1L2OC

Scallop myosin s1-adp-p-pdm in the actin-detached conformation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords MYOSIN HEAVY CHAIN
total genus 37
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2002-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l2oC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l2oC02
1MF8B 2K8MB 3WXAA 2AUCA 2LUCA 1W7JB 2B1UA 1M31A 1JC2A 1RWYA 1B7TZ 3CGAA 1SYMA 2EC6B 4GGFC 3EK8A 1J7RA 1DVIA 1YUTA 2GV5A 1WY9A 3FWBA 5ER4X 1F54A 3TDIA 1XK4C 4DRWA 1WDCC 3CR2A 2M1KB 1BJFA 2BCXA 4AQJA 4GPLB 1SR6C 1UP5A 2BE4A 2LLTA 4YI9A 3AAKA 1YRUB 2Y1MA 2K2AA 1IRJA 1K8UA 2WNDA 1YVHA 2RGIA 3PN7B 3TS5B 1UURA 2LLUA 4N1GA 1IG5A 4MRYA 1B8LA 3O2PA 4ETOA 3BUOB 1CM4A 3ZNIA 1QX5B 2NLNA 2KYCA 4NDCA 1RROA 4YRUA 1KFXL 1TNPA 3SIAA 4MZJA 4MEWA 2LMVA 2Q4UA 5KTYA 1EJ3A 2G2BA 2KFFA 5HKYA 3I5IB 2LMUA 3NSKA 2KNEA 1S26D 2LVIA 4ZCVA 1Y1AA 5HLVA 5HKWA 1IH0A 1KQMB 2JNXA 3EVVA 4YGCB 4PHMA 4HRHA 1QX7A 4MN0A 2MBXA 2QPTA 1E8AA 1CMGA 3SG3A 1SBJA 5AXIA 2WCEA 2BBNA 2M97A 2A4JA 2KFGA 3DF0A 3LL8B 4QJ5B 5FYXA 1F8HA 2KQYA 5TNCA 2JRFA 1CDPA 1MWNA 1PALA 2CCMA 1TTXA 2JT8A 2HETA 3O78A 2E6WA 1NX2A 3SG6A 5I2LA 3CZTX 1YVLA 3NSIA 1K2HA 2M1UA 2LVJA 3FS7A 1WRLA 1UHJA 1FPWA 4IL1A 2F33A 1B7TY 1TIZA 2KFHA 4PE7A 2I2RE 4ORCB 1QLSA 4CPVA 1G4YR 3VRNA 4CFRA 5AEQA 2MHHA 3WNXB 2IS9A 3EKHA 5HKZA 5K89A 1H4BA 4PHNA 1L7ZA 1SRAA 1PVAA 3NXAA 1J7OA 2R2IA 2JWWA 3IQOA 1FBVA 2CTNA 1YUUA 2I94A 3DVKA 1EG3A 2EC6C 1IQ5A 1FW4A 1SCVA 3FWCA 3CWGA 1MR8A 3CTNA 3A8RA 4OVNF 1A03A 1XFUO 4DS7A 1YTZC 2O60A 1F4QA 1B4CA 1K95A 2H61A 5HYDA 1AJ5A 1IWQA 1LKJA 3JVTB 1RFJA 1A29A 1DF0B 2NCOA 4NDBA 2PRUA 5CPVA 2ZRTA 3I5GC 3BXKA 1QIVA 1QXPA 2Y1NA 3PN7C 4GGFA 1Y1UA 2K0JA 2F3YA 3PALA 2JC2A 4A4CA 2KI6C 1F55A 1DJYA 2L98A 4MZLA 2BCBA 2F8PA 2BE6A 2K7BA 1ZMZA 1SW8A 4P5OE 1K9KA 1FI6A 4U8DA 5D7FA 1V1GA 2JTZA 2K2FA 3NSLA 3PSRA 5AANA 1NX0A 2LVVA 2WCBA 4GUKA 1R2UA 1DJGA 1M45A 1MXLC 1DJHA 1BU3A 5D69A 1SPYA 1CFDA 1DGVA 3BUXB 1XO5A 2L4HA 1PSBA 2M49B 2CXJA 4M2PA 3WHUB 2E30A 1CLMA 1Y6WA 2H2KA 2LANA 5CSFA 3GK1A 3PM8A 3PLFB 1C7WA 2LLSA 4JWQA 4OR9B 1B8RA 4HSZA 4GGNA 2OS8B 1C7VA 1NCZA 1AJ4A 3DD4A 4NDDA 4GAOA 1EL4A 1S5GZ 1NX3A 1QASA 1BLQA 1DGUA 1KFUL 3LLEA 4MLWA 4N5XA 1M46A 4MBEA 1SCMC 1AVSA 2LUXA 3A4UB 1H8BA 4OKHA 1CB1A 2PALA 5I2OA 1KQVA 4ZCUA 1SL9A 4JQ0D 1AK8A 2JULA 2ZNDA 3RLZA 1MUXA 1OZOA 4TNCA 1W7IB 1BT6A 2KOTA 1NCXA 2SASA 1K90D 4WRIA 1XVJA 4A4BA 2KI4C 1U5IB 1YR5A 2F3ZA 3OP0A 2EGDA 4FTGA 2CT9A 3I5IC 4I5LB 1JWDA 1UHKA 1OOJA 1KCYA 3AKAA 1NCYA 1TOPA 2JXCA 3FIAA 2JOJA 4YGAA 2L0PA 2MJWB 1LVCD 2OTGC 4HREE 2H61C 2G9BA 1PSRA 4C0KA 1IJ5A 1TRFA 2P6BB 1SY9A 4NQGA 4ORBB 4C0LA 1RECA 2LM5A 2LP3A 3JVTC 1QVIZ 3TUYC 1KFXS 2JT0A 1QVIY 1SR6B 2HPSA 1LXFC 3PATA 3I5FC 2KBIA 1NUBA 3OX6A 3KPXA 1JUOA 1M63B 2GGMA 2K61A 4CIDA 3BOWB 1S6JA 1XFYO 1MXEA 4GNKB 4I5JA 1QV1A 1OQPA 2ZN9A 5AFPA 1IJ6A 1SKTA 2JTTA 1ZFSA 1KWOC 2CNPA 3OB2B 4N1FA 2QACA 4I5NB 5DKNA 1XFWO 1NSHA 1NWDA 1UWOA 2V53A 1KSMA 1QLKA 1BF5A 4FQOA 4JPZB 2K7CA 3JTDC 1TNQA 1DTLA 2KQ6A 3HCMA 1FI5A 3TDUA 1A75B 4ORAB 3BOWA 1V1FA 1WLMA 2AMIA 2L50A 1UHHA 1QIWA 1NPQA 1S5GY 2M8UA 4AQIA 4DUQA 3CR4X 2JU0A 3ICBA 1CLLA 1M39A 2M29A 2OS8C 1KK7Y 5DKRA 2L5XB 3I5GB 4E68A 5GQQC 2K7OA 2D8NA 1K96A 3DVMA 3TS5C 1S1EA 1K9UA 1OSAA 2M3WA 2ISDA 1PULA 2DOQA 1F4OA 1XFZO 3F45A 4BY5A 1CDNA 2KAVA 1KSOA 1DJXA 1JSAA 2OPOA 1JFJA 1B1GA 1KK7Z 3KHEA 1SL8A 1QJTA 1DF0A 1DJWA 1TN4A 1WRKA 3HX4A 5CSJA 4I5KA 1YURA 1RK9A 2Y4QA 1S6IA 1RTP1 1AHRA 1QX2A 2KHNA 1PVBA 2HF5A 3RM1A 3IF7A 2FOTA 2KI4B 4F0ZB 1SL7A 4PE4A 2M9GA 1F71A 4WQ2A 4Q04A 2BL0B 4DCKA 3ZWHA 1OMRA 2PMYA 2COLB 1IQ3A 1XFVO 2FCDA 3O4YA 2KSPA 2OTGB 1OMDA 2LP2A 1QTXA 1S3PA 1J7PA 1QATA 3LK1A 2KAXA 2FJUB 3KF9A 1JBAA 2WCFA 3KO0A 1J1EA 1WDCB 2CBLA 1YX8A 5JOLA 1G8IA 4GBAA 5J3XA 4C0JA 2JQ6A 3SIBA 3AKBA 5KSZA 5IBWA 3M0WA 1SNLA 4UPGA 2PVBA 2Y5IA 1GGWA 3AAJA 1A2XA 1PRWA 2O5GA 1JF0A 1CDLA 2JZIA 1AUIB 3DVJA 1XFXO 4PALA 1EXRA 1CFFA 1EG4A 2MLEC 1K93D 1NIWA 1TNWA 3BUNB 1YUSA 3C1VA 3E3RA 3LCPC 2NZ0A 1TCOB 2LE9B 3MSEB 1BOCA 3D0YB 2VRGA 1UUSA 1TNXA 1ZUZA 1B8CA 2EHBA 2KAYA 1C07A 1PK0D 3EKJA 1S6CA 3GOFA 5CSIA 4OV2A 4YI8A 1ZACA 3D0YA 4L9MA 4YGEB 1HQVA 2LAPA 2SCPA 1EH2A 3CLNA 1DT7B 5ER5A 2MLFC 4MSPA 4PE0A 1NP8A 3VRRA 1SCMB 2LNKA 5JJGA 3VGOA 1OZSA 3CR5X 3TDZA 1BODA 3WHTB 2HQWA 2BBMA 1WLZA 2AAOA 3GK4X 1LA0A 2WC8A 1LINA 5G08A 4DIRA 1WRZA 2NXQA 3IQQA 1BG1A 1JF2A 3O6BA 3OX5A 4MRXA 4XYNA 1MHOA 5F6TA 3BUMB 1KK8C 1GJYA 2BKHB 1X02A 1J1DA 2BECA 4PDZA 2HQ8A 1B47A 1CTRA 2K7DA 2MRDA 2BCAA 2BL0C 3I5HB 2LV7A 4PCWA 3SG2A 4AOMA 3SG4A 1QV0A 1Y0VH 2LMTA 2KGRA 3VRPA 4YGBB 3K21A 1LA3A 2LHLA 1TCFA 4MZKA 4M2OA 3SG7A 1QS7A 3OB1B 3DVEA 5HLOA 3I5HC 1R6PA 1DJZA 4PHKA 2BKIB 2TN4A 1Y1XA 1CFCA 1S36A 2LCPA 2ZFDA 4WQ3A 4QJ4B 2KGBC 3I5FB 1UHNA 2NCPA 2ZRSA 3BUWB 3JTDB 4XJKA 2I18A 3OHMB 4R1EA 4YBHB 3EVUA 1G33A 2F2OA 4MVFA 1HT9A 3LK0A 1J55A 2JT3A 4QJ3B 1VRKA 5I2QA 5I8NA 1YRTB 2PASA 1XK4A 1N2DA 3NSOA 2LVKA 1YX7A 4BY4A 2M7NA 1U5IA 3CS1A 2KI6D 1ALWA 2GGZA 3D10A 2KBMA 3KEVA 5PALA 4PHJA 2M7LA 3VROA 1NX1A 4PE1A 3EVRA 4CFQA 1CLBA 1ODBA 1CNPA 1OE9B 2KYFA 2L2EA 3GK2A 3DF0B 1DJIA 1ZOTB 3SG5A 1KQMC 4M2QA 4D1EA 1GQMA 2Q91A 1KK8B 1JFKA 3EK4A 1BR4B 2ZN8A 1N65A 2JNFA 2LHIA 5CSNA 1D1OA 2M0RA 1N0YA 3QRXA 1KWOB 1IGVA 5DKQA 3SJSA 1XYDA 1CKKA 1A75A 2L4IA 1ALVA 2PSRA 1SK6D 1KFUS 1NYAA 1L2OB 2F2PA 2I7AA 2LC5A 4YGDB 1SMGA 4OCIA 5BPJA 1UHIA 1K94A 1B9AA 4P2YB 3TUYB 1FF1A 2MA2A 1IKUA 1CMFA 4ICBA 1BMOA 1RJVA 5KU1A 3TZ1A 3PFVA 2ZKMX 1CDMA 1XA5A 3EK7A 2L51A 1L2OC 4HRGA 1GGZA 1MQ1A 2JPTA 1AP4A 1BR1B 5AERA 2MAZA 1DMOA 2JXLA 3BYAA 4CLNA 1Q80A 3H4SE 1A4PA 1K9PA 2KDHA 4GFTA 2FCEA 2WOSA 4USLA 3BQ3A 4XJKB 3VRQA 2ZNEA 1CM1A 1OMVA 5B8IB 1CFPA 1F70A 1J7QA 2WORA
chains in the Genus database with same CATH superfamily
1MF8B 2K8MB 4INWA 3WXAA 2AUCA 2LUCA 1W7JB 3B87A 5DICA 2B1UA 1M31A 2PYQA 5FI6A 1JC2A 1RWYA 1B7TZ 3CGAA 3N7HA 1SYMA 2EC6B 4GGFC 3EK8A 1J7RA 1OW4A 1DVIA 1YUTA 2GV5A 1WY9A 3FWBA 5ER4X 3S0GA 1F54A 3TDIA 1XK4C 3CZ2A 2QEHA 4DRWA 1OOHA 1WDCC 3CR2A 2M1KB 1SSEB 1BJFA 2BCXA 4AQJA 4GPLB 1SR6C 1UP5A 2BE4A 2LLTA 4YI9A 3AAKA 1YRUB 4JKTA 2Y1MA 2K2AA 1IRJA 1K8UA 2WNDA 1YVHA 2RGIA 2WCHA 3PN7B 3TS5B 1UURA 2LLUA 4N1GA 1IG5A 3OBVA 4MRYA 1B8LA 3O2PA 4ETOA 3BUOB 1CM4A 3CABA 3ZNIA 4PT1A 1QX5B 2NLNA 1T14A 1TUJA 2KYCA 4NDCA 1RROA 2K60A 4YRUA 1KFXL 1TNPA 3SIAA 4MZJA 4MEWA 1DELA 2LMVA 2Q4UA 5KTYA 4FQTA 1EJ3A 2G2BA 2KFFA 3BFAA 5HKYA 2WCLA 3I5IB 2LMUA 3NSKA 2KNEA 1S26D 2LVIA 4ZCVA 1Y1AA 5HLVA 5HKWA 1IH0A 1KQMB 2JNXA 3EVVA 4YGCB 4PHMA 4HRHA 1QX7A 4MN0A 3BFBA 2MBXA 2QPTA 1E8AA 1CMGA 3SG3A 1SBJA 5AXIA 2GTEA 2WCEA 2BBNA 2M97A 2A4JA 2KFGA 3DF0A 1DQEA 3LL8B 2H8VA 5FYXA 4QJ5B 2KQYA 5FI2A 1F8HA 5TNCA 2JRFA 1CDPA 1MWNA 1PALA 2CCMA 1TTXA 2JT8A 2HETA 3O78A 2E6WA 1NX2A 3SG6A 5I2LA 3CZTX 1YVLA 3DYEA 3NSIA 1K2HA 2M1UA 2LVJA 3FS7A 1WRLA 1UHJA 2WCJA 3S0DA 1FPWA 4IL1A 2F33A 1B7TY 1TIZA 2KFHA 4PE7A 2I2RE 4ORCB 1QLSA 4CPVA 1G4YR 3VRNA 3R1OA 4CFRA 5AEQA 2MHHA 3WNXB 2IS9A 3EKHA 5HKZA 5K89A 1H4BA 4PHNA 1L7ZA 1SRAA 1PVAA 3NXAA 5HL1A 1J7OA 3IVTA 2R2IA 2JWWA 3IQOA 1FBVA 2CTNA 1YUUA 2I94A 3DVKA 1EG3A 2EC6C 2YGUA 1Z2CB 1IQ5A 3SS4A 1FW4A 1SCVA 3FWCA 3CWGA 1MR8A 3CTNA 3A8RA 1ORGA 4OVNF 1A03A 3NGVA 1XFUO 4DS7A 1YTZC 1QWVA 2O60A 1F4QA 1B4CA 1K95A 2H61A 5HYDA 1AJ5A 1IWQA 1LKJA 3JVTB 1RFJA 1A29A 1DF0B 2NCOA 4NDBA 5EL2A 2PRUA 5CPVA 2ZRTA 1P28A 3I5GC 3BXKA 1QIVA 2L2CA 1QXPA 2Y1NA 3EG5B 3PN7C 4GGFA 1Y1UA 2K0JA 4JD9A 2F3YA 3PALA 3FE8A 3B6XA 2JC2A 4A4CA 2KI6C 1F55A 2P70A 1DJYA 2L98A 4MZLA 1C3YA 2BCBA 2F8PA 2BE6A 3L47A 4OZDA 2K7BA 1ZMZA 3OGNA 1SW8A 3O4XA 4P5OE 1K9KA 1FI6A 4U8DA 5D7FA 1V1GA 2JTZA 2K2FA 3NSLA 3PSRA 5AANA 1NX0A 2LVVA 2WCBA 4GUKA 1R2UA 1DJGA 1M45A 1MXLC 1DJHA 1BU3A 5D69A 1SPYA 1CFDA 1DGVA 3RZSA 3BUXB 2QEOA 1DC1A 1XO5A 2L4HA 1PSBA 2M49B 2CXJA 4M2PA 3WHUB 2E30A 1CLMA 1Y6WA 4KYNA 2QEBA 2H2KA 2LANA 5CSFA 3D74A 3GK1A 3PM8A 3PLFB 3CDNA 1C7WA 2LLSA 4JWQA 4OR9B 1B8RA 2ERBA 4GGNA 4HSZA 2OS8B 1C7VA 1NCZA 3BJHA 1AJ4A 3DD4A 4NDDA 4GAOA 1EL4A 1S5GZ 1NX3A 3SS5A 2WC5A 1QASA 1BLQA 1DGUA 1KFUL 3FE6A 3LLEA 3B88A 1M46A 4MLWA 4N5XA 4MBEA 1SCMC 1AVSA 2LUXA 3A4UB 2KLEA 4OKHA 4PCWA 1H8BA 3DXLA 1CB1A 3CYZA 2PALA 5I2OA 1KQVA 4ZCUA 3V2LA 1SL9A 4JQ0D 1AK8A 2JULA 2ZNDA 3RLZA 1MUXA 3R1VA 1OZOA 4TNCA 3VB1A 1OOGA 1W7IB 1BT6A 3CZ0A 2KOTA 1NCXA 2SASA 1K90D 4WRIA 1XVJA 4A4BA 2KI4C 1U5IB 1YR5A 2F3ZA 3OP0A 2EGDA 4FTGA 2CT9A 3I5IC 4I5LB 1JWDA 1UHKA 1OOJA 1KCYA 3AKAA 1NCYA 1TOPA 2JXCA 3FIAA 2JOJA 3D76A 4YGAA 2L0PA 2MJWB 1LVCD 2OTGC 4HREE 2H61C 2G9BA 1PSRA 3D73A 1IJ5A 1TRFA 4C0KA 2P6BB 1SY9A 4NQGA 4ORBB 4C0LA 1RECA 2LM5A 2LP3A 3JVTC 1C3ZA 1QVIZ 3TUYC 1KFXS 2JT0A 1QVIY 1SR6B 2HPSA 1LXFC 3S0FA 3PATA 3I5FC 2KBIA 1NUBA 3OX6A 3KPXA 1JUOA 1M63B 2GGMA 2K61A 4CIDA 3BOWB 1S6JA 1XFYO 1MXEA 4GNKB 3S0EA 3Q8IA 4I5JA 1QV1A 1OQPA 2ZN9A 5AFPA 3FE9A 1IJ6A 1SKTA 2L5YA 2FJYA 2JTTA 1ZFSA 1KWOC 2CNPA 3OB2B 4N1FA 2QACA 4I5NB 5DKNA 3B86A 1XFWO 1NSHA 1NWDA 1UWOA 2V53A 1KSMA 1QLKA 1BF5A 4FQOA 4JPZB 2K7CA 3JTDC 1TNQA 1DTLA 2KQ6A 3DZTA 3HCMA 1FI5A 3TDUA 3D77A 1A75B 1XFRA 4ORAB 3BOWA 4IJ7A 2QDIA 1V1FA 1WLMA 2AMIA 2L50A 1UHHA 1QIWA 1NPQA 1S5GY 2M8UA 2KPHA 4AQIA 4DUQA 3CR4X 2JU0A 3ICBA 1CLLA 1M39A 2M29A 2OS8C 1KK7Y 5DKRA 2L5XB 3I5GB 4E68A 5GQQC 2K7OA 2D8NA 1K96A 3DVMA 3TS5C 1S1EA 1K9UA 1OSAA 5D3OA 2M3WA 2ISDA 1PULA 2P71A 2DOQA 1F4OA 1XFZO 3F45A 2KLDA 4BY5A 1CDNA 2KAVA 1KSOA 1DJXA 1JSAA 2OPOA 1JFJA 1B1GA 1KK7Z 3KHEA 1SL8A 1QJTA 1DF0A 1DJWA 1TN4A 1WRKA 3HX4A 5CSJA 4I5KA 2JPOA 1YURA 1RK9A 2Y4QA 3SS3A 1S6IA 1RTP1 1AHRA 1QX2A 2KHNA 1PVBA 2HF5A 3RM1A 3IF7A 2FOTA 2KI4B 4F0ZB 1SL7A 4PE4A 2M9GA 1F71A 3NHTA 4WQ2A 4Q04A 2BL0B 4DCKA 2BNXA 3ZWHA 1OMRA 2PMYA 2COLB 1IQ3A 1XFVO 5FI7A 2FCDA 3O4YA 2KSPA 2OTGB 1OMDA 3R72A 2LP2A 1QTXA 1S3PA 1J7PA 1QATA 3LK1A 2KAXA 2FJUB 3KF9A 1JBAA 2WCFA 3KO0A 3S0AA 1J1EA 1WDCB 2CBLA 3UNWA 1YX8A 5JOLA 1G8IA 4GBAA 5J3XA 4C0JA 2JQ6A 3SIBA 3CZ1A 3AKBA 5KSZA 5IBWA 3M0WA 1SNLA 4UPGA 3PJIA 2PVBA 2Y5IA 1GGWA 3AAJA 2QEVA 1A2XA 1PRWA 2O5GA 1JF0A 1CDLA 2JZIA 1AUIB 3DVJA 1XFXO 4PALA 1EXRA 1CFFA 1EG4A 2MLEC 1K93D 1NIWA 1TNWA 3B7AA 1YUSA 3BUNB 3C1VA 3E3RA 2NZ0A 1TCOB 3LCPC 2LE9B 3MSEB 1BOCA 3D0YB 2VRGA 1UUSA 1TNXA 2WCMA 1ZUZA 1B8CA 2EHBA 2KAYA 4F7FA 3PM2A 1PK0D 3EKJA 1S6CA 3GOFA 5CSIA 1C07A 4OV2A 4YI8A 1ZACA 3D0YA 4L9MA 4YGEB 1HQVA 2LAPA 2SCPA 2WCKA 1EH2A 3CLNA 1DT7B 5ER5A 2MLFC 4MSPA 4PE0A 1NP8A 3NHIA 3UO9A 3VRRA 1SCMB 2LNKA 5JJGA 3VGOA 1OZSA 3CR5X 3TDZA 1BODA 1GM0A 3WHTB 2HQWA 2BBMA 1WLZA 2AAOA 3GK4X 1LA0A 2WC8A 1LINA 5G08A 4DIRA 1WRZA 2NXQA 3IQQA 1BG1A 1JF2A 3O6BA 3OX5A 4MRXA 4XYNA 1MHOA 5F6TA 3BUMB 1KK8C 3BFHA 1GJYA 2BKHB 1X02A 1J1DA 2BECA 4PDZA 2HQ8A 1B47A 1CTRA 2K7DA 2MRDA 2BCAA 2BL0C 3I5HB 2BAPA 2LV7A 3QMEA 3SG2A 4AOMA 3SG4A 1QV0A 1Y0VH 2LMTA 2KGRA 3VRPA 4YGBB 3K21A 1LA3A 2LHLA 1TCFA 4MZKA 4M2OA 3SG7A 1QS7A 3OB1B 3DVEA 5HLOA 3I5HC 1R6PA 1DJZA 4PHKA 2BKIB 2TN4A 1Y1XA 1CFCA 1DEKA 1S36A 2LCPA 1Z4HA 2ZFDA 4WQ3A 2KGBC 3I5FB 4QJ4B 1UHNA 2NCPA 2ZRSA 3BUWB 3JTDB 4XJKA 2I18A 3OHMB 4R1EA 4YBHB 3DY9A 1G33A 2F2OA 3EVUA 4MVFA 1HT9A 3LK0A 1J55A 2JT3A 4QJ3B 1VRKA 5I2QA 5I8NA 3R1PA 5I94A 1YRTB 2PASA 1XK4A 1N2DA 3D78A 2LVKA 3L4LA 3NSOA 1YX7A 3S0BA 4BY4A 2M7NA 4INXA 1U5IA 3CS1A 2KI6D 1ALWA 2GGZA 3D10A 2KBMA 3KEVA 5PALA 4PHJA 2M7LA 3VROA 1NX1A 4PE1A 3EVRA 4CFQA 1CLBA 1ODBA 1CNPA 1OE9B 2KYFA 2L2EA 1TWOA 3GK2A 3DF0B 1DJIA 1ZOTB 3SG5A 1KQMC 4M2QA 4D1EA 1GQMA 2Q91A 3L4AA 1KK8B 1JFKA 1LS8A 3EK4A 1BR4B 2ZN8A 1N65A 2JNFA 1IIOA 2LHIA 5CSNA 1D1OA 2M0RA 1N0YA 1TUZA 1OOFA 3QRXA 1KWOB 1IGVA 5DKQA 3SJSA 1XYDA 1CKKA 1A75A 2L4IA 1ALVA 2PSRA 1SK6D 1KFUS 1NYAA 1L2OB 2F2PA 2I7AA 2LC5A 4YGDB 1SMGA 4OCIA 5BPJA 1UHIA 1K94A 1B9AA 4P2YB 3TUYB 1FF1A 2MA2A 1IKUA 1CMFA 1OOIX 4ICBA 1BMOA 1RJVA 1W9ZA 3TZ1A 3PFVA 5KU1A 2ZKMX 1CDMA 1XA5A 3EK7A 3D75A 2L51A 3K1EA 1L2OC 4HRGA 1GGZA 1MQ1A 2JPTA 1AP4A 1BR1B 5AERA 2MAZA 2PQLA 2WC6A 1DMOA 2JXLA 3BYAA 4CLNA 1Q80A 3H4SE 1A4PA 1K9PA 2KDHA 4GFTA 2FCEA 2WOSA 4USLA 3BQ3A 4XJKB 3VRQA 2ZNEA 1CM1A 1OMVA 5B8IB 1CFPA 1F70A 1J7QA 2WORA
chains in the Genus database with same CATH topology
1MF8B 2K8MB 3WXAA 2AUCA 2LUCA 1W7JB 2B1UA 1M31A 1JC2A 1RWYA 1B7TZ 3CGAA 1SYMA 2EC6B 4GGFC 3EK8A 1J7RA 1DVIA 1YUTA 2GV5A 1WY9A 3FWBA 5ER4X 1F54A 3TDIA 1XK4C 4DRWA 1WDCC 3CR2A 2M1KB 1BJFA 2BCXA 4AQJA 4GPLB 1SR6C 1UP5A 2BE4A 2LLTA 4YI9A 3AAKA 1YRUB 2Y1MA 2K2AA 1IRJA 1K8UA 2WNDA 1YVHA 2RGIA 3PN7B 3TS5B 1UURA 2LLUA 4N1GA 1IG5A 4MRYA 1B8LA 3O2PA 4ETOA 3BUOB 1CM4A 3ZNIA 1QX5B 2NLNA 2KYCA 4NDCA 1RROA 4YRUA 1KFXL 1TNPA 3SIAA 4MZJA 4MEWA 2LMVA 2Q4UA 5KTYA 1EJ3A 2G2BA 2KFFA 5HKYA 3I5IB 2LMUA 3NSKA 2KNEA 1S26D 2LVIA 4ZCVA 1Y1AA 5HLVA 5HKWA 1IH0A 1KQMB 2JNXA 3EVVA 4YGCB 4PHMA 4HRHA 1QX7A 4MN0A 2MBXA 2QPTA 1E8AA 1CMGA 3SG3A 1SBJA 5AXIA 2WCEA 2BBNA 2M97A 2A4JA 2KFGA 3DF0A 3LL8B 4QJ5B 5FYXA 1F8HA 2KQYA 5TNCA 2JRFA 1CDPA 1MWNA 1PALA 2CCMA 1TTXA 2JT8A 2HETA 3O78A 2E6WA 1NX2A 3SG6A 5I2LA 3CZTX 1YVLA 3NSIA 1K2HA 2M1UA 2LVJA 3FS7A 1WRLA 1UHJA 1FPWA 4IL1A 2F33A 1B7TY 1TIZA 2KFHA 4PE7A 2I2RE 4ORCB 1QLSA 4CPVA 1G4YR 3VRNA 4CFRA 5AEQA 2MHHA 3WNXB 2IS9A 3EKHA 5HKZA 5K89A 1H4BA 4PHNA 1L7ZA 1SRAA 1PVAA 3NXAA 1J7OA 2R2IA 2JWWA 3IQOA 1FBVA 2CTNA 1YUUA 2I94A 3DVKA 1EG3A 2EC6C 1IQ5A 1FW4A 1SCVA 3FWCA 3CWGA 1MR8A 3CTNA 3A8RA 4OVNF 1A03A 1XFUO 4DS7A 1YTZC 2O60A 1F4QA 1B4CA 1K95A 2H61A 5HYDA 1AJ5A 1IWQA 1LKJA 3JVTB 1RFJA 1A29A 1DF0B 2NCOA 4NDBA 2PRUA 5CPVA 2ZRTA 3I5GC 3BXKA 1QIVA 1QXPA 2Y1NA 3PN7C 4GGFA 1Y1UA 2K0JA 2F3YA 3PALA 2JC2A 4A4CA 2KI6C 1F55A 1DJYA 2L98A 4MZLA 2BCBA 2F8PA 2BE6A 2K7BA 1ZMZA 1SW8A 4P5OE 1K9KA 1FI6A 4U8DA 5D7FA 1V1GA 2JTZA 2K2FA 3NSLA 3PSRA 5AANA 1NX0A 2LVVA 2WCBA 4GUKA 1R2UA 1DJGA 1M45A 1MXLC 1DJHA 1BU3A 5D69A 1SPYA 1CFDA 1DGVA 3BUXB 1XO5A 2L4HA 1PSBA 2M49B 2CXJA 4M2PA 3WHUB 2E30A 1CLMA 1Y6WA 2H2KA 2LANA 5CSFA 3GK1A 3PM8A 3PLFB 1C7WA 2LLSA 4JWQA 4OR9B 1B8RA 4HSZA 4GGNA 2OS8B 1C7VA 1NCZA 1AJ4A 3DD4A 4NDDA 4GAOA 1EL4A 1S5GZ 1NX3A 1QASA 1BLQA 1DGUA 1KFUL 3LLEA 4MLWA 4N5XA 1M46A 4MBEA 1SCMC 1AVSA 2LUXA 3A4UB 1H8BA 4OKHA 1CB1A 2PALA 5I2OA 1KQVA 4ZCUA 1SL9A 4JQ0D 1AK8A 2JULA 2ZNDA 3RLZA 1MUXA 1OZOA 4TNCA 1W7IB 1BT6A 2KOTA 1NCXA 2SASA 1K90D 4WRIA 1XVJA 4A4BA 2KI4C 1U5IB 1YR5A 2F3ZA 3OP0A 2EGDA 4FTGA 2CT9A 3I5IC 4I5LB 1JWDA 1UHKA 1OOJA 1KCYA 3AKAA 1NCYA 1TOPA 2JXCA 3FIAA 2JOJA 4YGAA 2L0PA 2MJWB 1LVCD 2OTGC 4HREE 2H61C 2G9BA 1PSRA 4C0KA 1IJ5A 1TRFA 2P6BB 1SY9A 4NQGA 4ORBB 4C0LA 1RECA 2LM5A 2LP3A 3JVTC 1QVIZ 3TUYC 1KFXS 2JT0A 1QVIY 1SR6B 2HPSA 1LXFC 3PATA 3I5FC 2KBIA 1NUBA 3OX6A 3KPXA 1JUOA 1M63B 2GGMA 2K61A 4CIDA 3BOWB 1S6JA 1XFYO 1MXEA 4GNKB 4I5JA 1QV1A 1OQPA 2ZN9A 5AFPA 1IJ6A 1SKTA 2JTTA 1ZFSA 1KWOC 2CNPA 3OB2B 4N1FA 2QACA 4I5NB 5DKNA 1XFWO 1NSHA 1NWDA 1UWOA 2V53A 1KSMA 1QLKA 1BF5A 4FQOA 4JPZB 2K7CA 3JTDC 1TNQA 1DTLA 2KQ6A 3HCMA 1FI5A 3TDUA 1A75B 4ORAB 3BOWA 1V1FA 1WLMA 2AMIA 2L50A 1UHHA 1QIWA 1NPQA 1S5GY 2M8UA 4AQIA 4DUQA 3CR4X 2JU0A 3ICBA 1CLLA 1M39A 2M29A 2OS8C 1KK7Y 5DKRA 2L5XB 3I5GB 4E68A 5GQQC 2K7OA 2D8NA 1K96A 3DVMA 3TS5C 1S1EA 1K9UA 1OSAA 2M3WA 2ISDA 1PULA 2DOQA 1F4OA 1XFZO 3F45A 4BY5A 1CDNA 2KAVA 1KSOA 1DJXA 1JSAA 2OPOA 1JFJA 1B1GA 1KK7Z 3KHEA 1SL8A 1QJTA 1DF0A 1DJWA 1TN4A 1WRKA 3HX4A 5CSJA 4I5KA 1YURA 1RK9A 2Y4QA 1S6IA 1RTP1 1AHRA 1QX2A 2KHNA 1PVBA 2HF5A 3RM1A 3IF7A 2FOTA 2KI4B 4F0ZB 1SL7A 4PE4A 2M9GA 1F71A 4WQ2A 4Q04A 2BL0B 4DCKA 3ZWHA 1OMRA 2PMYA 2COLB 1IQ3A 1XFVO 2FCDA 3O4YA 2KSPA 2OTGB 1OMDA 2LP2A 1QTXA 1S3PA 1J7PA 1QATA 3LK1A 2KAXA 2FJUB 3KF9A 1JBAA 2WCFA 3KO0A 1J1EA 1WDCB 2CBLA 1YX8A 5JOLA 1G8IA 4GBAA 5J3XA 4C0JA 2JQ6A 3SIBA 3AKBA 5KSZA 5IBWA 3M0WA 1SNLA 4UPGA 2PVBA 2Y5IA 1GGWA 3AAJA 1A2XA 1PRWA 2O5GA 1JF0A 1CDLA 2JZIA 1AUIB 3DVJA 1XFXO 4PALA 1EXRA 1CFFA 1EG4A 2MLEC 1K93D 1NIWA 1TNWA 3BUNB 1YUSA 3C1VA 3E3RA 3LCPC 2NZ0A 1TCOB 2LE9B 3MSEB 1BOCA 3D0YB 2VRGA 1UUSA 1TNXA 1ZUZA 1B8CA 2EHBA 2KAYA 1C07A 1PK0D 3EKJA 1S6CA 3GOFA 5CSIA 4OV2A 4YI8A 1ZACA 3D0YA 4L9MA 4YGEB 1HQVA 2LAPA 2SCPA 1EH2A 3CLNA 1DT7B 5ER5A 2MLFC 4MSPA 4PE0A 1NP8A 3VRRA 1SCMB 2LNKA 5JJGA 3VGOA 1OZSA 3CR5X 3TDZA 1BODA 3WHTB 2HQWA 2BBMA 1WLZA 2AAOA 3GK4X 1LA0A 2WC8A 1LINA 5G08A 4DIRA 1WRZA 2NXQA 3IQQA 1BG1A 1JF2A 3O6BA 3OX5A 4MRXA 4XYNA 1MHOA 5F6TA 3BUMB 1KK8C 1GJYA 2BKHB 1X02A 1J1DA 2BECA 4PDZA 2HQ8A 1B47A 1CTRA 2K7DA 2MRDA 2BCAA 2BL0C 3I5HB 2LV7A 4PCWA 3SG2A 4AOMA 3SG4A 1QV0A 1Y0VH 2LMTA 2KGRA 3VRPA 4YGBB 3K21A 1LA3A 2LHLA 1TCFA 4MZKA 4M2OA 3SG7A 1QS7A 3OB1B 3DVEA 5HLOA 3I5HC 1R6PA 1DJZA 4PHKA 2BKIB 2TN4A 1Y1XA 1CFCA 1S36A 2LCPA 2ZFDA 4WQ3A 4QJ4B 2KGBC 3I5FB 1UHNA 2NCPA 2ZRSA 3BUWB 3JTDB 4XJKA 2I18A 3OHMB 4R1EA 4YBHB 3EVUA 1G33A 2F2OA 4MVFA 1HT9A 3LK0A 1J55A 2JT3A 4QJ3B 1VRKA 5I2QA 5I8NA 1YRTB 2PASA 1XK4A 1N2DA 3NSOA 2LVKA 1YX7A 4BY4A 2M7NA 1U5IA 3CS1A 2KI6D 1ALWA 2GGZA 3D10A 2KBMA 3KEVA 5PALA 4PHJA 2M7LA 3VROA 1NX1A 4PE1A 3EVRA 4CFQA 1CLBA 1ODBA 1CNPA 1OE9B 2KYFA 2L2EA 3GK2A 3DF0B 1DJIA 1ZOTB 3SG5A 1KQMC 4M2QA 4D1EA 1GQMA 2Q91A 1KK8B 1JFKA 3EK4A 1BR4B 2ZN8A 1N65A 2JNFA 2LHIA 5CSNA 1D1OA 2M0RA 1N0YA 3QRXA 1KWOB 1IGVA 5DKQA 3SJSA 1XYDA 1CKKA 1A75A 2L4IA 1ALVA 2PSRA 1SK6D 1KFUS 1NYAA 1L2OB 2F2PA 2I7AA 2LC5A 4YGDB 1SMGA 4OCIA 5BPJA 1UHIA 1K94A 1B9AA 4P2YB 3TUYB 1FF1A 2MA2A 1IKUA 1CMFA 4ICBA 1BMOA 1RJVA 5KU1A 3TZ1A 3PFVA 2ZKMX 1CDMA 1XA5A 3EK7A 2L51A 1L2OC 4HRGA 1GGZA 1MQ1A 2JPTA 1AP4A 1BR1B 5AERA 2MAZA 1DMOA 2JXLA 3BYAA 4CLNA 1Q80A 3H4SE 1A4PA 1K9PA 2KDHA 4GFTA 2FCEA 2WOSA 4USLA 3BQ3A 4XJKB 3VRQA 2ZNEA 1CM1A 1OMVA 5B8IB 1CFPA 1F70A 1J7QA 2WORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MF8 B;  2K8M B;  3WXA A;  2AUC A;  2LUC A;  1W7J B;  2B1U A;  1M31 A;  1JC2 A;  1RWY A;  1B7T Z;  3CGA A;  1SYM A;  2EC6 B;  4GGF C;  3EK8 A;  1J7R A;  1DVI A;  1YUT A;  2GV5 A;  1WY9 A;  3FWB A;  5ER4 X;  1F54 A;  3TDI A;  1XK4 C;  4DRW A;  1WDC C;  3CR2 A;  2M1K B;  1BJF A;  2BCX A;  4AQJ A;  4GPL B;  1SR6 C;  1UP5 A;  2BE4 A;  2LLT A;  4YI9 A;  3AAK A;  1YRU B;  2Y1M A;  2K2A A;  1IRJ A;  1K8U A;  2WND A;  1YVH A;  2RGI A;  3PN7 B;  3TS5 B;  1UUR A;  2LLU A;  4N1G A;  1IG5 A;  4MRY A;  1B8L A;  3O2P A;  4ETO A;  3BUO B;  1CM4 A;  3ZNI A;  1QX5 B;  2NLN A;  2KYC A;  4NDC A;  1RRO A;  4YRU A;  1KFX L;  1TNP A;  3SIA A;  4MZJ A;  4MEW A;  2LMV A;  2Q4U A;  5KTY A;  1EJ3 A;  2G2B A;  2KFF A;  5HKY A;  3I5I B;  2LMU A;  3NSK A;  2KNE A;  1S26 D;  2LVI A;  4ZCV A;  1Y1A A;  5HLV A;  5HKW A;  1IH0 A;  1KQM B;  2JNX A;  3EVV A;  4YGC B;  4PHM A;  4HRH A;  1QX7 A;  4MN0 A;  2MBX A;  2QPT A;  1E8A A;  1CMG A;  3SG3 A;  1SBJ A;  5AXI A;  2WCE A;  2BBN A;  2M97 A;  2A4J A;  2KFG A;  3DF0 A;  3LL8 B;  4QJ5 B;  5FYX A;  1F8H A;  2KQY A;  5TNC A;  2JRF A;  1CDP A;  1MWN A;  1PAL A;  2CCM A;  1TTX A;  2JT8 A;  2HET A;  3O78 A;  2E6W A;  1NX2 A;  3SG6 A;  5I2L A;  3CZT X;  1YVL A;  3NSI A;  1K2H A;  2M1U A;  2LVJ A;  3FS7 A;  1WRL A;  1UHJ A;  1FPW A;  4IL1 A;  2F33 A;  1B7T Y;  1TIZ A;  2KFH A;  4PE7 A;  2I2R E;  4ORC B;  1QLS A;  4CPV A;  1G4Y R;  3VRN A;  4CFR A;  5AEQ A;  2MHH A;  3WNX B;  2IS9 A;  3EKH A;  5HKZ A;  5K89 A;  1H4B A;  4PHN A;  1L7Z A;  1SRA A;  1PVA A;  3NXA A;  1J7O A;  2R2I A;  2JWW A;  3IQO A;  1FBV A;  2CTN A;  1YUU A;  2I94 A;  3DVK A;  1EG3 A;  2EC6 C;  1IQ5 A;  1FW4 A;  1SCV A;  3FWC A;  3CWG A;  1MR8 A;  3CTN A;  3A8R A;  4OVN F;  1A03 A;  1XFU O;  4DS7 A;  1YTZ C;  2O60 A;  1F4Q A;  1B4C A;  1K95 A;  2H61 A;  5HYD A;  1AJ5 A;  1IWQ A;  1LKJ A;  3JVT B;  1RFJ A;  1A29 A;  1DF0 B;  2NCO A;  4NDB A;  2PRU A;  5CPV A;  2ZRT A;  3I5G C;  3BXK A;  1QIV A;  1QXP A;  2Y1N A;  3PN7 C;  4GGF A;  1Y1U A;  2K0J A;  2F3Y A;  3PAL A;  2JC2 A;  4A4C A;  2KI6 C;  1F55 A;  1DJY A;  2L98 A;  4MZL A;  2BCB A;  2F8P A;  2BE6 A;  2K7B A;  1ZMZ A;  1SW8 A;  4P5O E;  1K9K A;  1FI6 A;  4U8D A;  5D7F A;  1V1G A;  2JTZ A;  2K2F A;  3NSL A;  3PSR A;  5AAN A;  1NX0 A;  2LVV A;  2WCB A;  4GUK A;  1R2U A;  1DJG A;  1M45 A;  1MXL C;  1DJH A;  1BU3 A;  5D69 A;  1SPY A;  1CFD A;  1DGV A;  3BUX B;  1XO5 A;  2L4H A;  1PSB A;  2M49 B;  2CXJ A;  4M2P A;  3WHU B;  2E30 A;  1CLM A;  1Y6W A;  2H2K A;  2LAN A;  5CSF A;  3GK1 A;  3PM8 A;  3PLF B;  1C7W A;  2LLS A;  4JWQ A;  4OR9 B;  1B8R A;  4HSZ A;  4GGN A;  2OS8 B;  1C7V A;  1NCZ A;  1AJ4 A;  3DD4 A;  4NDD A;  4GAO A;  1EL4 A;  1S5G Z;  1NX3 A;  1QAS A;  1BLQ A;  1DGU A;  1KFU L;  3LLE A;  4MLW A;  4N5X A;  1M46 A;  4MBE A;  1SCM C;  1AVS A;  2LUX A;  3A4U B;  1H8B A;  4OKH A;  1CB1 A;  2PAL A;  5I2O A;  1KQV A;  4ZCU A;  1SL9 A;  4JQ0 D;  1AK8 A;  2JUL A;  2ZND A;  3RLZ A;  1MUX A;  1OZO A;  4TNC A;  1W7I B;  1BT6 A;  2KOT A;  1NCX A;  2SAS A;  1K90 D;  4WRI A;  1XVJ A;  4A4B A;  2KI4 C;  1U5I B;  1YR5 A;  2F3Z A;  3OP0 A;  2EGD A;  4FTG A;  2CT9 A;  3I5I C;  4I5L B;  1JWD A;  1UHK A;  1OOJ A;  1KCY A;  3AKA A;  1NCY A;  1TOP A;  2JXC A;  3FIA A;  2JOJ A;  4YGA A;  2L0P A;  2MJW B;  1LVC D;  2OTG C;  4HRE E;  2H61 C;  2G9B A;  1PSR A;  4C0K A;  1IJ5 A;  1TRF A;  2P6B B;  1SY9 A;  4NQG A;  4ORB B;  4C0L A;  1REC A;  2LM5 A;  2LP3 A;  3JVT C;  1QVI Z;  3TUY C;  1KFX S;  2JT0 A;  1QVI Y;  1SR6 B;  2HPS A;  1LXF C;  3PAT A;  3I5F C;  2KBI A;  1NUB A;  3OX6 A;  3KPX A;  1JUO A;  1M63 B;  2GGM A;  2K61 A;  4CID A;  3BOW B;  1S6J A;  1XFY O;  1MXE A;  4GNK B;  4I5J A;  1QV1 A;  1OQP A;  2ZN9 A;  5AFP A;  1IJ6 A;  1SKT A;  2JTT A;  1ZFS A;  1KWO C;  2CNP A;  3OB2 B;  4N1F A;  2QAC A;  4I5N B;  5DKN A;  1XFW O;  1NSH A;  1NWD A;  1UWO A;  2V53 A;  1KSM A;  1QLK A;  1BF5 A;  4FQO A;  4JPZ B;  2K7C A;  3JTD C;  1TNQ A;  1DTL A;  2KQ6 A;  3HCM A;  1FI5 A;  3TDU A;  1A75 B;  4ORA B;  3BOW A;  1V1F A;  1WLM A;  2AMI A;  2L50 A;  1UHH A;  1QIW A;  1NPQ A;  1S5G Y;  2M8U A;  4AQI A;  4DUQ A;  3CR4 X;  2JU0 A;  3ICB A;  1CLL A;  1M39 A;  2M29 A;  2OS8 C;  1KK7 Y;  5DKR A;  2L5X B;  3I5G B;  4E68 A;  5GQQ C;  2K7O A;  2D8N A;  1K96 A;  3DVM A;  3TS5 C;  1S1E A;  1K9U A;  1OSA A;  2M3W A;  2ISD A;  1PUL A;  2DOQ A;  1F4O A;  1XFZ O;  3F45 A;  4BY5 A;  1CDN A;  2KAV A;  1KSO A;  1DJX A;  1JSA A;  2OPO A;  1JFJ A;  1B1G A;  1KK7 Z;  3KHE A;  1SL8 A;  1QJT A;  1DF0 A;  1DJW A;  1TN4 A;  1WRK A;  3HX4 A;  5CSJ A;  4I5K A;  1YUR A;  1RK9 A;  2Y4Q A;  1S6I A;  1RTP 1;  1AHR A;  1QX2 A;  2KHN A;  1PVB A;  2HF5 A;  3RM1 A;  3IF7 A;  2FOT A;  2KI4 B;  4F0Z B;  1SL7 A;  4PE4 A;  2M9G A;  1F71 A;  4WQ2 A;  4Q04 A;  2BL0 B;  4DCK A;  3ZWH A;  1OMR A;  2PMY A;  2COL B;  1IQ3 A;  1XFV O;  2FCD A;  3O4Y A;  2KSP A;  2OTG B;  1OMD A;  2LP2 A;  1QTX A;  1S3P A;  1J7P A;  1QAT A;  3LK1 A;  2KAX A;  2FJU B;  3KF9 A;  1JBA A;  2WCF A;  3KO0 A;  1J1E A;  1WDC B;  2CBL A;  1YX8 A;  5JOL A;  1G8I A;  4GBA A;  5J3X A;  4C0J A;  2JQ6 A;  3SIB A;  3AKB A;  5KSZ A;  5IBW A;  3M0W A;  1SNL A;  4UPG A;  2PVB A;  2Y5I A;  1GGW A;  3AAJ A;  1A2X A;  1PRW A;  2O5G A;  1JF0 A;  1CDL A;  2JZI A;  1AUI B;  3DVJ A;  1XFX O;  4PAL A;  1EXR A;  1CFF A;  1EG4 A;  2MLE C;  1K93 D;  1NIW A;  1TNW A;  3BUN B;  1YUS A;  3C1V A;  3E3R A;  3LCP C;  2NZ0 A;  1TCO B;  2LE9 B;  3MSE B;  1BOC A;  3D0Y B;  2VRG A;  1UUS A;  1TNX A;  1ZUZ A;  1B8C A;  2EHB A;  2KAY A;  1C07 A;  1PK0 D;  3EKJ A;  1S6C A;  3GOF A;  5CSI A;  4OV2 A;  4YI8 A;  1ZAC A;  3D0Y A;  4L9M A;  4YGE B;  1HQV A;  2LAP A;  2SCP A;  1EH2 A;  3CLN A;  1DT7 B;  5ER5 A;  2MLF C;  4MSP A;  4PE0 A;  1NP8 A;  3VRR A;  1SCM B;  2LNK A;  5JJG A;  3VGO A;  1OZS A;  3CR5 X;  3TDZ A;  1BOD A;  3WHT B;  2HQW A;  2BBM A;  1WLZ A;  2AAO A;  3GK4 X;  1LA0 A;  2WC8 A;  1LIN A;  5G08 A;  4DIR A;  1WRZ A;  2NXQ A;  3IQQ A;  1BG1 A;  1JF2 A;  3O6B A;  3OX5 A;  4MRX A;  4XYN A;  1MHO A;  5F6T A;  3BUM B;  1KK8 C;  1GJY A;  2BKH B;  1X02 A;  1J1D A;  2BEC A;  4PDZ A;  2HQ8 A;  1B47 A;  1CTR A;  2K7D A;  2MRD A;  2BCA A;  2BL0 C;  3I5H B;  2LV7 A;  4PCW A;  3SG2 A;  4AOM A;  3SG4 A;  1QV0 A;  1Y0V H;  2LMT A;  2KGR A;  3VRP A;  4YGB B;  3K21 A;  1LA3 A;  2LHL A;  1TCF A;  4MZK A;  4M2O A;  3SG7 A;  1QS7 A;  3OB1 B;  3DVE A;  5HLO A;  3I5H C;  1R6P A;  1DJZ A;  4PHK A;  2BKI B;  2TN4 A;  1Y1X A;  1CFC A;  1S36 A;  2LCP A;  2ZFD A;  4WQ3 A;  4QJ4 B;  2KGB C;  3I5F B;  1UHN A;  2NCP A;  2ZRS A;  3BUW B;  3JTD B;  4XJK A;  2I18 A;  3OHM B;  4R1E A;  4YBH B;  3EVU A;  1G33 A;  2F2O A;  4MVF A;  1HT9 A;  3LK0 A;  1J55 A;  2JT3 A;  4QJ3 B;  1VRK A;  5I2Q A;  5I8N A;  1YRT B;  2PAS A;  1XK4 A;  1N2D A;  3NSO A;  2LVK A;  1YX7 A;  4BY4 A;  2M7N A;  1U5I A;  3CS1 A;  2KI6 D;  1ALW A;  2GGZ A;  3D10 A;  2KBM A;  3KEV A;  5PAL A;  4PHJ A;  2M7L A;  3VRO A;  1NX1 A;  4PE1 A;  3EVR A;  4CFQ A;  1CLB A;  1ODB A;  1CNP A;  1OE9 B;  2KYF A;  2L2E A;  3GK2 A;  3DF0 B;  1DJI A;  1ZOT B;  3SG5 A;  1KQM C;  4M2Q A;  4D1E A;  1GQM A;  2Q91 A;  1KK8 B;  1JFK A;  3EK4 A;  1BR4 B;  2ZN8 A;  1N65 A;  2JNF A;  2LHI A;  5CSN A;  1D1O A;  2M0R A;  1N0Y A;  3QRX A;  1KWO B;  1IGV A;  5DKQ A;  3SJS A;  1XYD A;  1CKK A;  1A75 A;  2L4I A;  1ALV A;  2PSR A;  1SK6 D;  1KFU S;  1NYA A;  1L2O B;  2F2P A;  2I7A A;  2LC5 A;  4YGD B;  1SMG A;  4OCI A;  5BPJ A;  1UHI A;  1K94 A;  1B9A A;  4P2Y B;  3TUY B;  1FF1 A;  2MA2 A;  1IKU A;  1CMF A;  4ICB A;  1BMO A;  1RJV A;  5KU1 A;  3TZ1 A;  3PFV A;  2ZKM X;  1CDM A;  1XA5 A;  3EK7 A;  2L51 A;  1L2O C;  4HRG A;  1GGZ A;  1MQ1 A;  2JPT A;  1AP4 A;  1BR1 B;  5AER A;  2MAZ A;  1DMO A;  2JXL A;  3BYA A;  4CLN A;  1Q80 A;  3H4S E;  1A4P A;  1K9P A;  2KDH A;  4GFT A;  2FCE A;  2WOS A;  4USL A;  3BQ3 A;  4XJK B;  3VRQ A;  2ZNE A;  1CM1 A;  1OMV A;  5B8I B;  1CFP A;  1F70 A;  1J7Q A;  2WOR A; 
#chains in the Genus database with same CATH topology
 1MF8 B;  2K8M B;  4INW A;  3WXA A;  2AUC A;  2LUC A;  1W7J B;  3B87 A;  5DIC A;  2B1U A;  1M31 A;  2PYQ A;  5FI6 A;  1JC2 A;  1RWY A;  1B7T Z;  3CGA A;  3N7H A;  1SYM A;  2EC6 B;  4GGF C;  3EK8 A;  1J7R A;  1OW4 A;  1DVI A;  1YUT A;  2GV5 A;  1WY9 A;  3FWB A;  5ER4 X;  3S0G A;  1F54 A;  3TDI A;  1XK4 C;  3CZ2 A;  2QEH A;  4DRW A;  1OOH A;  1WDC C;  3CR2 A;  2M1K B;  1SSE B;  1BJF A;  2BCX A;  4AQJ A;  4GPL B;  1SR6 C;  1UP5 A;  2BE4 A;  2LLT A;  4YI9 A;  3AAK A;  1YRU B;  4JKT A;  2Y1M A;  2K2A A;  1IRJ A;  1K8U A;  2WND A;  1YVH A;  2RGI A;  2WCH A;  3PN7 B;  3TS5 B;  1UUR A;  2LLU A;  4N1G A;  1IG5 A;  3OBV A;  4MRY A;  1B8L A;  3O2P A;  4ETO A;  3BUO B;  1CM4 A;  3CAB A;  3ZNI A;  4PT1 A;  1QX5 B;  2NLN A;  1T14 A;  1TUJ A;  2KYC A;  4NDC A;  1RRO A;  2K60 A;  4YRU A;  1KFX L;  1TNP A;  3SIA A;  4MZJ A;  4MEW A;  1DEL A;  2LMV A;  2Q4U A;  5KTY A;  4FQT A;  1EJ3 A;  2G2B A;  2KFF A;  3BFA A;  5HKY A;  2WCL A;  3I5I B;  2LMU A;  3NSK A;  2KNE A;  1S26 D;  2LVI A;  4ZCV A;  1Y1A A;  5HLV A;  5HKW A;  1IH0 A;  1KQM B;  2JNX A;  3EVV A;  4YGC B;  4PHM A;  4HRH A;  1QX7 A;  4MN0 A;  3BFB A;  2MBX A;  2QPT A;  1E8A A;  1CMG A;  3SG3 A;  1SBJ A;  5AXI A;  2GTE A;  2WCE A;  2BBN A;  2M97 A;  2A4J A;  2KFG A;  3DF0 A;  1DQE A;  3LL8 B;  2H8V A;  5FYX A;  4QJ5 B;  2KQY A;  5FI2 A;  1F8H A;  5TNC A;  2JRF A;  1CDP A;  1MWN A;  1PAL A;  2CCM A;  1TTX A;  2JT8 A;  2HET A;  3O78 A;  2E6W A;  1NX2 A;  3SG6 A;  5I2L A;  3CZT X;  1YVL A;  3DYE A;  3NSI A;  1K2H A;  2M1U A;  2LVJ A;  3FS7 A;  1WRL A;  1UHJ A;  2WCJ A;  3S0D A;  1FPW A;  4IL1 A;  2F33 A;  1B7T Y;  1TIZ A;  2KFH A;  4PE7 A;  2I2R E;  4ORC B;  1QLS A;  4CPV A;  1G4Y R;  3VRN A;  3R1O A;  4CFR A;  5AEQ A;  2MHH A;  3WNX B;  2IS9 A;  3EKH A;  5HKZ A;  5K89 A;  1H4B A;  4PHN A;  1L7Z A;  1SRA A;  1PVA A;  3NXA A;  5HL1 A;  1J7O A;  3IVT A;  2R2I A;  2JWW A;  3IQO A;  1FBV A;  2CTN A;  1YUU A;  2I94 A;  3DVK A;  1EG3 A;  2EC6 C;  2YGU A;  1Z2C B;  1IQ5 A;  3SS4 A;  1FW4 A;  1SCV A;  3FWC A;  3CWG A;  1MR8 A;  3CTN A;  3A8R A;  1ORG A;  4OVN F;  1A03 A;  3NGV A;  1XFU O;  4DS7 A;  1YTZ C;  1QWV A;  2O60 A;  1F4Q A;  1B4C A;  1K95 A;  2H61 A;  5HYD A;  1AJ5 A;  1IWQ A;  1LKJ A;  3JVT B;  1RFJ A;  1A29 A;  1DF0 B;  2NCO A;  4NDB A;  5EL2 A;  2PRU A;  5CPV A;  2ZRT A;  1P28 A;  3I5G C;  3BXK A;  1QIV A;  2L2C A;  1QXP A;  2Y1N A;  3EG5 B;  3PN7 C;  4GGF A;  1Y1U A;  2K0J A;  4JD9 A;  2F3Y A;  3PAL A;  3FE8 A;  3B6X A;  2JC2 A;  4A4C A;  2KI6 C;  1F55 A;  2P70 A;  1DJY A;  2L98 A;  4MZL A;  1C3Y A;  2BCB A;  2F8P A;  2BE6 A;  3L47 A;  4OZD A;  2K7B A;  1ZMZ A;  3OGN A;  1SW8 A;  3O4X A;  4P5O E;  1K9K A;  1FI6 A;  4U8D A;  5D7F A;  1V1G A;  2JTZ A;  2K2F A;  3NSL A;  3PSR A;  5AAN A;  1NX0 A;  2LVV A;  2WCB A;  4GUK A;  1R2U A;  1DJG A;  1M45 A;  1MXL C;  1DJH A;  1BU3 A;  5D69 A;  1SPY A;  1CFD A;  1DGV A;  3RZS A;  3BUX B;  2QEO A;  1DC1 A;  1XO5 A;  2L4H A;  1PSB A;  2M49 B;  2CXJ A;  4M2P A;  3WHU B;  2E30 A;  1CLM A;  1Y6W A;  4KYN A;  2QEB A;  2H2K A;  2LAN A;  5CSF A;  3D74 A;  3GK1 A;  3PM8 A;  3PLF B;  3CDN A;  1C7W A;  2LLS A;  4JWQ A;  4OR9 B;  1B8R A;  2ERB A;  4GGN A;  4HSZ A;  2OS8 B;  1C7V A;  1NCZ A;  3BJH A;  1AJ4 A;  3DD4 A;  4NDD A;  4GAO A;  1EL4 A;  1S5G Z;  1NX3 A;  3SS5 A;  2WC5 A;  1QAS A;  1BLQ A;  1DGU A;  1KFU L;  3FE6 A;  3LLE A;  3B88 A;  1M46 A;  4MLW A;  4N5X A;  4MBE A;  1SCM C;  1AVS A;  2LUX A;  3A4U B;  2KLE A;  4OKH A;  4PCW A;  1H8B A;  3DXL A;  1CB1 A;  3CYZ A;  2PAL A;  5I2O A;  1KQV A;  4ZCU A;  3V2L A;  1SL9 A;  4JQ0 D;  1AK8 A;  2JUL A;  2ZND A;  3RLZ A;  1MUX A;  3R1V A;  1OZO A;  4TNC A;  3VB1 A;  1OOG A;  1W7I B;  1BT6 A;  3CZ0 A;  2KOT A;  1NCX A;  2SAS A;  1K90 D;  4WRI A;  1XVJ A;  4A4B A;  2KI4 C;  1U5I B;  1YR5 A;  2F3Z A;  3OP0 A;  2EGD A;  4FTG A;  2CT9 A;  3I5I C;  4I5L B;  1JWD A;  1UHK A;  1OOJ A;  1KCY A;  3AKA A;  1NCY A;  1TOP A;  2JXC A;  3FIA A;  2JOJ A;  3D76 A;  4YGA A;  2L0P A;  2MJW B;  1LVC D;  2OTG C;  4HRE E;  2H61 C;  2G9B A;  1PSR A;  3D73 A;  1IJ5 A;  1TRF A;  4C0K A;  2P6B B;  1SY9 A;  4NQG A;  4ORB B;  4C0L A;  1REC A;  2LM5 A;  2LP3 A;  3JVT C;  1C3Z A;  1QVI Z;  3TUY C;  1KFX S;  2JT0 A;  1QVI Y;  1SR6 B;  2HPS A;  1LXF C;  3S0F A;  3PAT A;  3I5F C;  2KBI A;  1NUB A;  3OX6 A;  3KPX A;  1JUO A;  1M63 B;  2GGM A;  2K61 A;  4CID A;  3BOW B;  1S6J A;  1XFY O;  1MXE A;  4GNK B;  3S0E A;  3Q8I A;  4I5J A;  1QV1 A;  1OQP A;  2ZN9 A;  5AFP A;  3FE9 A;  1IJ6 A;  1SKT A;  2L5Y A;  2FJY A;  2JTT A;  1ZFS A;  1KWO C;  2CNP A;  3OB2 B;  4N1F A;  2QAC A;  4I5N B;  5DKN A;  3B86 A;  1XFW O;  1NSH A;  1NWD A;  1UWO A;  2V53 A;  1KSM A;  1QLK A;  1BF5 A;  4FQO A;  4JPZ B;  2K7C A;  3JTD C;  1TNQ A;  1DTL A;  2KQ6 A;  3DZT A;  3HCM A;  1FI5 A;  3TDU A;  3D77 A;  1A75 B;  1XFR A;  4ORA B;  3BOW A;  4IJ7 A;  2QDI A;  1V1F A;  1WLM A;  2AMI A;  2L50 A;  1UHH A;  1QIW A;  1NPQ A;  1S5G Y;  2M8U A;  2KPH A;  4AQI A;  4DUQ A;  3CR4 X;  2JU0 A;  3ICB A;  1CLL A;  1M39 A;  2M29 A;  2OS8 C;  1KK7 Y;  5DKR A;  2L5X B;  3I5G B;  4E68 A;  5GQQ C;  2K7O A;  2D8N A;  1K96 A;  3DVM A;  3TS5 C;  1S1E A;  1K9U A;  1OSA A;  5D3O A;  2M3W A;  2ISD A;  1PUL A;  2P71 A;  2DOQ A;  1F4O A;  1XFZ O;  3F45 A;  2KLD A;  4BY5 A;  1CDN A;  2KAV A;  1KSO A;  1DJX A;  1JSA A;  2OPO A;  1JFJ A;  1B1G A;  1KK7 Z;  3KHE A;  1SL8 A;  1QJT A;  1DF0 A;  1DJW A;  1TN4 A;  1WRK A;  3HX4 A;  5CSJ A;  4I5K A;  2JPO A;  1YUR A;  1RK9 A;  2Y4Q A;  3SS3 A;  1S6I A;  1RTP 1;  1AHR A;  1QX2 A;  2KHN A;  1PVB A;  2HF5 A;  3RM1 A;  3IF7 A;  2FOT A;  2KI4 B;  4F0Z B;  1SL7 A;  4PE4 A;  2M9G A;  1F71 A;  3NHT A;  4WQ2 A;  4Q04 A;  2BL0 B;  4DCK A;  2BNX A;  3ZWH A;  1OMR A;  2PMY A;  2COL B;  1IQ3 A;  1XFV O;  5FI7 A;  2FCD A;  3O4Y A;  2KSP A;  2OTG B;  1OMD A;  3R72 A;  2LP2 A;  1QTX A;  1S3P A;  1J7P A;  1QAT A;  3LK1 A;  2KAX A;  2FJU B;  3KF9 A;  1JBA A;  2WCF A;  3KO0 A;  3S0A A;  1J1E A;  1WDC B;  2CBL A;  3UNW A;  1YX8 A;  5JOL A;  1G8I A;  4GBA A;  5J3X A;  4C0J A;  2JQ6 A;  3SIB A;  3CZ1 A;  3AKB A;  5KSZ A;  5IBW A;  3M0W A;  1SNL A;  4UPG A;  3PJI A;  2PVB A;  2Y5I A;  1GGW A;  3AAJ A;  2QEV A;  1A2X A;  1PRW A;  2O5G A;  1JF0 A;  1CDL A;  2JZI A;  1AUI B;  3DVJ A;  1XFX O;  4PAL A;  1EXR A;  1CFF A;  1EG4 A;  2MLE C;  1K93 D;  1NIW A;  1TNW A;  3B7A A;  1YUS A;  3BUN B;  3C1V A;  3E3R A;  2NZ0 A;  1TCO B;  3LCP C;  2LE9 B;  3MSE B;  1BOC A;  3D0Y B;  2VRG A;  1UUS A;  1TNX A;  2WCM A;  1ZUZ A;  1B8C A;  2EHB A;  2KAY A;  4F7F A;  3PM2 A;  1PK0 D;  3EKJ A;  1S6C A;  3GOF A;  5CSI A;  1C07 A;  4OV2 A;  4YI8 A;  1ZAC A;  3D0Y A;  4L9M A;  4YGE B;  1HQV A;  2LAP A;  2SCP A;  2WCK A;  1EH2 A;  3CLN A;  1DT7 B;  5ER5 A;  2MLF C;  4MSP A;  4PE0 A;  1NP8 A;  3NHI A;  3UO9 A;  3VRR A;  1SCM B;  2LNK A;  5JJG A;  3VGO A;  1OZS A;  3CR5 X;  3TDZ A;  1BOD A;  1GM0 A;  3WHT B;  2HQW A;  2BBM A;  1WLZ A;  2AAO A;  3GK4 X;  1LA0 A;  2WC8 A;  1LIN A;  5G08 A;  4DIR A;  1WRZ A;  2NXQ A;  3IQQ A;  1BG1 A;  1JF2 A;  3O6B A;  3OX5 A;  4MRX A;  4XYN A;  1MHO A;  5F6T A;  3BUM B;  1KK8 C;  3BFH A;  1GJY A;  2BKH B;  1X02 A;  1J1D A;  2BEC A;  4PDZ A;  2HQ8 A;  1B47 A;  1CTR A;  2K7D A;  2MRD A;  2BCA A;  2BL0 C;  3I5H B;  2BAP A;  2LV7 A;  3QME A;  3SG2 A;  4AOM A;  3SG4 A;  1QV0 A;  1Y0V H;  2LMT A;  2KGR A;  3VRP A;  4YGB B;  3K21 A;  1LA3 A;  2LHL A;  1TCF A;  4MZK A;  4M2O A;  3SG7 A;  1QS7 A;  3OB1 B;  3DVE A;  5HLO A;  3I5H C;  1R6P A;  1DJZ A;  4PHK A;  2BKI B;  2TN4 A;  1Y1X A;  1CFC A;  1DEK A;  1S36 A;  2LCP A;  1Z4H A;  2ZFD A;  4WQ3 A;  2KGB C;  3I5F B;  4QJ4 B;  1UHN A;  2NCP A;  2ZRS A;  3BUW B;  3JTD B;  4XJK A;  2I18 A;  3OHM B;  4R1E A;  4YBH B;  3DY9 A;  1G33 A;  2F2O A;  3EVU A;  4MVF A;  1HT9 A;  3LK0 A;  1J55 A;  2JT3 A;  4QJ3 B;  1VRK A;  5I2Q A;  5I8N A;  3R1P A;  5I94 A;  1YRT B;  2PAS A;  1XK4 A;  1N2D A;  3D78 A;  2LVK A;  3L4L A;  3NSO A;  1YX7 A;  3S0B A;  4BY4 A;  2M7N A;  4INX A;  1U5I A;  3CS1 A;  2KI6 D;  1ALW A;  2GGZ A;  3D10 A;  2KBM A;  3KEV A;  5PAL A;  4PHJ A;  2M7L A;  3VRO A;  1NX1 A;  4PE1 A;  3EVR A;  4CFQ A;  1CLB A;  1ODB A;  1CNP A;  1OE9 B;  2KYF A;  2L2E A;  1TWO A;  3GK2 A;  3DF0 B;  1DJI A;  1ZOT B;  3SG5 A;  1KQM C;  4M2Q A;  4D1E A;  1GQM A;  2Q91 A;  3L4A A;  1KK8 B;  1JFK A;  1LS8 A;  3EK4 A;  1BR4 B;  2ZN8 A;  1N65 A;  2JNF A;  1IIO A;  2LHI A;  5CSN A;  1D1O A;  2M0R A;  1N0Y A;  1TUZ A;  1OOF A;  3QRX A;  1KWO B;  1IGV A;  5DKQ A;  3SJS A;  1XYD A;  1CKK A;  1A75 A;  2L4I A;  1ALV A;  2PSR A;  1SK6 D;  1KFU S;  1NYA A;  1L2O B;  2F2P A;  2I7A A;  2LC5 A;  4YGD B;  1SMG A;  4OCI A;  5BPJ A;  1UHI A;  1K94 A;  1B9A A;  4P2Y B;  3TUY B;  1FF1 A;  2MA2 A;  1IKU A;  1CMF A;  1OOI X;  4ICB A;  1BMO A;  1RJV A;  1W9Z A;  3TZ1 A;  3PFV A;  5KU1 A;  2ZKM X;  1CDM A;  1XA5 A;  3EK7 A;  3D75 A;  2L51 A;  3K1E A;  1L2O C;  4HRG A;  1GGZ A;  1MQ1 A;  2JPT A;  1AP4 A;  1BR1 B;  5AER A;  2MAZ A;  2PQL A;  2WC6 A;  1DMO A;  2JXL A;  3BYA A;  4CLN A;  1Q80 A;  3H4S E;  1A4P A;  1K9P A;  2KDH A;  4GFT A;  2FCE A;  2WOS A;  4USL A;  3BQ3 A;  4XJK B;  3VRQ A;  2ZNE A;  1CM1 A;  1OMV A;  5B8I B;  1CFP A;  1F70 A;  1J7Q A;  2WOR A; 
#chains in the Genus database with same CATH homology
 1MF8 B;  2K8M B;  3WXA A;  2AUC A;  2LUC A;  1W7J B;  2B1U A;  1M31 A;  1JC2 A;  1RWY A;  1B7T Z;  3CGA A;  1SYM A;  2EC6 B;  4GGF C;  3EK8 A;  1J7R A;  1DVI A;  1YUT A;  2GV5 A;  1WY9 A;  3FWB A;  5ER4 X;  1F54 A;  3TDI A;  1XK4 C;  4DRW A;  1WDC C;  3CR2 A;  2M1K B;  1BJF A;  2BCX A;  4AQJ A;  4GPL B;  1SR6 C;  1UP5 A;  2BE4 A;  2LLT A;  4YI9 A;  3AAK A;  1YRU B;  2Y1M A;  2K2A A;  1IRJ A;  1K8U A;  2WND A;  1YVH A;  2RGI A;  3PN7 B;  3TS5 B;  1UUR A;  2LLU A;  4N1G A;  1IG5 A;  4MRY A;  1B8L A;  3O2P A;  4ETO A;  3BUO B;  1CM4 A;  3ZNI A;  1QX5 B;  2NLN A;  2KYC A;  4NDC A;  1RRO A;  4YRU A;  1KFX L;  1TNP A;  3SIA A;  4MZJ A;  4MEW A;  2LMV A;  2Q4U A;  5KTY A;  1EJ3 A;  2G2B A;  2KFF A;  5HKY A;  3I5I B;  2LMU A;  3NSK A;  2KNE A;  1S26 D;  2LVI A;  4ZCV A;  1Y1A A;  5HLV A;  5HKW A;  1IH0 A;  1KQM B;  2JNX A;  3EVV A;  4YGC B;  4PHM A;  4HRH A;  1QX7 A;  4MN0 A;  2MBX A;  2QPT A;  1E8A A;  1CMG A;  3SG3 A;  1SBJ A;  5AXI A;  2WCE A;  2BBN A;  2M97 A;  2A4J A;  2KFG A;  3DF0 A;  3LL8 B;  4QJ5 B;  5FYX A;  1F8H A;  2KQY A;  5TNC A;  2JRF A;  1CDP A;  1MWN A;  1PAL A;  2CCM A;  1TTX A;  2JT8 A;  2HET A;  3O78 A;  2E6W A;  1NX2 A;  3SG6 A;  5I2L A;  3CZT X;  1YVL A;  3NSI A;  1K2H A;  2M1U A;  2LVJ A;  3FS7 A;  1WRL A;  1UHJ A;  1FPW A;  4IL1 A;  2F33 A;  1B7T Y;  1TIZ A;  2KFH A;  4PE7 A;  2I2R E;  4ORC B;  1QLS A;  4CPV A;  1G4Y R;  3VRN A;  4CFR A;  5AEQ A;  2MHH A;  3WNX B;  2IS9 A;  3EKH A;  5HKZ A;  5K89 A;  1H4B A;  4PHN A;  1L7Z A;  1SRA A;  1PVA A;  3NXA A;  1J7O A;  2R2I A;  2JWW A;  3IQO A;  1FBV A;  2CTN A;  1YUU A;  2I94 A;  3DVK A;  1EG3 A;  2EC6 C;  1IQ5 A;  1FW4 A;  1SCV A;  3FWC A;  3CWG A;  1MR8 A;  3CTN A;  3A8R A;  4OVN F;  1A03 A;  1XFU O;  4DS7 A;  1YTZ C;  2O60 A;  1F4Q A;  1B4C A;  1K95 A;  2H61 A;  5HYD A;  1AJ5 A;  1IWQ A;  1LKJ A;  3JVT B;  1RFJ A;  1A29 A;  1DF0 B;  2NCO A;  4NDB A;  2PRU A;  5CPV A;  2ZRT A;  3I5G C;  3BXK A;  1QIV A;  1QXP A;  2Y1N A;  3PN7 C;  4GGF A;  1Y1U A;  2K0J A;  2F3Y A;  3PAL A;  2JC2 A;  4A4C A;  2KI6 C;  1F55 A;  1DJY A;  2L98 A;  4MZL A;  2BCB A;  2F8P A;  2BE6 A;  2K7B A;  1ZMZ A;  1SW8 A;  4P5O E;  1K9K A;  1FI6 A;  4U8D A;  5D7F A;  1V1G A;  2JTZ A;  2K2F A;  3NSL A;  3PSR A;  5AAN A;  1NX0 A;  2LVV A;  2WCB A;  4GUK A;  1R2U A;  1DJG A;  1M45 A;  1MXL C;  1DJH A;  1BU3 A;  5D69 A;  1SPY A;  1CFD A;  1DGV A;  3BUX B;  1XO5 A;  2L4H A;  1PSB A;  2M49 B;  2CXJ A;  4M2P A;  3WHU B;  2E30 A;  1CLM A;  1Y6W A;  2H2K A;  2LAN A;  5CSF A;  3GK1 A;  3PM8 A;  3PLF B;  1C7W A;  2LLS A;  4JWQ A;  4OR9 B;  1B8R A;  4HSZ A;  4GGN A;  2OS8 B;  1C7V A;  1NCZ A;  1AJ4 A;  3DD4 A;  4NDD A;  4GAO A;  1EL4 A;  1S5G Z;  1NX3 A;  1QAS A;  1BLQ A;  1DGU A;  1KFU L;  3LLE A;  4MLW A;  4N5X A;  1M46 A;  4MBE A;  1SCM C;  1AVS A;  2LUX A;  3A4U B;  1H8B A;  4OKH A;  1CB1 A;  2PAL A;  5I2O A;  1KQV A;  4ZCU A;  1SL9 A;  4JQ0 D;  1AK8 A;  2JUL A;  2ZND A;  3RLZ A;  1MUX A;  1OZO A;  4TNC A;  1W7I B;  1BT6 A;  2KOT A;  1NCX A;  2SAS A;  1K90 D;  4WRI A;  1XVJ A;  4A4B A;  2KI4 C;  1U5I B;  1YR5 A;  2F3Z A;  3OP0 A;  2EGD A;  4FTG A;  2CT9 A;  3I5I C;  4I5L B;  1JWD A;  1UHK A;  1OOJ A;  1KCY A;  3AKA A;  1NCY A;  1TOP A;  2JXC A;  3FIA A;  2JOJ A;  4YGA A;  2L0P A;  2MJW B;  1LVC D;  2OTG C;  4HRE E;  2H61 C;  2G9B A;  1PSR A;  4C0K A;  1IJ5 A;  1TRF A;  2P6B B;  1SY9 A;  4NQG A;  4ORB B;  4C0L A;  1REC A;  2LM5 A;  2LP3 A;  3JVT C;  1QVI Z;  3TUY C;  1KFX S;  2JT0 A;  1QVI Y;  1SR6 B;  2HPS A;  1LXF C;  3PAT A;  3I5F C;  2KBI A;  1NUB A;  3OX6 A;  3KPX A;  1JUO A;  1M63 B;  2GGM A;  2K61 A;  4CID A;  3BOW B;  1S6J A;  1XFY O;  1MXE A;  4GNK B;  4I5J A;  1QV1 A;  1OQP A;  2ZN9 A;  5AFP A;  1IJ6 A;  1SKT A;  2JTT A;  1ZFS A;  1KWO C;  2CNP A;  3OB2 B;  4N1F A;  2QAC A;  4I5N B;  5DKN A;  1XFW O;  1NSH A;  1NWD A;  1UWO A;  2V53 A;  1KSM A;  1QLK A;  1BF5 A;  4FQO A;  4JPZ B;  2K7C A;  3JTD C;  1TNQ A;  1DTL A;  2KQ6 A;  3HCM A;  1FI5 A;  3TDU A;  1A75 B;  4ORA B;  3BOW A;  1V1F A;  1WLM A;  2AMI A;  2L50 A;  1UHH A;  1QIW A;  1NPQ A;  1S5G Y;  2M8U A;  4AQI A;  4DUQ A;  3CR4 X;  2JU0 A;  3ICB A;  1CLL A;  1M39 A;  2M29 A;  2OS8 C;  1KK7 Y;  5DKR A;  2L5X B;  3I5G B;  4E68 A;  5GQQ C;  2K7O A;  2D8N A;  1K96 A;  3DVM A;  3TS5 C;  1S1E A;  1K9U A;  1OSA A;  2M3W A;  2ISD A;  1PUL A;  2DOQ A;  1F4O A;  1XFZ O;  3F45 A;  4BY5 A;  1CDN A;  2KAV A;  1KSO A;  1DJX A;  1JSA A;  2OPO A;  1JFJ A;  1B1G A;  1KK7 Z;  3KHE A;  1SL8 A;  1QJT A;  1DF0 A;  1DJW A;  1TN4 A;  1WRK A;  3HX4 A;  5CSJ A;  4I5K A;  1YUR A;  1RK9 A;  2Y4Q A;  1S6I A;  1RTP 1;  1AHR A;  1QX2 A;  2KHN A;  1PVB A;  2HF5 A;  3RM1 A;  3IF7 A;  2FOT A;  2KI4 B;  4F0Z B;  1SL7 A;  4PE4 A;  2M9G A;  1F71 A;  4WQ2 A;  4Q04 A;  2BL0 B;  4DCK A;  3ZWH A;  1OMR A;  2PMY A;  2COL B;  1IQ3 A;  1XFV O;  2FCD A;  3O4Y A;  2KSP A;  2OTG B;  1OMD A;  2LP2 A;  1QTX A;  1S3P A;  1J7P A;  1QAT A;  3LK1 A;  2KAX A;  2FJU B;  3KF9 A;  1JBA A;  2WCF A;  3KO0 A;  1J1E A;  1WDC B;  2CBL A;  1YX8 A;  5JOL A;  1G8I A;  4GBA A;  5J3X A;  4C0J A;  2JQ6 A;  3SIB A;  3AKB A;  5KSZ A;  5IBW A;  3M0W A;  1SNL A;  4UPG A;  2PVB A;  2Y5I A;  1GGW A;  3AAJ A;  1A2X A;  1PRW A;  2O5G A;  1JF0 A;  1CDL A;  2JZI A;  1AUI B;  3DVJ A;  1XFX O;  4PAL A;  1EXR A;  1CFF A;  1EG4 A;  2MLE C;  1K93 D;  1NIW A;  1TNW A;  3BUN B;  1YUS A;  3C1V A;  3E3R A;  3LCP C;  2NZ0 A;  1TCO B;  2LE9 B;  3MSE B;  1BOC A;  3D0Y B;  2VRG A;  1UUS A;  1TNX A;  1ZUZ A;  1B8C A;  2EHB A;  2KAY A;  1C07 A;  1PK0 D;  3EKJ A;  1S6C A;  3GOF A;  5CSI A;  4OV2 A;  4YI8 A;  1ZAC A;  3D0Y A;  4L9M A;  4YGE B;  1HQV A;  2LAP A;  2SCP A;  1EH2 A;  3CLN A;  1DT7 B;  5ER5 A;  2MLF C;  4MSP A;  4PE0 A;  1NP8 A;  3VRR A;  1SCM B;  2LNK A;  5JJG A;  3VGO A;  1OZS A;  3CR5 X;  3TDZ A;  1BOD A;  3WHT B;  2HQW A;  2BBM A;  1WLZ A;  2AAO A;  3GK4 X;  1LA0 A;  2WC8 A;  1LIN A;  5G08 A;  4DIR A;  1WRZ A;  2NXQ A;  3IQQ A;  1BG1 A;  1JF2 A;  3O6B A;  3OX5 A;  4MRX A;  4XYN A;  1MHO A;  5F6T A;  3BUM B;  1KK8 C;  1GJY A;  2BKH B;  1X02 A;  1J1D A;  2BEC A;  4PDZ A;  2HQ8 A;  1B47 A;  1CTR A;  2K7D A;  2MRD A;  2BCA A;  2BL0 C;  3I5H B;  2LV7 A;  4PCW A;  3SG2 A;  4AOM A;  3SG4 A;  1QV0 A;  1Y0V H;  2LMT A;  2KGR A;  3VRP A;  4YGB B;  3K21 A;  1LA3 A;  2LHL A;  1TCF A;  4MZK A;  4M2O A;  3SG7 A;  1QS7 A;  3OB1 B;  3DVE A;  5HLO A;  3I5H C;  1R6P A;  1DJZ A;  4PHK A;  2BKI B;  2TN4 A;  1Y1X A;  1CFC A;  1S36 A;  2LCP A;  2ZFD A;  4WQ3 A;  4QJ4 B;  2KGB C;  3I5F B;  1UHN A;  2NCP A;  2ZRS A;  3BUW B;  3JTD B;  4XJK A;  2I18 A;  3OHM B;  4R1E A;  4YBH B;  3EVU A;  1G33 A;  2F2O A;  4MVF A;  1HT9 A;  3LK0 A;  1J55 A;  2JT3 A;  4QJ3 B;  1VRK A;  5I2Q A;  5I8N A;  1YRT B;  2PAS A;  1XK4 A;  1N2D A;  3NSO A;  2LVK A;  1YX7 A;  4BY4 A;  2M7N A;  1U5I A;  3CS1 A;  2KI6 D;  1ALW A;  2GGZ A;  3D10 A;  2KBM A;  3KEV A;  5PAL A;  4PHJ A;  2M7L A;  3VRO A;  1NX1 A;  4PE1 A;  3EVR A;  4CFQ A;  1CLB A;  1ODB A;  1CNP A;  1OE9 B;  2KYF A;  2L2E A;  3GK2 A;  3DF0 B;  1DJI A;  1ZOT B;  3SG5 A;  1KQM C;  4M2Q A;  4D1E A;  1GQM A;  2Q91 A;  1KK8 B;  1JFK A;  3EK4 A;  1BR4 B;  2ZN8 A;  1N65 A;  2JNF A;  2LHI A;  5CSN A;  1D1O A;  2M0R A;  1N0Y A;  3QRX A;  1KWO B;  1IGV A;  5DKQ A;  3SJS A;  1XYD A;  1CKK A;  1A75 A;  2L4I A;  1ALV A;  2PSR A;  1SK6 D;  1KFU S;  1NYA A;  1L2O B;  2F2P A;  2I7A A;  2LC5 A;  4YGD B;  1SMG A;  4OCI A;  5BPJ A;  1UHI A;  1K94 A;  1B9A A;  4P2Y B;  3TUY B;  1FF1 A;  2MA2 A;  1IKU A;  1CMF A;  4ICB A;  1BMO A;  1RJV A;  5KU1 A;  3TZ1 A;  3PFV A;  2ZKM X;  1CDM A;  1XA5 A;  3EK7 A;  2L51 A;  1L2O C;  4HRG A;  1GGZ A;  1MQ1 A;  2JPT A;  1AP4 A;  1BR1 B;  5AER A;  2MAZ A;  1DMO A;  2JXL A;  3BYA A;  4CLN A;  1Q80 A;  3H4S E;  1A4P A;  1K9P A;  2KDH A;  4GFT A;  2FCE A;  2WOS A;  4USL A;  3BQ3 A;  4XJK B;  3VRQ A;  2ZNE A;  1CM1 A;  1OMV A;  5B8I B;  1CFP A;  1F70 A;  1J7Q A;  2WOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...