4YI8A

Crystal structure of non-myristoylated e153a recoverin at 1.2 a resolution with calcium ions bound to ef-hands 2 and 3
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAAKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Recoverin
publication title Crystal Structure of Recoverin with Calcium Ions Bound to Both Functional EF Hands.
pubmed doi rcsb
source organism Bos taurus
total genus 71
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2015-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yi8A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yi8A01
1CDLA 1A75A 1S6JA 1C7VA 1F4OA 4I5NB 1KFUS 1HT9A 2E30A 2EHBA 2F2PA 2KHNA 2LNKA 4QJ4B 1TNWA 5AEQA 2L4HA 4YGCB 1SYMA 3LK1A 1SW8A 1BMOA 1KFUL 2JU0A 3AKAA 1D1OA 2NCOA 2CTNA 1K8UA 1SL9A 1XVJA 1SK6D 2GV5A 2H61A 1CLBA 2HPSA 4MZJA 4OCIA 5IBWA 2M8UA 2HF5A 1UHJA 2K7DA 4PHNA 3PFVA 5K89A 4F0ZB 4A4CA 4E68A 1IWQA 4C0JA 1JFJA 1IRJA 2LAPA 3LL8B 2KAXA 1DF0A 2ZRSA 2L50A 2KGBC 1SNLA 3IQQA 3CS1A 4MEWA 4PE7A 1CB1A 3JVTC 3ICBA 1NP8A 4WRIA 1KFXS 1EG3A 2Q91A 4PHMA 2JWWA 1LXFC 4NDCA 5DKRA 1QIWA 4PE1A 2PMYA 5I2OA 2KFHA 3OHMB 1CNPA 4MLWA 1SCVA 1IQ3A 3HX4A 2KDHA 1SPYA 1SKTA 1ZOTB 1KFXL 2Y4QA 4OKHA 2LMVA 5JOLA 1YUTA 1K9UA 1CM4A 4HSZA 1YX8A 3SIBA 2HETA 2GGMA 3EKJA 2NLNA 3CWGA 4I5JA 2H61C 2M9GA 2ZNDA 2OTGB 1K9KA 4CPVA 1QX2A 5DKNA 2A4JA 1CDNA 2R2IA 1EL4A 1R6PA 4MZLA 3WNXB 4DIRA 3D0YA 1A03A 2JNFA 1YUSA 3A8RA 3CGAA 4L9MA 5G08A 1AJ4A 1KWOC 2L51A 3DVKA 2BCXA 1RWYA 5KSZA 4GUKA 3KEVA 4A4BA 1YX7A 3PN7C 4GBAA 1SMGA 1B9AA 1XK4A 3A4UB 2WORA 4PE4A 4QJ3B 2JC2A 2ISDA 1K93D 1SCMB 2LVKA 1J7RA 3DVMA 1LA3A 1V1FA 2MAZA 2LMTA 1TIZA 5AERA 2JULA 2CXJA 4CLNA 1WRZA 3FS7A 4IL1A 4BY4A 4YGEB 1SRAA 2KAVA 3BUOB 5HLVA 1M63B 2EGDA 3SG6A 3LK0A 1CMGA 2NXQA 3O2PA 5HKWA 1QV1A 3D0YB 5AXIA 2K2FA 1L7ZA 1N0YA 2I2RE 2KI4B 2IS9A 1Y1AA 4YRUA 2K8MB 3BQ3A 4ORBB 1DJZA 3PSRA 1DJXA 1FBVA 1UHIA 2KBIA 2M0RA 1UHKA 1BF5A 2WC8A 2KI4C 1RECA 1ZUZA 2TN4A 3FWBA 1A4PA 1SBJA 2D8NA 5I2LA 3TS5C 1ALWA 1JFKA 1NIWA 5AFPA 3I5IB 2F3ZA 2F33A 1XK4C 1QLSA 1QJTA 1CLMA 1QVIY 1L2OC 3GK4X 2EC6B 1LA0A 2CBLA 3BUMB 1TCFA 3EK7A 3TDUA 1S36A 3WHTB 2M1UA 3TDIA 2HQWA 1QX7A 3GOFA 3OP0A 4OVNF 1M39A 1TTXA 2Y1NA 1XFZO 2M1KB 2AMIA 2CNPA 2WCFA 1TNQA 2JNXA 2LC5A 4N5XA 3SG4A 5CSNA 1OMVA 3AAKA 3VRRA 1S6IA 1XFWO 1KQVA 4MBEA 4JQ0D 1R2UA 3JTDC 3KO0A 1KK8C 1J7QA 2DOQA 2JXLA 4ZCVA 2AUCA 1WLZA 1RROA 2BE4A 2E6WA 2MHHA 1E8AA 1GGZA 4Q04A 1F55A 3I5HC 3LLEA 3K21A 3EVUA 1S6CA 1PK0D 1MHOA 1IJ6A 1BJFA 3CTNA 1DGUA 2FJUB 2LP2A 4ICBA 1Y1XA 1XA5A 2F3YA 4FTGA 1IH0A 1QIVA 5DKQA 2JXCA 4I5LB 1BR1B 4WQ2A 2CCMA 3BUNB 3VROA 2KI6C 3C1VA 2BCAA 1MR8A 1H8BA 1IG5A 4GFTA 2V53A 1SL7A 3LCPC 1QS7A 1IQ5A 2L2EA 1K95A 2RGIA 4YGBB 4XJKA 3I5GB 1AHRA 1B7TZ 2JT3A 1AJ5A 1KK7Y 2PVBA 1F8HA 3SG2A 1DJIA 1SY9A 2SASA 1BOCA 2ZNEA 1NWDA 1PULA 3CR4X 1YVHA 3IF7A 1KSMA 3I5GC 3NXAA 5B8IB 4YI8A 1G33A 1QX5B 2LLUA 4DCKA 1AUIB 4HRGA 2BBMA 2LVIA 1PVBA 1TNXA 1CFPA 1K96A 4YI9A 1MXLC 1OMDA 4DRWA 2COLB 2H2KA 3CLNA 4XYNA 1KQMB 1IJ5A 3OX6A 3O78A 4XJKB 1XFYO 2M49B 3E3RA 2BL0B 1UURA 1GJYA 1WY9A 2QACA 4PE0A 1LVCD 1MWNA 1NPQA 3FWCA 1NX0A 2I18A 1UHHA 2FCDA 2WCBA 1ZFSA 1ALVA 4C0KA 2BECA 1NX2A 1Q80A 2OTGC 2WCEA 1UP5A 3KF9A 5BPJA 1NCYA 1RFJA 1DT7B 3VRQA 5KTYA 4PCWA 4MRYA 3PM8A 1CFDA 3PLFB 2M97A 1VRKA 1HQVA 2O5GA 1SL8A 2M29A 3DVEA 1SCMC 3TDZA 2PALA 5KU1A 3AKBA 4OV2A 2Y1MA 4M2QA 1DJWA 4N1FA 5FYXA 5AANA 1NX3A 1AK8A 3SG3A 2ZRTA 3PALA 2ZKMX 1WDCB 4DUQA 1BR4B 3PATA 3NSLA 2P6BB 1FI6A 1LINA 5I8NA 1S5GZ 1Y0VH 4PHJA 1SR6B 2BE6A 1XO5A 1C07A 2MRDA 2LHIA 1LKJA 1G4YR 4PDZA 5I2QA 1QLKA 1OZOA 1WRLA 2OS8B 1QTXA 3EK4A 3VRPA 3KHEA 4U8DA 2WNDA 1CLLA 5J3XA 1WRKA 1YR5A 2I7AA 2K2AA 2KFGA 1F71A 4WQ3A 3F45A 5HLOA 4JWQA 4ORAB 3WXAA 4ETOA 1BG1A 1QASA 1N65A 2F8PA 3I5IC 3IQOA 1PSRA 4MSPA 2MA2A 4YBHB 5D69A 1X02A 3I5FB 1TOPA 4NDDA 1JC2A 2LHLA 2LUXA 4R1EA 2EC6C 1M45A 2LVVA 3EVRA 3RLZA 1RK9A 2PSRA 2G9BA 1U5IB 3M0WA 4GGFA 5F6TA 4GPLB 2JT0A 1DVIA 1QV0A 4CFRA 1A29A 4CIDA 3CR2A 1IKUA 4MVFA 1B4CA 1EJ3A 4OR9B 1F54A 4TNCA 5HKYA 1S1EA 3EVVA 2KAYA 3O4YA 4MN0A 4D1EA 4P5OE 3WHUB 1GGWA 2L0PA 3SG7A 4BY5A 1OSAA 1B47A 1PRWA 2VRGA 5HKZA 1DGVA 1F4QA 1EH2A 1TRFA 2HQ8A 1NCZA 1XFXO 2O60A 4GNKB 1DJYA 1ZACA 1S3PA 4YGDB 3TUYB 1J1EA 1TCOB 2KBMA 5JJGA 5HYDA 1MF8B 3KPXA 3VGOA 1JWDA 2FOTA 3OB2B 4GGFC 2KQYA 3VRNA 2LP3A 1WLMA 2JTTA 3MSEB 1YVLA 2KQ6A 1B8LA 1CDPA 3HCMA 3GK1A 5ER4X 2LMUA 1QVIZ 1OMRA 1UWOA 3OX5A 1UUSA 4FQOA 1FI5A 1K94A 3QRXA 3BXKA 1G8IA 2PASA 1XFUO 3TZ1A 4HREE 2K0JA 2K7BA 4ZCUA 2G2BA 2JT8A 1JF0A 1XFVO 2JQ6A 3ZWHA 2KOTA 2LV7A 3BOWB 1EXRA 1CMFA 1CDMA 4NDBA 1CKKA 2MLFC 2ZN9A 3NSKA 1FF1A 2QPTA 1JUOA 2JPTA 1QATA 1EG4A 4GGNA 3NSOA 3DVJA 1A75B 1ZMZA 3JVTB 4C0LA 1YRTB 2NCPA 2KNEA 1TNPA 1F70A 1V1GA 1BODA 3RM1A 2MBXA 3NSIA 1S5GY 4N1GA 1GQMA 1Y6WA 1FW4A 2OPOA 1B8RA 1KQMC 3EKHA 4MRXA 3SIAA 3FIAA 4AQIA 1DJGA 1DJHA 2BL0C 1KSOA 5PALA 1M46A 2K7CA 2LCPA 5CPVA 1H4BA 5TNCA 1XYDA 1OZSA 3GK2A 1W7JB 2KYFA 2L5XB 3BUXB 2M7LA 3SG5A 1OQPA 1PVAA 4AOMA 5GQQC 1NCXA 4I5KA 1KWOB 1RTP1 1YTZC 2M7NA 3DD4A 2LLSA 5CSJA 2L98A 1DF0B 3PN7B 4CFQA 1C7WA 1J55A 1QXPA 4M2PA 2JTZA 1ODBA 2BKIB 2K7OA 3CZTX 2KYCA 1J7OA 1KK7Z 1DMOA 1FPWA 2ZN8A 1W7IB 3D10A 1JSAA 1OOJA 1JF2A 1DTLA 1NX1A 1U5IA 4ORCB 1CFCA 1WDCC 1YURA 3OB1B 1OE9B 4USLA 1N2DA 4PHKA 1SR6C 3H4SE 3CR5X 1YRUB 1BLQA 4JPZB 1A2XA 1CTRA 1Y1UA 2JOJA 4YGAA 4PALA 2F2OA 5CSIA 1M31A 2L4IA 2MLEC 2OS8C 1PALA 3TS5B 2LLTA 1AVSA 4UPGA 2M3WA 2NZ0A 3ZNIA 1NUBA 1B8CA 2BKHB 2BBNA 1MXEA 1CFFA 1J1DA 2KSPA 2LE9B 1PSBA 1L2OB 2FCEA 1J7PA 2JRFA 1JBAA 2GGZA 2LVJA 4NQGA 2WOSA 5ER5A 1K9PA 2LANA 3I5FC 4MZKA 5CSFA 2LUCA 1TN4A 1K90D 2JZIA 3AAJA 3O6BA 2KI6D 1NYAA 3DF0A 4P2YB 1B1GA 1B7TY 2LM5A 1MUXA 2Y5IA 3SJSA 2MJWB 2B1UA 1MQ1A 2ZFDA 3EK8A 1CM1A 1KCYA 2KGRA 5D7FA 3JTDB 1KK8B 1IGVA 1NSHA 1RJVA 2BCBA 4GAOA 1YUUA 1BU3A 4QJ5B 2K61A 2AAOA 3BUWB 2SCPA 3BOWA 1BT6A 3I5HB 4AQJA 1K2HA 2CT9A 2PRUA 4DS7A 3DF0B 2Q4UA 2KFFA 2I94A 3BYAA 4M2OA 4HRHA 3TUYC 1UHNA 1S26D 1AP4A
chains in the Genus database with same CATH superfamily
1DELA 1CDLA 1A75A 1S6JA 1C7VA 1F4OA 4I5NB 1KFUS 1HT9A 2E30A 2EHBA 4JD9A 2F2PA 2KHNA 2LNKA 4QJ4B 1TNWA 5AEQA 2L4HA 4YGCB 1SYMA 3LK1A 1SW8A 1BMOA 1KFUL 2JU0A 3AKAA 1D1OA 3CDNA 2P70A 2NCOA 2CTNA 1K8UA 3B7AA 5HL1A 1SL9A 1XVJA 1SK6D 2GV5A 3S0AA 2H61A 4OZDA 1CLBA 3D74A 2HPSA 4MZJA 4OCIA 5IBWA 2M8UA 2HF5A 1UHJA 2K7DA 4PHNA 3PFVA 5K89A 5I94A 4F0ZB 4A4CA 3S0DA 4E68A 1IWQA 4C0JA 1JFJA 1IRJA 2LAPA 3LL8B 2KAXA 1DF0A 2ZRSA 2L50A 2KGBC 1SNLA 3IQQA 3CS1A 4MEWA 4INXA 4PE7A 1CB1A 3JVTC 3ICBA 1NP8A 4WRIA 1KFXS 1EG3A 2Q91A 4PHMA 2JWWA 1LXFC 4NDCA 5DKRA 1QIWA 5FI6A 1Z2CB 4PE1A 2PMYA 5I2OA 2KFHA 3OHMB 4PT1A 1CNPA 4MLWA 1SCVA 1IQ3A 3HX4A 2KDHA 1SPYA 1SKTA 1ZOTB 1KFXL 2QEBA 2Y4QA 2LMVA 4OKHA 1YUTA 1K9UA 1CM4A 2QEVA 3L4LA 1YX8A 4HSZA 3SIBA 2HETA 3Q8IA 2GGMA 3EKJA 2NLNA 3CWGA 4I5JA 2H61C 2M9GA 2ZNDA 2OTGB 1K9KA 4CPVA 5I2QA 1QX2A 5DKNA 2A4JA 3D77A 1CDNA 2R2IA 1EL4A 1R6PA 4MZLA 3WNXB 4DIRA 3D0YA 1A03A 4IJ7A 2JNFA 1YUSA 3A8RA 3CGAA 4L9MA 1XFRA 5G08A 1AJ4A 1KWOC 2L51A 3B6XA 1RWYA 2BCXA 3DVKA 1OOGA 5KSZA 4GUKA 3KEVA 4A4BA 1YX7A 1OOFA 3PN7C 4GBAA 1SMGA 1B9AA 1XK4A 3A4UB 2WORA 4PE4A 3CYZA 2JC2A 2JPOA 4QJ3B 3N7HA 1K93D 1SCMB 2LVKA 1J7RA 3DVMA 1LA3A 1V1FA 2MAZA 2LMTA 1TIZA 5AERA 2JULA 2CXJA 4CLNA 1WRZA 3FS7A 4IL1A 4BY4A 4YGEB 1SRAA 2KAVA 3BUOB 5HLVA 1M63B 2EGDA 3SG6A 3LK0A 3V2LA 1CMGA 2NXQA 3O2PA 5HKWA 1QV1A 3D0YB 5AXIA 2K2FA 1L7ZA 1N0YA 2I2RE 2KI4B 2IS9A 1Y1AA 2K60A 4YRUA 3NHIA 2K8MB 3BQ3A 4ORBB 1DJZA 3R1OA 3PSRA 1DJXA 1FBVA 1UHIA 2KBIA 2M0RA 1UHKA 1BF5A 2WC8A 2KI4C 1RECA 2QDIA 1ZUZA 1OOIX 2TN4A 3FWBA 1A4PA 1SBJA 2D8NA 5EL2A 5I2LA 3TS5C 1ALWA 1JFKA 1NIWA 5AFPA 3I5IB 2F3ZA 2F33A 1XK4C 1QLSA 1QJTA 1CLMA 1QVIY 2L2CA 1L2OC 3GK4X 2EC6B 1W9ZA 1LA0A 2CBLA 3BUMB 1TCFA 3EK7A 3TDUA 1S36A 3WHTB 2M1UA 3TDIA 2HQWA 1QX7A 3GOFA 3OP0A 4OVNF 1M39A 1P28A 1TTXA 2Y1NA 3L4AA 1XFZO 2M1KB 2AMIA 2CNPA 2WCFA 1TNQA 2JNXA 2LC5A 4N5XA 3SG4A 5CSNA 1OMVA 3AAKA 3VRRA 1OW4A 1S6IA 1XFWO 3B86A 1KQVA 4MBEA 2WCHA 4JQ0D 2WCJA 1R2UA 3JTDC 3KO0A 1KK8C 1J7QA 2DOQA 2JXLA 4ZCVA 3OGNA 2AUCA 1WLZA 1TUZA 1C3YA 1RROA 2BE4A 2E6WA 2MHHA 1E8AA 1GGZA 2PQLA 4Q04A 1F55A 3I5HC 3LLEA 3K21A 3EVUA 1S6CA 1PK0D 1MHOA 1IJ6A 1BJFA 3CTNA 1DGUA 2FJUB 2LP2A 4ICBA 1Y1XA 5JOLA 1XA5A 2F3YA 4FTGA 2WCMA 1IH0A 1QIVA 5DKQA 2JXCA 4I5LB 1BR1B 4WQ2A 2CCMA 3BUNB 3VROA 3BFAA 2KI6C 3C1VA 2BCAA 4KYNA 1DQEA 1MR8A 1IG5A 3S0BA 1H8BA 4GFTA 2V53A 1SL7A 3QMEA 3LCPC 1QS7A 1IQ5A 2L2EA 1K95A 2RGIA 3CABA 4YGBB 2KLDA 4XJKA 3I5GB 1AHRA 1B7TZ 2H8VA 2JT3A 1AJ5A 1KK7Y 2PVBA 1F8HA 3SG2A 1DJIA 1SY9A 2SASA 1BOCA 2ZNEA 1NWDA 1PULA 3CR4X 1YVHA 3IF7A 1KSMA 3I5GC 3NXAA 5B8IB 2FJYA 4YI8A 1G33A 1QX5B 2LLUA 3DY9A 4DCKA 1AUIB 4HRGA 3NHTA 2BBMA 2LVIA 1PVBA 1TNXA 1CFPA 1K96A 4YI9A 1MXLC 1OMDA 4DRWA 2COLB 2H2KA 1ORGA 3B87A 1KQMB 3CLNA 4XYNA 3FE6A 3UO9A 1IJ5A 3OX6A 3O78A 4XJKB 1XFYO 2M49B 3E3RA 2BL0B 1UURA 1GJYA 1WY9A 2QACA 4PE0A 1LVCD 1MWNA 1NPQA 3R1PA 3FWCA 1NX0A 5DICA 2I18A 1UHHA 2QEHA 2FCDA 2WCBA 1ZFSA 1ALVA 4C0KA 2BECA 1NX2A 1Q80A 2ERBA 2OTGC 2WCEA 3B88A 1UP5A 3KF9A 1TUJA 1DC1A 3NGVA 4F7FA 1NCYA 5BPJA 3R1VA 1RFJA 1DT7B 3VRQA 5KTYA 4PCWA 4MRYA 3PM8A 1CFDA 2ISDA 3PLFB 2M97A 1VRKA 2YGUA 1HQVA 2O5GA 1SL8A 2M29A 3DVEA 1SCMC 3TDZA 2PALA 3BJHA 5KU1A 3AKBA 4OV2A 2Y1MA 4M2QA 1DJWA 4N1FA 5FYXA 5AANA 1NX3A 1AK8A 2GTEA 3SG3A 2ZRTA 3PALA 2ZKMX 1WDCB 3SS5A 3S0FA 4DUQA 3BFHA 1BR4B 3PATA 3NSLA 2P6BB 1FI6A 1LINA 5I8NA 1S5GZ 1Y0VH 4PHJA 1SR6B 2BE6A 1XO5A 1C07A 2MRDA 2LHIA 1LKJA 1G4YR 4PDZA 3CZ0A 1QLKA 1OZOA 1WRLA 2OS8B 1QTXA 3D76A 3EK4A 3VRPA 3KHEA 4U8DA 2WNDA 1CLLA 3DZTA 5J3XA 1WRKA 1YR5A 2I7AA 2K2AA 2KFGA 3RZSA 1F71A 4WQ3A 3F45A 3D73A 5HLOA 4JWQA 4ORAB 3CZ2A 3WXAA 4ETOA 3D75A 1BG1A 1QASA 1N65A 2F8PA 3I5IC 3IQOA 1PSRA 4MSPA 2MA2A 4YBHB 5D69A 1X02A 3I5FB 1TOPA 4NDDA 1JC2A 2LHLA 2LUXA 4R1EA 2EC6C 1M45A 2LVVA 3EVRA 3RLZA 1RK9A 2PSRA 2G9BA 1U5IB 3M0WA 4GGFA 5F6TA 4GPLB 2JT0A 1DVIA 1QV0A 4CFRA 1A29A 4CIDA 3K1EA 3CR2A 1IKUA 4MVFA 1B4CA 1EJ3A 4OR9B 3PM2A 4TNCA 1F54A 5HKYA 1S1EA 3EVVA 2KAYA 3O4YA 4MN0A 4D1EA 2QEOA 4P5OE 3WHUB 1GGWA 2L0PA 3VB1A 3SG7A 4BY5A 1OSAA 1B47A 1PRWA 2VRGA 3SS4A 5HKZA 1DGVA 1F4QA 1EH2A 1TRFA 2HQ8A 1NCZA 1XFXO 2O60A 2WCLA 1DJYA 1ZACA 1S3PA 4GNKB 4YGDB 3TUYB 3EG5B 1J1EA 1TCOB 2KBMA 5JJGA 5HYDA 1MF8B 3KPXA 1TWOA 1LS8A 3VGOA 1QWVA 1JWDA 2FOTA 3OB2B 4GGFC 2KQYA 3VRNA 1SSEB 2L5YA 2KLEA 2LP3A 1WLMA 2JTTA 3MSEB 1YVLA 2KQ6A 1B8LA 1CDPA 3HCMA 2P71A 3GK1A 5ER4X 2LMUA 1QVIZ 1OMRA 1UWOA 1T14A 3OX5A 1UUSA 4FQOA 1FI5A 1C3ZA 1K94A 3QRXA 3BXKA 1G8IA 2PASA 1XFUO 3TZ1A 4HREE 2K0JA 2K7BA 4ZCUA 2G2BA 2JT8A 1JF0A 1XFVO 2JQ6A 3ZWHA 2KOTA 2LV7A 3BOWB 1EXRA 4JKTA 1CMFA 1CDMA 4NDBA 1CKKA 2MLFC 2WCKA 2ZN9A 3NSKA 1FF1A 2QPTA 1JUOA 2JPTA 1QATA 1EG4A 4GGNA 3NSOA 3DVJA 1Z4HA 1IIOA 1A75B 1ZMZA 3JVTB 4C0LA 1YRTB 3CZ1A 2NCPA 2KNEA 1TNPA 1F70A 1V1GA 1BODA 3RM1A 2MBXA 3NSIA 1S5GY 2BNXA 4N1GA 1GQMA 1Y6WA 1FW4A 2OPOA 1B8RA 1KQMC 3EKHA 4MRXA 3SIAA 3FIAA 4AQIA 1DJGA 1DJHA 3IVTA 2BL0C 1KSOA 5PALA 1M46A 2K7CA 2LCPA 5CPVA 1H4BA 5TNCA 1XYDA 1OZSA 3GK2A 1W7JB 2KYFA 2L5XB 3BUXB 2WC6A 3DXLA 2M7LA 3SG5A 1OQPA 1PVAA 3D78A 4AOMA 5GQQC 3FE8A 1NCXA 3O4XA 4I5KA 1KWOB 1RTP1 1YTZC 2M7NA 3DD4A 2LLSA 5CSJA 2L98A 1DF0B 3PN7B 4CFQA 1C7WA 1J55A 1QXPA 4M2PA 4FQTA 2JTZA 3S0GA 2WC5A 1ODBA 2BKIB 2K7OA 3CZTX 2KYCA 1J7OA 1KK7Z 3PJIA 1DMOA 1FPWA 2ZN8A 1W7IB 3D10A 1JSAA 1OOJA 1JF2A 1DTLA 1NX1A 1U5IA 5FI7A 4ORCB 1CFCA 1WDCC 1YURA 3OB1B 1OE9B 3R72A 4USLA 1N2DA 4PHKA 1SR6C 3H4SE 3CR5X 1YRUB 1BLQA 4JPZB 1A2XA 1CTRA 1Y1UA 2JOJA 4YGAA 4PALA 2F2OA 4INWA 5CSIA 1M31A 1OOHA 2L4IA 2MLEC 2OS8C 1PALA 3TS5B 2LLTA 1DEKA 1AVSA 4UPGA 2M3WA 2NZ0A 3OBVA 1NUBA 3SS3A 1B8CA 2BKHB 3ZNIA 2BBNA 1MXEA 1CFFA 1J1DA 2KSPA 2LE9B 1PSBA 1L2OB 2KPHA 2FCEA 1J7PA 2JRFA 1JBAA 3FE9A 2GGZA 2LVJA 4NQGA 2WOSA 5ER5A 1K9PA 2LANA 3BFBA 3I5FC 4MZKA 5CSFA 2LUCA 1TN4A 3S0EA 1K90D 2JZIA 3AAJA 3O6BA 2KI6D 1NYAA 3DF0A 4P2YB 1B1GA 1B7TY 2LM5A 1GM0A 1MUXA 2Y5IA 3SJSA 2MJWB 2B1UA 1MQ1A 2ZFDA 3EK8A 1CM1A 1KCYA 2KGRA 5D7FA 3JTDB 1KK8B 3L47A 1IGVA 1NSHA 1RJVA 2BCBA 4GAOA 1YUUA 1BU3A 4QJ5B 2K61A 2AAOA 3BUWB 5D3OA 2SCPA 3BOWA 1BT6A 3I5HB 4AQJA 3DYEA 1K2HA 2CT9A 2BAPA 2PRUA 4DS7A 3DF0B 5FI2A 2PYQA 2KFFA 2I94A 2Q4UA 3BYAA 4HRHA 4M2OA 3TUYC 1UHNA 1S26D 3UNWA 1AP4A
chains in the Genus database with same CATH topology
1CDLA 1A75A 1S6JA 1C7VA 1F4OA 4I5NB 1KFUS 1HT9A 2E30A 2EHBA 2F2PA 2KHNA 2LNKA 4QJ4B 1TNWA 5AEQA 2L4HA 4YGCB 1SYMA 3LK1A 1SW8A 1BMOA 1KFUL 2JU0A 3AKAA 1D1OA 2NCOA 2CTNA 1K8UA 1SL9A 1XVJA 1SK6D 2GV5A 2H61A 1CLBA 2HPSA 4MZJA 4OCIA 5IBWA 2M8UA 2HF5A 1UHJA 2K7DA 4PHNA 3PFVA 5K89A 4F0ZB 4A4CA 4E68A 1IWQA 4C0JA 1JFJA 1IRJA 2LAPA 3LL8B 2KAXA 1DF0A 2ZRSA 2L50A 2KGBC 1SNLA 3IQQA 3CS1A 4MEWA 4PE7A 1CB1A 3JVTC 3ICBA 1NP8A 4WRIA 1KFXS 1EG3A 2Q91A 4PHMA 2JWWA 1LXFC 4NDCA 5DKRA 1QIWA 4PE1A 2PMYA 5I2OA 2KFHA 3OHMB 1CNPA 4MLWA 1SCVA 1IQ3A 3HX4A 2KDHA 1SPYA 1SKTA 1ZOTB 1KFXL 2Y4QA 4OKHA 2LMVA 5JOLA 1YUTA 1K9UA 1CM4A 4HSZA 1YX8A 3SIBA 2HETA 2GGMA 3EKJA 2NLNA 3CWGA 4I5JA 2H61C 2M9GA 2ZNDA 2OTGB 1K9KA 4CPVA 1QX2A 5DKNA 2A4JA 1CDNA 2R2IA 1EL4A 1R6PA 4MZLA 3WNXB 4DIRA 3D0YA 1A03A 2JNFA 1YUSA 3A8RA 3CGAA 4L9MA 5G08A 1AJ4A 1KWOC 2L51A 3DVKA 2BCXA 1RWYA 5KSZA 4GUKA 3KEVA 4A4BA 1YX7A 3PN7C 4GBAA 1SMGA 1B9AA 1XK4A 3A4UB 2WORA 4PE4A 4QJ3B 2JC2A 2ISDA 1K93D 1SCMB 2LVKA 1J7RA 3DVMA 1LA3A 1V1FA 2MAZA 2LMTA 1TIZA 5AERA 2JULA 2CXJA 4CLNA 1WRZA 3FS7A 4IL1A 4BY4A 4YGEB 1SRAA 2KAVA 3BUOB 5HLVA 1M63B 2EGDA 3SG6A 3LK0A 1CMGA 2NXQA 3O2PA 5HKWA 1QV1A 3D0YB 5AXIA 2K2FA 1L7ZA 1N0YA 2I2RE 2KI4B 2IS9A 1Y1AA 4YRUA 2K8MB 3BQ3A 4ORBB 1DJZA 3PSRA 1DJXA 1FBVA 1UHIA 2KBIA 2M0RA 1UHKA 1BF5A 2WC8A 2KI4C 1RECA 1ZUZA 2TN4A 3FWBA 1A4PA 1SBJA 2D8NA 5I2LA 3TS5C 1ALWA 1JFKA 1NIWA 5AFPA 3I5IB 2F3ZA 2F33A 1XK4C 1QLSA 1QJTA 1CLMA 1QVIY 1L2OC 3GK4X 2EC6B 1LA0A 2CBLA 3BUMB 1TCFA 3EK7A 3TDUA 1S36A 3WHTB 2M1UA 3TDIA 2HQWA 1QX7A 3GOFA 3OP0A 4OVNF 1M39A 1TTXA 2Y1NA 1XFZO 2M1KB 2AMIA 2CNPA 2WCFA 1TNQA 2JNXA 2LC5A 4N5XA 3SG4A 5CSNA 1OMVA 3AAKA 3VRRA 1S6IA 1XFWO 1KQVA 4MBEA 4JQ0D 1R2UA 3JTDC 3KO0A 1KK8C 1J7QA 2DOQA 2JXLA 4ZCVA 2AUCA 1WLZA 1RROA 2BE4A 2E6WA 2MHHA 1E8AA 1GGZA 4Q04A 1F55A 3I5HC 3LLEA 3K21A 3EVUA 1S6CA 1PK0D 1MHOA 1IJ6A 1BJFA 3CTNA 1DGUA 2FJUB 2LP2A 4ICBA 1Y1XA 1XA5A 2F3YA 4FTGA 1IH0A 1QIVA 5DKQA 2JXCA 4I5LB 1BR1B 4WQ2A 2CCMA 3BUNB 3VROA 2KI6C 3C1VA 2BCAA 1MR8A 1H8BA 1IG5A 4GFTA 2V53A 1SL7A 3LCPC 1QS7A 1IQ5A 2L2EA 1K95A 2RGIA 4YGBB 4XJKA 3I5GB 1AHRA 1B7TZ 2JT3A 1AJ5A 1KK7Y 2PVBA 1F8HA 3SG2A 1DJIA 1SY9A 2SASA 1BOCA 2ZNEA 1NWDA 1PULA 3CR4X 1YVHA 3IF7A 1KSMA 3I5GC 3NXAA 5B8IB 4YI8A 1G33A 1QX5B 2LLUA 4DCKA 1AUIB 4HRGA 2BBMA 2LVIA 1PVBA 1TNXA 1CFPA 1K96A 4YI9A 1MXLC 1OMDA 4DRWA 2COLB 2H2KA 3CLNA 4XYNA 1KQMB 1IJ5A 3OX6A 3O78A 4XJKB 1XFYO 2M49B 3E3RA 2BL0B 1UURA 1GJYA 1WY9A 2QACA 4PE0A 1LVCD 1MWNA 1NPQA 3FWCA 1NX0A 2I18A 1UHHA 2FCDA 2WCBA 1ZFSA 1ALVA 4C0KA 2BECA 1NX2A 1Q80A 2OTGC 2WCEA 1UP5A 3KF9A 5BPJA 1NCYA 1RFJA 1DT7B 3VRQA 5KTYA 4PCWA 4MRYA 3PM8A 1CFDA 3PLFB 2M97A 1VRKA 1HQVA 2O5GA 1SL8A 2M29A 3DVEA 1SCMC 3TDZA 2PALA 5KU1A 3AKBA 4OV2A 2Y1MA 4M2QA 1DJWA 4N1FA 5FYXA 5AANA 1NX3A 1AK8A 3SG3A 2ZRTA 3PALA 2ZKMX 1WDCB 4DUQA 1BR4B 3PATA 3NSLA 2P6BB 1FI6A 1LINA 5I8NA 1S5GZ 1Y0VH 4PHJA 1SR6B 2BE6A 1XO5A 1C07A 2MRDA 2LHIA 1LKJA 1G4YR 4PDZA 5I2QA 1QLKA 1OZOA 1WRLA 2OS8B 1QTXA 3EK4A 3VRPA 3KHEA 4U8DA 2WNDA 1CLLA 5J3XA 1WRKA 1YR5A 2I7AA 2K2AA 2KFGA 1F71A 4WQ3A 3F45A 5HLOA 4JWQA 4ORAB 3WXAA 4ETOA 1BG1A 1QASA 1N65A 2F8PA 3I5IC 3IQOA 1PSRA 4MSPA 2MA2A 4YBHB 5D69A 1X02A 3I5FB 1TOPA 4NDDA 1JC2A 2LHLA 2LUXA 4R1EA 2EC6C 1M45A 2LVVA 3EVRA 3RLZA 1RK9A 2PSRA 2G9BA 1U5IB 3M0WA 4GGFA 5F6TA 4GPLB 2JT0A 1DVIA 1QV0A 4CFRA 1A29A 4CIDA 3CR2A 1IKUA 4MVFA 1B4CA 1EJ3A 4OR9B 1F54A 4TNCA 5HKYA 1S1EA 3EVVA 2KAYA 3O4YA 4MN0A 4D1EA 4P5OE 3WHUB 1GGWA 2L0PA 3SG7A 4BY5A 1OSAA 1B47A 1PRWA 2VRGA 5HKZA 1DGVA 1F4QA 1EH2A 1TRFA 2HQ8A 1NCZA 1XFXO 2O60A 4GNKB 1DJYA 1ZACA 1S3PA 4YGDB 3TUYB 1J1EA 1TCOB 2KBMA 5JJGA 5HYDA 1MF8B 3KPXA 3VGOA 1JWDA 2FOTA 3OB2B 4GGFC 2KQYA 3VRNA 2LP3A 1WLMA 2JTTA 3MSEB 1YVLA 2KQ6A 1B8LA 1CDPA 3HCMA 3GK1A 5ER4X 2LMUA 1QVIZ 1OMRA 1UWOA 3OX5A 1UUSA 4FQOA 1FI5A 1K94A 3QRXA 3BXKA 1G8IA 2PASA 1XFUO 3TZ1A 4HREE 2K0JA 2K7BA 4ZCUA 2G2BA 2JT8A 1JF0A 1XFVO 2JQ6A 3ZWHA 2KOTA 2LV7A 3BOWB 1EXRA 1CMFA 1CDMA 4NDBA 1CKKA 2MLFC 2ZN9A 3NSKA 1FF1A 2QPTA 1JUOA 2JPTA 1QATA 1EG4A 4GGNA 3NSOA 3DVJA 1A75B 1ZMZA 3JVTB 4C0LA 1YRTB 2NCPA 2KNEA 1TNPA 1F70A 1V1GA 1BODA 3RM1A 2MBXA 3NSIA 1S5GY 4N1GA 1GQMA 1Y6WA 1FW4A 2OPOA 1B8RA 1KQMC 3EKHA 4MRXA 3SIAA 3FIAA 4AQIA 1DJGA 1DJHA 2BL0C 1KSOA 5PALA 1M46A 2K7CA 2LCPA 5CPVA 1H4BA 5TNCA 1XYDA 1OZSA 3GK2A 1W7JB 2KYFA 2L5XB 3BUXB 2M7LA 3SG5A 1OQPA 1PVAA 4AOMA 5GQQC 1NCXA 4I5KA 1KWOB 1RTP1 1YTZC 2M7NA 3DD4A 2LLSA 5CSJA 2L98A 1DF0B 3PN7B 4CFQA 1C7WA 1J55A 1QXPA 4M2PA 2JTZA 1ODBA 2BKIB 2K7OA 3CZTX 2KYCA 1J7OA 1KK7Z 1DMOA 1FPWA 2ZN8A 1W7IB 3D10A 1JSAA 1OOJA 1JF2A 1DTLA 1NX1A 1U5IA 4ORCB 1CFCA 1WDCC 1YURA 3OB1B 1OE9B 4USLA 1N2DA 4PHKA 1SR6C 3H4SE 3CR5X 1YRUB 1BLQA 4JPZB 1A2XA 1CTRA 1Y1UA 2JOJA 4YGAA 4PALA 2F2OA 5CSIA 1M31A 2L4IA 2MLEC 2OS8C 1PALA 3TS5B 2LLTA 1AVSA 4UPGA 2M3WA 2NZ0A 3ZNIA 1NUBA 1B8CA 2BKHB 2BBNA 1MXEA 1CFFA 1J1DA 2KSPA 2LE9B 1PSBA 1L2OB 2FCEA 1J7PA 2JRFA 1JBAA 2GGZA 2LVJA 4NQGA 2WOSA 5ER5A 1K9PA 2LANA 3I5FC 4MZKA 5CSFA 2LUCA 1TN4A 1K90D 2JZIA 3AAJA 3O6BA 2KI6D 1NYAA 3DF0A 4P2YB 1B1GA 1B7TY 2LM5A 1MUXA 2Y5IA 3SJSA 2MJWB 2B1UA 1MQ1A 2ZFDA 3EK8A 1CM1A 1KCYA 2KGRA 5D7FA 3JTDB 1KK8B 1IGVA 1NSHA 1RJVA 2BCBA 4GAOA 1YUUA 1BU3A 4QJ5B 2K61A 2AAOA 3BUWB 2SCPA 3BOWA 1BT6A 3I5HB 4AQJA 1K2HA 2CT9A 2PRUA 4DS7A 3DF0B 2Q4UA 2KFFA 2I94A 3BYAA 4M2OA 4HRHA 3TUYC 1UHNA 1S26D 1AP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDL A;  1A75 A;  1S6J A;  1C7V A;  1F4O A;  4I5N B;  1KFU S;  1HT9 A;  2E30 A;  2EHB A;  2F2P A;  2KHN A;  2LNK A;  4QJ4 B;  1TNW A;  5AEQ A;  2L4H A;  4YGC B;  1SYM A;  3LK1 A;  1SW8 A;  1BMO A;  1KFU L;  2JU0 A;  3AKA A;  1D1O A;  2NCO A;  2CTN A;  1K8U A;  1SL9 A;  1XVJ A;  1SK6 D;  2GV5 A;  2H61 A;  1CLB A;  2HPS A;  4MZJ A;  4OCI A;  5IBW A;  2M8U A;  2HF5 A;  1UHJ A;  2K7D A;  4PHN A;  3PFV A;  5K89 A;  4F0Z B;  4A4C A;  4E68 A;  1IWQ A;  4C0J A;  1JFJ A;  1IRJ A;  2LAP A;  3LL8 B;  2KAX A;  1DF0 A;  2ZRS A;  2L50 A;  2KGB C;  1SNL A;  3IQQ A;  3CS1 A;  4MEW A;  4PE7 A;  1CB1 A;  3JVT C;  3ICB A;  1NP8 A;  4WRI A;  1KFX S;  1EG3 A;  2Q91 A;  4PHM A;  2JWW A;  1LXF C;  4NDC A;  5DKR A;  1QIW A;  4PE1 A;  2PMY A;  5I2O A;  2KFH A;  3OHM B;  1CNP A;  4MLW A;  1SCV A;  1IQ3 A;  3HX4 A;  2KDH A;  1SPY A;  1SKT A;  1ZOT B;  1KFX L;  2Y4Q A;  4OKH A;  2LMV A;  5JOL A;  1YUT A;  1K9U A;  1CM4 A;  4HSZ A;  1YX8 A;  3SIB A;  2HET A;  2GGM A;  3EKJ A;  2NLN A;  3CWG A;  4I5J A;  2H61 C;  2M9G A;  2ZND A;  2OTG B;  1K9K A;  4CPV A;  1QX2 A;  5DKN A;  2A4J A;  1CDN A;  2R2I A;  1EL4 A;  1R6P A;  4MZL A;  3WNX B;  4DIR A;  3D0Y A;  1A03 A;  2JNF A;  1YUS A;  3A8R A;  3CGA A;  4L9M A;  5G08 A;  1AJ4 A;  1KWO C;  2L51 A;  3DVK A;  2BCX A;  1RWY A;  5KSZ A;  4GUK A;  3KEV A;  4A4B A;  1YX7 A;  3PN7 C;  4GBA A;  1SMG A;  1B9A A;  1XK4 A;  3A4U B;  2WOR A;  4PE4 A;  4QJ3 B;  2JC2 A;  2ISD A;  1K93 D;  1SCM B;  2LVK A;  1J7R A;  3DVM A;  1LA3 A;  1V1F A;  2MAZ A;  2LMT A;  1TIZ A;  5AER A;  2JUL A;  2CXJ A;  4CLN A;  1WRZ A;  3FS7 A;  4IL1 A;  4BY4 A;  4YGE B;  1SRA A;  2KAV A;  3BUO B;  5HLV A;  1M63 B;  2EGD A;  3SG6 A;  3LK0 A;  1CMG A;  2NXQ A;  3O2P A;  5HKW A;  1QV1 A;  3D0Y B;  5AXI A;  2K2F A;  1L7Z A;  1N0Y A;  2I2R E;  2KI4 B;  2IS9 A;  1Y1A A;  4YRU A;  2K8M B;  3BQ3 A;  4ORB B;  1DJZ A;  3PSR A;  1DJX A;  1FBV A;  1UHI A;  2KBI A;  2M0R A;  1UHK A;  1BF5 A;  2WC8 A;  2KI4 C;  1REC A;  1ZUZ A;  2TN4 A;  3FWB A;  1A4P A;  1SBJ A;  2D8N A;  5I2L A;  3TS5 C;  1ALW A;  1JFK A;  1NIW A;  5AFP A;  3I5I B;  2F3Z A;  2F33 A;  1XK4 C;  1QLS A;  1QJT A;  1CLM A;  1QVI Y;  1L2O C;  3GK4 X;  2EC6 B;  1LA0 A;  2CBL A;  3BUM B;  1TCF A;  3EK7 A;  3TDU A;  1S36 A;  3WHT B;  2M1U A;  3TDI A;  2HQW A;  1QX7 A;  3GOF A;  3OP0 A;  4OVN F;  1M39 A;  1TTX A;  2Y1N A;  1XFZ O;  2M1K B;  2AMI A;  2CNP A;  2WCF A;  1TNQ A;  2JNX A;  2LC5 A;  4N5X A;  3SG4 A;  5CSN A;  1OMV A;  3AAK A;  3VRR A;  1S6I A;  1XFW O;  1KQV A;  4MBE A;  4JQ0 D;  1R2U A;  3JTD C;  3KO0 A;  1KK8 C;  1J7Q A;  2DOQ A;  2JXL A;  4ZCV A;  2AUC A;  1WLZ A;  1RRO A;  2BE4 A;  2E6W A;  2MHH A;  1E8A A;  1GGZ A;  4Q04 A;  1F55 A;  3I5H C;  3LLE A;  3K21 A;  3EVU A;  1S6C A;  1PK0 D;  1MHO A;  1IJ6 A;  1BJF A;  3CTN A;  1DGU A;  2FJU B;  2LP2 A;  4ICB A;  1Y1X A;  1XA5 A;  2F3Y A;  4FTG A;  1IH0 A;  1QIV A;  5DKQ A;  2JXC A;  4I5L B;  1BR1 B;  4WQ2 A;  2CCM A;  3BUN B;  3VRO A;  2KI6 C;  3C1V A;  2BCA A;  1MR8 A;  1H8B A;  1IG5 A;  4GFT A;  2V53 A;  1SL7 A;  3LCP C;  1QS7 A;  1IQ5 A;  2L2E A;  1K95 A;  2RGI A;  4YGB B;  4XJK A;  3I5G B;  1AHR A;  1B7T Z;  2JT3 A;  1AJ5 A;  1KK7 Y;  2PVB A;  1F8H A;  3SG2 A;  1DJI A;  1SY9 A;  2SAS A;  1BOC A;  2ZNE A;  1NWD A;  1PUL A;  3CR4 X;  1YVH A;  3IF7 A;  1KSM A;  3I5G C;  3NXA A;  5B8I B;  4YI8 A;  1G33 A;  1QX5 B;  2LLU A;  4DCK A;  1AUI B;  4HRG A;  2BBM A;  2LVI A;  1PVB A;  1TNX A;  1CFP A;  1K96 A;  4YI9 A;  1MXL C;  1OMD A;  4DRW A;  2COL B;  2H2K A;  3CLN A;  4XYN A;  1KQM B;  1IJ5 A;  3OX6 A;  3O78 A;  4XJK B;  1XFY O;  2M49 B;  3E3R A;  2BL0 B;  1UUR A;  1GJY A;  1WY9 A;  2QAC A;  4PE0 A;  1LVC D;  1MWN A;  1NPQ A;  3FWC A;  1NX0 A;  2I18 A;  1UHH A;  2FCD A;  2WCB A;  1ZFS A;  1ALV A;  4C0K A;  2BEC A;  1NX2 A;  1Q80 A;  2OTG C;  2WCE A;  1UP5 A;  3KF9 A;  5BPJ A;  1NCY A;  1RFJ A;  1DT7 B;  3VRQ A;  5KTY A;  4PCW A;  4MRY A;  3PM8 A;  1CFD A;  3PLF B;  2M97 A;  1VRK A;  1HQV A;  2O5G A;  1SL8 A;  2M29 A;  3DVE A;  1SCM C;  3TDZ A;  2PAL A;  5KU1 A;  3AKB A;  4OV2 A;  2Y1M A;  4M2Q A;  1DJW A;  4N1F A;  5FYX A;  5AAN A;  1NX3 A;  1AK8 A;  3SG3 A;  2ZRT A;  3PAL A;  2ZKM X;  1WDC B;  4DUQ A;  1BR4 B;  3PAT A;  3NSL A;  2P6B B;  1FI6 A;  1LIN A;  5I8N A;  1S5G Z;  1Y0V H;  4PHJ A;  1SR6 B;  2BE6 A;  1XO5 A;  1C07 A;  2MRD A;  2LHI A;  1LKJ A;  1G4Y R;  4PDZ A;  5I2Q A;  1QLK A;  1OZO A;  1WRL A;  2OS8 B;  1QTX A;  3EK4 A;  3VRP A;  3KHE A;  4U8D A;  2WND A;  1CLL A;  5J3X A;  1WRK A;  1YR5 A;  2I7A A;  2K2A A;  2KFG A;  1F71 A;  4WQ3 A;  3F45 A;  5HLO A;  4JWQ A;  4ORA B;  3WXA A;  4ETO A;  1BG1 A;  1QAS A;  1N65 A;  2F8P A;  3I5I C;  3IQO A;  1PSR A;  4MSP A;  2MA2 A;  4YBH B;  5D69 A;  1X02 A;  3I5F B;  1TOP A;  4NDD A;  1JC2 A;  2LHL A;  2LUX A;  4R1E A;  2EC6 C;  1M45 A;  2LVV A;  3EVR A;  3RLZ A;  1RK9 A;  2PSR A;  2G9B A;  1U5I B;  3M0W A;  4GGF A;  5F6T A;  4GPL B;  2JT0 A;  1DVI A;  1QV0 A;  4CFR A;  1A29 A;  4CID A;  3CR2 A;  1IKU A;  4MVF A;  1B4C A;  1EJ3 A;  4OR9 B;  1F54 A;  4TNC A;  5HKY A;  1S1E A;  3EVV A;  2KAY A;  3O4Y A;  4MN0 A;  4D1E A;  4P5O E;  3WHU B;  1GGW A;  2L0P A;  3SG7 A;  4BY5 A;  1OSA A;  1B47 A;  1PRW A;  2VRG A;  5HKZ A;  1DGV A;  1F4Q A;  1EH2 A;  1TRF A;  2HQ8 A;  1NCZ A;  1XFX O;  2O60 A;  4GNK B;  1DJY A;  1ZAC A;  1S3P A;  4YGD B;  3TUY B;  1J1E A;  1TCO B;  2KBM A;  5JJG A;  5HYD A;  1MF8 B;  3KPX A;  3VGO A;  1JWD A;  2FOT A;  3OB2 B;  4GGF C;  2KQY A;  3VRN A;  2LP3 A;  1WLM A;  2JTT A;  3MSE B;  1YVL A;  2KQ6 A;  1B8L A;  1CDP A;  3HCM A;  3GK1 A;  5ER4 X;  2LMU A;  1QVI Z;  1OMR A;  1UWO A;  3OX5 A;  1UUS A;  4FQO A;  1FI5 A;  1K94 A;  3QRX A;  3BXK A;  1G8I A;  2PAS A;  1XFU O;  3TZ1 A;  4HRE E;  2K0J A;  2K7B A;  4ZCU A;  2G2B A;  2JT8 A;  1JF0 A;  1XFV O;  2JQ6 A;  3ZWH A;  2KOT A;  2LV7 A;  3BOW B;  1EXR A;  1CMF A;  1CDM A;  4NDB A;  1CKK A;  2MLF C;  2ZN9 A;  3NSK A;  1FF1 A;  2QPT A;  1JUO A;  2JPT A;  1QAT A;  1EG4 A;  4GGN A;  3NSO A;  3DVJ A;  1A75 B;  1ZMZ A;  3JVT B;  4C0L A;  1YRT B;  2NCP A;  2KNE A;  1TNP A;  1F70 A;  1V1G A;  1BOD A;  3RM1 A;  2MBX A;  3NSI A;  1S5G Y;  4N1G A;  1GQM A;  1Y6W A;  1FW4 A;  2OPO A;  1B8R A;  1KQM C;  3EKH A;  4MRX A;  3SIA A;  3FIA A;  4AQI A;  1DJG A;  1DJH A;  2BL0 C;  1KSO A;  5PAL A;  1M46 A;  2K7C A;  2LCP A;  5CPV A;  1H4B A;  5TNC A;  1XYD A;  1OZS A;  3GK2 A;  1W7J B;  2KYF A;  2L5X B;  3BUX B;  2M7L A;  3SG5 A;  1OQP A;  1PVA A;  4AOM A;  5GQQ C;  1NCX A;  4I5K A;  1KWO B;  1RTP 1;  1YTZ C;  2M7N A;  3DD4 A;  2LLS A;  5CSJ A;  2L98 A;  1DF0 B;  3PN7 B;  4CFQ A;  1C7W A;  1J55 A;  1QXP A;  4M2P A;  2JTZ A;  1ODB A;  2BKI B;  2K7O A;  3CZT X;  2KYC A;  1J7O A;  1KK7 Z;  1DMO A;  1FPW A;  2ZN8 A;  1W7I B;  3D10 A;  1JSA A;  1OOJ A;  1JF2 A;  1DTL A;  1NX1 A;  1U5I A;  4ORC B;  1CFC A;  1WDC C;  1YUR A;  3OB1 B;  1OE9 B;  4USL A;  1N2D A;  4PHK A;  1SR6 C;  3H4S E;  3CR5 X;  1YRU B;  1BLQ A;  4JPZ B;  1A2X A;  1CTR A;  1Y1U A;  2JOJ A;  4YGA A;  4PAL A;  2F2O A;  5CSI A;  1M31 A;  2L4I A;  2MLE C;  2OS8 C;  1PAL A;  3TS5 B;  2LLT A;  1AVS A;  4UPG A;  2M3W A;  2NZ0 A;  3ZNI A;  1NUB A;  1B8C A;  2BKH B;  2BBN A;  1MXE A;  1CFF A;  1J1D A;  2KSP A;  2LE9 B;  1PSB A;  1L2O B;  2FCE A;  1J7P A;  2JRF A;  1JBA A;  2GGZ A;  2LVJ A;  4NQG A;  2WOS A;  5ER5 A;  1K9P A;  2LAN A;  3I5F C;  4MZK A;  5CSF A;  2LUC A;  1TN4 A;  1K90 D;  2JZI A;  3AAJ A;  3O6B A;  2KI6 D;  1NYA A;  3DF0 A;  4P2Y B;  1B1G A;  1B7T Y;  2LM5 A;  1MUX A;  2Y5I A;  3SJS A;  2MJW B;  2B1U A;  1MQ1 A;  2ZFD A;  3EK8 A;  1CM1 A;  1KCY A;  2KGR A;  5D7F A;  3JTD B;  1KK8 B;  1IGV A;  1NSH A;  1RJV A;  2BCB A;  4GAO A;  1YUU A;  1BU3 A;  4QJ5 B;  2K61 A;  2AAO A;  3BUW B;  2SCP A;  3BOW A;  1BT6 A;  3I5H B;  4AQJ A;  1K2H A;  2CT9 A;  2PRU A;  4DS7 A;  3DF0 B;  2Q4U A;  2KFF A;  2I94 A;  3BYA A;  4M2O A;  4HRH A;  3TUY C;  1UHN A;  1S26 D;  1AP4 A; 
#chains in the Genus database with same CATH topology
 1DEL A;  1CDL A;  1A75 A;  1S6J A;  1C7V A;  1F4O A;  4I5N B;  1KFU S;  1HT9 A;  2E30 A;  2EHB A;  4JD9 A;  2F2P A;  2KHN A;  2LNK A;  4QJ4 B;  1TNW A;  5AEQ A;  2L4H A;  4YGC B;  1SYM A;  3LK1 A;  1SW8 A;  1BMO A;  1KFU L;  2JU0 A;  3AKA A;  1D1O A;  3CDN A;  2P70 A;  2NCO A;  2CTN A;  1K8U A;  3B7A A;  5HL1 A;  1SL9 A;  1XVJ A;  1SK6 D;  2GV5 A;  3S0A A;  2H61 A;  4OZD A;  1CLB A;  3D74 A;  2HPS A;  4MZJ A;  4OCI A;  5IBW A;  2M8U A;  2HF5 A;  1UHJ A;  2K7D A;  4PHN A;  3PFV A;  5K89 A;  5I94 A;  4F0Z B;  4A4C A;  3S0D A;  4E68 A;  1IWQ A;  4C0J A;  1JFJ A;  1IRJ A;  2LAP A;  3LL8 B;  2KAX A;  1DF0 A;  2ZRS A;  2L50 A;  2KGB C;  1SNL A;  3IQQ A;  3CS1 A;  4MEW A;  4INX A;  4PE7 A;  1CB1 A;  3JVT C;  3ICB A;  1NP8 A;  4WRI A;  1KFX S;  1EG3 A;  2Q91 A;  4PHM A;  2JWW A;  1LXF C;  4NDC A;  5DKR A;  1QIW A;  5FI6 A;  1Z2C B;  4PE1 A;  2PMY A;  5I2O A;  2KFH A;  3OHM B;  4PT1 A;  1CNP A;  4MLW A;  1SCV A;  1IQ3 A;  3HX4 A;  2KDH A;  1SPY A;  1SKT A;  1ZOT B;  1KFX L;  2QEB A;  2Y4Q A;  2LMV A;  4OKH A;  1YUT A;  1K9U A;  1CM4 A;  2QEV A;  3L4L A;  1YX8 A;  4HSZ A;  3SIB A;  2HET A;  3Q8I A;  2GGM A;  3EKJ A;  2NLN A;  3CWG A;  4I5J A;  2H61 C;  2M9G A;  2ZND A;  2OTG B;  1K9K A;  4CPV A;  5I2Q A;  1QX2 A;  5DKN A;  2A4J A;  3D77 A;  1CDN A;  2R2I A;  1EL4 A;  1R6P A;  4MZL A;  3WNX B;  4DIR A;  3D0Y A;  1A03 A;  4IJ7 A;  2JNF A;  1YUS A;  3A8R A;  3CGA A;  4L9M A;  1XFR A;  5G08 A;  1AJ4 A;  1KWO C;  2L51 A;  3B6X A;  1RWY A;  2BCX A;  3DVK A;  1OOG A;  5KSZ A;  4GUK A;  3KEV A;  4A4B A;  1YX7 A;  1OOF A;  3PN7 C;  4GBA A;  1SMG A;  1B9A A;  1XK4 A;  3A4U B;  2WOR A;  4PE4 A;  3CYZ A;  2JC2 A;  2JPO A;  4QJ3 B;  3N7H A;  1K93 D;  1SCM B;  2LVK A;  1J7R A;  3DVM A;  1LA3 A;  1V1F A;  2MAZ A;  2LMT A;  1TIZ A;  5AER A;  2JUL A;  2CXJ A;  4CLN A;  1WRZ A;  3FS7 A;  4IL1 A;  4BY4 A;  4YGE B;  1SRA A;  2KAV A;  3BUO B;  5HLV A;  1M63 B;  2EGD A;  3SG6 A;  3LK0 A;  3V2L A;  1CMG A;  2NXQ A;  3O2P A;  5HKW A;  1QV1 A;  3D0Y B;  5AXI A;  2K2F A;  1L7Z A;  1N0Y A;  2I2R E;  2KI4 B;  2IS9 A;  1Y1A A;  2K60 A;  4YRU A;  3NHI A;  2K8M B;  3BQ3 A;  4ORB B;  1DJZ A;  3R1O A;  3PSR A;  1DJX A;  1FBV A;  1UHI A;  2KBI A;  2M0R A;  1UHK A;  1BF5 A;  2WC8 A;  2KI4 C;  1REC A;  2QDI A;  1ZUZ A;  1OOI X;  2TN4 A;  3FWB A;  1A4P A;  1SBJ A;  2D8N A;  5EL2 A;  5I2L A;  3TS5 C;  1ALW A;  1JFK A;  1NIW A;  5AFP A;  3I5I B;  2F3Z A;  2F33 A;  1XK4 C;  1QLS A;  1QJT A;  1CLM A;  1QVI Y;  2L2C A;  1L2O C;  3GK4 X;  2EC6 B;  1W9Z A;  1LA0 A;  2CBL A;  3BUM B;  1TCF A;  3EK7 A;  3TDU A;  1S36 A;  3WHT B;  2M1U A;  3TDI A;  2HQW A;  1QX7 A;  3GOF A;  3OP0 A;  4OVN F;  1M39 A;  1P28 A;  1TTX A;  2Y1N A;  3L4A A;  1XFZ O;  2M1K B;  2AMI A;  2CNP A;  2WCF A;  1TNQ A;  2JNX A;  2LC5 A;  4N5X A;  3SG4 A;  5CSN A;  1OMV A;  3AAK A;  3VRR A;  1OW4 A;  1S6I A;  1XFW O;  3B86 A;  1KQV A;  4MBE A;  2WCH A;  4JQ0 D;  2WCJ A;  1R2U A;  3JTD C;  3KO0 A;  1KK8 C;  1J7Q A;  2DOQ A;  2JXL A;  4ZCV A;  3OGN A;  2AUC A;  1WLZ A;  1TUZ A;  1C3Y A;  1RRO A;  2BE4 A;  2E6W A;  2MHH A;  1E8A A;  1GGZ A;  2PQL A;  4Q04 A;  1F55 A;  3I5H C;  3LLE A;  3K21 A;  3EVU A;  1S6C A;  1PK0 D;  1MHO A;  1IJ6 A;  1BJF A;  3CTN A;  1DGU A;  2FJU B;  2LP2 A;  4ICB A;  1Y1X A;  5JOL A;  1XA5 A;  2F3Y A;  4FTG A;  2WCM A;  1IH0 A;  1QIV A;  5DKQ A;  2JXC A;  4I5L B;  1BR1 B;  4WQ2 A;  2CCM A;  3BUN B;  3VRO A;  3BFA A;  2KI6 C;  3C1V A;  2BCA A;  4KYN A;  1DQE A;  1MR8 A;  1IG5 A;  3S0B A;  1H8B A;  4GFT A;  2V53 A;  1SL7 A;  3QME A;  3LCP C;  1QS7 A;  1IQ5 A;  2L2E A;  1K95 A;  2RGI A;  3CAB A;  4YGB B;  2KLD A;  4XJK A;  3I5G B;  1AHR A;  1B7T Z;  2H8V A;  2JT3 A;  1AJ5 A;  1KK7 Y;  2PVB A;  1F8H A;  3SG2 A;  1DJI A;  1SY9 A;  2SAS A;  1BOC A;  2ZNE A;  1NWD A;  1PUL A;  3CR4 X;  1YVH A;  3IF7 A;  1KSM A;  3I5G C;  3NXA A;  5B8I B;  2FJY A;  4YI8 A;  1G33 A;  1QX5 B;  2LLU A;  3DY9 A;  4DCK A;  1AUI B;  4HRG A;  3NHT A;  2BBM A;  2LVI A;  1PVB A;  1TNX A;  1CFP A;  1K96 A;  4YI9 A;  1MXL C;  1OMD A;  4DRW A;  2COL B;  2H2K A;  1ORG A;  3B87 A;  1KQM B;  3CLN A;  4XYN A;  3FE6 A;  3UO9 A;  1IJ5 A;  3OX6 A;  3O78 A;  4XJK B;  1XFY O;  2M49 B;  3E3R A;  2BL0 B;  1UUR A;  1GJY A;  1WY9 A;  2QAC A;  4PE0 A;  1LVC D;  1MWN A;  1NPQ A;  3R1P A;  3FWC A;  1NX0 A;  5DIC A;  2I18 A;  1UHH A;  2QEH A;  2FCD A;  2WCB A;  1ZFS A;  1ALV A;  4C0K A;  2BEC A;  1NX2 A;  1Q80 A;  2ERB A;  2OTG C;  2WCE A;  3B88 A;  1UP5 A;  3KF9 A;  1TUJ A;  1DC1 A;  3NGV A;  4F7F A;  1NCY A;  5BPJ A;  3R1V A;  1RFJ A;  1DT7 B;  3VRQ A;  5KTY A;  4PCW A;  4MRY A;  3PM8 A;  1CFD A;  2ISD A;  3PLF B;  2M97 A;  1VRK A;  2YGU A;  1HQV A;  2O5G A;  1SL8 A;  2M29 A;  3DVE A;  1SCM C;  3TDZ A;  2PAL A;  3BJH A;  5KU1 A;  3AKB A;  4OV2 A;  2Y1M A;  4M2Q A;  1DJW A;  4N1F A;  5FYX A;  5AAN A;  1NX3 A;  1AK8 A;  2GTE A;  3SG3 A;  2ZRT A;  3PAL A;  2ZKM X;  1WDC B;  3SS5 A;  3S0F A;  4DUQ A;  3BFH A;  1BR4 B;  3PAT A;  3NSL A;  2P6B B;  1FI6 A;  1LIN A;  5I8N A;  1S5G Z;  1Y0V H;  4PHJ A;  1SR6 B;  2BE6 A;  1XO5 A;  1C07 A;  2MRD A;  2LHI A;  1LKJ A;  1G4Y R;  4PDZ A;  3CZ0 A;  1QLK A;  1OZO A;  1WRL A;  2OS8 B;  1QTX A;  3D76 A;  3EK4 A;  3VRP A;  3KHE A;  4U8D A;  2WND A;  1CLL A;  3DZT A;  5J3X A;  1WRK A;  1YR5 A;  2I7A A;  2K2A A;  2KFG A;  3RZS A;  1F71 A;  4WQ3 A;  3F45 A;  3D73 A;  5HLO A;  4JWQ A;  4ORA B;  3CZ2 A;  3WXA A;  4ETO A;  3D75 A;  1BG1 A;  1QAS A;  1N65 A;  2F8P A;  3I5I C;  3IQO A;  1PSR A;  4MSP A;  2MA2 A;  4YBH B;  5D69 A;  1X02 A;  3I5F B;  1TOP A;  4NDD A;  1JC2 A;  2LHL A;  2LUX A;  4R1E A;  2EC6 C;  1M45 A;  2LVV A;  3EVR A;  3RLZ A;  1RK9 A;  2PSR A;  2G9B A;  1U5I B;  3M0W A;  4GGF A;  5F6T A;  4GPL B;  2JT0 A;  1DVI A;  1QV0 A;  4CFR A;  1A29 A;  4CID A;  3K1E A;  3CR2 A;  1IKU A;  4MVF A;  1B4C A;  1EJ3 A;  4OR9 B;  3PM2 A;  4TNC A;  1F54 A;  5HKY A;  1S1E A;  3EVV A;  2KAY A;  3O4Y A;  4MN0 A;  4D1E A;  2QEO A;  4P5O E;  3WHU B;  1GGW A;  2L0P A;  3VB1 A;  3SG7 A;  4BY5 A;  1OSA A;  1B47 A;  1PRW A;  2VRG A;  3SS4 A;  5HKZ A;  1DGV A;  1F4Q A;  1EH2 A;  1TRF A;  2HQ8 A;  1NCZ A;  1XFX O;  2O60 A;  2WCL A;  1DJY A;  1ZAC A;  1S3P A;  4GNK B;  4YGD B;  3TUY B;  3EG5 B;  1J1E A;  1TCO B;  2KBM A;  5JJG A;  5HYD A;  1MF8 B;  3KPX A;  1TWO A;  1LS8 A;  3VGO A;  1QWV A;  1JWD A;  2FOT A;  3OB2 B;  4GGF C;  2KQY A;  3VRN A;  1SSE B;  2L5Y A;  2KLE A;  2LP3 A;  1WLM A;  2JTT A;  3MSE B;  1YVL A;  2KQ6 A;  1B8L A;  1CDP A;  3HCM A;  2P71 A;  3GK1 A;  5ER4 X;  2LMU A;  1QVI Z;  1OMR A;  1UWO A;  1T14 A;  3OX5 A;  1UUS A;  4FQO A;  1FI5 A;  1C3Z A;  1K94 A;  3QRX A;  3BXK A;  1G8I A;  2PAS A;  1XFU O;  3TZ1 A;  4HRE E;  2K0J A;  2K7B A;  4ZCU A;  2G2B A;  2JT8 A;  1JF0 A;  1XFV O;  2JQ6 A;  3ZWH A;  2KOT A;  2LV7 A;  3BOW B;  1EXR A;  4JKT A;  1CMF A;  1CDM A;  4NDB A;  1CKK A;  2MLF C;  2WCK A;  2ZN9 A;  3NSK A;  1FF1 A;  2QPT A;  1JUO A;  2JPT A;  1QAT A;  1EG4 A;  4GGN A;  3NSO A;  3DVJ A;  1Z4H A;  1IIO A;  1A75 B;  1ZMZ A;  3JVT B;  4C0L A;  1YRT B;  3CZ1 A;  2NCP A;  2KNE A;  1TNP A;  1F70 A;  1V1G A;  1BOD A;  3RM1 A;  2MBX A;  3NSI A;  1S5G Y;  2BNX A;  4N1G A;  1GQM A;  1Y6W A;  1FW4 A;  2OPO A;  1B8R A;  1KQM C;  3EKH A;  4MRX A;  3SIA A;  3FIA A;  4AQI A;  1DJG A;  1DJH A;  3IVT A;  2BL0 C;  1KSO A;  5PAL A;  1M46 A;  2K7C A;  2LCP A;  5CPV A;  1H4B A;  5TNC A;  1XYD A;  1OZS A;  3GK2 A;  1W7J B;  2KYF A;  2L5X B;  3BUX B;  2WC6 A;  3DXL A;  2M7L A;  3SG5 A;  1OQP A;  1PVA A;  3D78 A;  4AOM A;  5GQQ C;  3FE8 A;  1NCX A;  3O4X A;  4I5K A;  1KWO B;  1RTP 1;  1YTZ C;  2M7N A;  3DD4 A;  2LLS A;  5CSJ A;  2L98 A;  1DF0 B;  3PN7 B;  4CFQ A;  1C7W A;  1J55 A;  1QXP A;  4M2P A;  4FQT A;  2JTZ A;  3S0G A;  2WC5 A;  1ODB A;  2BKI B;  2K7O A;  3CZT X;  2KYC A;  1J7O A;  1KK7 Z;  3PJI A;  1DMO A;  1FPW A;  2ZN8 A;  1W7I B;  3D10 A;  1JSA A;  1OOJ A;  1JF2 A;  1DTL A;  1NX1 A;  1U5I A;  5FI7 A;  4ORC B;  1CFC A;  1WDC C;  1YUR A;  3OB1 B;  1OE9 B;  3R72 A;  4USL A;  1N2D A;  4PHK A;  1SR6 C;  3H4S E;  3CR5 X;  1YRU B;  1BLQ A;  4JPZ B;  1A2X A;  1CTR A;  1Y1U A;  2JOJ A;  4YGA A;  4PAL A;  2F2O A;  4INW A;  5CSI A;  1M31 A;  1OOH A;  2L4I A;  2MLE C;  2OS8 C;  1PAL A;  3TS5 B;  2LLT A;  1DEK A;  1AVS A;  4UPG A;  2M3W A;  2NZ0 A;  3OBV A;  1NUB A;  3SS3 A;  1B8C A;  2BKH B;  3ZNI A;  2BBN A;  1MXE A;  1CFF A;  1J1D A;  2KSP A;  2LE9 B;  1PSB A;  1L2O B;  2KPH A;  2FCE A;  1J7P A;  2JRF A;  1JBA A;  3FE9 A;  2GGZ A;  2LVJ A;  4NQG A;  2WOS A;  5ER5 A;  1K9P A;  2LAN A;  3BFB A;  3I5F C;  4MZK A;  5CSF A;  2LUC A;  1TN4 A;  3S0E A;  1K90 D;  2JZI A;  3AAJ A;  3O6B A;  2KI6 D;  1NYA A;  3DF0 A;  4P2Y B;  1B1G A;  1B7T Y;  2LM5 A;  1GM0 A;  1MUX A;  2Y5I A;  3SJS A;  2MJW B;  2B1U A;  1MQ1 A;  2ZFD A;  3EK8 A;  1CM1 A;  1KCY A;  2KGR A;  5D7F A;  3JTD B;  1KK8 B;  3L47 A;  1IGV A;  1NSH A;  1RJV A;  2BCB A;  4GAO A;  1YUU A;  1BU3 A;  4QJ5 B;  2K61 A;  2AAO A;  3BUW B;  5D3O A;  2SCP A;  3BOW A;  1BT6 A;  3I5H B;  4AQJ A;  3DYE A;  1K2H A;  2CT9 A;  2BAP A;  2PRU A;  4DS7 A;  3DF0 B;  5FI2 A;  2PYQ A;  2KFF A;  2I94 A;  2Q4U A;  3BYA A;  4HRH A;  4M2O A;  3TUY C;  1UHN A;  1S26 D;  3UNW A;  1AP4 A; 
#chains in the Genus database with same CATH homology
 1CDL A;  1A75 A;  1S6J A;  1C7V A;  1F4O A;  4I5N B;  1KFU S;  1HT9 A;  2E30 A;  2EHB A;  2F2P A;  2KHN A;  2LNK A;  4QJ4 B;  1TNW A;  5AEQ A;  2L4H A;  4YGC B;  1SYM A;  3LK1 A;  1SW8 A;  1BMO A;  1KFU L;  2JU0 A;  3AKA A;  1D1O A;  2NCO A;  2CTN A;  1K8U A;  1SL9 A;  1XVJ A;  1SK6 D;  2GV5 A;  2H61 A;  1CLB A;  2HPS A;  4MZJ A;  4OCI A;  5IBW A;  2M8U A;  2HF5 A;  1UHJ A;  2K7D A;  4PHN A;  3PFV A;  5K89 A;  4F0Z B;  4A4C A;  4E68 A;  1IWQ A;  4C0J A;  1JFJ A;  1IRJ A;  2LAP A;  3LL8 B;  2KAX A;  1DF0 A;  2ZRS A;  2L50 A;  2KGB C;  1SNL A;  3IQQ A;  3CS1 A;  4MEW A;  4PE7 A;  1CB1 A;  3JVT C;  3ICB A;  1NP8 A;  4WRI A;  1KFX S;  1EG3 A;  2Q91 A;  4PHM A;  2JWW A;  1LXF C;  4NDC A;  5DKR A;  1QIW A;  4PE1 A;  2PMY A;  5I2O A;  2KFH A;  3OHM B;  1CNP A;  4MLW A;  1SCV A;  1IQ3 A;  3HX4 A;  2KDH A;  1SPY A;  1SKT A;  1ZOT B;  1KFX L;  2Y4Q A;  4OKH A;  2LMV A;  5JOL A;  1YUT A;  1K9U A;  1CM4 A;  4HSZ A;  1YX8 A;  3SIB A;  2HET A;  2GGM A;  3EKJ A;  2NLN A;  3CWG A;  4I5J A;  2H61 C;  2M9G A;  2ZND A;  2OTG B;  1K9K A;  4CPV A;  1QX2 A;  5DKN A;  2A4J A;  1CDN A;  2R2I A;  1EL4 A;  1R6P A;  4MZL A;  3WNX B;  4DIR A;  3D0Y A;  1A03 A;  2JNF A;  1YUS A;  3A8R A;  3CGA A;  4L9M A;  5G08 A;  1AJ4 A;  1KWO C;  2L51 A;  3DVK A;  2BCX A;  1RWY A;  5KSZ A;  4GUK A;  3KEV A;  4A4B A;  1YX7 A;  3PN7 C;  4GBA A;  1SMG A;  1B9A A;  1XK4 A;  3A4U B;  2WOR A;  4PE4 A;  4QJ3 B;  2JC2 A;  2ISD A;  1K93 D;  1SCM B;  2LVK A;  1J7R A;  3DVM A;  1LA3 A;  1V1F A;  2MAZ A;  2LMT A;  1TIZ A;  5AER A;  2JUL A;  2CXJ A;  4CLN A;  1WRZ A;  3FS7 A;  4IL1 A;  4BY4 A;  4YGE B;  1SRA A;  2KAV A;  3BUO B;  5HLV A;  1M63 B;  2EGD A;  3SG6 A;  3LK0 A;  1CMG A;  2NXQ A;  3O2P A;  5HKW A;  1QV1 A;  3D0Y B;  5AXI A;  2K2F A;  1L7Z A;  1N0Y A;  2I2R E;  2KI4 B;  2IS9 A;  1Y1A A;  4YRU A;  2K8M B;  3BQ3 A;  4ORB B;  1DJZ A;  3PSR A;  1DJX A;  1FBV A;  1UHI A;  2KBI A;  2M0R A;  1UHK A;  1BF5 A;  2WC8 A;  2KI4 C;  1REC A;  1ZUZ A;  2TN4 A;  3FWB A;  1A4P A;  1SBJ A;  2D8N A;  5I2L A;  3TS5 C;  1ALW A;  1JFK A;  1NIW A;  5AFP A;  3I5I B;  2F3Z A;  2F33 A;  1XK4 C;  1QLS A;  1QJT A;  1CLM A;  1QVI Y;  1L2O C;  3GK4 X;  2EC6 B;  1LA0 A;  2CBL A;  3BUM B;  1TCF A;  3EK7 A;  3TDU A;  1S36 A;  3WHT B;  2M1U A;  3TDI A;  2HQW A;  1QX7 A;  3GOF A;  3OP0 A;  4OVN F;  1M39 A;  1TTX A;  2Y1N A;  1XFZ O;  2M1K B;  2AMI A;  2CNP A;  2WCF A;  1TNQ A;  2JNX A;  2LC5 A;  4N5X A;  3SG4 A;  5CSN A;  1OMV A;  3AAK A;  3VRR A;  1S6I A;  1XFW O;  1KQV A;  4MBE A;  4JQ0 D;  1R2U A;  3JTD C;  3KO0 A;  1KK8 C;  1J7Q A;  2DOQ A;  2JXL A;  4ZCV A;  2AUC A;  1WLZ A;  1RRO A;  2BE4 A;  2E6W A;  2MHH A;  1E8A A;  1GGZ A;  4Q04 A;  1F55 A;  3I5H C;  3LLE A;  3K21 A;  3EVU A;  1S6C A;  1PK0 D;  1MHO A;  1IJ6 A;  1BJF A;  3CTN A;  1DGU A;  2FJU B;  2LP2 A;  4ICB A;  1Y1X A;  1XA5 A;  2F3Y A;  4FTG A;  1IH0 A;  1QIV A;  5DKQ A;  2JXC A;  4I5L B;  1BR1 B;  4WQ2 A;  2CCM A;  3BUN B;  3VRO A;  2KI6 C;  3C1V A;  2BCA A;  1MR8 A;  1H8B A;  1IG5 A;  4GFT A;  2V53 A;  1SL7 A;  3LCP C;  1QS7 A;  1IQ5 A;  2L2E A;  1K95 A;  2RGI A;  4YGB B;  4XJK A;  3I5G B;  1AHR A;  1B7T Z;  2JT3 A;  1AJ5 A;  1KK7 Y;  2PVB A;  1F8H A;  3SG2 A;  1DJI A;  1SY9 A;  2SAS A;  1BOC A;  2ZNE A;  1NWD A;  1PUL A;  3CR4 X;  1YVH A;  3IF7 A;  1KSM A;  3I5G C;  3NXA A;  5B8I B;  4YI8 A;  1G33 A;  1QX5 B;  2LLU A;  4DCK A;  1AUI B;  4HRG A;  2BBM A;  2LVI A;  1PVB A;  1TNX A;  1CFP A;  1K96 A;  4YI9 A;  1MXL C;  1OMD A;  4DRW A;  2COL B;  2H2K A;  3CLN A;  4XYN A;  1KQM B;  1IJ5 A;  3OX6 A;  3O78 A;  4XJK B;  1XFY O;  2M49 B;  3E3R A;  2BL0 B;  1UUR A;  1GJY A;  1WY9 A;  2QAC A;  4PE0 A;  1LVC D;  1MWN A;  1NPQ A;  3FWC A;  1NX0 A;  2I18 A;  1UHH A;  2FCD A;  2WCB A;  1ZFS A;  1ALV A;  4C0K A;  2BEC A;  1NX2 A;  1Q80 A;  2OTG C;  2WCE A;  1UP5 A;  3KF9 A;  5BPJ A;  1NCY A;  1RFJ A;  1DT7 B;  3VRQ A;  5KTY A;  4PCW A;  4MRY A;  3PM8 A;  1CFD A;  3PLF B;  2M97 A;  1VRK A;  1HQV A;  2O5G A;  1SL8 A;  2M29 A;  3DVE A;  1SCM C;  3TDZ A;  2PAL A;  5KU1 A;  3AKB A;  4OV2 A;  2Y1M A;  4M2Q A;  1DJW A;  4N1F A;  5FYX A;  5AAN A;  1NX3 A;  1AK8 A;  3SG3 A;  2ZRT A;  3PAL A;  2ZKM X;  1WDC B;  4DUQ A;  1BR4 B;  3PAT A;  3NSL A;  2P6B B;  1FI6 A;  1LIN A;  5I8N A;  1S5G Z;  1Y0V H;  4PHJ A;  1SR6 B;  2BE6 A;  1XO5 A;  1C07 A;  2MRD A;  2LHI A;  1LKJ A;  1G4Y R;  4PDZ A;  5I2Q A;  1QLK A;  1OZO A;  1WRL A;  2OS8 B;  1QTX A;  3EK4 A;  3VRP A;  3KHE A;  4U8D A;  2WND A;  1CLL A;  5J3X A;  1WRK A;  1YR5 A;  2I7A A;  2K2A A;  2KFG A;  1F71 A;  4WQ3 A;  3F45 A;  5HLO A;  4JWQ A;  4ORA B;  3WXA A;  4ETO A;  1BG1 A;  1QAS A;  1N65 A;  2F8P A;  3I5I C;  3IQO A;  1PSR A;  4MSP A;  2MA2 A;  4YBH B;  5D69 A;  1X02 A;  3I5F B;  1TOP A;  4NDD A;  1JC2 A;  2LHL A;  2LUX A;  4R1E A;  2EC6 C;  1M45 A;  2LVV A;  3EVR A;  3RLZ A;  1RK9 A;  2PSR A;  2G9B A;  1U5I B;  3M0W A;  4GGF A;  5F6T A;  4GPL B;  2JT0 A;  1DVI A;  1QV0 A;  4CFR A;  1A29 A;  4CID A;  3CR2 A;  1IKU A;  4MVF A;  1B4C A;  1EJ3 A;  4OR9 B;  1F54 A;  4TNC A;  5HKY A;  1S1E A;  3EVV A;  2KAY A;  3O4Y A;  4MN0 A;  4D1E A;  4P5O E;  3WHU B;  1GGW A;  2L0P A;  3SG7 A;  4BY5 A;  1OSA A;  1B47 A;  1PRW A;  2VRG A;  5HKZ A;  1DGV A;  1F4Q A;  1EH2 A;  1TRF A;  2HQ8 A;  1NCZ A;  1XFX O;  2O60 A;  4GNK B;  1DJY A;  1ZAC A;  1S3P A;  4YGD B;  3TUY B;  1J1E A;  1TCO B;  2KBM A;  5JJG A;  5HYD A;  1MF8 B;  3KPX A;  3VGO A;  1JWD A;  2FOT A;  3OB2 B;  4GGF C;  2KQY A;  3VRN A;  2LP3 A;  1WLM A;  2JTT A;  3MSE B;  1YVL A;  2KQ6 A;  1B8L A;  1CDP A;  3HCM A;  3GK1 A;  5ER4 X;  2LMU A;  1QVI Z;  1OMR A;  1UWO A;  3OX5 A;  1UUS A;  4FQO A;  1FI5 A;  1K94 A;  3QRX A;  3BXK A;  1G8I A;  2PAS A;  1XFU O;  3TZ1 A;  4HRE E;  2K0J A;  2K7B A;  4ZCU A;  2G2B A;  2JT8 A;  1JF0 A;  1XFV O;  2JQ6 A;  3ZWH A;  2KOT A;  2LV7 A;  3BOW B;  1EXR A;  1CMF A;  1CDM A;  4NDB A;  1CKK A;  2MLF C;  2ZN9 A;  3NSK A;  1FF1 A;  2QPT A;  1JUO A;  2JPT A;  1QAT A;  1EG4 A;  4GGN A;  3NSO A;  3DVJ A;  1A75 B;  1ZMZ A;  3JVT B;  4C0L A;  1YRT B;  2NCP A;  2KNE A;  1TNP A;  1F70 A;  1V1G A;  1BOD A;  3RM1 A;  2MBX A;  3NSI A;  1S5G Y;  4N1G A;  1GQM A;  1Y6W A;  1FW4 A;  2OPO A;  1B8R A;  1KQM C;  3EKH A;  4MRX A;  3SIA A;  3FIA A;  4AQI A;  1DJG A;  1DJH A;  2BL0 C;  1KSO A;  5PAL A;  1M46 A;  2K7C A;  2LCP A;  5CPV A;  1H4B A;  5TNC A;  1XYD A;  1OZS A;  3GK2 A;  1W7J B;  2KYF A;  2L5X B;  3BUX B;  2M7L A;  3SG5 A;  1OQP A;  1PVA A;  4AOM A;  5GQQ C;  1NCX A;  4I5K A;  1KWO B;  1RTP 1;  1YTZ C;  2M7N A;  3DD4 A;  2LLS A;  5CSJ A;  2L98 A;  1DF0 B;  3PN7 B;  4CFQ A;  1C7W A;  1J55 A;  1QXP A;  4M2P A;  2JTZ A;  1ODB A;  2BKI B;  2K7O A;  3CZT X;  2KYC A;  1J7O A;  1KK7 Z;  1DMO A;  1FPW A;  2ZN8 A;  1W7I B;  3D10 A;  1JSA A;  1OOJ A;  1JF2 A;  1DTL A;  1NX1 A;  1U5I A;  4ORC B;  1CFC A;  1WDC C;  1YUR A;  3OB1 B;  1OE9 B;  4USL A;  1N2D A;  4PHK A;  1SR6 C;  3H4S E;  3CR5 X;  1YRU B;  1BLQ A;  4JPZ B;  1A2X A;  1CTR A;  1Y1U A;  2JOJ A;  4YGA A;  4PAL A;  2F2O A;  5CSI A;  1M31 A;  2L4I A;  2MLE C;  2OS8 C;  1PAL A;  3TS5 B;  2LLT A;  1AVS A;  4UPG A;  2M3W A;  2NZ0 A;  3ZNI A;  1NUB A;  1B8C A;  2BKH B;  2BBN A;  1MXE A;  1CFF A;  1J1D A;  2KSP A;  2LE9 B;  1PSB A;  1L2O B;  2FCE A;  1J7P A;  2JRF A;  1JBA A;  2GGZ A;  2LVJ A;  4NQG A;  2WOS A;  5ER5 A;  1K9P A;  2LAN A;  3I5F C;  4MZK A;  5CSF A;  2LUC A;  1TN4 A;  1K90 D;  2JZI A;  3AAJ A;  3O6B A;  2KI6 D;  1NYA A;  3DF0 A;  4P2Y B;  1B1G A;  1B7T Y;  2LM5 A;  1MUX A;  2Y5I A;  3SJS A;  2MJW B;  2B1U A;  1MQ1 A;  2ZFD A;  3EK8 A;  1CM1 A;  1KCY A;  2KGR A;  5D7F A;  3JTD B;  1KK8 B;  1IGV A;  1NSH A;  1RJV A;  2BCB A;  4GAO A;  1YUU A;  1BU3 A;  4QJ5 B;  2K61 A;  2AAO A;  3BUW B;  2SCP A;  3BOW A;  1BT6 A;  3I5H B;  4AQJ A;  1K2H A;  2CT9 A;  2PRU A;  4DS7 A;  3DF0 B;  2Q4U A;  2KFF A;  2I94 A;  3BYA A;  4M2O A;  4HRH A;  3TUY C;  1UHN A;  1S26 D;  1AP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...