1L2OC

Scallop myosin s1-adp-p-pdm in the actin-detached conformation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
KLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 37
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2002-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l2oC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1l2oC02
2JPTA 2LE9B 3HCMA 1DGVA 4GNKB 5JOLA 1KCYA 1DJYA 2M8UA 2MLFC 5ER4X 1LA0A 4PHMA 4GAOA 1J7OA 3KF9A 1L2OC 2IS9A 3LK0A 2ZN9A 4PDZA 1BT6A 2F33A 2KFHA 3TUYB 3WNXB 1F70A 3I5FB 3PATA 4WRIA 2GGMA 2WCBA 3O78A 1FW4A 1RK9A 3E3RA 4ORBB 2FCEA 1YRUB 4GBAA 2MAZA 2ZRTA 1KQVA 2PALA 2CNPA 1PRWA 3I5FC 1U5IB 1B7TZ 1UWOA 1YVLA 2K61A 3FS7A 1SCMB 4MSPA 2KYCA 4MLWA 2M7NA 3AKAA 1DJHA 3MSEB 2BKIB 3DF0B 1WDCB 2LVJA 1N0YA 1PULA 5CSJA 1M63B 1SCMC 3DVJA 4M2PA 1K8UA 3ZNIA 1CB1A 1CLBA 3I5IB 1RFJA 5PALA 1A4PA 1RWYA 2LVVA 1EJ3A 1F54A 1NP8A 2M0RA 3PM8A 4IL1A 1RTP1 1QVIY 1TN4A 5B8IB 1K90D 4P5OE 2VRGA 4HSZA 2E6WA 3GK2A 1QJTA 1XFZO 4OCIA 2KHNA 1QV1A 4MZKA 2L98A 1GQMA 1X02A 1R6PA 3OB1B 4PHNA 4JWQA 2LLTA 4I5LB 3EK8A 2L2EA 2K8MB 1KFUS 2KI4B 2Y1MA 3CR5X 5CSNA 4C0LA 1NX1A 1MWNA 5FYXA 4OVNF 2JT8A 3VGOA 2LLSA 1QX5B 1PALA 1XYDA 1JWDA 2HQ8A 1F4OA 2M1UA 1ZOTB 2LUCA 4CFRA 2BKHB 4CPVA 3SG2A 4FTGA 2JT3A 1F4QA 1DJGA 3OX6A 2BCXA 2LUXA 3I5HB 2KFGA 4ETOA 1WY9A 3JTDB 1W7JB 4WQ2A 1KFXS 3JVTB 2KGBC 1VRKA 1ALWA 3LL8B 3WHTB 3CGAA 2EHBA 4C0JA 5DKRA 2NXQA 3KEVA 3OP0A 2COLB 2LCPA 4AQJA 1YTZC 3GK1A 3JTDC 3JVTC 1DJWA 3F45A 1PVBA 3LCPC 3DVKA 2F2PA 1FPWA 2L51A 1JUOA 2MLEC 1KFUL 2LANA 2R2IA 1BJFA 1EXRA 1UHIA 1IQ3A 2JNFA 4DUQA 3DVMA 1UHKA 5GQQC 3KHEA 1C07A 3SJSA 1S1EA 1K94A 2AAOA 4CLNA 1QLKA 1IWQA 1XO5A 1WLMA 1EG4A 1WLZA 1JFJA 3CZTX 3LLEA 3BQ3A 2E30A 2BCAA 1SR6C 2KQYA 5HKYA 1J7PA 2H2KA 1OMDA 5HKZA 3SG3A 4M2QA 1DF0B 1QXPA 2FCDA 1BR1B 1K95A 3AAJA 2LP2A 1FF1A 1BMOA 4ZCUA 3K21A 1QX7A 1XFWO 4PCWA 1QS7A 4XJKB 4UPGA 1KFXL 4AQIA 2LP3A 5CSIA 1K96A 1CKKA 2A4JA 3AKBA 2F3ZA 2ZKMX 4L9MA 4F0ZB 3NXAA 1YR5A 2K7CA 4YGEB 3D10A 2BL0B 1JF2A 2AMIA 4Q04A 4XYNA 2PMYA 1S26D 2O5GA 2P6BB 1J1DA 1TOPA 3C1VA 5DKNA 3HX4A 2KAVA 2HPSA 2CCMA 2BL0C 4MRYA 4PE0A 1QIWA 4DRWA 1NCYA 1A75B 1NX0A 1BF5A 2KAYA 1F8HA 1QIVA 1TTXA 4I5KA 5I8NA 2V53A 1SPYA 2JWWA 1G33A 1KWOB 1RJVA 2JC2A 4MZJA 3BOWB 1XK4C 2G2BA 1DVIA 4OV2A 2LHIA 5HLVA 3CTNA 2JTTA 2L50A 3DVEA 2Q91A 3TUYC 1JSAA 2OPOA 4MZLA 2ZFDA 1CLLA 4N1GA 1N2DA 4YGAA 2MHHA 4I5JA 1QTXA 1DMOA 1A2XA 1Y1UA 5KTYA 2PASA 1IGVA 1V1FA 2KNEA 1IKUA 1JF0A 1DJXA 1BODA 1OZOA 2WNDA 1E8AA 1M46A 2QACA 1AK8A 1KK8B 2M1KB 1WDCC 1K9PA 1H4BA 2KI6C 1K9UA 2ZNEA 1U5IA 3EVVA 4PE4A 2F8PA 1S6CA 1OOJA 1UHNA 3I5IC 1KQMB 2ZN8A 3EVUA 2Q4UA 3OX5A 4CFQA 3EVRA 4FQOA 2M9GA 1SY9A 2JQ6A 1N65A 3DF0A 2K7BA 1KK8C 5AEQA 2B1UA 1FI6A 1J7QA 2RGIA 2BE4A 1EG3A 3EK4A 2KGRA 3BUWB 2M3WA 3VROA 1KQMC 2AUCA 1B47A 4GFTA 1FBVA 3CS1A 1QV0A 1DJIA 1BOCA 1EH2A 4GUKA 1SL7A 2TN4A 2KI4C 1WRKA 4QJ3B 3TDIA 1B4CA 2LMUA 1KSOA 3SIAA 1QVIZ 1LXFC 2KOTA 4AOMA 4PE7A 1UUSA 1RROA 3FWCA 2K7DA 3NSKA 1NX2A 5AXIA 4E68A 2FOTA 5J3XA 1HT9A 2JRFA 1NSHA 3IQOA 2I7AA 5HKWA 3SG7A 4YGBB 3IF7A 1CDLA 1TRFA 3TDZA 1DT7B 1YURA 4MEWA 2K0JA 1MR8A 4OR9B 3I5HC 1YUUA 3VRPA 3PALA 3M0WA 3O2PA 3DD4A 1WRZA 4MBEA 4ORCB 2KI6D 2M97A 3PSRA 1B8CA 5HLOA 2L4IA 2OS8B 1A03A 2JZIA 3CR2A 4NDCA 2JOJA 2KAXA 2EC6B 2JNXA 2M7LA 2L5XB 4QJ4B 3ICBA 2CBLA 4CIDA 4C0KA 1LKJA 1Y1XA 4ZCVA 1SBJA 1XFYO 1NUBA 1ODBA 1JC2A 1K93D 3D0YB 1UHHA 4D1EA 1UHJA 2LAPA 4YBHB 4JQ0D 1B8RA 4TNCA 1TNQA 1F71A 1S5GY 5I2QA 1TNWA 2JULA 1CDNA 3BUMB 4BY5A 1W7IB 2WCFA 5IBWA 2JXLA 1CMGA 2EGDA 2I18A 1AUIB 3NSIA 1F55A 1TNPA 3NSLA 4P2YB 1V1GA 1KSMA 1SK6D 3IQQA 1H8BA 4MRXA 2BBMA 4NDBA 1IRJA 1YX8A 4YGCB 3H4SE 3CWGA 1CFPA 2K7OA 1DF0A 4JPZB 1AVSA 3BUXB 4USLA 3OHMB 4YGDB 1DJZA 3CLNA 4YI9A 4XJKA 1EL4A 2KSPA 2LM5A 4GPLB 5D69A 2NLNA 1B9AA 3O6BA 1S6IA 3RM1A 1Y1AA 1QATA 4M2OA 1CFCA 3VRNA 2D8NA 2H61C 5JJGA 1NX3A 3PN7B 5BPJA 5AFPA 3TS5B 1OE9B 1CFDA 1IQ5A 2Y4QA 2I2RE 1TCFA 1TIZA 2HETA 3LK1A 1CMFA 1SYMA 1SL9A 3RLZA 2CT9A 3SG4A 3AAKA 1BG1A 2H61A 3BUOB 3PN7C 4HRGA 1SRAA 5AERA 5KSZA 1YVHA 1KWOC 5CPVA 3TS5C 1A75A 2OTGB 1UURA 1XFUO 1XK4A 1MHOA 1J55A 1YX7A 1UP5A 3EKJA 4N1FA 1XVJA 1DGUA 1ZUZA 2OTGC 3BOWA 2CXJA 1XA5A 1IJ5A 1S36A 2M29A 1IH0A 3SG5A 2WC8A 5D7FA 2K2FA 4PALA 2Y1NA 5AANA 4DIRA 3GOFA 2FJUB 4GGFC 1OMVA 5I2LA 2G9BA 3BXKA 4PHJA 4YRUA 1AHRA 1SNLA 2LLUA 1B8LA 1OMRA 1XFVO 2LC5A 1K9KA 5KU1A 1NYAA 2BE6A 1CLMA 4U8DA 4GGFA 5TNCA 2KQ6A 1Y0VH 1PK0D 1OSAA 2MA2A 4OKHA 1GJYA 4BY4A 1MXEA 4ICBA 2GGZA 2LVIA 2ZRSA 4ORAB 5DKQA 1AJ5A 1D1OA 1ZACA 2Y5IA 4NDDA 2JT0A 1SCVA 2F3YA 1GGZA 2KYFA 1G4YR 3QRXA 5F6TA 1RECA 2LMTA 1MUXA 5G08A 2PSRA 1S6JA 2K2AA 1QLSA 3EKHA 4PE1A 2LVKA 2DOQA 3PLFB 4A4BA 1CM1A 2WORA 3I5GB 2BCBA 2WOSA 2SCPA 1OZSA 2PRUA 2ZNDA 2BBNA 1B1GA 1PSBA 1M31A 1NCZA 3FIAA 1LA3A 2MBXA 4DCKA 1SW8A 2PVBA 4DS7A 4YI8A 1A29A 1FI5A 3I5GC 3O4YA 2WCEA 1K2HA 1XFXO 3PFVA 2JXCA 4MVFA 1CNPA 1TCOB 5HYDA 1QASA 2BECA 3SG6A 2M49B 4HRHA 1AP4A 2OS8C 1BLQA 1CM4A 1MQ1A 4PHKA 1BU3A 3TZ1A 2GV5A 1TNXA 2EC6C 1R2UA 3WHUB 2LMVA 1KK7Y 5I2OA 1QX2A 2LV7A 1MF8B 1NWDA 2LHLA 5CSFA 1LVCD 1SMGA 2JU0A 2SASA 3KPXA 4MN0A 2ISDA 3BUNB 3EK7A 1SL8A 5ER5A 3WXAA 1MXLC 1BR4B 3GK4X 1ALVA 1J1EA 1SR6B 1CDMA 1M39A 2F2OA 4NQGA 1YRTB 5K89A 3CR4X 1NPQA 1NCXA 3SIBA 4HREE 1S3PA 1AJ4A 2NZ0A 2CTNA 1GGWA 4GGNA 2L4HA 2L0PA 1ZMZA 2JTZA 2HF5A 1LINA 4I5NB 1DTLA 3VRRA 1CDPA 2MRDA 2KBMA 2MJWB 1CTRA 1PSRA 3D0YA 2HQWA 2NCPA 4WQ3A 2O60A 1CFFA 2KDHA 1YUTA 1HQVA 1G8IA 1L7ZA 1SKTA 1Q80A 1KK7Z 2KFFA 3FWBA 4N5XA 4R1EA 1J7RA 1PVAA 3OB2B 1WRLA 3NSOA 1JBAA 2NCOA 3BYAA 1ZFSA 4A4CA 1IJ6A 2KBIA 2LNKA 1Y6WA 1IG5A 1C7VA 2I94A 1YUSA 3A8RA 1M45A 1B7TY 1NIWA 1S5GZ 3ZWHA 4QJ5B 1JFKA 2QPTA 3VRQA 3TDUA 1C7WA 3A4UB 1OQPA 1L2OB 3KO0A
chains in the Genus database with same CATH superfamily
2JPTA 3EG5B 2LE9B 3HCMA 1DGVA 4GNKB 5I94A 5JOLA 1KCYA 1DJYA 2M8UA 3R1OA 2MLFC 5ER4X 1LA0A 4PHMA 1DELA 4GAOA 1J7OA 3KF9A 1L2OC 2IS9A 3LK0A 2ZN9A 4PDZA 1BT6A 2F33A 2KFHA 4JD9A 3TUYB 3WNXB 1F70A 3I5FB 3PATA 4WRIA 2GGMA 2WCBA 3O78A 1FW4A 1RK9A 3E3RA 4ORBB 2FCEA 1YRUB 4GBAA 4INWA 2MAZA 2ZRTA 1KQVA 2PALA 2CNPA 1PRWA 3CDNA 3I5FC 1U5IB 1B7TZ 1UWOA 1YVLA 2K61A 3FS7A 1SCMB 4MSPA 1Z4HA 2KYCA 4MLWA 2M7NA 3AKAA 1DJHA 3MSEB 3S0FA 2BKIB 3DF0B 1WDCB 2LVJA 1N0YA 1OOFA 1PULA 5CSJA 1M63B 1SCMC 1C3YA 3DVJA 4M2PA 1K8UA 3ZNIA 1CB1A 1CLBA 3I5IB 1RFJA 5PALA 1A4PA 1RWYA 2LVVA 1EJ3A 1F54A 1NP8A 2M0RA 3PM8A 4IL1A 1RTP1 1QVIY 1TN4A 5B8IB 1K90D 4P5OE 3RZSA 2VRGA 2L5YA 4HSZA 2E6WA 3GK2A 1QJTA 1XFZO 4OCIA 2KHNA 1QV1A 4MZKA 2L98A 1GQMA 1X02A 1R6PA 3OB1B 4PHNA 4JWQA 2LLTA 2WCKA 4I5LB 3EK8A 2L2EA 2K8MB 1KFUS 2KI4B 2Y1MA 3SS4A 3CR5X 5CSNA 4C0LA 1NX1A 1MWNA 5FYXA 4OVNF 2JT8A 3VGOA 2LLSA 1QX5B 1PALA 1XYDA 1JWDA 2HQ8A 1F4OA 3Q8IA 2M1UA 1ZOTB 1TWOA 2LUCA 4INXA 4CFRA 2BKHB 4CPVA 3SG2A 4FTGA 2KLEA 2JT3A 1F4QA 1DJGA 3OX6A 3V2LA 2BCXA 2LUXA 3DYEA 3I5HB 2KFGA 3S0EA 1WY9A 3JTDB 4ETOA 1W7JB 3BJHA 4WQ2A 1KFXS 3JVTB 2KGBC 1VRKA 1ALWA 3LL8B 3WHTB 3CGAA 2EHBA 4C0JA 5DKRA 2NXQA 3KEVA 3OP0A 2COLB 2LCPA 4AQJA 1YTZC 3GK1A 3JTDC 3B86A 3JVTC 1DJWA 3B7AA 3F45A 1PVBA 3LCPC 3DVKA 2F2PA 5D3OA 2L51A 1JUOA 2MLEC 3B87A 1FPWA 1KFUL 2LANA 2R2IA 1BJFA 3CYZA 1EXRA 1UHIA 1IQ3A 2JNFA 4DUQA 3DVMA 3O4XA 1UHKA 5GQQC 3KHEA 1C07A 1GM0A 3SJSA 1S1EA 4IJ7A 1K94A 2AAOA 4CLNA 1QLKA 1IWQA 1XO5A 1WLMA 1EG4A 1WLZA 1JFJA 3CZTX 3LLEA 3BQ3A 2E30A 2BCAA 1SR6C 2KQYA 5HKYA 1J7PA 1OW4A 2H2KA 1OMDA 5HKZA 3SG3A 4M2QA 1DF0B 1QXPA 1C3ZA 1BR1B 1K95A 2FCDA 3AAJA 1W9ZA 2LP2A 1FF1A 1BMOA 4ZCUA 3K21A 1QX7A 1XFWO 4PCWA 1QS7A 4XJKB 4UPGA 1KFXL 4AQIA 2LP3A 2QEOA 1K96A 3DXLA 2A4JA 3AKBA 2F3ZA 2ZKMX 4L9MA 5CSIA 4F0ZB 3NXAA 1YR5A 2K7CA 3NHTA 3D10A 2BL0B 4YGEB 1JF2A 1OOGA 2AMIA 4Q04A 4XYNA 2PMYA 1S26D 2O5GA 2P6BB 1J1DA 1TOPA 2PYQA 3C1VA 5DKNA 3HX4A 2KAVA 4OZDA 3OBVA 2HPSA 2CCMA 2BL0C 4MRYA 4PE0A 1QIWA 4DRWA 1TUJA 2WCLA 1NCYA 1A75B 2QDIA 3QMEA 1NX0A 1BF5A 2KAYA 1F8HA 1QIVA 1TTXA 4I5KA 5I8NA 2V53A 1SPYA 2JWWA 1G33A 1KWOB 2WCMA 1RJVA 2JC2A 3BFHA 4MZJA 3BOWB 1XK4C 1Z2CB 2G2BA 3B6XA 3SS3A 1DVIA 4OV2A 1QWVA 2BAPA 2LHIA 5HLVA 3CTNA 3UO9A 2JTTA 2L50A 3DVEA 2Q91A 3TUYC 1JSAA 2OPOA 4MZLA 2ZFDA 3DY9A 1CLLA 3S0BA 4N1GA 1N2DA 2ERBA 2MHHA 4I5JA 4YGAA 1QTXA 1DMOA 1A2XA 3FE9A 1Y1UA 5KTYA 2PASA 1IGVA 3L47A 1V1FA 2KNEA 1IKUA 1JF0A 1XFRA 1DJXA 3S0GA 1BODA 3B88A 3BFBA 1OZOA 2WNDA 1E8AA 1M46A 2QACA 1AK8A 1KK8B 2M1KB 1WDCC 1K9PA 3FE6A 2KI6C 1H4BA 1K9UA 2ZNEA 5HL1A 1U5IA 3EVVA 4PE4A 4PT1A 2F8PA 1S6CA 1OOJA 1UHNA 3I5IC 1KQMB 2ZN8A 3EVUA 2Q4UA 3OX5A 4CFQA 3EVRA 3CZ1A 2M9GA 4FQOA 1ORGA 1SY9A 3CZ0A 2JQ6A 1N65A 3D75A 3DF0A 2K7BA 1KK8C 5AEQA 2B1UA 2L2CA 1J7QA 2RGIA 2BE4A 1EG3A 3EK4A 2KGRA 5FI7A 1FI6A 3BUWB 2M3WA 3VROA 1KQMC 3K1EA 2AUCA 1B47A 4GFTA 1FBVA 3D78A 3CS1A 1QV0A 1DJIA 1BOCA 2YGUA 4GUKA 1EH2A 5DICA 1SL7A 2TN4A 2KI4C 3S0DA 1WRKA 3CABA 4QJ3B 3TDIA 1B4CA 2LMUA 1KSOA 3SIAA 1QVIZ 1LXFC 2KOTA 4AOMA 4PE7A 1UUSA 1RROA 3FWCA 2K7DA 3NSKA 1OOIX 1NX2A 5AXIA 3BFAA 4E68A 2FOTA 5J3XA 3FE8A 1HT9A 2JRFA 1NSHA 3IQOA 2I7AA 5HKWA 3SG7A 4YGBB 3IF7A 1CDLA 1TRFA 3TDZA 1DT7B 2WC5A 1YURA 4MEWA 2K0JA 1MR8A 2K60A 2WC6A 4OR9B 3I5HC 1YUUA 3CZ2A 3VRPA 3PALA 3M0WA 3O2PA 3DD4A 1WRZA 4MBEA 4ORCB 2KI6D 2M97A 3PSRA 1B8CA 5HLOA 2L4IA 2OS8B 1A03A 2JZIA 3CR2A 4NDCA 2JOJA 2KAXA 2EC6B 2JNXA 2QEVA 2M7LA 2L5XB 3D77A 4QJ4B 3ICBA 3R1PA 2CBLA 4KYNA 4C0KA 4CIDA 2GTEA 1LKJA 1Y1XA 2P71A 4ZCVA 1SBJA 1XFYO 3NHIA 1NUBA 1ODBA 1JC2A 1K93D 3D0YB 1UHHA 4D1EA 1UHJA 2LAPA 4YBHB 4JQ0D 1B8RA 4TNCA 1T14A 2KPHA 1TNQA 1F71A 1S5GY 5I2QA 1TNWA 1TUZA 2JULA 3BUMB 3D73A 4BY5A 1W7IB 2WCFA 5IBWA 2JXLA 1CDNA 1CMGA 2EGDA 2I18A 4JKTA 1AUIB 3NSIA 1F55A 1TNPA 3NSLA 4P2YB 1V1GA 1KSMA 1SK6D 3IQQA 1H8BA 4MRXA 2BBMA 4NDBA 1IRJA 1YX8A 4YGCB 3H4SE 3CWGA 3PM2A 1CFPA 3IVTA 2K7OA 1DF0A 4JPZB 1AVSA 5EL2A 3BUXB 4USLA 3OHMB 4YGDB 1DJZA 3CLNA 4YI9A 4XJKA 1EL4A 2KSPA 2LM5A 4GPLB 5D69A 2NLNA 1B9AA 3O6BA 1S6IA 3RM1A 1Y1AA 1QATA 4M2OA 2QEBA 1CFCA 3VRNA 2D8NA 2H61C 5JJGA 1NX3A 3PN7B 5BPJA 5AFPA 3TS5B 1OE9B 1CFDA 1IQ5A 2Y4QA 2I2RE 1TCFA 1TIZA 2HETA 3LK1A 2FJYA 1CMFA 1SYMA 3L4AA 1SL9A 3RLZA 2CT9A 3SG4A 3AAKA 1BG1A 2H61A 3BUOB 3PN7C 4HRGA 1SRAA 5AERA 5KSZA 1YVHA 2WCHA 1KWOC 5CPVA 1SSEB 3TS5C 1DC1A 1A75A 2OTGB 1UURA 1XFUO 1XK4A 1MHOA 1J55A 1YX7A 1UP5A 3EKJA 4N1FA 5FI2A 1XVJA 2H8VA 3PJIA 1DGUA 1ZUZA 2OTGC 3BOWA 2CXJA 1XA5A 1IJ5A 1S36A 2M29A 1IH0A 3SG5A 2WC8A 5D7FA 2K2FA 4PALA 2Y1NA 5AANA 4DIRA 3GOFA 2FJUB 4GGFC 1OMVA 5I2LA 2G9BA 3BXKA 4PHJA 4YRUA 1AHRA 1SNLA 2LLUA 1B8LA 1OMRA 2BNXA 1XFVO 2LC5A 1K9KA 5KU1A 1NYAA 2BE6A 1CLMA 4U8DA 4GGFA 5TNCA 2KQ6A 1Y0VH 1PK0D 1OSAA 2MA2A 4OKHA 1DQEA 1GJYA 4BY4A 1MXEA 4ICBA 1LS8A 2GGZA 2LVIA 2ZRSA 4ORAB 5DKQA 1AJ5A 1D1OA 1ZACA 2Y5IA 4NDDA 2JT0A 1SCVA 2F3YA 3NGVA 1GGZA 2KYFA 1G4YR 3QRXA 4F7FA 5F6TA 1RECA 2QEHA 3OGNA 2LMTA 1MUXA 2P70A 5G08A 2PSRA 1S6JA 2K2AA 1QLSA 3EKHA 4PE1A 2LVKA 2DOQA 3UNWA 3PLFB 4A4BA 1CM1A 2WORA 3I5GB 2BCBA 2WOSA 2SCPA 1OZSA 2PRUA 2ZNDA 2BBNA 1B1GA 1PSBA 1M31A 1NCZA 3FIAA 1LA3A 3N7HA 2MBXA 4DCKA 1SW8A 2PVBA 4DS7A 4YI8A 1A29A 1FI5A 3I5GC 3O4YA 2WCEA 1P28A 4FQTA 1K2HA 1XFXO 3PFVA 2JXCA 4MVFA 1CNPA 1TCOB 5HYDA 1QASA 2BECA 3SG6A 2M49B 4HRHA 1AP4A 2OS8C 1BLQA 1CM4A 1MQ1A 4PHKA 1BU3A 3TZ1A 2GV5A 1TNXA 2EC6C 1R2UA 3WHUB 3SS5A 2LMVA 1KK7Y 5I2OA 1QX2A 2LV7A 1MF8B 1NWDA 2LHLA 1OOHA 5CSFA 1LVCD 1SMGA 2JU0A 2SASA 3KPXA 1IIOA 4MN0A 2ISDA 3BUNB 3DZTA 3EK7A 3S0AA 1SL8A 5ER5A 3WXAA 3R1VA 1MXLC 1BR4B 3VB1A 1DEKA 1ALVA 1J1EA 1SR6B 1CDMA 1M39A 2F2OA 3GK4X 4NQGA 2WCJA 1YRTB 5K89A 3CR4X 1NPQA 1NCXA 5FI6A 3SIBA 4HREE 1S3PA 1AJ4A 2NZ0A 2CTNA 1GGWA 4GGNA 2L4HA 2L0PA 1ZMZA 2JTZA 2HF5A 1LINA 4I5NB 1DTLA 3VRRA 1CDPA 2MRDA 2KBMA 2PQLA 2MJWB 1CTRA 1PSRA 3D0YA 2HQWA 2NCPA 4WQ3A 2O60A 1CFFA 3D74A 3L4LA 2KDHA 1YUTA 3D76A 1HQVA 1G8IA 1L7ZA 1SKTA 1Q80A 1KK7Z 2KFFA 3FWBA 4N5XA 4R1EA 1J7RA 1PVAA 3OB2B 1WRLA 3NSOA 1JBAA 2NCOA 3BYAA 1CKKA 1ZFSA 3R72A 4A4CA 1IJ6A 2KBIA 2KLDA 2LNKA 1Y6WA 1IG5A 1C7VA 2I94A 1YUSA 3A8RA 1M45A 1B7TY 1NIWA 1S5GZ 3ZWHA 4QJ5B 1JFKA 2QPTA 3VRQA 3TDUA 1C7WA 3A4UB 1OQPA 1L2OB 2JPOA 3KO0A
chains in the Genus database with same CATH topology
2JPTA 2LE9B 3HCMA 1DGVA 4GNKB 5JOLA 1KCYA 1DJYA 2M8UA 2MLFC 5ER4X 1LA0A 4PHMA 4GAOA 1J7OA 3KF9A 1L2OC 2IS9A 3LK0A 2ZN9A 4PDZA 1BT6A 2F33A 2KFHA 3TUYB 3WNXB 1F70A 3I5FB 3PATA 4WRIA 2GGMA 2WCBA 3O78A 1FW4A 1RK9A 3E3RA 4ORBB 2FCEA 1YRUB 4GBAA 2MAZA 2ZRTA 1KQVA 2PALA 2CNPA 1PRWA 3I5FC 1U5IB 1B7TZ 1UWOA 1YVLA 2K61A 3FS7A 1SCMB 4MSPA 2KYCA 4MLWA 2M7NA 3AKAA 1DJHA 3MSEB 2BKIB 3DF0B 1WDCB 2LVJA 1N0YA 1PULA 5CSJA 1M63B 1SCMC 3DVJA 4M2PA 1K8UA 3ZNIA 1CB1A 1CLBA 3I5IB 1RFJA 5PALA 1A4PA 1RWYA 2LVVA 1EJ3A 1F54A 1NP8A 2M0RA 3PM8A 4IL1A 1RTP1 1QVIY 1TN4A 5B8IB 1K90D 4P5OE 2VRGA 4HSZA 2E6WA 3GK2A 1QJTA 1XFZO 4OCIA 2KHNA 1QV1A 4MZKA 2L98A 1GQMA 1X02A 1R6PA 3OB1B 4PHNA 4JWQA 2LLTA 4I5LB 3EK8A 2L2EA 2K8MB 1KFUS 2KI4B 2Y1MA 3CR5X 5CSNA 4C0LA 1NX1A 1MWNA 5FYXA 4OVNF 2JT8A 3VGOA 2LLSA 1QX5B 1PALA 1XYDA 1JWDA 2HQ8A 1F4OA 2M1UA 1ZOTB 2LUCA 4CFRA 2BKHB 4CPVA 3SG2A 4FTGA 2JT3A 1F4QA 1DJGA 3OX6A 2BCXA 2LUXA 3I5HB 2KFGA 4ETOA 1WY9A 3JTDB 1W7JB 4WQ2A 1KFXS 3JVTB 2KGBC 1VRKA 1ALWA 3LL8B 3WHTB 3CGAA 2EHBA 4C0JA 5DKRA 2NXQA 3KEVA 3OP0A 2COLB 2LCPA 4AQJA 1YTZC 3GK1A 3JTDC 3JVTC 1DJWA 3F45A 1PVBA 3LCPC 3DVKA 2F2PA 1FPWA 2L51A 1JUOA 2MLEC 1KFUL 2LANA 2R2IA 1BJFA 1EXRA 1UHIA 1IQ3A 2JNFA 4DUQA 3DVMA 1UHKA 5GQQC 3KHEA 1C07A 3SJSA 1S1EA 1K94A 2AAOA 4CLNA 1QLKA 1IWQA 1XO5A 1WLMA 1EG4A 1WLZA 1JFJA 3CZTX 3LLEA 3BQ3A 2E30A 2BCAA 1SR6C 2KQYA 5HKYA 1J7PA 2H2KA 1OMDA 5HKZA 3SG3A 4M2QA 1DF0B 1QXPA 2FCDA 1BR1B 1K95A 3AAJA 2LP2A 1FF1A 1BMOA 4ZCUA 3K21A 1QX7A 1XFWO 4PCWA 1QS7A 4XJKB 4UPGA 1KFXL 4AQIA 2LP3A 5CSIA 1K96A 1CKKA 2A4JA 3AKBA 2F3ZA 2ZKMX 4L9MA 4F0ZB 3NXAA 1YR5A 2K7CA 4YGEB 3D10A 2BL0B 1JF2A 2AMIA 4Q04A 4XYNA 2PMYA 1S26D 2O5GA 2P6BB 1J1DA 1TOPA 3C1VA 5DKNA 3HX4A 2KAVA 2HPSA 2CCMA 2BL0C 4MRYA 4PE0A 1QIWA 4DRWA 1NCYA 1A75B 1NX0A 1BF5A 2KAYA 1F8HA 1QIVA 1TTXA 4I5KA 5I8NA 2V53A 1SPYA 2JWWA 1G33A 1KWOB 1RJVA 2JC2A 4MZJA 3BOWB 1XK4C 2G2BA 1DVIA 4OV2A 2LHIA 5HLVA 3CTNA 2JTTA 2L50A 3DVEA 2Q91A 3TUYC 1JSAA 2OPOA 4MZLA 2ZFDA 1CLLA 4N1GA 1N2DA 4YGAA 2MHHA 4I5JA 1QTXA 1DMOA 1A2XA 1Y1UA 5KTYA 2PASA 1IGVA 1V1FA 2KNEA 1IKUA 1JF0A 1DJXA 1BODA 1OZOA 2WNDA 1E8AA 1M46A 2QACA 1AK8A 1KK8B 2M1KB 1WDCC 1K9PA 1H4BA 2KI6C 1K9UA 2ZNEA 1U5IA 3EVVA 4PE4A 2F8PA 1S6CA 1OOJA 1UHNA 3I5IC 1KQMB 2ZN8A 3EVUA 2Q4UA 3OX5A 4CFQA 3EVRA 4FQOA 2M9GA 1SY9A 2JQ6A 1N65A 3DF0A 2K7BA 1KK8C 5AEQA 2B1UA 1FI6A 1J7QA 2RGIA 2BE4A 1EG3A 3EK4A 2KGRA 3BUWB 2M3WA 3VROA 1KQMC 2AUCA 1B47A 4GFTA 1FBVA 3CS1A 1QV0A 1DJIA 1BOCA 1EH2A 4GUKA 1SL7A 2TN4A 2KI4C 1WRKA 4QJ3B 3TDIA 1B4CA 2LMUA 1KSOA 3SIAA 1QVIZ 1LXFC 2KOTA 4AOMA 4PE7A 1UUSA 1RROA 3FWCA 2K7DA 3NSKA 1NX2A 5AXIA 4E68A 2FOTA 5J3XA 1HT9A 2JRFA 1NSHA 3IQOA 2I7AA 5HKWA 3SG7A 4YGBB 3IF7A 1CDLA 1TRFA 3TDZA 1DT7B 1YURA 4MEWA 2K0JA 1MR8A 4OR9B 3I5HC 1YUUA 3VRPA 3PALA 3M0WA 3O2PA 3DD4A 1WRZA 4MBEA 4ORCB 2KI6D 2M97A 3PSRA 1B8CA 5HLOA 2L4IA 2OS8B 1A03A 2JZIA 3CR2A 4NDCA 2JOJA 2KAXA 2EC6B 2JNXA 2M7LA 2L5XB 4QJ4B 3ICBA 2CBLA 4CIDA 4C0KA 1LKJA 1Y1XA 4ZCVA 1SBJA 1XFYO 1NUBA 1ODBA 1JC2A 1K93D 3D0YB 1UHHA 4D1EA 1UHJA 2LAPA 4YBHB 4JQ0D 1B8RA 4TNCA 1TNQA 1F71A 1S5GY 5I2QA 1TNWA 2JULA 1CDNA 3BUMB 4BY5A 1W7IB 2WCFA 5IBWA 2JXLA 1CMGA 2EGDA 2I18A 1AUIB 3NSIA 1F55A 1TNPA 3NSLA 4P2YB 1V1GA 1KSMA 1SK6D 3IQQA 1H8BA 4MRXA 2BBMA 4NDBA 1IRJA 1YX8A 4YGCB 3H4SE 3CWGA 1CFPA 2K7OA 1DF0A 4JPZB 1AVSA 3BUXB 4USLA 3OHMB 4YGDB 1DJZA 3CLNA 4YI9A 4XJKA 1EL4A 2KSPA 2LM5A 4GPLB 5D69A 2NLNA 1B9AA 3O6BA 1S6IA 3RM1A 1Y1AA 1QATA 4M2OA 1CFCA 3VRNA 2D8NA 2H61C 5JJGA 1NX3A 3PN7B 5BPJA 5AFPA 3TS5B 1OE9B 1CFDA 1IQ5A 2Y4QA 2I2RE 1TCFA 1TIZA 2HETA 3LK1A 1CMFA 1SYMA 1SL9A 3RLZA 2CT9A 3SG4A 3AAKA 1BG1A 2H61A 3BUOB 3PN7C 4HRGA 1SRAA 5AERA 5KSZA 1YVHA 1KWOC 5CPVA 3TS5C 1A75A 2OTGB 1UURA 1XFUO 1XK4A 1MHOA 1J55A 1YX7A 1UP5A 3EKJA 4N1FA 1XVJA 1DGUA 1ZUZA 2OTGC 3BOWA 2CXJA 1XA5A 1IJ5A 1S36A 2M29A 1IH0A 3SG5A 2WC8A 5D7FA 2K2FA 4PALA 2Y1NA 5AANA 4DIRA 3GOFA 2FJUB 4GGFC 1OMVA 5I2LA 2G9BA 3BXKA 4PHJA 4YRUA 1AHRA 1SNLA 2LLUA 1B8LA 1OMRA 1XFVO 2LC5A 1K9KA 5KU1A 1NYAA 2BE6A 1CLMA 4U8DA 4GGFA 5TNCA 2KQ6A 1Y0VH 1PK0D 1OSAA 2MA2A 4OKHA 1GJYA 4BY4A 1MXEA 4ICBA 2GGZA 2LVIA 2ZRSA 4ORAB 5DKQA 1AJ5A 1D1OA 1ZACA 2Y5IA 4NDDA 2JT0A 1SCVA 2F3YA 1GGZA 2KYFA 1G4YR 3QRXA 5F6TA 1RECA 2LMTA 1MUXA 5G08A 2PSRA 1S6JA 2K2AA 1QLSA 3EKHA 4PE1A 2LVKA 2DOQA 3PLFB 4A4BA 1CM1A 2WORA 3I5GB 2BCBA 2WOSA 2SCPA 1OZSA 2PRUA 2ZNDA 2BBNA 1B1GA 1PSBA 1M31A 1NCZA 3FIAA 1LA3A 2MBXA 4DCKA 1SW8A 2PVBA 4DS7A 4YI8A 1A29A 1FI5A 3I5GC 3O4YA 2WCEA 1K2HA 1XFXO 3PFVA 2JXCA 4MVFA 1CNPA 1TCOB 5HYDA 1QASA 2BECA 3SG6A 2M49B 4HRHA 1AP4A 2OS8C 1BLQA 1CM4A 1MQ1A 4PHKA 1BU3A 3TZ1A 2GV5A 1TNXA 2EC6C 1R2UA 3WHUB 2LMVA 1KK7Y 5I2OA 1QX2A 2LV7A 1MF8B 1NWDA 2LHLA 5CSFA 1LVCD 1SMGA 2JU0A 2SASA 3KPXA 4MN0A 2ISDA 3BUNB 3EK7A 1SL8A 5ER5A 3WXAA 1MXLC 1BR4B 3GK4X 1ALVA 1J1EA 1SR6B 1CDMA 1M39A 2F2OA 4NQGA 1YRTB 5K89A 3CR4X 1NPQA 1NCXA 3SIBA 4HREE 1S3PA 1AJ4A 2NZ0A 2CTNA 1GGWA 4GGNA 2L4HA 2L0PA 1ZMZA 2JTZA 2HF5A 1LINA 4I5NB 1DTLA 3VRRA 1CDPA 2MRDA 2KBMA 2MJWB 1CTRA 1PSRA 3D0YA 2HQWA 2NCPA 4WQ3A 2O60A 1CFFA 2KDHA 1YUTA 1HQVA 1G8IA 1L7ZA 1SKTA 1Q80A 1KK7Z 2KFFA 3FWBA 4N5XA 4R1EA 1J7RA 1PVAA 3OB2B 1WRLA 3NSOA 1JBAA 2NCOA 3BYAA 1ZFSA 4A4CA 1IJ6A 2KBIA 2LNKA 1Y6WA 1IG5A 1C7VA 2I94A 1YUSA 3A8RA 1M45A 1B7TY 1NIWA 1S5GZ 3ZWHA 4QJ5B 1JFKA 2QPTA 3VRQA 3TDUA 1C7WA 3A4UB 1OQPA 1L2OB 3KO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPT A;  2LE9 B;  3HCM A;  1DGV A;  4GNK B;  5JOL A;  1KCY A;  1DJY A;  2M8U A;  2MLF C;  5ER4 X;  1LA0 A;  4PHM A;  4GAO A;  1J7O A;  3KF9 A;  1L2O C;  2IS9 A;  3LK0 A;  2ZN9 A;  4PDZ A;  1BT6 A;  2F33 A;  2KFH A;  3TUY B;  3WNX B;  1F70 A;  3I5F B;  3PAT A;  4WRI A;  2GGM A;  2WCB A;  3O78 A;  1FW4 A;  1RK9 A;  3E3R A;  4ORB B;  2FCE A;  1YRU B;  4GBA A;  2MAZ A;  2ZRT A;  1KQV A;  2PAL A;  2CNP A;  1PRW A;  3I5F C;  1U5I B;  1B7T Z;  1UWO A;  1YVL A;  2K61 A;  3FS7 A;  1SCM B;  4MSP A;  2KYC A;  4MLW A;  2M7N A;  3AKA A;  1DJH A;  3MSE B;  2BKI B;  3DF0 B;  1WDC B;  2LVJ A;  1N0Y A;  1PUL A;  5CSJ A;  1M63 B;  1SCM C;  3DVJ A;  4M2P A;  1K8U A;  3ZNI A;  1CB1 A;  1CLB A;  3I5I B;  1RFJ A;  5PAL A;  1A4P A;  1RWY A;  2LVV A;  1EJ3 A;  1F54 A;  1NP8 A;  2M0R A;  3PM8 A;  4IL1 A;  1RTP 1;  1QVI Y;  1TN4 A;  5B8I B;  1K90 D;  4P5O E;  2VRG A;  4HSZ A;  2E6W A;  3GK2 A;  1QJT A;  1XFZ O;  4OCI A;  2KHN A;  1QV1 A;  4MZK A;  2L98 A;  1GQM A;  1X02 A;  1R6P A;  3OB1 B;  4PHN A;  4JWQ A;  2LLT A;  4I5L B;  3EK8 A;  2L2E A;  2K8M B;  1KFU S;  2KI4 B;  2Y1M A;  3CR5 X;  5CSN A;  4C0L A;  1NX1 A;  1MWN A;  5FYX A;  4OVN F;  2JT8 A;  3VGO A;  2LLS A;  1QX5 B;  1PAL A;  1XYD A;  1JWD A;  2HQ8 A;  1F4O A;  2M1U A;  1ZOT B;  2LUC A;  4CFR A;  2BKH B;  4CPV A;  3SG2 A;  4FTG A;  2JT3 A;  1F4Q A;  1DJG A;  3OX6 A;  2BCX A;  2LUX A;  3I5H B;  2KFG A;  4ETO A;  1WY9 A;  3JTD B;  1W7J B;  4WQ2 A;  1KFX S;  3JVT B;  2KGB C;  1VRK A;  1ALW A;  3LL8 B;  3WHT B;  3CGA A;  2EHB A;  4C0J A;  5DKR A;  2NXQ A;  3KEV A;  3OP0 A;  2COL B;  2LCP A;  4AQJ A;  1YTZ C;  3GK1 A;  3JTD C;  3JVT C;  1DJW A;  3F45 A;  1PVB A;  3LCP C;  3DVK A;  2F2P A;  1FPW A;  2L51 A;  1JUO A;  2MLE C;  1KFU L;  2LAN A;  2R2I A;  1BJF A;  1EXR A;  1UHI A;  1IQ3 A;  2JNF A;  4DUQ A;  3DVM A;  1UHK A;  5GQQ C;  3KHE A;  1C07 A;  3SJS A;  1S1E A;  1K94 A;  2AAO A;  4CLN A;  1QLK A;  1IWQ A;  1XO5 A;  1WLM A;  1EG4 A;  1WLZ A;  1JFJ A;  3CZT X;  3LLE A;  3BQ3 A;  2E30 A;  2BCA A;  1SR6 C;  2KQY A;  5HKY A;  1J7P A;  2H2K A;  1OMD A;  5HKZ A;  3SG3 A;  4M2Q A;  1DF0 B;  1QXP A;  2FCD A;  1BR1 B;  1K95 A;  3AAJ A;  2LP2 A;  1FF1 A;  1BMO A;  4ZCU A;  3K21 A;  1QX7 A;  1XFW O;  4PCW A;  1QS7 A;  4XJK B;  4UPG A;  1KFX L;  4AQI A;  2LP3 A;  5CSI A;  1K96 A;  1CKK A;  2A4J A;  3AKB A;  2F3Z A;  2ZKM X;  4L9M A;  4F0Z B;  3NXA A;  1YR5 A;  2K7C A;  4YGE B;  3D10 A;  2BL0 B;  1JF2 A;  2AMI A;  4Q04 A;  4XYN A;  2PMY A;  1S26 D;  2O5G A;  2P6B B;  1J1D A;  1TOP A;  3C1V A;  5DKN A;  3HX4 A;  2KAV A;  2HPS A;  2CCM A;  2BL0 C;  4MRY A;  4PE0 A;  1QIW A;  4DRW A;  1NCY A;  1A75 B;  1NX0 A;  1BF5 A;  2KAY A;  1F8H A;  1QIV A;  1TTX A;  4I5K A;  5I8N A;  2V53 A;  1SPY A;  2JWW A;  1G33 A;  1KWO B;  1RJV A;  2JC2 A;  4MZJ A;  3BOW B;  1XK4 C;  2G2B A;  1DVI A;  4OV2 A;  2LHI A;  5HLV A;  3CTN A;  2JTT A;  2L50 A;  3DVE A;  2Q91 A;  3TUY C;  1JSA A;  2OPO A;  4MZL A;  2ZFD A;  1CLL A;  4N1G A;  1N2D A;  4YGA A;  2MHH A;  4I5J A;  1QTX A;  1DMO A;  1A2X A;  1Y1U A;  5KTY A;  2PAS A;  1IGV A;  1V1F A;  2KNE A;  1IKU A;  1JF0 A;  1DJX A;  1BOD A;  1OZO A;  2WND A;  1E8A A;  1M46 A;  2QAC A;  1AK8 A;  1KK8 B;  2M1K B;  1WDC C;  1K9P A;  1H4B A;  2KI6 C;  1K9U A;  2ZNE A;  1U5I A;  3EVV A;  4PE4 A;  2F8P A;  1S6C A;  1OOJ A;  1UHN A;  3I5I C;  1KQM B;  2ZN8 A;  3EVU A;  2Q4U A;  3OX5 A;  4CFQ A;  3EVR A;  4FQO A;  2M9G A;  1SY9 A;  2JQ6 A;  1N65 A;  3DF0 A;  2K7B A;  1KK8 C;  5AEQ A;  2B1U A;  1FI6 A;  1J7Q A;  2RGI A;  2BE4 A;  1EG3 A;  3EK4 A;  2KGR A;  3BUW B;  2M3W A;  3VRO A;  1KQM C;  2AUC A;  1B47 A;  4GFT A;  1FBV A;  3CS1 A;  1QV0 A;  1DJI A;  1BOC A;  1EH2 A;  4GUK A;  1SL7 A;  2TN4 A;  2KI4 C;  1WRK A;  4QJ3 B;  3TDI A;  1B4C A;  2LMU A;  1KSO A;  3SIA A;  1QVI Z;  1LXF C;  2KOT A;  4AOM A;  4PE7 A;  1UUS A;  1RRO A;  3FWC A;  2K7D A;  3NSK A;  1NX2 A;  5AXI A;  4E68 A;  2FOT A;  5J3X A;  1HT9 A;  2JRF A;  1NSH A;  3IQO A;  2I7A A;  5HKW A;  3SG7 A;  4YGB B;  3IF7 A;  1CDL A;  1TRF A;  3TDZ A;  1DT7 B;  1YUR A;  4MEW A;  2K0J A;  1MR8 A;  4OR9 B;  3I5H C;  1YUU A;  3VRP A;  3PAL A;  3M0W A;  3O2P A;  3DD4 A;  1WRZ A;  4MBE A;  4ORC B;  2KI6 D;  2M97 A;  3PSR A;  1B8C A;  5HLO A;  2L4I A;  2OS8 B;  1A03 A;  2JZI A;  3CR2 A;  4NDC A;  2JOJ A;  2KAX A;  2EC6 B;  2JNX A;  2M7L A;  2L5X B;  4QJ4 B;  3ICB A;  2CBL A;  4CID A;  4C0K A;  1LKJ A;  1Y1X A;  4ZCV A;  1SBJ A;  1XFY O;  1NUB A;  1ODB A;  1JC2 A;  1K93 D;  3D0Y B;  1UHH A;  4D1E A;  1UHJ A;  2LAP A;  4YBH B;  4JQ0 D;  1B8R A;  4TNC A;  1TNQ A;  1F71 A;  1S5G Y;  5I2Q A;  1TNW A;  2JUL A;  1CDN A;  3BUM B;  4BY5 A;  1W7I B;  2WCF A;  5IBW A;  2JXL A;  1CMG A;  2EGD A;  2I18 A;  1AUI B;  3NSI A;  1F55 A;  1TNP A;  3NSL A;  4P2Y B;  1V1G A;  1KSM A;  1SK6 D;  3IQQ A;  1H8B A;  4MRX A;  2BBM A;  4NDB A;  1IRJ A;  1YX8 A;  4YGC B;  3H4S E;  3CWG A;  1CFP A;  2K7O A;  1DF0 A;  4JPZ B;  1AVS A;  3BUX B;  4USL A;  3OHM B;  4YGD B;  1DJZ A;  3CLN A;  4YI9 A;  4XJK A;  1EL4 A;  2KSP A;  2LM5 A;  4GPL B;  5D69 A;  2NLN A;  1B9A A;  3O6B A;  1S6I A;  3RM1 A;  1Y1A A;  1QAT A;  4M2O A;  1CFC A;  3VRN A;  2D8N A;  2H61 C;  5JJG A;  1NX3 A;  3PN7 B;  5BPJ A;  5AFP A;  3TS5 B;  1OE9 B;  1CFD A;  1IQ5 A;  2Y4Q A;  2I2R E;  1TCF A;  1TIZ A;  2HET A;  3LK1 A;  1CMF A;  1SYM A;  1SL9 A;  3RLZ A;  2CT9 A;  3SG4 A;  3AAK A;  1BG1 A;  2H61 A;  3BUO B;  3PN7 C;  4HRG A;  1SRA A;  5AER A;  5KSZ A;  1YVH A;  1KWO C;  5CPV A;  3TS5 C;  1A75 A;  2OTG B;  1UUR A;  1XFU O;  1XK4 A;  1MHO A;  1J55 A;  1YX7 A;  1UP5 A;  3EKJ A;  4N1F A;  1XVJ A;  1DGU A;  1ZUZ A;  2OTG C;  3BOW A;  2CXJ A;  1XA5 A;  1IJ5 A;  1S36 A;  2M29 A;  1IH0 A;  3SG5 A;  2WC8 A;  5D7F A;  2K2F A;  4PAL A;  2Y1N A;  5AAN A;  4DIR A;  3GOF A;  2FJU B;  4GGF C;  1OMV A;  5I2L A;  2G9B A;  3BXK A;  4PHJ A;  4YRU A;  1AHR A;  1SNL A;  2LLU A;  1B8L A;  1OMR A;  1XFV O;  2LC5 A;  1K9K A;  5KU1 A;  1NYA A;  2BE6 A;  1CLM A;  4U8D A;  4GGF A;  5TNC A;  2KQ6 A;  1Y0V H;  1PK0 D;  1OSA A;  2MA2 A;  4OKH A;  1GJY A;  4BY4 A;  1MXE A;  4ICB A;  2GGZ A;  2LVI A;  2ZRS A;  4ORA B;  5DKQ A;  1AJ5 A;  1D1O A;  1ZAC A;  2Y5I A;  4NDD A;  2JT0 A;  1SCV A;  2F3Y A;  1GGZ A;  2KYF A;  1G4Y R;  3QRX A;  5F6T A;  1REC A;  2LMT A;  1MUX A;  5G08 A;  2PSR A;  1S6J A;  2K2A A;  1QLS A;  3EKH A;  4PE1 A;  2LVK A;  2DOQ A;  3PLF B;  4A4B A;  1CM1 A;  2WOR A;  3I5G B;  2BCB A;  2WOS A;  2SCP A;  1OZS A;  2PRU A;  2ZND A;  2BBN A;  1B1G A;  1PSB A;  1M31 A;  1NCZ A;  3FIA A;  1LA3 A;  2MBX A;  4DCK A;  1SW8 A;  2PVB A;  4DS7 A;  4YI8 A;  1A29 A;  1FI5 A;  3I5G C;  3O4Y A;  2WCE A;  1K2H A;  1XFX O;  3PFV A;  2JXC A;  4MVF A;  1CNP A;  1TCO B;  5HYD A;  1QAS A;  2BEC A;  3SG6 A;  2M49 B;  4HRH A;  1AP4 A;  2OS8 C;  1BLQ A;  1CM4 A;  1MQ1 A;  4PHK A;  1BU3 A;  3TZ1 A;  2GV5 A;  1TNX A;  2EC6 C;  1R2U A;  3WHU B;  2LMV A;  1KK7 Y;  5I2O A;  1QX2 A;  2LV7 A;  1MF8 B;  1NWD A;  2LHL A;  5CSF A;  1LVC D;  1SMG A;  2JU0 A;  2SAS A;  3KPX A;  4MN0 A;  2ISD A;  3BUN B;  3EK7 A;  1SL8 A;  5ER5 A;  3WXA A;  1MXL C;  1BR4 B;  3GK4 X;  1ALV A;  1J1E A;  1SR6 B;  1CDM A;  1M39 A;  2F2O A;  4NQG A;  1YRT B;  5K89 A;  3CR4 X;  1NPQ A;  1NCX A;  3SIB A;  4HRE E;  1S3P A;  1AJ4 A;  2NZ0 A;  2CTN A;  1GGW A;  4GGN A;  2L4H A;  2L0P A;  1ZMZ A;  2JTZ A;  2HF5 A;  1LIN A;  4I5N B;  1DTL A;  3VRR A;  1CDP A;  2MRD A;  2KBM A;  2MJW B;  1CTR A;  1PSR A;  3D0Y A;  2HQW A;  2NCP A;  4WQ3 A;  2O60 A;  1CFF A;  2KDH A;  1YUT A;  1HQV A;  1G8I A;  1L7Z A;  1SKT A;  1Q80 A;  1KK7 Z;  2KFF A;  3FWB A;  4N5X A;  4R1E A;  1J7R A;  1PVA A;  3OB2 B;  1WRL A;  3NSO A;  1JBA A;  2NCO A;  3BYA A;  1ZFS A;  4A4C A;  1IJ6 A;  2KBI A;  2LNK A;  1Y6W A;  1IG5 A;  1C7V A;  2I94 A;  1YUS A;  3A8R A;  1M45 A;  1B7T Y;  1NIW A;  1S5G Z;  3ZWH A;  4QJ5 B;  1JFK A;  2QPT A;  3VRQ A;  3TDU A;  1C7W A;  3A4U B;  1OQP A;  1L2O B;  3KO0 A; 
#chains in the Genus database with same CATH topology
 2JPT A;  3EG5 B;  2LE9 B;  3HCM A;  1DGV A;  4GNK B;  5I94 A;  5JOL A;  1KCY A;  1DJY A;  2M8U A;  3R1O A;  2MLF C;  5ER4 X;  1LA0 A;  4PHM A;  1DEL A;  4GAO A;  1J7O A;  3KF9 A;  1L2O C;  2IS9 A;  3LK0 A;  2ZN9 A;  4PDZ A;  1BT6 A;  2F33 A;  2KFH A;  4JD9 A;  3TUY B;  3WNX B;  1F70 A;  3I5F B;  3PAT A;  4WRI A;  2GGM A;  2WCB A;  3O78 A;  1FW4 A;  1RK9 A;  3E3R A;  4ORB B;  2FCE A;  1YRU B;  4GBA A;  4INW A;  2MAZ A;  2ZRT A;  1KQV A;  2PAL A;  2CNP A;  1PRW A;  3CDN A;  3I5F C;  1U5I B;  1B7T Z;  1UWO A;  1YVL A;  2K61 A;  3FS7 A;  1SCM B;  4MSP A;  1Z4H A;  2KYC A;  4MLW A;  2M7N A;  3AKA A;  1DJH A;  3MSE B;  3S0F A;  2BKI B;  3DF0 B;  1WDC B;  2LVJ A;  1N0Y A;  1OOF A;  1PUL A;  5CSJ A;  1M63 B;  1SCM C;  1C3Y A;  3DVJ A;  4M2P A;  1K8U A;  3ZNI A;  1CB1 A;  1CLB A;  3I5I B;  1RFJ A;  5PAL A;  1A4P A;  1RWY A;  2LVV A;  1EJ3 A;  1F54 A;  1NP8 A;  2M0R A;  3PM8 A;  4IL1 A;  1RTP 1;  1QVI Y;  1TN4 A;  5B8I B;  1K90 D;  4P5O E;  3RZS A;  2VRG A;  2L5Y A;  4HSZ A;  2E6W A;  3GK2 A;  1QJT A;  1XFZ O;  4OCI A;  2KHN A;  1QV1 A;  4MZK A;  2L98 A;  1GQM A;  1X02 A;  1R6P A;  3OB1 B;  4PHN A;  4JWQ A;  2LLT A;  2WCK A;  4I5L B;  3EK8 A;  2L2E A;  2K8M B;  1KFU S;  2KI4 B;  2Y1M A;  3SS4 A;  3CR5 X;  5CSN A;  4C0L A;  1NX1 A;  1MWN A;  5FYX A;  4OVN F;  2JT8 A;  3VGO A;  2LLS A;  1QX5 B;  1PAL A;  1XYD A;  1JWD A;  2HQ8 A;  1F4O A;  3Q8I A;  2M1U A;  1ZOT B;  1TWO A;  2LUC A;  4INX A;  4CFR A;  2BKH B;  4CPV A;  3SG2 A;  4FTG A;  2KLE A;  2JT3 A;  1F4Q A;  1DJG A;  3OX6 A;  3V2L A;  2BCX A;  2LUX A;  3DYE A;  3I5H B;  2KFG A;  3S0E A;  1WY9 A;  3JTD B;  4ETO A;  1W7J B;  3BJH A;  4WQ2 A;  1KFX S;  3JVT B;  2KGB C;  1VRK A;  1ALW A;  3LL8 B;  3WHT B;  3CGA A;  2EHB A;  4C0J A;  5DKR A;  2NXQ A;  3KEV A;  3OP0 A;  2COL B;  2LCP A;  4AQJ A;  1YTZ C;  3GK1 A;  3JTD C;  3B86 A;  3JVT C;  1DJW A;  3B7A A;  3F45 A;  1PVB A;  3LCP C;  3DVK A;  2F2P A;  5D3O A;  2L51 A;  1JUO A;  2MLE C;  3B87 A;  1FPW A;  1KFU L;  2LAN A;  2R2I A;  1BJF A;  3CYZ A;  1EXR A;  1UHI A;  1IQ3 A;  2JNF A;  4DUQ A;  3DVM A;  3O4X A;  1UHK A;  5GQQ C;  3KHE A;  1C07 A;  1GM0 A;  3SJS A;  1S1E A;  4IJ7 A;  1K94 A;  2AAO A;  4CLN A;  1QLK A;  1IWQ A;  1XO5 A;  1WLM A;  1EG4 A;  1WLZ A;  1JFJ A;  3CZT X;  3LLE A;  3BQ3 A;  2E30 A;  2BCA A;  1SR6 C;  2KQY A;  5HKY A;  1J7P A;  1OW4 A;  2H2K A;  1OMD A;  5HKZ A;  3SG3 A;  4M2Q A;  1DF0 B;  1QXP A;  1C3Z A;  1BR1 B;  1K95 A;  2FCD A;  3AAJ A;  1W9Z A;  2LP2 A;  1FF1 A;  1BMO A;  4ZCU A;  3K21 A;  1QX7 A;  1XFW O;  4PCW A;  1QS7 A;  4XJK B;  4UPG A;  1KFX L;  4AQI A;  2LP3 A;  2QEO A;  1K96 A;  3DXL A;  2A4J A;  3AKB A;  2F3Z A;  2ZKM X;  4L9M A;  5CSI A;  4F0Z B;  3NXA A;  1YR5 A;  2K7C A;  3NHT A;  3D10 A;  2BL0 B;  4YGE B;  1JF2 A;  1OOG A;  2AMI A;  4Q04 A;  4XYN A;  2PMY A;  1S26 D;  2O5G A;  2P6B B;  1J1D A;  1TOP A;  2PYQ A;  3C1V A;  5DKN A;  3HX4 A;  2KAV A;  4OZD A;  3OBV A;  2HPS A;  2CCM A;  2BL0 C;  4MRY A;  4PE0 A;  1QIW A;  4DRW A;  1TUJ A;  2WCL A;  1NCY A;  1A75 B;  2QDI A;  3QME A;  1NX0 A;  1BF5 A;  2KAY A;  1F8H A;  1QIV A;  1TTX A;  4I5K A;  5I8N A;  2V53 A;  1SPY A;  2JWW A;  1G33 A;  1KWO B;  2WCM A;  1RJV A;  2JC2 A;  3BFH A;  4MZJ A;  3BOW B;  1XK4 C;  1Z2C B;  2G2B A;  3B6X A;  3SS3 A;  1DVI A;  4OV2 A;  1QWV A;  2BAP A;  2LHI A;  5HLV A;  3CTN A;  3UO9 A;  2JTT A;  2L50 A;  3DVE A;  2Q91 A;  3TUY C;  1JSA A;  2OPO A;  4MZL A;  2ZFD A;  3DY9 A;  1CLL A;  3S0B A;  4N1G A;  1N2D A;  2ERB A;  2MHH A;  4I5J A;  4YGA A;  1QTX A;  1DMO A;  1A2X A;  3FE9 A;  1Y1U A;  5KTY A;  2PAS A;  1IGV A;  3L47 A;  1V1F A;  2KNE A;  1IKU A;  1JF0 A;  1XFR A;  1DJX A;  3S0G A;  1BOD A;  3B88 A;  3BFB A;  1OZO A;  2WND A;  1E8A A;  1M46 A;  2QAC A;  1AK8 A;  1KK8 B;  2M1K B;  1WDC C;  1K9P A;  3FE6 A;  2KI6 C;  1H4B A;  1K9U A;  2ZNE A;  5HL1 A;  1U5I A;  3EVV A;  4PE4 A;  4PT1 A;  2F8P A;  1S6C A;  1OOJ A;  1UHN A;  3I5I C;  1KQM B;  2ZN8 A;  3EVU A;  2Q4U A;  3OX5 A;  4CFQ A;  3EVR A;  3CZ1 A;  2M9G A;  4FQO A;  1ORG A;  1SY9 A;  3CZ0 A;  2JQ6 A;  1N65 A;  3D75 A;  3DF0 A;  2K7B A;  1KK8 C;  5AEQ A;  2B1U A;  2L2C A;  1J7Q A;  2RGI A;  2BE4 A;  1EG3 A;  3EK4 A;  2KGR A;  5FI7 A;  1FI6 A;  3BUW B;  2M3W A;  3VRO A;  1KQM C;  3K1E A;  2AUC A;  1B47 A;  4GFT A;  1FBV A;  3D78 A;  3CS1 A;  1QV0 A;  1DJI A;  1BOC A;  2YGU A;  4GUK A;  1EH2 A;  5DIC A;  1SL7 A;  2TN4 A;  2KI4 C;  3S0D A;  1WRK A;  3CAB A;  4QJ3 B;  3TDI A;  1B4C A;  2LMU A;  1KSO A;  3SIA A;  1QVI Z;  1LXF C;  2KOT A;  4AOM A;  4PE7 A;  1UUS A;  1RRO A;  3FWC A;  2K7D A;  3NSK A;  1OOI X;  1NX2 A;  5AXI A;  3BFA A;  4E68 A;  2FOT A;  5J3X A;  3FE8 A;  1HT9 A;  2JRF A;  1NSH A;  3IQO A;  2I7A A;  5HKW A;  3SG7 A;  4YGB B;  3IF7 A;  1CDL A;  1TRF A;  3TDZ A;  1DT7 B;  2WC5 A;  1YUR A;  4MEW A;  2K0J A;  1MR8 A;  2K60 A;  2WC6 A;  4OR9 B;  3I5H C;  1YUU A;  3CZ2 A;  3VRP A;  3PAL A;  3M0W A;  3O2P A;  3DD4 A;  1WRZ A;  4MBE A;  4ORC B;  2KI6 D;  2M97 A;  3PSR A;  1B8C A;  5HLO A;  2L4I A;  2OS8 B;  1A03 A;  2JZI A;  3CR2 A;  4NDC A;  2JOJ A;  2KAX A;  2EC6 B;  2JNX A;  2QEV A;  2M7L A;  2L5X B;  3D77 A;  4QJ4 B;  3ICB A;  3R1P A;  2CBL A;  4KYN A;  4C0K A;  4CID A;  2GTE A;  1LKJ A;  1Y1X A;  2P71 A;  4ZCV A;  1SBJ A;  1XFY O;  3NHI A;  1NUB A;  1ODB A;  1JC2 A;  1K93 D;  3D0Y B;  1UHH A;  4D1E A;  1UHJ A;  2LAP A;  4YBH B;  4JQ0 D;  1B8R A;  4TNC A;  1T14 A;  2KPH A;  1TNQ A;  1F71 A;  1S5G Y;  5I2Q A;  1TNW A;  1TUZ A;  2JUL A;  3BUM B;  3D73 A;  4BY5 A;  1W7I B;  2WCF A;  5IBW A;  2JXL A;  1CDN A;  1CMG A;  2EGD A;  2I18 A;  4JKT A;  1AUI B;  3NSI A;  1F55 A;  1TNP A;  3NSL A;  4P2Y B;  1V1G A;  1KSM A;  1SK6 D;  3IQQ A;  1H8B A;  4MRX A;  2BBM A;  4NDB A;  1IRJ A;  1YX8 A;  4YGC B;  3H4S E;  3CWG A;  3PM2 A;  1CFP A;  3IVT A;  2K7O A;  1DF0 A;  4JPZ B;  1AVS A;  5EL2 A;  3BUX B;  4USL A;  3OHM B;  4YGD B;  1DJZ A;  3CLN A;  4YI9 A;  4XJK A;  1EL4 A;  2KSP A;  2LM5 A;  4GPL B;  5D69 A;  2NLN A;  1B9A A;  3O6B A;  1S6I A;  3RM1 A;  1Y1A A;  1QAT A;  4M2O A;  2QEB A;  1CFC A;  3VRN A;  2D8N A;  2H61 C;  5JJG A;  1NX3 A;  3PN7 B;  5BPJ A;  5AFP A;  3TS5 B;  1OE9 B;  1CFD A;  1IQ5 A;  2Y4Q A;  2I2R E;  1TCF A;  1TIZ A;  2HET A;  3LK1 A;  2FJY A;  1CMF A;  1SYM A;  3L4A A;  1SL9 A;  3RLZ A;  2CT9 A;  3SG4 A;  3AAK A;  1BG1 A;  2H61 A;  3BUO B;  3PN7 C;  4HRG A;  1SRA A;  5AER A;  5KSZ A;  1YVH A;  2WCH A;  1KWO C;  5CPV A;  1SSE B;  3TS5 C;  1DC1 A;  1A75 A;  2OTG B;  1UUR A;  1XFU O;  1XK4 A;  1MHO A;  1J55 A;  1YX7 A;  1UP5 A;  3EKJ A;  4N1F A;  5FI2 A;  1XVJ A;  2H8V A;  3PJI A;  1DGU A;  1ZUZ A;  2OTG C;  3BOW A;  2CXJ A;  1XA5 A;  1IJ5 A;  1S36 A;  2M29 A;  1IH0 A;  3SG5 A;  2WC8 A;  5D7F A;  2K2F A;  4PAL A;  2Y1N A;  5AAN A;  4DIR A;  3GOF A;  2FJU B;  4GGF C;  1OMV A;  5I2L A;  2G9B A;  3BXK A;  4PHJ A;  4YRU A;  1AHR A;  1SNL A;  2LLU A;  1B8L A;  1OMR A;  2BNX A;  1XFV O;  2LC5 A;  1K9K A;  5KU1 A;  1NYA A;  2BE6 A;  1CLM A;  4U8D A;  4GGF A;  5TNC A;  2KQ6 A;  1Y0V H;  1PK0 D;  1OSA A;  2MA2 A;  4OKH A;  1DQE A;  1GJY A;  4BY4 A;  1MXE A;  4ICB A;  1LS8 A;  2GGZ A;  2LVI A;  2ZRS A;  4ORA B;  5DKQ A;  1AJ5 A;  1D1O A;  1ZAC A;  2Y5I A;  4NDD A;  2JT0 A;  1SCV A;  2F3Y A;  3NGV A;  1GGZ A;  2KYF A;  1G4Y R;  3QRX A;  4F7F A;  5F6T A;  1REC A;  2QEH A;  3OGN A;  2LMT A;  1MUX A;  2P70 A;  5G08 A;  2PSR A;  1S6J A;  2K2A A;  1QLS A;  3EKH A;  4PE1 A;  2LVK A;  2DOQ A;  3UNW A;  3PLF B;  4A4B A;  1CM1 A;  2WOR A;  3I5G B;  2BCB A;  2WOS A;  2SCP A;  1OZS A;  2PRU A;  2ZND A;  2BBN A;  1B1G A;  1PSB A;  1M31 A;  1NCZ A;  3FIA A;  1LA3 A;  3N7H A;  2MBX A;  4DCK A;  1SW8 A;  2PVB A;  4DS7 A;  4YI8 A;  1A29 A;  1FI5 A;  3I5G C;  3O4Y A;  2WCE A;  1P28 A;  4FQT A;  1K2H A;  1XFX O;  3PFV A;  2JXC A;  4MVF A;  1CNP A;  1TCO B;  5HYD A;  1QAS A;  2BEC A;  3SG6 A;  2M49 B;  4HRH A;  1AP4 A;  2OS8 C;  1BLQ A;  1CM4 A;  1MQ1 A;  4PHK A;  1BU3 A;  3TZ1 A;  2GV5 A;  1TNX A;  2EC6 C;  1R2U A;  3WHU B;  3SS5 A;  2LMV A;  1KK7 Y;  5I2O A;  1QX2 A;  2LV7 A;  1MF8 B;  1NWD A;  2LHL A;  1OOH A;  5CSF A;  1LVC D;  1SMG A;  2JU0 A;  2SAS A;  3KPX A;  1IIO A;  4MN0 A;  2ISD A;  3BUN B;  3DZT A;  3EK7 A;  3S0A A;  1SL8 A;  5ER5 A;  3WXA A;  3R1V A;  1MXL C;  1BR4 B;  3VB1 A;  1DEK A;  1ALV A;  1J1E A;  1SR6 B;  1CDM A;  1M39 A;  2F2O A;  3GK4 X;  4NQG A;  2WCJ A;  1YRT B;  5K89 A;  3CR4 X;  1NPQ A;  1NCX A;  5FI6 A;  3SIB A;  4HRE E;  1S3P A;  1AJ4 A;  2NZ0 A;  2CTN A;  1GGW A;  4GGN A;  2L4H A;  2L0P A;  1ZMZ A;  2JTZ A;  2HF5 A;  1LIN A;  4I5N B;  1DTL A;  3VRR A;  1CDP A;  2MRD A;  2KBM A;  2PQL A;  2MJW B;  1CTR A;  1PSR A;  3D0Y A;  2HQW A;  2NCP A;  4WQ3 A;  2O60 A;  1CFF A;  3D74 A;  3L4L A;  2KDH A;  1YUT A;  3D76 A;  1HQV A;  1G8I A;  1L7Z A;  1SKT A;  1Q80 A;  1KK7 Z;  2KFF A;  3FWB A;  4N5X A;  4R1E A;  1J7R A;  1PVA A;  3OB2 B;  1WRL A;  3NSO A;  1JBA A;  2NCO A;  3BYA A;  1CKK A;  1ZFS A;  3R72 A;  4A4C A;  1IJ6 A;  2KBI A;  2KLD A;  2LNK A;  1Y6W A;  1IG5 A;  1C7V A;  2I94 A;  1YUS A;  3A8R A;  1M45 A;  1B7T Y;  1NIW A;  1S5G Z;  3ZWH A;  4QJ5 B;  1JFK A;  2QPT A;  3VRQ A;  3TDU A;  1C7W A;  3A4U B;  1OQP A;  1L2O B;  2JPO A;  3KO0 A; 
#chains in the Genus database with same CATH homology
 2JPT A;  2LE9 B;  3HCM A;  1DGV A;  4GNK B;  5JOL A;  1KCY A;  1DJY A;  2M8U A;  2MLF C;  5ER4 X;  1LA0 A;  4PHM A;  4GAO A;  1J7O A;  3KF9 A;  1L2O C;  2IS9 A;  3LK0 A;  2ZN9 A;  4PDZ A;  1BT6 A;  2F33 A;  2KFH A;  3TUY B;  3WNX B;  1F70 A;  3I5F B;  3PAT A;  4WRI A;  2GGM A;  2WCB A;  3O78 A;  1FW4 A;  1RK9 A;  3E3R A;  4ORB B;  2FCE A;  1YRU B;  4GBA A;  2MAZ A;  2ZRT A;  1KQV A;  2PAL A;  2CNP A;  1PRW A;  3I5F C;  1U5I B;  1B7T Z;  1UWO A;  1YVL A;  2K61 A;  3FS7 A;  1SCM B;  4MSP A;  2KYC A;  4MLW A;  2M7N A;  3AKA A;  1DJH A;  3MSE B;  2BKI B;  3DF0 B;  1WDC B;  2LVJ A;  1N0Y A;  1PUL A;  5CSJ A;  1M63 B;  1SCM C;  3DVJ A;  4M2P A;  1K8U A;  3ZNI A;  1CB1 A;  1CLB A;  3I5I B;  1RFJ A;  5PAL A;  1A4P A;  1RWY A;  2LVV A;  1EJ3 A;  1F54 A;  1NP8 A;  2M0R A;  3PM8 A;  4IL1 A;  1RTP 1;  1QVI Y;  1TN4 A;  5B8I B;  1K90 D;  4P5O E;  2VRG A;  4HSZ A;  2E6W A;  3GK2 A;  1QJT A;  1XFZ O;  4OCI A;  2KHN A;  1QV1 A;  4MZK A;  2L98 A;  1GQM A;  1X02 A;  1R6P A;  3OB1 B;  4PHN A;  4JWQ A;  2LLT A;  4I5L B;  3EK8 A;  2L2E A;  2K8M B;  1KFU S;  2KI4 B;  2Y1M A;  3CR5 X;  5CSN A;  4C0L A;  1NX1 A;  1MWN A;  5FYX A;  4OVN F;  2JT8 A;  3VGO A;  2LLS A;  1QX5 B;  1PAL A;  1XYD A;  1JWD A;  2HQ8 A;  1F4O A;  2M1U A;  1ZOT B;  2LUC A;  4CFR A;  2BKH B;  4CPV A;  3SG2 A;  4FTG A;  2JT3 A;  1F4Q A;  1DJG A;  3OX6 A;  2BCX A;  2LUX A;  3I5H B;  2KFG A;  4ETO A;  1WY9 A;  3JTD B;  1W7J B;  4WQ2 A;  1KFX S;  3JVT B;  2KGB C;  1VRK A;  1ALW A;  3LL8 B;  3WHT B;  3CGA A;  2EHB A;  4C0J A;  5DKR A;  2NXQ A;  3KEV A;  3OP0 A;  2COL B;  2LCP A;  4AQJ A;  1YTZ C;  3GK1 A;  3JTD C;  3JVT C;  1DJW A;  3F45 A;  1PVB A;  3LCP C;  3DVK A;  2F2P A;  1FPW A;  2L51 A;  1JUO A;  2MLE C;  1KFU L;  2LAN A;  2R2I A;  1BJF A;  1EXR A;  1UHI A;  1IQ3 A;  2JNF A;  4DUQ A;  3DVM A;  1UHK A;  5GQQ C;  3KHE A;  1C07 A;  3SJS A;  1S1E A;  1K94 A;  2AAO A;  4CLN A;  1QLK A;  1IWQ A;  1XO5 A;  1WLM A;  1EG4 A;  1WLZ A;  1JFJ A;  3CZT X;  3LLE A;  3BQ3 A;  2E30 A;  2BCA A;  1SR6 C;  2KQY A;  5HKY A;  1J7P A;  2H2K A;  1OMD A;  5HKZ A;  3SG3 A;  4M2Q A;  1DF0 B;  1QXP A;  2FCD A;  1BR1 B;  1K95 A;  3AAJ A;  2LP2 A;  1FF1 A;  1BMO A;  4ZCU A;  3K21 A;  1QX7 A;  1XFW O;  4PCW A;  1QS7 A;  4XJK B;  4UPG A;  1KFX L;  4AQI A;  2LP3 A;  5CSI A;  1K96 A;  1CKK A;  2A4J A;  3AKB A;  2F3Z A;  2ZKM X;  4L9M A;  4F0Z B;  3NXA A;  1YR5 A;  2K7C A;  4YGE B;  3D10 A;  2BL0 B;  1JF2 A;  2AMI A;  4Q04 A;  4XYN A;  2PMY A;  1S26 D;  2O5G A;  2P6B B;  1J1D A;  1TOP A;  3C1V A;  5DKN A;  3HX4 A;  2KAV A;  2HPS A;  2CCM A;  2BL0 C;  4MRY A;  4PE0 A;  1QIW A;  4DRW A;  1NCY A;  1A75 B;  1NX0 A;  1BF5 A;  2KAY A;  1F8H A;  1QIV A;  1TTX A;  4I5K A;  5I8N A;  2V53 A;  1SPY A;  2JWW A;  1G33 A;  1KWO B;  1RJV A;  2JC2 A;  4MZJ A;  3BOW B;  1XK4 C;  2G2B A;  1DVI A;  4OV2 A;  2LHI A;  5HLV A;  3CTN A;  2JTT A;  2L50 A;  3DVE A;  2Q91 A;  3TUY C;  1JSA A;  2OPO A;  4MZL A;  2ZFD A;  1CLL A;  4N1G A;  1N2D A;  4YGA A;  2MHH A;  4I5J A;  1QTX A;  1DMO A;  1A2X A;  1Y1U A;  5KTY A;  2PAS A;  1IGV A;  1V1F A;  2KNE A;  1IKU A;  1JF0 A;  1DJX A;  1BOD A;  1OZO A;  2WND A;  1E8A A;  1M46 A;  2QAC A;  1AK8 A;  1KK8 B;  2M1K B;  1WDC C;  1K9P A;  1H4B A;  2KI6 C;  1K9U A;  2ZNE A;  1U5I A;  3EVV A;  4PE4 A;  2F8P A;  1S6C A;  1OOJ A;  1UHN A;  3I5I C;  1KQM B;  2ZN8 A;  3EVU A;  2Q4U A;  3OX5 A;  4CFQ A;  3EVR A;  4FQO A;  2M9G A;  1SY9 A;  2JQ6 A;  1N65 A;  3DF0 A;  2K7B A;  1KK8 C;  5AEQ A;  2B1U A;  1FI6 A;  1J7Q A;  2RGI A;  2BE4 A;  1EG3 A;  3EK4 A;  2KGR A;  3BUW B;  2M3W A;  3VRO A;  1KQM C;  2AUC A;  1B47 A;  4GFT A;  1FBV A;  3CS1 A;  1QV0 A;  1DJI A;  1BOC A;  1EH2 A;  4GUK A;  1SL7 A;  2TN4 A;  2KI4 C;  1WRK A;  4QJ3 B;  3TDI A;  1B4C A;  2LMU A;  1KSO A;  3SIA A;  1QVI Z;  1LXF C;  2KOT A;  4AOM A;  4PE7 A;  1UUS A;  1RRO A;  3FWC A;  2K7D A;  3NSK A;  1NX2 A;  5AXI A;  4E68 A;  2FOT A;  5J3X A;  1HT9 A;  2JRF A;  1NSH A;  3IQO A;  2I7A A;  5HKW A;  3SG7 A;  4YGB B;  3IF7 A;  1CDL A;  1TRF A;  3TDZ A;  1DT7 B;  1YUR A;  4MEW A;  2K0J A;  1MR8 A;  4OR9 B;  3I5H C;  1YUU A;  3VRP A;  3PAL A;  3M0W A;  3O2P A;  3DD4 A;  1WRZ A;  4MBE A;  4ORC B;  2KI6 D;  2M97 A;  3PSR A;  1B8C A;  5HLO A;  2L4I A;  2OS8 B;  1A03 A;  2JZI A;  3CR2 A;  4NDC A;  2JOJ A;  2KAX A;  2EC6 B;  2JNX A;  2M7L A;  2L5X B;  4QJ4 B;  3ICB A;  2CBL A;  4CID A;  4C0K A;  1LKJ A;  1Y1X A;  4ZCV A;  1SBJ A;  1XFY O;  1NUB A;  1ODB A;  1JC2 A;  1K93 D;  3D0Y B;  1UHH A;  4D1E A;  1UHJ A;  2LAP A;  4YBH B;  4JQ0 D;  1B8R A;  4TNC A;  1TNQ A;  1F71 A;  1S5G Y;  5I2Q A;  1TNW A;  2JUL A;  1CDN A;  3BUM B;  4BY5 A;  1W7I B;  2WCF A;  5IBW A;  2JXL A;  1CMG A;  2EGD A;  2I18 A;  1AUI B;  3NSI A;  1F55 A;  1TNP A;  3NSL A;  4P2Y B;  1V1G A;  1KSM A;  1SK6 D;  3IQQ A;  1H8B A;  4MRX A;  2BBM A;  4NDB A;  1IRJ A;  1YX8 A;  4YGC B;  3H4S E;  3CWG A;  1CFP A;  2K7O A;  1DF0 A;  4JPZ B;  1AVS A;  3BUX B;  4USL A;  3OHM B;  4YGD B;  1DJZ A;  3CLN A;  4YI9 A;  4XJK A;  1EL4 A;  2KSP A;  2LM5 A;  4GPL B;  5D69 A;  2NLN A;  1B9A A;  3O6B A;  1S6I A;  3RM1 A;  1Y1A A;  1QAT A;  4M2O A;  1CFC A;  3VRN A;  2D8N A;  2H61 C;  5JJG A;  1NX3 A;  3PN7 B;  5BPJ A;  5AFP A;  3TS5 B;  1OE9 B;  1CFD A;  1IQ5 A;  2Y4Q A;  2I2R E;  1TCF A;  1TIZ A;  2HET A;  3LK1 A;  1CMF A;  1SYM A;  1SL9 A;  3RLZ A;  2CT9 A;  3SG4 A;  3AAK A;  1BG1 A;  2H61 A;  3BUO B;  3PN7 C;  4HRG A;  1SRA A;  5AER A;  5KSZ A;  1YVH A;  1KWO C;  5CPV A;  3TS5 C;  1A75 A;  2OTG B;  1UUR A;  1XFU O;  1XK4 A;  1MHO A;  1J55 A;  1YX7 A;  1UP5 A;  3EKJ A;  4N1F A;  1XVJ A;  1DGU A;  1ZUZ A;  2OTG C;  3BOW A;  2CXJ A;  1XA5 A;  1IJ5 A;  1S36 A;  2M29 A;  1IH0 A;  3SG5 A;  2WC8 A;  5D7F A;  2K2F A;  4PAL A;  2Y1N A;  5AAN A;  4DIR A;  3GOF A;  2FJU B;  4GGF C;  1OMV A;  5I2L A;  2G9B A;  3BXK A;  4PHJ A;  4YRU A;  1AHR A;  1SNL A;  2LLU A;  1B8L A;  1OMR A;  1XFV O;  2LC5 A;  1K9K A;  5KU1 A;  1NYA A;  2BE6 A;  1CLM A;  4U8D A;  4GGF A;  5TNC A;  2KQ6 A;  1Y0V H;  1PK0 D;  1OSA A;  2MA2 A;  4OKH A;  1GJY A;  4BY4 A;  1MXE A;  4ICB A;  2GGZ A;  2LVI A;  2ZRS A;  4ORA B;  5DKQ A;  1AJ5 A;  1D1O A;  1ZAC A;  2Y5I A;  4NDD A;  2JT0 A;  1SCV A;  2F3Y A;  1GGZ A;  2KYF A;  1G4Y R;  3QRX A;  5F6T A;  1REC A;  2LMT A;  1MUX A;  5G08 A;  2PSR A;  1S6J A;  2K2A A;  1QLS A;  3EKH A;  4PE1 A;  2LVK A;  2DOQ A;  3PLF B;  4A4B A;  1CM1 A;  2WOR A;  3I5G B;  2BCB A;  2WOS A;  2SCP A;  1OZS A;  2PRU A;  2ZND A;  2BBN A;  1B1G A;  1PSB A;  1M31 A;  1NCZ A;  3FIA A;  1LA3 A;  2MBX A;  4DCK A;  1SW8 A;  2PVB A;  4DS7 A;  4YI8 A;  1A29 A;  1FI5 A;  3I5G C;  3O4Y A;  2WCE A;  1K2H A;  1XFX O;  3PFV A;  2JXC A;  4MVF A;  1CNP A;  1TCO B;  5HYD A;  1QAS A;  2BEC A;  3SG6 A;  2M49 B;  4HRH A;  1AP4 A;  2OS8 C;  1BLQ A;  1CM4 A;  1MQ1 A;  4PHK A;  1BU3 A;  3TZ1 A;  2GV5 A;  1TNX A;  2EC6 C;  1R2U A;  3WHU B;  2LMV A;  1KK7 Y;  5I2O A;  1QX2 A;  2LV7 A;  1MF8 B;  1NWD A;  2LHL A;  5CSF A;  1LVC D;  1SMG A;  2JU0 A;  2SAS A;  3KPX A;  4MN0 A;  2ISD A;  3BUN B;  3EK7 A;  1SL8 A;  5ER5 A;  3WXA A;  1MXL C;  1BR4 B;  3GK4 X;  1ALV A;  1J1E A;  1SR6 B;  1CDM A;  1M39 A;  2F2O A;  4NQG A;  1YRT B;  5K89 A;  3CR4 X;  1NPQ A;  1NCX A;  3SIB A;  4HRE E;  1S3P A;  1AJ4 A;  2NZ0 A;  2CTN A;  1GGW A;  4GGN A;  2L4H A;  2L0P A;  1ZMZ A;  2JTZ A;  2HF5 A;  1LIN A;  4I5N B;  1DTL A;  3VRR A;  1CDP A;  2MRD A;  2KBM A;  2MJW B;  1CTR A;  1PSR A;  3D0Y A;  2HQW A;  2NCP A;  4WQ3 A;  2O60 A;  1CFF A;  2KDH A;  1YUT A;  1HQV A;  1G8I A;  1L7Z A;  1SKT A;  1Q80 A;  1KK7 Z;  2KFF A;  3FWB A;  4N5X A;  4R1E A;  1J7R A;  1PVA A;  3OB2 B;  1WRL A;  3NSO A;  1JBA A;  2NCO A;  3BYA A;  1ZFS A;  4A4C A;  1IJ6 A;  2KBI A;  2LNK A;  1Y6W A;  1IG5 A;  1C7V A;  2I94 A;  1YUS A;  3A8R A;  1M45 A;  1B7T Y;  1NIW A;  1S5G Z;  3ZWH A;  4QJ5 B;  1JFK A;  2QPT A;  3VRQ A;  3TDU A;  1C7W A;  3A4U B;  1OQP A;  1L2O B;  3KO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...