1L2OC

Scallop myosin s1-adp-p-pdm in the actin-detached conformation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords MYOSIN HEAVY CHAIN
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
total genus 37
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2002-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l2oC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l2oC02
3KPXA 2LP3A 1DTLA 3OX6A 1QS7A 1AK8A 1QV0A 1W7IB 4XYNA 1OSAA 2QACA 1MF8B 3I5IB 3HX4A 1WY9A 3SG5A 1NX3A 4OR9B 1ODBA 3TDZA 1NX2A 3ICBA 1BLQA 1KQVA 5K89A 4MLWA 3VRNA 2G2BA 3EVRA 3CR2A 1LA3A 2K2AA 1IRJA 2FCDA 2LMUA 1IH0A 1G33A 2BCBA 4I5NB 4OKHA 2KYCA 1KK7Z 1BR1B 1SL8A 2KBMA 3C1VA 1N0YA 2L4IA 1F70A 5HKWA 1XK4C 1FPWA 3OB1B 3SG2A 4AQJA 1BT6A 2EC6B 2EHBA 1EH2A 2K7DA 1LXFC 1IKUA 4PE1A 1FW4A 2JT8A 1LINA 1GGWA 3D10A 4AOMA 1B8LA 4DS7A 2ZN9A 1L2OC 2ZKMX 3D0YA 1NCYA 1OMRA 1UURA 2OPOA 1G4YR 1N2DA 1WDCB 1CDMA 4QJ5B 3CGAA 1DJIA 1A4PA 1XFUO 1JFKA 3AKBA 3TDUA 1CMGA 1HT9A 2JNXA 1KFUS 4N1GA 1YVLA 5ER4X 3EVUA 4YGBB 1EJ3A 5CSFA 2BE4A 2F33A 3WHTB 1XFVO 3A8RA 2WNDA 3HCMA 2KFFA 2EGDA 2OS8C 4WQ2A 3VROA 1K2HA 2JNFA 4GBAA 1TNPA 1TNQA 4A4CA 2F8PA 2M8UA 1TN4A 2HPSA 4OV2A 2LVJA 2H61C 1BMOA 1SW8A 5B8IB 1NP8A 1ZMZA 3OX5A 1S36A 3BUOB 3DVKA 3ZNIA 1UUSA 5CSNA 1AJ5A 1PULA 4E68A 1DJWA 5FYXA 3JTDC 3FIAA 2M97A 2M7LA 4BY5A 4C0LA 2JPTA 3I5GC 1QIWA 1SRAA 1NWDA 1RK9A 3O2PA 4MZKA 1XVJA 4MVFA 4P2YB 1SY9A 1JFJA 1L2OB 3LL8B 1IQ5A 4YBHB 3VRRA 2MLFC 3TDIA 3O78A 1KWOC 2CBLA 1QX2A 2B1UA 2LHLA 3CZTX 3LK0A 1FI6A 2HETA 3F45A 1B47A 2L50A 3RM1A 2KOTA 2KSPA 3DF0B 1YR5A 3PFVA 1UHHA 1A03A 4ORCB 2LLTA 1DMOA 4PE4A 2LM5A 1QVIZ 2AMIA 3GK1A 4ORAB 4QJ4B 4NDBA 5AERA 1BR4B 1Y0VH 2OS8B 2SASA 3PM8A 1CFPA 1EL4A 1TCFA 4GFTA 3SIBA 2LNKA 1CLLA 1DJXA 2KYFA 2ZRSA 1DT7B 1HQVA 2L51A 1A75A 1AHRA 2RGIA 3JTDB 3NSOA 2LVVA 2BCAA 2TN4A 3I5GB 2NLNA 5PALA 3SG3A 2KAVA 1N65A 1KK7Y 2A4JA 1F4OA 1S6JA 3NSKA 4HRHA 3EKJA 2F2PA 2L5XB 4ICBA 1DGVA 3VGOA 4CLNA 3SG6A 4P5OE 4D1EA 1KWOB 1YUUA 2JRFA 1V1GA 3BOWA 2JTZA 3GOFA 1S6CA 2LMTA 3EK8A 3MSEB 2MBXA 1H4BA 2NZ0A 3CLNA 1YUSA 4PHNA 1OOJA 4PE7A 2K0JA 2ZNEA 2LHIA 3I5HB 4NQGA 1QX7A 5AXIA 5DKQA 4ZCUA 1YRTB 2NCOA 1KQMC 3VRPA 1KCYA 5HLOA 1CLBA 1CLMA 1UP5A 2KFHA 1EG3A 5KTYA 1PSBA 1LA0A 1F8HA 1WDCC 4L9MA 1S5GZ 4XJKB 4C0KA 1RFJA 4MRYA 1SCMB 1M39A 1MQ1A 1XYDA 2LLSA 2WC8A 3EK7A 5HKYA 1W7JB 2LCPA 3SJSA 1OZSA 4GGFC 1BF5A 2MJWB 2AUCA 4ORBB 1YRUB 1JSAA 2JT0A 3IQQA 2FCEA 3CTNA 2BECA 2M1KB 1YX8A 3PALA 1MHOA 1NPQA 5ER5A 3RLZA 1YTZC 2M1UA 4NDDA 3SG4A 1J7PA 2COLB 3D0YB 4I5LB 2KQYA 4HRGA 2KI6D 1RWYA 2BCXA 2CCMA 5D7FA 4FTGA 2GGZA 2ZFDA 3O4YA 1FI5A 1BU3A 1NUBA 2LANA 1DF0A 2JT3A 4A4BA 2LP2A 2BBNA 2MRDA 1M31A 5DKRA 3BUWB 1KQMB 1NIWA 1QJTA 2ZRTA 2LMVA 1JUOA 2K7CA 5DKNA 2JZIA 1Q80A 4DRWA 1QTXA 3PATA 4ETOA 2D8NA 3KF9A 1BG1A 1IJ5A 2LC5A 3AKAA 1DVIA 1QLKA 1SL9A 2AAOA 1IGVA 2BKHB 1IQ3A 1ZUZA 1V1FA 1YVHA 1J1DA 1CFCA 1MUXA 1SBJA 2IS9A 3KHEA 1QVIY 1XFWO 2M0RA 3DVEA 1S26D 2CTNA 4MSPA 2BE6A 1IWQA 4YGDB 2K61A 1ZFSA 3DD4A 3I5FC 1RECA 1TTXA 5G08A 1J55A 4CIDA 1CKKA 1XFZO 4PCWA 4HSZA 2KHNA 2Y1MA 4M2OA 4DUQA 1YX7A 2KBIA 5HKZA 4JPZB 1G8IA 1LKJA 1C7VA 2JWWA 1AUIB 4GUKA 2KFGA 1RJVA 2PASA 1JWDA 2OTGC 1JBAA 4MRXA 3FWCA 3CWGA 4PHJA 1UHIA 2BL0C 3I5HC 3NXAA 1FBVA 2Q4UA 1K9KA 1TOPA 3EK4A 3SIAA 2E30A 1K9UA 1FF1A 1A75B 3BUNB 5KU1A 5TNCA 3QRXA 1XO5A 2L0PA 4CFRA 2K2FA 4GPLB 1K90D 2JXCA 1B4CA 1KSMA 1BJFA 1S5GY 1SCMC 1Y6WA 1DJGA 1XK4A 1OZOA 3PLFB 1NSHA 4C0JA 3I5FB 2KI4B 1K8UA 2I2RE 1D1OA 3FWBA 4GAOA 1M46A 2BKIB 4MEWA 1TCOB 2KQ6A 3TS5C 2LAPA 1WLMA 2V53A 2I94A 2M9GA 3H4SE 2CNPA 1WRKA 2VRGA 3M0WA 4USLA 4JWQA 5KSZA 1WRZA 1Y1AA 2L4HA 1NX1A 4GGNA 1F54A 2KGRA 3O6BA 1S3PA 1C7WA 4PHMA 1B1GA 1NCXA 1GJYA 2LUXA 2LUCA 2ZN8A 4UPGA 4I5JA 1F71A 1X02A 2P6BB 2KDHA 2LLUA 2GV5A 2M29A 2OTGB 5HYDA 2PALA 1XA5A 2WCEA 2Y5IA 1KK8C 4WRIA 1M45A 2BL0B 1R6PA 2KGBC 4BY4A 3EKHA 4YI9A 4YGEB 4YRUA 2MAZA 5BPJA 2HF5A 1F4QA 1CDLA 4Q04A 4YI8A 4MBEA 3NSLA 2JXLA 2QPTA 4YGCB 1QLSA 2KNEA 2H61A 5HLVA 1SNLA 1QV1A 2PRUA 1A2XA 1TIZA 2H2KA 4PDZA 4ZCVA 3GK2A 1YURA 2I7AA 1MWNA 1EG4A 1QX5B 2BBMA 1L7ZA 2HQWA 1TRFA 3CR5X 3TS5B 5AANA 2LV7A 1PVAA 1TNWA 3AAKA 5CSJA 1DF0B 1SPYA 1U5IA 1CM4A 3VRQA 1TNXA 1OMDA 1JF0A 4JQ0D 2WORA 2M7NA 5I8NA 1J1EA 1NCZA 1JF2A 4YGAA 3PSRA 4MN0A 2WCBA 1KK8B 2F3ZA 4AQIA 2NCPA 1SR6C 2CXJA 4IL1A 1QASA 2LE9B 3LLEA 1BODA 5I2QA 1J7QA 2JULA 4XJKA 1K94A 2O60A 1SKTA 1B7TY 1KSOA 3K21A 3PN7C 1OMVA 2FOTA 2CT9A 3SG7A 1SYMA 1JC2A 1UWOA 2JC2A 4MZLA 1S6IA 2KI6C 4PE0A 4OVNF 3BUMB 1BOCA 5GQQC 2R2IA 1SCVA 3KEVA 1PK0D 5AEQA 4WQ3A 1B8CA 2K8MB 1UHKA 2WOSA 1ALWA 2KI4C 1NX0A 3WNXB 4PALA 1EXRA 2K7OA 3NSIA 4N1FA 5I2LA 4F0ZB 2LVKA 1DGUA 1CNPA 3OP0A 1ZACA 3BYAA 4MZJA 1KFXL 1PSRA 1XFYO 1SR6B 1VRKA 2DOQA 3BQ3A 3ZWHA 1AP4A 1H8BA 1CFFA 1MR8A 2MHHA 1WLZA 4HREE 3TZ1A 1S1EA 1B7TZ 2GGMA 1DJHA 1YUTA 2SCPA 4TNCA 3OHMB 4I5KA 4U8DA 1CTRA 3PN7B 1PALA 1Y1XA 4GNKB 1OQPA 2L2EA 4R1EA 2M49B 1E8AA 1AJ4A 1OE9B 3DVMA 1MXEA 4GGFA 4FQOA 1CM1A 1PRWA 1Y1UA 1QATA 2JTTA 1AVSA 2Q91A 1IG5A 2ISDA 3CS1A 1UHNA 2FJUB 3LK1A 1C07A 5AFPA 2JOJA 3AAJA 3WHUB 1QIVA 3FS7A 2L98A 3TUYC 4M2QA 1K9PA 4N5XA 1RROA 3DVJA 1XFXO 3BOWB 3OB2B 3JVTC 1F55A 2LVIA 2WCFA 2E6WA 1J7RA 3A4UB 1GQMA 1R2UA 4NDCA 1ZOTB 5CPVA 1CB1A 2G9BA 2JQ6A 5J3XA 5JJGA 1IJ6A 1M63B 1NYAA 2M3WA 1K96A 2O5GA 1CDNA 3E3RA 2JU0A 3IQOA 5F6TA 2NXQA 4CFQA 1QXPA 2ZNDA 1K93D 5D69A 1J7OA 5JOLA 3GK4X 3I5IC 1CDPA 5IBWA 1B8RA 2KAXA 1CFDA 1K95A 2MLEC 1SMGA 2MA2A 3EVVA 3DF0A 1PVBA 1GGZA 2PVBA 1WRLA 4QJ3B 1DJYA 2F2OA 1DJZA 3CR4X 2PMYA 3BXKA 4CPVA 1LVCD 4DIRA 2Y4QA 2KAYA 4M2PA 2Y1NA 1KFXS 4DCKA 1U5IB 1KFUL 1CMFA 1UHJA 2K7BA 1ALVA 3TUYB 5CSIA 2EC6C 1B9AA 1A29A 3KO0A 1RTP1 4PHKA 2F3YA 1SK6D 5I2OA 3BUXB 2I18A 2HQ8A 1MXLC 2PSRA 3JVTB 3WXAA 3IF7A 3LCPC 1SL7A 4OCIA
chains in the Genus database with same CATH superfamily
3KPXA 2QDIA 2LP3A 1DTLA 3OX6A 1QS7A 1AK8A 1QV0A 2KLEA 1W7IB 1P28A 4XYNA 1OSAA 2QACA 1MF8B 3I5IB 3HX4A 1WY9A 3SG5A 1NX3A 4OR9B 3UNWA 1ODBA 3TDZA 1NX2A 3ICBA 1BLQA 1KQVA 5K89A 4MLWA 3VRNA 1XFRA 1Z2CB 1OW4A 2G2BA 3EVRA 3CR2A 1LA3A 5D3OA 2K2AA 1IRJA 2FCDA 2LMUA 1IH0A 1G33A 2BCBA 4I5NB 1DELA 4OKHA 2KYCA 1KK7Z 1BR1B 1SL8A 2KBMA 3C1VA 1N0YA 2L4IA 3S0DA 1F70A 3BJHA 5HKWA 1XK4C 1FPWA 3OB1B 3SG2A 4AQJA 1BT6A 2EC6B 2EHBA 1EH2A 3B87A 2K7DA 1LXFC 2QEOA 1IKUA 4PE1A 1FW4A 2JT8A 1LINA 1GGWA 3D10A 2QEHA 4AOMA 3B88A 1B8LA 4DS7A 2ZN9A 3VB1A 1L2OC 2ZKMX 3D0YA 1NCYA 1OMRA 3CZ1A 1UURA 3OGNA 2OPOA 1G4YR 1N2DA 1WDCB 1CDMA 3UO9A 3CGAA 1DJIA 1A4PA 1XFUO 1JFKA 3AKBA 3TDUA 4QJ5B 1CMGA 1HT9A 2JNXA 1KFUS 4N1GA 1YVLA 5ER4X 3EVUA 4YGBB 1EJ3A 5CSFA 2BE4A 2F33A 3WHTB 1XFVO 3A8RA 2WNDA 3HCMA 2KFFA 2EGDA 2JPOA 2OS8C 4WQ2A 3VROA 1K2HA 2JNFA 4GBAA 1TNPA 1TNQA 4A4CA 2F8PA 2M8UA 1TN4A 2HPSA 4OV2A 2LVJA 2H61C 1BMOA 1SW8A 5B8IB 1NP8A 1ZMZA 3OX5A 1S36A 3BUOB 3S0FA 3DVKA 3ZNIA 1UUSA 5CSNA 1AJ5A 1PULA 4E68A 1DJWA 5FYXA 3JTDC 3FIAA 2M97A 4INXA 2M7LA 4BY5A 2JPTA 3DXLA 3I5GC 4C0LA 1QIWA 1SRAA 1NWDA 1RK9A 3O2PA 4MZKA 1XVJA 2KPHA 4MVFA 3RZSA 4P2YB 1SY9A 1JFJA 1L2OB 1TWOA 3LL8B 1IQ5A 1DC1A 4YBHB 3VRRA 2MLFC 3TDIA 3O78A 1KWOC 2CBLA 3R1VA 1QX2A 2B1UA 2LHLA 3CZTX 3LK0A 1FI6A 2HETA 3F45A 1B47A 2L50A 3RM1A 2KOTA 2KSPA 3DF0B 1YR5A 3PFVA 1UHHA 1A03A 4ORCB 2LLTA 1DMOA 4PE4A 3BFBA 2LM5A 4IJ7A 1QVIZ 2AMIA 3GK1A 4ORAB 4QJ4B 4NDBA 5AERA 1BR4B 1Y0VH 2OS8B 2SASA 3PM8A 2ERBA 1CFPA 1EL4A 1QWVA 1TCFA 3SS4A 3S0AA 4GFTA 3SIBA 2LNKA 1CLLA 1DJXA 2KYFA 3L4LA 3L4AA 2ZRSA 1DT7B 3O4XA 3SS5A 1HQVA 2L51A 1A75A 1AHRA 2RGIA 3JTDB 3NSOA 2LVVA 2BCAA 2TN4A 3I5GB 2NLNA 5PALA 4JKTA 3SG3A 2KAVA 1N65A 1KK7Y 2A4JA 4F7FA 1F4OA 1S6JA 3NSKA 4HRHA 3EKJA 2F2PA 2L5XB 4ICBA 1DGVA 3B7AA 3PJIA 3SG6A 2WCMA 4P5OE 3VGOA 3CDNA 4D1EA 1C3ZA 1KWOB 1YUUA 2JRFA 1V1GA 3BOWA 2JTZA 3GOFA 1S6CA 2LMTA 3EK8A 3MSEB 2MBXA 1H4BA 2NZ0A 3CLNA 1YUSA 4PHNA 1OOJA 4PE7A 2K0JA 2ZNEA 2LHIA 3I5HB 4NQGA 1TUZA 1QX7A 5AXIA 5DKQA 4ZCUA 1YRTB 2NCOA 1KQMC 3VRPA 1KCYA 5HLOA 1CLBA 1CLMA 1UP5A 2KFHA 1EG3A 5KTYA 1PSBA 1LA0A 1F8HA 1WDCC 2KLDA 4L9MA 4INWA 1S5GZ 3D75A 4XJKB 4C0KA 1RFJA 4MRYA 2WCJA 1SCMB 1TUJA 3CYZA 1M39A 1MQ1A 1XYDA 2LLSA 2WC8A 3EK7A 5HKYA 1W7JB 2LCPA 3SJSA 1OZSA 4GGFC 1BF5A 2MJWB 2AUCA 4ORBB 1YRUB 1JSAA 2JT0A 3IQQA 2FCEA 3CTNA 2BECA 2M1KB 1YX8A 3FE9A 1MHOA 1NPQA 3PALA 5ER5A 1YTZC 2M1UA 4NDDA 3SG4A 1J7PA 2COLB 3D0YB 4I5LB 2GTEA 2KQYA 4HRGA 2KI6D 1RWYA 2BCXA 2CCMA 5D7FA 4FTGA 2GGZA 2ZFDA 3O4YA 1FI5A 1BU3A 1NUBA 2LANA 1DF0A 2JT3A 4A4BA 2LP2A 2BBNA 2MRDA 1M31A 5DKRA 3BUWB 3CABA 1KQMB 1NIWA 1QJTA 2WCKA 2ZRTA 2LMVA 1JUOA 2K7CA 5DKNA 2JZIA 1Q80A 4DRWA 1QTXA 5EL2A 3FE8A 3PATA 3RLZA 4ETOA 2D8NA 3KF9A 1BG1A 1IJ5A 3EG5B 2LC5A 3AKAA 1DVIA 1QLKA 1SL9A 2AAOA 1IGVA 2BKHB 3PM2A 1IQ3A 1ZUZA 1V1FA 1YVHA 1J1DA 1CFCA 2YGUA 1MUXA 1SBJA 2IS9A 3KHEA 1QVIY 1XFWO 2M0RA 3D74A 3DVEA 1S26D 2CTNA 4MSPA 2BE6A 3DY9A 1IWQA 4YGDB 2K61A 2L5YA 1ZFSA 3D76A 2K60A 3DD4A 3I5FC 1RECA 1TTXA 2QEVA 3IVTA 5G08A 1J55A 3BFHA 3R1OA 4CIDA 1XFZO 1CKKA 4PCWA 4HSZA 2KHNA 2Y1MA 4M2OA 4DUQA 3NHIA 1YX7A 2KBIA 5HKZA 4JPZB 1G8IA 1IIOA 1LKJA 1C7VA 2JWWA 5FI7A 1AUIB 4GUKA 2KFGA 1RJVA 2PASA 1JWDA 3CZ0A 3S0GA 2OTGC 3Q8IA 4KYNA 1JBAA 4MRXA 3FWCA 3CWGA 4PHJA 1UHIA 2BL0C 3I5HC 3NXAA 2PYQA 1FBVA 2Q4UA 1K9KA 1TOPA 3EK4A 3R72A 2E30A 1K9UA 3SIAA 1FF1A 1A75B 3BUNB 5KU1A 5TNCA 3QRXA 1XO5A 2L0PA 4CFRA 3B6XA 2K2FA 4GPLB 1K90D 2JXCA 1OOHA 1B4CA 1KSMA 1BJFA 1S5GY 1SCMC 1Y6WA 1DJGA 1XK4A 1LS8A 1OZOA 3PLFB 1NSHA 4C0JA 3I5FB 2KI4B 5DICA 1K8UA 2I2RE 3N7HA 1D1OA 3FWBA 4GAOA 1M46A 2BKIB 4MEWA 1TCOB 2KQ6A 3TS5C 2LAPA 1WLMA 2V53A 2I94A 2M9GA 3H4SE 3D78A 2CNPA 1WRKA 2VRGA 3M0WA 4USLA 4JWQA 5KSZA 1WRZA 1Y1AA 2L4HA 1NX1A 4GGNA 1F54A 2KGRA 3O6BA 1S3PA 1C7WA 3DYEA 4PHMA 1B1GA 1NCXA 1GJYA 2LUXA 2LUCA 2ZN8A 4UPGA 4I5JA 1F71A 1X02A 2P6BB 2KDHA 2LLUA 2GV5A 2M29A 2OTGB 5HYDA 2PALA 1XA5A 2WCEA 2Y5IA 1KK8C 4WRIA 1M45A 2BL0B 1R6PA 2KGBC 4BY4A 3EKHA 4YI9A 4YGEB 4YRUA 2MAZA 5BPJA 2HF5A 1F4QA 1CDLA 4Q04A 4YI8A 4MBEA 3NSLA 2WCLA 2JXLA 2FJYA 2QPTA 4YGCB 3S0EA 1QLSA 2H8VA 2KNEA 2H61A 5HLVA 1SNLA 1QV1A 2PRUA 1A2XA 2P70A 1TIZA 2H2KA 4PDZA 4ZCVA 3GK2A 1OOFA 1YURA 2I7AA 1MWNA 1EG4A 1QX5B 2BBMA 1L7ZA 2HQWA 1TRFA 3CR5X 3TS5B 5AANA 2LV7A 1PVAA 1TNWA 3DZTA 3AAKA 5CSJA 1DF0B 1SPYA 1U5IA 1CM4A 3VRQA 1Z4HA 1ORGA 1TNXA 1OMDA 2PQLA 1JF0A 4JQ0D 2WORA 2WCHA 5FI6A 2M7NA 5I8NA 1J1EA 1NCZA 1JF2A 4YGAA 3PSRA 4MN0A 2WCBA 1KK8B 2F3ZA 4AQIA 1OOIX 2NCPA 1SR6C 2CXJA 4IL1A 1QASA 2LE9B 3LLEA 1DEKA 1BODA 5I2QA 1J7QA 2JULA 4XJKA 1K94A 2O60A 1SKTA 3NGVA 1B7TY 1KSOA 3K21A 3PN7C 1OMVA 2FOTA 2CT9A 3SG7A 1SYMA 1JC2A 1UWOA 2JC2A 4MZLA 1S6IA 2KI6C 4PE0A 4OVNF 3BUMB 1BOCA 5GQQC 2R2IA 1SCVA 3KEVA 1SSEB 1PK0D 5HL1A 5AEQA 4WQ3A 1B8CA 2K8MB 1UHKA 1T14A 2WOSA 1ALWA 2KI4C 1NX0A 3WNXB 4PALA 1EXRA 2K7OA 3NSIA 4N1FA 5I2LA 4F0ZB 2LVKA 4CLNA 1DGUA 3OBVA 1CNPA 3OP0A 1ZACA 3BYAA 4MZJA 3BFAA 1KFXL 1PSRA 1XFYO 1SR6B 1VRKA 2DOQA 3BQ3A 3V2LA 3ZWHA 1AP4A 1H8BA 1CFFA 3B86A 1MR8A 2MHHA 3S0BA 2BAPA 1WLZA 4HREE 3TZ1A 1S1EA 4PT1A 1B7TZ 2GGMA 1DJHA 3D73A 1YUTA 2SCPA 3QMEA 4TNCA 3OHMB 4I5KA 4U8DA 1CTRA 3PN7B 1PALA 1Y1XA 4GNKB 1C3YA 1OQPA 2L2EA 4R1EA 2M49B 1E8AA 1AJ4A 1OE9B 3DVMA 1MXEA 4GGFA 2L2CA 4FQOA 1CM1A 1PRWA 1Y1UA 1QATA 2JTTA 1AVSA 2Q91A 4FQTA 1IG5A 2ISDA 3CS1A 1UHNA 2FJUB 3LK1A 1C07A 5AFPA 2JOJA 3AAJA 3WHUB 1QIVA 3FS7A 2L98A 3TUYC 2BNXA 4M2QA 4JD9A 1K9PA 2WC6A 3L47A 4N5XA 1RROA 3DVJA 1XFXO 3BOWB 3OB2B 3JVTC 1F55A 2LVIA 2WCFA 2E6WA 1J7RA 3A4UB 1GQMA 1R2UA 4NDCA 1ZOTB 5CPVA 1CB1A 2G9BA 2JQ6A 5J3XA 5JJGA 1IJ6A 1M63B 1NYAA 2M3WA 1K96A 2O5GA 1CDNA 3E3RA 2QEBA 2JU0A 3IQOA 5F6TA 3SS3A 2NXQA 3D77A 1QXPA 1DQEA 4CFQA 1OOGA 1W9ZA 5FI2A 2ZNDA 1K93D 5D69A 5I94A 1J7OA 5JOLA 3GK4X 3I5IC 1CDPA 5IBWA 1B8RA 2KAXA 1CFDA 1K95A 2MLEC 1SMGA 2MA2A 3EVVA 3DF0A 1PVBA 1GGZA 2PVBA 1WRLA 4QJ3B 1DJYA 2F2OA 1DJZA 2WC5A 3CR4X 2P71A 2PMYA 3BXKA 4CPVA 1LVCD 4DIRA 2Y4QA 2KAYA 4M2PA 2Y1NA 1KFXS 4DCKA 1U5IB 3R1PA 1KFUL 1CMFA 1UHJA 2K7BA 1ALVA 3NHTA 3TUYB 5CSIA 2EC6C 1B9AA 1A29A 3KO0A 1RTP1 4OZDA 4PHKA 2F3YA 1SK6D 5I2OA 3BUXB 2I18A 2HQ8A 1MXLC 2PSRA 3FE6A 3JVTB 3WXAA 3IF7A 3K1EA 1GM0A 3LCPC 3CZ2A 1SL7A 4OCIA
chains in the Genus database with same CATH topology
3KPXA 2LP3A 1DTLA 3OX6A 1QS7A 1AK8A 1QV0A 1W7IB 4XYNA 1OSAA 2QACA 1MF8B 3I5IB 3HX4A 1WY9A 3SG5A 1NX3A 4OR9B 1ODBA 3TDZA 1NX2A 3ICBA 1BLQA 1KQVA 5K89A 4MLWA 3VRNA 2G2BA 3EVRA 3CR2A 1LA3A 2K2AA 1IRJA 2FCDA 2LMUA 1IH0A 1G33A 2BCBA 4I5NB 4OKHA 2KYCA 1KK7Z 1BR1B 1SL8A 2KBMA 3C1VA 1N0YA 2L4IA 1F70A 5HKWA 1XK4C 1FPWA 3OB1B 3SG2A 4AQJA 1BT6A 2EC6B 2EHBA 1EH2A 2K7DA 1LXFC 1IKUA 4PE1A 1FW4A 2JT8A 1LINA 1GGWA 3D10A 4AOMA 1B8LA 4DS7A 2ZN9A 1L2OC 2ZKMX 3D0YA 1NCYA 1OMRA 1UURA 2OPOA 1G4YR 1N2DA 1WDCB 1CDMA 4QJ5B 3CGAA 1DJIA 1A4PA 1XFUO 1JFKA 3AKBA 3TDUA 1CMGA 1HT9A 2JNXA 1KFUS 4N1GA 1YVLA 5ER4X 3EVUA 4YGBB 1EJ3A 5CSFA 2BE4A 2F33A 3WHTB 1XFVO 3A8RA 2WNDA 3HCMA 2KFFA 2EGDA 2OS8C 4WQ2A 3VROA 1K2HA 2JNFA 4GBAA 1TNPA 1TNQA 4A4CA 2F8PA 2M8UA 1TN4A 2HPSA 4OV2A 2LVJA 2H61C 1BMOA 1SW8A 5B8IB 1NP8A 1ZMZA 3OX5A 1S36A 3BUOB 3DVKA 3ZNIA 1UUSA 5CSNA 1AJ5A 1PULA 4E68A 1DJWA 5FYXA 3JTDC 3FIAA 2M97A 2M7LA 4BY5A 4C0LA 2JPTA 3I5GC 1QIWA 1SRAA 1NWDA 1RK9A 3O2PA 4MZKA 1XVJA 4MVFA 4P2YB 1SY9A 1JFJA 1L2OB 3LL8B 1IQ5A 4YBHB 3VRRA 2MLFC 3TDIA 3O78A 1KWOC 2CBLA 1QX2A 2B1UA 2LHLA 3CZTX 3LK0A 1FI6A 2HETA 3F45A 1B47A 2L50A 3RM1A 2KOTA 2KSPA 3DF0B 1YR5A 3PFVA 1UHHA 1A03A 4ORCB 2LLTA 1DMOA 4PE4A 2LM5A 1QVIZ 2AMIA 3GK1A 4ORAB 4QJ4B 4NDBA 5AERA 1BR4B 1Y0VH 2OS8B 2SASA 3PM8A 1CFPA 1EL4A 1TCFA 4GFTA 3SIBA 2LNKA 1CLLA 1DJXA 2KYFA 2ZRSA 1DT7B 1HQVA 2L51A 1A75A 1AHRA 2RGIA 3JTDB 3NSOA 2LVVA 2BCAA 2TN4A 3I5GB 2NLNA 5PALA 3SG3A 2KAVA 1N65A 1KK7Y 2A4JA 1F4OA 1S6JA 3NSKA 4HRHA 3EKJA 2F2PA 2L5XB 4ICBA 1DGVA 3VGOA 4CLNA 3SG6A 4P5OE 4D1EA 1KWOB 1YUUA 2JRFA 1V1GA 3BOWA 2JTZA 3GOFA 1S6CA 2LMTA 3EK8A 3MSEB 2MBXA 1H4BA 2NZ0A 3CLNA 1YUSA 4PHNA 1OOJA 4PE7A 2K0JA 2ZNEA 2LHIA 3I5HB 4NQGA 1QX7A 5AXIA 5DKQA 4ZCUA 1YRTB 2NCOA 1KQMC 3VRPA 1KCYA 5HLOA 1CLBA 1CLMA 1UP5A 2KFHA 1EG3A 5KTYA 1PSBA 1LA0A 1F8HA 1WDCC 4L9MA 1S5GZ 4XJKB 4C0KA 1RFJA 4MRYA 1SCMB 1M39A 1MQ1A 1XYDA 2LLSA 2WC8A 3EK7A 5HKYA 1W7JB 2LCPA 3SJSA 1OZSA 4GGFC 1BF5A 2MJWB 2AUCA 4ORBB 1YRUB 1JSAA 2JT0A 3IQQA 2FCEA 3CTNA 2BECA 2M1KB 1YX8A 3PALA 1MHOA 1NPQA 5ER5A 3RLZA 1YTZC 2M1UA 4NDDA 3SG4A 1J7PA 2COLB 3D0YB 4I5LB 2KQYA 4HRGA 2KI6D 1RWYA 2BCXA 2CCMA 5D7FA 4FTGA 2GGZA 2ZFDA 3O4YA 1FI5A 1BU3A 1NUBA 2LANA 1DF0A 2JT3A 4A4BA 2LP2A 2BBNA 2MRDA 1M31A 5DKRA 3BUWB 1KQMB 1NIWA 1QJTA 2ZRTA 2LMVA 1JUOA 2K7CA 5DKNA 2JZIA 1Q80A 4DRWA 1QTXA 3PATA 4ETOA 2D8NA 3KF9A 1BG1A 1IJ5A 2LC5A 3AKAA 1DVIA 1QLKA 1SL9A 2AAOA 1IGVA 2BKHB 1IQ3A 1ZUZA 1V1FA 1YVHA 1J1DA 1CFCA 1MUXA 1SBJA 2IS9A 3KHEA 1QVIY 1XFWO 2M0RA 3DVEA 1S26D 2CTNA 4MSPA 2BE6A 1IWQA 4YGDB 2K61A 1ZFSA 3DD4A 3I5FC 1RECA 1TTXA 5G08A 1J55A 4CIDA 1CKKA 1XFZO 4PCWA 4HSZA 2KHNA 2Y1MA 4M2OA 4DUQA 1YX7A 2KBIA 5HKZA 4JPZB 1G8IA 1LKJA 1C7VA 2JWWA 1AUIB 4GUKA 2KFGA 1RJVA 2PASA 1JWDA 2OTGC 1JBAA 4MRXA 3FWCA 3CWGA 4PHJA 1UHIA 2BL0C 3I5HC 3NXAA 1FBVA 2Q4UA 1K9KA 1TOPA 3EK4A 3SIAA 2E30A 1K9UA 1FF1A 1A75B 3BUNB 5KU1A 5TNCA 3QRXA 1XO5A 2L0PA 4CFRA 2K2FA 4GPLB 1K90D 2JXCA 1B4CA 1KSMA 1BJFA 1S5GY 1SCMC 1Y6WA 1DJGA 1XK4A 1OZOA 3PLFB 1NSHA 4C0JA 3I5FB 2KI4B 1K8UA 2I2RE 1D1OA 3FWBA 4GAOA 1M46A 2BKIB 4MEWA 1TCOB 2KQ6A 3TS5C 2LAPA 1WLMA 2V53A 2I94A 2M9GA 3H4SE 2CNPA 1WRKA 2VRGA 3M0WA 4USLA 4JWQA 5KSZA 1WRZA 1Y1AA 2L4HA 1NX1A 4GGNA 1F54A 2KGRA 3O6BA 1S3PA 1C7WA 4PHMA 1B1GA 1NCXA 1GJYA 2LUXA 2LUCA 2ZN8A 4UPGA 4I5JA 1F71A 1X02A 2P6BB 2KDHA 2LLUA 2GV5A 2M29A 2OTGB 5HYDA 2PALA 1XA5A 2WCEA 2Y5IA 1KK8C 4WRIA 1M45A 2BL0B 1R6PA 2KGBC 4BY4A 3EKHA 4YI9A 4YGEB 4YRUA 2MAZA 5BPJA 2HF5A 1F4QA 1CDLA 4Q04A 4YI8A 4MBEA 3NSLA 2JXLA 2QPTA 4YGCB 1QLSA 2KNEA 2H61A 5HLVA 1SNLA 1QV1A 2PRUA 1A2XA 1TIZA 2H2KA 4PDZA 4ZCVA 3GK2A 1YURA 2I7AA 1MWNA 1EG4A 1QX5B 2BBMA 1L7ZA 2HQWA 1TRFA 3CR5X 3TS5B 5AANA 2LV7A 1PVAA 1TNWA 3AAKA 5CSJA 1DF0B 1SPYA 1U5IA 1CM4A 3VRQA 1TNXA 1OMDA 1JF0A 4JQ0D 2WORA 2M7NA 5I8NA 1J1EA 1NCZA 1JF2A 4YGAA 3PSRA 4MN0A 2WCBA 1KK8B 2F3ZA 4AQIA 2NCPA 1SR6C 2CXJA 4IL1A 1QASA 2LE9B 3LLEA 1BODA 5I2QA 1J7QA 2JULA 4XJKA 1K94A 2O60A 1SKTA 1B7TY 1KSOA 3K21A 3PN7C 1OMVA 2FOTA 2CT9A 3SG7A 1SYMA 1JC2A 1UWOA 2JC2A 4MZLA 1S6IA 2KI6C 4PE0A 4OVNF 3BUMB 1BOCA 5GQQC 2R2IA 1SCVA 3KEVA 1PK0D 5AEQA 4WQ3A 1B8CA 2K8MB 1UHKA 2WOSA 1ALWA 2KI4C 1NX0A 3WNXB 4PALA 1EXRA 2K7OA 3NSIA 4N1FA 5I2LA 4F0ZB 2LVKA 1DGUA 1CNPA 3OP0A 1ZACA 3BYAA 4MZJA 1KFXL 1PSRA 1XFYO 1SR6B 1VRKA 2DOQA 3BQ3A 3ZWHA 1AP4A 1H8BA 1CFFA 1MR8A 2MHHA 1WLZA 4HREE 3TZ1A 1S1EA 1B7TZ 2GGMA 1DJHA 1YUTA 2SCPA 4TNCA 3OHMB 4I5KA 4U8DA 1CTRA 3PN7B 1PALA 1Y1XA 4GNKB 1OQPA 2L2EA 4R1EA 2M49B 1E8AA 1AJ4A 1OE9B 3DVMA 1MXEA 4GGFA 4FQOA 1CM1A 1PRWA 1Y1UA 1QATA 2JTTA 1AVSA 2Q91A 1IG5A 2ISDA 3CS1A 1UHNA 2FJUB 3LK1A 1C07A 5AFPA 2JOJA 3AAJA 3WHUB 1QIVA 3FS7A 2L98A 3TUYC 4M2QA 1K9PA 4N5XA 1RROA 3DVJA 1XFXO 3BOWB 3OB2B 3JVTC 1F55A 2LVIA 2WCFA 2E6WA 1J7RA 3A4UB 1GQMA 1R2UA 4NDCA 1ZOTB 5CPVA 1CB1A 2G9BA 2JQ6A 5J3XA 5JJGA 1IJ6A 1M63B 1NYAA 2M3WA 1K96A 2O5GA 1CDNA 3E3RA 2JU0A 3IQOA 5F6TA 2NXQA 4CFQA 1QXPA 2ZNDA 1K93D 5D69A 1J7OA 5JOLA 3GK4X 3I5IC 1CDPA 5IBWA 1B8RA 2KAXA 1CFDA 1K95A 2MLEC 1SMGA 2MA2A 3EVVA 3DF0A 1PVBA 1GGZA 2PVBA 1WRLA 4QJ3B 1DJYA 2F2OA 1DJZA 3CR4X 2PMYA 3BXKA 4CPVA 1LVCD 4DIRA 2Y4QA 2KAYA 4M2PA 2Y1NA 1KFXS 4DCKA 1U5IB 1KFUL 1CMFA 1UHJA 2K7BA 1ALVA 3TUYB 5CSIA 2EC6C 1B9AA 1A29A 3KO0A 1RTP1 4PHKA 2F3YA 1SK6D 5I2OA 3BUXB 2I18A 2HQ8A 1MXLC 2PSRA 3JVTB 3WXAA 3IF7A 3LCPC 1SL7A 4OCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPX A;  2LP3 A;  1DTL A;  3OX6 A;  1QS7 A;  1AK8 A;  1QV0 A;  1W7I B;  4XYN A;  1OSA A;  2QAC A;  1MF8 B;  3I5I B;  3HX4 A;  1WY9 A;  3SG5 A;  1NX3 A;  4OR9 B;  1ODB A;  3TDZ A;  1NX2 A;  3ICB A;  1BLQ A;  1KQV A;  5K89 A;  4MLW A;  3VRN A;  2G2B A;  3EVR A;  3CR2 A;  1LA3 A;  2K2A A;  1IRJ A;  2FCD A;  2LMU A;  1IH0 A;  1G33 A;  2BCB A;  4I5N B;  4OKH A;  2KYC A;  1KK7 Z;  1BR1 B;  1SL8 A;  2KBM A;  3C1V A;  1N0Y A;  2L4I A;  1F70 A;  5HKW A;  1XK4 C;  1FPW A;  3OB1 B;  3SG2 A;  4AQJ A;  1BT6 A;  2EC6 B;  2EHB A;  1EH2 A;  2K7D A;  1LXF C;  1IKU A;  4PE1 A;  1FW4 A;  2JT8 A;  1LIN A;  1GGW A;  3D10 A;  4AOM A;  1B8L A;  4DS7 A;  2ZN9 A;  1L2O C;  2ZKM X;  3D0Y A;  1NCY A;  1OMR A;  1UUR A;  2OPO A;  1G4Y R;  1N2D A;  1WDC B;  1CDM A;  4QJ5 B;  3CGA A;  1DJI A;  1A4P A;  1XFU O;  1JFK A;  3AKB A;  3TDU A;  1CMG A;  1HT9 A;  2JNX A;  1KFU S;  4N1G A;  1YVL A;  5ER4 X;  3EVU A;  4YGB B;  1EJ3 A;  5CSF A;  2BE4 A;  2F33 A;  3WHT B;  1XFV O;  3A8R A;  2WND A;  3HCM A;  2KFF A;  2EGD A;  2OS8 C;  4WQ2 A;  3VRO A;  1K2H A;  2JNF A;  4GBA A;  1TNP A;  1TNQ A;  4A4C A;  2F8P A;  2M8U A;  1TN4 A;  2HPS A;  4OV2 A;  2LVJ A;  2H61 C;  1BMO A;  1SW8 A;  5B8I B;  1NP8 A;  1ZMZ A;  3OX5 A;  1S36 A;  3BUO B;  3DVK A;  3ZNI A;  1UUS A;  5CSN A;  1AJ5 A;  1PUL A;  4E68 A;  1DJW A;  5FYX A;  3JTD C;  3FIA A;  2M97 A;  2M7L A;  4BY5 A;  4C0L A;  2JPT A;  3I5G C;  1QIW A;  1SRA A;  1NWD A;  1RK9 A;  3O2P A;  4MZK A;  1XVJ A;  4MVF A;  4P2Y B;  1SY9 A;  1JFJ A;  1L2O B;  3LL8 B;  1IQ5 A;  4YBH B;  3VRR A;  2MLF C;  3TDI A;  3O78 A;  1KWO C;  2CBL A;  1QX2 A;  2B1U A;  2LHL A;  3CZT X;  3LK0 A;  1FI6 A;  2HET A;  3F45 A;  1B47 A;  2L50 A;  3RM1 A;  2KOT A;  2KSP A;  3DF0 B;  1YR5 A;  3PFV A;  1UHH A;  1A03 A;  4ORC B;  2LLT A;  1DMO A;  4PE4 A;  2LM5 A;  1QVI Z;  2AMI A;  3GK1 A;  4ORA B;  4QJ4 B;  4NDB A;  5AER A;  1BR4 B;  1Y0V H;  2OS8 B;  2SAS A;  3PM8 A;  1CFP A;  1EL4 A;  1TCF A;  4GFT A;  3SIB A;  2LNK A;  1CLL A;  1DJX A;  2KYF A;  2ZRS A;  1DT7 B;  1HQV A;  2L51 A;  1A75 A;  1AHR A;  2RGI A;  3JTD B;  3NSO A;  2LVV A;  2BCA A;  2TN4 A;  3I5G B;  2NLN A;  5PAL A;  3SG3 A;  2KAV A;  1N65 A;  1KK7 Y;  2A4J A;  1F4O A;  1S6J A;  3NSK A;  4HRH A;  3EKJ A;  2F2P A;  2L5X B;  4ICB A;  1DGV A;  3VGO A;  4CLN A;  3SG6 A;  4P5O E;  4D1E A;  1KWO B;  1YUU A;  2JRF A;  1V1G A;  3BOW A;  2JTZ A;  3GOF A;  1S6C A;  2LMT A;  3EK8 A;  3MSE B;  2MBX A;  1H4B A;  2NZ0 A;  3CLN A;  1YUS A;  4PHN A;  1OOJ A;  4PE7 A;  2K0J A;  2ZNE A;  2LHI A;  3I5H B;  4NQG A;  1QX7 A;  5AXI A;  5DKQ A;  4ZCU A;  1YRT B;  2NCO A;  1KQM C;  3VRP A;  1KCY A;  5HLO A;  1CLB A;  1CLM A;  1UP5 A;  2KFH A;  1EG3 A;  5KTY A;  1PSB A;  1LA0 A;  1F8H A;  1WDC C;  4L9M A;  1S5G Z;  4XJK B;  4C0K A;  1RFJ A;  4MRY A;  1SCM B;  1M39 A;  1MQ1 A;  1XYD A;  2LLS A;  2WC8 A;  3EK7 A;  5HKY A;  1W7J B;  2LCP A;  3SJS A;  1OZS A;  4GGF C;  1BF5 A;  2MJW B;  2AUC A;  4ORB B;  1YRU B;  1JSA A;  2JT0 A;  3IQQ A;  2FCE A;  3CTN A;  2BEC A;  2M1K B;  1YX8 A;  3PAL A;  1MHO A;  1NPQ A;  5ER5 A;  3RLZ A;  1YTZ C;  2M1U A;  4NDD A;  3SG4 A;  1J7P A;  2COL B;  3D0Y B;  4I5L B;  2KQY A;  4HRG A;  2KI6 D;  1RWY A;  2BCX A;  2CCM A;  5D7F A;  4FTG A;  2GGZ A;  2ZFD A;  3O4Y A;  1FI5 A;  1BU3 A;  1NUB A;  2LAN A;  1DF0 A;  2JT3 A;  4A4B A;  2LP2 A;  2BBN A;  2MRD A;  1M31 A;  5DKR A;  3BUW B;  1KQM B;  1NIW A;  1QJT A;  2ZRT A;  2LMV A;  1JUO A;  2K7C A;  5DKN A;  2JZI A;  1Q80 A;  4DRW A;  1QTX A;  3PAT A;  4ETO A;  2D8N A;  3KF9 A;  1BG1 A;  1IJ5 A;  2LC5 A;  3AKA A;  1DVI A;  1QLK A;  1SL9 A;  2AAO A;  1IGV A;  2BKH B;  1IQ3 A;  1ZUZ A;  1V1F A;  1YVH A;  1J1D A;  1CFC A;  1MUX A;  1SBJ A;  2IS9 A;  3KHE A;  1QVI Y;  1XFW O;  2M0R A;  3DVE A;  1S26 D;  2CTN A;  4MSP A;  2BE6 A;  1IWQ A;  4YGD B;  2K61 A;  1ZFS A;  3DD4 A;  3I5F C;  1REC A;  1TTX A;  5G08 A;  1J55 A;  4CID A;  1CKK A;  1XFZ O;  4PCW A;  4HSZ A;  2KHN A;  2Y1M A;  4M2O A;  4DUQ A;  1YX7 A;  2KBI A;  5HKZ A;  4JPZ B;  1G8I A;  1LKJ A;  1C7V A;  2JWW A;  1AUI B;  4GUK A;  2KFG A;  1RJV A;  2PAS A;  1JWD A;  2OTG C;  1JBA A;  4MRX A;  3FWC A;  3CWG A;  4PHJ A;  1UHI A;  2BL0 C;  3I5H C;  3NXA A;  1FBV A;  2Q4U A;  1K9K A;  1TOP A;  3EK4 A;  3SIA A;  2E30 A;  1K9U A;  1FF1 A;  1A75 B;  3BUN B;  5KU1 A;  5TNC A;  3QRX A;  1XO5 A;  2L0P A;  4CFR A;  2K2F A;  4GPL B;  1K90 D;  2JXC A;  1B4C A;  1KSM A;  1BJF A;  1S5G Y;  1SCM C;  1Y6W A;  1DJG A;  1XK4 A;  1OZO A;  3PLF B;  1NSH A;  4C0J A;  3I5F B;  2KI4 B;  1K8U A;  2I2R E;  1D1O A;  3FWB A;  4GAO A;  1M46 A;  2BKI B;  4MEW A;  1TCO B;  2KQ6 A;  3TS5 C;  2LAP A;  1WLM A;  2V53 A;  2I94 A;  2M9G A;  3H4S E;  2CNP A;  1WRK A;  2VRG A;  3M0W A;  4USL A;  4JWQ A;  5KSZ A;  1WRZ A;  1Y1A A;  2L4H A;  1NX1 A;  4GGN A;  1F54 A;  2KGR A;  3O6B A;  1S3P A;  1C7W A;  4PHM A;  1B1G A;  1NCX A;  1GJY A;  2LUX A;  2LUC A;  2ZN8 A;  4UPG A;  4I5J A;  1F71 A;  1X02 A;  2P6B B;  2KDH A;  2LLU A;  2GV5 A;  2M29 A;  2OTG B;  5HYD A;  2PAL A;  1XA5 A;  2WCE A;  2Y5I A;  1KK8 C;  4WRI A;  1M45 A;  2BL0 B;  1R6P A;  2KGB C;  4BY4 A;  3EKH A;  4YI9 A;  4YGE B;  4YRU A;  2MAZ A;  5BPJ A;  2HF5 A;  1F4Q A;  1CDL A;  4Q04 A;  4YI8 A;  4MBE A;  3NSL A;  2JXL A;  2QPT A;  4YGC B;  1QLS A;  2KNE A;  2H61 A;  5HLV A;  1SNL A;  1QV1 A;  2PRU A;  1A2X A;  1TIZ A;  2H2K A;  4PDZ A;  4ZCV A;  3GK2 A;  1YUR A;  2I7A A;  1MWN A;  1EG4 A;  1QX5 B;  2BBM A;  1L7Z A;  2HQW A;  1TRF A;  3CR5 X;  3TS5 B;  5AAN A;  2LV7 A;  1PVA A;  1TNW A;  3AAK A;  5CSJ A;  1DF0 B;  1SPY A;  1U5I A;  1CM4 A;  3VRQ A;  1TNX A;  1OMD A;  1JF0 A;  4JQ0 D;  2WOR A;  2M7N A;  5I8N A;  1J1E A;  1NCZ A;  1JF2 A;  4YGA A;  3PSR A;  4MN0 A;  2WCB A;  1KK8 B;  2F3Z A;  4AQI A;  2NCP A;  1SR6 C;  2CXJ A;  4IL1 A;  1QAS A;  2LE9 B;  3LLE A;  1BOD A;  5I2Q A;  1J7Q A;  2JUL A;  4XJK A;  1K94 A;  2O60 A;  1SKT A;  1B7T Y;  1KSO A;  3K21 A;  3PN7 C;  1OMV A;  2FOT A;  2CT9 A;  3SG7 A;  1SYM A;  1JC2 A;  1UWO A;  2JC2 A;  4MZL A;  1S6I A;  2KI6 C;  4PE0 A;  4OVN F;  3BUM B;  1BOC A;  5GQQ C;  2R2I A;  1SCV A;  3KEV A;  1PK0 D;  5AEQ A;  4WQ3 A;  1B8C A;  2K8M B;  1UHK A;  2WOS A;  1ALW A;  2KI4 C;  1NX0 A;  3WNX B;  4PAL A;  1EXR A;  2K7O A;  3NSI A;  4N1F A;  5I2L A;  4F0Z B;  2LVK A;  1DGU A;  1CNP A;  3OP0 A;  1ZAC A;  3BYA A;  4MZJ A;  1KFX L;  1PSR A;  1XFY O;  1SR6 B;  1VRK A;  2DOQ A;  3BQ3 A;  3ZWH A;  1AP4 A;  1H8B A;  1CFF A;  1MR8 A;  2MHH A;  1WLZ A;  4HRE E;  3TZ1 A;  1S1E A;  1B7T Z;  2GGM A;  1DJH A;  1YUT A;  2SCP A;  4TNC A;  3OHM B;  4I5K A;  4U8D A;  1CTR A;  3PN7 B;  1PAL A;  1Y1X A;  4GNK B;  1OQP A;  2L2E A;  4R1E A;  2M49 B;  1E8A A;  1AJ4 A;  1OE9 B;  3DVM A;  1MXE A;  4GGF A;  4FQO A;  1CM1 A;  1PRW A;  1Y1U A;  1QAT A;  2JTT A;  1AVS A;  2Q91 A;  1IG5 A;  2ISD A;  3CS1 A;  1UHN A;  2FJU B;  3LK1 A;  1C07 A;  5AFP A;  2JOJ A;  3AAJ A;  3WHU B;  1QIV A;  3FS7 A;  2L98 A;  3TUY C;  4M2Q A;  1K9P A;  4N5X A;  1RRO A;  3DVJ A;  1XFX O;  3BOW B;  3OB2 B;  3JVT C;  1F55 A;  2LVI A;  2WCF A;  2E6W A;  1J7R A;  3A4U B;  1GQM A;  1R2U A;  4NDC A;  1ZOT B;  5CPV A;  1CB1 A;  2G9B A;  2JQ6 A;  5J3X A;  5JJG A;  1IJ6 A;  1M63 B;  1NYA A;  2M3W A;  1K96 A;  2O5G A;  1CDN A;  3E3R A;  2JU0 A;  3IQO A;  5F6T A;  2NXQ A;  4CFQ A;  1QXP A;  2ZND A;  1K93 D;  5D69 A;  1J7O A;  5JOL A;  3GK4 X;  3I5I C;  1CDP A;  5IBW A;  1B8R A;  2KAX A;  1CFD A;  1K95 A;  2MLE C;  1SMG A;  2MA2 A;  3EVV A;  3DF0 A;  1PVB A;  1GGZ A;  2PVB A;  1WRL A;  4QJ3 B;  1DJY A;  2F2O A;  1DJZ A;  3CR4 X;  2PMY A;  3BXK A;  4CPV A;  1LVC D;  4DIR A;  2Y4Q A;  2KAY A;  4M2P A;  2Y1N A;  1KFX S;  4DCK A;  1U5I B;  1KFU L;  1CMF A;  1UHJ A;  2K7B A;  1ALV A;  3TUY B;  5CSI A;  2EC6 C;  1B9A A;  1A29 A;  3KO0 A;  1RTP 1;  4PHK A;  2F3Y A;  1SK6 D;  5I2O A;  3BUX B;  2I18 A;  2HQ8 A;  1MXL C;  2PSR A;  3JVT B;  3WXA A;  3IF7 A;  3LCP C;  1SL7 A;  4OCI A; 
#chains in the Genus database with same CATH topology
 3KPX A;  2QDI A;  2LP3 A;  1DTL A;  3OX6 A;  1QS7 A;  1AK8 A;  1QV0 A;  2KLE A;  1W7I B;  1P28 A;  4XYN A;  1OSA A;  2QAC A;  1MF8 B;  3I5I B;  3HX4 A;  1WY9 A;  3SG5 A;  1NX3 A;  4OR9 B;  3UNW A;  1ODB A;  3TDZ A;  1NX2 A;  3ICB A;  1BLQ A;  1KQV A;  5K89 A;  4MLW A;  3VRN A;  1XFR A;  1Z2C B;  1OW4 A;  2G2B A;  3EVR A;  3CR2 A;  1LA3 A;  5D3O A;  2K2A A;  1IRJ A;  2FCD A;  2LMU A;  1IH0 A;  1G33 A;  2BCB A;  4I5N B;  1DEL A;  4OKH A;  2KYC A;  1KK7 Z;  1BR1 B;  1SL8 A;  2KBM A;  3C1V A;  1N0Y A;  2L4I A;  3S0D A;  1F70 A;  3BJH A;  5HKW A;  1XK4 C;  1FPW A;  3OB1 B;  3SG2 A;  4AQJ A;  1BT6 A;  2EC6 B;  2EHB A;  1EH2 A;  3B87 A;  2K7D A;  1LXF C;  2QEO A;  1IKU A;  4PE1 A;  1FW4 A;  2JT8 A;  1LIN A;  1GGW A;  3D10 A;  2QEH A;  4AOM A;  3B88 A;  1B8L A;  4DS7 A;  2ZN9 A;  3VB1 A;  1L2O C;  2ZKM X;  3D0Y A;  1NCY A;  1OMR A;  3CZ1 A;  1UUR A;  3OGN A;  2OPO A;  1G4Y R;  1N2D A;  1WDC B;  1CDM A;  3UO9 A;  3CGA A;  1DJI A;  1A4P A;  1XFU O;  1JFK A;  3AKB A;  3TDU A;  4QJ5 B;  1CMG A;  1HT9 A;  2JNX A;  1KFU S;  4N1G A;  1YVL A;  5ER4 X;  3EVU A;  4YGB B;  1EJ3 A;  5CSF A;  2BE4 A;  2F33 A;  3WHT B;  1XFV O;  3A8R A;  2WND A;  3HCM A;  2KFF A;  2EGD A;  2JPO A;  2OS8 C;  4WQ2 A;  3VRO A;  1K2H A;  2JNF A;  4GBA A;  1TNP A;  1TNQ A;  4A4C A;  2F8P A;  2M8U A;  1TN4 A;  2HPS A;  4OV2 A;  2LVJ A;  2H61 C;  1BMO A;  1SW8 A;  5B8I B;  1NP8 A;  1ZMZ A;  3OX5 A;  1S36 A;  3BUO B;  3S0F A;  3DVK A;  3ZNI A;  1UUS A;  5CSN A;  1AJ5 A;  1PUL A;  4E68 A;  1DJW A;  5FYX A;  3JTD C;  3FIA A;  2M97 A;  4INX A;  2M7L A;  4BY5 A;  2JPT A;  3DXL A;  3I5G C;  4C0L A;  1QIW A;  1SRA A;  1NWD A;  1RK9 A;  3O2P A;  4MZK A;  1XVJ A;  2KPH A;  4MVF A;  3RZS A;  4P2Y B;  1SY9 A;  1JFJ A;  1L2O B;  1TWO A;  3LL8 B;  1IQ5 A;  1DC1 A;  4YBH B;  3VRR A;  2MLF C;  3TDI A;  3O78 A;  1KWO C;  2CBL A;  3R1V A;  1QX2 A;  2B1U A;  2LHL A;  3CZT X;  3LK0 A;  1FI6 A;  2HET A;  3F45 A;  1B47 A;  2L50 A;  3RM1 A;  2KOT A;  2KSP A;  3DF0 B;  1YR5 A;  3PFV A;  1UHH A;  1A03 A;  4ORC B;  2LLT A;  1DMO A;  4PE4 A;  3BFB A;  2LM5 A;  4IJ7 A;  1QVI Z;  2AMI A;  3GK1 A;  4ORA B;  4QJ4 B;  4NDB A;  5AER A;  1BR4 B;  1Y0V H;  2OS8 B;  2SAS A;  3PM8 A;  2ERB A;  1CFP A;  1EL4 A;  1QWV A;  1TCF A;  3SS4 A;  3S0A A;  4GFT A;  3SIB A;  2LNK A;  1CLL A;  1DJX A;  2KYF A;  3L4L A;  3L4A A;  2ZRS A;  1DT7 B;  3O4X A;  3SS5 A;  1HQV A;  2L51 A;  1A75 A;  1AHR A;  2RGI A;  3JTD B;  3NSO A;  2LVV A;  2BCA A;  2TN4 A;  3I5G B;  2NLN A;  5PAL A;  4JKT A;  3SG3 A;  2KAV A;  1N65 A;  1KK7 Y;  2A4J A;  4F7F A;  1F4O A;  1S6J A;  3NSK A;  4HRH A;  3EKJ A;  2F2P A;  2L5X B;  4ICB A;  1DGV A;  3B7A A;  3PJI A;  3SG6 A;  2WCM A;  4P5O E;  3VGO A;  3CDN A;  4D1E A;  1C3Z A;  1KWO B;  1YUU A;  2JRF A;  1V1G A;  3BOW A;  2JTZ A;  3GOF A;  1S6C A;  2LMT A;  3EK8 A;  3MSE B;  2MBX A;  1H4B A;  2NZ0 A;  3CLN A;  1YUS A;  4PHN A;  1OOJ A;  4PE7 A;  2K0J A;  2ZNE A;  2LHI A;  3I5H B;  4NQG A;  1TUZ A;  1QX7 A;  5AXI A;  5DKQ A;  4ZCU A;  1YRT B;  2NCO A;  1KQM C;  3VRP A;  1KCY A;  5HLO A;  1CLB A;  1CLM A;  1UP5 A;  2KFH A;  1EG3 A;  5KTY A;  1PSB A;  1LA0 A;  1F8H A;  1WDC C;  2KLD A;  4L9M A;  4INW A;  1S5G Z;  3D75 A;  4XJK B;  4C0K A;  1RFJ A;  4MRY A;  2WCJ A;  1SCM B;  1TUJ A;  3CYZ A;  1M39 A;  1MQ1 A;  1XYD A;  2LLS A;  2WC8 A;  3EK7 A;  5HKY A;  1W7J B;  2LCP A;  3SJS A;  1OZS A;  4GGF C;  1BF5 A;  2MJW B;  2AUC A;  4ORB B;  1YRU B;  1JSA A;  2JT0 A;  3IQQ A;  2FCE A;  3CTN A;  2BEC A;  2M1K B;  1YX8 A;  3FE9 A;  1MHO A;  1NPQ A;  3PAL A;  5ER5 A;  1YTZ C;  2M1U A;  4NDD A;  3SG4 A;  1J7P A;  2COL B;  3D0Y B;  4I5L B;  2GTE A;  2KQY A;  4HRG A;  2KI6 D;  1RWY A;  2BCX A;  2CCM A;  5D7F A;  4FTG A;  2GGZ A;  2ZFD A;  3O4Y A;  1FI5 A;  1BU3 A;  1NUB A;  2LAN A;  1DF0 A;  2JT3 A;  4A4B A;  2LP2 A;  2BBN A;  2MRD A;  1M31 A;  5DKR A;  3BUW B;  3CAB A;  1KQM B;  1NIW A;  1QJT A;  2WCK A;  2ZRT A;  2LMV A;  1JUO A;  2K7C A;  5DKN A;  2JZI A;  1Q80 A;  4DRW A;  1QTX A;  5EL2 A;  3FE8 A;  3PAT A;  3RLZ A;  4ETO A;  2D8N A;  3KF9 A;  1BG1 A;  1IJ5 A;  3EG5 B;  2LC5 A;  3AKA A;  1DVI A;  1QLK A;  1SL9 A;  2AAO A;  1IGV A;  2BKH B;  3PM2 A;  1IQ3 A;  1ZUZ A;  1V1F A;  1YVH A;  1J1D A;  1CFC A;  2YGU A;  1MUX A;  1SBJ A;  2IS9 A;  3KHE A;  1QVI Y;  1XFW O;  2M0R A;  3D74 A;  3DVE A;  1S26 D;  2CTN A;  4MSP A;  2BE6 A;  3DY9 A;  1IWQ A;  4YGD B;  2K61 A;  2L5Y A;  1ZFS A;  3D76 A;  2K60 A;  3DD4 A;  3I5F C;  1REC A;  1TTX A;  2QEV A;  3IVT A;  5G08 A;  1J55 A;  3BFH A;  3R1O A;  4CID A;  1XFZ O;  1CKK A;  4PCW A;  4HSZ A;  2KHN A;  2Y1M A;  4M2O A;  4DUQ A;  3NHI A;  1YX7 A;  2KBI A;  5HKZ A;  4JPZ B;  1G8I A;  1IIO A;  1LKJ A;  1C7V A;  2JWW A;  5FI7 A;  1AUI B;  4GUK A;  2KFG A;  1RJV A;  2PAS A;  1JWD A;  3CZ0 A;  3S0G A;  2OTG C;  3Q8I A;  4KYN A;  1JBA A;  4MRX A;  3FWC A;  3CWG A;  4PHJ A;  1UHI A;  2BL0 C;  3I5H C;  3NXA A;  2PYQ A;  1FBV A;  2Q4U A;  1K9K A;  1TOP A;  3EK4 A;  3R72 A;  2E30 A;  1K9U A;  3SIA A;  1FF1 A;  1A75 B;  3BUN B;  5KU1 A;  5TNC A;  3QRX A;  1XO5 A;  2L0P A;  4CFR A;  3B6X A;  2K2F A;  4GPL B;  1K90 D;  2JXC A;  1OOH A;  1B4C A;  1KSM A;  1BJF A;  1S5G Y;  1SCM C;  1Y6W A;  1DJG A;  1XK4 A;  1LS8 A;  1OZO A;  3PLF B;  1NSH A;  4C0J A;  3I5F B;  2KI4 B;  5DIC A;  1K8U A;  2I2R E;  3N7H A;  1D1O A;  3FWB A;  4GAO A;  1M46 A;  2BKI B;  4MEW A;  1TCO B;  2KQ6 A;  3TS5 C;  2LAP A;  1WLM A;  2V53 A;  2I94 A;  2M9G A;  3H4S E;  3D78 A;  2CNP A;  1WRK A;  2VRG A;  3M0W A;  4USL A;  4JWQ A;  5KSZ A;  1WRZ A;  1Y1A A;  2L4H A;  1NX1 A;  4GGN A;  1F54 A;  2KGR A;  3O6B A;  1S3P A;  1C7W A;  3DYE A;  4PHM A;  1B1G A;  1NCX A;  1GJY A;  2LUX A;  2LUC A;  2ZN8 A;  4UPG A;  4I5J A;  1F71 A;  1X02 A;  2P6B B;  2KDH A;  2LLU A;  2GV5 A;  2M29 A;  2OTG B;  5HYD A;  2PAL A;  1XA5 A;  2WCE A;  2Y5I A;  1KK8 C;  4WRI A;  1M45 A;  2BL0 B;  1R6P A;  2KGB C;  4BY4 A;  3EKH A;  4YI9 A;  4YGE B;  4YRU A;  2MAZ A;  5BPJ A;  2HF5 A;  1F4Q A;  1CDL A;  4Q04 A;  4YI8 A;  4MBE A;  3NSL A;  2WCL A;  2JXL A;  2FJY A;  2QPT A;  4YGC B;  3S0E A;  1QLS A;  2H8V A;  2KNE A;  2H61 A;  5HLV A;  1SNL A;  1QV1 A;  2PRU A;  1A2X A;  2P70 A;  1TIZ A;  2H2K A;  4PDZ A;  4ZCV A;  3GK2 A;  1OOF A;  1YUR A;  2I7A A;  1MWN A;  1EG4 A;  1QX5 B;  2BBM A;  1L7Z A;  2HQW A;  1TRF A;  3CR5 X;  3TS5 B;  5AAN A;  2LV7 A;  1PVA A;  1TNW A;  3DZT A;  3AAK A;  5CSJ A;  1DF0 B;  1SPY A;  1U5I A;  1CM4 A;  3VRQ A;  1Z4H A;  1ORG A;  1TNX A;  1OMD A;  2PQL A;  1JF0 A;  4JQ0 D;  2WOR A;  2WCH A;  5FI6 A;  2M7N A;  5I8N A;  1J1E A;  1NCZ A;  1JF2 A;  4YGA A;  3PSR A;  4MN0 A;  2WCB A;  1KK8 B;  2F3Z A;  4AQI A;  1OOI X;  2NCP A;  1SR6 C;  2CXJ A;  4IL1 A;  1QAS A;  2LE9 B;  3LLE A;  1DEK A;  1BOD A;  5I2Q A;  1J7Q A;  2JUL A;  4XJK A;  1K94 A;  2O60 A;  1SKT A;  3NGV A;  1B7T Y;  1KSO A;  3K21 A;  3PN7 C;  1OMV A;  2FOT A;  2CT9 A;  3SG7 A;  1SYM A;  1JC2 A;  1UWO A;  2JC2 A;  4MZL A;  1S6I A;  2KI6 C;  4PE0 A;  4OVN F;  3BUM B;  1BOC A;  5GQQ C;  2R2I A;  1SCV A;  3KEV A;  1SSE B;  1PK0 D;  5HL1 A;  5AEQ A;  4WQ3 A;  1B8C A;  2K8M B;  1UHK A;  1T14 A;  2WOS A;  1ALW A;  2KI4 C;  1NX0 A;  3WNX B;  4PAL A;  1EXR A;  2K7O A;  3NSI A;  4N1F A;  5I2L A;  4F0Z B;  2LVK A;  4CLN A;  1DGU A;  3OBV A;  1CNP A;  3OP0 A;  1ZAC A;  3BYA A;  4MZJ A;  3BFA A;  1KFX L;  1PSR A;  1XFY O;  1SR6 B;  1VRK A;  2DOQ A;  3BQ3 A;  3V2L A;  3ZWH A;  1AP4 A;  1H8B A;  1CFF A;  3B86 A;  1MR8 A;  2MHH A;  3S0B A;  2BAP A;  1WLZ A;  4HRE E;  3TZ1 A;  1S1E A;  4PT1 A;  1B7T Z;  2GGM A;  1DJH A;  3D73 A;  1YUT A;  2SCP A;  3QME A;  4TNC A;  3OHM B;  4I5K A;  4U8D A;  1CTR A;  3PN7 B;  1PAL A;  1Y1X A;  4GNK B;  1C3Y A;  1OQP A;  2L2E A;  4R1E A;  2M49 B;  1E8A A;  1AJ4 A;  1OE9 B;  3DVM A;  1MXE A;  4GGF A;  2L2C A;  4FQO A;  1CM1 A;  1PRW A;  1Y1U A;  1QAT A;  2JTT A;  1AVS A;  2Q91 A;  4FQT A;  1IG5 A;  2ISD A;  3CS1 A;  1UHN A;  2FJU B;  3LK1 A;  1C07 A;  5AFP A;  2JOJ A;  3AAJ A;  3WHU B;  1QIV A;  3FS7 A;  2L98 A;  3TUY C;  2BNX A;  4M2Q A;  4JD9 A;  1K9P A;  2WC6 A;  3L47 A;  4N5X A;  1RRO A;  3DVJ A;  1XFX O;  3BOW B;  3OB2 B;  3JVT C;  1F55 A;  2LVI A;  2WCF A;  2E6W A;  1J7R A;  3A4U B;  1GQM A;  1R2U A;  4NDC A;  1ZOT B;  5CPV A;  1CB1 A;  2G9B A;  2JQ6 A;  5J3X A;  5JJG A;  1IJ6 A;  1M63 B;  1NYA A;  2M3W A;  1K96 A;  2O5G A;  1CDN A;  3E3R A;  2QEB A;  2JU0 A;  3IQO A;  5F6T A;  3SS3 A;  2NXQ A;  3D77 A;  1QXP A;  1DQE A;  4CFQ A;  1OOG A;  1W9Z A;  5FI2 A;  2ZND A;  1K93 D;  5D69 A;  5I94 A;  1J7O A;  5JOL A;  3GK4 X;  3I5I C;  1CDP A;  5IBW A;  1B8R A;  2KAX A;  1CFD A;  1K95 A;  2MLE C;  1SMG A;  2MA2 A;  3EVV A;  3DF0 A;  1PVB A;  1GGZ A;  2PVB A;  1WRL A;  4QJ3 B;  1DJY A;  2F2O A;  1DJZ A;  2WC5 A;  3CR4 X;  2P71 A;  2PMY A;  3BXK A;  4CPV A;  1LVC D;  4DIR A;  2Y4Q A;  2KAY A;  4M2P A;  2Y1N A;  1KFX S;  4DCK A;  1U5I B;  3R1P A;  1KFU L;  1CMF A;  1UHJ A;  2K7B A;  1ALV A;  3NHT A;  3TUY B;  5CSI A;  2EC6 C;  1B9A A;  1A29 A;  3KO0 A;  1RTP 1;  4OZD A;  4PHK A;  2F3Y A;  1SK6 D;  5I2O A;  3BUX B;  2I18 A;  2HQ8 A;  1MXL C;  2PSR A;  3FE6 A;  3JVT B;  3WXA A;  3IF7 A;  3K1E A;  1GM0 A;  3LCP C;  3CZ2 A;  1SL7 A;  4OCI A; 
#chains in the Genus database with same CATH homology
 3KPX A;  2LP3 A;  1DTL A;  3OX6 A;  1QS7 A;  1AK8 A;  1QV0 A;  1W7I B;  4XYN A;  1OSA A;  2QAC A;  1MF8 B;  3I5I B;  3HX4 A;  1WY9 A;  3SG5 A;  1NX3 A;  4OR9 B;  1ODB A;  3TDZ A;  1NX2 A;  3ICB A;  1BLQ A;  1KQV A;  5K89 A;  4MLW A;  3VRN A;  2G2B A;  3EVR A;  3CR2 A;  1LA3 A;  2K2A A;  1IRJ A;  2FCD A;  2LMU A;  1IH0 A;  1G33 A;  2BCB A;  4I5N B;  4OKH A;  2KYC A;  1KK7 Z;  1BR1 B;  1SL8 A;  2KBM A;  3C1V A;  1N0Y A;  2L4I A;  1F70 A;  5HKW A;  1XK4 C;  1FPW A;  3OB1 B;  3SG2 A;  4AQJ A;  1BT6 A;  2EC6 B;  2EHB A;  1EH2 A;  2K7D A;  1LXF C;  1IKU A;  4PE1 A;  1FW4 A;  2JT8 A;  1LIN A;  1GGW A;  3D10 A;  4AOM A;  1B8L A;  4DS7 A;  2ZN9 A;  1L2O C;  2ZKM X;  3D0Y A;  1NCY A;  1OMR A;  1UUR A;  2OPO A;  1G4Y R;  1N2D A;  1WDC B;  1CDM A;  4QJ5 B;  3CGA A;  1DJI A;  1A4P A;  1XFU O;  1JFK A;  3AKB A;  3TDU A;  1CMG A;  1HT9 A;  2JNX A;  1KFU S;  4N1G A;  1YVL A;  5ER4 X;  3EVU A;  4YGB B;  1EJ3 A;  5CSF A;  2BE4 A;  2F33 A;  3WHT B;  1XFV O;  3A8R A;  2WND A;  3HCM A;  2KFF A;  2EGD A;  2OS8 C;  4WQ2 A;  3VRO A;  1K2H A;  2JNF A;  4GBA A;  1TNP A;  1TNQ A;  4A4C A;  2F8P A;  2M8U A;  1TN4 A;  2HPS A;  4OV2 A;  2LVJ A;  2H61 C;  1BMO A;  1SW8 A;  5B8I B;  1NP8 A;  1ZMZ A;  3OX5 A;  1S36 A;  3BUO B;  3DVK A;  3ZNI A;  1UUS A;  5CSN A;  1AJ5 A;  1PUL A;  4E68 A;  1DJW A;  5FYX A;  3JTD C;  3FIA A;  2M97 A;  2M7L A;  4BY5 A;  4C0L A;  2JPT A;  3I5G C;  1QIW A;  1SRA A;  1NWD A;  1RK9 A;  3O2P A;  4MZK A;  1XVJ A;  4MVF A;  4P2Y B;  1SY9 A;  1JFJ A;  1L2O B;  3LL8 B;  1IQ5 A;  4YBH B;  3VRR A;  2MLF C;  3TDI A;  3O78 A;  1KWO C;  2CBL A;  1QX2 A;  2B1U A;  2LHL A;  3CZT X;  3LK0 A;  1FI6 A;  2HET A;  3F45 A;  1B47 A;  2L50 A;  3RM1 A;  2KOT A;  2KSP A;  3DF0 B;  1YR5 A;  3PFV A;  1UHH A;  1A03 A;  4ORC B;  2LLT A;  1DMO A;  4PE4 A;  2LM5 A;  1QVI Z;  2AMI A;  3GK1 A;  4ORA B;  4QJ4 B;  4NDB A;  5AER A;  1BR4 B;  1Y0V H;  2OS8 B;  2SAS A;  3PM8 A;  1CFP A;  1EL4 A;  1TCF A;  4GFT A;  3SIB A;  2LNK A;  1CLL A;  1DJX A;  2KYF A;  2ZRS A;  1DT7 B;  1HQV A;  2L51 A;  1A75 A;  1AHR A;  2RGI A;  3JTD B;  3NSO A;  2LVV A;  2BCA A;  2TN4 A;  3I5G B;  2NLN A;  5PAL A;  3SG3 A;  2KAV A;  1N65 A;  1KK7 Y;  2A4J A;  1F4O A;  1S6J A;  3NSK A;  4HRH A;  3EKJ A;  2F2P A;  2L5X B;  4ICB A;  1DGV A;  3VGO A;  4CLN A;  3SG6 A;  4P5O E;  4D1E A;  1KWO B;  1YUU A;  2JRF A;  1V1G A;  3BOW A;  2JTZ A;  3GOF A;  1S6C A;  2LMT A;  3EK8 A;  3MSE B;  2MBX A;  1H4B A;  2NZ0 A;  3CLN A;  1YUS A;  4PHN A;  1OOJ A;  4PE7 A;  2K0J A;  2ZNE A;  2LHI A;  3I5H B;  4NQG A;  1QX7 A;  5AXI A;  5DKQ A;  4ZCU A;  1YRT B;  2NCO A;  1KQM C;  3VRP A;  1KCY A;  5HLO A;  1CLB A;  1CLM A;  1UP5 A;  2KFH A;  1EG3 A;  5KTY A;  1PSB A;  1LA0 A;  1F8H A;  1WDC C;  4L9M A;  1S5G Z;  4XJK B;  4C0K A;  1RFJ A;  4MRY A;  1SCM B;  1M39 A;  1MQ1 A;  1XYD A;  2LLS A;  2WC8 A;  3EK7 A;  5HKY A;  1W7J B;  2LCP A;  3SJS A;  1OZS A;  4GGF C;  1BF5 A;  2MJW B;  2AUC A;  4ORB B;  1YRU B;  1JSA A;  2JT0 A;  3IQQ A;  2FCE A;  3CTN A;  2BEC A;  2M1K B;  1YX8 A;  3PAL A;  1MHO A;  1NPQ A;  5ER5 A;  3RLZ A;  1YTZ C;  2M1U A;  4NDD A;  3SG4 A;  1J7P A;  2COL B;  3D0Y B;  4I5L B;  2KQY A;  4HRG A;  2KI6 D;  1RWY A;  2BCX A;  2CCM A;  5D7F A;  4FTG A;  2GGZ A;  2ZFD A;  3O4Y A;  1FI5 A;  1BU3 A;  1NUB A;  2LAN A;  1DF0 A;  2JT3 A;  4A4B A;  2LP2 A;  2BBN A;  2MRD A;  1M31 A;  5DKR A;  3BUW B;  1KQM B;  1NIW A;  1QJT A;  2ZRT A;  2LMV A;  1JUO A;  2K7C A;  5DKN A;  2JZI A;  1Q80 A;  4DRW A;  1QTX A;  3PAT A;  4ETO A;  2D8N A;  3KF9 A;  1BG1 A;  1IJ5 A;  2LC5 A;  3AKA A;  1DVI A;  1QLK A;  1SL9 A;  2AAO A;  1IGV A;  2BKH B;  1IQ3 A;  1ZUZ A;  1V1F A;  1YVH A;  1J1D A;  1CFC A;  1MUX A;  1SBJ A;  2IS9 A;  3KHE A;  1QVI Y;  1XFW O;  2M0R A;  3DVE A;  1S26 D;  2CTN A;  4MSP A;  2BE6 A;  1IWQ A;  4YGD B;  2K61 A;  1ZFS A;  3DD4 A;  3I5F C;  1REC A;  1TTX A;  5G08 A;  1J55 A;  4CID A;  1CKK A;  1XFZ O;  4PCW A;  4HSZ A;  2KHN A;  2Y1M A;  4M2O A;  4DUQ A;  1YX7 A;  2KBI A;  5HKZ A;  4JPZ B;  1G8I A;  1LKJ A;  1C7V A;  2JWW A;  1AUI B;  4GUK A;  2KFG A;  1RJV A;  2PAS A;  1JWD A;  2OTG C;  1JBA A;  4MRX A;  3FWC A;  3CWG A;  4PHJ A;  1UHI A;  2BL0 C;  3I5H C;  3NXA A;  1FBV A;  2Q4U A;  1K9K A;  1TOP A;  3EK4 A;  3SIA A;  2E30 A;  1K9U A;  1FF1 A;  1A75 B;  3BUN B;  5KU1 A;  5TNC A;  3QRX A;  1XO5 A;  2L0P A;  4CFR A;  2K2F A;  4GPL B;  1K90 D;  2JXC A;  1B4C A;  1KSM A;  1BJF A;  1S5G Y;  1SCM C;  1Y6W A;  1DJG A;  1XK4 A;  1OZO A;  3PLF B;  1NSH A;  4C0J A;  3I5F B;  2KI4 B;  1K8U A;  2I2R E;  1D1O A;  3FWB A;  4GAO A;  1M46 A;  2BKI B;  4MEW A;  1TCO B;  2KQ6 A;  3TS5 C;  2LAP A;  1WLM A;  2V53 A;  2I94 A;  2M9G A;  3H4S E;  2CNP A;  1WRK A;  2VRG A;  3M0W A;  4USL A;  4JWQ A;  5KSZ A;  1WRZ A;  1Y1A A;  2L4H A;  1NX1 A;  4GGN A;  1F54 A;  2KGR A;  3O6B A;  1S3P A;  1C7W A;  4PHM A;  1B1G A;  1NCX A;  1GJY A;  2LUX A;  2LUC A;  2ZN8 A;  4UPG A;  4I5J A;  1F71 A;  1X02 A;  2P6B B;  2KDH A;  2LLU A;  2GV5 A;  2M29 A;  2OTG B;  5HYD A;  2PAL A;  1XA5 A;  2WCE A;  2Y5I A;  1KK8 C;  4WRI A;  1M45 A;  2BL0 B;  1R6P A;  2KGB C;  4BY4 A;  3EKH A;  4YI9 A;  4YGE B;  4YRU A;  2MAZ A;  5BPJ A;  2HF5 A;  1F4Q A;  1CDL A;  4Q04 A;  4YI8 A;  4MBE A;  3NSL A;  2JXL A;  2QPT A;  4YGC B;  1QLS A;  2KNE A;  2H61 A;  5HLV A;  1SNL A;  1QV1 A;  2PRU A;  1A2X A;  1TIZ A;  2H2K A;  4PDZ A;  4ZCV A;  3GK2 A;  1YUR A;  2I7A A;  1MWN A;  1EG4 A;  1QX5 B;  2BBM A;  1L7Z A;  2HQW A;  1TRF A;  3CR5 X;  3TS5 B;  5AAN A;  2LV7 A;  1PVA A;  1TNW A;  3AAK A;  5CSJ A;  1DF0 B;  1SPY A;  1U5I A;  1CM4 A;  3VRQ A;  1TNX A;  1OMD A;  1JF0 A;  4JQ0 D;  2WOR A;  2M7N A;  5I8N A;  1J1E A;  1NCZ A;  1JF2 A;  4YGA A;  3PSR A;  4MN0 A;  2WCB A;  1KK8 B;  2F3Z A;  4AQI A;  2NCP A;  1SR6 C;  2CXJ A;  4IL1 A;  1QAS A;  2LE9 B;  3LLE A;  1BOD A;  5I2Q A;  1J7Q A;  2JUL A;  4XJK A;  1K94 A;  2O60 A;  1SKT A;  1B7T Y;  1KSO A;  3K21 A;  3PN7 C;  1OMV A;  2FOT A;  2CT9 A;  3SG7 A;  1SYM A;  1JC2 A;  1UWO A;  2JC2 A;  4MZL A;  1S6I A;  2KI6 C;  4PE0 A;  4OVN F;  3BUM B;  1BOC A;  5GQQ C;  2R2I A;  1SCV A;  3KEV A;  1PK0 D;  5AEQ A;  4WQ3 A;  1B8C A;  2K8M B;  1UHK A;  2WOS A;  1ALW A;  2KI4 C;  1NX0 A;  3WNX B;  4PAL A;  1EXR A;  2K7O A;  3NSI A;  4N1F A;  5I2L A;  4F0Z B;  2LVK A;  1DGU A;  1CNP A;  3OP0 A;  1ZAC A;  3BYA A;  4MZJ A;  1KFX L;  1PSR A;  1XFY O;  1SR6 B;  1VRK A;  2DOQ A;  3BQ3 A;  3ZWH A;  1AP4 A;  1H8B A;  1CFF A;  1MR8 A;  2MHH A;  1WLZ A;  4HRE E;  3TZ1 A;  1S1E A;  1B7T Z;  2GGM A;  1DJH A;  1YUT A;  2SCP A;  4TNC A;  3OHM B;  4I5K A;  4U8D A;  1CTR A;  3PN7 B;  1PAL A;  1Y1X A;  4GNK B;  1OQP A;  2L2E A;  4R1E A;  2M49 B;  1E8A A;  1AJ4 A;  1OE9 B;  3DVM A;  1MXE A;  4GGF A;  4FQO A;  1CM1 A;  1PRW A;  1Y1U A;  1QAT A;  2JTT A;  1AVS A;  2Q91 A;  1IG5 A;  2ISD A;  3CS1 A;  1UHN A;  2FJU B;  3LK1 A;  1C07 A;  5AFP A;  2JOJ A;  3AAJ A;  3WHU B;  1QIV A;  3FS7 A;  2L98 A;  3TUY C;  4M2Q A;  1K9P A;  4N5X A;  1RRO A;  3DVJ A;  1XFX O;  3BOW B;  3OB2 B;  3JVT C;  1F55 A;  2LVI A;  2WCF A;  2E6W A;  1J7R A;  3A4U B;  1GQM A;  1R2U A;  4NDC A;  1ZOT B;  5CPV A;  1CB1 A;  2G9B A;  2JQ6 A;  5J3X A;  5JJG A;  1IJ6 A;  1M63 B;  1NYA A;  2M3W A;  1K96 A;  2O5G A;  1CDN A;  3E3R A;  2JU0 A;  3IQO A;  5F6T A;  2NXQ A;  4CFQ A;  1QXP A;  2ZND A;  1K93 D;  5D69 A;  1J7O A;  5JOL A;  3GK4 X;  3I5I C;  1CDP A;  5IBW A;  1B8R A;  2KAX A;  1CFD A;  1K95 A;  2MLE C;  1SMG A;  2MA2 A;  3EVV A;  3DF0 A;  1PVB A;  1GGZ A;  2PVB A;  1WRL A;  4QJ3 B;  1DJY A;  2F2O A;  1DJZ A;  3CR4 X;  2PMY A;  3BXK A;  4CPV A;  1LVC D;  4DIR A;  2Y4Q A;  2KAY A;  4M2P A;  2Y1N A;  1KFX S;  4DCK A;  1U5I B;  1KFU L;  1CMF A;  1UHJ A;  2K7B A;  1ALV A;  3TUY B;  5CSI A;  2EC6 C;  1B9A A;  1A29 A;  3KO0 A;  1RTP 1;  4PHK A;  2F3Y A;  1SK6 D;  5I2O A;  3BUX B;  2I18 A;  2HQ8 A;  1MXL C;  2PSR A;  3JVT B;  3WXA A;  3IF7 A;  3LCP C;  1SL7 A;  4OCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...