4PE1A

Crystal structure of calcium-loaded s100b bound to sc124
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/inhibitor
molecule keywords Protein S100-B
publication title Covalent Small Molecule Inhibitors of Ca(2+)-Bound S100B.
pubmed doi rcsb
source organism Bos taurus
total genus 31
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pe1A00
1NX1A 1S3PA 1UWOA 1BR1B 2WCBA 3GK2A 1NYAA 2LVIA 1XO5A 1MF8B 1B7TZ 1XVJA 2KFFA 5KU1A 2MLFC 1AHRA 1YRTB 1IQ5A 2GGMA 2BKIB 2M8UA 5CSNA 4PHJA 3D0YA 1IG5A 5DKQA 4OV2A 2HETA 2BECA 4YI8A 1QVIY 1F4QA 2K7DA 1S5GY 3IQQA 4DUQA 3OHMB 3DD4A 2M7LA 2OTGC 2WCEA 4ZCVA 3AKBA 5K89A 3EKHA 1RROA 2Q91A 5AEQA 5D69A 1DJYA 1JF2A 2LV7A 2ZRTA 1OMVA 3AKAA 1SBJA 2M49B 3EK8A 1DTLA 2M7NA 1GGWA 4PE0A 4QJ4B 1D1OA 3K21A 2M29A 3OP0A 3TDIA 1TRFA 4WRIA 1QIWA 2F8PA 3D10A 3DVMA 2LAPA 3FWCA 3OB2B 4CFRA 1CB1A 1SCVA 4GAOA 2JNXA 1BODA 1CLLA 2AMIA 3DF0A 3LLEA 4PE1A 5ER5A 1QLKA 1F54A 3GK4X 2MBXA 1EH2A 1F71A 1W7IB 1PSRA 2I7AA 2ZRSA 1YUTA 2MAZA 4XYNA 4F0ZB 4CPVA 1NX3A 4I5KA 3BUWB 4N1FA 3VRPA 5G08A 4USLA 5HLOA 1M63B 4BY4A 3EKJA 2KOTA 5AFPA 1LA3A 4PALA 1KSOA 1PALA 2BCBA 1QV1A 5I2QA 2KI6C 3SG3A 3VGOA 4ORCB 4YGCB 1SKTA 3LCPC 3QRXA 1Y1AA 2KFHA 4NDDA 1N2DA 2MLEC 1B7TY 1QTXA 2WCFA 2LMUA 1N65A 1UHJA 2KQYA 1L2OB 3PFVA 1H4BA 1WLMA 1UHIA 3OX5A 1SR6C 2GGZA 3PN7B 1GQMA 3SG6A 1IRJA 1CTRA 4MVFA 4BY5A 1OMDA 4MLWA 1RWYA 3I5IB 2ZFDA 4FTGA 1CNPA 4YGDB 1AK8A 2BBNA 3WXAA 1B8LA 1JBAA 4OR9B 2BL0B 3SIBA 4UPGA 2KQ6A 1YVHA 1SL8A 3KHEA 1K94A 1WRZA 2OTGB 3LK0A 1XYDA 4Q04A 1Y1UA 1IKUA 2L50A 1WLZA 5KSZA 1KK8C 2LP3A 1J7PA 3BUOB 2LLSA 2RGIA 4NDCA 1DJXA 4GNKB 1QASA 2EC6C 5HKYA 1OZSA 1DF0A 4WQ2A 4DRWA 4MEWA 1K95A 1H8BA 4PE4A 2CCMA 3JTDC 4A4BA 1S6CA 1CFCA 2ZNEA 3JVTB 3HX4A 1MUXA 2PMYA 1UHHA 2LVVA 1FPWA 2FJUB 1K9UA 3PALA 4OVNF 5GQQC 2F3ZA 2KYFA 2F2PA 1XFYO 2TN4A 3SIAA 1UUSA 1V1FA 2M0RA 1KFXL 3VRRA 2E6WA 2LHLA 1G4YR 2MRDA 1QXPA 3CWGA 1ZMZA 1DGUA 2B1UA 2JT8A 2NCPA 3ICBA 1LA0A 1A4PA 4P5OE 2M1KB 4CLNA 1CM1A 1ODBA 1U5IB 4I5NB 5PALA 3DVKA 3TS5C 3VROA 1TTXA 2FOTA 1SY9A 1NIWA 1IJ5A 3CS1A 1YX8A 2ZN8A 3GK1A 1A75A 1ALVA 3WHUB 1OMRA 1QLSA 1WDCC 1TNWA 1F8HA 1L7ZA 1JFKA 2LC5A 1XA5A 3LL8B 2OS8C 2ISDA 1LINA 3CLNA 5JOLA 2KYCA 2HQWA 1WRLA 4NDBA 1J7RA 2CTNA 1BT6A 2LCPA 1DJIA 1MWNA 4OCIA 3E3RA 2KI4B 2JNFA 1K96A 2GV5A 1QJTA 4M2QA 1CDMA 3RLZA 1NCZA 1KFUL 4YBHB 3D0YB 1KWOC 1JWDA 2JXCA 1TOPA 2KBMA 4GFTA 4HSZA 1SRAA 1M39A 3AAJA 1FI5A 1TIZA 1IGVA 2I2RE 1QATA 1Y1XA 4YGBB 5IBWA 5TNCA 1F55A 3PLFB 3CR5X 1PK0D 2L98A 1B9AA 1TNPA 2MHHA 2NLNA 2Y1NA 1YR5A 5CPVA 3I5HB 4GUKA 1ALWA 4MN0A 1XFUO 1J55A 4MRYA 5I2LA 3CZTX 3H4SE 2JT0A 1DJWA 2PRUA 1SCMC 1SNLA 2HF5A 4TNCA 1J1DA 2D8NA 1YURA 4PE7A 4CFQA 4MZLA 2LANA 2AUCA 3NSKA 1ZACA 2K7CA 3DF0B 2IS9A 2NXQA 3A4UB 2JQ6A 1KQMB 1NX2A 1R6PA 4N1GA 3TUYB 4N5XA 2KDHA 3I5FB 2SCPA 2LUCA 2G9BA 4C0KA 3I5GC 5CSIA 3EVUA 2EGDA 2KI6D 2JOJA 1CDLA 4I5JA 4MRXA 1BOCA 4GGFA 1SPYA 3O6BA 2KSPA 3VRNA 1B1GA 1PVAA 1C07A 1TN4A 1KQVA 2O60A 3BOWA 4NQGA 4E68A 1QX5B 1FI6A 2L2EA 3KO0A 4ICBA 2KGRA 3FS7A 5BPJA 1C7VA 1S36A 1ZOTB 1C7WA 1OE9B 1JFJA 1DVIA 1QX2A 1RK9A 3O2PA 1F4OA 4OKHA 2L0PA 2BE6A 2JPTA 1EG3A 2JXLA 2KBIA 5HYDA 1NCYA 2M9GA 4DIRA 4QJ5B 3MSEB 1SMGA 1CFDA 3LK1A 1YRUB 1CLBA 2JTTA 4P2YB 2Y1MA 1YVLA 1K9KA 1YUSA 5AERA 1S5GZ 3BUXB 2CT9A 1B8CA 1SL7A 2WOSA 1XK4A 3FWBA 2LVJA 4IL1A 3CR4X 1DMOA 1LVCD 1DT7B 1IQ3A 1PULA 4AQJA 4AQIA 4HREE 3OB1B 1QX7A 3FIAA 5DKNA 1JUOA 2KGBC 2PASA 2JTZA 1YX7A 1Q80A 3AAKA 1AP4A 1OQPA 4GPLB 2PVBA 4U8DA 2LNKA 1CMGA 2KAVA 1TCOB 4M2PA 2K61A 1J7QA 1EG4A 5I8NA 1JC2A 1RJVA 1DF0B 5FYXA 4XJKB 5KTYA 1G8IA 3WNXB 1DGVA 1OSAA 3BYAA 2ZNDA 3CR2A 3A8RA 3EK4A 4I5LB 4GBAA 1QS7A 1BJFA 2LHIA 1BG1A 1CKKA 2FCDA 4YI9A 2H61A 4AOMA 3EVRA 2NZ0A 3O4YA 1DJGA 3DVEA 2M1UA 3KF9A 3SG5A 1PRWA 2O5GA 1DJHA 1K9PA 3NXAA 1AUIB 4ORAB 1XFXO 2LP2A 2ZN9A 1LXFC 1M45A 2JT3A 3CTNA 1SR6B 2I94A 1IJ6A 1UHKA 2K2AA 3CGAA 4YRUA 1K2HA 2KHNA 1SW8A 4GGFC 1OOJA 2LMTA 3PN7C 3EK7A 1WY9A 2BCAA 5D7FA 1A75B 2K0JA 3I5IC 1KFXS 2LMVA 1QV0A 2F3YA 4YGAA 5HKWA 1A29A 2LLTA 2G2BA 4ZCUA 3VRQA 1WRKA 2BCXA 2QPTA 2BBMA 3RM1A 2BL0C 3IQOA 5DKRA 1KK8B 2COLB 4MZKA 1GGZA 4HRGA 1JF0A 1MHOA 1PSBA 2OPOA 1AJ4A 1NPQA 1UP5A 2JRFA 4MZJA 2EHBA 1MXEA 2F33A 2K8MB 1RTP1 3ZWHA 3IF7A 1KK7Z 3NSOA 3BXKA 1J1EA 3M0WA 5F6TA 2EC6B 1CM4A 3EVVA 3F45A 3NSIA 2DOQA 2L4HA 2ZKMX 1K90D 1BLQA 2F2OA 1DJZA 1K8UA 3SG2A 1NSHA 2PALA 1Y0VH 2HQ8A 3JTDB 1NX0A 2CXJA 1ZUZA 3BUMB 3NSLA 3WHTB 1S6IA 4PHNA 1XK4C 1N0YA 5ER4X 3TDUA 3C1VA 1X02A 2Y5IA 1W7JB 1Y6WA 1EXRA 2KNEA 3JVTC 5AANA 2E30A 3SG4A 1NP8A 2BKHB 3DVJA 1MR8A 2LE9B 1QIVA 4HRHA 1UHNA 2I18A 1BF5A 3BUNB 1FW4A 1KFUS 4JWQA 4WQ3A 5CSFA 4DS7A 2WORA 1PVBA 3ZNIA 2QACA 2FCEA 2AAOA 4JQ0D 1KCYA 3TS5B 2V53A 1XFWO 2M97A 1B8RA 1S26D 2JULA 2K7OA 1TNQA 5I2OA 1F70A 2M3WA 2WNDA 1M46A 1YUUA 1WDCB 4YGEB 1SL9A 3KPXA 4L9MA 1LKJA 4FQOA 4R1EA 1CDNA 2CBLA 2JZIA 3GOFA 5JJGA 4MBEA 1S1EA 4C0LA 1SYMA 1BU3A 2OS8B 3SG7A 4A4CA 2PSRA 3PATA 2H61C 3BQ3A 1FF1A 4M2OA 1NCXA 4PCWA 2LVKA 1JSAA 1SK6D 1TCFA 1CDPA 2KAXA 2L5XB 2NCOA 2P6BB 1E8AA 1R2UA 2L4IA 3PSRA 2BE4A 2VRGA 3KEVA 4QJ3B 1AVSA 2R2IA 3BOWB 1QVIZ 4PHMA 1A2XA 2Y4QA 2KI4C 4JPZB 1M31A 1KWOB 5HKZA 5J3XA 2K2FA 2LM5A 1IH0A 2L51A 1KK7Y 2KAYA 4ETOA 1GJYA 1TNXA 3TZ1A 5AXIA 1G33A 5HLVA 1HT9A 2LLUA 2WC8A 3O78A 5B8IB 1RFJA 1S6JA 3PM8A 4DCKA 2CNPA 1BR4B 1CMFA 1MQ1A 2SASA 4C0JA 1VRKA 1CFFA 2JC2A 3TDZA 1IWQA 1NWDA 1RECA 1SCMB 1U5IA 2JWWA 1HQVA 1EL4A 1MXLC 2Q4UA 3OX6A 4XJKA 4MSPA 1BMOA 1EJ3A 1KSMA 2A4JA 1CFPA 1J7OA 2H2KA 1ZFSA 4PDZA 1A03A 4GGNA 4PHKA 1UURA 1K93D 3HCMA 4ORBB 1FBVA 1B4CA 5CSJA 4CIDA 2MA2A 1AJ5A 2LUXA 1CLMA 1XFZO 1OZOA 3I5HC 3SJSA 3I5GB 2JU0A 1KQMC 1YTZC 2MJWB 4D1EA 1V1GA 3TUYC 3I5FC 2K7BA 2KFGA 1XFVO 2HPSA 1NUBA 1L2OC 1B47A
chains in the Genus database with same CATH superfamily
3R1VA 1NX1A 1S3PA 1UWOA 1BR1B 2K60A 2WCBA 3GK2A 1NYAA 2LVIA 1XO5A 1MF8B 1B7TZ 1XVJA 2KFFA 5KU1A 2MLFC 1AHRA 1YRTB 1IQ5A 2GGMA 2BKIB 2M8UA 5CSNA 4PHJA 3D0YA 3B6XA 3S0GA 1IG5A 5DKQA 4OV2A 2HETA 2BECA 4YI8A 1QVIY 1F4QA 2K7DA 1S5GY 3IQQA 4DUQA 3OHMB 3DD4A 2M7LA 2OTGC 2WCEA 4ZCVA 3AKBA 5K89A 3EKHA 1RROA 2Q91A 5AEQA 5D69A 1DJYA 3D74A 1JF2A 2LV7A 2ZRTA 1OMVA 3AKAA 1SBJA 2M49B 3EK8A 1DTLA 2M7NA 1GGWA 4PE0A 4QJ4B 1D1OA 3K21A 2M29A 3OP0A 2YGUA 2GTEA 1TRFA 4WRIA 1QIWA 3TDIA 3B87A 2F8PA 3D10A 3DVMA 2LAPA 3FWCA 3OB2B 4CFRA 1CB1A 1SCVA 4GAOA 1OW4A 2JNXA 1CLLA 3B86A 1BODA 2AMIA 3S0EA 3DF0A 5I94A 3LLEA 4PE1A 5ER5A 1QLKA 1F54A 3GK4X 2MBXA 3S0AA 1EH2A 1F71A 1W7IB 1PSRA 2I7AA 2ZRSA 1YUTA 2MAZA 4XYNA 4F0ZB 4CPVA 1NX3A 4I5KA 3BUWB 4N1FA 3VRPA 5G08A 4USLA 5HLOA 1M63B 4BY4A 3EKJA 2KOTA 5FI7A 5AFPA 1LA3A 4PALA 1KSOA 2KLDA 1PALA 2BCBA 3BJHA 1QV1A 1Z4HA 5I2QA 2KI6C 3SG3A 3VGOA 4ORCB 4YGCB 1SKTA 3LCPC 3QRXA 1Y1AA 2KFHA 4NDDA 1N2DA 2MLEC 1B7TY 2QEHA 3D76A 1QTXA 2WCFA 2LMUA 1N65A 1UHJA 2KQYA 2P71A 1L2OB 3PFVA 1H4BA 1WLMA 3BFHA 1UHIA 3OX5A 3NGVA 1SR6C 2GGZA 3PN7B 1GQMA 3SG6A 1IRJA 1CTRA 4JD9A 4MVFA 1OMDA 4BY5A 4MLWA 1RWYA 1GM0A 3OGNA 3I5IB 2ZFDA 4FTGA 2BNXA 1CNPA 4YGDB 1AK8A 2BBNA 3WXAA 1B8LA 1JBAA 4OR9B 3RZSA 2BL0B 3SIBA 4UPGA 2KQ6A 1YVHA 1SL8A 3KHEA 3OBVA 1K94A 1WRZA 2PYQA 3UNWA 2OTGB 3LK0A 1XYDA 4Q04A 1Y1UA 1IKUA 3B88A 2L50A 1WLZA 5KSZA 1KK8C 2LP3A 3QMEA 1J7PA 1SSEB 3DYEA 3BUOB 2LLSA 2RGIA 4NDCA 1DJXA 4GNKB 1QASA 2EC6C 5HKYA 1OZSA 1DF0A 4WQ2A 4DRWA 4MEWA 1K95A 1H8BA 4PE4A 2CCMA 3JTDC 4A4BA 3DXLA 3D73A 1S6CA 1CFCA 2ZNEA 3JVTB 3HX4A 2QEOA 1MUXA 2PMYA 1UHHA 2LVVA 1FPWA 2FJUB 1K9UA 3PALA 4OVNF 5GQQC 3R72A 2F3ZA 2KYFA 1XFRA 2F2PA 1XFYO 2TN4A 3SIAA 1UUSA 4INXA 1V1FA 2M0RA 1KFXL 3VRRA 2E6WA 2LHLA 1G4YR 2MRDA 1QXPA 3CWGA 1ZMZA 1DGUA 2B1UA 2JT8A 2NCPA 3ICBA 1LA0A 1A4PA 3D75A 4P5OE 1DEKA 2M1KB 4CLNA 1CM1A 1ODBA 1U5IB 4I5NB 5PALA 3DVKA 3TS5C 3VROA 1TTXA 2FOTA 1SY9A 1NIWA 1IJ5A 3CS1A 1YX8A 2ZN8A 3GK1A 3CDNA 1A75A 1ALVA 4JKTA 3WHUB 1OMRA 1QLSA 1WDCC 1TNWA 3R1PA 3IVTA 3SS4A 1F8HA 1L7ZA 3CYZA 1JFKA 2LC5A 1XA5A 3LL8B 2OS8C 2ISDA 1LINA 3CLNA 2WCHA 2KYCA 5JOLA 2HQWA 4OZDA 1WRLA 4NDBA 1J7RA 2CTNA 3CZ1A 1BT6A 2WCLA 2LCPA 1DJIA 1MWNA 2P70A 5FI6A 4OCIA 3CZ0A 3E3RA 2KI4B 2JNFA 3N7HA 1K96A 2GV5A 1QJTA 3L4AA 1CDMA 4M2QA 1NCZA 3RLZA 1KFUL 4YBHB 3S0DA 3D0YB 1KWOC 1JWDA 1OOFA 2JXCA 1TOPA 2KBMA 4GFTA 4HSZA 1SRAA 1M39A 3AAJA 1FI5A 1TIZA 1IGVA 2I2RE 1QATA 1Y1XA 4YGBB 5IBWA 3B7AA 5TNCA 1F55A 3PLFB 3CR5X 1PK0D 2L98A 1B9AA 1TNPA 2MHHA 2NLNA 2WCMA 2Y1NA 1YR5A 2KPHA 3I5HB 2WCJA 4GUKA 1ALWA 5CPVA 4MN0A 1XFUO 1J55A 4MRYA 5I2LA 1P28A 3CZTX 3H4SE 2JT0A 1DJWA 2PRUA 1Z2CB 1SCMC 1SNLA 2HF5A 4TNCA 1J1DA 2D8NA 1YURA 4PE7A 4CFQA 4MZLA 2LANA 2AUCA 3NSKA 5FI2A 1ZACA 2K7CA 3DF0B 3BFAA 3V2LA 2IS9A 2NXQA 3A4UB 2JQ6A 1KQMB 1NX2A 2PQLA 3PJIA 1R6PA 4N1GA 3TUYB 4N5XA 2KDHA 3I5FB 1C3ZA 2SCPA 2LUCA 2G9BA 4C0KA 3I5GC 5CSIA 1ORGA 3EVUA 2EGDA 2H8VA 2KI6D 2QEVA 2JOJA 1CDLA 4I5JA 4MRXA 1BOCA 4GGFA 1SPYA 3CABA 3O6BA 2KSPA 3VRNA 1B1GA 1PVAA 1C07A 1TN4A 1KQVA 1IIOA 2O60A 3BOWA 4NQGA 4E68A 1QX5B 1FI6A 2L2EA 3KO0A 4ICBA 2KGRA 3FE6A 3FS7A 5BPJA 1C7VA 1S36A 1ZOTB 2WC6A 1C7WA 1OE9B 4FQTA 1JFJA 1DVIA 1TUJA 1QX2A 1RK9A 3O2PA 2ERBA 1F4OA 4OKHA 1QWVA 2L0PA 2BE6A 2JPTA 1EG3A 2JXLA 2KBIA 3NHIA 5HYDA 1NCYA 2M9GA 4DIRA 4QJ5B 3MSEB 1SMGA 1CFDA 2QDIA 3LK1A 1YRUB 1CLBA 2JTTA 4P2YB 3DY9A 3K1EA 2Y1MA 1YVLA 5HL1A 1K9KA 1YUSA 5AERA 1S5GZ 3BUXB 2CT9A 1B8CA 2BAPA 1SL7A 2WOSA 1XK4A 3FWBA 2LVJA 4IL1A 3CR4X 1DMOA 1LVCD 1DT7B 1IQ3A 1PULA 4AQJA 4AQIA 3L4LA 2L5YA 3S0FA 4HREE 3OB1B 1QX7A 3FIAA 5DKNA 1JUOA 2KGBC 2PASA 2JTZA 1YX7A 1Q80A 3AAKA 1DELA 1AP4A 1OQPA 4GPLB 2PVBA 4U8DA 2LNKA 1CMGA 2KAVA 1TCOB 4M2PA 2K61A 1J7QA 1EG4A 3O4XA 5I8NA 1JC2A 1RJVA 1DF0B 5FYXA 4XJKB 5EL2A 5KTYA 3R1OA 1G8IA 3NHTA 3WNXB 1DGVA 1OSAA 3BYAA 2ZNDA 3CR2A 3A8RA 3EK4A 5DICA 4I5LB 4GBAA 1T14A 1QS7A 1BJFA 1LS8A 2LHIA 1BG1A 1CKKA 2FCDA 4YI9A 2H61A 4AOMA 3EVRA 3PM2A 2NZ0A 3O4YA 1DJGA 3DVEA 2M1UA 3KF9A 3SG5A 1PRWA 2JPOA 2O5GA 3D77A 2L2CA 1DJHA 4KYNA 1K9PA 3NXAA 1AUIB 4ORAB 1XFXO 2LP2A 2ZN9A 1LXFC 1M45A 2JT3A 3CTNA 1SR6B 2I94A 1IJ6A 1UHKA 2KLEA 2K2AA 3CGAA 4YRUA 1K2HA 2KHNA 1SW8A 4GGFC 1OOJA 3Q8IA 2LMTA 3PN7C 3EK7A 1WY9A 2BCAA 5D7FA 1A75B 3D78A 2K0JA 3I5IC 1KFXS 2LMVA 1QV0A 2F3YA 4YGAA 5HKWA 1A29A 2LLTA 2G2BA 4ZCUA 5D3OA 3VRQA 1WRKA 2BCXA 2QPTA 2BBMA 3RM1A 2BL0C 3IQOA 1TUZA 5DKRA 1KK8B 2COLB 4MZKA 1GGZA 4HRGA 1JF0A 1MHOA 1PSBA 2OPOA 1AJ4A 1NPQA 1UP5A 2JRFA 4MZJA 2EHBA 1MXEA 2F33A 2K8MB 1RTP1 3ZWHA 3IF7A 1KK7Z 3NSOA 3BXKA 1J1EA 2WC5A 3M0WA 2EC6B 1CM4A 3EVVA 3F45A 3NSIA 5F6TA 2DOQA 2L4HA 2ZKMX 1K90D 1BLQA 2F2OA 1DJZA 1K8UA 3SG2A 1NSHA 2PALA 1Y0VH 2HQ8A 3FE8A 1NX0A 3JTDB 2CXJA 1ZUZA 3BUMB 3NSLA 3WHTB 1S6IA 4PHNA 1XK4C 1N0YA 5ER4X 3TDUA 3C1VA 1X02A 2Y5IA 1W7JB 1Y6WA 1EXRA 2KNEA 1TWOA 3JVTC 2E30A 5AANA 1NP8A 1OOGA 2BKHB 3DVJA 4IJ7A 3SG4A 1DC1A 1MR8A 2LE9B 1QIVA 3CZ2A 1UHNA 3FE9A 4HRHA 4INWA 2I18A 1BF5A 1DQEA 3BUNB 1FW4A 1KFUS 4JWQA 4WQ3A 5CSFA 4DS7A 2WORA 1PVBA 3ZNIA 2QACA 2FCEA 2AAOA 4JQ0D 1KCYA 3EG5B 3TS5B 2V53A 1XFWO 2M97A 1B8RA 1S26D 2JULA 2K7OA 1TNQA 5I2OA 1F70A 2M3WA 2WNDA 3SS3A 1M46A 1YUUA 1WDCB 4YGEB 1SL9A 3KPXA 4L9MA 1LKJA 4FQOA 4R1EA 1CDNA 2CBLA 2JZIA 3GOFA 2QEBA 5JJGA 4MBEA 1S1EA 4C0LA 1SYMA 1BU3A 2OS8B 3SG7A 1C3YA 2WCKA 4A4CA 2PSRA 3PATA 2H61C 3BQ3A 3L47A 1FF1A 4M2OA 1NCXA 4PCWA 2FJYA 2LVKA 1JSAA 1SK6D 1TCFA 1CDPA 2KAXA 2L5XB 2NCOA 2P6BB 1E8AA 1R2UA 2L4IA 3PSRA 2BE4A 2VRGA 3KEVA 4QJ3B 3UO9A 1AVSA 2R2IA 3BOWB 1QVIZ 4PHMA 1A2XA 2Y4QA 2KI4C 1OOIX 1M31A 1KWOB 4JPZB 5HKZA 5J3XA 2K2FA 2LM5A 1IH0A 2L51A 1KK7Y 2KAYA 4PT1A 4ETOA 1GJYA 1TNXA 3TZ1A 1OOHA 1G33A 5AXIA 3VB1A 3S0BA 5HLVA 1HT9A 2LLUA 2WC8A 3O78A 5B8IB 1RFJA 1S6JA 3PM8A 4DCKA 2CNPA 1BR4B 1CMFA 1MQ1A 2SASA 4C0JA 1VRKA 1W9ZA 1CFFA 2JC2A 3BFBA 3TDZA 1IWQA 1NWDA 1RECA 1SCMB 1U5IA 2JWWA 1HQVA 1EL4A 1MXLC 2Q4UA 3OX6A 4XJKA 4MSPA 1BMOA 1EJ3A 1KSMA 2A4JA 1CFPA 1J7OA 2H2KA 1ZFSA 4PDZA 1A03A 4GGNA 4PHKA 1UURA 1K93D 3HCMA 4ORBB 1FBVA 1B4CA 5CSJA 4CIDA 2MA2A 1AJ5A 2LUXA 1CLMA 1XFZO 1OZOA 3DZTA 3I5HC 3SJSA 3I5GB 2JU0A 1KQMC 1YTZC 2MJWB 4D1EA 1V1GA 3TUYC 3I5FC 2K7BA 2KFGA 3SS5A 4F7FA 1XFVO 2HPSA 1NUBA 1L2OC 1B47A
chains in the Genus database with same CATH topology
1NX1A 1S3PA 1UWOA 1BR1B 2WCBA 3GK2A 1NYAA 2LVIA 1XO5A 1MF8B 1B7TZ 1XVJA 2KFFA 5KU1A 2MLFC 1AHRA 1YRTB 1IQ5A 2GGMA 2BKIB 2M8UA 5CSNA 4PHJA 3D0YA 1IG5A 5DKQA 4OV2A 2HETA 2BECA 4YI8A 1QVIY 1F4QA 2K7DA 1S5GY 3IQQA 4DUQA 3OHMB 3DD4A 2M7LA 2OTGC 2WCEA 4ZCVA 3AKBA 5K89A 3EKHA 1RROA 2Q91A 5AEQA 5D69A 1DJYA 1JF2A 2LV7A 2ZRTA 1OMVA 3AKAA 1SBJA 2M49B 3EK8A 1DTLA 2M7NA 1GGWA 4PE0A 4QJ4B 1D1OA 3K21A 2M29A 3OP0A 3TDIA 1TRFA 4WRIA 1QIWA 2F8PA 3D10A 3DVMA 2LAPA 3FWCA 3OB2B 4CFRA 1CB1A 1SCVA 4GAOA 2JNXA 1BODA 1CLLA 2AMIA 3DF0A 3LLEA 4PE1A 5ER5A 1QLKA 1F54A 3GK4X 2MBXA 1EH2A 1F71A 1W7IB 1PSRA 2I7AA 2ZRSA 1YUTA 2MAZA 4XYNA 4F0ZB 4CPVA 1NX3A 4I5KA 3BUWB 4N1FA 3VRPA 5G08A 4USLA 5HLOA 1M63B 4BY4A 3EKJA 2KOTA 5AFPA 1LA3A 4PALA 1KSOA 1PALA 2BCBA 1QV1A 5I2QA 2KI6C 3SG3A 3VGOA 4ORCB 4YGCB 1SKTA 3LCPC 3QRXA 1Y1AA 2KFHA 4NDDA 1N2DA 2MLEC 1B7TY 1QTXA 2WCFA 2LMUA 1N65A 1UHJA 2KQYA 1L2OB 3PFVA 1H4BA 1WLMA 1UHIA 3OX5A 1SR6C 2GGZA 3PN7B 1GQMA 3SG6A 1IRJA 1CTRA 4MVFA 4BY5A 1OMDA 4MLWA 1RWYA 3I5IB 2ZFDA 4FTGA 1CNPA 4YGDB 1AK8A 2BBNA 3WXAA 1B8LA 1JBAA 4OR9B 2BL0B 3SIBA 4UPGA 2KQ6A 1YVHA 1SL8A 3KHEA 1K94A 1WRZA 2OTGB 3LK0A 1XYDA 4Q04A 1Y1UA 1IKUA 2L50A 1WLZA 5KSZA 1KK8C 2LP3A 1J7PA 3BUOB 2LLSA 2RGIA 4NDCA 1DJXA 4GNKB 1QASA 2EC6C 5HKYA 1OZSA 1DF0A 4WQ2A 4DRWA 4MEWA 1K95A 1H8BA 4PE4A 2CCMA 3JTDC 4A4BA 1S6CA 1CFCA 2ZNEA 3JVTB 3HX4A 1MUXA 2PMYA 1UHHA 2LVVA 1FPWA 2FJUB 1K9UA 3PALA 4OVNF 5GQQC 2F3ZA 2KYFA 2F2PA 1XFYO 2TN4A 3SIAA 1UUSA 1V1FA 2M0RA 1KFXL 3VRRA 2E6WA 2LHLA 1G4YR 2MRDA 1QXPA 3CWGA 1ZMZA 1DGUA 2B1UA 2JT8A 2NCPA 3ICBA 1LA0A 1A4PA 4P5OE 2M1KB 4CLNA 1CM1A 1ODBA 1U5IB 4I5NB 5PALA 3DVKA 3TS5C 3VROA 1TTXA 2FOTA 1SY9A 1NIWA 1IJ5A 3CS1A 1YX8A 2ZN8A 3GK1A 1A75A 1ALVA 3WHUB 1OMRA 1QLSA 1WDCC 1TNWA 1F8HA 1L7ZA 1JFKA 2LC5A 1XA5A 3LL8B 2OS8C 2ISDA 1LINA 3CLNA 5JOLA 2KYCA 2HQWA 1WRLA 4NDBA 1J7RA 2CTNA 1BT6A 2LCPA 1DJIA 1MWNA 4OCIA 3E3RA 2KI4B 2JNFA 1K96A 2GV5A 1QJTA 4M2QA 1CDMA 3RLZA 1NCZA 1KFUL 4YBHB 3D0YB 1KWOC 1JWDA 2JXCA 1TOPA 2KBMA 4GFTA 4HSZA 1SRAA 1M39A 3AAJA 1FI5A 1TIZA 1IGVA 2I2RE 1QATA 1Y1XA 4YGBB 5IBWA 5TNCA 1F55A 3PLFB 3CR5X 1PK0D 2L98A 1B9AA 1TNPA 2MHHA 2NLNA 2Y1NA 1YR5A 5CPVA 3I5HB 4GUKA 1ALWA 4MN0A 1XFUO 1J55A 4MRYA 5I2LA 3CZTX 3H4SE 2JT0A 1DJWA 2PRUA 1SCMC 1SNLA 2HF5A 4TNCA 1J1DA 2D8NA 1YURA 4PE7A 4CFQA 4MZLA 2LANA 2AUCA 3NSKA 1ZACA 2K7CA 3DF0B 2IS9A 2NXQA 3A4UB 2JQ6A 1KQMB 1NX2A 1R6PA 4N1GA 3TUYB 4N5XA 2KDHA 3I5FB 2SCPA 2LUCA 2G9BA 4C0KA 3I5GC 5CSIA 3EVUA 2EGDA 2KI6D 2JOJA 1CDLA 4I5JA 4MRXA 1BOCA 4GGFA 1SPYA 3O6BA 2KSPA 3VRNA 1B1GA 1PVAA 1C07A 1TN4A 1KQVA 2O60A 3BOWA 4NQGA 4E68A 1QX5B 1FI6A 2L2EA 3KO0A 4ICBA 2KGRA 3FS7A 5BPJA 1C7VA 1S36A 1ZOTB 1C7WA 1OE9B 1JFJA 1DVIA 1QX2A 1RK9A 3O2PA 1F4OA 4OKHA 2L0PA 2BE6A 2JPTA 1EG3A 2JXLA 2KBIA 5HYDA 1NCYA 2M9GA 4DIRA 4QJ5B 3MSEB 1SMGA 1CFDA 3LK1A 1YRUB 1CLBA 2JTTA 4P2YB 2Y1MA 1YVLA 1K9KA 1YUSA 5AERA 1S5GZ 3BUXB 2CT9A 1B8CA 1SL7A 2WOSA 1XK4A 3FWBA 2LVJA 4IL1A 3CR4X 1DMOA 1LVCD 1DT7B 1IQ3A 1PULA 4AQJA 4AQIA 4HREE 3OB1B 1QX7A 3FIAA 5DKNA 1JUOA 2KGBC 2PASA 2JTZA 1YX7A 1Q80A 3AAKA 1AP4A 1OQPA 4GPLB 2PVBA 4U8DA 2LNKA 1CMGA 2KAVA 1TCOB 4M2PA 2K61A 1J7QA 1EG4A 5I8NA 1JC2A 1RJVA 1DF0B 5FYXA 4XJKB 5KTYA 1G8IA 3WNXB 1DGVA 1OSAA 3BYAA 2ZNDA 3CR2A 3A8RA 3EK4A 4I5LB 4GBAA 1QS7A 1BJFA 2LHIA 1BG1A 1CKKA 2FCDA 4YI9A 2H61A 4AOMA 3EVRA 2NZ0A 3O4YA 1DJGA 3DVEA 2M1UA 3KF9A 3SG5A 1PRWA 2O5GA 1DJHA 1K9PA 3NXAA 1AUIB 4ORAB 1XFXO 2LP2A 2ZN9A 1LXFC 1M45A 2JT3A 3CTNA 1SR6B 2I94A 1IJ6A 1UHKA 2K2AA 3CGAA 4YRUA 1K2HA 2KHNA 1SW8A 4GGFC 1OOJA 2LMTA 3PN7C 3EK7A 1WY9A 2BCAA 5D7FA 1A75B 2K0JA 3I5IC 1KFXS 2LMVA 1QV0A 2F3YA 4YGAA 5HKWA 1A29A 2LLTA 2G2BA 4ZCUA 3VRQA 1WRKA 2BCXA 2QPTA 2BBMA 3RM1A 2BL0C 3IQOA 5DKRA 1KK8B 2COLB 4MZKA 1GGZA 4HRGA 1JF0A 1MHOA 1PSBA 2OPOA 1AJ4A 1NPQA 1UP5A 2JRFA 4MZJA 2EHBA 1MXEA 2F33A 2K8MB 1RTP1 3ZWHA 3IF7A 1KK7Z 3NSOA 3BXKA 1J1EA 3M0WA 5F6TA 2EC6B 1CM4A 3EVVA 3F45A 3NSIA 2DOQA 2L4HA 2ZKMX 1K90D 1BLQA 2F2OA 1DJZA 1K8UA 3SG2A 1NSHA 2PALA 1Y0VH 2HQ8A 3JTDB 1NX0A 2CXJA 1ZUZA 3BUMB 3NSLA 3WHTB 1S6IA 4PHNA 1XK4C 1N0YA 5ER4X 3TDUA 3C1VA 1X02A 2Y5IA 1W7JB 1Y6WA 1EXRA 2KNEA 3JVTC 5AANA 2E30A 3SG4A 1NP8A 2BKHB 3DVJA 1MR8A 2LE9B 1QIVA 4HRHA 1UHNA 2I18A 1BF5A 3BUNB 1FW4A 1KFUS 4JWQA 4WQ3A 5CSFA 4DS7A 2WORA 1PVBA 3ZNIA 2QACA 2FCEA 2AAOA 4JQ0D 1KCYA 3TS5B 2V53A 1XFWO 2M97A 1B8RA 1S26D 2JULA 2K7OA 1TNQA 5I2OA 1F70A 2M3WA 2WNDA 1M46A 1YUUA 1WDCB 4YGEB 1SL9A 3KPXA 4L9MA 1LKJA 4FQOA 4R1EA 1CDNA 2CBLA 2JZIA 3GOFA 5JJGA 4MBEA 1S1EA 4C0LA 1SYMA 1BU3A 2OS8B 3SG7A 4A4CA 2PSRA 3PATA 2H61C 3BQ3A 1FF1A 4M2OA 1NCXA 4PCWA 2LVKA 1JSAA 1SK6D 1TCFA 1CDPA 2KAXA 2L5XB 2NCOA 2P6BB 1E8AA 1R2UA 2L4IA 3PSRA 2BE4A 2VRGA 3KEVA 4QJ3B 1AVSA 2R2IA 3BOWB 1QVIZ 4PHMA 1A2XA 2Y4QA 2KI4C 4JPZB 1M31A 1KWOB 5HKZA 5J3XA 2K2FA 2LM5A 1IH0A 2L51A 1KK7Y 2KAYA 4ETOA 1GJYA 1TNXA 3TZ1A 5AXIA 1G33A 5HLVA 1HT9A 2LLUA 2WC8A 3O78A 5B8IB 1RFJA 1S6JA 3PM8A 4DCKA 2CNPA 1BR4B 1CMFA 1MQ1A 2SASA 4C0JA 1VRKA 1CFFA 2JC2A 3TDZA 1IWQA 1NWDA 1RECA 1SCMB 1U5IA 2JWWA 1HQVA 1EL4A 1MXLC 2Q4UA 3OX6A 4XJKA 4MSPA 1BMOA 1EJ3A 1KSMA 2A4JA 1CFPA 1J7OA 2H2KA 1ZFSA 4PDZA 1A03A 4GGNA 4PHKA 1UURA 1K93D 3HCMA 4ORBB 1FBVA 1B4CA 5CSJA 4CIDA 2MA2A 1AJ5A 2LUXA 1CLMA 1XFZO 1OZOA 3I5HC 3SJSA 3I5GB 2JU0A 1KQMC 1YTZC 2MJWB 4D1EA 1V1GA 3TUYC 3I5FC 2K7BA 2KFGA 1XFVO 2HPSA 1NUBA 1L2OC 1B47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NX1 A;  1S3P A;  1UWO A;  1BR1 B;  2WCB A;  3GK2 A;  1NYA A;  2LVI A;  1XO5 A;  1MF8 B;  1B7T Z;  1XVJ A;  2KFF A;  5KU1 A;  2MLF C;  1AHR A;  1YRT B;  1IQ5 A;  2GGM A;  2BKI B;  2M8U A;  5CSN A;  4PHJ A;  3D0Y A;  1IG5 A;  5DKQ A;  4OV2 A;  2HET A;  2BEC A;  4YI8 A;  1QVI Y;  1F4Q A;  2K7D A;  1S5G Y;  3IQQ A;  4DUQ A;  3OHM B;  3DD4 A;  2M7L A;  2OTG C;  2WCE A;  4ZCV A;  3AKB A;  5K89 A;  3EKH A;  1RRO A;  2Q91 A;  5AEQ A;  5D69 A;  1DJY A;  1JF2 A;  2LV7 A;  2ZRT A;  1OMV A;  3AKA A;  1SBJ A;  2M49 B;  3EK8 A;  1DTL A;  2M7N A;  1GGW A;  4PE0 A;  4QJ4 B;  1D1O A;  3K21 A;  2M29 A;  3OP0 A;  3TDI A;  1TRF A;  4WRI A;  1QIW A;  2F8P A;  3D10 A;  3DVM A;  2LAP A;  3FWC A;  3OB2 B;  4CFR A;  1CB1 A;  1SCV A;  4GAO A;  2JNX A;  1BOD A;  1CLL A;  2AMI A;  3DF0 A;  3LLE A;  4PE1 A;  5ER5 A;  1QLK A;  1F54 A;  3GK4 X;  2MBX A;  1EH2 A;  1F71 A;  1W7I B;  1PSR A;  2I7A A;  2ZRS A;  1YUT A;  2MAZ A;  4XYN A;  4F0Z B;  4CPV A;  1NX3 A;  4I5K A;  3BUW B;  4N1F A;  3VRP A;  5G08 A;  4USL A;  5HLO A;  1M63 B;  4BY4 A;  3EKJ A;  2KOT A;  5AFP A;  1LA3 A;  4PAL A;  1KSO A;  1PAL A;  2BCB A;  1QV1 A;  5I2Q A;  2KI6 C;  3SG3 A;  3VGO A;  4ORC B;  4YGC B;  1SKT A;  3LCP C;  3QRX A;  1Y1A A;  2KFH A;  4NDD A;  1N2D A;  2MLE C;  1B7T Y;  1QTX A;  2WCF A;  2LMU A;  1N65 A;  1UHJ A;  2KQY A;  1L2O B;  3PFV A;  1H4B A;  1WLM A;  1UHI A;  3OX5 A;  1SR6 C;  2GGZ A;  3PN7 B;  1GQM A;  3SG6 A;  1IRJ A;  1CTR A;  4MVF A;  4BY5 A;  1OMD A;  4MLW A;  1RWY A;  3I5I B;  2ZFD A;  4FTG A;  1CNP A;  4YGD B;  1AK8 A;  2BBN A;  3WXA A;  1B8L A;  1JBA A;  4OR9 B;  2BL0 B;  3SIB A;  4UPG A;  2KQ6 A;  1YVH A;  1SL8 A;  3KHE A;  1K94 A;  1WRZ A;  2OTG B;  3LK0 A;  1XYD A;  4Q04 A;  1Y1U A;  1IKU A;  2L50 A;  1WLZ A;  5KSZ A;  1KK8 C;  2LP3 A;  1J7P A;  3BUO B;  2LLS A;  2RGI A;  4NDC A;  1DJX A;  4GNK B;  1QAS A;  2EC6 C;  5HKY A;  1OZS A;  1DF0 A;  4WQ2 A;  4DRW A;  4MEW A;  1K95 A;  1H8B A;  4PE4 A;  2CCM A;  3JTD C;  4A4B A;  1S6C A;  1CFC A;  2ZNE A;  3JVT B;  3HX4 A;  1MUX A;  2PMY A;  1UHH A;  2LVV A;  1FPW A;  2FJU B;  1K9U A;  3PAL A;  4OVN F;  5GQQ C;  2F3Z A;  2KYF A;  2F2P A;  1XFY O;  2TN4 A;  3SIA A;  1UUS A;  1V1F A;  2M0R A;  1KFX L;  3VRR A;  2E6W A;  2LHL A;  1G4Y R;  2MRD A;  1QXP A;  3CWG A;  1ZMZ A;  1DGU A;  2B1U A;  2JT8 A;  2NCP A;  3ICB A;  1LA0 A;  1A4P A;  4P5O E;  2M1K B;  4CLN A;  1CM1 A;  1ODB A;  1U5I B;  4I5N B;  5PAL A;  3DVK A;  3TS5 C;  3VRO A;  1TTX A;  2FOT A;  1SY9 A;  1NIW A;  1IJ5 A;  3CS1 A;  1YX8 A;  2ZN8 A;  3GK1 A;  1A75 A;  1ALV A;  3WHU B;  1OMR A;  1QLS A;  1WDC C;  1TNW A;  1F8H A;  1L7Z A;  1JFK A;  2LC5 A;  1XA5 A;  3LL8 B;  2OS8 C;  2ISD A;  1LIN A;  3CLN A;  5JOL A;  2KYC A;  2HQW A;  1WRL A;  4NDB A;  1J7R A;  2CTN A;  1BT6 A;  2LCP A;  1DJI A;  1MWN A;  4OCI A;  3E3R A;  2KI4 B;  2JNF A;  1K96 A;  2GV5 A;  1QJT A;  4M2Q A;  1CDM A;  3RLZ A;  1NCZ A;  1KFU L;  4YBH B;  3D0Y B;  1KWO C;  1JWD A;  2JXC A;  1TOP A;  2KBM A;  4GFT A;  4HSZ A;  1SRA A;  1M39 A;  3AAJ A;  1FI5 A;  1TIZ A;  1IGV A;  2I2R E;  1QAT A;  1Y1X A;  4YGB B;  5IBW A;  5TNC A;  1F55 A;  3PLF B;  3CR5 X;  1PK0 D;  2L98 A;  1B9A A;  1TNP A;  2MHH A;  2NLN A;  2Y1N A;  1YR5 A;  5CPV A;  3I5H B;  4GUK A;  1ALW A;  4MN0 A;  1XFU O;  1J55 A;  4MRY A;  5I2L A;  3CZT X;  3H4S E;  2JT0 A;  1DJW A;  2PRU A;  1SCM C;  1SNL A;  2HF5 A;  4TNC A;  1J1D A;  2D8N A;  1YUR A;  4PE7 A;  4CFQ A;  4MZL A;  2LAN A;  2AUC A;  3NSK A;  1ZAC A;  2K7C A;  3DF0 B;  2IS9 A;  2NXQ A;  3A4U B;  2JQ6 A;  1KQM B;  1NX2 A;  1R6P A;  4N1G A;  3TUY B;  4N5X A;  2KDH A;  3I5F B;  2SCP A;  2LUC A;  2G9B A;  4C0K A;  3I5G C;  5CSI A;  3EVU A;  2EGD A;  2KI6 D;  2JOJ A;  1CDL A;  4I5J A;  4MRX A;  1BOC A;  4GGF A;  1SPY A;  3O6B A;  2KSP A;  3VRN A;  1B1G A;  1PVA A;  1C07 A;  1TN4 A;  1KQV A;  2O60 A;  3BOW A;  4NQG A;  4E68 A;  1QX5 B;  1FI6 A;  2L2E A;  3KO0 A;  4ICB A;  2KGR A;  3FS7 A;  5BPJ A;  1C7V A;  1S36 A;  1ZOT B;  1C7W A;  1OE9 B;  1JFJ A;  1DVI A;  1QX2 A;  1RK9 A;  3O2P A;  1F4O A;  4OKH A;  2L0P A;  2BE6 A;  2JPT A;  1EG3 A;  2JXL A;  2KBI A;  5HYD A;  1NCY A;  2M9G A;  4DIR A;  4QJ5 B;  3MSE B;  1SMG A;  1CFD A;  3LK1 A;  1YRU B;  1CLB A;  2JTT A;  4P2Y B;  2Y1M A;  1YVL A;  1K9K A;  1YUS A;  5AER A;  1S5G Z;  3BUX B;  2CT9 A;  1B8C A;  1SL7 A;  2WOS A;  1XK4 A;  3FWB A;  2LVJ A;  4IL1 A;  3CR4 X;  1DMO A;  1LVC D;  1DT7 B;  1IQ3 A;  1PUL A;  4AQJ A;  4AQI A;  4HRE E;  3OB1 B;  1QX7 A;  3FIA A;  5DKN A;  1JUO A;  2KGB C;  2PAS A;  2JTZ A;  1YX7 A;  1Q80 A;  3AAK A;  1AP4 A;  1OQP A;  4GPL B;  2PVB A;  4U8D A;  2LNK A;  1CMG A;  2KAV A;  1TCO B;  4M2P A;  2K61 A;  1J7Q A;  1EG4 A;  5I8N A;  1JC2 A;  1RJV A;  1DF0 B;  5FYX A;  4XJK B;  5KTY A;  1G8I A;  3WNX B;  1DGV A;  1OSA A;  3BYA A;  2ZND A;  3CR2 A;  3A8R A;  3EK4 A;  4I5L B;  4GBA A;  1QS7 A;  1BJF A;  2LHI A;  1BG1 A;  1CKK A;  2FCD A;  4YI9 A;  2H61 A;  4AOM A;  3EVR A;  2NZ0 A;  3O4Y A;  1DJG A;  3DVE A;  2M1U A;  3KF9 A;  3SG5 A;  1PRW A;  2O5G A;  1DJH A;  1K9P A;  3NXA A;  1AUI B;  4ORA B;  1XFX O;  2LP2 A;  2ZN9 A;  1LXF C;  1M45 A;  2JT3 A;  3CTN A;  1SR6 B;  2I94 A;  1IJ6 A;  1UHK A;  2K2A A;  3CGA A;  4YRU A;  1K2H A;  2KHN A;  1SW8 A;  4GGF C;  1OOJ A;  2LMT A;  3PN7 C;  3EK7 A;  1WY9 A;  2BCA A;  5D7F A;  1A75 B;  2K0J A;  3I5I C;  1KFX S;  2LMV A;  1QV0 A;  2F3Y A;  4YGA A;  5HKW A;  1A29 A;  2LLT A;  2G2B A;  4ZCU A;  3VRQ A;  1WRK A;  2BCX A;  2QPT A;  2BBM A;  3RM1 A;  2BL0 C;  3IQO A;  5DKR A;  1KK8 B;  2COL B;  4MZK A;  1GGZ A;  4HRG A;  1JF0 A;  1MHO A;  1PSB A;  2OPO A;  1AJ4 A;  1NPQ A;  1UP5 A;  2JRF A;  4MZJ A;  2EHB A;  1MXE A;  2F33 A;  2K8M B;  1RTP 1;  3ZWH A;  3IF7 A;  1KK7 Z;  3NSO A;  3BXK A;  1J1E A;  3M0W A;  5F6T A;  2EC6 B;  1CM4 A;  3EVV A;  3F45 A;  3NSI A;  2DOQ A;  2L4H A;  2ZKM X;  1K90 D;  1BLQ A;  2F2O A;  1DJZ A;  1K8U A;  3SG2 A;  1NSH A;  2PAL A;  1Y0V H;  2HQ8 A;  3JTD B;  1NX0 A;  2CXJ A;  1ZUZ A;  3BUM B;  3NSL A;  3WHT B;  1S6I A;  4PHN A;  1XK4 C;  1N0Y A;  5ER4 X;  3TDU A;  3C1V A;  1X02 A;  2Y5I A;  1W7J B;  1Y6W A;  1EXR A;  2KNE A;  3JVT C;  5AAN A;  2E30 A;  3SG4 A;  1NP8 A;  2BKH B;  3DVJ A;  1MR8 A;  2LE9 B;  1QIV A;  4HRH A;  1UHN A;  2I18 A;  1BF5 A;  3BUN B;  1FW4 A;  1KFU S;  4JWQ A;  4WQ3 A;  5CSF A;  4DS7 A;  2WOR A;  1PVB A;  3ZNI A;  2QAC A;  2FCE A;  2AAO A;  4JQ0 D;  1KCY A;  3TS5 B;  2V53 A;  1XFW O;  2M97 A;  1B8R A;  1S26 D;  2JUL A;  2K7O A;  1TNQ A;  5I2O A;  1F70 A;  2M3W A;  2WND A;  1M46 A;  1YUU A;  1WDC B;  4YGE B;  1SL9 A;  3KPX A;  4L9M A;  1LKJ A;  4FQO A;  4R1E A;  1CDN A;  2CBL A;  2JZI A;  3GOF A;  5JJG A;  4MBE A;  1S1E A;  4C0L A;  1SYM A;  1BU3 A;  2OS8 B;  3SG7 A;  4A4C A;  2PSR A;  3PAT A;  2H61 C;  3BQ3 A;  1FF1 A;  4M2O A;  1NCX A;  4PCW A;  2LVK A;  1JSA A;  1SK6 D;  1TCF A;  1CDP A;  2KAX A;  2L5X B;  2NCO A;  2P6B B;  1E8A A;  1R2U A;  2L4I A;  3PSR A;  2BE4 A;  2VRG A;  3KEV A;  4QJ3 B;  1AVS A;  2R2I A;  3BOW B;  1QVI Z;  4PHM A;  1A2X A;  2Y4Q A;  2KI4 C;  4JPZ B;  1M31 A;  1KWO B;  5HKZ A;  5J3X A;  2K2F A;  2LM5 A;  1IH0 A;  2L51 A;  1KK7 Y;  2KAY A;  4ETO A;  1GJY A;  1TNX A;  3TZ1 A;  5AXI A;  1G33 A;  5HLV A;  1HT9 A;  2LLU A;  2WC8 A;  3O78 A;  5B8I B;  1RFJ A;  1S6J A;  3PM8 A;  4DCK A;  2CNP A;  1BR4 B;  1CMF A;  1MQ1 A;  2SAS A;  4C0J A;  1VRK A;  1CFF A;  2JC2 A;  3TDZ A;  1IWQ A;  1NWD A;  1REC A;  1SCM B;  1U5I A;  2JWW A;  1HQV A;  1EL4 A;  1MXL C;  2Q4U A;  3OX6 A;  4XJK A;  4MSP A;  1BMO A;  1EJ3 A;  1KSM A;  2A4J A;  1CFP A;  1J7O A;  2H2K A;  1ZFS A;  4PDZ A;  1A03 A;  4GGN A;  4PHK A;  1UUR A;  1K93 D;  3HCM A;  4ORB B;  1FBV A;  1B4C A;  5CSJ A;  4CID A;  2MA2 A;  1AJ5 A;  2LUX A;  1CLM A;  1XFZ O;  1OZO A;  3I5H C;  3SJS A;  3I5G B;  2JU0 A;  1KQM C;  1YTZ C;  2MJW B;  4D1E A;  1V1G A;  3TUY C;  3I5F C;  2K7B A;  2KFG A;  1XFV O;  2HPS A;  1NUB A;  1L2O C;  1B47 A; 
#chains in the Genus database with same CATH topology
 3R1V A;  1NX1 A;  1S3P A;  1UWO A;  1BR1 B;  2K60 A;  2WCB A;  3GK2 A;  1NYA A;  2LVI A;  1XO5 A;  1MF8 B;  1B7T Z;  1XVJ A;  2KFF A;  5KU1 A;  2MLF C;  1AHR A;  1YRT B;  1IQ5 A;  2GGM A;  2BKI B;  2M8U A;  5CSN A;  4PHJ A;  3D0Y A;  3B6X A;  3S0G A;  1IG5 A;  5DKQ A;  4OV2 A;  2HET A;  2BEC A;  4YI8 A;  1QVI Y;  1F4Q A;  2K7D A;  1S5G Y;  3IQQ A;  4DUQ A;  3OHM B;  3DD4 A;  2M7L A;  2OTG C;  2WCE A;  4ZCV A;  3AKB A;  5K89 A;  3EKH A;  1RRO A;  2Q91 A;  5AEQ A;  5D69 A;  1DJY A;  3D74 A;  1JF2 A;  2LV7 A;  2ZRT A;  1OMV A;  3AKA A;  1SBJ A;  2M49 B;  3EK8 A;  1DTL A;  2M7N A;  1GGW A;  4PE0 A;  4QJ4 B;  1D1O A;  3K21 A;  2M29 A;  3OP0 A;  2YGU A;  2GTE A;  1TRF A;  4WRI A;  1QIW A;  3TDI A;  3B87 A;  2F8P A;  3D10 A;  3DVM A;  2LAP A;  3FWC A;  3OB2 B;  4CFR A;  1CB1 A;  1SCV A;  4GAO A;  1OW4 A;  2JNX A;  1CLL A;  3B86 A;  1BOD A;  2AMI A;  3S0E A;  3DF0 A;  5I94 A;  3LLE A;  4PE1 A;  5ER5 A;  1QLK A;  1F54 A;  3GK4 X;  2MBX A;  3S0A A;  1EH2 A;  1F71 A;  1W7I B;  1PSR A;  2I7A A;  2ZRS A;  1YUT A;  2MAZ A;  4XYN A;  4F0Z B;  4CPV A;  1NX3 A;  4I5K A;  3BUW B;  4N1F A;  3VRP A;  5G08 A;  4USL A;  5HLO A;  1M63 B;  4BY4 A;  3EKJ A;  2KOT A;  5FI7 A;  5AFP A;  1LA3 A;  4PAL A;  1KSO A;  2KLD A;  1PAL A;  2BCB A;  3BJH A;  1QV1 A;  1Z4H A;  5I2Q A;  2KI6 C;  3SG3 A;  3VGO A;  4ORC B;  4YGC B;  1SKT A;  3LCP C;  3QRX A;  1Y1A A;  2KFH A;  4NDD A;  1N2D A;  2MLE C;  1B7T Y;  2QEH A;  3D76 A;  1QTX A;  2WCF A;  2LMU A;  1N65 A;  1UHJ A;  2KQY A;  2P71 A;  1L2O B;  3PFV A;  1H4B A;  1WLM A;  3BFH A;  1UHI A;  3OX5 A;  3NGV A;  1SR6 C;  2GGZ A;  3PN7 B;  1GQM A;  3SG6 A;  1IRJ A;  1CTR A;  4JD9 A;  4MVF A;  1OMD A;  4BY5 A;  4MLW A;  1RWY A;  1GM0 A;  3OGN A;  3I5I B;  2ZFD A;  4FTG A;  2BNX A;  1CNP A;  4YGD B;  1AK8 A;  2BBN A;  3WXA A;  1B8L A;  1JBA A;  4OR9 B;  3RZS A;  2BL0 B;  3SIB A;  4UPG A;  2KQ6 A;  1YVH A;  1SL8 A;  3KHE A;  3OBV A;  1K94 A;  1WRZ A;  2PYQ A;  3UNW A;  2OTG B;  3LK0 A;  1XYD A;  4Q04 A;  1Y1U A;  1IKU A;  3B88 A;  2L50 A;  1WLZ A;  5KSZ A;  1KK8 C;  2LP3 A;  3QME A;  1J7P A;  1SSE B;  3DYE A;  3BUO B;  2LLS A;  2RGI A;  4NDC A;  1DJX A;  4GNK B;  1QAS A;  2EC6 C;  5HKY A;  1OZS A;  1DF0 A;  4WQ2 A;  4DRW A;  4MEW A;  1K95 A;  1H8B A;  4PE4 A;  2CCM A;  3JTD C;  4A4B A;  3DXL A;  3D73 A;  1S6C A;  1CFC A;  2ZNE A;  3JVT B;  3HX4 A;  2QEO A;  1MUX A;  2PMY A;  1UHH A;  2LVV A;  1FPW A;  2FJU B;  1K9U A;  3PAL A;  4OVN F;  5GQQ C;  3R72 A;  2F3Z A;  2KYF A;  1XFR A;  2F2P A;  1XFY O;  2TN4 A;  3SIA A;  1UUS A;  4INX A;  1V1F A;  2M0R A;  1KFX L;  3VRR A;  2E6W A;  2LHL A;  1G4Y R;  2MRD A;  1QXP A;  3CWG A;  1ZMZ A;  1DGU A;  2B1U A;  2JT8 A;  2NCP A;  3ICB A;  1LA0 A;  1A4P A;  3D75 A;  4P5O E;  1DEK A;  2M1K B;  4CLN A;  1CM1 A;  1ODB A;  1U5I B;  4I5N B;  5PAL A;  3DVK A;  3TS5 C;  3VRO A;  1TTX A;  2FOT A;  1SY9 A;  1NIW A;  1IJ5 A;  3CS1 A;  1YX8 A;  2ZN8 A;  3GK1 A;  3CDN A;  1A75 A;  1ALV A;  4JKT A;  3WHU B;  1OMR A;  1QLS A;  1WDC C;  1TNW A;  3R1P A;  3IVT A;  3SS4 A;  1F8H A;  1L7Z A;  3CYZ A;  1JFK A;  2LC5 A;  1XA5 A;  3LL8 B;  2OS8 C;  2ISD A;  1LIN A;  3CLN A;  2WCH A;  2KYC A;  5JOL A;  2HQW A;  4OZD A;  1WRL A;  4NDB A;  1J7R A;  2CTN A;  3CZ1 A;  1BT6 A;  2WCL A;  2LCP A;  1DJI A;  1MWN A;  2P70 A;  5FI6 A;  4OCI A;  3CZ0 A;  3E3R A;  2KI4 B;  2JNF A;  3N7H A;  1K96 A;  2GV5 A;  1QJT A;  3L4A A;  1CDM A;  4M2Q A;  1NCZ A;  3RLZ A;  1KFU L;  4YBH B;  3S0D A;  3D0Y B;  1KWO C;  1JWD A;  1OOF A;  2JXC A;  1TOP A;  2KBM A;  4GFT A;  4HSZ A;  1SRA A;  1M39 A;  3AAJ A;  1FI5 A;  1TIZ A;  1IGV A;  2I2R E;  1QAT A;  1Y1X A;  4YGB B;  5IBW A;  3B7A A;  5TNC A;  1F55 A;  3PLF B;  3CR5 X;  1PK0 D;  2L98 A;  1B9A A;  1TNP A;  2MHH A;  2NLN A;  2WCM A;  2Y1N A;  1YR5 A;  2KPH A;  3I5H B;  2WCJ A;  4GUK A;  1ALW A;  5CPV A;  4MN0 A;  1XFU O;  1J55 A;  4MRY A;  5I2L A;  1P28 A;  3CZT X;  3H4S E;  2JT0 A;  1DJW A;  2PRU A;  1Z2C B;  1SCM C;  1SNL A;  2HF5 A;  4TNC A;  1J1D A;  2D8N A;  1YUR A;  4PE7 A;  4CFQ A;  4MZL A;  2LAN A;  2AUC A;  3NSK A;  5FI2 A;  1ZAC A;  2K7C A;  3DF0 B;  3BFA A;  3V2L A;  2IS9 A;  2NXQ A;  3A4U B;  2JQ6 A;  1KQM B;  1NX2 A;  2PQL A;  3PJI A;  1R6P A;  4N1G A;  3TUY B;  4N5X A;  2KDH A;  3I5F B;  1C3Z A;  2SCP A;  2LUC A;  2G9B A;  4C0K A;  3I5G C;  5CSI A;  1ORG A;  3EVU A;  2EGD A;  2H8V A;  2KI6 D;  2QEV A;  2JOJ A;  1CDL A;  4I5J A;  4MRX A;  1BOC A;  4GGF A;  1SPY A;  3CAB A;  3O6B A;  2KSP A;  3VRN A;  1B1G A;  1PVA A;  1C07 A;  1TN4 A;  1KQV A;  1IIO A;  2O60 A;  3BOW A;  4NQG A;  4E68 A;  1QX5 B;  1FI6 A;  2L2E A;  3KO0 A;  4ICB A;  2KGR A;  3FE6 A;  3FS7 A;  5BPJ A;  1C7V A;  1S36 A;  1ZOT B;  2WC6 A;  1C7W A;  1OE9 B;  4FQT A;  1JFJ A;  1DVI A;  1TUJ A;  1QX2 A;  1RK9 A;  3O2P A;  2ERB A;  1F4O A;  4OKH A;  1QWV A;  2L0P A;  2BE6 A;  2JPT A;  1EG3 A;  2JXL A;  2KBI A;  3NHI A;  5HYD A;  1NCY A;  2M9G A;  4DIR A;  4QJ5 B;  3MSE B;  1SMG A;  1CFD A;  2QDI A;  3LK1 A;  1YRU B;  1CLB A;  2JTT A;  4P2Y B;  3DY9 A;  3K1E A;  2Y1M A;  1YVL A;  5HL1 A;  1K9K A;  1YUS A;  5AER A;  1S5G Z;  3BUX B;  2CT9 A;  1B8C A;  2BAP A;  1SL7 A;  2WOS A;  1XK4 A;  3FWB A;  2LVJ A;  4IL1 A;  3CR4 X;  1DMO A;  1LVC D;  1DT7 B;  1IQ3 A;  1PUL A;  4AQJ A;  4AQI A;  3L4L A;  2L5Y A;  3S0F A;  4HRE E;  3OB1 B;  1QX7 A;  3FIA A;  5DKN A;  1JUO A;  2KGB C;  2PAS A;  2JTZ A;  1YX7 A;  1Q80 A;  3AAK A;  1DEL A;  1AP4 A;  1OQP A;  4GPL B;  2PVB A;  4U8D A;  2LNK A;  1CMG A;  2KAV A;  1TCO B;  4M2P A;  2K61 A;  1J7Q A;  1EG4 A;  3O4X A;  5I8N A;  1JC2 A;  1RJV A;  1DF0 B;  5FYX A;  4XJK B;  5EL2 A;  5KTY A;  3R1O A;  1G8I A;  3NHT A;  3WNX B;  1DGV A;  1OSA A;  3BYA A;  2ZND A;  3CR2 A;  3A8R A;  3EK4 A;  5DIC A;  4I5L B;  4GBA A;  1T14 A;  1QS7 A;  1BJF A;  1LS8 A;  2LHI A;  1BG1 A;  1CKK A;  2FCD A;  4YI9 A;  2H61 A;  4AOM A;  3EVR A;  3PM2 A;  2NZ0 A;  3O4Y A;  1DJG A;  3DVE A;  2M1U A;  3KF9 A;  3SG5 A;  1PRW A;  2JPO A;  2O5G A;  3D77 A;  2L2C A;  1DJH A;  4KYN A;  1K9P A;  3NXA A;  1AUI B;  4ORA B;  1XFX O;  2LP2 A;  2ZN9 A;  1LXF C;  1M45 A;  2JT3 A;  3CTN A;  1SR6 B;  2I94 A;  1IJ6 A;  1UHK A;  2KLE A;  2K2A A;  3CGA A;  4YRU A;  1K2H A;  2KHN A;  1SW8 A;  4GGF C;  1OOJ A;  3Q8I A;  2LMT A;  3PN7 C;  3EK7 A;  1WY9 A;  2BCA A;  5D7F A;  1A75 B;  3D78 A;  2K0J A;  3I5I C;  1KFX S;  2LMV A;  1QV0 A;  2F3Y A;  4YGA A;  5HKW A;  1A29 A;  2LLT A;  2G2B A;  4ZCU A;  5D3O A;  3VRQ A;  1WRK A;  2BCX A;  2QPT A;  2BBM A;  3RM1 A;  2BL0 C;  3IQO A;  1TUZ A;  5DKR A;  1KK8 B;  2COL B;  4MZK A;  1GGZ A;  4HRG A;  1JF0 A;  1MHO A;  1PSB A;  2OPO A;  1AJ4 A;  1NPQ A;  1UP5 A;  2JRF A;  4MZJ A;  2EHB A;  1MXE A;  2F33 A;  2K8M B;  1RTP 1;  3ZWH A;  3IF7 A;  1KK7 Z;  3NSO A;  3BXK A;  1J1E A;  2WC5 A;  3M0W A;  2EC6 B;  1CM4 A;  3EVV A;  3F45 A;  3NSI A;  5F6T A;  2DOQ A;  2L4H A;  2ZKM X;  1K90 D;  1BLQ A;  2F2O A;  1DJZ A;  1K8U A;  3SG2 A;  1NSH A;  2PAL A;  1Y0V H;  2HQ8 A;  3FE8 A;  1NX0 A;  3JTD B;  2CXJ A;  1ZUZ A;  3BUM B;  3NSL A;  3WHT B;  1S6I A;  4PHN A;  1XK4 C;  1N0Y A;  5ER4 X;  3TDU A;  3C1V A;  1X02 A;  2Y5I A;  1W7J B;  1Y6W A;  1EXR A;  2KNE A;  1TWO A;  3JVT C;  2E30 A;  5AAN A;  1NP8 A;  1OOG A;  2BKH B;  3DVJ A;  4IJ7 A;  3SG4 A;  1DC1 A;  1MR8 A;  2LE9 B;  1QIV A;  3CZ2 A;  1UHN A;  3FE9 A;  4HRH A;  4INW A;  2I18 A;  1BF5 A;  1DQE A;  3BUN B;  1FW4 A;  1KFU S;  4JWQ A;  4WQ3 A;  5CSF A;  4DS7 A;  2WOR A;  1PVB A;  3ZNI A;  2QAC A;  2FCE A;  2AAO A;  4JQ0 D;  1KCY A;  3EG5 B;  3TS5 B;  2V53 A;  1XFW O;  2M97 A;  1B8R A;  1S26 D;  2JUL A;  2K7O A;  1TNQ A;  5I2O A;  1F70 A;  2M3W A;  2WND A;  3SS3 A;  1M46 A;  1YUU A;  1WDC B;  4YGE B;  1SL9 A;  3KPX A;  4L9M A;  1LKJ A;  4FQO A;  4R1E A;  1CDN A;  2CBL A;  2JZI A;  3GOF A;  2QEB A;  5JJG A;  4MBE A;  1S1E A;  4C0L A;  1SYM A;  1BU3 A;  2OS8 B;  3SG7 A;  1C3Y A;  2WCK A;  4A4C A;  2PSR A;  3PAT A;  2H61 C;  3BQ3 A;  3L47 A;  1FF1 A;  4M2O A;  1NCX A;  4PCW A;  2FJY A;  2LVK A;  1JSA A;  1SK6 D;  1TCF A;  1CDP A;  2KAX A;  2L5X B;  2NCO A;  2P6B B;  1E8A A;  1R2U A;  2L4I A;  3PSR A;  2BE4 A;  2VRG A;  3KEV A;  4QJ3 B;  3UO9 A;  1AVS A;  2R2I A;  3BOW B;  1QVI Z;  4PHM A;  1A2X A;  2Y4Q A;  2KI4 C;  1OOI X;  1M31 A;  1KWO B;  4JPZ B;  5HKZ A;  5J3X A;  2K2F A;  2LM5 A;  1IH0 A;  2L51 A;  1KK7 Y;  2KAY A;  4PT1 A;  4ETO A;  1GJY A;  1TNX A;  3TZ1 A;  1OOH A;  1G33 A;  5AXI A;  3VB1 A;  3S0B A;  5HLV A;  1HT9 A;  2LLU A;  2WC8 A;  3O78 A;  5B8I B;  1RFJ A;  1S6J A;  3PM8 A;  4DCK A;  2CNP A;  1BR4 B;  1CMF A;  1MQ1 A;  2SAS A;  4C0J A;  1VRK A;  1W9Z A;  1CFF A;  2JC2 A;  3BFB A;  3TDZ A;  1IWQ A;  1NWD A;  1REC A;  1SCM B;  1U5I A;  2JWW A;  1HQV A;  1EL4 A;  1MXL C;  2Q4U A;  3OX6 A;  4XJK A;  4MSP A;  1BMO A;  1EJ3 A;  1KSM A;  2A4J A;  1CFP A;  1J7O A;  2H2K A;  1ZFS A;  4PDZ A;  1A03 A;  4GGN A;  4PHK A;  1UUR A;  1K93 D;  3HCM A;  4ORB B;  1FBV A;  1B4C A;  5CSJ A;  4CID A;  2MA2 A;  1AJ5 A;  2LUX A;  1CLM A;  1XFZ O;  1OZO A;  3DZT A;  3I5H C;  3SJS A;  3I5G B;  2JU0 A;  1KQM C;  1YTZ C;  2MJW B;  4D1E A;  1V1G A;  3TUY C;  3I5F C;  2K7B A;  2KFG A;  3SS5 A;  4F7F A;  1XFV O;  2HPS A;  1NUB A;  1L2O C;  1B47 A; 
#chains in the Genus database with same CATH homology
 1NX1 A;  1S3P A;  1UWO A;  1BR1 B;  2WCB A;  3GK2 A;  1NYA A;  2LVI A;  1XO5 A;  1MF8 B;  1B7T Z;  1XVJ A;  2KFF A;  5KU1 A;  2MLF C;  1AHR A;  1YRT B;  1IQ5 A;  2GGM A;  2BKI B;  2M8U A;  5CSN A;  4PHJ A;  3D0Y A;  1IG5 A;  5DKQ A;  4OV2 A;  2HET A;  2BEC A;  4YI8 A;  1QVI Y;  1F4Q A;  2K7D A;  1S5G Y;  3IQQ A;  4DUQ A;  3OHM B;  3DD4 A;  2M7L A;  2OTG C;  2WCE A;  4ZCV A;  3AKB A;  5K89 A;  3EKH A;  1RRO A;  2Q91 A;  5AEQ A;  5D69 A;  1DJY A;  1JF2 A;  2LV7 A;  2ZRT A;  1OMV A;  3AKA A;  1SBJ A;  2M49 B;  3EK8 A;  1DTL A;  2M7N A;  1GGW A;  4PE0 A;  4QJ4 B;  1D1O A;  3K21 A;  2M29 A;  3OP0 A;  3TDI A;  1TRF A;  4WRI A;  1QIW A;  2F8P A;  3D10 A;  3DVM A;  2LAP A;  3FWC A;  3OB2 B;  4CFR A;  1CB1 A;  1SCV A;  4GAO A;  2JNX A;  1BOD A;  1CLL A;  2AMI A;  3DF0 A;  3LLE A;  4PE1 A;  5ER5 A;  1QLK A;  1F54 A;  3GK4 X;  2MBX A;  1EH2 A;  1F71 A;  1W7I B;  1PSR A;  2I7A A;  2ZRS A;  1YUT A;  2MAZ A;  4XYN A;  4F0Z B;  4CPV A;  1NX3 A;  4I5K A;  3BUW B;  4N1F A;  3VRP A;  5G08 A;  4USL A;  5HLO A;  1M63 B;  4BY4 A;  3EKJ A;  2KOT A;  5AFP A;  1LA3 A;  4PAL A;  1KSO A;  1PAL A;  2BCB A;  1QV1 A;  5I2Q A;  2KI6 C;  3SG3 A;  3VGO A;  4ORC B;  4YGC B;  1SKT A;  3LCP C;  3QRX A;  1Y1A A;  2KFH A;  4NDD A;  1N2D A;  2MLE C;  1B7T Y;  1QTX A;  2WCF A;  2LMU A;  1N65 A;  1UHJ A;  2KQY A;  1L2O B;  3PFV A;  1H4B A;  1WLM A;  1UHI A;  3OX5 A;  1SR6 C;  2GGZ A;  3PN7 B;  1GQM A;  3SG6 A;  1IRJ A;  1CTR A;  4MVF A;  4BY5 A;  1OMD A;  4MLW A;  1RWY A;  3I5I B;  2ZFD A;  4FTG A;  1CNP A;  4YGD B;  1AK8 A;  2BBN A;  3WXA A;  1B8L A;  1JBA A;  4OR9 B;  2BL0 B;  3SIB A;  4UPG A;  2KQ6 A;  1YVH A;  1SL8 A;  3KHE A;  1K94 A;  1WRZ A;  2OTG B;  3LK0 A;  1XYD A;  4Q04 A;  1Y1U A;  1IKU A;  2L50 A;  1WLZ A;  5KSZ A;  1KK8 C;  2LP3 A;  1J7P A;  3BUO B;  2LLS A;  2RGI A;  4NDC A;  1DJX A;  4GNK B;  1QAS A;  2EC6 C;  5HKY A;  1OZS A;  1DF0 A;  4WQ2 A;  4DRW A;  4MEW A;  1K95 A;  1H8B A;  4PE4 A;  2CCM A;  3JTD C;  4A4B A;  1S6C A;  1CFC A;  2ZNE A;  3JVT B;  3HX4 A;  1MUX A;  2PMY A;  1UHH A;  2LVV A;  1FPW A;  2FJU B;  1K9U A;  3PAL A;  4OVN F;  5GQQ C;  2F3Z A;  2KYF A;  2F2P A;  1XFY O;  2TN4 A;  3SIA A;  1UUS A;  1V1F A;  2M0R A;  1KFX L;  3VRR A;  2E6W A;  2LHL A;  1G4Y R;  2MRD A;  1QXP A;  3CWG A;  1ZMZ A;  1DGU A;  2B1U A;  2JT8 A;  2NCP A;  3ICB A;  1LA0 A;  1A4P A;  4P5O E;  2M1K B;  4CLN A;  1CM1 A;  1ODB A;  1U5I B;  4I5N B;  5PAL A;  3DVK A;  3TS5 C;  3VRO A;  1TTX A;  2FOT A;  1SY9 A;  1NIW A;  1IJ5 A;  3CS1 A;  1YX8 A;  2ZN8 A;  3GK1 A;  1A75 A;  1ALV A;  3WHU B;  1OMR A;  1QLS A;  1WDC C;  1TNW A;  1F8H A;  1L7Z A;  1JFK A;  2LC5 A;  1XA5 A;  3LL8 B;  2OS8 C;  2ISD A;  1LIN A;  3CLN A;  5JOL A;  2KYC A;  2HQW A;  1WRL A;  4NDB A;  1J7R A;  2CTN A;  1BT6 A;  2LCP A;  1DJI A;  1MWN A;  4OCI A;  3E3R A;  2KI4 B;  2JNF A;  1K96 A;  2GV5 A;  1QJT A;  4M2Q A;  1CDM A;  3RLZ A;  1NCZ A;  1KFU L;  4YBH B;  3D0Y B;  1KWO C;  1JWD A;  2JXC A;  1TOP A;  2KBM A;  4GFT A;  4HSZ A;  1SRA A;  1M39 A;  3AAJ A;  1FI5 A;  1TIZ A;  1IGV A;  2I2R E;  1QAT A;  1Y1X A;  4YGB B;  5IBW A;  5TNC A;  1F55 A;  3PLF B;  3CR5 X;  1PK0 D;  2L98 A;  1B9A A;  1TNP A;  2MHH A;  2NLN A;  2Y1N A;  1YR5 A;  5CPV A;  3I5H B;  4GUK A;  1ALW A;  4MN0 A;  1XFU O;  1J55 A;  4MRY A;  5I2L A;  3CZT X;  3H4S E;  2JT0 A;  1DJW A;  2PRU A;  1SCM C;  1SNL A;  2HF5 A;  4TNC A;  1J1D A;  2D8N A;  1YUR A;  4PE7 A;  4CFQ A;  4MZL A;  2LAN A;  2AUC A;  3NSK A;  1ZAC A;  2K7C A;  3DF0 B;  2IS9 A;  2NXQ A;  3A4U B;  2JQ6 A;  1KQM B;  1NX2 A;  1R6P A;  4N1G A;  3TUY B;  4N5X A;  2KDH A;  3I5F B;  2SCP A;  2LUC A;  2G9B A;  4C0K A;  3I5G C;  5CSI A;  3EVU A;  2EGD A;  2KI6 D;  2JOJ A;  1CDL A;  4I5J A;  4MRX A;  1BOC A;  4GGF A;  1SPY A;  3O6B A;  2KSP A;  3VRN A;  1B1G A;  1PVA A;  1C07 A;  1TN4 A;  1KQV A;  2O60 A;  3BOW A;  4NQG A;  4E68 A;  1QX5 B;  1FI6 A;  2L2E A;  3KO0 A;  4ICB A;  2KGR A;  3FS7 A;  5BPJ A;  1C7V A;  1S36 A;  1ZOT B;  1C7W A;  1OE9 B;  1JFJ A;  1DVI A;  1QX2 A;  1RK9 A;  3O2P A;  1F4O A;  4OKH A;  2L0P A;  2BE6 A;  2JPT A;  1EG3 A;  2JXL A;  2KBI A;  5HYD A;  1NCY A;  2M9G A;  4DIR A;  4QJ5 B;  3MSE B;  1SMG A;  1CFD A;  3LK1 A;  1YRU B;  1CLB A;  2JTT A;  4P2Y B;  2Y1M A;  1YVL A;  1K9K A;  1YUS A;  5AER A;  1S5G Z;  3BUX B;  2CT9 A;  1B8C A;  1SL7 A;  2WOS A;  1XK4 A;  3FWB A;  2LVJ A;  4IL1 A;  3CR4 X;  1DMO A;  1LVC D;  1DT7 B;  1IQ3 A;  1PUL A;  4AQJ A;  4AQI A;  4HRE E;  3OB1 B;  1QX7 A;  3FIA A;  5DKN A;  1JUO A;  2KGB C;  2PAS A;  2JTZ A;  1YX7 A;  1Q80 A;  3AAK A;  1AP4 A;  1OQP A;  4GPL B;  2PVB A;  4U8D A;  2LNK A;  1CMG A;  2KAV A;  1TCO B;  4M2P A;  2K61 A;  1J7Q A;  1EG4 A;  5I8N A;  1JC2 A;  1RJV A;  1DF0 B;  5FYX A;  4XJK B;  5KTY A;  1G8I A;  3WNX B;  1DGV A;  1OSA A;  3BYA A;  2ZND A;  3CR2 A;  3A8R A;  3EK4 A;  4I5L B;  4GBA A;  1QS7 A;  1BJF A;  2LHI A;  1BG1 A;  1CKK A;  2FCD A;  4YI9 A;  2H61 A;  4AOM A;  3EVR A;  2NZ0 A;  3O4Y A;  1DJG A;  3DVE A;  2M1U A;  3KF9 A;  3SG5 A;  1PRW A;  2O5G A;  1DJH A;  1K9P A;  3NXA A;  1AUI B;  4ORA B;  1XFX O;  2LP2 A;  2ZN9 A;  1LXF C;  1M45 A;  2JT3 A;  3CTN A;  1SR6 B;  2I94 A;  1IJ6 A;  1UHK A;  2K2A A;  3CGA A;  4YRU A;  1K2H A;  2KHN A;  1SW8 A;  4GGF C;  1OOJ A;  2LMT A;  3PN7 C;  3EK7 A;  1WY9 A;  2BCA A;  5D7F A;  1A75 B;  2K0J A;  3I5I C;  1KFX S;  2LMV A;  1QV0 A;  2F3Y A;  4YGA A;  5HKW A;  1A29 A;  2LLT A;  2G2B A;  4ZCU A;  3VRQ A;  1WRK A;  2BCX A;  2QPT A;  2BBM A;  3RM1 A;  2BL0 C;  3IQO A;  5DKR A;  1KK8 B;  2COL B;  4MZK A;  1GGZ A;  4HRG A;  1JF0 A;  1MHO A;  1PSB A;  2OPO A;  1AJ4 A;  1NPQ A;  1UP5 A;  2JRF A;  4MZJ A;  2EHB A;  1MXE A;  2F33 A;  2K8M B;  1RTP 1;  3ZWH A;  3IF7 A;  1KK7 Z;  3NSO A;  3BXK A;  1J1E A;  3M0W A;  5F6T A;  2EC6 B;  1CM4 A;  3EVV A;  3F45 A;  3NSI A;  2DOQ A;  2L4H A;  2ZKM X;  1K90 D;  1BLQ A;  2F2O A;  1DJZ A;  1K8U A;  3SG2 A;  1NSH A;  2PAL A;  1Y0V H;  2HQ8 A;  3JTD B;  1NX0 A;  2CXJ A;  1ZUZ A;  3BUM B;  3NSL A;  3WHT B;  1S6I A;  4PHN A;  1XK4 C;  1N0Y A;  5ER4 X;  3TDU A;  3C1V A;  1X02 A;  2Y5I A;  1W7J B;  1Y6W A;  1EXR A;  2KNE A;  3JVT C;  5AAN A;  2E30 A;  3SG4 A;  1NP8 A;  2BKH B;  3DVJ A;  1MR8 A;  2LE9 B;  1QIV A;  4HRH A;  1UHN A;  2I18 A;  1BF5 A;  3BUN B;  1FW4 A;  1KFU S;  4JWQ A;  4WQ3 A;  5CSF A;  4DS7 A;  2WOR A;  1PVB A;  3ZNI A;  2QAC A;  2FCE A;  2AAO A;  4JQ0 D;  1KCY A;  3TS5 B;  2V53 A;  1XFW O;  2M97 A;  1B8R A;  1S26 D;  2JUL A;  2K7O A;  1TNQ A;  5I2O A;  1F70 A;  2M3W A;  2WND A;  1M46 A;  1YUU A;  1WDC B;  4YGE B;  1SL9 A;  3KPX A;  4L9M A;  1LKJ A;  4FQO A;  4R1E A;  1CDN A;  2CBL A;  2JZI A;  3GOF A;  5JJG A;  4MBE A;  1S1E A;  4C0L A;  1SYM A;  1BU3 A;  2OS8 B;  3SG7 A;  4A4C A;  2PSR A;  3PAT A;  2H61 C;  3BQ3 A;  1FF1 A;  4M2O A;  1NCX A;  4PCW A;  2LVK A;  1JSA A;  1SK6 D;  1TCF A;  1CDP A;  2KAX A;  2L5X B;  2NCO A;  2P6B B;  1E8A A;  1R2U A;  2L4I A;  3PSR A;  2BE4 A;  2VRG A;  3KEV A;  4QJ3 B;  1AVS A;  2R2I A;  3BOW B;  1QVI Z;  4PHM A;  1A2X A;  2Y4Q A;  2KI4 C;  4JPZ B;  1M31 A;  1KWO B;  5HKZ A;  5J3X A;  2K2F A;  2LM5 A;  1IH0 A;  2L51 A;  1KK7 Y;  2KAY A;  4ETO A;  1GJY A;  1TNX A;  3TZ1 A;  5AXI A;  1G33 A;  5HLV A;  1HT9 A;  2LLU A;  2WC8 A;  3O78 A;  5B8I B;  1RFJ A;  1S6J A;  3PM8 A;  4DCK A;  2CNP A;  1BR4 B;  1CMF A;  1MQ1 A;  2SAS A;  4C0J A;  1VRK A;  1CFF A;  2JC2 A;  3TDZ A;  1IWQ A;  1NWD A;  1REC A;  1SCM B;  1U5I A;  2JWW A;  1HQV A;  1EL4 A;  1MXL C;  2Q4U A;  3OX6 A;  4XJK A;  4MSP A;  1BMO A;  1EJ3 A;  1KSM A;  2A4J A;  1CFP A;  1J7O A;  2H2K A;  1ZFS A;  4PDZ A;  1A03 A;  4GGN A;  4PHK A;  1UUR A;  1K93 D;  3HCM A;  4ORB B;  1FBV A;  1B4C A;  5CSJ A;  4CID A;  2MA2 A;  1AJ5 A;  2LUX A;  1CLM A;  1XFZ O;  1OZO A;  3I5H C;  3SJS A;  3I5G B;  2JU0 A;  1KQM C;  1YTZ C;  2MJW B;  4D1E A;  1V1G A;  3TUY C;  3I5F C;  2K7B A;  2KFG A;  1XFV O;  2HPS A;  1NUB A;  1L2O C;  1B47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...