4YI8A

Crystal structure of non-myristoylated e153a recoverin at 1.2 a resolution with calcium ions bound to ef-hands 2 and 3
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAAKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title Crystal Structure of Recoverin with Calcium Ions Bound to Both Functional EF Hands.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium binding protein
total genus 71
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2015-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yi8A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yi8A01
2JULA 1OMDA 1J7QA 4YGAA 1EJ3A 1J55A 3EVUA 1OZOA 1K8UA 1NX0A 2LM5A 1XVJA 3HX4A 1JC2A 3KO0A 1LA0A 1RK9A 1BOCA 2PSRA 1YVHA 3D10A 1WRLA 2KSPA 1AJ5A 3KHEA 1KCYA 1NIWA 2RGIA 1IG5A 1X02A 1CNPA 3DF0B 1EG4A 2G9BA 1W7IB 5HKZA 2KYCA 4HSZA 1DT7B 4MZLA 1F54A 1Y0VH 2JT3A 1JF0A 2BKIB 4MLWA 1DF0A 1SRAA 5GQQC 2ZKMX 4ZCVA 3TS5C 1A03A 3IF7A 4YBHB 4M2QA 1U5IA 2KAVA 1A75A 4ETOA 5K89A 1QJTA 4ICBA 2O60A 5AXIA 4FTGA 1K90D 3TDZA 2MBXA 1G33A 3BUOB 4DUQA 2VRGA 1K95A 1MF8B 3PSRA 1TCFA 2LHLA 4CFRA 3LLEA 1JBAA 1QASA 1CM4A 3CWGA 1PVAA 1CFCA 1CDLA 2ZRTA 3GK2A 2CBLA 3O2PA 3KEVA 4PE0A 3VRRA 1J7OA 1QTXA 1PSRA 1CTRA 3O6BA 1UHHA 2LMVA 3O4YA 2L5XB 2AMIA 3I5HC 2LP3A 2WNDA 2EC6B 4MVFA 3TDUA 1S36A 1WLZA 1SL8A 1LXFC 3GK1A 1A29A 4CIDA 3FWCA 1BJFA 2V53A 3M0WA 2KQYA 1YR5A 1DMOA 2B1UA 2OS8C 5B8IB 1BR4B 2COLB 2JQ6A 1NPQA 3FIAA 2LLTA 2FCDA 1L2OC 2JC2A 1YRUB 2M7LA 2BKHB 2KI4B 2JWWA 4JQ0D 1DTLA 1IH0A 1DJGA 1CFDA 1BLQA 3PN7C 3I5IC 2Y5IA 2MRDA 2I7AA 2GGZA 2L4HA 4WQ2A 5HKYA 1BF5A 3LK0A 1XFVO 3F45A 1GGZA 1J1DA 2SCPA 1NYAA 2LNKA 1XO5A 2LC5A 2CTNA 3TZ1A 3I5GC 3DVJA 4MRXA 1ZACA 1V1FA 2CT9A 1F4QA 1PULA 2OPOA 3DVEA 3KF9A 3TUYC 1E8AA 4M2OA 2LLSA 2MJWB 1OMRA 1UHNA 5PALA 1S26D 1QV1A 4CFQA 1IJ6A 1TCOB 4N1GA 1KQVA 3CGAA 1RROA 2KHNA 1MWNA 2ZFDA 1QXPA 1UHJA 1J1EA 1RJVA 1FBVA 1KWOC 2F8PA 2LMTA 4YGBB 1N0YA 5AEQA 4BY4A 1L7ZA 4CPVA 1YRTB 2LUCA 1BODA 1UURA 2IS9A 3VRQA 1JFKA 1S1EA 3ZNIA 1DGUA 3DD4A 4GAOA 5CSIA 1XA5A 2ZN9A 4GGFA 4N1FA 1NCZA 1CLBA 1ZMZA 4XJKB 3TS5B 1MQ1A 3PLFB 2K61A 1BU3A 1SY9A 1IWQA 5AERA 2BECA 2BBNA 1CDPA 1AHRA 2BL0C 3CR5X 1YUSA 2AAOA 5DKQA 1IJ5A 1WLMA 5HYDA 2F2PA 2KYFA 1NX2A 1M45A 3WXAA 3VROA 2NLNA 2M49B 1TTXA 4MN0A 2LVVA 1QLSA 3CS1A 3GOFA 1SMGA 5ER5A 2F3ZA 4HREE 4MEWA 4OVNF 4ORBB 2JT0A 2PASA 1XFYO 3JTDB 1S3PA 2L51A 4PHMA 4FQOA 2PMYA 4I5JA 1CKKA 3I5HB 3PM8A 3AKBA 2KQ6A 2JTTA 1CMGA 2I2RE 1B8CA 1KK7Z 1WRKA 3DF0A 2QACA 4I5KA 4I5NB 2K7DA 5TNCA 2EHBA 2ZNEA 2NXQA 1BMOA 5DKRA 1OMVA 4GGFC 4OCIA 1SL7A 2E6WA 1NCYA 1DF0B 2OS8B 4PHNA 1KK7Y 4MZJA 3EK4A 2BBMA 2KI6C 1TIZA 1XK4C 2K8MB 5BPJA 5I2QA 3CR2A 1L2OB 3EK8A 4NQGA 4QJ5B 1R2UA 3VGOA 1D1OA 2NCPA 1LKJA 4I5LB 1CB1A 1NX3A 2WCFA 2LE9B 2F3YA 3I5IB 1DJYA 3PN7B 2KI6D 2L2EA 1SR6C 1ZFSA 2JXLA 2ZRSA 1SPYA 1XFWO 4P2YB 4BY5A 1XFZO 3BQ3A 1FPWA 2LV7A 3NSOA 2JPTA 1BG1A 2M3WA 3CLNA 2NCOA 1F4OA 1HT9A 1KFXL 2JOJA 1KSMA 2PALA 5HLOA 4DS7A 3I5GB 1XFUO 2Q4UA 1OE9B 4PDZA 1SL9A 3PFVA 5HKWA 1NWDA 1S6JA 2LVKA 1KK8B 1DJHA 3TUYB 3BUNB 5CSFA 2P6BB 2WC8A 1M31A 1Y1AA 4GBAA 1QIWA 4YI9A 4A4BA 2KBIA 1YX8A 2LMUA 2M1UA 3AAJA 4U8DA 1M63B 3AAKA 1F70A 1YTZC 1QIVA 2LLUA 4GGNA 1DVIA 1KWOB 3DVKA 1SKTA 3D0YA 1R6PA 1ZUZA 1SYMA 1UHIA 2OTGC 1GJYA 1Y1UA 2R2IA 4DRWA 3PATA 5IBWA 2LUXA 1J7RA 4F0ZB 3NSLA 2KDHA 5CSNA 2MAZA 4PHJA 1WDCC 2WCBA 2K7BA 2EGDA 4HRHA 2JT8A 1SCVA 3BUXB 1FW4A 1M39A 1N2DA 3QRXA 4GPLB 4MZKA 3EVVA 1TNWA 4R1EA 1Y1XA 1KQMC 1TRFA 1OSAA 2GGMA 1OZSA 1NCXA 2FOTA 2BCBA 1TNQA 3DVMA 2QPTA 4AQIA 1QVIZ 1AVSA 2BL0B 1GQMA 2LHIA 3A8RA 3KPXA 2BCAA 2BCXA 1CFFA 1RWYA 4N5XA 1S6CA 1B9AA 2H2KA 4ZCUA 1N65A 1FI6A 1QLKA 4L9MA 2HQ8A 1MXEA 3FS7A 1G8IA 5D7FA 5I2LA 1QVIY 3NXAA 1MXLC 4YGDB 1EG3A 2DOQA 4C0KA 1TOPA 1QATA 3VRPA 5F6TA 1WY9A 2M7NA 3SIAA 4GNKB 1RTP1 3SG3A 3RM1A 2KFHA 1SBJA 1OQPA 1SNLA 2JU0A 3MSEB 4NDDA 1BR1B 2KGRA 4PHKA 1K9PA 1YURA 2KOTA 2L50A 5CSJA 1AUIB 4P5OE 1CLLA 4JWQA 2WORA 1K93D 1Q80A 1XYDA 2D8NA 3EKHA 2KAYA 1PSBA 1NP8A 2M1KB 1OOJA 1K9KA 2FJUB 1B7TZ 2FCEA 1C07A 1YUUA 3LL8B 2LCPA 4Q04A 4QJ4B 5JJGA 3A4UB 1B8LA 3OB1B 3BOWB 2K7OA 1H4BA 4AQJA 3SG6A 1QX7A 2H61A 2MLEC 2MLFC 3EK7A 2WOSA 1IQ3A 1LVCD 4WRIA 1B7TY 1SCMC 2F33A 1KFUL 5I8NA 1MR8A 1C7VA 2LP2A 3GK4X 3BUWB 3PALA 2K2AA 3SG4A 1CMFA 1JWDA 1SR6B 3K21A 4ORAB 1UHKA 1AJ4A 1FF1A 1CLMA 3BUMB 2KFGA 5G08A 2BE6A 1DJIA 2HPSA 2I18A 1RECA 3OX5A 4C0LA 3OHMB 5AANA 2KFFA 2CNPA 3ZWHA 4PE7A 2JRFA 4OV2A 1A4PA 3JVTC 2M29A 4M2PA 1KFUS 1U5IB 3EVRA 2Y1NA 1A75B 4GUKA 5CPVA 2Y1MA 1ALVA 1QS7A 3LCPC 1YUTA 2GV5A 2SASA 2G2BA 2LVJA 2NZ0A 3I5FC 1PK0D 2JNFA 4A4CA 3WNXB 1G4YR 3EKJA 4YRUA 1F55A 1B47A 1RFJA 2LVIA 2OTGB 1LINA 3FWBA 4PE4A 4PCWA 1F8HA 3CR4X 3OX6A 3BXKA 2HF5A 2H61C 1PALA 3SG5A 1ODBA 1WDCB 1YX7A 2WCEA 5ER4X 2LAPA 2MA2A 2K7CA 1QV0A 1CM1A 2L98A 2M0RA 2JZIA 2M8UA 4DCKA 3ICBA 1MHOA 1H8BA 1KQMB 2M9GA 1IGVA 2F2OA 1SK6D 3TDIA 1PVBA 1YVLA 2TN4A 2HETA 1DJXA 4HRGA 5KTYA 1AK8A 1V1GA 3JTDC 3BYAA 2BE4A 3SG7A 4NDCA 2MHHA 1B1GA 1IKUA 1FI5A 1M46A 4MSPA 3AKAA 2CXJA 2I94A 1CFPA 3SIBA 1NX1A 4YGCB 1JFJA 1QX5B 1KFXS 4D1EA 1K2HA 3O78A 4IL1A 1AP4A 1A2XA 1B4CA 1Y6WA 4WQ3A 5JOLA 1C7WA 2E30A 1K94A 4NDBA 1VRKA 2L4IA 1B8RA 2KAXA 3IQOA 3D0YB 2ISDA 1PRWA 1SW8A 1JUOA 4YGEB 3H4SE 3WHTB 4QJ3B 4OKHA 1GGWA 1IQ5A 1JSAA 2KGBC 1TNPA 4JPZB 1K9UA 4GFTA 1MUXA 1EH2A 1DJZA 2HQWA 4USLA 3HCMA 4YI8A 1HQVA 2ZN8A 2K2FA 2LANA 2EC6C 1F71A 1UWOA 2PVBA 1S5GZ 4MBEA 1S6IA 5HLVA 1NUBA 1DGVA 1J7PA 3WHUB 1QX2A 4AOMA 2K0JA 1DJWA 1KK8C 2L0PA 3SG2A 1W7JB 3OP0A 2AUCA 5KSZA 5FYXA 1SCMB 2JXCA 3NSIA 2PRUA 1BT6A 2KNEA 4DIRA 3CTNA 5AFPA 3OB2B 1KSOA 1S5GY 4MRYA 2JTZA 2O5GA 4UPGA 3CZTX 3NSKA 1TN4A 3SJSA 1NSHA 2KI4C 3C1VA 5I2OA 4TNCA 4CLNA 4XJKA 5DKNA 4OR9B 1EL4A 1XFXO 5KU1A 2ZNDA 1CDNA 2Q91A 1LA3A 2KBMA 3JVTB 3E3RA 1UP5A 3LK1A 2Y4QA 4ORCB 5D69A 2JNXA 1CDMA 1ZOTB 5J3XA 3RLZA 1JF2A 3VRNA 1IRJA 2M97A 4XYNA 1UUSA 1EXRA 2CCMA 4C0JA 1ALWA 3BOWA 3IQQA 1XK4A 3I5FB 4PALA 1WRZA 4E68A 1TNXA 4PE1A 1K96A 2A4JA
chains in the Genus database with same CATH superfamily
5FI7A 2JULA 1OMDA 1J7QA 4YGAA 1EJ3A 1J55A 3EVUA 1OZOA 1K8UA 1NX0A 2LM5A 1XVJA 3HX4A 1JC2A 3KO0A 1LA0A 1RK9A 2L2CA 1BOCA 2PSRA 3R1PA 1YVHA 3D10A 1WRLA 2KSPA 2P71A 1AJ5A 3KHEA 1KCYA 1NIWA 2RGIA 1IG5A 1X02A 1CNPA 3DF0B 2WC5A 1EG4A 2G9BA 1W7IB 5HKZA 2KYCA 4HSZA 1DT7B 3R1OA 4MZLA 1F54A 1Y0VH 2JT3A 1JF0A 2BKIB 4MLWA 1DF0A 1SRAA 5GQQC 2ZKMX 4ZCVA 3TS5C 1A03A 2WCLA 3IF7A 4YBHB 3DXLA 4M2QA 1U5IA 2KAVA 1A75A 4ETOA 5K89A 1QJTA 4ICBA 2O60A 5AXIA 4FTGA 1LS8A 1K90D 3TDZA 2MBXA 1G33A 3BUOB 4DUQA 2VRGA 1K95A 1MF8B 3PSRA 1TCFA 2LHLA 4CFRA 3LLEA 1JBAA 1QASA 1CM4A 3CWGA 1PVAA 3D76A 2FJYA 1CFCA 1CDLA 2ZRTA 3GK2A 2CBLA 3O2PA 3KEVA 4PE0A 3VRRA 3V2LA 1QTXA 1J7OA 1PSRA 1CTRA 3O6BA 1UHHA 2LMVA 1OOHA 3O4YA 2L5XB 3CZ2A 2AMIA 3I5HC 3NGVA 2LP3A 2WNDA 2EC6B 4MVFA 1OOGA 1S36A 2K60A 2QEBA 3TDUA 1WLZA 1SL8A 1DQEA 3K1EA 1LXFC 3GK1A 1A29A 4CIDA 2QEHA 3FWCA 1BJFA 2V53A 3M0WA 2GTEA 2P70A 2KQYA 1YR5A 1DMOA 2B1UA 2OS8C 5B8IB 1BR4B 2COLB 2JQ6A 1NPQA 3FIAA 2LLTA 2FCDA 1L2OC 2JC2A 1YRUB 2M7LA 2PYQA 2BKHB 2KI4B 2JWWA 4JQ0D 1DTLA 1IH0A 1DJGA 1CFDA 1BLQA 1DEKA 3PN7C 3I5IC 2Y5IA 2MRDA 2I7AA 2GGZA 2L4HA 4WQ2A 5HKYA 1BF5A 1TWOA 3LK0A 1XFVO 3F45A 1GGZA 1J1DA 2SCPA 1NYAA 2LNKA 1XO5A 2LC5A 2CTNA 3TZ1A 3I5GC 3DVJA 3QMEA 4MRXA 1ZACA 1V1FA 2CT9A 1F4QA 1TUZA 1OOFA 1PULA 3B6XA 2OPOA 4INXA 3DVEA 2WCMA 3KF9A 3TUYC 1E8AA 4M2OA 2LLSA 2MJWB 1OMRA 1UHNA 4OZDA 5EL2A 5PALA 1S26D 1QV1A 4CFQA 3D78A 1IJ6A 1TCOB 4N1GA 1KQVA 3CGAA 1RROA 2KHNA 1MWNA 2ZFDA 1QXPA 1UHJA 1J1EA 1RJVA 1FBVA 1KWOC 2F8PA 2LMTA 3FE9A 4YGBB 1N0YA 5AEQA 4BY4A 1L7ZA 4CPVA 1YRTB 2LUCA 1BODA 1C3YA 1UURA 1Z4HA 2IS9A 1JFKA 1S1EA 3PM2A 3VRQA 3ZNIA 1DGUA 2KLEA 3DD4A 4GAOA 5CSIA 1XA5A 2ZN9A 4GGFA 4N1FA 1NCZA 5I94A 1ZMZA 4XJKB 3TS5B 1MQ1A 1CLBA 3PLFB 2K61A 1BU3A 1SY9A 1IWQA 5AERA 2BECA 2BBNA 1CDPA 1C3ZA 1AHRA 2BL0C 3CR5X 1YUSA 2AAOA 5DKQA 1IJ5A 1WLMA 5HYDA 2F2PA 3EG5B 2KYFA 1NX2A 3Q8IA 1M45A 3WXAA 3VROA 2NLNA 3NHIA 2M49B 1TTXA 4MN0A 2LVVA 1QLSA 3CS1A 3GOFA 3N7HA 1SMGA 3B87A 5ER5A 2F3ZA 4HREE 4INWA 4MEWA 4OVNF 4ORBB 2JT0A 2PASA 1XFYO 3JTDB 1S3PA 2L51A 4PHMA 4FQOA 2PMYA 4I5JA 1CKKA 3I5HB 3PM8A 3AKBA 2KQ6A 2JTTA 1CMGA 2I2RE 1B8CA 1KK7Z 1WRKA 3DF0A 2QACA 4I5KA 4I5NB 2K7DA 5TNCA 1W9ZA 2EHBA 4F7FA 2ZNEA 2NXQA 1BMOA 5DKRA 1OMVA 4GGFC 4OCIA 1SL7A 1XFRA 3CABA 2E6WA 1NCYA 1DF0B 2OS8B 4PHNA 1KK7Y 4MZJA 3EK4A 2BBMA 2KI6C 5D3OA 1TIZA 1XK4C 2K8MB 5BPJA 5I2QA 3CR2A 1L2OB 1GM0A 3EK8A 4NQGA 4QJ5B 1R2UA 3VGOA 1D1OA 2NCPA 1LKJA 3DZTA 4I5LB 1CB1A 1NX3A 2WCFA 2LE9B 2F3YA 3I5IB 1DJYA 3PN7B 2KI6D 2L2EA 1SR6C 1ZFSA 2JXLA 2ZRSA 1SPYA 1XFWO 4P2YB 5DICA 1XFZO 3VB1A 4BY5A 3BQ3A 3L4LA 2LV7A 3NSOA 2JPTA 1FPWA 1BG1A 2M3WA 3CLNA 2NCOA 1F4OA 1HT9A 1KFXL 2JOJA 1KSMA 2PALA 5HLOA 4DS7A 3I5GB 1XFUO 2Q4UA 1OE9B 4JD9A 1SL9A 3PFVA 4PDZA 5HKWA 1NWDA 3RZSA 1S6JA 2LVKA 1KK8B 3BFAA 3R72A 1DJHA 3TUYB 3BUNB 5CSFA 2P6BB 2WC8A 1M31A 1Y1AA 3D77A 4GBAA 1QIWA 4YI9A 2WCJA 4A4BA 2KBIA 1YX8A 3S0GA 2LMUA 2M1UA 3AAJA 4U8DA 1M63B 3AAKA 1F70A 1YTZC 3SS3A 1QIVA 2LLUA 4GGNA 1DVIA 3CYZA 1KWOB 3BJHA 3DVKA 1SKTA 3D0YA 1R6PA 1ZUZA 1SYMA 1UHIA 2OTGC 1GJYA 1Y1UA 2R2IA 4DRWA 3PATA 5IBWA 2LUXA 1J7RA 4F0ZB 3NSLA 4KYNA 2KDHA 5CSNA 2PQLA 2MAZA 4PHJA 3S0FA 1WDCC 2WCBA 2K7BA 3D73A 2EGDA 1T14A 4HRHA 2JT8A 1SCVA 3B7AA 3BUXB 1FW4A 1M39A 1N2DA 3QRXA 4GPLB 4MZKA 3EVVA 1P28A 1TNWA 3BFBA 4R1EA 1Y1XA 1KQMC 1TRFA 3O4XA 1OSAA 2GGMA 1OZSA 1NCXA 2FOTA 2JPOA 2BCBA 1TNQA 3DVMA 2QPTA 3L47A 3S0EA 4AQIA 1QVIZ 1AVSA 2BL0B 1GQMA 2LHIA 3A8RA 1DELA 3B86A 2BCAA 2BCXA 3KPXA 1RWYA 1CFFA 4N5XA 1S6CA 1B9AA 2H2KA 4ZCUA 1N65A 1FI6A 1QLKA 4L9MA 2HQ8A 2YGUA 1MXEA 3FS7A 1G8IA 5D7FA 5I2LA 1QVIY 3NXAA 1MXLC 4YGDB 1EG3A 2DOQA 4C0KA 1TOPA 1QATA 3VRPA 5F6TA 1WY9A 2M7NA 3SIAA 4GNKB 1RTP1 3SG3A 3RM1A 2KFHA 1SBJA 1OQPA 1SNLA 1Z2CB 2JU0A 3L4AA 1BR1B 2KGRA 3MSEB 4NDDA 1K9PA 1YURA 1SSEB 2KOTA 2L50A 1AUIB 4P5OE 1CLLA 4PHKA 5CSJA 4JWQA 2WORA 1K93D 1Q80A 1XYDA 2D8NA 3EKHA 2WCHA 2KAYA 1PSBA 1NP8A 2M1KB 1OOJA 1K9KA 2FJUB 1B7TZ 2FCEA 1C07A 1YUUA 3LL8B 2LCPA 4Q04A 4QJ4B 5JJGA 3A4UB 3CZ1A 1B8LA 3UO9A 3OB1B 3BOWB 2K7OA 1H4BA 2WC6A 4AQJA 3SG6A 1QX7A 2H61A 2MLEC 3OGNA 2MLFC 3EK7A 2WOSA 1IQ3A 1LVCD 4WRIA 1B7TY 1SCMC 2F33A 1KFUL 5I8NA 1MR8A 1C7VA 2LP2A 3GK4X 2WCKA 3BUWB 2K2AA 3PALA 3NHTA 3SG4A 1SR6B 1CMFA 1JWDA 3K21A 4ORAB 1UHKA 1AJ4A 3DY9A 3B88A 1FF1A 1CLMA 3BUMB 2KFGA 3D74A 5G08A 2BE6A 1DJIA 2HPSA 2I18A 1RECA 3OX5A 4C0LA 3OHMB 5AANA 3BFHA 2KFFA 2CNPA 3ZWHA 4PE7A 4PT1A 2JRFA 4OV2A 1A4PA 3JVTC 2M29A 4M2PA 1KFUS 1U5IB 3EVRA 2Y1NA 1A75B 4GUKA 3S0DA 5CPVA 2Y1MA 1ALVA 1QS7A 3LCPC 1YUTA 2GV5A 2SASA 2G2BA 2LVJA 2NZ0A 3I5FC 1PK0D 2JNFA 4A4CA 3WNXB 1G4YR 3EKJA 4YRUA 4FQTA 1F55A 1B47A 1RFJA 2LVIA 2OTGB 1LINA 3FWBA 4PE4A 4PCWA 1F8HA 3CR4X 3OX6A 3BXKA 2HF5A 2H61C 4IJ7A 5FI2A 1PALA 3SG5A 1ODBA 3OBVA 1WDCB 1YX7A 2WCEA 5ER4X 2LAPA 2MA2A 2K7CA 1QV0A 2QDIA 1CM1A 2L98A 2M0RA 2JZIA 2M8UA 3S0BA 3ICBA 4DCKA 1MHOA 1H8BA 1KQMB 2M9GA 3CDNA 1IGVA 1QWVA 1SK6D 2F2OA 3FE8A 1PVBA 3TDIA 1YVLA 3SS5A 2TN4A 2HETA 1DJXA 4HRGA 5KTYA 1AK8A 1V1GA 3JTDC 3BYAA 2BE4A 3SG7A 4NDCA 2MHHA 1B1GA 1IKUA 3IVTA 1FI5A 1M46A 4MSPA 3AKAA 5FI6A 2CXJA 2I94A 3D75A 3DYEA 1CFPA 3SIBA 1NX1A 4YGCB 1JFJA 1QX5B 1KFXS 4D1EA 1DC1A 1K2HA 2BAPA 3FE6A 3O78A 4IL1A 1AP4A 1A2XA 2QEOA 1B4CA 1Y6WA 4WQ3A 5JOLA 1C7WA 2E30A 5HL1A 1K94A 4NDBA 1VRKA 2L4IA 1B8RA 2KAXA 3IQOA 2BNXA 3D0YB 2ISDA 1TUJA 1PRWA 1SW8A 1JUOA 4YGEB 3UNWA 3H4SE 3WHTB 4QJ3B 4OKHA 1GGWA 3CZ0A 1IQ5A 1JSAA 2KGBC 1TNPA 4JPZB 1K9UA 4GFTA 1MUXA 2QEVA 1EH2A 1DJZA 2HQWA 1OW4A 3HCMA 4USLA 4YI8A 1HQVA 2ZN8A 2K2FA 2LANA 2EC6C 1F71A 3S0AA 1UWOA 2L5YA 2PVBA 1S5GZ 4MBEA 1S6IA 5HLVA 1NUBA 1DGVA 2ERBA 1J7PA 3WHUB 1QX2A 4AOMA 2K0JA 1DJWA 1KK8C 2H8VA 2L0PA 3SG2A 1W7JB 3OP0A 2AUCA 1ORGA 5FYXA 5KSZA 1SCMB 2JXCA 3NSIA 2PRUA 1BT6A 2KNEA 4DIRA 3CTNA 5AFPA 3OB2B 1KSOA 1S5GY 4MRYA 2JTZA 2O5GA 4UPGA 3CZTX 3NSKA 1TN4A 3SJSA 1NSHA 2KI4C 4JKTA 3C1VA 5I2OA 4TNCA 4CLNA 2KLDA 1IIOA 4XJKA 5DKNA 4OR9B 1EL4A 1XFXO 5KU1A 2ZNDA 1CDNA 2Q91A 1LA3A 2KBMA 3JVTB 2KPHA 3PJIA 3E3RA 1UP5A 3LK1A 2Y4QA 4ORCB 5D69A 2JNXA 1CDMA 1ZOTB 5J3XA 3RLZA 1JF2A 3VRNA 1IRJA 2M97A 4XYNA 3SS4A 1UUSA 1OOIX 3R1VA 1EXRA 2CCMA 4C0JA 1ALWA 3BOWA 3IQQA 1XK4A 3I5FB 4PALA 1WRZA 4E68A 1TNXA 4PE1A 1K96A 2A4JA
chains in the Genus database with same CATH topology
2JULA 1OMDA 1J7QA 4YGAA 1EJ3A 1J55A 3EVUA 1OZOA 1K8UA 1NX0A 2LM5A 1XVJA 3HX4A 1JC2A 3KO0A 1LA0A 1RK9A 1BOCA 2PSRA 1YVHA 3D10A 1WRLA 2KSPA 1AJ5A 3KHEA 1KCYA 1NIWA 2RGIA 1IG5A 1X02A 1CNPA 3DF0B 1EG4A 2G9BA 1W7IB 5HKZA 2KYCA 4HSZA 1DT7B 4MZLA 1F54A 1Y0VH 2JT3A 1JF0A 2BKIB 4MLWA 1DF0A 1SRAA 5GQQC 2ZKMX 4ZCVA 3TS5C 1A03A 3IF7A 4YBHB 4M2QA 1U5IA 2KAVA 1A75A 4ETOA 5K89A 1QJTA 4ICBA 2O60A 5AXIA 4FTGA 1K90D 3TDZA 2MBXA 1G33A 3BUOB 4DUQA 2VRGA 1K95A 1MF8B 3PSRA 1TCFA 2LHLA 4CFRA 3LLEA 1JBAA 1QASA 1CM4A 3CWGA 1PVAA 1CFCA 1CDLA 2ZRTA 3GK2A 2CBLA 3O2PA 3KEVA 4PE0A 3VRRA 1J7OA 1QTXA 1PSRA 1CTRA 3O6BA 1UHHA 2LMVA 3O4YA 2L5XB 2AMIA 3I5HC 2LP3A 2WNDA 2EC6B 4MVFA 3TDUA 1S36A 1WLZA 1SL8A 1LXFC 3GK1A 1A29A 4CIDA 3FWCA 1BJFA 2V53A 3M0WA 2KQYA 1YR5A 1DMOA 2B1UA 2OS8C 5B8IB 1BR4B 2COLB 2JQ6A 1NPQA 3FIAA 2LLTA 2FCDA 1L2OC 2JC2A 1YRUB 2M7LA 2BKHB 2KI4B 2JWWA 4JQ0D 1DTLA 1IH0A 1DJGA 1CFDA 1BLQA 3PN7C 3I5IC 2Y5IA 2MRDA 2I7AA 2GGZA 2L4HA 4WQ2A 5HKYA 1BF5A 3LK0A 1XFVO 3F45A 1GGZA 1J1DA 2SCPA 1NYAA 2LNKA 1XO5A 2LC5A 2CTNA 3TZ1A 3I5GC 3DVJA 4MRXA 1ZACA 1V1FA 2CT9A 1F4QA 1PULA 2OPOA 3DVEA 3KF9A 3TUYC 1E8AA 4M2OA 2LLSA 2MJWB 1OMRA 1UHNA 5PALA 1S26D 1QV1A 4CFQA 1IJ6A 1TCOB 4N1GA 1KQVA 3CGAA 1RROA 2KHNA 1MWNA 2ZFDA 1QXPA 1UHJA 1J1EA 1RJVA 1FBVA 1KWOC 2F8PA 2LMTA 4YGBB 1N0YA 5AEQA 4BY4A 1L7ZA 4CPVA 1YRTB 2LUCA 1BODA 1UURA 2IS9A 3VRQA 1JFKA 1S1EA 3ZNIA 1DGUA 3DD4A 4GAOA 5CSIA 1XA5A 2ZN9A 4GGFA 4N1FA 1NCZA 1CLBA 1ZMZA 4XJKB 3TS5B 1MQ1A 3PLFB 2K61A 1BU3A 1SY9A 1IWQA 5AERA 2BECA 2BBNA 1CDPA 1AHRA 2BL0C 3CR5X 1YUSA 2AAOA 5DKQA 1IJ5A 1WLMA 5HYDA 2F2PA 2KYFA 1NX2A 1M45A 3WXAA 3VROA 2NLNA 2M49B 1TTXA 4MN0A 2LVVA 1QLSA 3CS1A 3GOFA 1SMGA 5ER5A 2F3ZA 4HREE 4MEWA 4OVNF 4ORBB 2JT0A 2PASA 1XFYO 3JTDB 1S3PA 2L51A 4PHMA 4FQOA 2PMYA 4I5JA 1CKKA 3I5HB 3PM8A 3AKBA 2KQ6A 2JTTA 1CMGA 2I2RE 1B8CA 1KK7Z 1WRKA 3DF0A 2QACA 4I5KA 4I5NB 2K7DA 5TNCA 2EHBA 2ZNEA 2NXQA 1BMOA 5DKRA 1OMVA 4GGFC 4OCIA 1SL7A 2E6WA 1NCYA 1DF0B 2OS8B 4PHNA 1KK7Y 4MZJA 3EK4A 2BBMA 2KI6C 1TIZA 1XK4C 2K8MB 5BPJA 5I2QA 3CR2A 1L2OB 3EK8A 4NQGA 4QJ5B 1R2UA 3VGOA 1D1OA 2NCPA 1LKJA 4I5LB 1CB1A 1NX3A 2WCFA 2LE9B 2F3YA 3I5IB 1DJYA 3PN7B 2KI6D 2L2EA 1SR6C 1ZFSA 2JXLA 2ZRSA 1SPYA 1XFWO 4P2YB 4BY5A 1XFZO 3BQ3A 1FPWA 2LV7A 3NSOA 2JPTA 1BG1A 2M3WA 3CLNA 2NCOA 1F4OA 1HT9A 1KFXL 2JOJA 1KSMA 2PALA 5HLOA 4DS7A 3I5GB 1XFUO 2Q4UA 1OE9B 4PDZA 1SL9A 3PFVA 5HKWA 1NWDA 1S6JA 2LVKA 1KK8B 1DJHA 3TUYB 3BUNB 5CSFA 2P6BB 2WC8A 1M31A 1Y1AA 4GBAA 1QIWA 4YI9A 4A4BA 2KBIA 1YX8A 2LMUA 2M1UA 3AAJA 4U8DA 1M63B 3AAKA 1F70A 1YTZC 1QIVA 2LLUA 4GGNA 1DVIA 1KWOB 3DVKA 1SKTA 3D0YA 1R6PA 1ZUZA 1SYMA 1UHIA 2OTGC 1GJYA 1Y1UA 2R2IA 4DRWA 3PATA 5IBWA 2LUXA 1J7RA 4F0ZB 3NSLA 2KDHA 5CSNA 2MAZA 4PHJA 1WDCC 2WCBA 2K7BA 2EGDA 4HRHA 2JT8A 1SCVA 3BUXB 1FW4A 1M39A 1N2DA 3QRXA 4GPLB 4MZKA 3EVVA 1TNWA 4R1EA 1Y1XA 1KQMC 1TRFA 1OSAA 2GGMA 1OZSA 1NCXA 2FOTA 2BCBA 1TNQA 3DVMA 2QPTA 4AQIA 1QVIZ 1AVSA 2BL0B 1GQMA 2LHIA 3A8RA 3KPXA 2BCAA 2BCXA 1CFFA 1RWYA 4N5XA 1S6CA 1B9AA 2H2KA 4ZCUA 1N65A 1FI6A 1QLKA 4L9MA 2HQ8A 1MXEA 3FS7A 1G8IA 5D7FA 5I2LA 1QVIY 3NXAA 1MXLC 4YGDB 1EG3A 2DOQA 4C0KA 1TOPA 1QATA 3VRPA 5F6TA 1WY9A 2M7NA 3SIAA 4GNKB 1RTP1 3SG3A 3RM1A 2KFHA 1SBJA 1OQPA 1SNLA 2JU0A 3MSEB 4NDDA 1BR1B 2KGRA 4PHKA 1K9PA 1YURA 2KOTA 2L50A 5CSJA 1AUIB 4P5OE 1CLLA 4JWQA 2WORA 1K93D 1Q80A 1XYDA 2D8NA 3EKHA 2KAYA 1PSBA 1NP8A 2M1KB 1OOJA 1K9KA 2FJUB 1B7TZ 2FCEA 1C07A 1YUUA 3LL8B 2LCPA 4Q04A 4QJ4B 5JJGA 3A4UB 1B8LA 3OB1B 3BOWB 2K7OA 1H4BA 4AQJA 3SG6A 1QX7A 2H61A 2MLEC 2MLFC 3EK7A 2WOSA 1IQ3A 1LVCD 4WRIA 1B7TY 1SCMC 2F33A 1KFUL 5I8NA 1MR8A 1C7VA 2LP2A 3GK4X 3BUWB 3PALA 2K2AA 3SG4A 1CMFA 1JWDA 1SR6B 3K21A 4ORAB 1UHKA 1AJ4A 1FF1A 1CLMA 3BUMB 2KFGA 5G08A 2BE6A 1DJIA 2HPSA 2I18A 1RECA 3OX5A 4C0LA 3OHMB 5AANA 2KFFA 2CNPA 3ZWHA 4PE7A 2JRFA 4OV2A 1A4PA 3JVTC 2M29A 4M2PA 1KFUS 1U5IB 3EVRA 2Y1NA 1A75B 4GUKA 5CPVA 2Y1MA 1ALVA 1QS7A 3LCPC 1YUTA 2GV5A 2SASA 2G2BA 2LVJA 2NZ0A 3I5FC 1PK0D 2JNFA 4A4CA 3WNXB 1G4YR 3EKJA 4YRUA 1F55A 1B47A 1RFJA 2LVIA 2OTGB 1LINA 3FWBA 4PE4A 4PCWA 1F8HA 3CR4X 3OX6A 3BXKA 2HF5A 2H61C 1PALA 3SG5A 1ODBA 1WDCB 1YX7A 2WCEA 5ER4X 2LAPA 2MA2A 2K7CA 1QV0A 1CM1A 2L98A 2M0RA 2JZIA 2M8UA 4DCKA 3ICBA 1MHOA 1H8BA 1KQMB 2M9GA 1IGVA 2F2OA 1SK6D 3TDIA 1PVBA 1YVLA 2TN4A 2HETA 1DJXA 4HRGA 5KTYA 1AK8A 1V1GA 3JTDC 3BYAA 2BE4A 3SG7A 4NDCA 2MHHA 1B1GA 1IKUA 1FI5A 1M46A 4MSPA 3AKAA 2CXJA 2I94A 1CFPA 3SIBA 1NX1A 4YGCB 1JFJA 1QX5B 1KFXS 4D1EA 1K2HA 3O78A 4IL1A 1AP4A 1A2XA 1B4CA 1Y6WA 4WQ3A 5JOLA 1C7WA 2E30A 1K94A 4NDBA 1VRKA 2L4IA 1B8RA 2KAXA 3IQOA 3D0YB 2ISDA 1PRWA 1SW8A 1JUOA 4YGEB 3H4SE 3WHTB 4QJ3B 4OKHA 1GGWA 1IQ5A 1JSAA 2KGBC 1TNPA 4JPZB 1K9UA 4GFTA 1MUXA 1EH2A 1DJZA 2HQWA 4USLA 3HCMA 4YI8A 1HQVA 2ZN8A 2K2FA 2LANA 2EC6C 1F71A 1UWOA 2PVBA 1S5GZ 4MBEA 1S6IA 5HLVA 1NUBA 1DGVA 1J7PA 3WHUB 1QX2A 4AOMA 2K0JA 1DJWA 1KK8C 2L0PA 3SG2A 1W7JB 3OP0A 2AUCA 5KSZA 5FYXA 1SCMB 2JXCA 3NSIA 2PRUA 1BT6A 2KNEA 4DIRA 3CTNA 5AFPA 3OB2B 1KSOA 1S5GY 4MRYA 2JTZA 2O5GA 4UPGA 3CZTX 3NSKA 1TN4A 3SJSA 1NSHA 2KI4C 3C1VA 5I2OA 4TNCA 4CLNA 4XJKA 5DKNA 4OR9B 1EL4A 1XFXO 5KU1A 2ZNDA 1CDNA 2Q91A 1LA3A 2KBMA 3JVTB 3E3RA 1UP5A 3LK1A 2Y4QA 4ORCB 5D69A 2JNXA 1CDMA 1ZOTB 5J3XA 3RLZA 1JF2A 3VRNA 1IRJA 2M97A 4XYNA 1UUSA 1EXRA 2CCMA 4C0JA 1ALWA 3BOWA 3IQQA 1XK4A 3I5FB 4PALA 1WRZA 4E68A 1TNXA 4PE1A 1K96A 2A4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUL A;  1OMD A;  1J7Q A;  4YGA A;  1EJ3 A;  1J55 A;  3EVU A;  1OZO A;  1K8U A;  1NX0 A;  2LM5 A;  1XVJ A;  3HX4 A;  1JC2 A;  3KO0 A;  1LA0 A;  1RK9 A;  1BOC A;  2PSR A;  1YVH A;  3D10 A;  1WRL A;  2KSP A;  1AJ5 A;  3KHE A;  1KCY A;  1NIW A;  2RGI A;  1IG5 A;  1X02 A;  1CNP A;  3DF0 B;  1EG4 A;  2G9B A;  1W7I B;  5HKZ A;  2KYC A;  4HSZ A;  1DT7 B;  4MZL A;  1F54 A;  1Y0V H;  2JT3 A;  1JF0 A;  2BKI B;  4MLW A;  1DF0 A;  1SRA A;  5GQQ C;  2ZKM X;  4ZCV A;  3TS5 C;  1A03 A;  3IF7 A;  4YBH B;  4M2Q A;  1U5I A;  2KAV A;  1A75 A;  4ETO A;  5K89 A;  1QJT A;  4ICB A;  2O60 A;  5AXI A;  4FTG A;  1K90 D;  3TDZ A;  2MBX A;  1G33 A;  3BUO B;  4DUQ A;  2VRG A;  1K95 A;  1MF8 B;  3PSR A;  1TCF A;  2LHL A;  4CFR A;  3LLE A;  1JBA A;  1QAS A;  1CM4 A;  3CWG A;  1PVA A;  1CFC A;  1CDL A;  2ZRT A;  3GK2 A;  2CBL A;  3O2P A;  3KEV A;  4PE0 A;  3VRR A;  1J7O A;  1QTX A;  1PSR A;  1CTR A;  3O6B A;  1UHH A;  2LMV A;  3O4Y A;  2L5X B;  2AMI A;  3I5H C;  2LP3 A;  2WND A;  2EC6 B;  4MVF A;  3TDU A;  1S36 A;  1WLZ A;  1SL8 A;  1LXF C;  3GK1 A;  1A29 A;  4CID A;  3FWC A;  1BJF A;  2V53 A;  3M0W A;  2KQY A;  1YR5 A;  1DMO A;  2B1U A;  2OS8 C;  5B8I B;  1BR4 B;  2COL B;  2JQ6 A;  1NPQ A;  3FIA A;  2LLT A;  2FCD A;  1L2O C;  2JC2 A;  1YRU B;  2M7L A;  2BKH B;  2KI4 B;  2JWW A;  4JQ0 D;  1DTL A;  1IH0 A;  1DJG A;  1CFD A;  1BLQ A;  3PN7 C;  3I5I C;  2Y5I A;  2MRD A;  2I7A A;  2GGZ A;  2L4H A;  4WQ2 A;  5HKY A;  1BF5 A;  3LK0 A;  1XFV O;  3F45 A;  1GGZ A;  1J1D A;  2SCP A;  1NYA A;  2LNK A;  1XO5 A;  2LC5 A;  2CTN A;  3TZ1 A;  3I5G C;  3DVJ A;  4MRX A;  1ZAC A;  1V1F A;  2CT9 A;  1F4Q A;  1PUL A;  2OPO A;  3DVE A;  3KF9 A;  3TUY C;  1E8A A;  4M2O A;  2LLS A;  2MJW B;  1OMR A;  1UHN A;  5PAL A;  1S26 D;  1QV1 A;  4CFQ A;  1IJ6 A;  1TCO B;  4N1G A;  1KQV A;  3CGA A;  1RRO A;  2KHN A;  1MWN A;  2ZFD A;  1QXP A;  1UHJ A;  1J1E A;  1RJV A;  1FBV A;  1KWO C;  2F8P A;  2LMT A;  4YGB B;  1N0Y A;  5AEQ A;  4BY4 A;  1L7Z A;  4CPV A;  1YRT B;  2LUC A;  1BOD A;  1UUR A;  2IS9 A;  3VRQ A;  1JFK A;  1S1E A;  3ZNI A;  1DGU A;  3DD4 A;  4GAO A;  5CSI A;  1XA5 A;  2ZN9 A;  4GGF A;  4N1F A;  1NCZ A;  1CLB A;  1ZMZ A;  4XJK B;  3TS5 B;  1MQ1 A;  3PLF B;  2K61 A;  1BU3 A;  1SY9 A;  1IWQ A;  5AER A;  2BEC A;  2BBN A;  1CDP A;  1AHR A;  2BL0 C;  3CR5 X;  1YUS A;  2AAO A;  5DKQ A;  1IJ5 A;  1WLM A;  5HYD A;  2F2P A;  2KYF A;  1NX2 A;  1M45 A;  3WXA A;  3VRO A;  2NLN A;  2M49 B;  1TTX A;  4MN0 A;  2LVV A;  1QLS A;  3CS1 A;  3GOF A;  1SMG A;  5ER5 A;  2F3Z A;  4HRE E;  4MEW A;  4OVN F;  4ORB B;  2JT0 A;  2PAS A;  1XFY O;  3JTD B;  1S3P A;  2L51 A;  4PHM A;  4FQO A;  2PMY A;  4I5J A;  1CKK A;  3I5H B;  3PM8 A;  3AKB A;  2KQ6 A;  2JTT A;  1CMG A;  2I2R E;  1B8C A;  1KK7 Z;  1WRK A;  3DF0 A;  2QAC A;  4I5K A;  4I5N B;  2K7D A;  5TNC A;  2EHB A;  2ZNE A;  2NXQ A;  1BMO A;  5DKR A;  1OMV A;  4GGF C;  4OCI A;  1SL7 A;  2E6W A;  1NCY A;  1DF0 B;  2OS8 B;  4PHN A;  1KK7 Y;  4MZJ A;  3EK4 A;  2BBM A;  2KI6 C;  1TIZ A;  1XK4 C;  2K8M B;  5BPJ A;  5I2Q A;  3CR2 A;  1L2O B;  3EK8 A;  4NQG A;  4QJ5 B;  1R2U A;  3VGO A;  1D1O A;  2NCP A;  1LKJ A;  4I5L B;  1CB1 A;  1NX3 A;  2WCF A;  2LE9 B;  2F3Y A;  3I5I B;  1DJY A;  3PN7 B;  2KI6 D;  2L2E A;  1SR6 C;  1ZFS A;  2JXL A;  2ZRS A;  1SPY A;  1XFW O;  4P2Y B;  4BY5 A;  1XFZ O;  3BQ3 A;  1FPW A;  2LV7 A;  3NSO A;  2JPT A;  1BG1 A;  2M3W A;  3CLN A;  2NCO A;  1F4O A;  1HT9 A;  1KFX L;  2JOJ A;  1KSM A;  2PAL A;  5HLO A;  4DS7 A;  3I5G B;  1XFU O;  2Q4U A;  1OE9 B;  4PDZ A;  1SL9 A;  3PFV A;  5HKW A;  1NWD A;  1S6J A;  2LVK A;  1KK8 B;  1DJH A;  3TUY B;  3BUN B;  5CSF A;  2P6B B;  2WC8 A;  1M31 A;  1Y1A A;  4GBA A;  1QIW A;  4YI9 A;  4A4B A;  2KBI A;  1YX8 A;  2LMU A;  2M1U A;  3AAJ A;  4U8D A;  1M63 B;  3AAK A;  1F70 A;  1YTZ C;  1QIV A;  2LLU A;  4GGN A;  1DVI A;  1KWO B;  3DVK A;  1SKT A;  3D0Y A;  1R6P A;  1ZUZ A;  1SYM A;  1UHI A;  2OTG C;  1GJY A;  1Y1U A;  2R2I A;  4DRW A;  3PAT A;  5IBW A;  2LUX A;  1J7R A;  4F0Z B;  3NSL A;  2KDH A;  5CSN A;  2MAZ A;  4PHJ A;  1WDC C;  2WCB A;  2K7B A;  2EGD A;  4HRH A;  2JT8 A;  1SCV A;  3BUX B;  1FW4 A;  1M39 A;  1N2D A;  3QRX A;  4GPL B;  4MZK A;  3EVV A;  1TNW A;  4R1E A;  1Y1X A;  1KQM C;  1TRF A;  1OSA A;  2GGM A;  1OZS A;  1NCX A;  2FOT A;  2BCB A;  1TNQ A;  3DVM A;  2QPT A;  4AQI A;  1QVI Z;  1AVS A;  2BL0 B;  1GQM A;  2LHI A;  3A8R A;  3KPX A;  2BCA A;  2BCX A;  1CFF A;  1RWY A;  4N5X A;  1S6C A;  1B9A A;  2H2K A;  4ZCU A;  1N65 A;  1FI6 A;  1QLK A;  4L9M A;  2HQ8 A;  1MXE A;  3FS7 A;  1G8I A;  5D7F A;  5I2L A;  1QVI Y;  3NXA A;  1MXL C;  4YGD B;  1EG3 A;  2DOQ A;  4C0K A;  1TOP A;  1QAT A;  3VRP A;  5F6T A;  1WY9 A;  2M7N A;  3SIA A;  4GNK B;  1RTP 1;  3SG3 A;  3RM1 A;  2KFH A;  1SBJ A;  1OQP A;  1SNL A;  2JU0 A;  3MSE B;  4NDD A;  1BR1 B;  2KGR A;  4PHK A;  1K9P A;  1YUR A;  2KOT A;  2L50 A;  5CSJ A;  1AUI B;  4P5O E;  1CLL A;  4JWQ A;  2WOR A;  1K93 D;  1Q80 A;  1XYD A;  2D8N A;  3EKH A;  2KAY A;  1PSB A;  1NP8 A;  2M1K B;  1OOJ A;  1K9K A;  2FJU B;  1B7T Z;  2FCE A;  1C07 A;  1YUU A;  3LL8 B;  2LCP A;  4Q04 A;  4QJ4 B;  5JJG A;  3A4U B;  1B8L A;  3OB1 B;  3BOW B;  2K7O A;  1H4B A;  4AQJ A;  3SG6 A;  1QX7 A;  2H61 A;  2MLE C;  2MLF C;  3EK7 A;  2WOS A;  1IQ3 A;  1LVC D;  4WRI A;  1B7T Y;  1SCM C;  2F33 A;  1KFU L;  5I8N A;  1MR8 A;  1C7V A;  2LP2 A;  3GK4 X;  3BUW B;  3PAL A;  2K2A A;  3SG4 A;  1CMF A;  1JWD A;  1SR6 B;  3K21 A;  4ORA B;  1UHK A;  1AJ4 A;  1FF1 A;  1CLM A;  3BUM B;  2KFG A;  5G08 A;  2BE6 A;  1DJI A;  2HPS A;  2I18 A;  1REC A;  3OX5 A;  4C0L A;  3OHM B;  5AAN A;  2KFF A;  2CNP A;  3ZWH A;  4PE7 A;  2JRF A;  4OV2 A;  1A4P A;  3JVT C;  2M29 A;  4M2P A;  1KFU S;  1U5I B;  3EVR A;  2Y1N A;  1A75 B;  4GUK A;  5CPV A;  2Y1M A;  1ALV A;  1QS7 A;  3LCP C;  1YUT A;  2GV5 A;  2SAS A;  2G2B A;  2LVJ A;  2NZ0 A;  3I5F C;  1PK0 D;  2JNF A;  4A4C A;  3WNX B;  1G4Y R;  3EKJ A;  4YRU A;  1F55 A;  1B47 A;  1RFJ A;  2LVI A;  2OTG B;  1LIN A;  3FWB A;  4PE4 A;  4PCW A;  1F8H A;  3CR4 X;  3OX6 A;  3BXK A;  2HF5 A;  2H61 C;  1PAL A;  3SG5 A;  1ODB A;  1WDC B;  1YX7 A;  2WCE A;  5ER4 X;  2LAP A;  2MA2 A;  2K7C A;  1QV0 A;  1CM1 A;  2L98 A;  2M0R A;  2JZI A;  2M8U A;  4DCK A;  3ICB A;  1MHO A;  1H8B A;  1KQM B;  2M9G A;  1IGV A;  2F2O A;  1SK6 D;  3TDI A;  1PVB A;  1YVL A;  2TN4 A;  2HET A;  1DJX A;  4HRG A;  5KTY A;  1AK8 A;  1V1G A;  3JTD C;  3BYA A;  2BE4 A;  3SG7 A;  4NDC A;  2MHH A;  1B1G A;  1IKU A;  1FI5 A;  1M46 A;  4MSP A;  3AKA A;  2CXJ A;  2I94 A;  1CFP A;  3SIB A;  1NX1 A;  4YGC B;  1JFJ A;  1QX5 B;  1KFX S;  4D1E A;  1K2H A;  3O78 A;  4IL1 A;  1AP4 A;  1A2X A;  1B4C A;  1Y6W A;  4WQ3 A;  5JOL A;  1C7W A;  2E30 A;  1K94 A;  4NDB A;  1VRK A;  2L4I A;  1B8R A;  2KAX A;  3IQO A;  3D0Y B;  2ISD A;  1PRW A;  1SW8 A;  1JUO A;  4YGE B;  3H4S E;  3WHT B;  4QJ3 B;  4OKH A;  1GGW A;  1IQ5 A;  1JSA A;  2KGB C;  1TNP A;  4JPZ B;  1K9U A;  4GFT A;  1MUX A;  1EH2 A;  1DJZ A;  2HQW A;  4USL A;  3HCM A;  4YI8 A;  1HQV A;  2ZN8 A;  2K2F A;  2LAN A;  2EC6 C;  1F71 A;  1UWO A;  2PVB A;  1S5G Z;  4MBE A;  1S6I A;  5HLV A;  1NUB A;  1DGV A;  1J7P A;  3WHU B;  1QX2 A;  4AOM A;  2K0J A;  1DJW A;  1KK8 C;  2L0P A;  3SG2 A;  1W7J B;  3OP0 A;  2AUC A;  5KSZ A;  5FYX A;  1SCM B;  2JXC A;  3NSI A;  2PRU A;  1BT6 A;  2KNE A;  4DIR A;  3CTN A;  5AFP A;  3OB2 B;  1KSO A;  1S5G Y;  4MRY A;  2JTZ A;  2O5G A;  4UPG A;  3CZT X;  3NSK A;  1TN4 A;  3SJS A;  1NSH A;  2KI4 C;  3C1V A;  5I2O A;  4TNC A;  4CLN A;  4XJK A;  5DKN A;  4OR9 B;  1EL4 A;  1XFX O;  5KU1 A;  2ZND A;  1CDN A;  2Q91 A;  1LA3 A;  2KBM A;  3JVT B;  3E3R A;  1UP5 A;  3LK1 A;  2Y4Q A;  4ORC B;  5D69 A;  2JNX A;  1CDM A;  1ZOT B;  5J3X A;  3RLZ A;  1JF2 A;  3VRN A;  1IRJ A;  2M97 A;  4XYN A;  1UUS A;  1EXR A;  2CCM A;  4C0J A;  1ALW A;  3BOW A;  3IQQ A;  1XK4 A;  3I5F B;  4PAL A;  1WRZ A;  4E68 A;  1TNX A;  4PE1 A;  1K96 A;  2A4J A; 
#chains in the Genus database with same CATH topology
 5FI7 A;  2JUL A;  1OMD A;  1J7Q A;  4YGA A;  1EJ3 A;  1J55 A;  3EVU A;  1OZO A;  1K8U A;  1NX0 A;  2LM5 A;  1XVJ A;  3HX4 A;  1JC2 A;  3KO0 A;  1LA0 A;  1RK9 A;  2L2C A;  1BOC A;  2PSR A;  3R1P A;  1YVH A;  3D10 A;  1WRL A;  2KSP A;  2P71 A;  1AJ5 A;  3KHE A;  1KCY A;  1NIW A;  2RGI A;  1IG5 A;  1X02 A;  1CNP A;  3DF0 B;  2WC5 A;  1EG4 A;  2G9B A;  1W7I B;  5HKZ A;  2KYC A;  4HSZ A;  1DT7 B;  3R1O A;  4MZL A;  1F54 A;  1Y0V H;  2JT3 A;  1JF0 A;  2BKI B;  4MLW A;  1DF0 A;  1SRA A;  5GQQ C;  2ZKM X;  4ZCV A;  3TS5 C;  1A03 A;  2WCL A;  3IF7 A;  4YBH B;  3DXL A;  4M2Q A;  1U5I A;  2KAV A;  1A75 A;  4ETO A;  5K89 A;  1QJT A;  4ICB A;  2O60 A;  5AXI A;  4FTG A;  1LS8 A;  1K90 D;  3TDZ A;  2MBX A;  1G33 A;  3BUO B;  4DUQ A;  2VRG A;  1K95 A;  1MF8 B;  3PSR A;  1TCF A;  2LHL A;  4CFR A;  3LLE A;  1JBA A;  1QAS A;  1CM4 A;  3CWG A;  1PVA A;  3D76 A;  2FJY A;  1CFC A;  1CDL A;  2ZRT A;  3GK2 A;  2CBL A;  3O2P A;  3KEV A;  4PE0 A;  3VRR A;  3V2L A;  1QTX A;  1J7O A;  1PSR A;  1CTR A;  3O6B A;  1UHH A;  2LMV A;  1OOH A;  3O4Y A;  2L5X B;  3CZ2 A;  2AMI A;  3I5H C;  3NGV A;  2LP3 A;  2WND A;  2EC6 B;  4MVF A;  1OOG A;  1S36 A;  2K60 A;  2QEB A;  3TDU A;  1WLZ A;  1SL8 A;  1DQE A;  3K1E A;  1LXF C;  3GK1 A;  1A29 A;  4CID A;  2QEH A;  3FWC A;  1BJF A;  2V53 A;  3M0W A;  2GTE A;  2P70 A;  2KQY A;  1YR5 A;  1DMO A;  2B1U A;  2OS8 C;  5B8I B;  1BR4 B;  2COL B;  2JQ6 A;  1NPQ A;  3FIA A;  2LLT A;  2FCD A;  1L2O C;  2JC2 A;  1YRU B;  2M7L A;  2PYQ A;  2BKH B;  2KI4 B;  2JWW A;  4JQ0 D;  1DTL A;  1IH0 A;  1DJG A;  1CFD A;  1BLQ A;  1DEK A;  3PN7 C;  3I5I C;  2Y5I A;  2MRD A;  2I7A A;  2GGZ A;  2L4H A;  4WQ2 A;  5HKY A;  1BF5 A;  1TWO A;  3LK0 A;  1XFV O;  3F45 A;  1GGZ A;  1J1D A;  2SCP A;  1NYA A;  2LNK A;  1XO5 A;  2LC5 A;  2CTN A;  3TZ1 A;  3I5G C;  3DVJ A;  3QME A;  4MRX A;  1ZAC A;  1V1F A;  2CT9 A;  1F4Q A;  1TUZ A;  1OOF A;  1PUL A;  3B6X A;  2OPO A;  4INX A;  3DVE A;  2WCM A;  3KF9 A;  3TUY C;  1E8A A;  4M2O A;  2LLS A;  2MJW B;  1OMR A;  1UHN A;  4OZD A;  5EL2 A;  5PAL A;  1S26 D;  1QV1 A;  4CFQ A;  3D78 A;  1IJ6 A;  1TCO B;  4N1G A;  1KQV A;  3CGA A;  1RRO A;  2KHN A;  1MWN A;  2ZFD A;  1QXP A;  1UHJ A;  1J1E A;  1RJV A;  1FBV A;  1KWO C;  2F8P A;  2LMT A;  3FE9 A;  4YGB B;  1N0Y A;  5AEQ A;  4BY4 A;  1L7Z A;  4CPV A;  1YRT B;  2LUC A;  1BOD A;  1C3Y A;  1UUR A;  1Z4H A;  2IS9 A;  1JFK A;  1S1E A;  3PM2 A;  3VRQ A;  3ZNI A;  1DGU A;  2KLE A;  3DD4 A;  4GAO A;  5CSI A;  1XA5 A;  2ZN9 A;  4GGF A;  4N1F A;  1NCZ A;  5I94 A;  1ZMZ A;  4XJK B;  3TS5 B;  1MQ1 A;  1CLB A;  3PLF B;  2K61 A;  1BU3 A;  1SY9 A;  1IWQ A;  5AER A;  2BEC A;  2BBN A;  1CDP A;  1C3Z A;  1AHR A;  2BL0 C;  3CR5 X;  1YUS A;  2AAO A;  5DKQ A;  1IJ5 A;  1WLM A;  5HYD A;  2F2P A;  3EG5 B;  2KYF A;  1NX2 A;  3Q8I A;  1M45 A;  3WXA A;  3VRO A;  2NLN A;  3NHI A;  2M49 B;  1TTX A;  4MN0 A;  2LVV A;  1QLS A;  3CS1 A;  3GOF A;  3N7H A;  1SMG A;  3B87 A;  5ER5 A;  2F3Z A;  4HRE E;  4INW A;  4MEW A;  4OVN F;  4ORB B;  2JT0 A;  2PAS A;  1XFY O;  3JTD B;  1S3P A;  2L51 A;  4PHM A;  4FQO A;  2PMY A;  4I5J A;  1CKK A;  3I5H B;  3PM8 A;  3AKB A;  2KQ6 A;  2JTT A;  1CMG A;  2I2R E;  1B8C A;  1KK7 Z;  1WRK A;  3DF0 A;  2QAC A;  4I5K A;  4I5N B;  2K7D A;  5TNC A;  1W9Z A;  2EHB A;  4F7F A;  2ZNE A;  2NXQ A;  1BMO A;  5DKR A;  1OMV A;  4GGF C;  4OCI A;  1SL7 A;  1XFR A;  3CAB A;  2E6W A;  1NCY A;  1DF0 B;  2OS8 B;  4PHN A;  1KK7 Y;  4MZJ A;  3EK4 A;  2BBM A;  2KI6 C;  5D3O A;  1TIZ A;  1XK4 C;  2K8M B;  5BPJ A;  5I2Q A;  3CR2 A;  1L2O B;  1GM0 A;  3EK8 A;  4NQG A;  4QJ5 B;  1R2U A;  3VGO A;  1D1O A;  2NCP A;  1LKJ A;  3DZT A;  4I5L B;  1CB1 A;  1NX3 A;  2WCF A;  2LE9 B;  2F3Y A;  3I5I B;  1DJY A;  3PN7 B;  2KI6 D;  2L2E A;  1SR6 C;  1ZFS A;  2JXL A;  2ZRS A;  1SPY A;  1XFW O;  4P2Y B;  5DIC A;  1XFZ O;  3VB1 A;  4BY5 A;  3BQ3 A;  3L4L A;  2LV7 A;  3NSO A;  2JPT A;  1FPW A;  1BG1 A;  2M3W A;  3CLN A;  2NCO A;  1F4O A;  1HT9 A;  1KFX L;  2JOJ A;  1KSM A;  2PAL A;  5HLO A;  4DS7 A;  3I5G B;  1XFU O;  2Q4U A;  1OE9 B;  4JD9 A;  1SL9 A;  3PFV A;  4PDZ A;  5HKW A;  1NWD A;  3RZS A;  1S6J A;  2LVK A;  1KK8 B;  3BFA A;  3R72 A;  1DJH A;  3TUY B;  3BUN B;  5CSF A;  2P6B B;  2WC8 A;  1M31 A;  1Y1A A;  3D77 A;  4GBA A;  1QIW A;  4YI9 A;  2WCJ A;  4A4B A;  2KBI A;  1YX8 A;  3S0G A;  2LMU A;  2M1U A;  3AAJ A;  4U8D A;  1M63 B;  3AAK A;  1F70 A;  1YTZ C;  3SS3 A;  1QIV A;  2LLU A;  4GGN A;  1DVI A;  3CYZ A;  1KWO B;  3BJH A;  3DVK A;  1SKT A;  3D0Y A;  1R6P A;  1ZUZ A;  1SYM A;  1UHI A;  2OTG C;  1GJY A;  1Y1U A;  2R2I A;  4DRW A;  3PAT A;  5IBW A;  2LUX A;  1J7R A;  4F0Z B;  3NSL A;  4KYN A;  2KDH A;  5CSN A;  2PQL A;  2MAZ A;  4PHJ A;  3S0F A;  1WDC C;  2WCB A;  2K7B A;  3D73 A;  2EGD A;  1T14 A;  4HRH A;  2JT8 A;  1SCV A;  3B7A A;  3BUX B;  1FW4 A;  1M39 A;  1N2D A;  3QRX A;  4GPL B;  4MZK A;  3EVV A;  1P28 A;  1TNW A;  3BFB A;  4R1E A;  1Y1X A;  1KQM C;  1TRF A;  3O4X A;  1OSA A;  2GGM A;  1OZS A;  1NCX A;  2FOT A;  2JPO A;  2BCB A;  1TNQ A;  3DVM A;  2QPT A;  3L47 A;  3S0E A;  4AQI A;  1QVI Z;  1AVS A;  2BL0 B;  1GQM A;  2LHI A;  3A8R A;  1DEL A;  3B86 A;  2BCA A;  2BCX A;  3KPX A;  1RWY A;  1CFF A;  4N5X A;  1S6C A;  1B9A A;  2H2K A;  4ZCU A;  1N65 A;  1FI6 A;  1QLK A;  4L9M A;  2HQ8 A;  2YGU A;  1MXE A;  3FS7 A;  1G8I A;  5D7F A;  5I2L A;  1QVI Y;  3NXA A;  1MXL C;  4YGD B;  1EG3 A;  2DOQ A;  4C0K A;  1TOP A;  1QAT A;  3VRP A;  5F6T A;  1WY9 A;  2M7N A;  3SIA A;  4GNK B;  1RTP 1;  3SG3 A;  3RM1 A;  2KFH A;  1SBJ A;  1OQP A;  1SNL A;  1Z2C B;  2JU0 A;  3L4A A;  1BR1 B;  2KGR A;  3MSE B;  4NDD A;  1K9P A;  1YUR A;  1SSE B;  2KOT A;  2L50 A;  1AUI B;  4P5O E;  1CLL A;  4PHK A;  5CSJ A;  4JWQ A;  2WOR A;  1K93 D;  1Q80 A;  1XYD A;  2D8N A;  3EKH A;  2WCH A;  2KAY A;  1PSB A;  1NP8 A;  2M1K B;  1OOJ A;  1K9K A;  2FJU B;  1B7T Z;  2FCE A;  1C07 A;  1YUU A;  3LL8 B;  2LCP A;  4Q04 A;  4QJ4 B;  5JJG A;  3A4U B;  3CZ1 A;  1B8L A;  3UO9 A;  3OB1 B;  3BOW B;  2K7O A;  1H4B A;  2WC6 A;  4AQJ A;  3SG6 A;  1QX7 A;  2H61 A;  2MLE C;  3OGN A;  2MLF C;  3EK7 A;  2WOS A;  1IQ3 A;  1LVC D;  4WRI A;  1B7T Y;  1SCM C;  2F33 A;  1KFU L;  5I8N A;  1MR8 A;  1C7V A;  2LP2 A;  3GK4 X;  2WCK A;  3BUW B;  2K2A A;  3PAL A;  3NHT A;  3SG4 A;  1SR6 B;  1CMF A;  1JWD A;  3K21 A;  4ORA B;  1UHK A;  1AJ4 A;  3DY9 A;  3B88 A;  1FF1 A;  1CLM A;  3BUM B;  2KFG A;  3D74 A;  5G08 A;  2BE6 A;  1DJI A;  2HPS A;  2I18 A;  1REC A;  3OX5 A;  4C0L A;  3OHM B;  5AAN A;  3BFH A;  2KFF A;  2CNP A;  3ZWH A;  4PE7 A;  4PT1 A;  2JRF A;  4OV2 A;  1A4P A;  3JVT C;  2M29 A;  4M2P A;  1KFU S;  1U5I B;  3EVR A;  2Y1N A;  1A75 B;  4GUK A;  3S0D A;  5CPV A;  2Y1M A;  1ALV A;  1QS7 A;  3LCP C;  1YUT A;  2GV5 A;  2SAS A;  2G2B A;  2LVJ A;  2NZ0 A;  3I5F C;  1PK0 D;  2JNF A;  4A4C A;  3WNX B;  1G4Y R;  3EKJ A;  4YRU A;  4FQT A;  1F55 A;  1B47 A;  1RFJ A;  2LVI A;  2OTG B;  1LIN A;  3FWB A;  4PE4 A;  4PCW A;  1F8H A;  3CR4 X;  3OX6 A;  3BXK A;  2HF5 A;  2H61 C;  4IJ7 A;  5FI2 A;  1PAL A;  3SG5 A;  1ODB A;  3OBV A;  1WDC B;  1YX7 A;  2WCE A;  5ER4 X;  2LAP A;  2MA2 A;  2K7C A;  1QV0 A;  2QDI A;  1CM1 A;  2L98 A;  2M0R A;  2JZI A;  2M8U A;  3S0B A;  3ICB A;  4DCK A;  1MHO A;  1H8B A;  1KQM B;  2M9G A;  3CDN A;  1IGV A;  1QWV A;  1SK6 D;  2F2O A;  3FE8 A;  1PVB A;  3TDI A;  1YVL A;  3SS5 A;  2TN4 A;  2HET A;  1DJX A;  4HRG A;  5KTY A;  1AK8 A;  1V1G A;  3JTD C;  3BYA A;  2BE4 A;  3SG7 A;  4NDC A;  2MHH A;  1B1G A;  1IKU A;  3IVT A;  1FI5 A;  1M46 A;  4MSP A;  3AKA A;  5FI6 A;  2CXJ A;  2I94 A;  3D75 A;  3DYE A;  1CFP A;  3SIB A;  1NX1 A;  4YGC B;  1JFJ A;  1QX5 B;  1KFX S;  4D1E A;  1DC1 A;  1K2H A;  2BAP A;  3FE6 A;  3O78 A;  4IL1 A;  1AP4 A;  1A2X A;  2QEO A;  1B4C A;  1Y6W A;  4WQ3 A;  5JOL A;  1C7W A;  2E30 A;  5HL1 A;  1K94 A;  4NDB A;  1VRK A;  2L4I A;  1B8R A;  2KAX A;  3IQO A;  2BNX A;  3D0Y B;  2ISD A;  1TUJ A;  1PRW A;  1SW8 A;  1JUO A;  4YGE B;  3UNW A;  3H4S E;  3WHT B;  4QJ3 B;  4OKH A;  1GGW A;  3CZ0 A;  1IQ5 A;  1JSA A;  2KGB C;  1TNP A;  4JPZ B;  1K9U A;  4GFT A;  1MUX A;  2QEV A;  1EH2 A;  1DJZ A;  2HQW A;  1OW4 A;  3HCM A;  4USL A;  4YI8 A;  1HQV A;  2ZN8 A;  2K2F A;  2LAN A;  2EC6 C;  1F71 A;  3S0A A;  1UWO A;  2L5Y A;  2PVB A;  1S5G Z;  4MBE A;  1S6I A;  5HLV A;  1NUB A;  1DGV A;  2ERB A;  1J7P A;  3WHU B;  1QX2 A;  4AOM A;  2K0J A;  1DJW A;  1KK8 C;  2H8V A;  2L0P A;  3SG2 A;  1W7J B;  3OP0 A;  2AUC A;  1ORG A;  5FYX A;  5KSZ A;  1SCM B;  2JXC A;  3NSI A;  2PRU A;  1BT6 A;  2KNE A;  4DIR A;  3CTN A;  5AFP A;  3OB2 B;  1KSO A;  1S5G Y;  4MRY A;  2JTZ A;  2O5G A;  4UPG A;  3CZT X;  3NSK A;  1TN4 A;  3SJS A;  1NSH A;  2KI4 C;  4JKT A;  3C1V A;  5I2O A;  4TNC A;  4CLN A;  2KLD A;  1IIO A;  4XJK A;  5DKN A;  4OR9 B;  1EL4 A;  1XFX O;  5KU1 A;  2ZND A;  1CDN A;  2Q91 A;  1LA3 A;  2KBM A;  3JVT B;  2KPH A;  3PJI A;  3E3R A;  1UP5 A;  3LK1 A;  2Y4Q A;  4ORC B;  5D69 A;  2JNX A;  1CDM A;  1ZOT B;  5J3X A;  3RLZ A;  1JF2 A;  3VRN A;  1IRJ A;  2M97 A;  4XYN A;  3SS4 A;  1UUS A;  1OOI X;  3R1V A;  1EXR A;  2CCM A;  4C0J A;  1ALW A;  3BOW A;  3IQQ A;  1XK4 A;  3I5F B;  4PAL A;  1WRZ A;  4E68 A;  1TNX A;  4PE1 A;  1K96 A;  2A4J A; 
#chains in the Genus database with same CATH homology
 2JUL A;  1OMD A;  1J7Q A;  4YGA A;  1EJ3 A;  1J55 A;  3EVU A;  1OZO A;  1K8U A;  1NX0 A;  2LM5 A;  1XVJ A;  3HX4 A;  1JC2 A;  3KO0 A;  1LA0 A;  1RK9 A;  1BOC A;  2PSR A;  1YVH A;  3D10 A;  1WRL A;  2KSP A;  1AJ5 A;  3KHE A;  1KCY A;  1NIW A;  2RGI A;  1IG5 A;  1X02 A;  1CNP A;  3DF0 B;  1EG4 A;  2G9B A;  1W7I B;  5HKZ A;  2KYC A;  4HSZ A;  1DT7 B;  4MZL A;  1F54 A;  1Y0V H;  2JT3 A;  1JF0 A;  2BKI B;  4MLW A;  1DF0 A;  1SRA A;  5GQQ C;  2ZKM X;  4ZCV A;  3TS5 C;  1A03 A;  3IF7 A;  4YBH B;  4M2Q A;  1U5I A;  2KAV A;  1A75 A;  4ETO A;  5K89 A;  1QJT A;  4ICB A;  2O60 A;  5AXI A;  4FTG A;  1K90 D;  3TDZ A;  2MBX A;  1G33 A;  3BUO B;  4DUQ A;  2VRG A;  1K95 A;  1MF8 B;  3PSR A;  1TCF A;  2LHL A;  4CFR A;  3LLE A;  1JBA A;  1QAS A;  1CM4 A;  3CWG A;  1PVA A;  1CFC A;  1CDL A;  2ZRT A;  3GK2 A;  2CBL A;  3O2P A;  3KEV A;  4PE0 A;  3VRR A;  1J7O A;  1QTX A;  1PSR A;  1CTR A;  3O6B A;  1UHH A;  2LMV A;  3O4Y A;  2L5X B;  2AMI A;  3I5H C;  2LP3 A;  2WND A;  2EC6 B;  4MVF A;  3TDU A;  1S36 A;  1WLZ A;  1SL8 A;  1LXF C;  3GK1 A;  1A29 A;  4CID A;  3FWC A;  1BJF A;  2V53 A;  3M0W A;  2KQY A;  1YR5 A;  1DMO A;  2B1U A;  2OS8 C;  5B8I B;  1BR4 B;  2COL B;  2JQ6 A;  1NPQ A;  3FIA A;  2LLT A;  2FCD A;  1L2O C;  2JC2 A;  1YRU B;  2M7L A;  2BKH B;  2KI4 B;  2JWW A;  4JQ0 D;  1DTL A;  1IH0 A;  1DJG A;  1CFD A;  1BLQ A;  3PN7 C;  3I5I C;  2Y5I A;  2MRD A;  2I7A A;  2GGZ A;  2L4H A;  4WQ2 A;  5HKY A;  1BF5 A;  3LK0 A;  1XFV O;  3F45 A;  1GGZ A;  1J1D A;  2SCP A;  1NYA A;  2LNK A;  1XO5 A;  2LC5 A;  2CTN A;  3TZ1 A;  3I5G C;  3DVJ A;  4MRX A;  1ZAC A;  1V1F A;  2CT9 A;  1F4Q A;  1PUL A;  2OPO A;  3DVE A;  3KF9 A;  3TUY C;  1E8A A;  4M2O A;  2LLS A;  2MJW B;  1OMR A;  1UHN A;  5PAL A;  1S26 D;  1QV1 A;  4CFQ A;  1IJ6 A;  1TCO B;  4N1G A;  1KQV A;  3CGA A;  1RRO A;  2KHN A;  1MWN A;  2ZFD A;  1QXP A;  1UHJ A;  1J1E A;  1RJV A;  1FBV A;  1KWO C;  2F8P A;  2LMT A;  4YGB B;  1N0Y A;  5AEQ A;  4BY4 A;  1L7Z A;  4CPV A;  1YRT B;  2LUC A;  1BOD A;  1UUR A;  2IS9 A;  3VRQ A;  1JFK A;  1S1E A;  3ZNI A;  1DGU A;  3DD4 A;  4GAO A;  5CSI A;  1XA5 A;  2ZN9 A;  4GGF A;  4N1F A;  1NCZ A;  1CLB A;  1ZMZ A;  4XJK B;  3TS5 B;  1MQ1 A;  3PLF B;  2K61 A;  1BU3 A;  1SY9 A;  1IWQ A;  5AER A;  2BEC A;  2BBN A;  1CDP A;  1AHR A;  2BL0 C;  3CR5 X;  1YUS A;  2AAO A;  5DKQ A;  1IJ5 A;  1WLM A;  5HYD A;  2F2P A;  2KYF A;  1NX2 A;  1M45 A;  3WXA A;  3VRO A;  2NLN A;  2M49 B;  1TTX A;  4MN0 A;  2LVV A;  1QLS A;  3CS1 A;  3GOF A;  1SMG A;  5ER5 A;  2F3Z A;  4HRE E;  4MEW A;  4OVN F;  4ORB B;  2JT0 A;  2PAS A;  1XFY O;  3JTD B;  1S3P A;  2L51 A;  4PHM A;  4FQO A;  2PMY A;  4I5J A;  1CKK A;  3I5H B;  3PM8 A;  3AKB A;  2KQ6 A;  2JTT A;  1CMG A;  2I2R E;  1B8C A;  1KK7 Z;  1WRK A;  3DF0 A;  2QAC A;  4I5K A;  4I5N B;  2K7D A;  5TNC A;  2EHB A;  2ZNE A;  2NXQ A;  1BMO A;  5DKR A;  1OMV A;  4GGF C;  4OCI A;  1SL7 A;  2E6W A;  1NCY A;  1DF0 B;  2OS8 B;  4PHN A;  1KK7 Y;  4MZJ A;  3EK4 A;  2BBM A;  2KI6 C;  1TIZ A;  1XK4 C;  2K8M B;  5BPJ A;  5I2Q A;  3CR2 A;  1L2O B;  3EK8 A;  4NQG A;  4QJ5 B;  1R2U A;  3VGO A;  1D1O A;  2NCP A;  1LKJ A;  4I5L B;  1CB1 A;  1NX3 A;  2WCF A;  2LE9 B;  2F3Y A;  3I5I B;  1DJY A;  3PN7 B;  2KI6 D;  2L2E A;  1SR6 C;  1ZFS A;  2JXL A;  2ZRS A;  1SPY A;  1XFW O;  4P2Y B;  4BY5 A;  1XFZ O;  3BQ3 A;  1FPW A;  2LV7 A;  3NSO A;  2JPT A;  1BG1 A;  2M3W A;  3CLN A;  2NCO A;  1F4O A;  1HT9 A;  1KFX L;  2JOJ A;  1KSM A;  2PAL A;  5HLO A;  4DS7 A;  3I5G B;  1XFU O;  2Q4U A;  1OE9 B;  4PDZ A;  1SL9 A;  3PFV A;  5HKW A;  1NWD A;  1S6J A;  2LVK A;  1KK8 B;  1DJH A;  3TUY B;  3BUN B;  5CSF A;  2P6B B;  2WC8 A;  1M31 A;  1Y1A A;  4GBA A;  1QIW A;  4YI9 A;  4A4B A;  2KBI A;  1YX8 A;  2LMU A;  2M1U A;  3AAJ A;  4U8D A;  1M63 B;  3AAK A;  1F70 A;  1YTZ C;  1QIV A;  2LLU A;  4GGN A;  1DVI A;  1KWO B;  3DVK A;  1SKT A;  3D0Y A;  1R6P A;  1ZUZ A;  1SYM A;  1UHI A;  2OTG C;  1GJY A;  1Y1U A;  2R2I A;  4DRW A;  3PAT A;  5IBW A;  2LUX A;  1J7R A;  4F0Z B;  3NSL A;  2KDH A;  5CSN A;  2MAZ A;  4PHJ A;  1WDC C;  2WCB A;  2K7B A;  2EGD A;  4HRH A;  2JT8 A;  1SCV A;  3BUX B;  1FW4 A;  1M39 A;  1N2D A;  3QRX A;  4GPL B;  4MZK A;  3EVV A;  1TNW A;  4R1E A;  1Y1X A;  1KQM C;  1TRF A;  1OSA A;  2GGM A;  1OZS A;  1NCX A;  2FOT A;  2BCB A;  1TNQ A;  3DVM A;  2QPT A;  4AQI A;  1QVI Z;  1AVS A;  2BL0 B;  1GQM A;  2LHI A;  3A8R A;  3KPX A;  2BCA A;  2BCX A;  1CFF A;  1RWY A;  4N5X A;  1S6C A;  1B9A A;  2H2K A;  4ZCU A;  1N65 A;  1FI6 A;  1QLK A;  4L9M A;  2HQ8 A;  1MXE A;  3FS7 A;  1G8I A;  5D7F A;  5I2L A;  1QVI Y;  3NXA A;  1MXL C;  4YGD B;  1EG3 A;  2DOQ A;  4C0K A;  1TOP A;  1QAT A;  3VRP A;  5F6T A;  1WY9 A;  2M7N A;  3SIA A;  4GNK B;  1RTP 1;  3SG3 A;  3RM1 A;  2KFH A;  1SBJ A;  1OQP A;  1SNL A;  2JU0 A;  3MSE B;  4NDD A;  1BR1 B;  2KGR A;  4PHK A;  1K9P A;  1YUR A;  2KOT A;  2L50 A;  5CSJ A;  1AUI B;  4P5O E;  1CLL A;  4JWQ A;  2WOR A;  1K93 D;  1Q80 A;  1XYD A;  2D8N A;  3EKH A;  2KAY A;  1PSB A;  1NP8 A;  2M1K B;  1OOJ A;  1K9K A;  2FJU B;  1B7T Z;  2FCE A;  1C07 A;  1YUU A;  3LL8 B;  2LCP A;  4Q04 A;  4QJ4 B;  5JJG A;  3A4U B;  1B8L A;  3OB1 B;  3BOW B;  2K7O A;  1H4B A;  4AQJ A;  3SG6 A;  1QX7 A;  2H61 A;  2MLE C;  2MLF C;  3EK7 A;  2WOS A;  1IQ3 A;  1LVC D;  4WRI A;  1B7T Y;  1SCM C;  2F33 A;  1KFU L;  5I8N A;  1MR8 A;  1C7V A;  2LP2 A;  3GK4 X;  3BUW B;  3PAL A;  2K2A A;  3SG4 A;  1CMF A;  1JWD A;  1SR6 B;  3K21 A;  4ORA B;  1UHK A;  1AJ4 A;  1FF1 A;  1CLM A;  3BUM B;  2KFG A;  5G08 A;  2BE6 A;  1DJI A;  2HPS A;  2I18 A;  1REC A;  3OX5 A;  4C0L A;  3OHM B;  5AAN A;  2KFF A;  2CNP A;  3ZWH A;  4PE7 A;  2JRF A;  4OV2 A;  1A4P A;  3JVT C;  2M29 A;  4M2P A;  1KFU S;  1U5I B;  3EVR A;  2Y1N A;  1A75 B;  4GUK A;  5CPV A;  2Y1M A;  1ALV A;  1QS7 A;  3LCP C;  1YUT A;  2GV5 A;  2SAS A;  2G2B A;  2LVJ A;  2NZ0 A;  3I5F C;  1PK0 D;  2JNF A;  4A4C A;  3WNX B;  1G4Y R;  3EKJ A;  4YRU A;  1F55 A;  1B47 A;  1RFJ A;  2LVI A;  2OTG B;  1LIN A;  3FWB A;  4PE4 A;  4PCW A;  1F8H A;  3CR4 X;  3OX6 A;  3BXK A;  2HF5 A;  2H61 C;  1PAL A;  3SG5 A;  1ODB A;  1WDC B;  1YX7 A;  2WCE A;  5ER4 X;  2LAP A;  2MA2 A;  2K7C A;  1QV0 A;  1CM1 A;  2L98 A;  2M0R A;  2JZI A;  2M8U A;  4DCK A;  3ICB A;  1MHO A;  1H8B A;  1KQM B;  2M9G A;  1IGV A;  2F2O A;  1SK6 D;  3TDI A;  1PVB A;  1YVL A;  2TN4 A;  2HET A;  1DJX A;  4HRG A;  5KTY A;  1AK8 A;  1V1G A;  3JTD C;  3BYA A;  2BE4 A;  3SG7 A;  4NDC A;  2MHH A;  1B1G A;  1IKU A;  1FI5 A;  1M46 A;  4MSP A;  3AKA A;  2CXJ A;  2I94 A;  1CFP A;  3SIB A;  1NX1 A;  4YGC B;  1JFJ A;  1QX5 B;  1KFX S;  4D1E A;  1K2H A;  3O78 A;  4IL1 A;  1AP4 A;  1A2X A;  1B4C A;  1Y6W A;  4WQ3 A;  5JOL A;  1C7W A;  2E30 A;  1K94 A;  4NDB A;  1VRK A;  2L4I A;  1B8R A;  2KAX A;  3IQO A;  3D0Y B;  2ISD A;  1PRW A;  1SW8 A;  1JUO A;  4YGE B;  3H4S E;  3WHT B;  4QJ3 B;  4OKH A;  1GGW A;  1IQ5 A;  1JSA A;  2KGB C;  1TNP A;  4JPZ B;  1K9U A;  4GFT A;  1MUX A;  1EH2 A;  1DJZ A;  2HQW A;  4USL A;  3HCM A;  4YI8 A;  1HQV A;  2ZN8 A;  2K2F A;  2LAN A;  2EC6 C;  1F71 A;  1UWO A;  2PVB A;  1S5G Z;  4MBE A;  1S6I A;  5HLV A;  1NUB A;  1DGV A;  1J7P A;  3WHU B;  1QX2 A;  4AOM A;  2K0J A;  1DJW A;  1KK8 C;  2L0P A;  3SG2 A;  1W7J B;  3OP0 A;  2AUC A;  5KSZ A;  5FYX A;  1SCM B;  2JXC A;  3NSI A;  2PRU A;  1BT6 A;  2KNE A;  4DIR A;  3CTN A;  5AFP A;  3OB2 B;  1KSO A;  1S5G Y;  4MRY A;  2JTZ A;  2O5G A;  4UPG A;  3CZT X;  3NSK A;  1TN4 A;  3SJS A;  1NSH A;  2KI4 C;  3C1V A;  5I2O A;  4TNC A;  4CLN A;  4XJK A;  5DKN A;  4OR9 B;  1EL4 A;  1XFX O;  5KU1 A;  2ZND A;  1CDN A;  2Q91 A;  1LA3 A;  2KBM A;  3JVT B;  3E3R A;  1UP5 A;  3LK1 A;  2Y4Q A;  4ORC B;  5D69 A;  2JNX A;  1CDM A;  1ZOT B;  5J3X A;  3RLZ A;  1JF2 A;  3VRN A;  1IRJ A;  2M97 A;  4XYN A;  1UUS A;  1EXR A;  2CCM A;  4C0J A;  1ALW A;  3BOW A;  3IQQ A;  1XK4 A;  3I5F B;  4PAL A;  1WRZ A;  4E68 A;  1TNX A;  4PE1 A;  1K96 A;  2A4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...