4YI8A

Crystal structure of non-myristoylated e153a recoverin at 1.2 a resolution with calcium ions bound to ef-hands 2 and 3
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
b'GALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAAKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title Crystal Structure of Recoverin with Calcium Ions Bound to Both Functional EF Hands.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium binding protein
total genus 71
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2015-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yi8A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yi8A01
3DD4A 1YRTB 1F70A 2K2FA 5J3XA 1XFYO 3TDIA 2OS8C 1J7PA 1EJ3A 2A4JA 3EKHA 5CSNA 2HQ8A 1AK8A 2GGMA 5HLOA 2MLEC 1QVIY 1H8BA 3I5HC 1CDMA 1IG5A 1FI5A 4E68A 1NX2A 1K95A 1DJHA 5IBWA 1JSAA 1ZOTB 1A75B 1CNPA 5F6TA 1S5GZ 4MVFA 3GK2A 1C7WA 2KQYA 3JTDB 2WNDA 1UP5A 2K61A 2LC5A 3IQOA 2BL0B 3CR5X 1YX7A 2M1KB 2KOTA 2HPSA 2WC8A 2JPTA 1AJ5A 1IRJA 3JVTC 4I5NB 2G9BA 1XK4A 1DF0B 3FWBA 3PATA 1SY9A 2JNXA 2Y5IA 1OZOA 4PE0A 1YVHA 2PVBA 1Y1UA 2KGBC 4PHMA 4USLA 3VRQA 1G8IA 1K9PA 1DGUA 2BCBA 1B8RA 1OMDA 1CFDA 3SG3A 2JT3A 2ZN8A 1DJZA 1NX1A 2LCPA 2LVVA 3SG5A 1A03A 2MBXA 2LMUA 1YTZC 1QXPA 3CR4X 4WRIA 2JOJA 2PMYA 2NCPA 1B7TZ 2OS8B 1UWOA 2CCMA 1CFFA 2CNPA 4FQOA 2AAOA 1SR6C 2B1UA 3LLEA 3I5HB 4YI8A 5CSFA 2CBLA 5AERA 2LP3A 4CPVA 5D7FA 4DS7A 2LLUA 1DGVA 1N0YA 1JUOA 1IQ5A 3TUYC 1QIWA 2BE4A 2JTTA 5HLVA 1B47A 1DTLA 1F4OA 1JFJA 1NIWA 3EVRA 2JT0A 4ORAB 1UURA 1BODA 1KQVA 2KI6C 1RECA 4QJ3B 4YI9A 4JPZB 1J7OA 4CLNA 4WQ3A 3TDZA 1ZUZA 1FF1A 4GNKB 1TCFA 3JVTB 1XK4C 2CTNA 2JRFA 2L98A 2BBNA 1DJYA 2GV5A 1F71A 1G33A 1QLKA 2KHNA 2O5GA 3SIAA 3E3RA 1BF5A 1WY9A 2K7BA 3BYAA 1NUBA 2Y1MA 1MUXA 2I2RE 3QRXA 3TZ1A 2V53A 4R1EA 3GK1A 2KYFA 1KWOB 1H4BA 1QLSA 4C0LA 2JTZA 4MZLA 3EK8A 1MXLC 4F0ZB 2VRGA 3DVEA 4ETOA 2BKHB 1MXEA 2Y4QA 1AVSA 4GGNA 1MQ1A 1YUUA 2KI4C 1NPQA 4IL1A 2KBMA 2PSRA 4L9MA 3PALA 1NSHA 2BCAA 1QX5B 1MHOA 3AKBA 2D8NA 1SR6B 1KK7Z 1C7VA 2K0JA 2JT8A 2QACA 4DIRA 2JU0A 1K8UA 3ZNIA 5DKRA 3M0WA 2KFFA 1K96A 2L50A 3H4SE 2MLFC 2LMTA 2MA2A 1FI6A 3BOWA 2F3ZA 2PASA 2WORA 1ZMZA 4N1GA 1IKUA 2ISDA 5AANA 1PALA 1KQMC 1ZACA 4DRWA 1B8LA 2AMIA 2KDHA 1LXFC 2LV7A 4ZCVA 1LKJA 1NP8A 2KNEA 2BKIB 1IH0A 2K7OA 1DMOA 2LLSA 4AOMA 1KCYA 1K9UA 2RGIA 2FJUB 1BLQA 3EK7A 3VRPA 2M9GA 1SCMB 2M7LA 2EHBA 5AXIA 1IJ5A 4U8DA 1V1FA 4JWQA 3EKJA 2JULA 3DF0B 5HKWA 1QASA 2L2EA 1F54A 4D1EA 4YGDB 1QX2A 3SG2A 1CLBA 2EC6C 2KFHA 2KAXA 4PDZA 4A4BA 5KU1A 3I5GC 1XFXO 3I5IC 5JJGA 1S6CA 2HF5A 4CIDA 1WRLA 5CPVA 1TNWA 4PE1A 1IJ6A 1S1EA 1XFZO 1EG3A 1CDNA 5GQQC 2R2IA 1WDCC 2P6BB 5FYXA 5KSZA 3NSLA 1R6PA 1SW8A 1NWDA 3IQQA 1NYAA 1U5IA 1SYMA 3A8RA 1NCZA 2WCFA 4MLWA 2F3YA 3TS5B 1JC2A 3FIAA 1FW4A 5KTYA 4GFTA 3WXAA 1RWYA 1YR5A 3PN7C 1BU3A 1PULA 4PHNA 4Q04A 3NSKA 3BUNB 3PSRA 5JOLA 2FOTA 2BCXA 2IS9A 3KF9A 2K7CA 1XYDA 5I8NA 2LLTA 2WCBA 4ORBB 3KO0A 2SASA 1XVJA 3CGAA 2I94A 2LNKA 4MZJA 3I5FB 3WHTB 1CMFA 3SG4A 4JQ0D 3SG7A 1L2OC 2LHLA 2KAYA 1ALVA 2KI6D 1CB1A 1K9KA 1PRWA 3PFVA 2KAVA 3CS1A 4NDBA 3O78A 2GGZA 2DOQA 1EL4A 2FCDA 5CSJA 1B4CA 1M31A 4AQIA 3D0YA 2G2BA 5CSIA 1TN4A 4HREE 2EGDA 2EC6B 4YGCB 3DVKA 1EXRA 1NX3A 1J7QA 3I5GB 1RJVA 3F45A 1SNLA 2M8UA 3I5IB 1YRUB 1JBAA 1ALWA 1S5GY 3O2PA 1LA0A 1X02A 2KSPA 1SRAA 3CWGA 3PLFB 5I2QA 2LVKA 1CLLA 1CFPA 3TDUA 1JFKA 1BT6A 2F2PA 1S3PA 2OTGC 3OP0A 1TRFA 1F4QA 2MJWB 1PSBA 4MZKA 1WLMA 4ICBA 2LAPA 3BOWB 4OKHA 3PN7B 3AAKA 2JQ6A 1KFUL 5BPJA 1KK8C 3EK4A 3HX4A 1NCYA 2F2OA 1IWQA 2MAZA 1OE9B 4I5LB 4ZCUA 2KGRA 1D1OA 1QV0A 1W7JB 2M3WA 3VGOA 1CDPA 2M29A 4YGAA 1A2XA 1AHRA 2LVJA 1OQPA 2LVIA 1OMRA 3RLZA 1LINA 4M2OA 1TNXA 1NCXA 2NXQA 1QX7A 1KFUS 1KSOA 2LMVA 1B7TY 3LL8B 2Y1NA 3A4UB 4QJ5B 4OR9B 4GBAA 1RROA 3CR2A 1B8CA 1BJFA 1M39A 1QATA 5HKYA 1CMGA 1S26D 1GQMA 1QV1A 2JNFA 4M2PA 1CM4A 4C0JA 3TUYB 1MWNA 1QVIZ 3ICBA 1SMGA 3WNXB 1RK9A 1CDLA 3NXAA 1SL8A 1N2DA 1M45A 2M7NA 1F55A 1AUIB 1XFUO 3OB1B 2PRUA 1K90D 1SPYA 1CM1A 2M49B 4WQ2A 3JTDC 1U5IB 2ZN9A 1K93D 2OTGB 1TCOB 2NZ0A 1DJXA 1S6JA 3LCPC 1AP4A 2BL0C 4HRGA 1SL9A 2M1UA 2NLNA 1SK6D 2TN4A 3BUOB 3SIBA 1B1GA 5DKQA 2KFGA 2L0PA 4GGFA 5TNCA 1UHIA 2HQWA 4ORCB 2BBMA 2CT9A 4QJ4B 1YX8A 3BUMB 5AEQA 3DVJA 2WOSA 4CFQA 1S36A 1E8AA 1MR8A 1RTP1 2KI4B 3OB2B 3SJSA 1JWDA 5D69A 3VRNA 4BY5A 1R2UA 3AKAA 4M2QA 2H61A 1LVCD 4C0KA 1A29A 4NQGA 5HKZA 1GGWA 3KHEA 1Q80A 1BOCA 1KK7Y 2ZKMX 3D0YB 2ZFDA 3KEVA 1J55A 3FWCA 1M63B 4PHJA 4TNCA 3BQ3A 2K8MB 2K7DA 1XO5A 1A4PA 1HQVA 2MRDA 2SCPA 1SBJA 1K2HA 1OMVA 3KPXA 1UHNA 1SL7A 4OCIA 1YUTA 1CTRA 1EG4A 2K2AA 3VROA 1C07A 3OHMB 1UHJA 1TIZA 1KQMB 1KSMA 2LM5A 4XJKA 3ZWHA 2O60A 4XYNA 1PVBA 4MRYA 1F8HA 1QJTA 1EH2A 2L5XB 1ODBA 2AUCA 5DKNA 1BR1B 5I2OA 2I7AA 1Y6WA 1OSAA 5I2LA 1L7ZA 2L51A 4GGFC 1SCVA 2CXJA 1K94A 4MBEA 4N5XA 4GPLB 2ZNEA 2KQ6A 3AAJA 4GUKA 4CFRA 2BE6A 1CFCA 1NX0A 1KFXL 2WCEA 3EVUA 4MRXA 2E30A 5HYDA 1FBVA 2I18A 2Q4UA 1Y1AA 5K89A 1KWOC 1XFVO 1UUSA 1WRKA 2COLB 1GGZA 3O6BA 2JC2A 2M97A 3DF0A 3O4YA 4BY4A 3BUWB 3IF7A 4MEWA 2M0RA 2H61C 5B8IB 1CLMA 1N65A 2MHHA 1PSRA 3VRRA 3NSIA 4N1FA 1BR4B 1WDCB 2LANA 4YRUA 1A75A 1G4YR 1KFXS 3MSEB 1HT9A 1WLZA 4NDDA 1SKTA 4PALA 1RFJA 1QTXA 4HRHA 1J7RA 3BUXB 4DCKA 3OX6A 1YURA 4OV2A 1DJGA 5G08A 5PALA 1DF0A 1LA3A 2OPOA 3CLNA 1ZFSA 4YBHB 1S6IA 3CZTX 4HSZA 1FPWA 1B9AA 3LK0A 1TOPA 3K21A 1DT7B 2LP2A 1DJIA 2NCOA 3BXKA 1BG1A 4MSPA 4P5OE 1L2OB 1Y1XA 2ZNDA 1GJYA 1OOJA 1QS7A 2H2KA 3FS7A 2Q91A 4MN0A 3RM1A 1OZSA 3CTNA 2LUXA 3GOFA 1DJWA 1VRKA 4DUQA 3NSOA 1YUSA 1DVIA 2F8PA 1AJ4A 1UHHA 1WRZA 2BECA 1SCMC 3OX5A 1XFWO 4PHKA 1UHKA 5ER5A 1JF2A 2E6WA 2QPTA 4I5KA 3LK1A 1W7IB 4P2YB 3DVMA 2KBIA 1QIVA 4NDCA 1PK0D 4PE7A 4A4CA 4PCWA 2L4HA 2JXCA 1JF0A 4AQJA 2LHIA 1IQ3A 1XA5A 4YGEB 5AFPA 1TNPA 3PM8A 4GAOA 1J1DA 3GK4X 2JWWA 1PVAA 2PALA 2JZIA 1M46A 2FCEA 4I5JA 1Y0VH 3D10A 2LUCA 3SG6A 1YVLA 1KK8B 3TS5C 3EVVA 4FTGA 2KYCA 2F33A 4YGBB 1V1GA 4XJKB 2LE9B 2L4IA 2HETA 2JXLA 3HCMA 1BMOA 1IGVA 3C1VA 4OVNF 1MF8B 2ZRSA 3WHUB 4UPGA 5ER4X 3I5FC 1CKKA 4PE4A 1TNQA 2ZRTA 1TTXA 1J1EA
chains in the Genus database with same CATH superfamily
3DD4A 1YRTB 1F70A 2WCJA 2K2FA 5J3XA 1XFYO 2P70A 3TDIA 2OS8C 1J7PA 1EJ3A 2A4JA 3EKHA 5CSNA 2HQ8A 1AK8A 2GGMA 5HLOA 2MLEC 1QVIY 1H8BA 3I5HC 1CDMA 1IG5A 1FI5A 4E68A 1NX2A 1K95A 2WC6A 1DJHA 5IBWA 1JSAA 1ZOTB 1A75B 1CNPA 5F6TA 3S0BA 1S5GZ 4MVFA 3BFAA 3GK2A 1C7WA 1XFRA 2KQYA 2WCKA 3JTDB 2WNDA 1UP5A 2K61A 2LC5A 3IQOA 2BL0B 3CR5X 1YX7A 2M1KB 2KOTA 2HPSA 2BNXA 2WC8A 2JPTA 1AJ5A 1IRJA 3JVTC 4I5NB 2G9BA 1XK4A 1DF0B 3FWBA 3PATA 1SY9A 2JNXA 2Y5IA 1OZOA 4PE0A 1YVHA 1DQEA 2PVBA 1Y1UA 2KGBC 4PHMA 4USLA 3VRQA 2PYQA 1G8IA 1K9PA 1OOIX 1DGUA 2BCBA 1B8RA 1OMDA 1CFDA 3SG3A 2JT3A 2L2CA 2ZN8A 1DJZA 1NX1A 2LCPA 2LVVA 3SG5A 1A03A 1TUJA 2MBXA 2LMUA 1YTZC 1QXPA 3CR4X 4WRIA 2JOJA 1ORGA 2PMYA 3R72A 2NCPA 1B7TZ 2OS8B 1UWOA 2CCMA 1CFFA 2CNPA 2ERBA 4FQOA 2AAOA 1SR6C 2B1UA 3IVTA 3I5HB 3LLEA 4YI8A 5CSFA 2CBLA 5AERA 2LP3A 4CPVA 5D7FA 3S0DA 2LLUA 4DS7A 1DGVA 1N0YA 3VB1A 1JUOA 1IQ5A 3TUYC 1QIWA 2BE4A 3K1EA 2JTTA 5HLVA 1B47A 1DTLA 1F4OA 1JFJA 1NIWA 3EVRA 2JT0A 4ORAB 1UURA 1BODA 1KQVA 2KI6C 1RECA 3CDNA 4QJ3B 4JPZB 4YI9A 1J7OA 4CLNA 4WQ3A 3TDZA 1ZUZA 5HL1A 1FF1A 4GNKB 1TCFA 3JVTB 1XK4C 2CTNA 2JRFA 2L98A 2BBNA 1DJYA 2GV5A 1F71A 1G33A 1QLKA 2KHNA 2O5GA 3CZ0A 3E3RA 3NGVA 1WY9A 2K7BA 3BYAA 3L4AA 1NUBA 2Y1MA 1MUXA 2I2RE 3QRXA 3TZ1A 2V53A 4R1EA 3GK1A 2KYFA 3S0FA 1KWOB 1H4BA 1QLSA 4JKTA 4C0LA 2JTZA 4MZLA 3EK8A 1MXLC 4KYNA 4F0ZB 2VRGA 3DVEA 4ETOA 2BKHB 1MXEA 2Y4QA 1AVSA 4GGNA 1MQ1A 1YUUA 2KI4C 1NPQA 3OBVA 2KBMA 2PSRA 4IL1A 4L9MA 3PALA 3S0EA 1NSHA 2BCAA 2QEHA 1QX5B 1MHOA 3AKBA 2D8NA 1SR6B 3EG5B 1KK7Z 2WCLA 2K0JA 2JT8A 1C7VA 2QACA 4DIRA 2JU0A 3D77A 1K8UA 3ZNIA 5DKRA 3M0WA 2KFFA 1K96A 2L50A 3PM2A 3H4SE 2MLFC 2LMTA 2MA2A 3R1OA 1FI6A 3BOWA 2F3ZA 2PASA 2WORA 1ZMZA 3CYZA 4N1GA 3DZTA 5FI2A 1IKUA 2ISDA 5AANA 1PALA 3D74A 1KQMC 1ZACA 2WCMA 4DRWA 1B8LA 2AMIA 2KDHA 2BAPA 1LXFC 2LV7A 4ZCVA 1LKJA 1NP8A 2KNEA 2BKIB 1IH0A 2K7OA 1DMOA 2LLSA 3DXLA 4AOMA 2H8VA 5FI7A 1KCYA 1K9UA 2RGIA 2FJUB 1BLQA 3EK7A 1OW4A 3VRPA 2M9GA 1SCMB 2M7LA 2EHBA 5AXIA 1IJ5A 4U8DA 1CFCA 1V1FA 4JWQA 3EKJA 2JULA 3DF0B 5HKWA 1QASA 2L2EA 1F54A 4D1EA 1IIOA 4YGDB 1QX2A 2FJYA 2QDIA 3SG2A 1CLBA 2EC6C 2KFHA 2KAXA 4PDZA 4A4BA 5KU1A 3I5GC 1XFXO 1BF5A 3I5IC 5JJGA 1S6CA 2HF5A 4CIDA 1WRLA 5CPVA 1TNWA 4PE1A 1IJ6A 1S1EA 1XFZO 1EG3A 1CDNA 5GQQC 3B6XA 2QEVA 2R2IA 1WDCC 2P6BB 5FYXA 1Z2CB 5KSZA 3NSLA 1R6PA 1SW8A 1NWDA 3IQQA 1NYAA 1U5IA 1SYMA 3A8RA 1NCZA 3B88A 2WCFA 4INXA 2F3YA 4MLWA 3TS5B 1JC2A 3FIAA 1FW4A 5KTYA 4GFTA 3NHIA 3WXAA 1RWYA 1YR5A 3PN7C 1BU3A 1PULA 4PHNA 2KLEA 4Q04A 3NSKA 3BUNB 3D75A 3PSRA 5JOLA 2FOTA 2BCXA 2IS9A 3KF9A 2K7CA 1XYDA 5I8NA 2LLTA 2WCBA 4ORBB 3KO0A 2SASA 1XVJA 3CGAA 2I94A 2LNKA 4MZJA 3I5FB 3WHTB 2WCHA 3CABA 1CMFA 1C3ZA 3SG4A 4JQ0D 3SG7A 1L2OC 2LHLA 3RZSA 2KAYA 3D76A 3D73A 1ALVA 2KI6D 1CB1A 1K9KA 1PRWA 3O4XA 3PFVA 2KAVA 3CS1A 3UO9A 4NDBA 3O78A 2GGZA 2DOQA 1EL4A 2FCDA 5CSJA 1B4CA 1M31A 4AQIA 3D0YA 2G2BA 5CSIA 1TN4A 4HREE 2EGDA 2EC6B 4YGCB 3DVKA 1EXRA 1NX3A 1J7QA 3I5GB 3FE8A 1RJVA 3F45A 1SNLA 2M8UA 3I5IB 1YRUB 1JBAA 2K60A 1ALWA 1S5GY 3O2PA 4INWA 1LA0A 1C3YA 1X02A 2KSPA 1SRAA 3CWGA 3PLFB 5I2QA 2LVKA 1CLLA 1CFPA 3TDUA 1JFKA 3V2LA 1BT6A 2QEOA 2F2PA 1S3PA 2OTGC 3OP0A 1TRFA 1F4QA 3CZ1A 5I94A 2MJWB 1PSBA 4MZKA 1WLMA 4ICBA 2LAPA 3BOWB 4OKHA 5DICA 3PN7B 3AAKA 2JQ6A 1KFUL 5BPJA 1KK8C 3EK4A 3HX4A 4F7FA 1NCYA 2F2OA 1IWQA 1DC1A 2MAZA 1OE9B 4I5LB 4ZCUA 2KGRA 1D1OA 1QV0A 1W7JB 2M3WA 3VGOA 1SSEB 1W9ZA 1CDPA 2M29A 4YGAA 1A2XA 1AHRA 2LVJA 1OQPA 2LVIA 1OMRA 3RLZA 1LINA 4M2OA 1TNXA 1NCXA 1QWVA 3R1VA 2NXQA 1QX7A 1KFUS 1KSOA 2LMVA 1B7TY 3LL8B 2Y1NA 3DYEA 2P71A 5FI6A 3A4UB 4QJ5B 4OR9B 4GBAA 1RROA 3CR2A 1B8CA 1BJFA 1M39A 1QATA 5HKYA 1CMGA 1S26D 1GQMA 1QV1A 2JNFA 4M2PA 2GTEA 1CM4A 4C0JA 3TUYB 1MWNA 1QVIZ 3ICBA 1SMGA 3WNXB 1RK9A 1CDLA 3NXAA 1SL8A 1N2DA 1M45A 2M7NA 1F55A 1AUIB 1XFUO 3OB1B 2PRUA 1K90D 1LS8A 1SPYA 1CM1A 1TWOA 1DEKA 2M49B 4WQ2A 3JTDC 3SS3A 1U5IB 2ZN9A 1K93D 2OTGB 1TCOB 2NZ0A 2QEBA 1DJXA 1S6JA 3LCPC 1AP4A 2BL0C 4HRGA 1SL9A 2M1UA 2NLNA 3B87A 1SK6D 2TN4A 3BUOB 3SIBA 1B1GA 5DKQA 2KFGA 2L0PA 3Q8IA 4GGFA 5TNCA 1UHIA 2HQWA 1DELA 4ORCB 2BBMA 2CT9A 4QJ4B 1YX8A 3BUMB 5AEQA 3DVJA 2WOSA 4CFQA 1S36A 1E8AA 1MR8A 1RTP1 2KI4B 3OB2B 3SJSA 1JWDA 5D69A 3VRNA 4BY5A 1R2UA 3AKAA 4M2QA 1Z4HA 2H61A 3S0GA 1LVCD 4C0KA 1A29A 4NQGA 4OZDA 5HKZA 1GGWA 3KHEA 1Q80A 1BOCA 1KK7Y 2ZKMX 3D0YB 2ZFDA 3KEVA 1J55A 3FWCA 3D78A 1M63B 4PHJA 4TNCA 3BQ3A 2K8MB 2K7DA 1XO5A 1A4PA 1HQVA 2MRDA 1OOFA 1SBJA 2SCPA 1K2HA 1OMVA 3KPXA 3N7HA 1UHNA 1SL7A 4OCIA 1YUTA 1CTRA 1EG4A 2K2AA 3VROA 1C07A 3OHMB 1UHJA 1TIZA 1KQMB 1KSMA 2LM5A 4XJKA 3ZWHA 2O60A 4XYNA 1PVBA 4MRYA 1F8HA 1QJTA 1EH2A 2L5XB 1ODBA 2AUCA 5DKNA 1BR1B 5I2OA 2I7AA 1Y6WA 1OSAA 5I2LA 3DY9A 1L7ZA 2L51A 4GGFC 1SCVA 2CXJA 1K94A 4MBEA 4N5XA 4GPLB 2ZNEA 2KQ6A 3AAJA 2WC5A 3OGNA 2BE6A 4GUKA 4CFRA 1NX0A 1KFXL 3L47A 2WCEA 3EVUA 4MRXA 3SIAA 2E30A 5HYDA 1FBVA 2I18A 2Q4UA 1Y1AA 5K89A 1KWOC 1P28A 1XFVO 1UUSA 1WRKA 2COLB 1GGZA 3FE9A 2JC2A 2M97A 3O6BA 3DF0A 3O4YA 4BY4A 3BUWB 3IF7A 4MEWA 2M0RA 2H61C 3BFHA 5B8IB 1CLMA 1N65A 1T14A 2MHHA 1PSRA 3VRRA 3NSIA 4N1FA 3BFBA 2YGUA 1BR4B 1WDCB 2LANA 4YRUA 1A75A 1G4YR 1KFXS 3MSEB 1HT9A 1WLZA 3QMEA 4NDDA 1SKTA 4PALA 3UNWA 1RFJA 1QTXA 3SS5A 4HRHA 1J7RA 3BUXB 4DCKA 3OX6A 1YURA 4OV2A 1DJGA 5G08A 5PALA 1DF0A 1LA3A 2OPOA 3CLNA 1ZFSA 4YBHB 1S6IA 3CZTX 4HSZA 3L4LA 1FPWA 1B9AA 3LK0A 1TOPA 3K21A 1DT7B 2LP2A 1DJIA 2NCOA 3BXKA 1BG1A 2KPHA 4MSPA 4P5OE 1L2OB 3B86A 1Y1XA 2ZNDA 1GJYA 1OOJA 2L5YA 1QS7A 2H2KA 3FS7A 2Q91A 4MN0A 3RM1A 1OZSA 3NHTA 3CTNA 4IJ7A 2LUXA 3GOFA 3SS4A 1DJWA 1VRKA 4DUQA 3NSOA 2PQLA 1YUSA 1DVIA 2F8PA 1AJ4A 5D3OA 1UHHA 1WRZA 2BECA 1SCMC 3FE6A 1XFWO 1OOGA 3OX5A 4PHKA 1UHKA 5ER5A 3PJIA 1JF2A 3B7AA 2E6WA 5EL2A 2QPTA 4I5KA 3LK1A 1W7IB 4P2YB 3DVMA 2KBIA 1QIVA 4NDCA 1PK0D 4PT1A 4PE7A 4A4CA 4PCWA 2L4HA 2JXCA 1JF0A 4AQJA 2LHIA 1IQ3A 1XA5A 4YGEB 5AFPA 3S0AA 1TNPA 3PM8A 4GAOA 1J1DA 3GK4X 2JWWA 1PVAA 2JPOA 2PALA 1OOHA 2JZIA 1M46A 2FCEA 4I5JA 1Y0VH 3D10A 2LUCA 3SG6A 1YVLA 3R1PA 2KLDA 1KK8B 3TS5C 3BJHA 3EVVA 4FQTA 2KYCA 4FTGA 2F33A 4YGBB 1TUZA 1V1GA 1GM0A 4XJKB 2LE9B 2L4IA 2HETA 2JXLA 4JD9A 3CZ2A 3HCMA 1BMOA 1IGVA 3C1VA 4OVNF 1MF8B 2ZRSA 3WHUB 4UPGA 5ER4X 3I5FC 1CKKA 4PE4A 1TNQA 2ZRTA 1TTXA 1J1EA
chains in the Genus database with same CATH topology
3DD4A 1YRTB 1F70A 2K2FA 5J3XA 1XFYO 3TDIA 2OS8C 1J7PA 1EJ3A 2A4JA 3EKHA 5CSNA 2HQ8A 1AK8A 2GGMA 5HLOA 2MLEC 1QVIY 1H8BA 3I5HC 1CDMA 1IG5A 1FI5A 4E68A 1NX2A 1K95A 1DJHA 5IBWA 1JSAA 1ZOTB 1A75B 1CNPA 5F6TA 1S5GZ 4MVFA 3GK2A 1C7WA 2KQYA 3JTDB 2WNDA 1UP5A 2K61A 2LC5A 3IQOA 2BL0B 3CR5X 1YX7A 2M1KB 2KOTA 2HPSA 2WC8A 2JPTA 1AJ5A 1IRJA 3JVTC 4I5NB 2G9BA 1XK4A 1DF0B 3FWBA 3PATA 1SY9A 2JNXA 2Y5IA 1OZOA 4PE0A 1YVHA 2PVBA 1Y1UA 2KGBC 4PHMA 4USLA 3VRQA 1G8IA 1K9PA 1DGUA 2BCBA 1B8RA 1OMDA 1CFDA 3SG3A 2JT3A 2ZN8A 1DJZA 1NX1A 2LCPA 2LVVA 3SG5A 1A03A 2MBXA 2LMUA 1YTZC 1QXPA 3CR4X 4WRIA 2JOJA 2PMYA 2NCPA 1B7TZ 2OS8B 1UWOA 2CCMA 1CFFA 2CNPA 4FQOA 2AAOA 1SR6C 2B1UA 3LLEA 3I5HB 4YI8A 5CSFA 2CBLA 5AERA 2LP3A 4CPVA 5D7FA 4DS7A 2LLUA 1DGVA 1N0YA 1JUOA 1IQ5A 3TUYC 1QIWA 2BE4A 2JTTA 5HLVA 1B47A 1DTLA 1F4OA 1JFJA 1NIWA 3EVRA 2JT0A 4ORAB 1UURA 1BODA 1KQVA 2KI6C 1RECA 4QJ3B 4YI9A 4JPZB 1J7OA 4CLNA 4WQ3A 3TDZA 1ZUZA 1FF1A 4GNKB 1TCFA 3JVTB 1XK4C 2CTNA 2JRFA 2L98A 2BBNA 1DJYA 2GV5A 1F71A 1G33A 1QLKA 2KHNA 2O5GA 3SIAA 3E3RA 1BF5A 1WY9A 2K7BA 3BYAA 1NUBA 2Y1MA 1MUXA 2I2RE 3QRXA 3TZ1A 2V53A 4R1EA 3GK1A 2KYFA 1KWOB 1H4BA 1QLSA 4C0LA 2JTZA 4MZLA 3EK8A 1MXLC 4F0ZB 2VRGA 3DVEA 4ETOA 2BKHB 1MXEA 2Y4QA 1AVSA 4GGNA 1MQ1A 1YUUA 2KI4C 1NPQA 4IL1A 2KBMA 2PSRA 4L9MA 3PALA 1NSHA 2BCAA 1QX5B 1MHOA 3AKBA 2D8NA 1SR6B 1KK7Z 1C7VA 2K0JA 2JT8A 2QACA 4DIRA 2JU0A 1K8UA 3ZNIA 5DKRA 3M0WA 2KFFA 1K96A 2L50A 3H4SE 2MLFC 2LMTA 2MA2A 1FI6A 3BOWA 2F3ZA 2PASA 2WORA 1ZMZA 4N1GA 1IKUA 2ISDA 5AANA 1PALA 1KQMC 1ZACA 4DRWA 1B8LA 2AMIA 2KDHA 1LXFC 2LV7A 4ZCVA 1LKJA 1NP8A 2KNEA 2BKIB 1IH0A 2K7OA 1DMOA 2LLSA 4AOMA 1KCYA 1K9UA 2RGIA 2FJUB 1BLQA 3EK7A 3VRPA 2M9GA 1SCMB 2M7LA 2EHBA 5AXIA 1IJ5A 4U8DA 1V1FA 4JWQA 3EKJA 2JULA 3DF0B 5HKWA 1QASA 2L2EA 1F54A 4D1EA 4YGDB 1QX2A 3SG2A 1CLBA 2EC6C 2KFHA 2KAXA 4PDZA 4A4BA 5KU1A 3I5GC 1XFXO 3I5IC 5JJGA 1S6CA 2HF5A 4CIDA 1WRLA 5CPVA 1TNWA 4PE1A 1IJ6A 1S1EA 1XFZO 1EG3A 1CDNA 5GQQC 2R2IA 1WDCC 2P6BB 5FYXA 5KSZA 3NSLA 1R6PA 1SW8A 1NWDA 3IQQA 1NYAA 1U5IA 1SYMA 3A8RA 1NCZA 2WCFA 4MLWA 2F3YA 3TS5B 1JC2A 3FIAA 1FW4A 5KTYA 4GFTA 3WXAA 1RWYA 1YR5A 3PN7C 1BU3A 1PULA 4PHNA 4Q04A 3NSKA 3BUNB 3PSRA 5JOLA 2FOTA 2BCXA 2IS9A 3KF9A 2K7CA 1XYDA 5I8NA 2LLTA 2WCBA 4ORBB 3KO0A 2SASA 1XVJA 3CGAA 2I94A 2LNKA 4MZJA 3I5FB 3WHTB 1CMFA 3SG4A 4JQ0D 3SG7A 1L2OC 2LHLA 2KAYA 1ALVA 2KI6D 1CB1A 1K9KA 1PRWA 3PFVA 2KAVA 3CS1A 4NDBA 3O78A 2GGZA 2DOQA 1EL4A 2FCDA 5CSJA 1B4CA 1M31A 4AQIA 3D0YA 2G2BA 5CSIA 1TN4A 4HREE 2EGDA 2EC6B 4YGCB 3DVKA 1EXRA 1NX3A 1J7QA 3I5GB 1RJVA 3F45A 1SNLA 2M8UA 3I5IB 1YRUB 1JBAA 1ALWA 1S5GY 3O2PA 1LA0A 1X02A 2KSPA 1SRAA 3CWGA 3PLFB 5I2QA 2LVKA 1CLLA 1CFPA 3TDUA 1JFKA 1BT6A 2F2PA 1S3PA 2OTGC 3OP0A 1TRFA 1F4QA 2MJWB 1PSBA 4MZKA 1WLMA 4ICBA 2LAPA 3BOWB 4OKHA 3PN7B 3AAKA 2JQ6A 1KFUL 5BPJA 1KK8C 3EK4A 3HX4A 1NCYA 2F2OA 1IWQA 2MAZA 1OE9B 4I5LB 4ZCUA 2KGRA 1D1OA 1QV0A 1W7JB 2M3WA 3VGOA 1CDPA 2M29A 4YGAA 1A2XA 1AHRA 2LVJA 1OQPA 2LVIA 1OMRA 3RLZA 1LINA 4M2OA 1TNXA 1NCXA 2NXQA 1QX7A 1KFUS 1KSOA 2LMVA 1B7TY 3LL8B 2Y1NA 3A4UB 4QJ5B 4OR9B 4GBAA 1RROA 3CR2A 1B8CA 1BJFA 1M39A 1QATA 5HKYA 1CMGA 1S26D 1GQMA 1QV1A 2JNFA 4M2PA 1CM4A 4C0JA 3TUYB 1MWNA 1QVIZ 3ICBA 1SMGA 3WNXB 1RK9A 1CDLA 3NXAA 1SL8A 1N2DA 1M45A 2M7NA 1F55A 1AUIB 1XFUO 3OB1B 2PRUA 1K90D 1SPYA 1CM1A 2M49B 4WQ2A 3JTDC 1U5IB 2ZN9A 1K93D 2OTGB 1TCOB 2NZ0A 1DJXA 1S6JA 3LCPC 1AP4A 2BL0C 4HRGA 1SL9A 2M1UA 2NLNA 1SK6D 2TN4A 3BUOB 3SIBA 1B1GA 5DKQA 2KFGA 2L0PA 4GGFA 5TNCA 1UHIA 2HQWA 4ORCB 2BBMA 2CT9A 4QJ4B 1YX8A 3BUMB 5AEQA 3DVJA 2WOSA 4CFQA 1S36A 1E8AA 1MR8A 1RTP1 2KI4B 3OB2B 3SJSA 1JWDA 5D69A 3VRNA 4BY5A 1R2UA 3AKAA 4M2QA 2H61A 1LVCD 4C0KA 1A29A 4NQGA 5HKZA 1GGWA 3KHEA 1Q80A 1BOCA 1KK7Y 2ZKMX 3D0YB 2ZFDA 3KEVA 1J55A 3FWCA 1M63B 4PHJA 4TNCA 3BQ3A 2K8MB 2K7DA 1XO5A 1A4PA 1HQVA 2MRDA 2SCPA 1SBJA 1K2HA 1OMVA 3KPXA 1UHNA 1SL7A 4OCIA 1YUTA 1CTRA 1EG4A 2K2AA 3VROA 1C07A 3OHMB 1UHJA 1TIZA 1KQMB 1KSMA 2LM5A 4XJKA 3ZWHA 2O60A 4XYNA 1PVBA 4MRYA 1F8HA 1QJTA 1EH2A 2L5XB 1ODBA 2AUCA 5DKNA 1BR1B 5I2OA 2I7AA 1Y6WA 1OSAA 5I2LA 1L7ZA 2L51A 4GGFC 1SCVA 2CXJA 1K94A 4MBEA 4N5XA 4GPLB 2ZNEA 2KQ6A 3AAJA 4GUKA 4CFRA 2BE6A 1CFCA 1NX0A 1KFXL 2WCEA 3EVUA 4MRXA 2E30A 5HYDA 1FBVA 2I18A 2Q4UA 1Y1AA 5K89A 1KWOC 1XFVO 1UUSA 1WRKA 2COLB 1GGZA 3O6BA 2JC2A 2M97A 3DF0A 3O4YA 4BY4A 3BUWB 3IF7A 4MEWA 2M0RA 2H61C 5B8IB 1CLMA 1N65A 2MHHA 1PSRA 3VRRA 3NSIA 4N1FA 1BR4B 1WDCB 2LANA 4YRUA 1A75A 1G4YR 1KFXS 3MSEB 1HT9A 1WLZA 4NDDA 1SKTA 4PALA 1RFJA 1QTXA 4HRHA 1J7RA 3BUXB 4DCKA 3OX6A 1YURA 4OV2A 1DJGA 5G08A 5PALA 1DF0A 1LA3A 2OPOA 3CLNA 1ZFSA 4YBHB 1S6IA 3CZTX 4HSZA 1FPWA 1B9AA 3LK0A 1TOPA 3K21A 1DT7B 2LP2A 1DJIA 2NCOA 3BXKA 1BG1A 4MSPA 4P5OE 1L2OB 1Y1XA 2ZNDA 1GJYA 1OOJA 1QS7A 2H2KA 3FS7A 2Q91A 4MN0A 3RM1A 1OZSA 3CTNA 2LUXA 3GOFA 1DJWA 1VRKA 4DUQA 3NSOA 1YUSA 1DVIA 2F8PA 1AJ4A 1UHHA 1WRZA 2BECA 1SCMC 3OX5A 1XFWO 4PHKA 1UHKA 5ER5A 1JF2A 2E6WA 2QPTA 4I5KA 3LK1A 1W7IB 4P2YB 3DVMA 2KBIA 1QIVA 4NDCA 1PK0D 4PE7A 4A4CA 4PCWA 2L4HA 2JXCA 1JF0A 4AQJA 2LHIA 1IQ3A 1XA5A 4YGEB 5AFPA 1TNPA 3PM8A 4GAOA 1J1DA 3GK4X 2JWWA 1PVAA 2PALA 2JZIA 1M46A 2FCEA 4I5JA 1Y0VH 3D10A 2LUCA 3SG6A 1YVLA 1KK8B 3TS5C 3EVVA 4FTGA 2KYCA 2F33A 4YGBB 1V1GA 4XJKB 2LE9B 2L4IA 2HETA 2JXLA 3HCMA 1BMOA 1IGVA 3C1VA 4OVNF 1MF8B 2ZRSA 3WHUB 4UPGA 5ER4X 3I5FC 1CKKA 4PE4A 1TNQA 2ZRTA 1TTXA 1J1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD4 A;  1YRT B;  1F70 A;  2K2F A;  5J3X A;  1XFY O;  3TDI A;  2OS8 C;  1J7P A;  1EJ3 A;  2A4J A;  3EKH A;  5CSN A;  2HQ8 A;  1AK8 A;  2GGM A;  5HLO A;  2MLE C;  1QVI Y;  1H8B A;  3I5H C;  1CDM A;  1IG5 A;  1FI5 A;  4E68 A;  1NX2 A;  1K95 A;  1DJH A;  5IBW A;  1JSA A;  1ZOT B;  1A75 B;  1CNP A;  5F6T A;  1S5G Z;  4MVF A;  3GK2 A;  1C7W A;  2KQY A;  3JTD B;  2WND A;  1UP5 A;  2K61 A;  2LC5 A;  3IQO A;  2BL0 B;  3CR5 X;  1YX7 A;  2M1K B;  2KOT A;  2HPS A;  2WC8 A;  2JPT A;  1AJ5 A;  1IRJ A;  3JVT C;  4I5N B;  2G9B A;  1XK4 A;  1DF0 B;  3FWB A;  3PAT A;  1SY9 A;  2JNX A;  2Y5I A;  1OZO A;  4PE0 A;  1YVH A;  2PVB A;  1Y1U A;  2KGB C;  4PHM A;  4USL A;  3VRQ A;  1G8I A;  1K9P A;  1DGU A;  2BCB A;  1B8R A;  1OMD A;  1CFD A;  3SG3 A;  2JT3 A;  2ZN8 A;  1DJZ A;  1NX1 A;  2LCP A;  2LVV A;  3SG5 A;  1A03 A;  2MBX A;  2LMU A;  1YTZ C;  1QXP A;  3CR4 X;  4WRI A;  2JOJ A;  2PMY A;  2NCP A;  1B7T Z;  2OS8 B;  1UWO A;  2CCM A;  1CFF A;  2CNP A;  4FQO A;  2AAO A;  1SR6 C;  2B1U A;  3LLE A;  3I5H B;  4YI8 A;  5CSF A;  2CBL A;  5AER A;  2LP3 A;  4CPV A;  5D7F A;  4DS7 A;  2LLU A;  1DGV A;  1N0Y A;  1JUO A;  1IQ5 A;  3TUY C;  1QIW A;  2BE4 A;  2JTT A;  5HLV A;  1B47 A;  1DTL A;  1F4O A;  1JFJ A;  1NIW A;  3EVR A;  2JT0 A;  4ORA B;  1UUR A;  1BOD A;  1KQV A;  2KI6 C;  1REC A;  4QJ3 B;  4YI9 A;  4JPZ B;  1J7O A;  4CLN A;  4WQ3 A;  3TDZ A;  1ZUZ A;  1FF1 A;  4GNK B;  1TCF A;  3JVT B;  1XK4 C;  2CTN A;  2JRF A;  2L98 A;  2BBN A;  1DJY A;  2GV5 A;  1F71 A;  1G33 A;  1QLK A;  2KHN A;  2O5G A;  3SIA A;  3E3R A;  1BF5 A;  1WY9 A;  2K7B A;  3BYA A;  1NUB A;  2Y1M A;  1MUX A;  2I2R E;  3QRX A;  3TZ1 A;  2V53 A;  4R1E A;  3GK1 A;  2KYF A;  1KWO B;  1H4B A;  1QLS A;  4C0L A;  2JTZ A;  4MZL A;  3EK8 A;  1MXL C;  4F0Z B;  2VRG A;  3DVE A;  4ETO A;  2BKH B;  1MXE A;  2Y4Q A;  1AVS A;  4GGN A;  1MQ1 A;  1YUU A;  2KI4 C;  1NPQ A;  4IL1 A;  2KBM A;  2PSR A;  4L9M A;  3PAL A;  1NSH A;  2BCA A;  1QX5 B;  1MHO A;  3AKB A;  2D8N A;  1SR6 B;  1KK7 Z;  1C7V A;  2K0J A;  2JT8 A;  2QAC A;  4DIR A;  2JU0 A;  1K8U A;  3ZNI A;  5DKR A;  3M0W A;  2KFF A;  1K96 A;  2L50 A;  3H4S E;  2MLF C;  2LMT A;  2MA2 A;  1FI6 A;  3BOW A;  2F3Z A;  2PAS A;  2WOR A;  1ZMZ A;  4N1G A;  1IKU A;  2ISD A;  5AAN A;  1PAL A;  1KQM C;  1ZAC A;  4DRW A;  1B8L A;  2AMI A;  2KDH A;  1LXF C;  2LV7 A;  4ZCV A;  1LKJ A;  1NP8 A;  2KNE A;  2BKI B;  1IH0 A;  2K7O A;  1DMO A;  2LLS A;  4AOM A;  1KCY A;  1K9U A;  2RGI A;  2FJU B;  1BLQ A;  3EK7 A;  3VRP A;  2M9G A;  1SCM B;  2M7L A;  2EHB A;  5AXI A;  1IJ5 A;  4U8D A;  1V1F A;  4JWQ A;  3EKJ A;  2JUL A;  3DF0 B;  5HKW A;  1QAS A;  2L2E A;  1F54 A;  4D1E A;  4YGD B;  1QX2 A;  3SG2 A;  1CLB A;  2EC6 C;  2KFH A;  2KAX A;  4PDZ A;  4A4B A;  5KU1 A;  3I5G C;  1XFX O;  3I5I C;  5JJG A;  1S6C A;  2HF5 A;  4CID A;  1WRL A;  5CPV A;  1TNW A;  4PE1 A;  1IJ6 A;  1S1E A;  1XFZ O;  1EG3 A;  1CDN A;  5GQQ C;  2R2I A;  1WDC C;  2P6B B;  5FYX A;  5KSZ A;  3NSL A;  1R6P A;  1SW8 A;  1NWD A;  3IQQ A;  1NYA A;  1U5I A;  1SYM A;  3A8R A;  1NCZ A;  2WCF A;  4MLW A;  2F3Y A;  3TS5 B;  1JC2 A;  3FIA A;  1FW4 A;  5KTY A;  4GFT A;  3WXA A;  1RWY A;  1YR5 A;  3PN7 C;  1BU3 A;  1PUL A;  4PHN A;  4Q04 A;  3NSK A;  3BUN B;  3PSR A;  5JOL A;  2FOT A;  2BCX A;  2IS9 A;  3KF9 A;  2K7C A;  1XYD A;  5I8N A;  2LLT A;  2WCB A;  4ORB B;  3KO0 A;  2SAS A;  1XVJ A;  3CGA A;  2I94 A;  2LNK A;  4MZJ A;  3I5F B;  3WHT B;  1CMF A;  3SG4 A;  4JQ0 D;  3SG7 A;  1L2O C;  2LHL A;  2KAY A;  1ALV A;  2KI6 D;  1CB1 A;  1K9K A;  1PRW A;  3PFV A;  2KAV A;  3CS1 A;  4NDB A;  3O78 A;  2GGZ A;  2DOQ A;  1EL4 A;  2FCD A;  5CSJ A;  1B4C A;  1M31 A;  4AQI A;  3D0Y A;  2G2B A;  5CSI A;  1TN4 A;  4HRE E;  2EGD A;  2EC6 B;  4YGC B;  3DVK A;  1EXR A;  1NX3 A;  1J7Q A;  3I5G B;  1RJV A;  3F45 A;  1SNL A;  2M8U A;  3I5I B;  1YRU B;  1JBA A;  1ALW A;  1S5G Y;  3O2P A;  1LA0 A;  1X02 A;  2KSP A;  1SRA A;  3CWG A;  3PLF B;  5I2Q A;  2LVK A;  1CLL A;  1CFP A;  3TDU A;  1JFK A;  1BT6 A;  2F2P A;  1S3P A;  2OTG C;  3OP0 A;  1TRF A;  1F4Q A;  2MJW B;  1PSB A;  4MZK A;  1WLM A;  4ICB A;  2LAP A;  3BOW B;  4OKH A;  3PN7 B;  3AAK A;  2JQ6 A;  1KFU L;  5BPJ A;  1KK8 C;  3EK4 A;  3HX4 A;  1NCY A;  2F2O A;  1IWQ A;  2MAZ A;  1OE9 B;  4I5L B;  4ZCU A;  2KGR A;  1D1O A;  1QV0 A;  1W7J B;  2M3W A;  3VGO A;  1CDP A;  2M29 A;  4YGA A;  1A2X A;  1AHR A;  2LVJ A;  1OQP A;  2LVI A;  1OMR A;  3RLZ A;  1LIN A;  4M2O A;  1TNX A;  1NCX A;  2NXQ A;  1QX7 A;  1KFU S;  1KSO A;  2LMV A;  1B7T Y;  3LL8 B;  2Y1N A;  3A4U B;  4QJ5 B;  4OR9 B;  4GBA A;  1RRO A;  3CR2 A;  1B8C A;  1BJF A;  1M39 A;  1QAT A;  5HKY A;  1CMG A;  1S26 D;  1GQM A;  1QV1 A;  2JNF A;  4M2P A;  1CM4 A;  4C0J A;  3TUY B;  1MWN A;  1QVI Z;  3ICB A;  1SMG A;  3WNX B;  1RK9 A;  1CDL A;  3NXA A;  1SL8 A;  1N2D A;  1M45 A;  2M7N A;  1F55 A;  1AUI B;  1XFU O;  3OB1 B;  2PRU A;  1K90 D;  1SPY A;  1CM1 A;  2M49 B;  4WQ2 A;  3JTD C;  1U5I B;  2ZN9 A;  1K93 D;  2OTG B;  1TCO B;  2NZ0 A;  1DJX A;  1S6J A;  3LCP C;  1AP4 A;  2BL0 C;  4HRG A;  1SL9 A;  2M1U A;  2NLN A;  1SK6 D;  2TN4 A;  3BUO B;  3SIB A;  1B1G A;  5DKQ A;  2KFG A;  2L0P A;  4GGF A;  5TNC A;  1UHI A;  2HQW A;  4ORC B;  2BBM A;  2CT9 A;  4QJ4 B;  1YX8 A;  3BUM B;  5AEQ A;  3DVJ A;  2WOS A;  4CFQ A;  1S36 A;  1E8A A;  1MR8 A;  1RTP 1;  2KI4 B;  3OB2 B;  3SJS A;  1JWD A;  5D69 A;  3VRN A;  4BY5 A;  1R2U A;  3AKA A;  4M2Q A;  2H61 A;  1LVC D;  4C0K A;  1A29 A;  4NQG A;  5HKZ A;  1GGW A;  3KHE A;  1Q80 A;  1BOC A;  1KK7 Y;  2ZKM X;  3D0Y B;  2ZFD A;  3KEV A;  1J55 A;  3FWC A;  1M63 B;  4PHJ A;  4TNC A;  3BQ3 A;  2K8M B;  2K7D A;  1XO5 A;  1A4P A;  1HQV A;  2MRD A;  2SCP A;  1SBJ A;  1K2H A;  1OMV A;  3KPX A;  1UHN A;  1SL7 A;  4OCI A;  1YUT A;  1CTR A;  1EG4 A;  2K2A A;  3VRO A;  1C07 A;  3OHM B;  1UHJ A;  1TIZ A;  1KQM B;  1KSM A;  2LM5 A;  4XJK A;  3ZWH A;  2O60 A;  4XYN A;  1PVB A;  4MRY A;  1F8H A;  1QJT A;  1EH2 A;  2L5X B;  1ODB A;  2AUC A;  5DKN A;  1BR1 B;  5I2O A;  2I7A A;  1Y6W A;  1OSA A;  5I2L A;  1L7Z A;  2L51 A;  4GGF C;  1SCV A;  2CXJ A;  1K94 A;  4MBE A;  4N5X A;  4GPL B;  2ZNE A;  2KQ6 A;  3AAJ A;  4GUK A;  4CFR A;  2BE6 A;  1CFC A;  1NX0 A;  1KFX L;  2WCE A;  3EVU A;  4MRX A;  2E30 A;  5HYD A;  1FBV A;  2I18 A;  2Q4U A;  1Y1A A;  5K89 A;  1KWO C;  1XFV O;  1UUS A;  1WRK A;  2COL B;  1GGZ A;  3O6B A;  2JC2 A;  2M97 A;  3DF0 A;  3O4Y A;  4BY4 A;  3BUW B;  3IF7 A;  4MEW A;  2M0R A;  2H61 C;  5B8I B;  1CLM A;  1N65 A;  2MHH A;  1PSR A;  3VRR A;  3NSI A;  4N1F A;  1BR4 B;  1WDC B;  2LAN A;  4YRU A;  1A75 A;  1G4Y R;  1KFX S;  3MSE B;  1HT9 A;  1WLZ A;  4NDD A;  1SKT A;  4PAL A;  1RFJ A;  1QTX A;  4HRH A;  1J7R A;  3BUX B;  4DCK A;  3OX6 A;  1YUR A;  4OV2 A;  1DJG A;  5G08 A;  5PAL A;  1DF0 A;  1LA3 A;  2OPO A;  3CLN A;  1ZFS A;  4YBH B;  1S6I A;  3CZT X;  4HSZ A;  1FPW A;  1B9A A;  3LK0 A;  1TOP A;  3K21 A;  1DT7 B;  2LP2 A;  1DJI A;  2NCO A;  3BXK A;  1BG1 A;  4MSP A;  4P5O E;  1L2O B;  1Y1X A;  2ZND A;  1GJY A;  1OOJ A;  1QS7 A;  2H2K A;  3FS7 A;  2Q91 A;  4MN0 A;  3RM1 A;  1OZS A;  3CTN A;  2LUX A;  3GOF A;  1DJW A;  1VRK A;  4DUQ A;  3NSO A;  1YUS A;  1DVI A;  2F8P A;  1AJ4 A;  1UHH A;  1WRZ A;  2BEC A;  1SCM C;  3OX5 A;  1XFW O;  4PHK A;  1UHK A;  5ER5 A;  1JF2 A;  2E6W A;  2QPT A;  4I5K A;  3LK1 A;  1W7I B;  4P2Y B;  3DVM A;  2KBI A;  1QIV A;  4NDC A;  1PK0 D;  4PE7 A;  4A4C A;  4PCW A;  2L4H A;  2JXC A;  1JF0 A;  4AQJ A;  2LHI A;  1IQ3 A;  1XA5 A;  4YGE B;  5AFP A;  1TNP A;  3PM8 A;  4GAO A;  1J1D A;  3GK4 X;  2JWW A;  1PVA A;  2PAL A;  2JZI A;  1M46 A;  2FCE A;  4I5J A;  1Y0V H;  3D10 A;  2LUC A;  3SG6 A;  1YVL A;  1KK8 B;  3TS5 C;  3EVV A;  4FTG A;  2KYC A;  2F33 A;  4YGB B;  1V1G A;  4XJK B;  2LE9 B;  2L4I A;  2HET A;  2JXL A;  3HCM A;  1BMO A;  1IGV A;  3C1V A;  4OVN F;  1MF8 B;  2ZRS A;  3WHU B;  4UPG A;  5ER4 X;  3I5F C;  1CKK A;  4PE4 A;  1TNQ A;  2ZRT A;  1TTX A;  1J1E A; 
#chains in the Genus database with same CATH topology
 3DD4 A;  1YRT B;  1F70 A;  2WCJ A;  2K2F A;  5J3X A;  1XFY O;  2P70 A;  3TDI A;  2OS8 C;  1J7P A;  1EJ3 A;  2A4J A;  3EKH A;  5CSN A;  2HQ8 A;  1AK8 A;  2GGM A;  5HLO A;  2MLE C;  1QVI Y;  1H8B A;  3I5H C;  1CDM A;  1IG5 A;  1FI5 A;  4E68 A;  1NX2 A;  1K95 A;  2WC6 A;  1DJH A;  5IBW A;  1JSA A;  1ZOT B;  1A75 B;  1CNP A;  5F6T A;  3S0B A;  1S5G Z;  4MVF A;  3BFA A;  3GK2 A;  1C7W A;  1XFR A;  2KQY A;  2WCK A;  3JTD B;  2WND A;  1UP5 A;  2K61 A;  2LC5 A;  3IQO A;  2BL0 B;  3CR5 X;  1YX7 A;  2M1K B;  2KOT A;  2HPS A;  2BNX A;  2WC8 A;  2JPT A;  1AJ5 A;  1IRJ A;  3JVT C;  4I5N B;  2G9B A;  1XK4 A;  1DF0 B;  3FWB A;  3PAT A;  1SY9 A;  2JNX A;  2Y5I A;  1OZO A;  4PE0 A;  1YVH A;  1DQE A;  2PVB A;  1Y1U A;  2KGB C;  4PHM A;  4USL A;  3VRQ A;  2PYQ A;  1G8I A;  1K9P A;  1OOI X;  1DGU A;  2BCB A;  1B8R A;  1OMD A;  1CFD A;  3SG3 A;  2JT3 A;  2L2C A;  2ZN8 A;  1DJZ A;  1NX1 A;  2LCP A;  2LVV A;  3SG5 A;  1A03 A;  1TUJ A;  2MBX A;  2LMU A;  1YTZ C;  1QXP A;  3CR4 X;  4WRI A;  2JOJ A;  1ORG A;  2PMY A;  3R72 A;  2NCP A;  1B7T Z;  2OS8 B;  1UWO A;  2CCM A;  1CFF A;  2CNP A;  2ERB A;  4FQO A;  2AAO A;  1SR6 C;  2B1U A;  3IVT A;  3I5H B;  3LLE A;  4YI8 A;  5CSF A;  2CBL A;  5AER A;  2LP3 A;  4CPV A;  5D7F A;  3S0D A;  2LLU A;  4DS7 A;  1DGV A;  1N0Y A;  3VB1 A;  1JUO A;  1IQ5 A;  3TUY C;  1QIW A;  2BE4 A;  3K1E A;  2JTT A;  5HLV A;  1B47 A;  1DTL A;  1F4O A;  1JFJ A;  1NIW A;  3EVR A;  2JT0 A;  4ORA B;  1UUR A;  1BOD A;  1KQV A;  2KI6 C;  1REC A;  3CDN A;  4QJ3 B;  4JPZ B;  4YI9 A;  1J7O A;  4CLN A;  4WQ3 A;  3TDZ A;  1ZUZ A;  5HL1 A;  1FF1 A;  4GNK B;  1TCF A;  3JVT B;  1XK4 C;  2CTN A;  2JRF A;  2L98 A;  2BBN A;  1DJY A;  2GV5 A;  1F71 A;  1G33 A;  1QLK A;  2KHN A;  2O5G A;  3CZ0 A;  3E3R A;  3NGV A;  1WY9 A;  2K7B A;  3BYA A;  3L4A A;  1NUB A;  2Y1M A;  1MUX A;  2I2R E;  3QRX A;  3TZ1 A;  2V53 A;  4R1E A;  3GK1 A;  2KYF A;  3S0F A;  1KWO B;  1H4B A;  1QLS A;  4JKT A;  4C0L A;  2JTZ A;  4MZL A;  3EK8 A;  1MXL C;  4KYN A;  4F0Z B;  2VRG A;  3DVE A;  4ETO A;  2BKH B;  1MXE A;  2Y4Q A;  1AVS A;  4GGN A;  1MQ1 A;  1YUU A;  2KI4 C;  1NPQ A;  3OBV A;  2KBM A;  2PSR A;  4IL1 A;  4L9M A;  3PAL A;  3S0E A;  1NSH A;  2BCA A;  2QEH A;  1QX5 B;  1MHO A;  3AKB A;  2D8N A;  1SR6 B;  3EG5 B;  1KK7 Z;  2WCL A;  2K0J A;  2JT8 A;  1C7V A;  2QAC A;  4DIR A;  2JU0 A;  3D77 A;  1K8U A;  3ZNI A;  5DKR A;  3M0W A;  2KFF A;  1K96 A;  2L50 A;  3PM2 A;  3H4S E;  2MLF C;  2LMT A;  2MA2 A;  3R1O A;  1FI6 A;  3BOW A;  2F3Z A;  2PAS A;  2WOR A;  1ZMZ A;  3CYZ A;  4N1G A;  3DZT A;  5FI2 A;  1IKU A;  2ISD A;  5AAN A;  1PAL A;  3D74 A;  1KQM C;  1ZAC A;  2WCM A;  4DRW A;  1B8L A;  2AMI A;  2KDH A;  2BAP A;  1LXF C;  2LV7 A;  4ZCV A;  1LKJ A;  1NP8 A;  2KNE A;  2BKI B;  1IH0 A;  2K7O A;  1DMO A;  2LLS A;  3DXL A;  4AOM A;  2H8V A;  5FI7 A;  1KCY A;  1K9U A;  2RGI A;  2FJU B;  1BLQ A;  3EK7 A;  1OW4 A;  3VRP A;  2M9G A;  1SCM B;  2M7L A;  2EHB A;  5AXI A;  1IJ5 A;  4U8D A;  1CFC A;  1V1F A;  4JWQ A;  3EKJ A;  2JUL A;  3DF0 B;  5HKW A;  1QAS A;  2L2E A;  1F54 A;  4D1E A;  1IIO A;  4YGD B;  1QX2 A;  2FJY A;  2QDI A;  3SG2 A;  1CLB A;  2EC6 C;  2KFH A;  2KAX A;  4PDZ A;  4A4B A;  5KU1 A;  3I5G C;  1XFX O;  1BF5 A;  3I5I C;  5JJG A;  1S6C A;  2HF5 A;  4CID A;  1WRL A;  5CPV A;  1TNW A;  4PE1 A;  1IJ6 A;  1S1E A;  1XFZ O;  1EG3 A;  1CDN A;  5GQQ C;  3B6X A;  2QEV A;  2R2I A;  1WDC C;  2P6B B;  5FYX A;  1Z2C B;  5KSZ A;  3NSL A;  1R6P A;  1SW8 A;  1NWD A;  3IQQ A;  1NYA A;  1U5I A;  1SYM A;  3A8R A;  1NCZ A;  3B88 A;  2WCF A;  4INX A;  2F3Y A;  4MLW A;  3TS5 B;  1JC2 A;  3FIA A;  1FW4 A;  5KTY A;  4GFT A;  3NHI A;  3WXA A;  1RWY A;  1YR5 A;  3PN7 C;  1BU3 A;  1PUL A;  4PHN A;  2KLE A;  4Q04 A;  3NSK A;  3BUN B;  3D75 A;  3PSR A;  5JOL A;  2FOT A;  2BCX A;  2IS9 A;  3KF9 A;  2K7C A;  1XYD A;  5I8N A;  2LLT A;  2WCB A;  4ORB B;  3KO0 A;  2SAS A;  1XVJ A;  3CGA A;  2I94 A;  2LNK A;  4MZJ A;  3I5F B;  3WHT B;  2WCH A;  3CAB A;  1CMF A;  1C3Z A;  3SG4 A;  4JQ0 D;  3SG7 A;  1L2O C;  2LHL A;  3RZS A;  2KAY A;  3D76 A;  3D73 A;  1ALV A;  2KI6 D;  1CB1 A;  1K9K A;  1PRW A;  3O4X A;  3PFV A;  2KAV A;  3CS1 A;  3UO9 A;  4NDB A;  3O78 A;  2GGZ A;  2DOQ A;  1EL4 A;  2FCD A;  5CSJ A;  1B4C A;  1M31 A;  4AQI A;  3D0Y A;  2G2B A;  5CSI A;  1TN4 A;  4HRE E;  2EGD A;  2EC6 B;  4YGC B;  3DVK A;  1EXR A;  1NX3 A;  1J7Q A;  3I5G B;  3FE8 A;  1RJV A;  3F45 A;  1SNL A;  2M8U A;  3I5I B;  1YRU B;  1JBA A;  2K60 A;  1ALW A;  1S5G Y;  3O2P A;  4INW A;  1LA0 A;  1C3Y A;  1X02 A;  2KSP A;  1SRA A;  3CWG A;  3PLF B;  5I2Q A;  2LVK A;  1CLL A;  1CFP A;  3TDU A;  1JFK A;  3V2L A;  1BT6 A;  2QEO A;  2F2P A;  1S3P A;  2OTG C;  3OP0 A;  1TRF A;  1F4Q A;  3CZ1 A;  5I94 A;  2MJW B;  1PSB A;  4MZK A;  1WLM A;  4ICB A;  2LAP A;  3BOW B;  4OKH A;  5DIC A;  3PN7 B;  3AAK A;  2JQ6 A;  1KFU L;  5BPJ A;  1KK8 C;  3EK4 A;  3HX4 A;  4F7F A;  1NCY A;  2F2O A;  1IWQ A;  1DC1 A;  2MAZ A;  1OE9 B;  4I5L B;  4ZCU A;  2KGR A;  1D1O A;  1QV0 A;  1W7J B;  2M3W A;  3VGO A;  1SSE B;  1W9Z A;  1CDP A;  2M29 A;  4YGA A;  1A2X A;  1AHR A;  2LVJ A;  1OQP A;  2LVI A;  1OMR A;  3RLZ A;  1LIN A;  4M2O A;  1TNX A;  1NCX A;  1QWV A;  3R1V A;  2NXQ A;  1QX7 A;  1KFU S;  1KSO A;  2LMV A;  1B7T Y;  3LL8 B;  2Y1N A;  3DYE A;  2P71 A;  5FI6 A;  3A4U B;  4QJ5 B;  4OR9 B;  4GBA A;  1RRO A;  3CR2 A;  1B8C A;  1BJF A;  1M39 A;  1QAT A;  5HKY A;  1CMG A;  1S26 D;  1GQM A;  1QV1 A;  2JNF A;  4M2P A;  2GTE A;  1CM4 A;  4C0J A;  3TUY B;  1MWN A;  1QVI Z;  3ICB A;  1SMG A;  3WNX B;  1RK9 A;  1CDL A;  3NXA A;  1SL8 A;  1N2D A;  1M45 A;  2M7N A;  1F55 A;  1AUI B;  1XFU O;  3OB1 B;  2PRU A;  1K90 D;  1LS8 A;  1SPY A;  1CM1 A;  1TWO A;  1DEK A;  2M49 B;  4WQ2 A;  3JTD C;  3SS3 A;  1U5I B;  2ZN9 A;  1K93 D;  2OTG B;  1TCO B;  2NZ0 A;  2QEB A;  1DJX A;  1S6J A;  3LCP C;  1AP4 A;  2BL0 C;  4HRG A;  1SL9 A;  2M1U A;  2NLN A;  3B87 A;  1SK6 D;  2TN4 A;  3BUO B;  3SIB A;  1B1G A;  5DKQ A;  2KFG A;  2L0P A;  3Q8I A;  4GGF A;  5TNC A;  1UHI A;  2HQW A;  1DEL A;  4ORC B;  2BBM A;  2CT9 A;  4QJ4 B;  1YX8 A;  3BUM B;  5AEQ A;  3DVJ A;  2WOS A;  4CFQ A;  1S36 A;  1E8A A;  1MR8 A;  1RTP 1;  2KI4 B;  3OB2 B;  3SJS A;  1JWD A;  5D69 A;  3VRN A;  4BY5 A;  1R2U A;  3AKA A;  4M2Q A;  1Z4H A;  2H61 A;  3S0G A;  1LVC D;  4C0K A;  1A29 A;  4NQG A;  4OZD A;  5HKZ A;  1GGW A;  3KHE A;  1Q80 A;  1BOC A;  1KK7 Y;  2ZKM X;  3D0Y B;  2ZFD A;  3KEV A;  1J55 A;  3FWC A;  3D78 A;  1M63 B;  4PHJ A;  4TNC A;  3BQ3 A;  2K8M B;  2K7D A;  1XO5 A;  1A4P A;  1HQV A;  2MRD A;  1OOF A;  1SBJ A;  2SCP A;  1K2H A;  1OMV A;  3KPX A;  3N7H A;  1UHN A;  1SL7 A;  4OCI A;  1YUT A;  1CTR A;  1EG4 A;  2K2A A;  3VRO A;  1C07 A;  3OHM B;  1UHJ A;  1TIZ A;  1KQM B;  1KSM A;  2LM5 A;  4XJK A;  3ZWH A;  2O60 A;  4XYN A;  1PVB A;  4MRY A;  1F8H A;  1QJT A;  1EH2 A;  2L5X B;  1ODB A;  2AUC A;  5DKN A;  1BR1 B;  5I2O A;  2I7A A;  1Y6W A;  1OSA A;  5I2L A;  3DY9 A;  1L7Z A;  2L51 A;  4GGF C;  1SCV A;  2CXJ A;  1K94 A;  4MBE A;  4N5X A;  4GPL B;  2ZNE A;  2KQ6 A;  3AAJ A;  2WC5 A;  3OGN A;  2BE6 A;  4GUK A;  4CFR A;  1NX0 A;  1KFX L;  3L47 A;  2WCE A;  3EVU A;  4MRX A;  3SIA A;  2E30 A;  5HYD A;  1FBV A;  2I18 A;  2Q4U A;  1Y1A A;  5K89 A;  1KWO C;  1P28 A;  1XFV O;  1UUS A;  1WRK A;  2COL B;  1GGZ A;  3FE9 A;  2JC2 A;  2M97 A;  3O6B A;  3DF0 A;  3O4Y A;  4BY4 A;  3BUW B;  3IF7 A;  4MEW A;  2M0R A;  2H61 C;  3BFH A;  5B8I B;  1CLM A;  1N65 A;  1T14 A;  2MHH A;  1PSR A;  3VRR A;  3NSI A;  4N1F A;  3BFB A;  2YGU A;  1BR4 B;  1WDC B;  2LAN A;  4YRU A;  1A75 A;  1G4Y R;  1KFX S;  3MSE B;  1HT9 A;  1WLZ A;  3QME A;  4NDD A;  1SKT A;  4PAL A;  3UNW A;  1RFJ A;  1QTX A;  3SS5 A;  4HRH A;  1J7R A;  3BUX B;  4DCK A;  3OX6 A;  1YUR A;  4OV2 A;  1DJG A;  5G08 A;  5PAL A;  1DF0 A;  1LA3 A;  2OPO A;  3CLN A;  1ZFS A;  4YBH B;  1S6I A;  3CZT X;  4HSZ A;  3L4L A;  1FPW A;  1B9A A;  3LK0 A;  1TOP A;  3K21 A;  1DT7 B;  2LP2 A;  1DJI A;  2NCO A;  3BXK A;  1BG1 A;  2KPH A;  4MSP A;  4P5O E;  1L2O B;  3B86 A;  1Y1X A;  2ZND A;  1GJY A;  1OOJ A;  2L5Y A;  1QS7 A;  2H2K A;  3FS7 A;  2Q91 A;  4MN0 A;  3RM1 A;  1OZS A;  3NHT A;  3CTN A;  4IJ7 A;  2LUX A;  3GOF A;  3SS4 A;  1DJW A;  1VRK A;  4DUQ A;  3NSO A;  2PQL A;  1YUS A;  1DVI A;  2F8P A;  1AJ4 A;  5D3O A;  1UHH A;  1WRZ A;  2BEC A;  1SCM C;  3FE6 A;  1XFW O;  1OOG A;  3OX5 A;  4PHK A;  1UHK A;  5ER5 A;  3PJI A;  1JF2 A;  3B7A A;  2E6W A;  5EL2 A;  2QPT A;  4I5K A;  3LK1 A;  1W7I B;  4P2Y B;  3DVM A;  2KBI A;  1QIV A;  4NDC A;  1PK0 D;  4PT1 A;  4PE7 A;  4A4C A;  4PCW A;  2L4H A;  2JXC A;  1JF0 A;  4AQJ A;  2LHI A;  1IQ3 A;  1XA5 A;  4YGE B;  5AFP A;  3S0A A;  1TNP A;  3PM8 A;  4GAO A;  1J1D A;  3GK4 X;  2JWW A;  1PVA A;  2JPO A;  2PAL A;  1OOH A;  2JZI A;  1M46 A;  2FCE A;  4I5J A;  1Y0V H;  3D10 A;  2LUC A;  3SG6 A;  1YVL A;  3R1P A;  2KLD A;  1KK8 B;  3TS5 C;  3BJH A;  3EVV A;  4FQT A;  2KYC A;  4FTG A;  2F33 A;  4YGB B;  1TUZ A;  1V1G A;  1GM0 A;  4XJK B;  2LE9 B;  2L4I A;  2HET A;  2JXL A;  4JD9 A;  3CZ2 A;  3HCM A;  1BMO A;  1IGV A;  3C1V A;  4OVN F;  1MF8 B;  2ZRS A;  3WHU B;  4UPG A;  5ER4 X;  3I5F C;  1CKK A;  4PE4 A;  1TNQ A;  2ZRT A;  1TTX A;  1J1E A; 
#chains in the Genus database with same CATH homology
 3DD4 A;  1YRT B;  1F70 A;  2K2F A;  5J3X A;  1XFY O;  3TDI A;  2OS8 C;  1J7P A;  1EJ3 A;  2A4J A;  3EKH A;  5CSN A;  2HQ8 A;  1AK8 A;  2GGM A;  5HLO A;  2MLE C;  1QVI Y;  1H8B A;  3I5H C;  1CDM A;  1IG5 A;  1FI5 A;  4E68 A;  1NX2 A;  1K95 A;  1DJH A;  5IBW A;  1JSA A;  1ZOT B;  1A75 B;  1CNP A;  5F6T A;  1S5G Z;  4MVF A;  3GK2 A;  1C7W A;  2KQY A;  3JTD B;  2WND A;  1UP5 A;  2K61 A;  2LC5 A;  3IQO A;  2BL0 B;  3CR5 X;  1YX7 A;  2M1K B;  2KOT A;  2HPS A;  2WC8 A;  2JPT A;  1AJ5 A;  1IRJ A;  3JVT C;  4I5N B;  2G9B A;  1XK4 A;  1DF0 B;  3FWB A;  3PAT A;  1SY9 A;  2JNX A;  2Y5I A;  1OZO A;  4PE0 A;  1YVH A;  2PVB A;  1Y1U A;  2KGB C;  4PHM A;  4USL A;  3VRQ A;  1G8I A;  1K9P A;  1DGU A;  2BCB A;  1B8R A;  1OMD A;  1CFD A;  3SG3 A;  2JT3 A;  2ZN8 A;  1DJZ A;  1NX1 A;  2LCP A;  2LVV A;  3SG5 A;  1A03 A;  2MBX A;  2LMU A;  1YTZ C;  1QXP A;  3CR4 X;  4WRI A;  2JOJ A;  2PMY A;  2NCP A;  1B7T Z;  2OS8 B;  1UWO A;  2CCM A;  1CFF A;  2CNP A;  4FQO A;  2AAO A;  1SR6 C;  2B1U A;  3LLE A;  3I5H B;  4YI8 A;  5CSF A;  2CBL A;  5AER A;  2LP3 A;  4CPV A;  5D7F A;  4DS7 A;  2LLU A;  1DGV A;  1N0Y A;  1JUO A;  1IQ5 A;  3TUY C;  1QIW A;  2BE4 A;  2JTT A;  5HLV A;  1B47 A;  1DTL A;  1F4O A;  1JFJ A;  1NIW A;  3EVR A;  2JT0 A;  4ORA B;  1UUR A;  1BOD A;  1KQV A;  2KI6 C;  1REC A;  4QJ3 B;  4YI9 A;  4JPZ B;  1J7O A;  4CLN A;  4WQ3 A;  3TDZ A;  1ZUZ A;  1FF1 A;  4GNK B;  1TCF A;  3JVT B;  1XK4 C;  2CTN A;  2JRF A;  2L98 A;  2BBN A;  1DJY A;  2GV5 A;  1F71 A;  1G33 A;  1QLK A;  2KHN A;  2O5G A;  3SIA A;  3E3R A;  1BF5 A;  1WY9 A;  2K7B A;  3BYA A;  1NUB A;  2Y1M A;  1MUX A;  2I2R E;  3QRX A;  3TZ1 A;  2V53 A;  4R1E A;  3GK1 A;  2KYF A;  1KWO B;  1H4B A;  1QLS A;  4C0L A;  2JTZ A;  4MZL A;  3EK8 A;  1MXL C;  4F0Z B;  2VRG A;  3DVE A;  4ETO A;  2BKH B;  1MXE A;  2Y4Q A;  1AVS A;  4GGN A;  1MQ1 A;  1YUU A;  2KI4 C;  1NPQ A;  4IL1 A;  2KBM A;  2PSR A;  4L9M A;  3PAL A;  1NSH A;  2BCA A;  1QX5 B;  1MHO A;  3AKB A;  2D8N A;  1SR6 B;  1KK7 Z;  1C7V A;  2K0J A;  2JT8 A;  2QAC A;  4DIR A;  2JU0 A;  1K8U A;  3ZNI A;  5DKR A;  3M0W A;  2KFF A;  1K96 A;  2L50 A;  3H4S E;  2MLF C;  2LMT A;  2MA2 A;  1FI6 A;  3BOW A;  2F3Z A;  2PAS A;  2WOR A;  1ZMZ A;  4N1G A;  1IKU A;  2ISD A;  5AAN A;  1PAL A;  1KQM C;  1ZAC A;  4DRW A;  1B8L A;  2AMI A;  2KDH A;  1LXF C;  2LV7 A;  4ZCV A;  1LKJ A;  1NP8 A;  2KNE A;  2BKI B;  1IH0 A;  2K7O A;  1DMO A;  2LLS A;  4AOM A;  1KCY A;  1K9U A;  2RGI A;  2FJU B;  1BLQ A;  3EK7 A;  3VRP A;  2M9G A;  1SCM B;  2M7L A;  2EHB A;  5AXI A;  1IJ5 A;  4U8D A;  1V1F A;  4JWQ A;  3EKJ A;  2JUL A;  3DF0 B;  5HKW A;  1QAS A;  2L2E A;  1F54 A;  4D1E A;  4YGD B;  1QX2 A;  3SG2 A;  1CLB A;  2EC6 C;  2KFH A;  2KAX A;  4PDZ A;  4A4B A;  5KU1 A;  3I5G C;  1XFX O;  3I5I C;  5JJG A;  1S6C A;  2HF5 A;  4CID A;  1WRL A;  5CPV A;  1TNW A;  4PE1 A;  1IJ6 A;  1S1E A;  1XFZ O;  1EG3 A;  1CDN A;  5GQQ C;  2R2I A;  1WDC C;  2P6B B;  5FYX A;  5KSZ A;  3NSL A;  1R6P A;  1SW8 A;  1NWD A;  3IQQ A;  1NYA A;  1U5I A;  1SYM A;  3A8R A;  1NCZ A;  2WCF A;  4MLW A;  2F3Y A;  3TS5 B;  1JC2 A;  3FIA A;  1FW4 A;  5KTY A;  4GFT A;  3WXA A;  1RWY A;  1YR5 A;  3PN7 C;  1BU3 A;  1PUL A;  4PHN A;  4Q04 A;  3NSK A;  3BUN B;  3PSR A;  5JOL A;  2FOT A;  2BCX A;  2IS9 A;  3KF9 A;  2K7C A;  1XYD A;  5I8N A;  2LLT A;  2WCB A;  4ORB B;  3KO0 A;  2SAS A;  1XVJ A;  3CGA A;  2I94 A;  2LNK A;  4MZJ A;  3I5F B;  3WHT B;  1CMF A;  3SG4 A;  4JQ0 D;  3SG7 A;  1L2O C;  2LHL A;  2KAY A;  1ALV A;  2KI6 D;  1CB1 A;  1K9K A;  1PRW A;  3PFV A;  2KAV A;  3CS1 A;  4NDB A;  3O78 A;  2GGZ A;  2DOQ A;  1EL4 A;  2FCD A;  5CSJ A;  1B4C A;  1M31 A;  4AQI A;  3D0Y A;  2G2B A;  5CSI A;  1TN4 A;  4HRE E;  2EGD A;  2EC6 B;  4YGC B;  3DVK A;  1EXR A;  1NX3 A;  1J7Q A;  3I5G B;  1RJV A;  3F45 A;  1SNL A;  2M8U A;  3I5I B;  1YRU B;  1JBA A;  1ALW A;  1S5G Y;  3O2P A;  1LA0 A;  1X02 A;  2KSP A;  1SRA A;  3CWG A;  3PLF B;  5I2Q A;  2LVK A;  1CLL A;  1CFP A;  3TDU A;  1JFK A;  1BT6 A;  2F2P A;  1S3P A;  2OTG C;  3OP0 A;  1TRF A;  1F4Q A;  2MJW B;  1PSB A;  4MZK A;  1WLM A;  4ICB A;  2LAP A;  3BOW B;  4OKH A;  3PN7 B;  3AAK A;  2JQ6 A;  1KFU L;  5BPJ A;  1KK8 C;  3EK4 A;  3HX4 A;  1NCY A;  2F2O A;  1IWQ A;  2MAZ A;  1OE9 B;  4I5L B;  4ZCU A;  2KGR A;  1D1O A;  1QV0 A;  1W7J B;  2M3W A;  3VGO A;  1CDP A;  2M29 A;  4YGA A;  1A2X A;  1AHR A;  2LVJ A;  1OQP A;  2LVI A;  1OMR A;  3RLZ A;  1LIN A;  4M2O A;  1TNX A;  1NCX A;  2NXQ A;  1QX7 A;  1KFU S;  1KSO A;  2LMV A;  1B7T Y;  3LL8 B;  2Y1N A;  3A4U B;  4QJ5 B;  4OR9 B;  4GBA A;  1RRO A;  3CR2 A;  1B8C A;  1BJF A;  1M39 A;  1QAT A;  5HKY A;  1CMG A;  1S26 D;  1GQM A;  1QV1 A;  2JNF A;  4M2P A;  1CM4 A;  4C0J A;  3TUY B;  1MWN A;  1QVI Z;  3ICB A;  1SMG A;  3WNX B;  1RK9 A;  1CDL A;  3NXA A;  1SL8 A;  1N2D A;  1M45 A;  2M7N A;  1F55 A;  1AUI B;  1XFU O;  3OB1 B;  2PRU A;  1K90 D;  1SPY A;  1CM1 A;  2M49 B;  4WQ2 A;  3JTD C;  1U5I B;  2ZN9 A;  1K93 D;  2OTG B;  1TCO B;  2NZ0 A;  1DJX A;  1S6J A;  3LCP C;  1AP4 A;  2BL0 C;  4HRG A;  1SL9 A;  2M1U A;  2NLN A;  1SK6 D;  2TN4 A;  3BUO B;  3SIB A;  1B1G A;  5DKQ A;  2KFG A;  2L0P A;  4GGF A;  5TNC A;  1UHI A;  2HQW A;  4ORC B;  2BBM A;  2CT9 A;  4QJ4 B;  1YX8 A;  3BUM B;  5AEQ A;  3DVJ A;  2WOS A;  4CFQ A;  1S36 A;  1E8A A;  1MR8 A;  1RTP 1;  2KI4 B;  3OB2 B;  3SJS A;  1JWD A;  5D69 A;  3VRN A;  4BY5 A;  1R2U A;  3AKA A;  4M2Q A;  2H61 A;  1LVC D;  4C0K A;  1A29 A;  4NQG A;  5HKZ A;  1GGW A;  3KHE A;  1Q80 A;  1BOC A;  1KK7 Y;  2ZKM X;  3D0Y B;  2ZFD A;  3KEV A;  1J55 A;  3FWC A;  1M63 B;  4PHJ A;  4TNC A;  3BQ3 A;  2K8M B;  2K7D A;  1XO5 A;  1A4P A;  1HQV A;  2MRD A;  2SCP A;  1SBJ A;  1K2H A;  1OMV A;  3KPX A;  1UHN A;  1SL7 A;  4OCI A;  1YUT A;  1CTR A;  1EG4 A;  2K2A A;  3VRO A;  1C07 A;  3OHM B;  1UHJ A;  1TIZ A;  1KQM B;  1KSM A;  2LM5 A;  4XJK A;  3ZWH A;  2O60 A;  4XYN A;  1PVB A;  4MRY A;  1F8H A;  1QJT A;  1EH2 A;  2L5X B;  1ODB A;  2AUC A;  5DKN A;  1BR1 B;  5I2O A;  2I7A A;  1Y6W A;  1OSA A;  5I2L A;  1L7Z A;  2L51 A;  4GGF C;  1SCV A;  2CXJ A;  1K94 A;  4MBE A;  4N5X A;  4GPL B;  2ZNE A;  2KQ6 A;  3AAJ A;  4GUK A;  4CFR A;  2BE6 A;  1CFC A;  1NX0 A;  1KFX L;  2WCE A;  3EVU A;  4MRX A;  2E30 A;  5HYD A;  1FBV A;  2I18 A;  2Q4U A;  1Y1A A;  5K89 A;  1KWO C;  1XFV O;  1UUS A;  1WRK A;  2COL B;  1GGZ A;  3O6B A;  2JC2 A;  2M97 A;  3DF0 A;  3O4Y A;  4BY4 A;  3BUW B;  3IF7 A;  4MEW A;  2M0R A;  2H61 C;  5B8I B;  1CLM A;  1N65 A;  2MHH A;  1PSR A;  3VRR A;  3NSI A;  4N1F A;  1BR4 B;  1WDC B;  2LAN A;  4YRU A;  1A75 A;  1G4Y R;  1KFX S;  3MSE B;  1HT9 A;  1WLZ A;  4NDD A;  1SKT A;  4PAL A;  1RFJ A;  1QTX A;  4HRH A;  1J7R A;  3BUX B;  4DCK A;  3OX6 A;  1YUR A;  4OV2 A;  1DJG A;  5G08 A;  5PAL A;  1DF0 A;  1LA3 A;  2OPO A;  3CLN A;  1ZFS A;  4YBH B;  1S6I A;  3CZT X;  4HSZ A;  1FPW A;  1B9A A;  3LK0 A;  1TOP A;  3K21 A;  1DT7 B;  2LP2 A;  1DJI A;  2NCO A;  3BXK A;  1BG1 A;  4MSP A;  4P5O E;  1L2O B;  1Y1X A;  2ZND A;  1GJY A;  1OOJ A;  1QS7 A;  2H2K A;  3FS7 A;  2Q91 A;  4MN0 A;  3RM1 A;  1OZS A;  3CTN A;  2LUX A;  3GOF A;  1DJW A;  1VRK A;  4DUQ A;  3NSO A;  1YUS A;  1DVI A;  2F8P A;  1AJ4 A;  1UHH A;  1WRZ A;  2BEC A;  1SCM C;  3OX5 A;  1XFW O;  4PHK A;  1UHK A;  5ER5 A;  1JF2 A;  2E6W A;  2QPT A;  4I5K A;  3LK1 A;  1W7I B;  4P2Y B;  3DVM A;  2KBI A;  1QIV A;  4NDC A;  1PK0 D;  4PE7 A;  4A4C A;  4PCW A;  2L4H A;  2JXC A;  1JF0 A;  4AQJ A;  2LHI A;  1IQ3 A;  1XA5 A;  4YGE B;  5AFP A;  1TNP A;  3PM8 A;  4GAO A;  1J1D A;  3GK4 X;  2JWW A;  1PVA A;  2PAL A;  2JZI A;  1M46 A;  2FCE A;  4I5J A;  1Y0V H;  3D10 A;  2LUC A;  3SG6 A;  1YVL A;  1KK8 B;  3TS5 C;  3EVV A;  4FTG A;  2KYC A;  2F33 A;  4YGB B;  1V1G A;  4XJK B;  2LE9 B;  2L4I A;  2HET A;  2JXL A;  3HCM A;  1BMO A;  1IGV A;  3C1V A;  4OVN F;  1MF8 B;  2ZRS A;  3WHU B;  4UPG A;  5ER4 X;  3I5F C;  1CKK A;  4PE4 A;  1TNQ A;  2ZRT A;  1TTX A;  1J1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...