 1QLKA 2BECA 3EVUA 4CIDA 1TNXA 2F2PA 1K9PA 1R2UA 1XFWO 5CSNA 2LMUA 2CNPA 1IG5A 5D69A 3I5HC 4WQ2A 5HLVA 3O78A 1DMOA 2LLSA 4GUKA 4M2PA 1YUSA 2KHNA 3BYAA 2CCMA 1XFYO 4MRXA 1K95A 2LM5A 2JXLA 3CR2A 3LLEA 3UO9A 5I94A 2I7AA 1PALA 2PVBA 1TNQA 5HYDA 1KWOC 1OOFA 3BUWB 1S26D 3OP0A 1CDMA 1K9UA 2F33A 2I18A 4U8DA 3S0GA 3DVEA 4HREE 4ICBA 1XFVO 3DY9A 5DKRA 1OQPA 2QEOA 1F4QA 4GBAA 3GK2A 2WCHA 5KU1A 1DF0A 1MUXA 3IQQA 2JWWA 4NDBA 2L51A 3R1VA 3SS3A 1QV1A 2WC8A 3QMEA 2P71A 1CFDA 2LP2A 1QLSA 2K2AA 2MAZA 1CFFA 1NIWA 1SW8A 1MXEA 4HRGA 2LHIA 4P2YB 3L47A 1J1EA 2JU0A 4JPZB 4ORCB 1PVBA 1BMOA 1P28A 2K7DA 2LLTA 3S0AA 2KOTA 3PN7C 5JOLA 1QVIY 1M45A 1XFXO 2CBLA 1OOHA 4HSZA 2G9BA 4PALA 3O4XA 3ZNIA 1LA3A 4F7FA 1J7PA 3TDUA 4XJKA 1WLMA 4R1EA 3R1PA 1CB1A 1CNPA 1BT6A 3EK8A 1SK6D 4PE1A 4KYNA 3DVJA 1B4CA 1QATA 4PHKA 5PALA 2KGBC 4INWA 3CYZA 1IKUA 1SSEB 3TS5B 2M97A 5KTYA 3FS7A 1CDNA 5FI7A 1TWOA 2ZN8A 3CTNA 3CABA 4A4CA 2JT3A 4QJ5B 3FWBA 1XO5A 3BQ3A 1F4OA 1DF0B 2WORA 3BFBA 3D75A 3TUYB 3OB2B 1C7VA 3I5FC 5AANA 1JSAA 1B9AA 2QEVA 2AMIA 1NX1A 2I94A 3O2PA 5B8IB 1UHKA 1MQ1A 2FJUB 1B7TY 3TDIA 2ZNEA 1AUIB 1SNLA 1OMRA 3EKJA 4GAOA 3I5GB 2WCMA 3M0WA 1OSAA 1ZMZA 4M2OA 5I2OA 3EVVA 5DKNA 1DJXA 2E6WA 3R72A 1YR5A 4JD9A 2LV7A 4OCIA 4PE4A 2HF5A 2SCPA 2WCLA 3S0EA 2KI6C 1E8AA 1L2OB 2CXJA 3WNXB 1Y1UA 3C1VA 1N2DA 3BFHA 4XJKB 2PMYA 5IBWA 3IQOA 4YI9A 2BCAA 1YURA 5I2QA 1GJYA 3JTDB 4GGFA 2LCPA 2M0RA 4ORBB 3NSOA 1XA5A 2M29A 1XYDA 2ZN9A 5HKWA 2KFHA 1DTLA 1WRLA 2JXCA 5CSJA 1HQVA 3S0BA 3QRXA 2M3WA 1EG3A 2TN4A 1YUTA 2I2RE 2M49B 4HRHA 3OHMB 1IH0A 1JFJA 2LUXA 2LHLA 1FW4A 2LVKA 1ALWA 3CWGA 1A29A 1MF8B 2GTEA 1GM0A 1OMDA 2NLNA 1QX2A 2QPTA 4OR9B 1SCVA 1QASA 1K94A 2LVIA 3CR4X 1B1GA 1K96A 1LXFC 1IJ6A 2CTNA 5F6TA 3VROA 2JPOA 4CFRA 1AVSA 1NYAA 3BOWB 1YVHA 3AAJA 1AP4A 2ZFDA 2HQWA 1W9ZA 3GK1A 1QJTA 1AJ5A 1EG4A 1M46A 1VRKA 2L98A 4E68A 3V2LA 4BY4A 3D77A 1XFUO 2JOJA 4TNCA 2WCBA 4A4BA 5GQQC 3BUOB 3DVKA 2JZIA 3GOFA 3CZTX 3FIAA 4OV2A 2KFFA 4OVNF 4BY5A 2MLEC 2A4JA 4N1FA 5I2LA 1YTZC 5ER4X 1QTXA 2ISDA 1QX7A 2BL0B 3BJHA 3TS5C 2M1KB 1SL9A 2NCPA 2OS8B 4YI8A 1TOPA 2L2CA 1QX5B 1T14A 3SIAA 1F8HA 3L4AA 1OE9B 3SG6A 3RZSA 1ALVA 3TUYC 1YX7A 2BCXA 2KQ6A 3B87A 3LK0A 3LL8B 2MBXA 1NCYA 3LCPC 1U5IA 1OOGA 1NP8A 1A75A 1LVCD 4NDDA 1JF0A 1RK9A 1V1FA 3UNWA 1DC1A 1DGUA 2F3YA 2BE6A 2QEHA 2ZNDA 3I5GC 5HLOA 1B8LA 2R2IA 1BOCA 4PE7A 1PRWA 1CLBA 3CZ2A 3MSEB 3EKHA 3SG2A 4MEWA 3FE8A 4N5XA 2MA2A 1Q80A 1CMFA 1L2OC 4YGBB 1S5GZ 1V1GA 2H2KA 2DOQA 5JJGA 1KFUL 2KAXA 4DCKA 3HX4A 2JRFA 3Q8IA 1F70A 4CFQA 3DZTA 1UHJA 2KBMA 4DUQA 2G2BA 3S0DA 1QXPA 3JTDC 1UHNA 1KK7Z 2EC6B 4YGEB 2BAPA 3VGOA 1RROA 4NQGA 4F0ZB 2JC2A 1KFUS 1NPQA 1KQMB 3BUNB 5AXIA 1KQVA 1TRFA 1LKJA 1K93D 4GFTA 2PASA 4MZKA 2E30A 2EHBA 2K7OA 2PRUA 1FPWA 1U5IB 1Y0VH 4YRUA 1A75B 2HPSA 1BU3A 1KK8B 2AUCA 4MRYA 4XYNA 1UHIA 2LP3A 1RECA 3CLNA 3AAKA 2F2OA 3OX6A 1DJIA 2PALA 4FTGA 2JNXA 2L4IA 1NWDA 2Y5IA 1PK0D 1IRJA 4IJ7A 1WDCB 2JNFA 2FCDA 3F45A 3PJIA 2QDIA 2WCEA 2OTGB 1G4YR 4YGCB 2KFGA 2LUCA 4ZCVA 3O4YA 1PSBA 1TN4A 1SYMA 4N1GA 1BODA 3B7AA 2M8UA 1A2XA 2FJYA 3A4UB 2KI6D 3IVTA 2PSRA 3D76A 3KHEA 4GGFC 1LINA 4FQTA 1XFRA 3PALA 4IL1A 4MBEA 1RWYA 1DJYA 1ZUZA 1OOIX 2BL0C 3BOWA 3RLZA 1IQ5A 3SG4A 2OS8C 1F55A 2L5YA 1MWNA 4C0KA 1FF1A 1UP5A 1M31A 1CDLA 1QIWA 3LK1A 2M7LA 1ZFSA 1J7QA 1SL7A 3D10A 1B47A 2Y1NA 3FWCA 2SASA 5D7FA 4UPGA 1S36A 1ZOTB 3SJSA 4I5JA 1IGVA 1DT7B 1CMGA 1KFXL 3A8RA 3H4SE 4WRIA 4MVFA 2BKHB 2KYFA 3CS1A 3DYEA 2WCJA 1D1OA 1NCZA 1YRTB 2MRDA 2BNXA 1CLLA 2KAYA 3SIBA 1FI5A 2OPOA 3WXAA 3TZ1A 3I5IB 1B8CA 2JPTA 3WHUB 1CKKA 4GGNA 2NXQA 1H4BA 1EL4A 1SMGA 3OB1B 2L2EA 3PATA 2PQLA 2D8NA 1G33A 3S0FA 1FI6A 1SKTA 1A03A 3EK7A 4PT1A 2O60A 3FE6A 3JVTB 1BG1A 1NX0A 2M7NA 2EC6C 1M39A 1SL8A 1SY9A 2LAPA 2NZ0A 2QACA 3HCMA 4PHMA 1MHOA 1RJVA 3CDNA 5HKZA 3FE9A 4MN0A 2KI4B 1KQMC
chains in the Genus database with same CATH topology
3CGAA 2EGDA 3PSRA 5K89A 4GPLB 2BBNA 4I5LB 1AHRA 4YBHB 1K8UA 1DGVA 2VRGA 1KK8C 4MZLA 2K7BA 3SG7A 1IWQA 2HQ8A 4JWQA 5ER5A 1WLZA 3PM8A 1KCYA 2Q91A 1HT9A 1EJ3A 3EVRA 1BR4B 2V53A 1UURA 4L9MA 4YGAA 1S5GY 4PCWA 1WDCC 3WHTB 1S1EA 2LVVA 2KYCA 2CT9A 3DVMA 4MSPA 2OTGC 4PE0A 1N65A 5CSFA 1TCOB 4NDCA 3SG3A 2F8PA 2KSPA 4ZCUA 3TDZA 1FBVA 1MR8A 4USLA 4DIRA 1JBAA 1RTP1 5TNCA 1KSOA 3VRQA 4QJ3B 1CM1A 1XK4C 1C7WA 1K9KA 3AKAA 1DVIA 3VRNA 1NX2A 4YGDB 3NSKA 2K8MB 2RGIA 1UHHA 1BJFA 1YRUB 1Y1XA 1Y1AA 2M1UA 3KPXA 1J1DA 1ZACA 2AAOA 1SR6C 3BUXB 1OZOA 3OX5A 1F54A 1WY9A 3EK4A 4PHJA 2KDHA 1UWOA 4AQIA 1JWDA 1J7RA 1M63B 1A4PA 1SPYA 1CM4A 2M9GA 5AERA 3PLFB 1CLMA 4ORAB 4WQ3A 1XK4A 4MZJA 3DF0A 2B1UA 2COLB 3SG5A 1BLQA 4DRWA 1SCMC 1CFPA 2JTTA 1F71A 1TCFA 2LMTA 1YVLA 1PSRA 2GGMA 2JT0A 1J55A 2JULA 1RFJA 3I5IC 2BCBA 1NX3A 2LNKA 3NXAA 1H8BA 2JQ6A 2Y1MA 1SRAA 2MLFC 1OMVA 2ZRTA 1JFKA 1MXLC 1Y6WA 3JVTC 4C0JA 1WRKA 2KQYA 2K2FA 1WRZA 2K61A 3ZWHA 1JC2A 1DJGA 1W7JB 3BXKA 1L7ZA 4M2QA 2MJWB 2KI4C 4GNKB 2L0PA 2WOSA 2LMVA 2JT8A 1LA0A 1S6IA 1AJ4A 1CDPA 3DD4A 5J3XA 2O5GA 3KEVA 4AOMA 5FYXA 3D0YA 3E3RA 1EH2A 4OKHA 2LE9B 3KO0A 1TTXA 1IQ3A 3DF0B 1SBJA 1GGWA 2F3ZA 1KSMA 4C0LA 1G8IA 2NCOA 5I8NA 2FCEA 1K90D 1SR6B 2WNDA 3K21A 3I5HB 5HKYA 2BBMA 1CTRA 3BUMB 1QVIZ 1OOJA 4Q04A 1K2HA 5CSIA 2KGRA 5G08A 4DS7A 2L4HA 2L50A 4P5OE 2H61C 4CLNA 2BE4A 1KWOB 2LVJA 2LLUA 1SCMB 2MHHA 2GGZA 2KBIA 3PFVA 5AEQA 1JUOA 2FOTA 3VRPA 1OZSA 1PULA 1ODBA 1X02A 1W7IB 4I5NB 1QIVA 2WCFA 1NSHA 2ZKMX 2LANA 1KFXS 2ZRSA 3VRRA 4PHNA 2L5XB 1JF2A 3ICBA 1S6CA 1PVAA 1R6PA 3D0YB 1GGZA 2H61A 2K0JA 1YX8A 1B7TZ 5DKQA 2KAVA 1TIZA 1NCXA 1NUBA 4JQ0D 4MLWA 3RM1A 2IS9A 3PN7B 1CFCA 1C07A 1DJZA 3CR5X 4D1EA 5BPJA 1BF5A 1DJWA 1EXRA 1TNWA 2HETA 2K7CA 2BKIB 2Q4UA 1IJ5A 1AK8A 1GQMA 1J7OA 1TNPA 3NSIA 5AFPA 1YUUA 1S6JA 1DJHA 4ETOA 3AKBA 1XFZO 4CPVA 1B8RA 2P6BB 4I5KA 5CPVA 4AQJA 3NSLA 1BR1B 1QS7A 1QV0A 2JTZA 1XVJA 3I5FB 2KNEA 2Y4QA 2GV5A 3O6BA 2LC5A 1N0YA 4PDZA 1S3PA 3KF9A 1KK7Y 1UUSA 3IF7A 3GK4X 4FQOA 4QJ4B 5KSZA 1QLKA 2BECA 3EVUA 4CIDA 1TNXA 2F2PA 1K9PA 1R2UA 1XFWO 5CSNA 2LMUA 2CNPA 1IG5A 5D69A 3I5HC 4WQ2A 5HLVA 3O78A 1DMOA 2LLSA 4GUKA 4M2PA 1YUSA 2KHNA 3BYAA 2CCMA 1XFYO 4MRXA 1K95A 2LM5A 2JXLA 3CR2A 3LLEA 2I7AA 1PALA 2PVBA 1TNQA 5HYDA 1KWOC 3BUWB 4U8DA 1S26D 3OP0A 1CDMA 1K9UA 2F33A 2I18A 3DVEA 4HREE 4ICBA 1XFVO 5DKRA 1OQPA 1F4QA 4GBAA 3GK2A 5KU1A 1DF0A 1MUXA 3IQQA 2JWWA 4NDBA 2L51A 1QV1A 2WC8A 1CFDA 2LP2A 1QLSA 2K2AA 2MAZA 1CFFA 1NIWA 1SW8A 1MXEA 4HRGA 2LHIA 4P2YB 1J1EA 2JU0A 4JPZB 4ORCB 1PVBA 1BMOA 2K7DA 2LLTA 2KOTA 3PN7C 5JOLA 1QVIY 1M45A 1XFXO 2CBLA 4HSZA 2G9BA 4PALA 3ZNIA 1LA3A 1J7PA 3TDUA 4XJKA 1WLMA 4R1EA 1CB1A 1CNPA 1BT6A 3EK8A 1SK6D 4PE1A 3DVJA 1B4CA 1QATA 4PHKA 5PALA 2KGBC 1IKUA 3TS5B 5KTYA 2M97A 3FS7A 1CDNA 2ZN8A 3CTNA 4A4CA 2JT3A 4QJ5B 3FWBA 1XO5A 3BQ3A 1F4OA 1DF0B 2WORA 3TUYB 1C7VA 3OB2B 3I5FC 5AANA 1JSAA 1B9AA 3O2PA 2AMIA 1NX1A 2I94A 5B8IB 1UHKA 1MQ1A 2FJUB 1B7TY 3TDIA 2ZNEA 1AUIB 1SNLA 1OMRA 3EKJA 4GAOA 3I5GB 3M0WA 1OSAA 1ZMZA 4M2OA 5I2OA 3EVVA 5DKNA 1DJXA 2E6WA 1YR5A 2LV7A 4OCIA 4PE4A 2HF5A 2SCPA 2KI6C 1E8AA 1L2OB 2CXJA 3WNXB 1Y1UA 3C1VA 1N2DA 4XJKB 2PMYA 5IBWA 3IQOA 4YI9A 2BCAA 1YURA 5I2QA 1GJYA 3JTDB 4GGFA 2LCPA 2M0RA 4ORBB 3NSOA 1XA5A 2M29A 1XYDA 2ZN9A 5HKWA 2KFHA 1DTLA 1WRLA 2JXCA 5CSJA 1HQVA 3QRXA 2M3WA 1EG3A 2TN4A 1YUTA 2I2RE 2M49B 4HRHA 3OHMB 1IH0A 1JFJA 2LUXA 2LHLA 1FW4A 2LVKA 1ALWA 3CWGA 1A29A 1MF8B 1OMDA 2NLNA 1QX2A 2QPTA 4OR9B 1SCVA 1QASA 1K94A 2LVIA 3CR4X 1B1GA 1K96A 1LXFC 1IJ6A 2CTNA 5F6TA 3VROA 4CFRA 1AVSA 1NYAA 3BOWB 1YVHA 3AAJA 1AP4A 2ZFDA 2HQWA 3GK1A 1QJTA 1AJ5A 1EG4A 1M46A 1VRKA 2L98A 4E68A 4BY4A 1XFUO 2JOJA 4TNCA 2WCBA 4A4BA 5GQQC 3BUOB 3DVKA 2JZIA 3GOFA 3CZTX 3FIAA 4OV2A 2KFFA 4OVNF 4BY5A 2MLEC 2A4JA 4N1FA 5I2LA 1YTZC 5ER4X 1QTXA 2ISDA 1QX7A 2BL0B 3TS5C 2M1KB 1SL9A 2NCPA 2OS8B 4YI8A 1TOPA 1QX5B 3SIAA 1F8HA 1OE9B 3SG6A 1KQVA 1ALVA 3TUYC 1YX7A 2BCXA 2KQ6A 3LK0A 3LL8B 2MBXA 1NCYA 3LCPC 1U5IA 1NP8A 1A75A 1LVCD 4NDDA 1JF0A 1RK9A 1V1FA 1DGUA 2F3YA 2BE6A 2ZNDA 3I5GC 5HLOA 1B8LA 2R2IA 1BOCA 4PE7A 1PRWA 1CLBA 3MSEB 3EKHA 3SG2A 4MEWA 4N5XA 2MA2A 1Q80A 1CMFA 1L2OC 4YGBB 1S5GZ 1V1GA 2H2KA 2DOQA 5JJGA 1KFUL 2KAXA 4DCKA 3HX4A 2JRFA 1F70A 4CFQA 1UHJA 2KBMA 4DUQA 2G2BA 1QXPA 3JTDC 1UHNA 1KK7Z 2EC6B 4YGEB 3VGOA 1RROA 4NQGA 4F0ZB 2JC2A 1KFUS 1NPQA 1KQMB 3BUNB 5AXIA 1TRFA 1LKJA 1K93D 4GFTA 2PASA 4MZKA 2E30A 2EHBA 2K7OA 2PRUA 1FPWA 1U5IB 1Y0VH 4YRUA 1A75B 2HPSA 1BU3A 1KK8B 2AUCA 4MRYA 4XYNA 1UHIA 2LP3A 1RECA 3CLNA 3AAKA 2F2OA 3OX6A 1DJIA 2PALA 4FTGA 2JNXA 2L4IA 1NWDA 2Y5IA 1PK0D 1IRJA 1WDCB 2JNFA 2FCDA 3F45A 2WCEA 2OTGB 1G4YR 4YGCB 2KFGA 2LUCA 4ZCVA 3O4YA 1PSBA 1TN4A 1SYMA 4N1GA 1BODA 2M8UA 1A2XA 3A4UB 2KI6D 2PSRA 3KHEA 4GGFC 1LINA 3PALA 4IL1A 4MBEA 1RWYA 1DJYA 1ZUZA 2BL0C 3BOWA 3RLZA 1IQ5A 3SG4A 2OS8C 1F55A 1MWNA 4C0KA 1FF1A 1UP5A 1M31A 1CDLA 1QIWA 3LK1A 2M7LA 1ZFSA 1J7QA 1SL7A 3D10A 1B47A 2Y1NA 3FWCA 2SASA 5D7FA 4UPGA 1S36A 1ZOTB 3SJSA 4I5JA 1IGVA 1DT7B 1CMGA 1KFXL 3A8RA 3H4SE 4WRIA 4MVFA 2BKHB 2KYFA 3CS1A 1D1OA 1NCZA 1YRTB 2MRDA 1CLLA 2KAYA 3SIBA 1FI5A 2OPOA 3WXAA 3TZ1A 3I5IB 1B8CA 2JPTA 3WHUB 1CKKA 4GGNA 2NXQA 1H4BA 1EL4A 1SMGA 3OB1B 2L2EA 3PATA 2D8NA 1G33A 1FI6A 1SKTA 1A03A 3EK7A 2O60A 3JVTB 1BG1A 1NX0A 2M7NA 2EC6C 1M39A 1SL8A 1SY9A 2LAPA 2NZ0A 2QACA 3HCMA 4PHMA 1MHOA 1RJVA 5HKZA 4MN0A 2KI4B 1KQMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGA A;  2EGD A;  3PSR A;  5K89 A;  4GPL B;  2BBN A;  4I5L B;  1AHR A;  4YBH B;  1K8U A;  1DGV A;  2VRG A;  1KK8 C;  4MZL A;  2K7B A;  3SG7 A;  1IWQ A;  2HQ8 A;  4JWQ A;  5ER5 A;  1WLZ A;  3PM8 A;  1KCY A;  2Q91 A;  1HT9 A;  1EJ3 A;  3EVR A;  1BR4 B;  2V53 A;  1UUR A;  4L9M A;  4YGA A;  1S5G Y;  4PCW A;  1WDC C;  3WHT B;  1S1E A;  2LVV A;  2KYC A;  2CT9 A;  3DVM A;  4MSP A;  2OTG C;  4PE0 A;  1N65 A;  5CSF A;  1TCO B;  4NDC A;  3SG3 A;  2F8P A;  2KSP A;  4ZCU A;  3TDZ A;  1FBV A;  1MR8 A;  4USL A;  4DIR A;  1JBA A;  1RTP 1;  5TNC A;  1KSO A;  3VRQ A;  4QJ3 B;  1CM1 A;  1XK4 C;  1C7W A;  1K9K A;  3AKA A;  1DVI A;  3VRN A;  1NX2 A;  4YGD B;  3NSK A;  2K8M B;  2RGI A;  1UHH A;  1BJF A;  1YRU B;  1Y1X A;  1Y1A A;  2M1U A;  3KPX A;  1J1D A;  1ZAC A;  2AAO A;  1SR6 C;  3BUX B;  1OZO A;  3OX5 A;  1F54 A;  1WY9 A;  3EK4 A;  4PHJ A;  2KDH A;  1UWO A;  4AQI A;  1JWD A;  1J7R A;  1M63 B;  1A4P A;  1SPY A;  1CM4 A;  2M9G A;  5AER A;  3PLF B;  1CLM A;  4ORA B;  4WQ3 A;  1XK4 A;  4MZJ A;  3DF0 A;  2B1U A;  2COL B;  3SG5 A;  1BLQ A;  4DRW A;  1SCM C;  1CFP A;  2JTT A;  1F71 A;  1TCF A;  2LMT A;  1YVL A;  1PSR A;  2GGM A;  2JT0 A;  1J55 A;  2JUL A;  1RFJ A;  3I5I C;  2BCB A;  1NX3 A;  2LNK A;  3NXA A;  1H8B A;  2JQ6 A;  2Y1M A;  1SRA A;  2MLF C;  1OMV A;  2ZRT A;  1JFK A;  1MXL C;  1Y6W A;  3JVT C;  4C0J A;  1WRK A;  2KQY A;  2K2F A;  1WRZ A;  2K61 A;  3ZWH A;  1JC2 A;  1DJG A;  1W7J B;  3BXK A;  1L7Z A;  4M2Q A;  2MJW B;  2KI4 C;  4GNK B;  2L0P A;  2WOS A;  2LMV A;  2JT8 A;  1LA0 A;  1S6I A;  1AJ4 A;  1CDP A;  3DD4 A;  5J3X A;  2O5G A;  3KEV A;  4AOM A;  5FYX A;  3D0Y A;  3E3R A;  1EH2 A;  4OKH A;  2LE9 B;  3KO0 A;  1TTX A;  1IQ3 A;  3DF0 B;  1SBJ A;  1GGW A;  2F3Z A;  1KSM A;  4C0L A;  1G8I A;  2NCO A;  5I8N A;  2FCE A;  1K90 D;  1SR6 B;  2WND A;  3K21 A;  3I5H B;  5HKY A;  2BBM A;  1CTR A;  3BUM B;  1QVI Z;  1OOJ A;  4Q04 A;  1K2H A;  5CSI A;  2KGR A;  5G08 A;  4DS7 A;  2L4H A;  2L50 A;  4P5O E;  2H61 C;  4CLN A;  2BE4 A;  1KWO B;  2LVJ A;  2LLU A;  1SCM B;  2MHH A;  2GGZ A;  2KBI A;  3PFV A;  5AEQ A;  1JUO A;  2FOT A;  3VRP A;  1OZS A;  1PUL A;  1ODB A;  1X02 A;  1W7I B;  4I5N B;  1QIV A;  2WCF A;  1NSH A;  2ZKM X;  2LAN A;  1KFX S;  2ZRS A;  3VRR A;  4PHN A;  2L5X B;  1JF2 A;  3ICB A;  1S6C A;  1PVA A;  1R6P A;  3D0Y B;  1GGZ A;  2H61 A;  2K0J A;  1YX8 A;  1B7T Z;  5DKQ A;  2KAV A;  1TIZ A;  1NCX A;  1NUB A;  4JQ0 D;  4MLW A;  3RM1 A;  2IS9 A;  3PN7 B;  1CFC A;  1C07 A;  1DJZ A;  3CR5 X;  4D1E A;  5BPJ A;  1BF5 A;  1DJW A;  1EXR A;  1TNW A;  2HET A;  2K7C A;  2BKI B;  2Q4U A;  1IJ5 A;  1AK8 A;  1GQM A;  1J7O A;  1TNP A;  3NSI A;  5AFP A;  1YUU A;  1S6J A;  1DJH A;  4ETO A;  3AKB A;  1XFZ O;  4CPV A;  1B8R A;  2P6B B;  4I5K A;  5CPV A;  4AQJ A;  3NSL A;  1BR1 B;  1QS7 A;  1QV0 A;  2JTZ A;  1XVJ A;  3I5F B;  2KNE A;  2Y4Q A;  2GV5 A;  3O6B A;  2LC5 A;  1N0Y A;  4PDZ A;  1S3P A;  3KF9 A;  1KK7 Y;  1UUS A;  3IF7 A;  3GK4 X;  4FQO A;  4QJ4 B;  5KSZ A;  1QLK A;  2BEC A;  3EVU A;  4CID A;  1TNX A;  2F2P A;  1K9P A;  1R2U A;  1XFW O;  5CSN A;  2LMU A;  2CNP A;  1IG5 A;  5D69 A;  3I5H C;  4WQ2 A;  5HLV A;  3O78 A;  1DMO A;  2LLS A;  4GUK A;  4M2P A;  1YUS A;  2KHN A;  3BYA A;  2CCM A;  1XFY O;  4MRX A;  1K95 A;  2LM5 A;  2JXL A;  3CR2 A;  3LLE A;  2I7A A;  1PAL A;  2PVB A;  1TNQ A;  5HYD A;  1KWO C;  3BUW B;  4U8D A;  1S26 D;  3OP0 A;  1CDM A;  1K9U A;  2F33 A;  2I18 A;  3DVE A;  4HRE E;  4ICB A;  1XFV O;  5DKR A;  1OQP A;  1F4Q A;  4GBA A;  3GK2 A;  5KU1 A;  1DF0 A;  1MUX A;  3IQQ A;  2JWW A;  4NDB A;  2L51 A;  1QV1 A;  2WC8 A;  1CFD A;  2LP2 A;  1QLS A;  2K2A A;  2MAZ A;  1CFF A;  1NIW A;  1SW8 A;  1MXE A;  4HRG A;  2LHI A;  4P2Y B;  1J1E A;  2JU0 A;  4JPZ B;  4ORC B;  1PVB A;  1BMO A;  2K7D A;  2LLT A;  2KOT A;  3PN7 C;  5JOL A;  1QVI Y;  1M45 A;  1XFX O;  2CBL A;  4HSZ A;  2G9B A;  4PAL A;  3ZNI A;  1LA3 A;  1J7P A;  3TDU A;  4XJK A;  1WLM A;  4R1E A;  1CB1 A;  1CNP A;  1BT6 A;  3EK8 A;  1SK6 D;  4PE1 A;  3DVJ A;  1B4C A;  1QAT A;  4PHK A;  5PAL A;  2KGB C;  1IKU A;  3TS5 B;  5KTY A;  2M97 A;  3FS7 A;  1CDN A;  2ZN8 A;  3CTN A;  4A4C A;  2JT3 A;  4QJ5 B;  3FWB A;  1XO5 A;  3BQ3 A;  1F4O A;  1DF0 B;  2WOR A;  3TUY B;  1C7V A;  3OB2 B;  3I5F C;  5AAN A;  1JSA A;  1B9A A;  3O2P A;  2AMI A;  1NX1 A;  2I94 A;  5B8I B;  1UHK A;  1MQ1 A;  2FJU B;  1B7T Y;  3TDI A;  2ZNE A;  1AUI B;  1SNL A;  1OMR A;  3EKJ A;  4GAO A;  3I5G B;  3M0W A;  1OSA A;  1ZMZ A;  4M2O A;  5I2O A;  3EVV A;  5DKN A;  1DJX A;  2E6W A;  1YR5 A;  2LV7 A;  4OCI A;  4PE4 A;  2HF5 A;  2SCP A;  2KI6 C;  1E8A A;  1L2O B;  2CXJ A;  3WNX B;  1Y1U A;  3C1V A;  1N2D A;  4XJK B;  2PMY A;  5IBW A;  3IQO A;  4YI9 A;  2BCA A;  1YUR A;  5I2Q A;  1GJY A;  3JTD B;  4GGF A;  2LCP A;  2M0R A;  4ORB B;  3NSO A;  1XA5 A;  2M29 A;  1XYD A;  2ZN9 A;  5HKW A;  2KFH A;  1DTL A;  1WRL A;  2JXC A;  5CSJ A;  1HQV A;  3QRX A;  2M3W A;  1EG3 A;  2TN4 A;  1YUT A;  2I2R E;  2M49 B;  4HRH A;  3OHM B;  1IH0 A;  1JFJ A;  2LUX A;  2LHL A;  1FW4 A;  2LVK A;  1ALW A;  3CWG A;  1A29 A;  1MF8 B;  1OMD A;  2NLN A;  1QX2 A;  2QPT A;  4OR9 B;  1SCV A;  1QAS A;  1K94 A;  2LVI A;  3CR4 X;  1B1G A;  1K96 A;  1LXF C;  1IJ6 A;  2CTN A;  5F6T A;  3VRO A;  4CFR A;  1AVS A;  1NYA A;  3BOW B;  1YVH A;  3AAJ A;  1AP4 A;  2ZFD A;  2HQW A;  3GK1 A;  1QJT A;  1AJ5 A;  1EG4 A;  1M46 A;  1VRK A;  2L98 A;  4E68 A;  4BY4 A;  1XFU O;  2JOJ A;  4TNC A;  2WCB A;  4A4B A;  5GQQ C;  3BUO B;  3DVK A;  2JZI A;  3GOF A;  3CZT X;  3FIA A;  4OV2 A;  2KFF A;  4OVN F;  4BY5 A;  2MLE C;  2A4J A;  4N1F A;  5I2L A;  1YTZ C;  5ER4 X;  1QTX A;  2ISD A;  1QX7 A;  2BL0 B;  3TS5 C;  2M1K B;  1SL9 A;  2NCP A;  2OS8 B;  4YI8 A;  1TOP A;  1QX5 B;  3SIA A;  1F8H A;  1OE9 B;  3SG6 A;  1KQV A;  1ALV A;  3TUY C;  1YX7 A;  2BCX A;  2KQ6 A;  3LK0 A;  3LL8 B;  2MBX A;  1NCY A;  3LCP C;  1U5I A;  1NP8 A;  1A75 A;  1LVC D;  4NDD A;  1JF0 A;  1RK9 A;  1V1F A;  1DGU A;  2F3Y A;  2BE6 A;  2ZND A;  3I5G C;  5HLO A;  1B8L A;  2R2I A;  1BOC A;  4PE7 A;  1PRW A;  1CLB A;  3MSE B;  3EKH A;  3SG2 A;  4MEW A;  4N5X A;  2MA2 A;  1Q80 A;  1CMF A;  1L2O C;  4YGB B;  1S5G Z;  1V1G A;  2H2K A;  2DOQ A;  5JJG A;  1KFU L;  2KAX A;  4DCK A;  3HX4 A;  2JRF A;  1F70 A;  4CFQ A;  1UHJ A;  2KBM A;  4DUQ A;  2G2B A;  1QXP A;  3JTD C;  1UHN A;  1KK7 Z;  2EC6 B;  4YGE B;  3VGO A;  1RRO A;  4NQG A;  4F0Z B;  2JC2 A;  1KFU S;  1NPQ A;  1KQM B;  3BUN B;  5AXI A;  1TRF A;  1LKJ A;  1K93 D;  4GFT A;  2PAS A;  4MZK A;  2E30 A;  2EHB A;  2K7O A;  2PRU A;  1FPW A;  1U5I B;  1Y0V H;  4YRU A;  1A75 B;  2HPS A;  1BU3 A;  1KK8 B;  2AUC A;  4MRY A;  4XYN A;  1UHI A;  2LP3 A;  1REC A;  3CLN A;  3AAK A;  2F2O A;  3OX6 A;  1DJI A;  2PAL A;  4FTG A;  2JNX A;  2L4I A;  1NWD A;  2Y5I A;  1PK0 D;  1IRJ A;  1WDC B;  2JNF A;  2FCD A;  3F45 A;  2WCE A;  2OTG B;  1G4Y R;  4YGC B;  2KFG A;  2LUC A;  4ZCV A;  3O4Y A;  1PSB A;  1TN4 A;  1SYM A;  4N1G A;  1BOD A;  2M8U A;  1A2X A;  3A4U B;  2KI6 D;  2PSR A;  3KHE A;  4GGF C;  1LIN A;  3PAL A;  4IL1 A;  4MBE A;  1RWY A;  1DJY A;  1ZUZ A;  2BL0 C;  3BOW A;  3RLZ A;  1IQ5 A;  3SG4 A;  2OS8 C;  1F55 A;  1MWN A;  4C0K A;  1FF1 A;  1UP5 A;  1M31 A;  1CDL A;  1QIW A;  3LK1 A;  2M7L A;  1ZFS A;  1J7Q A;  1SL7 A;  3D10 A;  1B47 A;  2Y1N A;  3FWC A;  2SAS A;  5D7F A;  4UPG A;  1S36 A;  1ZOT B;  3SJS A;  4I5J A;  1IGV A;  1DT7 B;  1CMG A;  1KFX L;  3A8R A;  3H4S E;  4WRI A;  4MVF A;  2BKH B;  2KYF A;  3CS1 A;  1D1O A;  1NCZ A;  1YRT B;  2MRD A;  1CLL A;  2KAY A;  3SIB A;  1FI5 A;  2OPO A;  3WXA A;  3TZ1 A;  3I5I B;  1B8C A;  2JPT A;  3WHU B;  1CKK A;  4GGN A;  2NXQ A;  1H4B A;  1EL4 A;  1SMG A;  3OB1 B;  2L2E A;  3PAT A;  2D8N A;  1G33 A;  1FI6 A;  1SKT A;  1A03 A;  3EK7 A;  2O60 A;  3JVT B;  1BG1 A;  1NX0 A;  2M7N A;  2EC6 C;  1M39 A;  1SL8 A;  1SY9 A;  2LAP A;  2NZ0 A;  2QAC A;  3HCM A;  4PHM A;  1MHO A;  1RJV A;  5HKZ A;  4MN0 A;  2KI4 B;  1KQM C; 
#chains in the Genus database with same CATH topology
 3CGA A;  2EGD A;  3PSR A;  2KLD A;  4GPL B;  2BBN A;  5K89 A;  2P70 A;  3NGV A;  4I5L B;  1AHR A;  4YBH B;  5D3O A;  5FI2 A;  1K8U A;  1DGV A;  2VRG A;  3OBV A;  1KK8 C;  4MZL A;  2K7B A;  3SG7 A;  1IWQ A;  3B86 A;  2HQ8 A;  4JWQ A;  5ER5 A;  1WLZ A;  2KLE A;  3PM8 A;  1KCY A;  2Q91 A;  1HT9 A;  1EJ3 A;  3EVR A;  1BR4 B;  2V53 A;  1UUR A;  3BFA A;  4L9M A;  4YGA A;  1S5G Y;  4PCW A;  1WDC C;  1LS8 A;  3WHT B;  1S1E A;  2ERB A;  2LVV A;  2KYC A;  2CT9 A;  3DVM A;  4MSP A;  2OTG C;  3R1O A;  1N65 A;  4PE0 A;  5CSF A;  5DIC A;  1TCO B;  4NDC A;  3SG3 A;  2F8P A;  2KSP A;  4ZCU A;  3TDZ A;  1FBV A;  1MR8 A;  4USL A;  4DIR A;  1JBA A;  3SS5 A;  1RTP 1;  5TNC A;  1KSO A;  3VRQ A;  4QJ3 B;  1CM1 A;  1XK4 C;  1C7W A;  1K9K A;  2PYQ A;  1DVI A;  3AKA A;  3N7H A;  3VRN A;  1NX2 A;  4YGD B;  3NSK A;  2K8M B;  2RGI A;  1TUZ A;  1UHH A;  1BJF A;  1YRU B;  1Y1X A;  3D74 A;  1QWV A;  1Y1A A;  2M1U A;  1J1D A;  1ZAC A;  2AAO A;  3KPX A;  1SR6 C;  3BUX B;  1OZO A;  3OX5 A;  1F54 A;  1WY9 A;  3EK4 A;  1ORG A;  4PHJ A;  2KDH A;  1UWO A;  4AQI A;  2KPH A;  1DQE A;  1TUJ A;  2H8V A;  1JWD A;  1J7R A;  1M63 B;  1A4P A;  1SPY A;  1CM4 A;  2M9G A;  5AER A;  3PLF B;  1CLM A;  4ORA B;  4WQ3 A;  1XK4 A;  4MZJ A;  3DF0 A;  2B1U A;  2COL B;  3SG5 A;  1BLQ A;  4DRW A;  1SCM C;  1CFP A;  2JTT A;  1F71 A;  1TCF A;  2LMT A;  1DEL A;  1YVL A;  1PSR A;  2GGM A;  2JT0 A;  1J55 A;  2JUL A;  1RFJ A;  3I5I C;  2BCB A;  1NX3 A;  2LNK A;  3NXA A;  1H8B A;  2JQ6 A;  3D78 A;  2Y1M A;  1SRA A;  2MLF C;  3CZ0 A;  1OMV A;  2ZRT A;  1JFK A;  1MXL C;  1Y6W A;  3JVT C;  4C0J A;  1WRK A;  2KQY A;  2K2F A;  1WRZ A;  2K61 A;  1IIO A;  3ZWH A;  1JC2 A;  1DJG A;  1W7J B;  3BXK A;  1L7Z A;  4M2Q A;  2MJW B;  2KI4 C;  4GNK B;  2L0P A;  2WOS A;  2LMV A;  2JT8 A;  4JKT A;  1LA0 A;  1S6I A;  1AJ4 A;  3NHT A;  1CDP A;  3DD4 A;  5J3X A;  2O5G A;  3KEV A;  4INX A;  4AOM A;  5FYX A;  3D0Y A;  3E3R A;  3EG5 B;  1EH2 A;  4OKH A;  2LE9 B;  3KO0 A;  1TTX A;  1IQ3 A;  3DF0 B;  1SBJ A;  1GGW A;  2F3Z A;  1KSM A;  4C0L A;  1G8I A;  3B88 A;  2NCO A;  2WC6 A;  5I8N A;  2FCE A;  1K90 D;  1SR6 B;  2WND A;  2K60 A;  2QEB A;  3K21 A;  3I5H B;  5HKY A;  2BBM A;  1CTR A;  3BUM B;  1QVI Z;  4OZD A;  1OOJ A;  3NHI A;  4Q04 A;  1K2H A;  5CSI A;  2KGR A;  5G08 A;  4DS7 A;  3CZ1 A;  2L4H A;  2L50 A;  4P5O E;  1C3Z A;  3PM2 A;  2H61 C;  1OW4 A;  4CLN A;  2BE4 A;  1KWO B;  2LVJ A;  2LLU A;  3OGN A;  1SCM B;  3K1E A;  2MHH A;  2GGZ A;  2KBI A;  3PFV A;  5AEQ A;  1C3Y A;  1JUO A;  2FOT A;  3VRP A;  2WC5 A;  1OZS A;  1PUL A;  1Z4H A;  1ODB A;  1X02 A;  1W7I B;  4I5N B;  1QIV A;  3DXL A;  2WCF A;  1NSH A;  2ZKM X;  2LAN A;  1KFX S;  2ZRS A;  3VRR A;  5HL1 A;  4PHN A;  2L5X B;  1JF2 A;  3ICB A;  1S6C A;  1PVA A;  1R6P A;  3D0Y B;  1GGZ A;  2H61 A;  2K0J A;  1YX8 A;  1B7T Z;  5DKQ A;  2KAV A;  1TIZ A;  1NCX A;  1NUB A;  2WCK A;  4JQ0 D;  4MLW A;  3RM1 A;  2IS9 A;  3PN7 B;  1CFC A;  1C07 A;  3SS4 A;  1DJZ A;  1DEK A;  3CR5 X;  4D1E A;  5BPJ A;  1BF5 A;  1DJW A;  1EXR A;  1TNW A;  2HET A;  2K7C A;  2BKI B;  2Q4U A;  1IJ5 A;  1AK8 A;  1GQM A;  1J7O A;  1TNP A;  3NSI A;  5AFP A;  1YUU A;  3B6X A;  1S6J A;  1DJH A;  5EL2 A;  3VB1 A;  3AKB A;  4ETO A;  1XFZ O;  4CPV A;  1B8R A;  2P6B B;  4I5K A;  1Z2C B;  5CPV A;  4AQJ A;  3NSL A;  1BR1 B;  1QS7 A;  1QV0 A;  2JTZ A;  1XVJ A;  3I5F B;  5FI6 A;  2KNE A;  2Y4Q A;  2GV5 A;  3O6B A;  2LC5 A;  3L4L A;  1N0Y A;  4PDZ A;  1S3P A;  2YGU A;  3KF9 A;  1KK7 Y;  1UUS A;  3D73 A;  3IF7 A;  3GK4 X;  4FQO A;  4QJ4 B;  5KSZ A;  1QLK A;  2BEC A;  3EVU A;  4CID A;  1TNX A;  2F2P A;  1K9P A;  1R2U A;  1XFW O;  5CSN A;  2LMU A;  2CNP A;  1IG5 A;  5D69 A;  3I5H C;  4WQ2 A;  5HLV A;  3O78 A;  1DMO A;  2LLS A;  4GUK A;  4M2P A;  1YUS A;  2KHN A;  3BYA A;  2CCM A;  1XFY O;  4MRX A;  1K95 A;  2LM5 A;  2JXL A;  3CR2 A;  3LLE A;  3UO9 A;  5I94 A;  2I7A A;  1PAL A;  2PVB A;  1TNQ A;  5HYD A;  1KWO C;  1OOF A;  3BUW B;  1S26 D;  3OP0 A;  1CDM A;  1K9U A;  2F33 A;  2I18 A;  4U8D A;  3S0G A;  3DVE A;  4HRE E;  4ICB A;  1XFV O;  3DY9 A;  5DKR A;  1OQP A;  2QEO A;  1F4Q A;  4GBA A;  3GK2 A;  2WCH A;  5KU1 A;  1DF0 A;  1MUX A;  3IQQ A;  2JWW A;  4NDB A;  2L51 A;  3R1V A;  3SS3 A;  1QV1 A;  2WC8 A;  3QME A;  2P71 A;  1CFD A;  2LP2 A;  1QLS A;  2K2A A;  2MAZ A;  1CFF A;  1NIW A;  1SW8 A;  1MXE A;  4HRG A;  2LHI A;  4P2Y B;  3L47 A;  1J1E A;  2JU0 A;  4JPZ B;  4ORC B;  1PVB A;  1BMO A;  1P28 A;  2K7D A;  2LLT A;  3S0A A;  2KOT A;  3PN7 C;  5JOL A;  1QVI Y;  1M45 A;  1XFX O;  2CBL A;  1OOH A;  4HSZ A;  2G9B A;  4PAL A;  3O4X A;  3ZNI A;  1LA3 A;  4F7F A;  1J7P A;  3TDU A;  4XJK A;  1WLM A;  4R1E A;  3R1P A;  1CB1 A;  1CNP A;  1BT6 A;  3EK8 A;  1SK6 D;  4PE1 A;  4KYN A;  3DVJ A;  1B4C A;  1QAT A;  4PHK A;  5PAL A;  2KGB C;  4INW A;  3CYZ A;  1IKU A;  1SSE B;  3TS5 B;  2M97 A;  5KTY A;  3FS7 A;  1CDN A;  5FI7 A;  1TWO A;  2ZN8 A;  3CTN A;  3CAB A;  4A4C A;  2JT3 A;  4QJ5 B;  3FWB A;  1XO5 A;  3BQ3 A;  1F4O A;  1DF0 B;  2WOR A;  3BFB A;  3D75 A;  3TUY B;  3OB2 B;  1C7V A;  3I5F C;  5AAN A;  1JSA A;  1B9A A;  2QEV A;  2AMI A;  1NX1 A;  2I94 A;  3O2P A;  5B8I B;  1UHK A;  1MQ1 A;  2FJU B;  1B7T Y;  3TDI A;  2ZNE A;  1AUI B;  1SNL A;  1OMR A;  3EKJ A;  4GAO A;  3I5G B;  2WCM A;  3M0W A;  1OSA A;  1ZMZ A;  4M2O A;  5I2O A;  3EVV A;  5DKN A;  1DJX A;  2E6W A;  3R72 A;  1YR5 A;  4JD9 A;  2LV7 A;  4OCI A;  4PE4 A;  2HF5 A;  2SCP A;  2WCL A;  3S0E A;  2KI6 C;  1E8A A;  1L2O B;  2CXJ A;  3WNX B;  1Y1U A;  3C1V A;  1N2D A;  3BFH A;  4XJK B;  2PMY A;  5IBW A;  3IQO A;  4YI9 A;  2BCA A;  1YUR A;  5I2Q A;  1GJY A;  3JTD B;  4GGF A;  2LCP A;  2M0R A;  4ORB B;  3NSO A;  1XA5 A;  2M29 A;  1XYD A;  2ZN9 A;  5HKW A;  2KFH A;  1DTL A;  1WRL A;  2JXC A;  5CSJ A;  1HQV A;  3S0B A;  3QRX A;  2M3W A;  1EG3 A;  2TN4 A;  1YUT A;  2I2R E;  2M49 B;  4HRH A;  3OHM B;  1IH0 A;  1JFJ A;  2LUX A;  2LHL A;  1FW4 A;  2LVK A;  1ALW A;  3CWG A;  1A29 A;  1MF8 B;  2GTE A;  1GM0 A;  1OMD A;  2NLN A;  1QX2 A;  2QPT A;  4OR9 B;  1SCV A;  1QAS A;  1K94 A;  2LVI A;  3CR4 X;  1B1G A;  1K96 A;  1LXF C;  1IJ6 A;  2CTN A;  5F6T A;  3VRO A;  2JPO A;  4CFR A;  1AVS A;  1NYA A;  3BOW B;  1YVH A;  3AAJ A;  1AP4 A;  2ZFD A;  2HQW A;  1W9Z A;  3GK1 A;  1QJT A;  1AJ5 A;  1EG4 A;  1M46 A;  1VRK A;  2L98 A;  4E68 A;  3V2L A;  4BY4 A;  3D77 A;  1XFU O;  2JOJ A;  4TNC A;  2WCB A;  4A4B A;  5GQQ C;  3BUO B;  3DVK A;  2JZI A;  3GOF A;  3CZT X;  3FIA A;  4OV2 A;  2KFF A;  4OVN F;  4BY5 A;  2MLE C;  2A4J A;  4N1F A;  5I2L A;  1YTZ C;  5ER4 X;  1QTX A;  2ISD A;  1QX7 A;  2BL0 B;  3BJH A;  3TS5 C;  2M1K B;  1SL9 A;  2NCP A;  2OS8 B;  4YI8 A;  1TOP A;  2L2C A;  1QX5 B;  1T14 A;  3SIA A;  1F8H A;  3L4A A;  1OE9 B;  3SG6 A;  3RZS A;  1ALV A;  3TUY C;  1YX7 A;  2BCX A;  2KQ6 A;  3B87 A;  3LK0 A;  3LL8 B;  2MBX A;  1NCY A;  3LCP C;  1U5I A;  1OOG A;  1NP8 A;  1A75 A;  1LVC D;  4NDD A;  1JF0 A;  1RK9 A;  1V1F A;  3UNW A;  1DC1 A;  1DGU A;  2F3Y A;  2BE6 A;  2QEH A;  2ZND A;  3I5G C;  5HLO A;  1B8L A;  2R2I A;  1BOC A;  4PE7 A;  1PRW A;  1CLB A;  3CZ2 A;  3MSE B;  3EKH A;  3SG2 A;  4MEW A;  3FE8 A;  4N5X A;  2MA2 A;  1Q80 A;  1CMF A;  1L2O C;  4YGB B;  1S5G Z;  1V1G A;  2H2K A;  2DOQ A;  5JJG A;  1KFU L;  2KAX A;  4DCK A;  3HX4 A;  2JRF A;  3Q8I A;  1F70 A;  4CFQ A;  3DZT A;  1UHJ A;  2KBM A;  4DUQ A;  2G2B A;  3S0D A;  1QXP A;  3JTD C;  1UHN A;  1KK7 Z;  2EC6 B;  4YGE B;  2BAP A;  3VGO A;  1RRO A;  4NQG A;  4F0Z B;  2JC2 A;  1KFU S;  1NPQ A;  1KQM B;  3BUN B;  5AXI A;  1KQV A;  1TRF A;  1LKJ A;  1K93 D;  4GFT A;  2PAS A;  4MZK A;  2E30 A;  2EHB A;  2K7O A;  2PRU A;  1FPW A;  1U5I B;  1Y0V H;  4YRU A;  1A75 B;  2HPS A;  1BU3 A;  1KK8 B;  2AUC A;  4MRY A;  4XYN A;  1UHI A;  2LP3 A;  1REC A;  3CLN A;  3AAK A;  2F2O A;  3OX6 A;  1DJI A;  2PAL A;  4FTG A;  2JNX A;  2L4I A;  1NWD A;  2Y5I A;  1PK0 D;  1IRJ A;  4IJ7 A;  1WDC B;  2JNF A;  2FCD A;  3F45 A;  3PJI A;  2QDI A;  2WCE A;  2OTG B;  1G4Y R;  4YGC B;  2KFG A;  2LUC A;  4ZCV A;  3O4Y A;  1PSB A;  1TN4 A;  1SYM A;  4N1G A;  1BOD A;  3B7A A;  2M8U A;  1A2X A;  2FJY A;  3A4U B;  2KI6 D;  3IVT A;  2PSR A;  3D76 A;  3KHE A;  4GGF C;  1LIN A;  4FQT A;  1XFR A;  3PAL A;  4IL1 A;  4MBE A;  1RWY A;  1DJY A;  1ZUZ A;  1OOI X;  2BL0 C;  3BOW A;  3RLZ A;  1IQ5 A;  3SG4 A;  2OS8 C;  1F55 A;  2L5Y A;  1MWN A;  4C0K A;  1FF1 A;  1UP5 A;  1M31 A;  1CDL A;  1QIW A;  3LK1 A;  2M7L A;  1ZFS A;  1J7Q A;  1SL7 A;  3D10 A;  1B47 A;  2Y1N A;  3FWC A;  2SAS A;  5D7F A;  4UPG A;  1S36 A;  1ZOT B;  3SJS A;  4I5J A;  1IGV A;  1DT7 B;  1CMG A;  1KFX L;  3A8R A;  3H4S E;  4WRI A;  4MVF A;  2BKH B;  2KYF A;  3CS1 A;  3DYE A;  2WCJ A;  1D1O A;  1NCZ A;  1YRT B;  2MRD A;  2BNX A;  1CLL A;  2KAY A;  3SIB A;  1FI5 A;  2OPO A;  3WXA A;  3TZ1 A;  3I5I B;  1B8C A;  2JPT A;  3WHU B;  1CKK A;  4GGN A;  2NXQ A;  1H4B A;  1EL4 A;  1SMG A;  3OB1 B;  2L2E A;  3PAT A;  2PQL A;  2D8N A;  1G33 A;  3S0F A;  1FI6 A;  1SKT A;  1A03 A;  3EK7 A;  4PT1 A;  2O60 A;  3FE6 A;  3JVT B;  1BG1 A;  1NX0 A;  2M7N A;  2EC6 C;  1M39 A;  1SL8 A;  1SY9 A;  2LAP A;  2NZ0 A;  2QAC A;  3HCM A;  4PHM A;  1MHO A;  1RJV A;  3CDN A;  5HKZ A;  3FE9 A;  4MN0 A;  2KI4 B;  1KQM C; 
#chains in the Genus database with same CATH homology
 3CGA A;  2EGD A;  3PSR A;  5K89 A;  4GPL B;  2BBN A;  4I5L B;  1AHR A;  4YBH B;  1K8U A;  1DGV A;  2VRG A;  1KK8 C;  4MZL A;  2K7B A;  3SG7 A;  1IWQ A;  2HQ8 A;  4JWQ A;  5ER5 A;  1WLZ A;  3PM8 A;  1KCY A;  2Q91 A;  1HT9 A;  1EJ3 A;  3EVR A;  1BR4 B;  2V53 A;  1UUR A;  4L9M A;  4YGA A;  1S5G Y;  4PCW A;  1WDC C;  3WHT B;  1S1E A;  2LVV A;  2KYC A;  2CT9 A;  3DVM A;  4MSP A;  2OTG C;  4PE0 A;  1N65 A;  5CSF A;  1TCO B;  4NDC A;  3SG3 A;  2F8P A;  2KSP A;  4ZCU A;  3TDZ A;  1FBV A;  1MR8 A;  4USL A;  4DIR A;  1JBA A;  1RTP 1;  5TNC A;  1KSO A;  3VRQ A;  4QJ3 B;  1CM1 A;  1XK4 C;  1C7W A;  1K9K A;  3AKA A;  1DVI A;  3VRN A;  1NX2 A;  4YGD B;  3NSK A;  2K8M B;  2RGI A;  1UHH A;  1BJF A;  1YRU B;  1Y1X A;  1Y1A A;  2M1U A;  3KPX A;  1J1D A;  1ZAC A;  2AAO A;  1SR6 C;  3BUX B;  1OZO A;  3OX5 A;  1F54 A;  1WY9 A;  3EK4 A;  4PHJ A;  2KDH A;  1UWO A;  4AQI A;  1JWD A;  1J7R A;  1M63 B;  1A4P A;  1SPY A;  1CM4 A;  2M9G A;  5AER A;  3PLF B;  1CLM A;  4ORA B;  4WQ3 A;  1XK4 A;  4MZJ A;  3DF0 A;  2B1U A;  2COL B;  3SG5 A;  1BLQ A;  4DRW A;  1SCM C;  1CFP A;  2JTT A;  1F71 A;  1TCF A;  2LMT A;  1YVL A;  1PSR A;  2GGM A;  2JT0 A;  1J55 A;  2JUL A;  1RFJ A;  3I5I C;  2BCB A;  1NX3 A;  2LNK A;  3NXA A;  1H8B A;  2JQ6 A;  2Y1M A;  1SRA A;  2MLF C;  1OMV A;  2ZRT A;  1JFK A;  1MXL C;  1Y6W A;  3JVT C;  4C0J A;  1WRK A;  2KQY A;  2K2F A;  1WRZ A;  2K61 A;  3ZWH A;  1JC2 A;  1DJG A;  1W7J B;  3BXK A;  1L7Z A;  4M2Q A;  2MJW B;  2KI4 C;  4GNK B;  2L0P A;  2WOS A;  2LMV A;  2JT8 A;  1LA0 A;  1S6I A;  1AJ4 A;  1CDP A;  3DD4 A;  5J3X A;  2O5G A;  3KEV A;  4AOM A;  5FYX A;  3D0Y A;  3E3R A;  1EH2 A;  4OKH A;  2LE9 B;  3KO0 A;  1TTX A;  1IQ3 A;  3DF0 B;  1SBJ A;  1GGW A;  2F3Z A;  1KSM A;  4C0L A;  1G8I A;  2NCO A;  5I8N A;  2FCE A;  1K90 D;  1SR6 B;  2WND A;  3K21 A;  3I5H B;  5HKY A;  2BBM A;  1CTR A;  3BUM B;  1QVI Z;  1OOJ A;  4Q04 A;  1K2H A;  5CSI A;  2KGR A;  5G08 A;  4DS7 A;  2L4H A;  2L50 A;  4P5O E;  2H61 C;  4CLN A;  2BE4 A;  1KWO B;  2LVJ A;  2LLU A;  1SCM B;  2MHH A;  2GGZ A;  2KBI A;  3PFV A;  5AEQ A;  1JUO A;  2FOT A;  3VRP A;  1OZS A;  1PUL A;  1ODB A;  1X02 A;  1W7I B;  4I5N B;  1QIV A;  2WCF A;  1NSH A;  2ZKM X;  2LAN A;  1KFX S;  2ZRS A;  3VRR A;  4PHN A;  2L5X B;  1JF2 A;  3ICB A;  1S6C A;  1PVA A;  1R6P A;  3D0Y B;  1GGZ A;  2H61 A;  2K0J A;  1YX8 A;  1B7T Z;  5DKQ A;  2KAV A;  1TIZ A;  1NCX A;  1NUB A;  4JQ0 D;  4MLW A;  3RM1 A;  2IS9 A;  3PN7 B;  1CFC A;  1C07 A;  1DJZ A;  3CR5 X;  4D1E A;  5BPJ A;  1BF5 A;  1DJW A;  1EXR A;  1TNW A;  2HET A;  2K7C A;  2BKI B;  2Q4U A;  1IJ5 A;  1AK8 A;  1GQM A;  1J7O A;  1TNP A;  3NSI A;  5AFP A;  1YUU A;  1S6J A;  1DJH A;  4ETO A;  3AKB A;  1XFZ O;  4CPV A;  1B8R A;  2P6B B;  4I5K A;  5CPV A;  4AQJ A;  3NSL A;  1BR1 B;  1QS7 A;  1QV0 A;  2JTZ A;  1XVJ A;  3I5F B;  2KNE A;  2Y4Q A;  2GV5 A;  3O6B A;  2LC5 A;  1N0Y A;  4PDZ A;  1S3P A;  3KF9 A;  1KK7 Y;  1UUS A;  3IF7 A;  3GK4 X;  4FQO A;  4QJ4 B;  5KSZ A;  1QLK A;  2BEC A;  3EVU A;  4CID A;  1TNX A;  2F2P A;  1K9P A;  1R2U A;  1XFW O;  5CSN A;  2LMU A;  2CNP A;  1IG5 A;  5D69 A;  3I5H C;  4WQ2 A;  5HLV A;  3O78 A;  1DMO A;  2LLS A;  4GUK A;  4M2P A;  1YUS A;  2KHN A;  3BYA A;  2CCM A;  1XFY O;  4MRX A;  1K95 A;  2LM5 A;  2JXL A;  3CR2 A;  3LLE A;  2I7A A;  1PAL A;  2PVB A;  1TNQ A;  5HYD A;  1KWO C;  3BUW B;  4U8D A;  1S26 D;  3OP0 A;  1CDM A;  1K9U A;  2F33 A;  2I18 A;  3DVE A;  4HRE E;  4ICB A;  1XFV O;  5DKR A;  1OQP A;  1F4Q A;  4GBA A;  3GK2 A;  5KU1 A;  1DF0 A;  1MUX A;  3IQQ A;  2JWW A;  4NDB A;  2L51 A;  1QV1 A;  2WC8 A;  1CFD A;  2LP2 A;  1QLS A;  2K2A A;  2MAZ A;  1CFF A;  1NIW A;  1SW8 A;  1MXE A;  4HRG A;  2LHI A;  4P2Y B;  1J1E A;  2JU0 A;  4JPZ B;  4ORC B;  1PVB A;  1BMO A;  2K7D A;  2LLT A;  2KOT A;  3PN7 C;  5JOL A;  1QVI Y;  1M45 A;  1XFX O;  2CBL A;  4HSZ A;  2G9B A;  4PAL A;  3ZNI A;  1LA3 A;  1J7P A;  3TDU A;  4XJK A;  1WLM A;  4R1E A;  1CB1 A;  1CNP A;  1BT6 A;  3EK8 A;  1SK6 D;  4PE1 A;  3DVJ A;  1B4C A;  1QAT A;  4PHK A;  5PAL A;  2KGB C;  1IKU A;  3TS5 B;  5KTY A;  2M97 A;  3FS7 A;  1CDN A;  2ZN8 A;  3CTN A;  4A4C A;  2JT3 A;  4QJ5 B;  3FWB A;  1XO5 A;  3BQ3 A;  1F4O A;  1DF0 B;  2WOR A;  3TUY B;  1C7V A;  3OB2 B;  3I5F C;  5AAN A;  1JSA A;  1B9A A;  3O2P A;  2AMI A;  1NX1 A;  2I94 A;  5B8I B;  1UHK A;  1MQ1 A;  2FJU B;  1B7T Y;  3TDI A;  2ZNE A;  1AUI B;  1SNL A;  1OMR A;  3EKJ A;  4GAO A;  3I5G B;  3M0W A;  1OSA A;  1ZMZ A;  4M2O A;  5I2O A;  3EVV A;  5DKN A;  1DJX A;  2E6W A;  1YR5 A;  2LV7 A;  4OCI A;  4PE4 A;  2HF5 A;  2SCP A;  2KI6 C;  1E8A A;  1L2O B;  2CXJ A;  3WNX B;  1Y1U A;  3C1V A;  1N2D A;  4XJK B;  2PMY A;  5IBW A;  3IQO A;  4YI9 A;  2BCA A;  1YUR A;  5I2Q A;  1GJY A;  3JTD B;  4GGF A;  2LCP A;  2M0R A;  4ORB B;  3NSO A;  1XA5 A;  2M29 A;  1XYD A;  2ZN9 A;  5HKW A;  2KFH A;  1DTL A;  1WRL A;  2JXC A;  5CSJ A;  1HQV A;  3QRX A;  2M3W A;  1EG3 A;  2TN4 A;  1YUT A;  2I2R E;  2M49 B;  4HRH A;  3OHM B;  1IH0 A;  1JFJ A;  2LUX A;  2LHL A;  1FW4 A;  2LVK A;  1ALW A;  3CWG A;  1A29 A;  1MF8 B;  1OMD A;  2NLN A;  1QX2 A;  2QPT A;  4OR9 B;  1SCV A;  1QAS A;  1K94 A;  2LVI A;  3CR4 X;  1B1G A;  1K96 A;  1LXF C;  1IJ6 A;  2CTN A;  5F6T A;  3VRO A;  4CFR A;  1AVS A;  1NYA A;  3BOW B;  1YVH A;  3AAJ A;  1AP4 A;  2ZFD A;  2HQW A;  3GK1 A;  1QJT A;  1AJ5 A;  1EG4 A;  1M46 A;  1VRK A;  2L98 A;  4E68 A;  4BY4 A;  1XFU O;  2JOJ A;  4TNC A;  2WCB A;  4A4B A;  5GQQ C;  3BUO B;  3DVK A;  2JZI A;  3GOF A;  3CZT X;  3FIA A;  4OV2 A;  2KFF A;  4OVN F;  4BY5 A;  2MLE C;  2A4J A;  4N1F A;  5I2L A;  1YTZ C;  5ER4 X;  1QTX A;  2ISD A;  1QX7 A;  2BL0 B;  3TS5 C;  2M1K B;  1SL9 A;  2NCP A;  2OS8 B;  4YI8 A;  1TOP A;  1QX5 B;  3SIA A;  1F8H A;  1OE9 B;  3SG6 A;  1KQV A;  1ALV A;  3TUY C;  1YX7 A;  2BCX A;  2KQ6 A;  3LK0 A;  3LL8 B;  2MBX A;  1NCY A;  3LCP C;  1U5I A;  1NP8 A;  1A75 A;  1LVC D;  4NDD A;  1JF0 A;  1RK9 A;  1V1F A;  1DGU A;  2F3Y A;  2BE6 A;  2ZND A;  3I5G C;  5HLO A;  1B8L A;  2R2I A;  1BOC A;  4PE7 A;  1PRW A;  1CLB A;  3MSE B;  3EKH A;  3SG2 A;  4MEW A;  4N5X A;  2MA2 A;  1Q80 A;  1CMF A;  1L2O C;  4YGB B;  1S5G Z;  1V1G A;  2H2K A;  2DOQ A;  5JJG A;  1KFU L;  2KAX A;  4DCK A;  3HX4 A;  2JRF A;  1F70 A;  4CFQ A;  1UHJ A;  2KBM A;  4DUQ A;  2G2B A;  1QXP A;  3JTD C;  1UHN A;  1KK7 Z;  2EC6 B;  4YGE B;  3VGO A;  1RRO A;  4NQG A;  4F0Z B;  2JC2 A;  1KFU S;  1NPQ A;  1KQM B;  3BUN B;  5AXI A;  1TRF A;  1LKJ A;  1K93 D;  4GFT A;  2PAS A;  4MZK A;  2E30 A;  2EHB A;  2K7O A;  2PRU A;  1FPW A;  1U5I B;  1Y0V H;  4YRU A;  1A75 B;  2HPS A;  1BU3 A;  1KK8 B;  2AUC A;  4MRY A;  4XYN A;  1UHI A;  2LP3 A;  1REC A;  3CLN A;  3AAK A;  2F2O A;  3OX6 A;  1DJI A;  2PAL A;  4FTG A;  2JNX A;  2L4I A;  1NWD A;  2Y5I A;  1PK0 D;  1IRJ A;  1WDC B;  2JNF A;  2FCD A;  3F45 A;  2WCE A;  2OTG B;  1G4Y R;  4YGC B;  2KFG A;  2LUC A;  4ZCV A;  3O4Y A;  1PSB A;  1TN4 A;  1SYM A;  4N1G A;  1BOD A;  2M8U A;  1A2X A;  3A4U B;  2KI6 D;  2PSR A;  3KHE A;  4GGF C;  1LIN A;  3PAL A;  4IL1 A;  4MBE A;  1RWY A;  1DJY A;  1ZUZ A;  2BL0 C;  3BOW A;  3RLZ A;  1IQ5 A;  3SG4 A;  2OS8 C;  1F55 A;  1MWN A;  4C0K A;  1FF1 A;  1UP5 A;  1M31 A;  1CDL A;  1QIW A;  3LK1 A;  2M7L A;  1ZFS A;  1J7Q A;  1SL7 A;  3D10 A;  1B47 A;  2Y1N A;  3FWC A;  2SAS A;  5D7F A;  4UPG A;  1S36 A;  1ZOT B;  3SJS A;  4I5J A;  1IGV A;  1DT7 B;  1CMG A;  1KFX L;  3A8R A;  3H4S E;  4WRI A;  4MVF A;  2BKH B;  2KYF A;  3CS1 A;  1D1O A;  1NCZ A;  1YRT B;  2MRD A;  1CLL A;  2KAY A;  3SIB A;  1FI5 A;  2OPO A;  3WXA A;  3TZ1 A;  3I5I B;  1B8C A;  2JPT A;  3WHU B;  1CKK A;  4GGN A;  2NXQ A;  1H4B A;  1EL4 A;  1SMG A;  3OB1 B;  2L2E A;  3PAT A;  2D8N A;  1G33 A;  1FI6 A;  1SKT A;  1A03 A;  3EK7 A;  2O60 A;  3JVT B;  1BG1 A;  1NX0 A;  2M7N A;  2EC6 C;  1M39 A;  1SL8 A;  1SY9 A;  2LAP A;  2NZ0 A;  2QAC A;  3HCM A;  4PHM A;  1MHO A;  1RJV A;  5HKZ A;  4MN0 A;  2KI4 B;  1KQM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...