4PE1A

Crystal structure of calcium-loaded s100b bound to sc124
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Covalent Small Molecule Inhibitors of Ca(2+)-Bound S100B.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 31
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4pe1A00
1YRUB 1OOJA 5CSJA 1LINA 1JF0A 5AFPA 4PE7A 2K7DA 5F6TA 2JNXA 1J1DA 4N1GA 2LAPA 2NZ0A 4HSZA 4QJ4B 1W7IB 4A4CA 3PN7B 2LUCA 1B1GA 1C07A 2K7CA 1UURA 2BKIB 2LC5A 3AKAA 1GQMA 4ICBA 4L9MA 3I5GC 1F55A 1LKJA 4AQJA 1U5IB 3NSOA 3I5IB 2M97A 4YBHB 2MBXA 2GGZA 3CZTX 2AUCA 3VGOA 2M7LA 1J7PA 1XA5A 2H61C 1K96A 1KK8C 1QASA 2NCOA 3TDIA 1NX3A 4OVNF 1A4PA 2NCPA 3BUNB 1K95A 1KSMA 1QIWA 2EC6C 2RGIA 3D0YB 3O2PA 1KQMC 1BMOA 3EK7A 3PSRA 3O78A 1WRLA 3O4YA 3VRQA 1QX5B 1MXEA 5PALA 1K9KA 2JWWA 5ER4X 4PE0A 2Y4QA 5J3XA 2WOSA 5HKYA 3WXAA 1QS7A 1F8HA 4DS7A 1Y1AA 1ODBA 2QACA 4XJKB 3HX4A 2KAYA 1TCOB 1SPYA 1FI5A 4MZJA 2JT0A 1NCYA 3I5GB 3BXKA 1OZOA 1B7TY 1RK9A 3NXAA 1XK4A 1K9PA 2KYFA 5KU1A 1SKTA 1YRTB 1CNPA 2MLEC 2EHBA 2WNDA 4PE1A 1KK8B 1MUXA 2JOJA 2CCMA 2R2IA 1G8IA 1OE9B 3BUXB 3SG4A 1M63B 3CS1A 2EC6B 1A2XA 3KHEA 2MLFC 1KQMB 1NX0A 2KQ6A 3KPXA 1CFCA 2BCBA 3I5HC 5D7FA 4ETOA 1CDNA 1QXPA 1HT9A 1Y0VH 2JU0A 1J1EA 5B8IB 1MQ1A 2L50A 1BF5A 1KFUS 1PULA 2VRGA 1CLBA 1OMDA 5TNCA 4CFRA 1PRWA 2Y1MA 2JTZA 2L51A 2LUXA 1NP8A 1WRZA 2ISDA 3TS5B 4DIRA 1KFXS 3TZ1A 1NCXA 4PDZA 2BBNA 2KI4C 2Q91A 2LHIA 1TRFA 1SW8A 2L5XB 2NXQA 2OS8B 2G2BA 3PFVA 1CLMA 4MZLA 4CIDA 1RECA 1S5GY 1QATA 4OR9B 1EL4A 1B7TZ 2LVIA 5I8NA 3JTDC 1JWDA 4GGNA 1CB1A 4WQ2A 1IQ3A 4MN0A 3SG5A 1DTLA 2O5GA 1RFJA 4P5OE 1MHOA 2WCFA 1JSAA 2KFFA 3I5HB 4P2YB 2LLUA 3VRRA 2QPTA 4IL1A 1YR5A 3BQ3A 4GUKA 1QV1A 1J7RA 2D8NA 5AXIA 1XYDA 2ZNEA 1Y1XA 2KQYA 5FYXA 2JXLA 4DCKA 2MA2A 3PN7C 1CFFA 2ZN8A 2MHHA 2SASA 1AK8A 1DVIA 1BJFA 2KI4B 2L98A 2O60A 3ICBA 3PM8A 3PLFB 3TDUA 3EVRA 1DJWA 1WY9A 2IS9A 2JQ6A 2PVBA 1S5GZ 3BUWB 3JTDB 2PALA 3F45A 2L0PA 1JBAA 2KBMA 1TIZA 2M7NA 3FWCA 2JRFA 5CSIA 4C0LA 1TCFA 2K7OA 4USLA 4MVFA 1U5IA 3DVEA 1ZOTB 5GQQC 5CPVA 2AAOA 4MSPA 2BE6A 3LK0A 1DF0B 2HF5A 1KCYA 2M0RA 3H4SE 4NDDA 2K2FA 1IKUA 4N5XA 3NSLA 2KOTA 5HLOA 3D0YA 4DUQA 1BR4B 3SIBA 1K94A 2L2EA 3A4UB 1B8LA 1M46A 4M2OA 3SG3A 2KFHA 1DT7B 2KNEA 1NX1A 1C7WA 3C1VA 1S6CA 3O6BA 2Y5IA 1AUIB 1A75B 3E3RA 1Y1UA 4M2QA 1R2UA 4I5LB 3KF9A 1DGUA 3D10A 1OSAA 3SG2A 5G08A 1OMRA 1FPWA 2KFGA 1IQ5A 3AAKA 1IG5A 1TNWA 2KHNA 1EG3A 4GFTA 1TNXA 1J55A 2A4JA 3HCMA 1QV0A 1RJVA 2K8MB 1ALVA 1SNLA 3EVVA 3LL8B 3WHTB 1PVBA 3BYAA 1YURA 2WCBA 2CBLA 2M49B 2H61A 1ZMZA 2MJWB 2TN4A 1B8CA 3DF0A 4R1EA 4JQ0D 1IWQA 1DGVA 4OV2A 1CDLA 1CFPA 1NPQA 2L4HA 1X02A 1JC2A 1G33A 5DKRA 2LV7A 2E30A 5BPJA 1XFWO 2FCDA 4FQOA 3TS5C 2M1KB 2WCEA 2OS8C 2ZNDA 2M3WA 5DKQA 1LA3A 2LVVA 1ALWA 1TNQA 2M29A 1L7ZA 4F0ZB 5HYDA 4YRUA 3GK1A 4PE4A 3GOFA 5AANA 3AAJA 2M9GA 2GGMA 4N1FA 1BG1A 1IJ5A 1DMOA 4GAOA 2FCEA 3FS7A 1WDCC 2F3YA 2GV5A 3IF7A 3IQQA 2JNFA 2JT3A 2KBIA 1A03A 5AERA 1L2OC 3DD4A 3FWBA 4XYNA 1K90D 4ZCVA 2ZRTA 1ZUZA 2LMVA 4E68A 1SMGA 2PSRA 1XO5A 2LVJA 1CM4A 1JF2A 2KDHA 1DJHA 1Q80A 4YI9A 1NX2A 4WRIA 1XFVO 1WRKA 1SY9A 4C0KA 2L4IA 1BLQA 1VRKA 2KSPA 3BOWA 3EKHA 1ZFSA 1UHNA 4HRGA 1K8UA 1UWOA 1FF1A 5ER5A 2Q4UA 2SCPA 5CSNA 2M1UA 3PATA 2F2PA 4NQGA 3VRNA 3I5FB 2DOQA 1QTXA 2K2AA 2OTGB 4I5KA 1ZACA 1PK0D 1WDCB 2CT9A 2G9BA 4BY5A 1SL8A 1L2OB 1FI6A 3LLEA 1NIWA 1QVIY 1OQPA 1YUTA 3QRXA 1N2DA 1F71A 4PALA 4MRXA 3TUYC 2BCAA 1YX8A 3DVMA 1OZSA 3CWGA 1TTXA 2JXCA 1RROA 1DF0A 1W7JB 4FTGA 4YGAA 1UHIA 1IH0A 3SG7A 1N65A 4GGFC 1DJIA 1K93D 5I2LA 1N0YA 2HPSA 1UUSA 1H8BA 1AVSA 2ZKMX 2HETA 1NWDA 1RWYA 1KSOA 2COLB 2I7AA 2K7BA 3EKJA 1NSHA 4BY4A 1AJ4A 2AMIA 3VRPA 4QJ3B 1A29A 2JPTA 2BECA 1SL9A 3BUMB 3ZNIA 1XFYO 2CNPA 5I2OA 1PSBA 5HLVA 1LXFC 1QX2A 2F3ZA 4Q04A 1BR1B 2LVKA 1SRAA 1SBJA 1CM1A 1G4YR 5HKWA 1H4BA 1UHHA 1QVIZ 1S6IA 1YVLA 2BCXA 3SIAA 3TUYB 5KTYA 3GK2A 1WLZA 1JUOA 2FOTA 1YVHA 3CR4X 2E6WA 1F70A 3BUOB 4MZKA 1LVCD 2LMUA 4AOMA 1DJGA 2JULA 1DJXA 4ORBB 4PHKA 2ZRSA 1M31A 4ZCUA 2WORA 5AEQA 1RTP1 4XJKA 2I18A 4OKHA 2HQWA 2K0JA 4TNCA 2I94A 2ZN9A 5KSZA 2I2RE 1J7OA 1B4CA 1XFZO 4AQIA 1HQVA 3KEVA 1CDMA 2LM5A 1Y6WA 1SR6C 3DVJA 1FBVA 1KFUL 3M0WA 4NDBA 3EK8A 2PRUA 1IJ6A 1QLKA 2JZIA 3DVKA 1BOCA 1KFXL 1UP5A 4CPVA 1QIVA 1YTZC 3PALA 2LLSA 2M8UA 1CTRA 2B1UA 3OB1B 1BODA 4MRYA 4CLNA 2F8PA 1PVAA 3WNXB 2HQ8A 1SCMC 2KI6C 1EXRA 1PALA 2JT8A 3GK4X 1XVJA 1KK7Y 3EVUA 2KAXA 3K21A 4MEWA 2MAZA 1UHJA 2BE4A 4M2PA 4YGBB 1XFXO 4UPGA 4ORCB 1CMGA 4WQ3A 3I5FC 2K61A 1YX7A 2JTTA 5I2QA 2OTGC 1XK4C 1K2HA 1NUBA 2PMYA 1SR6B 2Y1NA 1MF8B 1KWOC 1GGWA 4YGCB 2H2KA 2CXJA 1JFKA 1SL7A 3TDZA 1QLSA 4HREE 1AHRA 1B9AA 3LCPC 1SK6D 2V53A 3AKBA 1UHKA 3OX6A 2ZFDA 3CTNA 3NSKA 1CLLA 1JFJA 4OCIA 3CR5X 1QX7A 1S1EA 3OB2B 1GJYA 1F4OA 1YUUA 1V1FA 3JVTC 2NLNA 1SCMB 2LANA 3DF0B 2KGRA 3LK1A 1B8RA 4HRHA 3WHUB 1KK7Z 3RLZA 2LHLA 5CSFA 1B47A 4ORAB 2BL0C 2KYCA 1TOPA 4GNKB 1GGZA 1NCZA 1CFDA 2LE9B 1R6PA 4GPLB 4I5NB 4YGDB 3CGAA 2CTNA 4D1EA 5DKNA 4JPZB 3SJSA 4JWQA 2F33A 5D69A 1D1OA 4MBEA 3OHMB 2LP3A 1KWOB 1NYAA 2JC2A 3RM1A 1MR8A 3OP0A 5JJGA 2LCPA 2MRDA 4PHJA 3MSEB 1KQVA 5JOLA 1F54A 1S6JA 1BU3A 1MXLC 1FW4A 1V1GA 2BKHB 3OX5A 2WC8A 2LNKA 1F4QA 3JVTB 4I5JA 1EJ3A 1MWNA 4MLWA 3EK4A 1DJZA 2PASA 1TNPA 4U8DA 1DJYA 1S3PA 4A4BA 1BT6A 1IRJA 1SYMA 4PHNA 1IGVA 2BL0B 1AP4A 3IQOA 5K89A 1E8AA 5HKZA 1YUSA 2BBMA 1M45A 3ZWHA 1A75A 1TN4A 4GGFA 1LA0A 1AJ5A 1J7QA 2KAVA 3BOWB 1S36A 1WLMA 2F2OA 2LP2A 2P6BB 1CKKA 3CLNA 2LMTA 3KO0A 1S26D 4DRWA 1C7VA 1K9UA 2LLTA 3CR2A 1CDPA 2OPOA 4NDCA 1CMFA 3FIAA 3I5IC 3NSIA 4YI8A 4PCWA 1OMVA 2KGBC 4QJ5B 5IBWA 1QJTA 3A8RA 2KI6D 2FJUB 1SCVA 3VROA 4YGEB 4C0JA 1PSRA 2EGDA 4GBAA 1XFUO 1EG4A 1M39A 4CFQA 4PHMA 3SG6A 1EH2A
chains in the Genus database with same CATH superfamily
1W9ZA 4JD9A 1YRUB 2QEHA 1OOJA 3D74A 5CSJA 2BAPA 1LINA 1JF0A 2ERBA 5AFPA 4PE7A 2K7DA 5F6TA 2JNXA 1J1DA 4N1GA 2LAPA 2NZ0A 4HSZA 4QJ4B 1W7IB 4A4CA 3PN7B 2LUCA 2KPHA 1B1GA 1C07A 2K7CA 2K60A 1UURA 2BKIB 2LC5A 3AKAA 1GQMA 4ICBA 4L9MA 3S0AA 1DELA 3I5GC 1F55A 1LKJA 4AQJA 1U5IB 3NSOA 3I5IB 2M97A 4YBHB 2MBXA 2GGZA 4F7FA 3CZTX 2AUCA 3VGOA 2M7LA 1J7PA 1XA5A 2H61C 1K96A 1SSEB 1KK8C 1QASA 2NCOA 2PYQA 3TDIA 1NX3A 4OVNF 1A4PA 2NCPA 3BUNB 1K95A 1KSMA 1QIWA 2EC6C 2RGIA 3D0YB 3O2PA 1KQMC 1BMOA 3EK7A 3PSRA 3O78A 1WRLA 3O4YA 3VRQA 1QX5B 1MXEA 5PALA 1K9KA 2JWWA 5ER4X 4PE0A 3B86A 2Y4QA 5J3XA 2WOSA 5HKYA 3WXAA 1QS7A 3FE6A 1F8HA 4DS7A 1Y1AA 1ODBA 2QACA 4XJKB 3HX4A 2KAYA 1TCOB 1SPYA 1FI5A 4MZJA 4KYNA 2JT0A 1NCYA 5HL1A 3CZ2A 3I5GB 3QMEA 3BXKA 1OZOA 1B7TY 1RK9A 3NXAA 1XK4A 1K9PA 2KYFA 5KU1A 1SKTA 1YRTB 1CNPA 2MLEC 2EHBA 2WNDA 3DZTA 4PE1A 1KK8B 1MUXA 2JOJA 2CCMA 3N7HA 2R2IA 1G8IA 1OE9B 3BUXB 3SG4A 1M63B 3CS1A 3DYEA 2EC6B 1A2XA 3KHEA 2MLFC 1KQMB 1NX0A 2KQ6A 3KPXA 1CFCA 2BCBA 3I5HC 5D7FA 4ETOA 1CDNA 1QXPA 1HT9A 1Y0VH 2JU0A 1J1EA 3CYZA 1MQ1A 2L50A 5B8IB 1BF5A 1KFUS 1PULA 2QEOA 2VRGA 3BFAA 3DXLA 1OMDA 5TNCA 4CFRA 1PRWA 1CLBA 2Y1MA 2JTZA 2L51A 3CABA 2LUXA 1NP8A 1WRZA 2ISDA 3TS5B 4DIRA 1KFXS 3TZ1A 1NCXA 4PDZA 2BBNA 2KI4C 2Q91A 2LHIA 3RZSA 1TRFA 1SW8A 2L5XB 2NXQA 1OOHA 2G2BA 2OS8B 1CLMA 3PFVA 4MZLA 4CIDA 1RECA 1S5GY 1QATA 4OR9B 1EL4A 1B7TZ 2LVIA 5I8NA 3JTDC 1JWDA 4GGNA 1CB1A 4WQ2A 2WC5A 1IQ3A 2L2CA 4MN0A 3O4XA 3SG5A 1DTLA 2O5GA 1RFJA 4P5OE 3NHTA 1TWOA 3B88A 1IIOA 1MHOA 2WCFA 2WCJA 1JSAA 2KFFA 3I5HB 4P2YB 2LLUA 3VRRA 2QPTA 4IL1A 1YR5A 3BQ3A 4GUKA 1QV1A 1J7RA 2D8NA 5AXIA 1XYDA 2ZNEA 1Y1XA 2H8VA 2KQYA 3D78A 5FYXA 2JXLA 4DCKA 2MA2A 3OBVA 3PN7C 1Z4HA 1CFFA 2ZN8A 2QDIA 2MHHA 2SASA 1AK8A 1DVIA 1BJFA 2KI4B 2L98A 2O60A 3ICBA 3IVTA 3PM8A 3PLFB 3TDUA 3EVRA 1DJWA 1WY9A 2IS9A 2JQ6A 2PVBA 1S5GZ 3BUWB 3JTDB 2PALA 1T14A 4INXA 2PQLA 3F45A 1TUJA 2L0PA 1JBAA 2KBMA 1TIZA 2M7NA 3FWCA 3CZ0A 2JRFA 5CSIA 4C0LA 1TCFA 2K7OA 4USLA 4MVFA 1U5IA 3DVEA 1ZOTB 5GQQC 5CPVA 2AAOA 4MSPA 2BE6A 3LK0A 1DF0B 2HF5A 1KCYA 2M0RA 3H4SE 3S0DA 4NDDA 2K2FA 1IKUA 4N5XA 4INWA 3NSLA 2KOTA 5HLOA 3D0YA 4DUQA 1BR4B 5EL2A 3SIBA 1K94A 2L2EA 3A4UB 1B8LA 1M46A 4M2OA 3SG3A 2KFHA 1DT7B 2KNEA 1NX1A 1C7WA 3C1VA 1S6CA 3O6BA 2Y5IA 1AUIB 3D75A 3UO9A 1A75B 3E3RA 1Y1UA 4M2QA 4IJ7A 1R2UA 4I5LB 3KF9A 1DGUA 3D10A 5I94A 1OSAA 3SG2A 5G08A 1OMRA 1FPWA 3DY9A 2KFGA 1IQ5A 3AAKA 3R72A 1IG5A 1TNWA 2KHNA 1EG3A 4GFTA 1TNXA 1J55A 2A4JA 3HCMA 1QV0A 1RJVA 5FI2A 2K8MB 1ALVA 1SNLA 3EVVA 3LL8B 3WHTB 1PVBA 3BYAA 3FE8A 3CZ1A 1YURA 2WCBA 2CBLA 2M49B 2H61A 1ZMZA 2MJWB 2TN4A 3EG5B 1B8CA 3DF0A 4R1EA 1C3YA 4JQ0D 1IWQA 1DGVA 4OV2A 1CDLA 1CFPA 1NPQA 2L4HA 1X02A 3S0GA 1G33A 1JC2A 5DKRA 2LV7A 2E30A 5BPJA 1XFWO 2FCDA 4FQOA 3TS5C 2M1KB 2WCEA 2OS8C 2ZNDA 2M3WA 5DKQA 1LA3A 2LVVA 1ALWA 1TNQA 2M29A 1L7ZA 4F0ZB 5HYDA 3B87A 4YRUA 3GK1A 4PE4A 3GOFA 2WCMA 3S0EA 5AANA 3AAJA 2M9GA 2GGMA 1QWVA 3L4AA 4N1FA 1BG1A 1IJ5A 1DMOA 4GAOA 2FCEA 3FS7A 2FJYA 1WDCC 2WCKA 2F3YA 2GV5A 3IF7A 3IQQA 2JNFA 2JT3A 2KBIA 4OZDA 5AERA 1A03A 1L2OC 3DD4A 3FWBA 4XYNA 3CDNA 1K90D 4ZCVA 2ZRTA 1ZUZA 2LMVA 4E68A 1SMGA 2PSRA 1XO5A 2LVJA 3BFBA 1CM4A 1JF2A 2KDHA 1DJHA 2WCHA 1Q80A 4YI9A 1NX2A 4WRIA 1XFVO 1WRKA 1SY9A 4C0KA 2L4IA 1BLQA 5DICA 1VRKA 2KSPA 3BOWA 4JKTA 3EKHA 1ZFSA 1UHNA 4HRGA 1K8UA 1UWOA 3D77A 1FF1A 5ER5A 2Q4UA 2SCPA 2P70A 5CSNA 2M1UA 3PATA 2F2PA 4NQGA 3B7AA 3I5FB 2DOQA 1QTXA 3VRNA 2K2AA 2OTGB 4I5KA 1ZACA 1PK0D 1WDCB 3SS3A 2CT9A 2G9BA 4BY5A 1SL8A 1L2OB 1FI6A 3LLEA 1NIWA 1QVIY 1OQPA 1YUTA 3QRXA 1N2DA 1F71A 4PALA 4MRXA 3TUYC 2BCAA 1TUZA 2QEBA 1YX8A 3DVMA 1OZSA 3CWGA 1TTXA 2JXCA 1RROA 1DF0A 1W7JB 4FTGA 4YGAA 1UHIA 1DC1A 1IH0A 3SG7A 1N65A 4GGFC 1DJIA 1K93D 5I2LA 1N0YA 2HPSA 1UUSA 1H8BA 1AVSA 2JPOA 2ZKMX 2HETA 1OOGA 1NWDA 1RWYA 1KSOA 2COLB 2I7AA 2BNXA 2K7BA 1NSHA 2KLDA 3EKJA 4FQTA 4BY4A 1AJ4A 2AMIA 3VRPA 2WC6A 4QJ3B 1A29A 5FI7A 2JPTA 2BECA 3NGVA 1SL9A 3BUMB 3ZNIA 1XFYO 2CNPA 5I2OA 3S0FA 3OGNA 1PSBA 5HLVA 1LXFC 1QX2A 2F3ZA 4Q04A 1BR1B 2LVKA 1SRAA 1SBJA 1CM1A 1G4YR 5HKWA 1H4BA 1UHHA 1QVIZ 1S6IA 1YVLA 2BCXA 3SIAA 3TUYB 5KTYA 3NHIA 3GK2A 3L4LA 1WLZA 1JUOA 2FOTA 1YVHA 3CR4X 2E6WA 1F70A 3BUOB 4MZKA 1LVCD 2LMUA 4AOMA 1DJGA 2JULA 1DJXA 1GM0A 4ORBB 3BJHA 3S0BA 4PHKA 2KLEA 2ZRSA 1M31A 3FE9A 4ZCUA 2WORA 1XFRA 1RTP1 5AEQA 4XJKA 2I18A 4OKHA 2HQWA 2K0JA 4TNCA 2I94A 2ZN9A 5KSZA 2I2RE 1J7OA 1B4CA 1XFZO 3R1VA 1HQVA 3KEVA 4AQIA 1CDMA 1LS8A 2LM5A 1Y6WA 1Z2CB 1C3ZA 1ORGA 1SR6C 3DVJA 1FBVA 1KFUL 3BFHA 3M0WA 3SS5A 4NDBA 3EK8A 2PRUA 1IJ6A 1QLKA 2JZIA 3DVKA 1BOCA 1KFXL 1UP5A 3B6XA 4CPVA 1QIVA 1YTZC 3PALA 2LLSA 2M8UA 1CTRA 2B1UA 3OB1B 1BODA 4MRYA 4CLNA 2F8PA 1PVAA 3WNXB 2HQ8A 1SCMC 2KI6C 1EXRA 1PALA 2JT8A 3GK4X 1XVJA 1KK7Y 3EVUA 2KAXA 3K21A 4MEWA 2MAZA 1UHJA 2BE4A 4M2PA 4YGBB 1XFXO 4UPGA 4ORCB 1CMGA 4WQ3A 3I5FC 2K61A 1YX7A 2JTTA 5I2QA 2OTGC 1XK4C 1K2HA 1NUBA 2PMYA 1SR6B 2Y1NA 1MF8B 1KWOC 1GGWA 4YGCB 2H2KA 2CXJA 1JFKA 1SL7A 3TDZA 1QLSA 4HREE 1AHRA 1B9AA 2P71A 1SK6D 2V53A 3AKBA 3LCPC 1UHKA 2YGUA 3OX6A 2ZFDA 3CTNA 3NSKA 3PM2A 1CLLA 1JFJA 4OCIA 3CR5X 1QX7A 1S1EA 3OB2B 1GJYA 1F4OA 1YUUA 1V1FA 3JVTC 2NLNA 1SCMB 2LANA 3DF0B 2KGRA 3LK1A 3V2LA 1B8RA 4HRHA 3WHUB 1KK7Z 3RLZA 1OW4A 2GTEA 2LHLA 5CSFA 1B47A 2QEVA 2BL0C 2KYCA 1TOPA 3D73A 4ORAB 4GNKB 1GGZA 1NCZA 3R1OA 1CFDA 4PT1A 2LE9B 1DEKA 1R6PA 3D76A 4GPLB 4I5NB 4YGDB 5FI6A 3CGAA 2CTNA 4D1EA 5DKNA 4JPZB 3SJSA 4JWQA 2F33A 5D69A 1D1OA 4MBEA 3OHMB 2LP3A 1KWOB 1NYAA 2JC2A 3RM1A 1MR8A 3OP0A 5JJGA 2LCPA 1P28A 2MRDA 4PHJA 3MSEB 1KQVA 5JOLA 1F54A 1S6JA 1BU3A 1MXLC 1FW4A 1V1GA 3VB1A 2BKHB 3OX5A 2WC8A 2LNKA 1F4QA 3JVTB 4I5JA 1EJ3A 1MWNA 4MLWA 3EK4A 1DJZA 2PASA 1TNPA 4U8DA 1DJYA 5D3OA 3K1EA 1S3PA 4A4BA 1BT6A 1OOIX 3Q8IA 2L5YA 1IRJA 1SYMA 4PHNA 1IGVA 2BL0B 1AP4A 3SS4A 3UNWA 3IQOA 5K89A 1E8AA 5HKZA 1YUSA 2BBMA 1M45A 1DQEA 3ZWHA 1A75A 1TN4A 4GGFA 1LA0A 1AJ5A 3PJIA 2KAVA 3BOWB 1J7QA 1S36A 3R1PA 1WLMA 2F2OA 2LP2A 2P6BB 1CKKA 3CLNA 2LMTA 3KO0A 1S26D 4DRWA 1C7VA 1OOFA 1K9UA 2LLTA 3CR2A 1CDPA 2OPOA 4NDCA 1CMFA 3FIAA 3I5IC 3NSIA 4YI8A 4PCWA 1OMVA 2KGBC 4QJ5B 5IBWA 1QJTA 3A8RA 2KI6D 3L47A 2FJUB 1SCVA 3VROA 4YGEB 4C0JA 1PSRA 2EGDA 4GBAA 1XFUO 1EG4A 2WCLA 1M39A 4CFQA 4PHMA 3SG6A 1EH2A
chains in the Genus database with same CATH topology
1YRUB 1OOJA 5CSJA 1LINA 1JF0A 5AFPA 4PE7A 2K7DA 5F6TA 2JNXA 1J1DA 4N1GA 2LAPA 2NZ0A 4HSZA 4QJ4B 1W7IB 4A4CA 3PN7B 2LUCA 1B1GA 1C07A 2K7CA 1UURA 2BKIB 2LC5A 3AKAA 1GQMA 4ICBA 4L9MA 3I5GC 1F55A 1LKJA 4AQJA 1U5IB 3NSOA 3I5IB 2M97A 4YBHB 2MBXA 2GGZA 3CZTX 2AUCA 3VGOA 2M7LA 1J7PA 1XA5A 2H61C 1K96A 1KK8C 1QASA 2NCOA 3TDIA 1NX3A 4OVNF 1A4PA 2NCPA 3BUNB 1K95A 1KSMA 1QIWA 2EC6C 2RGIA 3D0YB 3O2PA 1KQMC 1BMOA 3EK7A 3PSRA 3O78A 1WRLA 3O4YA 3VRQA 1QX5B 1MXEA 5PALA 1K9KA 2JWWA 5ER4X 4PE0A 2Y4QA 5J3XA 2WOSA 5HKYA 3WXAA 1QS7A 1F8HA 4DS7A 1Y1AA 1ODBA 2QACA 4XJKB 3HX4A 2KAYA 1TCOB 1SPYA 1FI5A 4MZJA 2JT0A 1NCYA 3I5GB 3BXKA 1OZOA 1B7TY 1RK9A 3NXAA 1XK4A 1K9PA 2KYFA 5KU1A 1SKTA 1YRTB 1CNPA 2MLEC 2EHBA 2WNDA 4PE1A 1KK8B 1MUXA 2JOJA 2CCMA 2R2IA 1G8IA 1OE9B 3BUXB 3SG4A 1M63B 3CS1A 2EC6B 1A2XA 3KHEA 2MLFC 1KQMB 1NX0A 2KQ6A 3KPXA 1CFCA 2BCBA 3I5HC 5D7FA 4ETOA 1CDNA 1QXPA 1HT9A 1Y0VH 2JU0A 1J1EA 5B8IB 1MQ1A 2L50A 1BF5A 1KFUS 1PULA 2VRGA 1CLBA 1OMDA 5TNCA 4CFRA 1PRWA 2Y1MA 2JTZA 2L51A 2LUXA 1NP8A 1WRZA 2ISDA 3TS5B 4DIRA 1KFXS 3TZ1A 1NCXA 4PDZA 2BBNA 2KI4C 2Q91A 2LHIA 1TRFA 1SW8A 2L5XB 2NXQA 2OS8B 2G2BA 3PFVA 1CLMA 4MZLA 4CIDA 1RECA 1S5GY 1QATA 4OR9B 1EL4A 1B7TZ 2LVIA 5I8NA 3JTDC 1JWDA 4GGNA 1CB1A 4WQ2A 1IQ3A 4MN0A 3SG5A 1DTLA 2O5GA 1RFJA 4P5OE 1MHOA 2WCFA 1JSAA 2KFFA 3I5HB 4P2YB 2LLUA 3VRRA 2QPTA 4IL1A 1YR5A 3BQ3A 4GUKA 1QV1A 1J7RA 2D8NA 5AXIA 1XYDA 2ZNEA 1Y1XA 2KQYA 5FYXA 2JXLA 4DCKA 2MA2A 3PN7C 1CFFA 2ZN8A 2MHHA 2SASA 1AK8A 1DVIA 1BJFA 2KI4B 2L98A 2O60A 3ICBA 3PM8A 3PLFB 3TDUA 3EVRA 1DJWA 1WY9A 2IS9A 2JQ6A 2PVBA 1S5GZ 3BUWB 3JTDB 2PALA 3F45A 2L0PA 1JBAA 2KBMA 1TIZA 2M7NA 3FWCA 2JRFA 5CSIA 4C0LA 1TCFA 2K7OA 4USLA 4MVFA 1U5IA 3DVEA 1ZOTB 5GQQC 5CPVA 2AAOA 4MSPA 2BE6A 3LK0A 1DF0B 2HF5A 1KCYA 2M0RA 3H4SE 4NDDA 2K2FA 1IKUA 4N5XA 3NSLA 2KOTA 5HLOA 3D0YA 4DUQA 1BR4B 3SIBA 1K94A 2L2EA 3A4UB 1B8LA 1M46A 4M2OA 3SG3A 2KFHA 1DT7B 2KNEA 1NX1A 1C7WA 3C1VA 1S6CA 3O6BA 2Y5IA 1AUIB 1A75B 3E3RA 1Y1UA 4M2QA 1R2UA 4I5LB 3KF9A 1DGUA 3D10A 1OSAA 3SG2A 5G08A 1OMRA 1FPWA 2KFGA 1IQ5A 3AAKA 1IG5A 1TNWA 2KHNA 1EG3A 4GFTA 1TNXA 1J55A 2A4JA 3HCMA 1QV0A 1RJVA 2K8MB 1ALVA 1SNLA 3EVVA 3LL8B 3WHTB 1PVBA 3BYAA 1YURA 2WCBA 2CBLA 2M49B 2H61A 1ZMZA 2MJWB 2TN4A 1B8CA 3DF0A 4R1EA 4JQ0D 1IWQA 1DGVA 4OV2A 1CDLA 1CFPA 1NPQA 2L4HA 1X02A 1JC2A 1G33A 5DKRA 2LV7A 2E30A 5BPJA 1XFWO 2FCDA 4FQOA 3TS5C 2M1KB 2WCEA 2OS8C 2ZNDA 2M3WA 5DKQA 1LA3A 2LVVA 1ALWA 1TNQA 2M29A 1L7ZA 4F0ZB 5HYDA 4YRUA 3GK1A 4PE4A 3GOFA 5AANA 3AAJA 2M9GA 2GGMA 4N1FA 1BG1A 1IJ5A 1DMOA 4GAOA 2FCEA 3FS7A 1WDCC 2F3YA 2GV5A 3IF7A 3IQQA 2JNFA 2JT3A 2KBIA 1A03A 5AERA 1L2OC 3DD4A 3FWBA 4XYNA 1K90D 4ZCVA 2ZRTA 1ZUZA 2LMVA 4E68A 1SMGA 2PSRA 1XO5A 2LVJA 1CM4A 1JF2A 2KDHA 1DJHA 1Q80A 4YI9A 1NX2A 4WRIA 1XFVO 1WRKA 1SY9A 4C0KA 2L4IA 1BLQA 1VRKA 2KSPA 3BOWA 3EKHA 1ZFSA 1UHNA 4HRGA 1K8UA 1UWOA 1FF1A 5ER5A 2Q4UA 2SCPA 5CSNA 2M1UA 3PATA 2F2PA 4NQGA 3VRNA 3I5FB 2DOQA 1QTXA 2K2AA 2OTGB 4I5KA 1ZACA 1PK0D 1WDCB 2CT9A 2G9BA 4BY5A 1SL8A 1L2OB 1FI6A 3LLEA 1NIWA 1QVIY 1OQPA 1YUTA 3QRXA 1N2DA 1F71A 4PALA 4MRXA 3TUYC 2BCAA 1YX8A 3DVMA 1OZSA 3CWGA 1TTXA 2JXCA 1RROA 1DF0A 1W7JB 4FTGA 4YGAA 1UHIA 1IH0A 3SG7A 1N65A 4GGFC 1DJIA 1K93D 5I2LA 1N0YA 2HPSA 1UUSA 1H8BA 1AVSA 2ZKMX 2HETA 1NWDA 1RWYA 1KSOA 2COLB 2I7AA 2K7BA 3EKJA 1NSHA 4BY4A 1AJ4A 2AMIA 3VRPA 4QJ3B 1A29A 2JPTA 2BECA 1SL9A 3BUMB 3ZNIA 1XFYO 2CNPA 5I2OA 1PSBA 5HLVA 1LXFC 1QX2A 2F3ZA 4Q04A 1BR1B 2LVKA 1SRAA 1SBJA 1CM1A 1G4YR 5HKWA 1H4BA 1UHHA 1QVIZ 1S6IA 1YVLA 2BCXA 3SIAA 3TUYB 5KTYA 3GK2A 1WLZA 1JUOA 2FOTA 1YVHA 3CR4X 2E6WA 1F70A 3BUOB 4MZKA 1LVCD 2LMUA 4AOMA 1DJGA 2JULA 1DJXA 4ORBB 4PHKA 2ZRSA 1M31A 4ZCUA 2WORA 5AEQA 1RTP1 4XJKA 2I18A 4OKHA 2HQWA 2K0JA 4TNCA 2I94A 2ZN9A 5KSZA 2I2RE 1J7OA 1B4CA 1XFZO 4AQIA 1HQVA 3KEVA 1CDMA 2LM5A 1Y6WA 1SR6C 3DVJA 1FBVA 1KFUL 3M0WA 4NDBA 3EK8A 2PRUA 1IJ6A 1QLKA 2JZIA 3DVKA 1BOCA 1KFXL 1UP5A 4CPVA 1QIVA 1YTZC 3PALA 2LLSA 2M8UA 1CTRA 2B1UA 3OB1B 1BODA 4MRYA 4CLNA 2F8PA 1PVAA 3WNXB 2HQ8A 1SCMC 2KI6C 1EXRA 1PALA 2JT8A 3GK4X 1XVJA 1KK7Y 3EVUA 2KAXA 3K21A 4MEWA 2MAZA 1UHJA 2BE4A 4M2PA 4YGBB 1XFXO 4UPGA 4ORCB 1CMGA 4WQ3A 3I5FC 2K61A 1YX7A 2JTTA 5I2QA 2OTGC 1XK4C 1K2HA 1NUBA 2PMYA 1SR6B 2Y1NA 1MF8B 1KWOC 1GGWA 4YGCB 2H2KA 2CXJA 1JFKA 1SL7A 3TDZA 1QLSA 4HREE 1AHRA 1B9AA 3LCPC 1SK6D 2V53A 3AKBA 1UHKA 3OX6A 2ZFDA 3CTNA 3NSKA 1CLLA 1JFJA 4OCIA 3CR5X 1QX7A 1S1EA 3OB2B 1GJYA 1F4OA 1YUUA 1V1FA 3JVTC 2NLNA 1SCMB 2LANA 3DF0B 2KGRA 3LK1A 1B8RA 4HRHA 3WHUB 1KK7Z 3RLZA 2LHLA 5CSFA 1B47A 4ORAB 2BL0C 2KYCA 1TOPA 4GNKB 1GGZA 1NCZA 1CFDA 2LE9B 1R6PA 4GPLB 4I5NB 4YGDB 3CGAA 2CTNA 4D1EA 5DKNA 4JPZB 3SJSA 4JWQA 2F33A 5D69A 1D1OA 4MBEA 3OHMB 2LP3A 1KWOB 1NYAA 2JC2A 3RM1A 1MR8A 3OP0A 5JJGA 2LCPA 2MRDA 4PHJA 3MSEB 1KQVA 5JOLA 1F54A 1S6JA 1BU3A 1MXLC 1FW4A 1V1GA 2BKHB 3OX5A 2WC8A 2LNKA 1F4QA 3JVTB 4I5JA 1EJ3A 1MWNA 4MLWA 3EK4A 1DJZA 2PASA 1TNPA 4U8DA 1DJYA 1S3PA 4A4BA 1BT6A 1IRJA 1SYMA 4PHNA 1IGVA 2BL0B 1AP4A 3IQOA 5K89A 1E8AA 5HKZA 1YUSA 2BBMA 1M45A 3ZWHA 1A75A 1TN4A 4GGFA 1LA0A 1AJ5A 1J7QA 2KAVA 3BOWB 1S36A 1WLMA 2F2OA 2LP2A 2P6BB 1CKKA 3CLNA 2LMTA 3KO0A 1S26D 4DRWA 1C7VA 1K9UA 2LLTA 3CR2A 1CDPA 2OPOA 4NDCA 1CMFA 3FIAA 3I5IC 3NSIA 4YI8A 4PCWA 1OMVA 2KGBC 4QJ5B 5IBWA 1QJTA 3A8RA 2KI6D 2FJUB 1SCVA 3VROA 4YGEB 4C0JA 1PSRA 2EGDA 4GBAA 1XFUO 1EG4A 1M39A 4CFQA 4PHMA 3SG6A 1EH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRU B;  1OOJ A;  5CSJ A;  1LIN A;  1JF0 A;  5AFP A;  4PE7 A;  2K7D A;  5F6T A;  2JNX A;  1J1D A;  4N1G A;  2LAP A;  2NZ0 A;  4HSZ A;  4QJ4 B;  1W7I B;  4A4C A;  3PN7 B;  2LUC A;  1B1G A;  1C07 A;  2K7C A;  1UUR A;  2BKI B;  2LC5 A;  3AKA A;  1GQM A;  4ICB A;  4L9M A;  3I5G C;  1F55 A;  1LKJ A;  4AQJ A;  1U5I B;  3NSO A;  3I5I B;  2M97 A;  4YBH B;  2MBX A;  2GGZ A;  3CZT X;  2AUC A;  3VGO A;  2M7L A;  1J7P A;  1XA5 A;  2H61 C;  1K96 A;  1KK8 C;  1QAS A;  2NCO A;  3TDI A;  1NX3 A;  4OVN F;  1A4P A;  2NCP A;  3BUN B;  1K95 A;  1KSM A;  1QIW A;  2EC6 C;  2RGI A;  3D0Y B;  3O2P A;  1KQM C;  1BMO A;  3EK7 A;  3PSR A;  3O78 A;  1WRL A;  3O4Y A;  3VRQ A;  1QX5 B;  1MXE A;  5PAL A;  1K9K A;  2JWW A;  5ER4 X;  4PE0 A;  2Y4Q A;  5J3X A;  2WOS A;  5HKY A;  3WXA A;  1QS7 A;  1F8H A;  4DS7 A;  1Y1A A;  1ODB A;  2QAC A;  4XJK B;  3HX4 A;  2KAY A;  1TCO B;  1SPY A;  1FI5 A;  4MZJ A;  2JT0 A;  1NCY A;  3I5G B;  3BXK A;  1OZO A;  1B7T Y;  1RK9 A;  3NXA A;  1XK4 A;  1K9P A;  2KYF A;  5KU1 A;  1SKT A;  1YRT B;  1CNP A;  2MLE C;  2EHB A;  2WND A;  4PE1 A;  1KK8 B;  1MUX A;  2JOJ A;  2CCM A;  2R2I A;  1G8I A;  1OE9 B;  3BUX B;  3SG4 A;  1M63 B;  3CS1 A;  2EC6 B;  1A2X A;  3KHE A;  2MLF C;  1KQM B;  1NX0 A;  2KQ6 A;  3KPX A;  1CFC A;  2BCB A;  3I5H C;  5D7F A;  4ETO A;  1CDN A;  1QXP A;  1HT9 A;  1Y0V H;  2JU0 A;  1J1E A;  5B8I B;  1MQ1 A;  2L50 A;  1BF5 A;  1KFU S;  1PUL A;  2VRG A;  1CLB A;  1OMD A;  5TNC A;  4CFR A;  1PRW A;  2Y1M A;  2JTZ A;  2L51 A;  2LUX A;  1NP8 A;  1WRZ A;  2ISD A;  3TS5 B;  4DIR A;  1KFX S;  3TZ1 A;  1NCX A;  4PDZ A;  2BBN A;  2KI4 C;  2Q91 A;  2LHI A;  1TRF A;  1SW8 A;  2L5X B;  2NXQ A;  2OS8 B;  2G2B A;  3PFV A;  1CLM A;  4MZL A;  4CID A;  1REC A;  1S5G Y;  1QAT A;  4OR9 B;  1EL4 A;  1B7T Z;  2LVI A;  5I8N A;  3JTD C;  1JWD A;  4GGN A;  1CB1 A;  4WQ2 A;  1IQ3 A;  4MN0 A;  3SG5 A;  1DTL A;  2O5G A;  1RFJ A;  4P5O E;  1MHO A;  2WCF A;  1JSA A;  2KFF A;  3I5H B;  4P2Y B;  2LLU A;  3VRR A;  2QPT A;  4IL1 A;  1YR5 A;  3BQ3 A;  4GUK A;  1QV1 A;  1J7R A;  2D8N A;  5AXI A;  1XYD A;  2ZNE A;  1Y1X A;  2KQY A;  5FYX A;  2JXL A;  4DCK A;  2MA2 A;  3PN7 C;  1CFF A;  2ZN8 A;  2MHH A;  2SAS A;  1AK8 A;  1DVI A;  1BJF A;  2KI4 B;  2L98 A;  2O60 A;  3ICB A;  3PM8 A;  3PLF B;  3TDU A;  3EVR A;  1DJW A;  1WY9 A;  2IS9 A;  2JQ6 A;  2PVB A;  1S5G Z;  3BUW B;  3JTD B;  2PAL A;  3F45 A;  2L0P A;  1JBA A;  2KBM A;  1TIZ A;  2M7N A;  3FWC A;  2JRF A;  5CSI A;  4C0L A;  1TCF A;  2K7O A;  4USL A;  4MVF A;  1U5I A;  3DVE A;  1ZOT B;  5GQQ C;  5CPV A;  2AAO A;  4MSP A;  2BE6 A;  3LK0 A;  1DF0 B;  2HF5 A;  1KCY A;  2M0R A;  3H4S E;  4NDD A;  2K2F A;  1IKU A;  4N5X A;  3NSL A;  2KOT A;  5HLO A;  3D0Y A;  4DUQ A;  1BR4 B;  3SIB A;  1K94 A;  2L2E A;  3A4U B;  1B8L A;  1M46 A;  4M2O A;  3SG3 A;  2KFH A;  1DT7 B;  2KNE A;  1NX1 A;  1C7W A;  3C1V A;  1S6C A;  3O6B A;  2Y5I A;  1AUI B;  1A75 B;  3E3R A;  1Y1U A;  4M2Q A;  1R2U A;  4I5L B;  3KF9 A;  1DGU A;  3D10 A;  1OSA A;  3SG2 A;  5G08 A;  1OMR A;  1FPW A;  2KFG A;  1IQ5 A;  3AAK A;  1IG5 A;  1TNW A;  2KHN A;  1EG3 A;  4GFT A;  1TNX A;  1J55 A;  2A4J A;  3HCM A;  1QV0 A;  1RJV A;  2K8M B;  1ALV A;  1SNL A;  3EVV A;  3LL8 B;  3WHT B;  1PVB A;  3BYA A;  1YUR A;  2WCB A;  2CBL A;  2M49 B;  2H61 A;  1ZMZ A;  2MJW B;  2TN4 A;  1B8C A;  3DF0 A;  4R1E A;  4JQ0 D;  1IWQ A;  1DGV A;  4OV2 A;  1CDL A;  1CFP A;  1NPQ A;  2L4H A;  1X02 A;  1JC2 A;  1G33 A;  5DKR A;  2LV7 A;  2E30 A;  5BPJ A;  1XFW O;  2FCD A;  4FQO A;  3TS5 C;  2M1K B;  2WCE A;  2OS8 C;  2ZND A;  2M3W A;  5DKQ A;  1LA3 A;  2LVV A;  1ALW A;  1TNQ A;  2M29 A;  1L7Z A;  4F0Z B;  5HYD A;  4YRU A;  3GK1 A;  4PE4 A;  3GOF A;  5AAN A;  3AAJ A;  2M9G A;  2GGM A;  4N1F A;  1BG1 A;  1IJ5 A;  1DMO A;  4GAO A;  2FCE A;  3FS7 A;  1WDC C;  2F3Y A;  2GV5 A;  3IF7 A;  3IQQ A;  2JNF A;  2JT3 A;  2KBI A;  1A03 A;  5AER A;  1L2O C;  3DD4 A;  3FWB A;  4XYN A;  1K90 D;  4ZCV A;  2ZRT A;  1ZUZ A;  2LMV A;  4E68 A;  1SMG A;  2PSR A;  1XO5 A;  2LVJ A;  1CM4 A;  1JF2 A;  2KDH A;  1DJH A;  1Q80 A;  4YI9 A;  1NX2 A;  4WRI A;  1XFV O;  1WRK A;  1SY9 A;  4C0K A;  2L4I A;  1BLQ A;  1VRK A;  2KSP A;  3BOW A;  3EKH A;  1ZFS A;  1UHN A;  4HRG A;  1K8U A;  1UWO A;  1FF1 A;  5ER5 A;  2Q4U A;  2SCP A;  5CSN A;  2M1U A;  3PAT A;  2F2P A;  4NQG A;  3VRN A;  3I5F B;  2DOQ A;  1QTX A;  2K2A A;  2OTG B;  4I5K A;  1ZAC A;  1PK0 D;  1WDC B;  2CT9 A;  2G9B A;  4BY5 A;  1SL8 A;  1L2O B;  1FI6 A;  3LLE A;  1NIW A;  1QVI Y;  1OQP A;  1YUT A;  3QRX A;  1N2D A;  1F71 A;  4PAL A;  4MRX A;  3TUY C;  2BCA A;  1YX8 A;  3DVM A;  1OZS A;  3CWG A;  1TTX A;  2JXC A;  1RRO A;  1DF0 A;  1W7J B;  4FTG A;  4YGA A;  1UHI A;  1IH0 A;  3SG7 A;  1N65 A;  4GGF C;  1DJI A;  1K93 D;  5I2L A;  1N0Y A;  2HPS A;  1UUS A;  1H8B A;  1AVS A;  2ZKM X;  2HET A;  1NWD A;  1RWY A;  1KSO A;  2COL B;  2I7A A;  2K7B A;  3EKJ A;  1NSH A;  4BY4 A;  1AJ4 A;  2AMI A;  3VRP A;  4QJ3 B;  1A29 A;  2JPT A;  2BEC A;  1SL9 A;  3BUM B;  3ZNI A;  1XFY O;  2CNP A;  5I2O A;  1PSB A;  5HLV A;  1LXF C;  1QX2 A;  2F3Z A;  4Q04 A;  1BR1 B;  2LVK A;  1SRA A;  1SBJ A;  1CM1 A;  1G4Y R;  5HKW A;  1H4B A;  1UHH A;  1QVI Z;  1S6I A;  1YVL A;  2BCX A;  3SIA A;  3TUY B;  5KTY A;  3GK2 A;  1WLZ A;  1JUO A;  2FOT A;  1YVH A;  3CR4 X;  2E6W A;  1F70 A;  3BUO B;  4MZK A;  1LVC D;  2LMU A;  4AOM A;  1DJG A;  2JUL A;  1DJX A;  4ORB B;  4PHK A;  2ZRS A;  1M31 A;  4ZCU A;  2WOR A;  5AEQ A;  1RTP 1;  4XJK A;  2I18 A;  4OKH A;  2HQW A;  2K0J A;  4TNC A;  2I94 A;  2ZN9 A;  5KSZ A;  2I2R E;  1J7O A;  1B4C A;  1XFZ O;  4AQI A;  1HQV A;  3KEV A;  1CDM A;  2LM5 A;  1Y6W A;  1SR6 C;  3DVJ A;  1FBV A;  1KFU L;  3M0W A;  4NDB A;  3EK8 A;  2PRU A;  1IJ6 A;  1QLK A;  2JZI A;  3DVK A;  1BOC A;  1KFX L;  1UP5 A;  4CPV A;  1QIV A;  1YTZ C;  3PAL A;  2LLS A;  2M8U A;  1CTR A;  2B1U A;  3OB1 B;  1BOD A;  4MRY A;  4CLN A;  2F8P A;  1PVA A;  3WNX B;  2HQ8 A;  1SCM C;  2KI6 C;  1EXR A;  1PAL A;  2JT8 A;  3GK4 X;  1XVJ A;  1KK7 Y;  3EVU A;  2KAX A;  3K21 A;  4MEW A;  2MAZ A;  1UHJ A;  2BE4 A;  4M2P A;  4YGB B;  1XFX O;  4UPG A;  4ORC B;  1CMG A;  4WQ3 A;  3I5F C;  2K61 A;  1YX7 A;  2JTT A;  5I2Q A;  2OTG C;  1XK4 C;  1K2H A;  1NUB A;  2PMY A;  1SR6 B;  2Y1N A;  1MF8 B;  1KWO C;  1GGW A;  4YGC B;  2H2K A;  2CXJ A;  1JFK A;  1SL7 A;  3TDZ A;  1QLS A;  4HRE E;  1AHR A;  1B9A A;  3LCP C;  1SK6 D;  2V53 A;  3AKB A;  1UHK A;  3OX6 A;  2ZFD A;  3CTN A;  3NSK A;  1CLL A;  1JFJ A;  4OCI A;  3CR5 X;  1QX7 A;  1S1E A;  3OB2 B;  1GJY A;  1F4O A;  1YUU A;  1V1F A;  3JVT C;  2NLN A;  1SCM B;  2LAN A;  3DF0 B;  2KGR A;  3LK1 A;  1B8R A;  4HRH A;  3WHU B;  1KK7 Z;  3RLZ A;  2LHL A;  5CSF A;  1B47 A;  4ORA B;  2BL0 C;  2KYC A;  1TOP A;  4GNK B;  1GGZ A;  1NCZ A;  1CFD A;  2LE9 B;  1R6P A;  4GPL B;  4I5N B;  4YGD B;  3CGA A;  2CTN A;  4D1E A;  5DKN A;  4JPZ B;  3SJS A;  4JWQ A;  2F33 A;  5D69 A;  1D1O A;  4MBE A;  3OHM B;  2LP3 A;  1KWO B;  1NYA A;  2JC2 A;  3RM1 A;  1MR8 A;  3OP0 A;  5JJG A;  2LCP A;  2MRD A;  4PHJ A;  3MSE B;  1KQV A;  5JOL A;  1F54 A;  1S6J A;  1BU3 A;  1MXL C;  1FW4 A;  1V1G A;  2BKH B;  3OX5 A;  2WC8 A;  2LNK A;  1F4Q A;  3JVT B;  4I5J A;  1EJ3 A;  1MWN A;  4MLW A;  3EK4 A;  1DJZ A;  2PAS A;  1TNP A;  4U8D A;  1DJY A;  1S3P A;  4A4B A;  1BT6 A;  1IRJ A;  1SYM A;  4PHN A;  1IGV A;  2BL0 B;  1AP4 A;  3IQO A;  5K89 A;  1E8A A;  5HKZ A;  1YUS A;  2BBM A;  1M45 A;  3ZWH A;  1A75 A;  1TN4 A;  4GGF A;  1LA0 A;  1AJ5 A;  1J7Q A;  2KAV A;  3BOW B;  1S36 A;  1WLM A;  2F2O A;  2LP2 A;  2P6B B;  1CKK A;  3CLN A;  2LMT A;  3KO0 A;  1S26 D;  4DRW A;  1C7V A;  1K9U A;  2LLT A;  3CR2 A;  1CDP A;  2OPO A;  4NDC A;  1CMF A;  3FIA A;  3I5I C;  3NSI A;  4YI8 A;  4PCW A;  1OMV A;  2KGB C;  4QJ5 B;  5IBW A;  1QJT A;  3A8R A;  2KI6 D;  2FJU B;  1SCV A;  3VRO A;  4YGE B;  4C0J A;  1PSR A;  2EGD A;  4GBA A;  1XFU O;  1EG4 A;  1M39 A;  4CFQ A;  4PHM A;  3SG6 A;  1EH2 A; 
#chains in the Genus database with same CATH topology
 1W9Z A;  4JD9 A;  1YRU B;  2QEH A;  1OOJ A;  3D74 A;  5CSJ A;  2BAP A;  1LIN A;  1JF0 A;  2ERB A;  5AFP A;  4PE7 A;  2K7D A;  5F6T A;  2JNX A;  1J1D A;  4N1G A;  2LAP A;  2NZ0 A;  4HSZ A;  4QJ4 B;  1W7I B;  4A4C A;  3PN7 B;  2LUC A;  2KPH A;  1B1G A;  1C07 A;  2K7C A;  2K60 A;  1UUR A;  2BKI B;  2LC5 A;  3AKA A;  1GQM A;  4ICB A;  4L9M A;  3S0A A;  1DEL A;  3I5G C;  1F55 A;  1LKJ A;  4AQJ A;  1U5I B;  3NSO A;  3I5I B;  2M97 A;  4YBH B;  2MBX A;  2GGZ A;  4F7F A;  3CZT X;  2AUC A;  3VGO A;  2M7L A;  1J7P A;  1XA5 A;  2H61 C;  1K96 A;  1SSE B;  1KK8 C;  1QAS A;  2NCO A;  2PYQ A;  3TDI A;  1NX3 A;  4OVN F;  1A4P A;  2NCP A;  3BUN B;  1K95 A;  1KSM A;  1QIW A;  2EC6 C;  2RGI A;  3D0Y B;  3O2P A;  1KQM C;  1BMO A;  3EK7 A;  3PSR A;  3O78 A;  1WRL A;  3O4Y A;  3VRQ A;  1QX5 B;  1MXE A;  5PAL A;  1K9K A;  2JWW A;  5ER4 X;  4PE0 A;  3B86 A;  2Y4Q A;  5J3X A;  2WOS A;  5HKY A;  3WXA A;  1QS7 A;  3FE6 A;  1F8H A;  4DS7 A;  1Y1A A;  1ODB A;  2QAC A;  4XJK B;  3HX4 A;  2KAY A;  1TCO B;  1SPY A;  1FI5 A;  4MZJ A;  4KYN A;  2JT0 A;  1NCY A;  5HL1 A;  3CZ2 A;  3I5G B;  3QME A;  3BXK A;  1OZO A;  1B7T Y;  1RK9 A;  3NXA A;  1XK4 A;  1K9P A;  2KYF A;  5KU1 A;  1SKT A;  1YRT B;  1CNP A;  2MLE C;  2EHB A;  2WND A;  3DZT A;  4PE1 A;  1KK8 B;  1MUX A;  2JOJ A;  2CCM A;  3N7H A;  2R2I A;  1G8I A;  1OE9 B;  3BUX B;  3SG4 A;  1M63 B;  3CS1 A;  3DYE A;  2EC6 B;  1A2X A;  3KHE A;  2MLF C;  1KQM B;  1NX0 A;  2KQ6 A;  3KPX A;  1CFC A;  2BCB A;  3I5H C;  5D7F A;  4ETO A;  1CDN A;  1QXP A;  1HT9 A;  1Y0V H;  2JU0 A;  1J1E A;  3CYZ A;  1MQ1 A;  2L50 A;  5B8I B;  1BF5 A;  1KFU S;  1PUL A;  2QEO A;  2VRG A;  3BFA A;  3DXL A;  1OMD A;  5TNC A;  4CFR A;  1PRW A;  1CLB A;  2Y1M A;  2JTZ A;  2L51 A;  3CAB A;  2LUX A;  1NP8 A;  1WRZ A;  2ISD A;  3TS5 B;  4DIR A;  1KFX S;  3TZ1 A;  1NCX A;  4PDZ A;  2BBN A;  2KI4 C;  2Q91 A;  2LHI A;  3RZS A;  1TRF A;  1SW8 A;  2L5X B;  2NXQ A;  1OOH A;  2G2B A;  2OS8 B;  1CLM A;  3PFV A;  4MZL A;  4CID A;  1REC A;  1S5G Y;  1QAT A;  4OR9 B;  1EL4 A;  1B7T Z;  2LVI A;  5I8N A;  3JTD C;  1JWD A;  4GGN A;  1CB1 A;  4WQ2 A;  2WC5 A;  1IQ3 A;  2L2C A;  4MN0 A;  3O4X A;  3SG5 A;  1DTL A;  2O5G A;  1RFJ A;  4P5O E;  3NHT A;  1TWO A;  3B88 A;  1IIO A;  1MHO A;  2WCF A;  2WCJ A;  1JSA A;  2KFF A;  3I5H B;  4P2Y B;  2LLU A;  3VRR A;  2QPT A;  4IL1 A;  1YR5 A;  3BQ3 A;  4GUK A;  1QV1 A;  1J7R A;  2D8N A;  5AXI A;  1XYD A;  2ZNE A;  1Y1X A;  2H8V A;  2KQY A;  3D78 A;  5FYX A;  2JXL A;  4DCK A;  2MA2 A;  3OBV A;  3PN7 C;  1Z4H A;  1CFF A;  2ZN8 A;  2QDI A;  2MHH A;  2SAS A;  1AK8 A;  1DVI A;  1BJF A;  2KI4 B;  2L98 A;  2O60 A;  3ICB A;  3IVT A;  3PM8 A;  3PLF B;  3TDU A;  3EVR A;  1DJW A;  1WY9 A;  2IS9 A;  2JQ6 A;  2PVB A;  1S5G Z;  3BUW B;  3JTD B;  2PAL A;  1T14 A;  4INX A;  2PQL A;  3F45 A;  1TUJ A;  2L0P A;  1JBA A;  2KBM A;  1TIZ A;  2M7N A;  3FWC A;  3CZ0 A;  2JRF A;  5CSI A;  4C0L A;  1TCF A;  2K7O A;  4USL A;  4MVF A;  1U5I A;  3DVE A;  1ZOT B;  5GQQ C;  5CPV A;  2AAO A;  4MSP A;  2BE6 A;  3LK0 A;  1DF0 B;  2HF5 A;  1KCY A;  2M0R A;  3H4S E;  3S0D A;  4NDD A;  2K2F A;  1IKU A;  4N5X A;  4INW A;  3NSL A;  2KOT A;  5HLO A;  3D0Y A;  4DUQ A;  1BR4 B;  5EL2 A;  3SIB A;  1K94 A;  2L2E A;  3A4U B;  1B8L A;  1M46 A;  4M2O A;  3SG3 A;  2KFH A;  1DT7 B;  2KNE A;  1NX1 A;  1C7W A;  3C1V A;  1S6C A;  3O6B A;  2Y5I A;  1AUI B;  3D75 A;  3UO9 A;  1A75 B;  3E3R A;  1Y1U A;  4M2Q A;  4IJ7 A;  1R2U A;  4I5L B;  3KF9 A;  1DGU A;  3D10 A;  5I94 A;  1OSA A;  3SG2 A;  5G08 A;  1OMR A;  1FPW A;  3DY9 A;  2KFG A;  1IQ5 A;  3AAK A;  3R72 A;  1IG5 A;  1TNW A;  2KHN A;  1EG3 A;  4GFT A;  1TNX A;  1J55 A;  2A4J A;  3HCM A;  1QV0 A;  1RJV A;  5FI2 A;  2K8M B;  1ALV A;  1SNL A;  3EVV A;  3LL8 B;  3WHT B;  1PVB A;  3BYA A;  3FE8 A;  3CZ1 A;  1YUR A;  2WCB A;  2CBL A;  2M49 B;  2H61 A;  1ZMZ A;  2MJW B;  2TN4 A;  3EG5 B;  1B8C A;  3DF0 A;  4R1E A;  1C3Y A;  4JQ0 D;  1IWQ A;  1DGV A;  4OV2 A;  1CDL A;  1CFP A;  1NPQ A;  2L4H A;  1X02 A;  3S0G A;  1G33 A;  1JC2 A;  5DKR A;  2LV7 A;  2E30 A;  5BPJ A;  1XFW O;  2FCD A;  4FQO A;  3TS5 C;  2M1K B;  2WCE A;  2OS8 C;  2ZND A;  2M3W A;  5DKQ A;  1LA3 A;  2LVV A;  1ALW A;  1TNQ A;  2M29 A;  1L7Z A;  4F0Z B;  5HYD A;  3B87 A;  4YRU A;  3GK1 A;  4PE4 A;  3GOF A;  2WCM A;  3S0E A;  5AAN A;  3AAJ A;  2M9G A;  2GGM A;  1QWV A;  3L4A A;  4N1F A;  1BG1 A;  1IJ5 A;  1DMO A;  4GAO A;  2FCE A;  3FS7 A;  2FJY A;  1WDC C;  2WCK A;  2F3Y A;  2GV5 A;  3IF7 A;  3IQQ A;  2JNF A;  2JT3 A;  2KBI A;  4OZD A;  5AER A;  1A03 A;  1L2O C;  3DD4 A;  3FWB A;  4XYN A;  3CDN A;  1K90 D;  4ZCV A;  2ZRT A;  1ZUZ A;  2LMV A;  4E68 A;  1SMG A;  2PSR A;  1XO5 A;  2LVJ A;  3BFB A;  1CM4 A;  1JF2 A;  2KDH A;  1DJH A;  2WCH A;  1Q80 A;  4YI9 A;  1NX2 A;  4WRI A;  1XFV O;  1WRK A;  1SY9 A;  4C0K A;  2L4I A;  1BLQ A;  5DIC A;  1VRK A;  2KSP A;  3BOW A;  4JKT A;  3EKH A;  1ZFS A;  1UHN A;  4HRG A;  1K8U A;  1UWO A;  3D77 A;  1FF1 A;  5ER5 A;  2Q4U A;  2SCP A;  2P70 A;  5CSN A;  2M1U A;  3PAT A;  2F2P A;  4NQG A;  3B7A A;  3I5F B;  2DOQ A;  1QTX A;  3VRN A;  2K2A A;  2OTG B;  4I5K A;  1ZAC A;  1PK0 D;  1WDC B;  3SS3 A;  2CT9 A;  2G9B A;  4BY5 A;  1SL8 A;  1L2O B;  1FI6 A;  3LLE A;  1NIW A;  1QVI Y;  1OQP A;  1YUT A;  3QRX A;  1N2D A;  1F71 A;  4PAL A;  4MRX A;  3TUY C;  2BCA A;  1TUZ A;  2QEB A;  1YX8 A;  3DVM A;  1OZS A;  3CWG A;  1TTX A;  2JXC A;  1RRO A;  1DF0 A;  1W7J B;  4FTG A;  4YGA A;  1UHI A;  1DC1 A;  1IH0 A;  3SG7 A;  1N65 A;  4GGF C;  1DJI A;  1K93 D;  5I2L A;  1N0Y A;  2HPS A;  1UUS A;  1H8B A;  1AVS A;  2JPO A;  2ZKM X;  2HET A;  1OOG A;  1NWD A;  1RWY A;  1KSO A;  2COL B;  2I7A A;  2BNX A;  2K7B A;  1NSH A;  2KLD A;  3EKJ A;  4FQT A;  4BY4 A;  1AJ4 A;  2AMI A;  3VRP A;  2WC6 A;  4QJ3 B;  1A29 A;  5FI7 A;  2JPT A;  2BEC A;  3NGV A;  1SL9 A;  3BUM B;  3ZNI A;  1XFY O;  2CNP A;  5I2O A;  3S0F A;  3OGN A;  1PSB A;  5HLV A;  1LXF C;  1QX2 A;  2F3Z A;  4Q04 A;  1BR1 B;  2LVK A;  1SRA A;  1SBJ A;  1CM1 A;  1G4Y R;  5HKW A;  1H4B A;  1UHH A;  1QVI Z;  1S6I A;  1YVL A;  2BCX A;  3SIA A;  3TUY B;  5KTY A;  3NHI A;  3GK2 A;  3L4L A;  1WLZ A;  1JUO A;  2FOT A;  1YVH A;  3CR4 X;  2E6W A;  1F70 A;  3BUO B;  4MZK A;  1LVC D;  2LMU A;  4AOM A;  1DJG A;  2JUL A;  1DJX A;  1GM0 A;  4ORB B;  3BJH A;  3S0B A;  4PHK A;  2KLE A;  2ZRS A;  1M31 A;  3FE9 A;  4ZCU A;  2WOR A;  1XFR A;  1RTP 1;  5AEQ A;  4XJK A;  2I18 A;  4OKH A;  2HQW A;  2K0J A;  4TNC A;  2I94 A;  2ZN9 A;  5KSZ A;  2I2R E;  1J7O A;  1B4C A;  1XFZ O;  3R1V A;  1HQV A;  3KEV A;  4AQI A;  1CDM A;  1LS8 A;  2LM5 A;  1Y6W A;  1Z2C B;  1C3Z A;  1ORG A;  1SR6 C;  3DVJ A;  1FBV A;  1KFU L;  3BFH A;  3M0W A;  3SS5 A;  4NDB A;  3EK8 A;  2PRU A;  1IJ6 A;  1QLK A;  2JZI A;  3DVK A;  1BOC A;  1KFX L;  1UP5 A;  3B6X A;  4CPV A;  1QIV A;  1YTZ C;  3PAL A;  2LLS A;  2M8U A;  1CTR A;  2B1U A;  3OB1 B;  1BOD A;  4MRY A;  4CLN A;  2F8P A;  1PVA A;  3WNX B;  2HQ8 A;  1SCM C;  2KI6 C;  1EXR A;  1PAL A;  2JT8 A;  3GK4 X;  1XVJ A;  1KK7 Y;  3EVU A;  2KAX A;  3K21 A;  4MEW A;  2MAZ A;  1UHJ A;  2BE4 A;  4M2P A;  4YGB B;  1XFX O;  4UPG A;  4ORC B;  1CMG A;  4WQ3 A;  3I5F C;  2K61 A;  1YX7 A;  2JTT A;  5I2Q A;  2OTG C;  1XK4 C;  1K2H A;  1NUB A;  2PMY A;  1SR6 B;  2Y1N A;  1MF8 B;  1KWO C;  1GGW A;  4YGC B;  2H2K A;  2CXJ A;  1JFK A;  1SL7 A;  3TDZ A;  1QLS A;  4HRE E;  1AHR A;  1B9A A;  2P71 A;  1SK6 D;  2V53 A;  3AKB A;  3LCP C;  1UHK A;  2YGU A;  3OX6 A;  2ZFD A;  3CTN A;  3NSK A;  3PM2 A;  1CLL A;  1JFJ A;  4OCI A;  3CR5 X;  1QX7 A;  1S1E A;  3OB2 B;  1GJY A;  1F4O A;  1YUU A;  1V1F A;  3JVT C;  2NLN A;  1SCM B;  2LAN A;  3DF0 B;  2KGR A;  3LK1 A;  3V2L A;  1B8R A;  4HRH A;  3WHU B;  1KK7 Z;  3RLZ A;  1OW4 A;  2GTE A;  2LHL A;  5CSF A;  1B47 A;  2QEV A;  2BL0 C;  2KYC A;  1TOP A;  3D73 A;  4ORA B;  4GNK B;  1GGZ A;  1NCZ A;  3R1O A;  1CFD A;  4PT1 A;  2LE9 B;  1DEK A;  1R6P A;  3D76 A;  4GPL B;  4I5N B;  4YGD B;  5FI6 A;  3CGA A;  2CTN A;  4D1E A;  5DKN A;  4JPZ B;  3SJS A;  4JWQ A;  2F33 A;  5D69 A;  1D1O A;  4MBE A;  3OHM B;  2LP3 A;  1KWO B;  1NYA A;  2JC2 A;  3RM1 A;  1MR8 A;  3OP0 A;  5JJG A;  2LCP A;  1P28 A;  2MRD A;  4PHJ A;  3MSE B;  1KQV A;  5JOL A;  1F54 A;  1S6J A;  1BU3 A;  1MXL C;  1FW4 A;  1V1G A;  3VB1 A;  2BKH B;  3OX5 A;  2WC8 A;  2LNK A;  1F4Q A;  3JVT B;  4I5J A;  1EJ3 A;  1MWN A;  4MLW A;  3EK4 A;  1DJZ A;  2PAS A;  1TNP A;  4U8D A;  1DJY A;  5D3O A;  3K1E A;  1S3P A;  4A4B A;  1BT6 A;  1OOI X;  3Q8I A;  2L5Y A;  1IRJ A;  1SYM A;  4PHN A;  1IGV A;  2BL0 B;  1AP4 A;  3SS4 A;  3UNW A;  3IQO A;  5K89 A;  1E8A A;  5HKZ A;  1YUS A;  2BBM A;  1M45 A;  1DQE A;  3ZWH A;  1A75 A;  1TN4 A;  4GGF A;  1LA0 A;  1AJ5 A;  3PJI A;  2KAV A;  3BOW B;  1J7Q A;  1S36 A;  3R1P A;  1WLM A;  2F2O A;  2LP2 A;  2P6B B;  1CKK A;  3CLN A;  2LMT A;  3KO0 A;  1S26 D;  4DRW A;  1C7V A;  1OOF A;  1K9U A;  2LLT A;  3CR2 A;  1CDP A;  2OPO A;  4NDC A;  1CMF A;  3FIA A;  3I5I C;  3NSI A;  4YI8 A;  4PCW A;  1OMV A;  2KGB C;  4QJ5 B;  5IBW A;  1QJT A;  3A8R A;  2KI6 D;  3L47 A;  2FJU B;  1SCV A;  3VRO A;  4YGE B;  4C0J A;  1PSR A;  2EGD A;  4GBA A;  1XFU O;  1EG4 A;  2WCL A;  1M39 A;  4CFQ A;  4PHM A;  3SG6 A;  1EH2 A; 
#chains in the Genus database with same CATH homology
 1YRU B;  1OOJ A;  5CSJ A;  1LIN A;  1JF0 A;  5AFP A;  4PE7 A;  2K7D A;  5F6T A;  2JNX A;  1J1D A;  4N1G A;  2LAP A;  2NZ0 A;  4HSZ A;  4QJ4 B;  1W7I B;  4A4C A;  3PN7 B;  2LUC A;  1B1G A;  1C07 A;  2K7C A;  1UUR A;  2BKI B;  2LC5 A;  3AKA A;  1GQM A;  4ICB A;  4L9M A;  3I5G C;  1F55 A;  1LKJ A;  4AQJ A;  1U5I B;  3NSO A;  3I5I B;  2M97 A;  4YBH B;  2MBX A;  2GGZ A;  3CZT X;  2AUC A;  3VGO A;  2M7L A;  1J7P A;  1XA5 A;  2H61 C;  1K96 A;  1KK8 C;  1QAS A;  2NCO A;  3TDI A;  1NX3 A;  4OVN F;  1A4P A;  2NCP A;  3BUN B;  1K95 A;  1KSM A;  1QIW A;  2EC6 C;  2RGI A;  3D0Y B;  3O2P A;  1KQM C;  1BMO A;  3EK7 A;  3PSR A;  3O78 A;  1WRL A;  3O4Y A;  3VRQ A;  1QX5 B;  1MXE A;  5PAL A;  1K9K A;  2JWW A;  5ER4 X;  4PE0 A;  2Y4Q A;  5J3X A;  2WOS A;  5HKY A;  3WXA A;  1QS7 A;  1F8H A;  4DS7 A;  1Y1A A;  1ODB A;  2QAC A;  4XJK B;  3HX4 A;  2KAY A;  1TCO B;  1SPY A;  1FI5 A;  4MZJ A;  2JT0 A;  1NCY A;  3I5G B;  3BXK A;  1OZO A;  1B7T Y;  1RK9 A;  3NXA A;  1XK4 A;  1K9P A;  2KYF A;  5KU1 A;  1SKT A;  1YRT B;  1CNP A;  2MLE C;  2EHB A;  2WND A;  4PE1 A;  1KK8 B;  1MUX A;  2JOJ A;  2CCM A;  2R2I A;  1G8I A;  1OE9 B;  3BUX B;  3SG4 A;  1M63 B;  3CS1 A;  2EC6 B;  1A2X A;  3KHE A;  2MLF C;  1KQM B;  1NX0 A;  2KQ6 A;  3KPX A;  1CFC A;  2BCB A;  3I5H C;  5D7F A;  4ETO A;  1CDN A;  1QXP A;  1HT9 A;  1Y0V H;  2JU0 A;  1J1E A;  5B8I B;  1MQ1 A;  2L50 A;  1BF5 A;  1KFU S;  1PUL A;  2VRG A;  1CLB A;  1OMD A;  5TNC A;  4CFR A;  1PRW A;  2Y1M A;  2JTZ A;  2L51 A;  2LUX A;  1NP8 A;  1WRZ A;  2ISD A;  3TS5 B;  4DIR A;  1KFX S;  3TZ1 A;  1NCX A;  4PDZ A;  2BBN A;  2KI4 C;  2Q91 A;  2LHI A;  1TRF A;  1SW8 A;  2L5X B;  2NXQ A;  2OS8 B;  2G2B A;  3PFV A;  1CLM A;  4MZL A;  4CID A;  1REC A;  1S5G Y;  1QAT A;  4OR9 B;  1EL4 A;  1B7T Z;  2LVI A;  5I8N A;  3JTD C;  1JWD A;  4GGN A;  1CB1 A;  4WQ2 A;  1IQ3 A;  4MN0 A;  3SG5 A;  1DTL A;  2O5G A;  1RFJ A;  4P5O E;  1MHO A;  2WCF A;  1JSA A;  2KFF A;  3I5H B;  4P2Y B;  2LLU A;  3VRR A;  2QPT A;  4IL1 A;  1YR5 A;  3BQ3 A;  4GUK A;  1QV1 A;  1J7R A;  2D8N A;  5AXI A;  1XYD A;  2ZNE A;  1Y1X A;  2KQY A;  5FYX A;  2JXL A;  4DCK A;  2MA2 A;  3PN7 C;  1CFF A;  2ZN8 A;  2MHH A;  2SAS A;  1AK8 A;  1DVI A;  1BJF A;  2KI4 B;  2L98 A;  2O60 A;  3ICB A;  3PM8 A;  3PLF B;  3TDU A;  3EVR A;  1DJW A;  1WY9 A;  2IS9 A;  2JQ6 A;  2PVB A;  1S5G Z;  3BUW B;  3JTD B;  2PAL A;  3F45 A;  2L0P A;  1JBA A;  2KBM A;  1TIZ A;  2M7N A;  3FWC A;  2JRF A;  5CSI A;  4C0L A;  1TCF A;  2K7O A;  4USL A;  4MVF A;  1U5I A;  3DVE A;  1ZOT B;  5GQQ C;  5CPV A;  2AAO A;  4MSP A;  2BE6 A;  3LK0 A;  1DF0 B;  2HF5 A;  1KCY A;  2M0R A;  3H4S E;  4NDD A;  2K2F A;  1IKU A;  4N5X A;  3NSL A;  2KOT A;  5HLO A;  3D0Y A;  4DUQ A;  1BR4 B;  3SIB A;  1K94 A;  2L2E A;  3A4U B;  1B8L A;  1M46 A;  4M2O A;  3SG3 A;  2KFH A;  1DT7 B;  2KNE A;  1NX1 A;  1C7W A;  3C1V A;  1S6C A;  3O6B A;  2Y5I A;  1AUI B;  1A75 B;  3E3R A;  1Y1U A;  4M2Q A;  1R2U A;  4I5L B;  3KF9 A;  1DGU A;  3D10 A;  1OSA A;  3SG2 A;  5G08 A;  1OMR A;  1FPW A;  2KFG A;  1IQ5 A;  3AAK A;  1IG5 A;  1TNW A;  2KHN A;  1EG3 A;  4GFT A;  1TNX A;  1J55 A;  2A4J A;  3HCM A;  1QV0 A;  1RJV A;  2K8M B;  1ALV A;  1SNL A;  3EVV A;  3LL8 B;  3WHT B;  1PVB A;  3BYA A;  1YUR A;  2WCB A;  2CBL A;  2M49 B;  2H61 A;  1ZMZ A;  2MJW B;  2TN4 A;  1B8C A;  3DF0 A;  4R1E A;  4JQ0 D;  1IWQ A;  1DGV A;  4OV2 A;  1CDL A;  1CFP A;  1NPQ A;  2L4H A;  1X02 A;  1JC2 A;  1G33 A;  5DKR A;  2LV7 A;  2E30 A;  5BPJ A;  1XFW O;  2FCD A;  4FQO A;  3TS5 C;  2M1K B;  2WCE A;  2OS8 C;  2ZND A;  2M3W A;  5DKQ A;  1LA3 A;  2LVV A;  1ALW A;  1TNQ A;  2M29 A;  1L7Z A;  4F0Z B;  5HYD A;  4YRU A;  3GK1 A;  4PE4 A;  3GOF A;  5AAN A;  3AAJ A;  2M9G A;  2GGM A;  4N1F A;  1BG1 A;  1IJ5 A;  1DMO A;  4GAO A;  2FCE A;  3FS7 A;  1WDC C;  2F3Y A;  2GV5 A;  3IF7 A;  3IQQ A;  2JNF A;  2JT3 A;  2KBI A;  1A03 A;  5AER A;  1L2O C;  3DD4 A;  3FWB A;  4XYN A;  1K90 D;  4ZCV A;  2ZRT A;  1ZUZ A;  2LMV A;  4E68 A;  1SMG A;  2PSR A;  1XO5 A;  2LVJ A;  1CM4 A;  1JF2 A;  2KDH A;  1DJH A;  1Q80 A;  4YI9 A;  1NX2 A;  4WRI A;  1XFV O;  1WRK A;  1SY9 A;  4C0K A;  2L4I A;  1BLQ A;  1VRK A;  2KSP A;  3BOW A;  3EKH A;  1ZFS A;  1UHN A;  4HRG A;  1K8U A;  1UWO A;  1FF1 A;  5ER5 A;  2Q4U A;  2SCP A;  5CSN A;  2M1U A;  3PAT A;  2F2P A;  4NQG A;  3VRN A;  3I5F B;  2DOQ A;  1QTX A;  2K2A A;  2OTG B;  4I5K A;  1ZAC A;  1PK0 D;  1WDC B;  2CT9 A;  2G9B A;  4BY5 A;  1SL8 A;  1L2O B;  1FI6 A;  3LLE A;  1NIW A;  1QVI Y;  1OQP A;  1YUT A;  3QRX A;  1N2D A;  1F71 A;  4PAL A;  4MRX A;  3TUY C;  2BCA A;  1YX8 A;  3DVM A;  1OZS A;  3CWG A;  1TTX A;  2JXC A;  1RRO A;  1DF0 A;  1W7J B;  4FTG A;  4YGA A;  1UHI A;  1IH0 A;  3SG7 A;  1N65 A;  4GGF C;  1DJI A;  1K93 D;  5I2L A;  1N0Y A;  2HPS A;  1UUS A;  1H8B A;  1AVS A;  2ZKM X;  2HET A;  1NWD A;  1RWY A;  1KSO A;  2COL B;  2I7A A;  2K7B A;  3EKJ A;  1NSH A;  4BY4 A;  1AJ4 A;  2AMI A;  3VRP A;  4QJ3 B;  1A29 A;  2JPT A;  2BEC A;  1SL9 A;  3BUM B;  3ZNI A;  1XFY O;  2CNP A;  5I2O A;  1PSB A;  5HLV A;  1LXF C;  1QX2 A;  2F3Z A;  4Q04 A;  1BR1 B;  2LVK A;  1SRA A;  1SBJ A;  1CM1 A;  1G4Y R;  5HKW A;  1H4B A;  1UHH A;  1QVI Z;  1S6I A;  1YVL A;  2BCX A;  3SIA A;  3TUY B;  5KTY A;  3GK2 A;  1WLZ A;  1JUO A;  2FOT A;  1YVH A;  3CR4 X;  2E6W A;  1F70 A;  3BUO B;  4MZK A;  1LVC D;  2LMU A;  4AOM A;  1DJG A;  2JUL A;  1DJX A;  4ORB B;  4PHK A;  2ZRS A;  1M31 A;  4ZCU A;  2WOR A;  5AEQ A;  1RTP 1;  4XJK A;  2I18 A;  4OKH A;  2HQW A;  2K0J A;  4TNC A;  2I94 A;  2ZN9 A;  5KSZ A;  2I2R E;  1J7O A;  1B4C A;  1XFZ O;  4AQI A;  1HQV A;  3KEV A;  1CDM A;  2LM5 A;  1Y6W A;  1SR6 C;  3DVJ A;  1FBV A;  1KFU L;  3M0W A;  4NDB A;  3EK8 A;  2PRU A;  1IJ6 A;  1QLK A;  2JZI A;  3DVK A;  1BOC A;  1KFX L;  1UP5 A;  4CPV A;  1QIV A;  1YTZ C;  3PAL A;  2LLS A;  2M8U A;  1CTR A;  2B1U A;  3OB1 B;  1BOD A;  4MRY A;  4CLN A;  2F8P A;  1PVA A;  3WNX B;  2HQ8 A;  1SCM C;  2KI6 C;  1EXR A;  1PAL A;  2JT8 A;  3GK4 X;  1XVJ A;  1KK7 Y;  3EVU A;  2KAX A;  3K21 A;  4MEW A;  2MAZ A;  1UHJ A;  2BE4 A;  4M2P A;  4YGB B;  1XFX O;  4UPG A;  4ORC B;  1CMG A;  4WQ3 A;  3I5F C;  2K61 A;  1YX7 A;  2JTT A;  5I2Q A;  2OTG C;  1XK4 C;  1K2H A;  1NUB A;  2PMY A;  1SR6 B;  2Y1N A;  1MF8 B;  1KWO C;  1GGW A;  4YGC B;  2H2K A;  2CXJ A;  1JFK A;  1SL7 A;  3TDZ A;  1QLS A;  4HRE E;  1AHR A;  1B9A A;  3LCP C;  1SK6 D;  2V53 A;  3AKB A;  1UHK A;  3OX6 A;  2ZFD A;  3CTN A;  3NSK A;  1CLL A;  1JFJ A;  4OCI A;  3CR5 X;  1QX7 A;  1S1E A;  3OB2 B;  1GJY A;  1F4O A;  1YUU A;  1V1F A;  3JVT C;  2NLN A;  1SCM B;  2LAN A;  3DF0 B;  2KGR A;  3LK1 A;  1B8R A;  4HRH A;  3WHU B;  1KK7 Z;  3RLZ A;  2LHL A;  5CSF A;  1B47 A;  4ORA B;  2BL0 C;  2KYC A;  1TOP A;  4GNK B;  1GGZ A;  1NCZ A;  1CFD A;  2LE9 B;  1R6P A;  4GPL B;  4I5N B;  4YGD B;  3CGA A;  2CTN A;  4D1E A;  5DKN A;  4JPZ B;  3SJS A;  4JWQ A;  2F33 A;  5D69 A;  1D1O A;  4MBE A;  3OHM B;  2LP3 A;  1KWO B;  1NYA A;  2JC2 A;  3RM1 A;  1MR8 A;  3OP0 A;  5JJG A;  2LCP A;  2MRD A;  4PHJ A;  3MSE B;  1KQV A;  5JOL A;  1F54 A;  1S6J A;  1BU3 A;  1MXL C;  1FW4 A;  1V1G A;  2BKH B;  3OX5 A;  2WC8 A;  2LNK A;  1F4Q A;  3JVT B;  4I5J A;  1EJ3 A;  1MWN A;  4MLW A;  3EK4 A;  1DJZ A;  2PAS A;  1TNP A;  4U8D A;  1DJY A;  1S3P A;  4A4B A;  1BT6 A;  1IRJ A;  1SYM A;  4PHN A;  1IGV A;  2BL0 B;  1AP4 A;  3IQO A;  5K89 A;  1E8A A;  5HKZ A;  1YUS A;  2BBM A;  1M45 A;  3ZWH A;  1A75 A;  1TN4 A;  4GGF A;  1LA0 A;  1AJ5 A;  1J7Q A;  2KAV A;  3BOW B;  1S36 A;  1WLM A;  2F2O A;  2LP2 A;  2P6B B;  1CKK A;  3CLN A;  2LMT A;  3KO0 A;  1S26 D;  4DRW A;  1C7V A;  1K9U A;  2LLT A;  3CR2 A;  1CDP A;  2OPO A;  4NDC A;  1CMF A;  3FIA A;  3I5I C;  3NSI A;  4YI8 A;  4PCW A;  1OMV A;  2KGB C;  4QJ5 B;  5IBW A;  1QJT A;  3A8R A;  2KI6 D;  2FJU B;  1SCV A;  3VRO A;  4YGE B;  4C0J A;  1PSR A;  2EGD A;  4GBA A;  1XFU O;  1EG4 A;  1M39 A;  4CFQ A;  4PHM A;  3SG6 A;  1EH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...