4F0ZB

Crystal structure of calcineurin in complex with the calcineurin-inhibiting domain of the african swine fever virus protein a238l
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
155
structure length
155
Chain Sequence
YPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit al
publication title The molecular mechanism of substrate engagement and immunosuppressant inhibition of calcineurin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 58
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4f0zB00
3F45A 1NUBA 1RECA 3I5GC 1AUIB 1WDCB 1YVHA 3I5FB 1CLBA 4CLNA 1L7ZA 3GK1A 2ZNEA 1Y0VH 2BBNA 1WY9A 4MVFA 1F70A 1Q80A 2LLSA 3KF9A 2H2KA 3A8RA 3HCMA 1QIVA 5KU1A 2JOJA 1JWDA 3SG2A 2LCPA 4R1EA 3BYAA 2Q4UA 1K93D 3FWBA 3FWCA 5CPVA 5JJGA 2G2BA 2NCPA 1CB1A 2LVIA 4TNCA 1QX2A 1WRKA 2BKHB 1TCFA 2F3ZA 1BU3A 1SNLA 1BODA 1SCMC 4OKHA 3D0YB 3O78A 5ER5A 1J1EA 3SIAA 2HPSA 2JC2A 1NCYA 2I2RE 1KK8B 1XFUO 2MBXA 3GK4X 2BBMA 1GQMA 1LKJA 1CKKA 1OMDA 3ZWHA 1DT7B 1MWNA 2JPTA 1Y1UA 2EHBA 4PE4A 5HKZA 3EK4A 1TNQA 1RTP1 3PM8A 4AQJA 3AAKA 2SCPA 2E30A 1FPWA 3VGOA 4QJ5B 1KWOB 1S5GZ 1K9UA 4AQIA 1MF8B 2GGZA 1WDCC 3I5FC 2ISDA 4CFRA 1CMFA 1IJ5A 1IJ6A 2Y4QA 1JFKA 1GJYA 2M49B 3I5IB 1KK7Z 1YUTA 3DF0B 4NDBA 2Y5IA 2LV7A 2F33A 4PE0A 1K8UA 2OTGB 1CLLA 5HKYA 3NXAA 1S6IA 3CWGA 4HREE 1F54A 1HQVA 1ZACA 5D7FA 1BLQA 3SG7A 5G08A 1SPYA 3TDZA 1A75B 2L50A 1NPQA 5FYXA 2Y1NA 1KK8C 2DOQA 2ZFDA 3E3RA 3ICBA 3NSLA 4M2OA 4MSPA 3WHTB 4CPVA 1A4PA 1WRZA 4XJKB 1YUSA 3SIBA 1KQVA 1G33A 1KWOC 3PN7B 1DJYA 1YRTB 4PHMA 1UHKA 4XYNA 2OS8B 1QX7A 1OOJA 1QTXA 1W7JB 2O5GA 4NDDA 3I5IC 1XK4C 2KI6C 1JF0A 2MHHA 3LLEA 1YX7A 2G9BA 3VROA 2JTTA 2OTGC 3NSOA 1J55A 1QJTA 4C0LA 5GQQC 2LM5A 5B8IB 3EVUA 5ER4X 1X02A 4MN0A 2L5XB 3BQ3A 2JU0A 3CR2A 1RROA 2L4IA 1PVBA 4BY4A 5KTYA 1JBAA 1N2DA 1Y1AA 1FI6A 3TDUA 2KDHA 1S3PA 2KAYA 1EH2A 3RLZA 4IL1A 1K96A 1OE9B 2F2PA 1QIWA 4ZCUA 1EL4A 2KFGA 3BOWB 1AJ5A 4PALA 3PN7C 2V53A 1JC2A 1JF2A 4MRYA 2QACA 3VRQA 2OS8C 3I5HB 1XFZO 1QATA 1QVIY 2K7CA 2OPOA 1BJFA 2KSPA 1IGVA 1SKTA 2PMYA 4Q04A 1Y6WA 1B8LA 2JNXA 1SR6B 1OZSA 1SCVA 1XK4A 4N1GA 1SBJA 3DF0A 1UP5A 3TDIA 2NLNA 2M1UA 4QJ3B 1CLMA 1B1GA 1DGVA 1K9PA 2GGMA 5PALA 1BT6A 1NP8A 3M0WA 2K2AA 4I5LB 1NCXA 1NSHA 1ZFSA 4YRUA 2LLUA 4MEWA 1PULA 3BXKA 1DF0B 2KI6D 4HRHA 1FF1A 1A75A 1LA3A 3JTDC 4GPLB 1S6CA 3OB2B 2WCBA 1EG4A 1K2HA 1N65A 1B7TZ 1IG5A 1CM1A 1S26D 4MZKA 4XJKA 1VRKA 2KHNA 2SASA 4AOMA 1A03A 5HKWA 4ORCB 4YGBB 1EJ3A 5I2QA 1DGUA 3I5HC 4HSZA 1W7IB 2COLB 2H61C 2CCMA 3SG3A 2K7BA 4DRWA 1S36A 2O60A 1JFJA 2LP2A 2KAXA 4MBEA 1SR6C 5I8NA 4USLA 2K2FA 4BY5A 3EVVA 3VRRA 1PSRA 1F8HA 4OV2A 2I7AA 1QLKA 1QX5B 1TNWA 3OB1B 1XO5A 2R2IA 3D10A 3PFVA 1A2XA 5AXIA 3IF7A 3GK2A 2FCDA 1SL9A 4A4BA 1IRJA 1EXRA 3K21A 4N5XA 2KFHA 4ORBB 1XA5A 3IQQA 1J7OA 2A4JA 2JTZA 5AEQA 2WCEA 1XFYO 4DIRA 1ZOTB 5HLVA 1CDNA 2JZIA 2L0PA 2JT0A 2KNEA 3BOWA 1ALWA 1DTLA 1BG1A 5I2LA 2KYCA 1AP4A 2PSRA 1CDPA 1SMGA 3HX4A 4WQ2A 5AERA 1R6PA 1XYDA 1BR4B 3DD4A 1NX2A 2LANA 2RGIA 1CM4A 1KCYA 2H61A 4M2QA 5DKQA 4CIDA 1NX1A 1SYMA 4L9MA 1NCZA 3AKAA 4PHJA 1YURA 4GFTA 3LCPC 2F3YA 2E6WA 2LVVA 2NCOA 4OCIA 1LA0A 1N0YA 1LVCD 1CNPA 1U5IB 1S5GY 4PE1A 2ZNDA 1NWDA 3PLFB 2JNFA 4YGAA 4GGFC 2LNKA 4D1EA 2QPTA 1SW8A 2L51A 4GAOA 3TUYB 3CZTX 1KK7Y 4ETOA 3JVTB 2M8UA 2EC6B 3WNXB 2KGBC 1CDLA 2MRDA 3DVKA 1DF0A 1QASA 4JPZB 1M39A 4NDCA 1C7WA 4I5JA 1NYAA 2JT3A 1MR8A 1B8RA 2KGRA 2P6BB 2JXLA 1K9KA 1UWOA 2M1KB 1BOCA 1LXFC 1B4CA 1KFUS 2BCAA 1L2OB 2BE4A 1F55A 2HQWA 3CGAA 2Y1MA 1M63B 3BUXB 2FCEA 2WORA 1XFWO 1CTRA 1DJGA 5CSNA 1TNPA 4YGDB 1C7VA 2MLFC 2PALA 2M7LA 1AK8A 1UUSA 3D0YA 4I5NB 1ZUZA 3TUYC 1YVLA 3RM1A 5HYDA 2K7DA 1J7RA 3JVTC 3O2PA 2EC6C 2KI4B 4DCKA 1TIZA 4GGFA 2KQ6A 1V1FA 1MHOA 1KFUL 1QXPA 2I94A 1CDMA 4PDZA 2K7OA 1J7PA 1YR5A 3CLNA 1YTZC 4M2PA 3KEVA 3MSEB 2CBLA 1UHJA 1DJXA 1L2OC 2MLEC 1TRFA 1CFPA 4ICBA 1PVAA 1RFJA 1TN4A 2M7NA 4C0KA 1UHNA 1M31A 1YRUB 3NSKA 3O6BA 3LL8B 1MXEA 2CTNA 1FBVA 1IH0A 1MQ1A 1H8BA 3AKBA 3NSIA 3OX6A 2LVJA 3KHEA 2JRFA 1PK0D 1OMVA 2BECA 1U5IA 1IWQA 3FS7A 3WXAA 1TTXA 2PVBA 3ZNIA 1IKUA 1XFXO 4OVNF 2JXCA 1KQMB 1J1DA 2EGDA 5CSFA 3SG5A 3DVJA 2L98A 2ZRTA 3CTNA 2LUXA 3EK8A 2LHIA 2KBMA 2PASA 1OMRA 1TCOB 1B8CA 4WQ3A 1SL7A 2LVKA 3EKJA 3EKHA 1CMGA 1G4YR 2NZ0A 5BPJA 1PALA 2KQYA 2MAZA 5DKRA 2JT8A 2FOTA 1BF5A 4CFQA 1B7TY 3KO0A 4MZLA 4ORAB 3SG6A 2KAVA 4N1FA 3O4YA 1AHRA 2M29A 5AFPA 1KFXS 3TS5B 1A29A 1M45A 4HRGA 2K0JA 1F4OA 1AJ4A 2NXQA 4P5OE 2K8MB 5F6TA 2ZN9A 4E68A 2CNPA 1DMOA 3GOFA 1K94A 1WLZA 1KQMC 2K61A 1DJZA 3FIAA 4YGEB 1PSBA 1H4BA 1IQ5A 1AVSA 1OZOA 2KYFA 3BUOB 1QV0A 1GGZA 1G8IA 3LK0A 4C0JA 4DUQA 2BCXA 2LC5A 3EK7A 4ZCVA 3OX5A 1SRAA 2VRGA 5CSJA 4YI8A 1KFXL 3SJSA 4UPGA 1MUXA 1DJWA 2ZKMX 2F8PA 4GUKA 4F0ZB 1TOPA 1B9AA 5KSZA 3DVMA 3QRXA 2BE6A 1UURA 3CR5X 2LMUA 5D69A 3BUWB 2F2OA 1B47A 3TZ1A 1ALVA 4QJ4B 3CR4X 3TS5C 4MLWA 5JOLA 1RWYA 1BMOA 4GBAA 4NQGA 2ZRSA 2JQ6A 1DVIA 4YBHB 4DS7A 1QV1A 1YUUA 3WHUB 4MZJA 1D1OA 4YGCB 3CS1A 2L2EA 3BUNB 3VRPA 2JWWA 1C07A 2M9GA 2Q91A 1OSAA 3IQOA 2PRUA 2AMIA 2BL0B 5J3XA 1LINA 1R2UA 2CT9A 1PRWA 4PHNA 1F71A 3DVEA 2LUCA 4A4CA 1ODBA 3AAJA 5DKNA 2L4HA 2LE9B 2M97A 2MA2A 3OHMB 2HQ8A 2GV5A 3BUMB 5IBWA 1FI5A 4GGNA 2HF5A 2CXJA 2LP3A 3PATA 2HETA 1JSAA 1CFCA 3KPXA 1RJVA 1KSOA 1MXLC 2KFFA 4PE7A 2AAOA 4FTGA 2KBIA 4PCWA 1KSMA 2MJWB 1DJIA 2ZN8A 1RK9A 1ZMZA 2LHLA 5TNCA 1QS7A 2WOSA 1QVIZ 1K90D 2I18A 3OP0A 5K89A 1CFFA 3A4UB 1NX3A 2BL0C 2IS9A 1Y1XA 2LMVA 4I5KA 4JQ0D 1IQ3A 1EG3A 4PHKA 5AANA 2FJUB 3VRNA 2JULA 1S6JA 3JTDB 2KOTA 4GNKB 2M3WA 4MRXA 1SL8A 3I5GB 1GGWA 1YX8A 1SY9A 1M46A 2LMTA 4FQOA 1SK6D 4P2YB 4WRIA 1CFDA 1TNXA 1OQPA 1BR1B 1JUOA 2AUCA 4YI9A 2D8NA 2KI4C 1NIWA 3PSRA 1K95A 5I2OA 2BKIB 1HT9A 5HLOA 2B1UA 1QLSA 4U8DA 2M0RA 1V1GA 3SG4A 1SCMB 1XFVO 1FW4A 1WRLA 1S1EA 2LAPA 1NX0A 2BCBA 1XVJA 1WLMA 1DJHA 2WC8A 3H4SE 2LLTA 2WCFA 3PALA 1E8AA 4JWQA 1UHIA 5CSIA 3EVRA 1J7QA 2TN4A 1UHHA 3LK1A 3C1VA 4OR9B 1F4QA 2WNDA
chains in the Genus database with same CATH superfamily
3F45A 1NUBA 1RECA 3I5GC 1AUIB 3O4XA 1WDCB 1YVHA 2KLDA 3D76A 3I5FB 4CLNA 1L7ZA 3GK1A 2ZNEA 2WCKA 1Y0VH 2BBNA 1WY9A 4MVFA 1F70A 1Q80A 2LLSA 3KF9A 2H2KA 3A8RA 3HCMA 1QIVA 5KU1A 2JOJA 1JWDA 3SG2A 2LCPA 4R1EA 3BYAA 2Q4UA 1K93D 3FWBA 3FWCA 5CPVA 5JJGA 2G2BA 2NCPA 3S0EA 3DYEA 1CB1A 2LVIA 4TNCA 1QX2A 1WRKA 2BKHB 1TCFA 2F3ZA 1BU3A 1SNLA 2PYQA 1BODA 1SCMC 4OKHA 3D0YB 3O78A 5ER5A 1J1EA 3SIAA 2HPSA 2JC2A 1NCYA 2I2RE 1KK8B 1XFUO 2MBXA 3GK4X 2BBMA 1GQMA 1LKJA 1CKKA 1OMDA 3ZWHA 1DT7B 1MWNA 2JPTA 1Y1UA 2EHBA 4PE4A 5HKZA 3EK4A 1TNQA 1RTP1 3PM8A 4AQJA 3AAKA 2SCPA 2E30A 3DZTA 1FPWA 3VGOA 4QJ5B 1KWOB 1S5GZ 1K9UA 4AQIA 2PQLA 1MF8B 2GGZA 1WDCC 2ERBA 3I5FC 2ISDA 4CFRA 1CMFA 1IJ5A 1IJ6A 2P70A 2Y4QA 1JFKA 1GJYA 2M49B 3I5IB 1KK7Z 1YUTA 3DF0B 4NDBA 2Y5IA 2LV7A 2F33A 4PE0A 1K8UA 2OTGB 1CLLA 5HKYA 3NXAA 1S6IA 3CWGA 4HREE 1F54A 1HQVA 1ZACA 2L5YA 5D7FA 1BLQA 3SG7A 5G08A 1SPYA 3TDZA 3NHTA 1A75B 2L50A 1NPQA 5FYXA 2Y1NA 1KK8C 2DOQA 2ZFDA 3E3RA 3ICBA 3NSLA 4M2OA 4MSPA 3WHTB 4CPVA 1A4PA 1WRZA 4XJKB 1YUSA 3D73A 3SIBA 3S0AA 1KQVA 1G33A 1OOGA 1KWOC 3PN7B 1DJYA 1YRTB 4PHMA 1UHKA 4XYNA 2OS8B 1QX7A 1OOJA 1QTXA 1W7JB 2O5GA 4NDDA 3I5IC 1XK4C 2KI6C 1JF0A 2MHHA 3LLEA 1YX7A 2G9BA 3VROA 2JTTA 2OTGC 3NSOA 1J55A 1QJTA 4C0LA 5GQQC 2LM5A 3L47A 5B8IB 1W9ZA 3EVUA 5ER4X 1X02A 4MN0A 2L5XB 3BQ3A 2JU0A 3CR2A 1RROA 2L4IA 1PVBA 4BY4A 5KTYA 1JBAA 1N2DA 1Y1AA 1FI6A 3TDUA 2KDHA 1S3PA 2KAYA 1EH2A 3RLZA 4IL1A 1K96A 1OE9B 2F2PA 1QIWA 4ZCUA 1EL4A 2KFGA 3S0FA 3L4AA 3BOWB 1AJ5A 4PALA 3PN7C 2V53A 3CABA 5DICA 1JC2A 1JF2A 2KPHA 4MRYA 2GTEA 2QACA 3VRQA 2OS8C 3I5HB 1XFZO 1QATA 1QVIY 2K7CA 2OPOA 1BJFA 2KSPA 1IGVA 1SKTA 2PMYA 4Q04A 1Y6WA 1B8LA 2JNXA 5HL1A 1SR6B 1OZSA 1SCVA 1XK4A 4N1GA 1SBJA 3DF0A 1UP5A 3TDIA 2NLNA 2M1UA 4QJ3B 3SS3A 1CLMA 1SSEB 3BFAA 1B1GA 1DGVA 1K9PA 2GGMA 5PALA 1BT6A 1NP8A 3M0WA 2K2AA 3CZ0A 1NCXA 4I5LB 1NSHA 1ZFSA 1GM0A 4YRUA 2LLUA 4MEWA 1PULA 3BXKA 1DF0B 2KI6D 1CLBA 4HRHA 1FF1A 1A75A 1LA3A 3JTDC 4GPLB 1S6CA 3OB2B 2WCBA 1EG4A 1K2HA 1N65A 1B7TZ 1IG5A 1CM1A 1S26D 4MZKA 4XJKA 1VRKA 2KHNA 2SASA 3D75A 4AOMA 1A03A 3NHIA 5HKWA 4ORCB 4YGBB 1EJ3A 5I2QA 1DGUA 3I5HC 4HSZA 1W7IB 2COLB 2H61C 2CCMA 3SG3A 2K7BA 4DRWA 1S36A 2O60A 1JFJA 2LP2A 2KAXA 4MBEA 1SR6C 5I8NA 4USLA 2K2FA 4BY5A 3EVVA 3VRRA 1PSRA 1F8HA 4OV2A 3CDNA 1OOFA 3FE9A 2I7AA 1QLKA 1QX5B 1TNWA 3OB1B 1XO5A 2R2IA 3D10A 3PFVA 1A2XA 5AXIA 3IF7A 3GK2A 2FCDA 1SL9A 4A4BA 1IRJA 1EXRA 2WC5A 3K21A 4N5XA 2KFHA 4ORBB 1XA5A 3IQQA 1J7OA 2A4JA 2JTZA 5AEQA 2WCEA 1XFYO 4DIRA 1ZOTB 5HLVA 2WCLA 5EL2A 1CDNA 2JZIA 2L0PA 2JT0A 2KNEA 3BOWA 1ALWA 1DTLA 1BG1A 5I2LA 2KYCA 1AP4A 2PSRA 1CDPA 1SMGA 3HX4A 4WQ2A 5AERA 1R6PA 1XYDA 1BR4B 3DD4A 1NX2A 2LANA 2RGIA 1CM4A 1KCYA 2H61A 4M2QA 5DKQA 4CIDA 1NX1A 1SYMA 2QEOA 4L9MA 1NCZA 3AKAA 4PHJA 1YURA 4GFTA 3LCPC 2F3YA 2E6WA 2LVVA 2NCOA 4OCIA 1LA0A 1N0YA 1LVCD 1CNPA 1U5IB 1S5GY 4PE1A 2ZNDA 1NWDA 3PLFB 2JNFA 4YGAA 4GGFC 2LNKA 4D1EA 2QPTA 1SW8A 2L51A 4GAOA 3CZ2A 4OZDA 3TUYB 3CZTX 1KK7Y 4ETOA 3JVTB 2M8UA 2EC6B 3WNXB 2H8VA 2KGBC 1CDLA 2MRDA 3DVKA 1DF0A 1QASA 4JPZB 3SS5A 1M39A 1DELA 4NDCA 1C7WA 4I5JA 1NYAA 2JT3A 1MR8A 1B8RA 2KGRA 3L4LA 2P6BB 3S0BA 3K1EA 2JXLA 1K9KA 1UWOA 2M1KB 3D77A 1LXFC 1B4CA 1BOCA 1KFUS 2BCAA 1L2OB 2BE4A 1F55A 2HQWA 3CGAA 2Y1MA 3NGVA 5D3OA 3QMEA 1M63B 3BUXB 2FCEA 2WORA 1XFWO 1CTRA 3B6XA 1DJGA 5CSNA 1TNPA 4YGDB 1C7VA 2MLFC 2PALA 2M7LA 1AK8A 1UUSA 3D0YA 4I5NB 1ZUZA 4JKTA 3TUYC 1YVLA 3RM1A 5HYDA 2K7DA 1J7RA 3JVTC 3O2PA 2EC6C 2KI4B 3D74A 3R1VA 1TIZA 4GGFA 4DCKA 2KQ6A 1V1FA 1MHOA 1KFUL 1QXPA 2I94A 1CDMA 1ORGA 3S0DA 4PDZA 3B87A 2K7OA 2KLEA 1J7PA 3DXLA 4F7FA 1YR5A 3CLNA 1YTZC 4M2PA 3BJHA 3PM2A 1OW4A 3KEVA 3MSEB 2CBLA 1UHJA 1DJXA 1L2OC 2MLEC 1TRFA 3EG5B 1CFPA 4ICBA 1PVAA 5FI6A 1RFJA 2QEBA 1TN4A 2M7NA 2QEHA 4C0KA 1UHNA 1M31A 1YRUB 3N7HA 3NSKA 3LL8B 3O6BA 1MXEA 1LS8A 1FBVA 2CTNA 1IH0A 1MQ1A 3R1PA 1DEKA 1H8BA 3AKBA 3NSIA 3OX6A 2LVJA 3KHEA 2JRFA 3Q8IA 1PK0D 1OMVA 2BECA 1U5IA 1IWQA 2FJYA 3B86A 3FS7A 3WXAA 1TTXA 2PVBA 3OBVA 3ZNIA 1IKUA 1XFXO 4OVNF 2JXCA 1KQMB 1J1DA 2EGDA 5CSFA 3SG5A 3DVJA 2L98A 2ZRTA 3CTNA 2LUXA 3EK8A 2LHIA 2KBMA 2PASA 1OMRA 3BFBA 1TCOB 1B8CA 4WQ3A 1SL7A 2LVKA 3EKJA 3EKHA 1CMGA 1G4YR 2NZ0A 5BPJA 1PALA 2KQYA 2MAZA 5DKRA 2JT8A 2FOTA 1BF5A 4CFQA 1B7TY 3KO0A 4MZLA 4ORAB 3SG6A 2KAVA 4N1FA 1TWOA 1AHRA 2M29A 3O4YA 5AFPA 1KFXS 3TS5B 5FI2A 1A29A 1M45A 4HRGA 2K0JA 1DC1A 1F4OA 1AJ4A 2NXQA 2L2CA 2K8MB 4P5OE 2ZN9A 5F6TA 2CNPA 3UO9A 4E68A 2P71A 3GOFA 2BAPA 1K94A 1WLZA 3OGNA 1KQMC 2K61A 1DJZA 2QDIA 3FIAA 1PSBA 4YGEB 1H4BA 1IQ5A 1AVSA 5I94A 1OZOA 2KYFA 3BUOB 1QV0A 1GGZA 1G8IA 3R1OA 3LK0A 4C0JA 4DUQA 2BCXA 2LC5A 1DMOA 3FE6A 3EK7A 4ZCVA 3OX5A 1SRAA 1C3ZA 2VRGA 5CSJA 4YI8A 1KFXL 3SJSA 4UPGA 1MUXA 1DJWA 2ZKMX 2F8PA 4GUKA 4F0ZB 1TOPA 1B9AA 5KSZA 3B88A 1TUJA 3DVMA 3QRXA 2BE6A 3SS4A 1UURA 3CR5X 2LMUA 5D69A 3BUWB 2F2OA 1B47A 2WCHA 3TZ1A 1ALVA 4QJ4B 3RZSA 3CR4X 3TS5C 4MLWA 5JOLA 1RWYA 1BMOA 4GBAA 4NQGA 2ZRSA 4PT1A 2JQ6A 1DVIA 1P28A 4YBHB 4DS7A 1QV1A 1YUUA 3WHUB 4MZJA 1D1OA 4YGCB 3PJIA 3CS1A 2L2EA 1IIOA 1OOHA 3BUNB 1Z2CB 2JWWA 3VRPA 2K60A 1C07A 2M9GA 2Q91A 1OSAA 3IQOA 2PRUA 2AMIA 2BL0B 5J3XA 1LINA 1R2UA 2CT9A 1PRWA 2WC6A 4IJ7A 4PHNA 1F71A 3DVEA 2LUCA 4A4CA 1ODBA 3AAJA 5DKNA 2L4HA 2LE9B 2M97A 2MA2A 2YGUA 2WCJA 3FE8A 3BFHA 3OHMB 1TUZA 2HQ8A 2GV5A 3BUMB 4JD9A 5IBWA 1FI5A 1QWVA 4GGNA 2HF5A 2CXJA 2LP3A 3PATA 2HETA 1JSAA 1CFCA 3CZ1A 3KPXA 1RJVA 1KSOA 1MXLC 2KFFA 1XFRA 4INWA 5FI7A 1DQEA 4PE7A 2AAOA 1Z4HA 4FTGA 2KBIA 4PCWA 1KSMA 2MJWB 1DJIA 2ZN8A 1RK9A 1ZMZA 2LHLA 5TNCA 1QS7A 2WCMA 1QVIZ 2WOSA 1K90D 2I18A 2QEVA 3OP0A 3CYZA 5K89A 1CFFA 3A4UB 1NX3A 2BL0C 3VB1A 2IS9A 1Y1XA 2LMVA 3R72A 4I5KA 4JQ0D 1EG3A 1IQ3A 4PHKA 5AANA 2FJUB 3IVTA 3VRNA 2JULA 1S6JA 3JTDB 2KOTA 4GNKB 2M3WA 4MRXA 1SL8A 3I5GB 1GGWA 3B7AA 3DY9A 3V2LA 1YX8A 1SY9A 1M46A 2LMTA 4FQOA 1SK6D 4INXA 4P2YB 4WRIA 4FQTA 1CFDA 1OOIX 1OQPA 1BR1B 1JUOA 1TNXA 2AUCA 2D8NA 2KI4C 4YI9A 1NIWA 3PSRA 1K95A 5I2OA 2BKIB 2JPOA 3D78A 1HT9A 1T14A 3UNWA 5HLOA 2B1UA 1QLSA 2BNXA 4U8DA 2M0RA 1V1GA 3SG4A 1SCMB 1XFVO 1FW4A 1WRLA 1S1EA 2LAPA 1NX0A 2BCBA 1XVJA 1WLMA 1DJHA 2WC8A 3H4SE 3S0GA 2LLTA 2WCFA 4KYNA 3PALA 1C3YA 1E8AA 4JWQA 1UHIA 5CSIA 3EVRA 1J7QA 2TN4A 1UHHA 3LK1A 3C1VA 4OR9B 1F4QA 2WNDA
chains in the Genus database with same CATH topology
3F45A 1NUBA 1RECA 3I5GC 1AUIB 1WDCB 1YVHA 3I5FB 1CLBA 4CLNA 1L7ZA 3GK1A 2ZNEA 1Y0VH 2BBNA 1WY9A 4MVFA 1F70A 1Q80A 2LLSA 3KF9A 2H2KA 3A8RA 3HCMA 1QIVA 5KU1A 2JOJA 1JWDA 3SG2A 2LCPA 4R1EA 3BYAA 2Q4UA 1K93D 3FWBA 3FWCA 5CPVA 5JJGA 2G2BA 2NCPA 1CB1A 2LVIA 4TNCA 1QX2A 1WRKA 2BKHB 1TCFA 2F3ZA 1BU3A 1SNLA 1BODA 1SCMC 4OKHA 3D0YB 3O78A 5ER5A 1J1EA 3SIAA 2HPSA 2JC2A 1NCYA 2I2RE 1KK8B 1XFUO 2MBXA 3GK4X 2BBMA 1GQMA 1LKJA 1CKKA 1OMDA 3ZWHA 1DT7B 1MWNA 2JPTA 1Y1UA 2EHBA 4PE4A 5HKZA 3EK4A 1TNQA 1RTP1 3PM8A 4AQJA 3AAKA 2SCPA 2E30A 1FPWA 3VGOA 4QJ5B 1KWOB 1S5GZ 1K9UA 4AQIA 1MF8B 2GGZA 1WDCC 3I5FC 2ISDA 4CFRA 1CMFA 1IJ5A 1IJ6A 2Y4QA 1JFKA 1GJYA 2M49B 3I5IB 1KK7Z 1YUTA 3DF0B 4NDBA 2Y5IA 2LV7A 2F33A 4PE0A 1K8UA 2OTGB 1CLLA 5HKYA 3NXAA 1S6IA 3CWGA 4HREE 1F54A 1HQVA 1ZACA 5D7FA 1BLQA 3SG7A 5G08A 1SPYA 3TDZA 1A75B 2L50A 1NPQA 5FYXA 2Y1NA 1KK8C 2DOQA 2ZFDA 3E3RA 3ICBA 3NSLA 4M2OA 4MSPA 3WHTB 4CPVA 1A4PA 1WRZA 4XJKB 1YUSA 3SIBA 1KQVA 1G33A 1KWOC 3PN7B 1DJYA 1YRTB 4PHMA 1UHKA 4XYNA 2OS8B 1QX7A 1OOJA 1QTXA 1W7JB 2O5GA 4NDDA 3I5IC 1XK4C 2KI6C 1JF0A 2MHHA 3LLEA 1YX7A 2G9BA 3VROA 2JTTA 2OTGC 3NSOA 1J55A 1QJTA 4C0LA 5GQQC 2LM5A 5B8IB 3EVUA 5ER4X 1X02A 4MN0A 2L5XB 3BQ3A 2JU0A 3CR2A 1RROA 2L4IA 1PVBA 4BY4A 5KTYA 1JBAA 1N2DA 1Y1AA 1FI6A 3TDUA 2KDHA 1S3PA 2KAYA 1EH2A 3RLZA 4IL1A 1K96A 1OE9B 2F2PA 1QIWA 4ZCUA 1EL4A 2KFGA 3BOWB 1AJ5A 4PALA 3PN7C 2V53A 1JC2A 1JF2A 4MRYA 2QACA 3VRQA 2OS8C 3I5HB 1XFZO 1QATA 1QVIY 2K7CA 2OPOA 1BJFA 2KSPA 1IGVA 1SKTA 2PMYA 4Q04A 1Y6WA 1B8LA 2JNXA 1SR6B 1OZSA 1SCVA 1XK4A 4N1GA 1SBJA 3DF0A 1UP5A 3TDIA 2NLNA 2M1UA 4QJ3B 1CLMA 1B1GA 1DGVA 1K9PA 2GGMA 5PALA 1BT6A 1NP8A 3M0WA 2K2AA 4I5LB 1NCXA 1NSHA 1ZFSA 4YRUA 2LLUA 4MEWA 1PULA 3BXKA 1DF0B 2KI6D 4HRHA 1FF1A 1A75A 1LA3A 3JTDC 4GPLB 1S6CA 3OB2B 2WCBA 1EG4A 1K2HA 1N65A 1B7TZ 1IG5A 1CM1A 1S26D 4MZKA 4XJKA 1VRKA 2KHNA 2SASA 4AOMA 1A03A 5HKWA 4ORCB 4YGBB 1EJ3A 5I2QA 1DGUA 3I5HC 4HSZA 1W7IB 2COLB 2H61C 2CCMA 3SG3A 2K7BA 4DRWA 1S36A 2O60A 1JFJA 2LP2A 2KAXA 4MBEA 1SR6C 5I8NA 4USLA 2K2FA 4BY5A 3EVVA 3VRRA 1PSRA 1F8HA 4OV2A 2I7AA 1QLKA 1QX5B 1TNWA 3OB1B 1XO5A 2R2IA 3D10A 3PFVA 1A2XA 5AXIA 3IF7A 3GK2A 2FCDA 1SL9A 4A4BA 1IRJA 1EXRA 3K21A 4N5XA 2KFHA 4ORBB 1XA5A 3IQQA 1J7OA 2A4JA 2JTZA 5AEQA 2WCEA 1XFYO 4DIRA 1ZOTB 5HLVA 1CDNA 2JZIA 2L0PA 2JT0A 2KNEA 3BOWA 1ALWA 1DTLA 1BG1A 5I2LA 2KYCA 1AP4A 2PSRA 1CDPA 1SMGA 3HX4A 4WQ2A 5AERA 1R6PA 1XYDA 1BR4B 3DD4A 1NX2A 2LANA 2RGIA 1CM4A 1KCYA 2H61A 4M2QA 5DKQA 4CIDA 1NX1A 1SYMA 4L9MA 1NCZA 3AKAA 4PHJA 1YURA 4GFTA 3LCPC 2F3YA 2E6WA 2LVVA 2NCOA 4OCIA 1LA0A 1N0YA 1LVCD 1CNPA 1U5IB 1S5GY 4PE1A 2ZNDA 1NWDA 3PLFB 2JNFA 4YGAA 4GGFC 2LNKA 4D1EA 2QPTA 1SW8A 2L51A 4GAOA 3TUYB 3CZTX 1KK7Y 4ETOA 3JVTB 2M8UA 2EC6B 3WNXB 2KGBC 1CDLA 2MRDA 3DVKA 1DF0A 1QASA 4JPZB 1M39A 4NDCA 1C7WA 4I5JA 1NYAA 2JT3A 1MR8A 1B8RA 2KGRA 2P6BB 2JXLA 1K9KA 1UWOA 2M1KB 1BOCA 1LXFC 1B4CA 1KFUS 2BCAA 1L2OB 2BE4A 1F55A 2HQWA 3CGAA 2Y1MA 1M63B 3BUXB 2FCEA 2WORA 1XFWO 1CTRA 1DJGA 5CSNA 1TNPA 4YGDB 1C7VA 2MLFC 2PALA 2M7LA 1AK8A 1UUSA 3D0YA 4I5NB 1ZUZA 3TUYC 1YVLA 3RM1A 5HYDA 2K7DA 1J7RA 3JVTC 3O2PA 2EC6C 2KI4B 4DCKA 1TIZA 4GGFA 2KQ6A 1V1FA 1MHOA 1KFUL 1QXPA 2I94A 1CDMA 4PDZA 2K7OA 1J7PA 1YR5A 3CLNA 1YTZC 4M2PA 3KEVA 3MSEB 2CBLA 1UHJA 1DJXA 1L2OC 2MLEC 1TRFA 1CFPA 4ICBA 1PVAA 1RFJA 1TN4A 2M7NA 4C0KA 1UHNA 1M31A 1YRUB 3NSKA 3O6BA 3LL8B 1MXEA 2CTNA 1FBVA 1IH0A 1MQ1A 1H8BA 3AKBA 3NSIA 3OX6A 2LVJA 3KHEA 2JRFA 1PK0D 1OMVA 2BECA 1U5IA 1IWQA 3FS7A 3WXAA 1TTXA 2PVBA 3ZNIA 1IKUA 1XFXO 4OVNF 2JXCA 1KQMB 1J1DA 2EGDA 5CSFA 3SG5A 3DVJA 2L98A 2ZRTA 3CTNA 2LUXA 3EK8A 2LHIA 2KBMA 2PASA 1OMRA 1TCOB 1B8CA 4WQ3A 1SL7A 2LVKA 3EKJA 3EKHA 1CMGA 1G4YR 2NZ0A 5BPJA 1PALA 2KQYA 2MAZA 5DKRA 2JT8A 2FOTA 1BF5A 4CFQA 1B7TY 3KO0A 4MZLA 4ORAB 3SG6A 2KAVA 4N1FA 3O4YA 1AHRA 2M29A 5AFPA 1KFXS 3TS5B 1A29A 1M45A 4HRGA 2K0JA 1F4OA 1AJ4A 2NXQA 4P5OE 2K8MB 5F6TA 2ZN9A 4E68A 2CNPA 1DMOA 3GOFA 1K94A 1WLZA 1KQMC 2K61A 1DJZA 3FIAA 4YGEB 1PSBA 1H4BA 1IQ5A 1AVSA 1OZOA 2KYFA 3BUOB 1QV0A 1GGZA 1G8IA 3LK0A 4C0JA 4DUQA 2BCXA 2LC5A 3EK7A 4ZCVA 3OX5A 1SRAA 2VRGA 5CSJA 4YI8A 1KFXL 3SJSA 4UPGA 1MUXA 1DJWA 2ZKMX 2F8PA 4GUKA 4F0ZB 1TOPA 1B9AA 5KSZA 3DVMA 3QRXA 2BE6A 1UURA 3CR5X 2LMUA 5D69A 3BUWB 2F2OA 1B47A 3TZ1A 1ALVA 4QJ4B 3CR4X 3TS5C 4MLWA 5JOLA 1RWYA 1BMOA 4GBAA 4NQGA 2ZRSA 2JQ6A 1DVIA 4YBHB 4DS7A 1QV1A 1YUUA 3WHUB 4MZJA 1D1OA 4YGCB 3CS1A 2L2EA 3BUNB 3VRPA 2JWWA 1C07A 2M9GA 2Q91A 1OSAA 3IQOA 2PRUA 2AMIA 2BL0B 5J3XA 1LINA 1R2UA 2CT9A 1PRWA 4PHNA 1F71A 3DVEA 2LUCA 4A4CA 1ODBA 3AAJA 5DKNA 2L4HA 2LE9B 2M97A 2MA2A 3OHMB 2HQ8A 2GV5A 3BUMB 5IBWA 1FI5A 4GGNA 2HF5A 2CXJA 2LP3A 3PATA 2HETA 1JSAA 1CFCA 3KPXA 1RJVA 1KSOA 1MXLC 2KFFA 4PE7A 2AAOA 4FTGA 2KBIA 4PCWA 1KSMA 2MJWB 1DJIA 2ZN8A 1RK9A 1ZMZA 2LHLA 5TNCA 1QS7A 2WOSA 1QVIZ 1K90D 2I18A 3OP0A 5K89A 1CFFA 3A4UB 1NX3A 2BL0C 2IS9A 1Y1XA 2LMVA 4I5KA 4JQ0D 1IQ3A 1EG3A 4PHKA 5AANA 2FJUB 3VRNA 2JULA 1S6JA 3JTDB 2KOTA 4GNKB 2M3WA 4MRXA 1SL8A 3I5GB 1GGWA 1YX8A 1SY9A 1M46A 2LMTA 4FQOA 1SK6D 4P2YB 4WRIA 1CFDA 1TNXA 1OQPA 1BR1B 1JUOA 2AUCA 4YI9A 2D8NA 2KI4C 1NIWA 3PSRA 1K95A 5I2OA 2BKIB 1HT9A 5HLOA 2B1UA 1QLSA 4U8DA 2M0RA 1V1GA 3SG4A 1SCMB 1XFVO 1FW4A 1WRLA 1S1EA 2LAPA 1NX0A 2BCBA 1XVJA 1WLMA 1DJHA 2WC8A 3H4SE 2LLTA 2WCFA 3PALA 1E8AA 4JWQA 1UHIA 5CSIA 3EVRA 1J7QA 2TN4A 1UHHA 3LK1A 3C1VA 4OR9B 1F4QA 2WNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F45 A;  1NUB A;  1REC A;  3I5G C;  1AUI B;  1WDC B;  1YVH A;  3I5F B;  1CLB A;  4CLN A;  1L7Z A;  3GK1 A;  2ZNE A;  1Y0V H;  2BBN A;  1WY9 A;  4MVF A;  1F70 A;  1Q80 A;  2LLS A;  3KF9 A;  2H2K A;  3A8R A;  3HCM A;  1QIV A;  5KU1 A;  2JOJ A;  1JWD A;  3SG2 A;  2LCP A;  4R1E A;  3BYA A;  2Q4U A;  1K93 D;  3FWB A;  3FWC A;  5CPV A;  5JJG A;  2G2B A;  2NCP A;  1CB1 A;  2LVI A;  4TNC A;  1QX2 A;  1WRK A;  2BKH B;  1TCF A;  2F3Z A;  1BU3 A;  1SNL A;  1BOD A;  1SCM C;  4OKH A;  3D0Y B;  3O78 A;  5ER5 A;  1J1E A;  3SIA A;  2HPS A;  2JC2 A;  1NCY A;  2I2R E;  1KK8 B;  1XFU O;  2MBX A;  3GK4 X;  2BBM A;  1GQM A;  1LKJ A;  1CKK A;  1OMD A;  3ZWH A;  1DT7 B;  1MWN A;  2JPT A;  1Y1U A;  2EHB A;  4PE4 A;  5HKZ A;  3EK4 A;  1TNQ A;  1RTP 1;  3PM8 A;  4AQJ A;  3AAK A;  2SCP A;  2E30 A;  1FPW A;  3VGO A;  4QJ5 B;  1KWO B;  1S5G Z;  1K9U A;  4AQI A;  1MF8 B;  2GGZ A;  1WDC C;  3I5F C;  2ISD A;  4CFR A;  1CMF A;  1IJ5 A;  1IJ6 A;  2Y4Q A;  1JFK A;  1GJY A;  2M49 B;  3I5I B;  1KK7 Z;  1YUT A;  3DF0 B;  4NDB A;  2Y5I A;  2LV7 A;  2F33 A;  4PE0 A;  1K8U A;  2OTG B;  1CLL A;  5HKY A;  3NXA A;  1S6I A;  3CWG A;  4HRE E;  1F54 A;  1HQV A;  1ZAC A;  5D7F A;  1BLQ A;  3SG7 A;  5G08 A;  1SPY A;  3TDZ A;  1A75 B;  2L50 A;  1NPQ A;  5FYX A;  2Y1N A;  1KK8 C;  2DOQ A;  2ZFD A;  3E3R A;  3ICB A;  3NSL A;  4M2O A;  4MSP A;  3WHT B;  4CPV A;  1A4P A;  1WRZ A;  4XJK B;  1YUS A;  3SIB A;  1KQV A;  1G33 A;  1KWO C;  3PN7 B;  1DJY A;  1YRT B;  4PHM A;  1UHK A;  4XYN A;  2OS8 B;  1QX7 A;  1OOJ A;  1QTX A;  1W7J B;  2O5G A;  4NDD A;  3I5I C;  1XK4 C;  2KI6 C;  1JF0 A;  2MHH A;  3LLE A;  1YX7 A;  2G9B A;  3VRO A;  2JTT A;  2OTG C;  3NSO A;  1J55 A;  1QJT A;  4C0L A;  5GQQ C;  2LM5 A;  5B8I B;  3EVU A;  5ER4 X;  1X02 A;  4MN0 A;  2L5X B;  3BQ3 A;  2JU0 A;  3CR2 A;  1RRO A;  2L4I A;  1PVB A;  4BY4 A;  5KTY A;  1JBA A;  1N2D A;  1Y1A A;  1FI6 A;  3TDU A;  2KDH A;  1S3P A;  2KAY A;  1EH2 A;  3RLZ A;  4IL1 A;  1K96 A;  1OE9 B;  2F2P A;  1QIW A;  4ZCU A;  1EL4 A;  2KFG A;  3BOW B;  1AJ5 A;  4PAL A;  3PN7 C;  2V53 A;  1JC2 A;  1JF2 A;  4MRY A;  2QAC A;  3VRQ A;  2OS8 C;  3I5H B;  1XFZ O;  1QAT A;  1QVI Y;  2K7C A;  2OPO A;  1BJF A;  2KSP A;  1IGV A;  1SKT A;  2PMY A;  4Q04 A;  1Y6W A;  1B8L A;  2JNX A;  1SR6 B;  1OZS A;  1SCV A;  1XK4 A;  4N1G A;  1SBJ A;  3DF0 A;  1UP5 A;  3TDI A;  2NLN A;  2M1U A;  4QJ3 B;  1CLM A;  1B1G A;  1DGV A;  1K9P A;  2GGM A;  5PAL A;  1BT6 A;  1NP8 A;  3M0W A;  2K2A A;  4I5L B;  1NCX A;  1NSH A;  1ZFS A;  4YRU A;  2LLU A;  4MEW A;  1PUL A;  3BXK A;  1DF0 B;  2KI6 D;  4HRH A;  1FF1 A;  1A75 A;  1LA3 A;  3JTD C;  4GPL B;  1S6C A;  3OB2 B;  2WCB A;  1EG4 A;  1K2H A;  1N65 A;  1B7T Z;  1IG5 A;  1CM1 A;  1S26 D;  4MZK A;  4XJK A;  1VRK A;  2KHN A;  2SAS A;  4AOM A;  1A03 A;  5HKW A;  4ORC B;  4YGB B;  1EJ3 A;  5I2Q A;  1DGU A;  3I5H C;  4HSZ A;  1W7I B;  2COL B;  2H61 C;  2CCM A;  3SG3 A;  2K7B A;  4DRW A;  1S36 A;  2O60 A;  1JFJ A;  2LP2 A;  2KAX A;  4MBE A;  1SR6 C;  5I8N A;  4USL A;  2K2F A;  4BY5 A;  3EVV A;  3VRR A;  1PSR A;  1F8H A;  4OV2 A;  2I7A A;  1QLK A;  1QX5 B;  1TNW A;  3OB1 B;  1XO5 A;  2R2I A;  3D10 A;  3PFV A;  1A2X A;  5AXI A;  3IF7 A;  3GK2 A;  2FCD A;  1SL9 A;  4A4B A;  1IRJ A;  1EXR A;  3K21 A;  4N5X A;  2KFH A;  4ORB B;  1XA5 A;  3IQQ A;  1J7O A;  2A4J A;  2JTZ A;  5AEQ A;  2WCE A;  1XFY O;  4DIR A;  1ZOT B;  5HLV A;  1CDN A;  2JZI A;  2L0P A;  2JT0 A;  2KNE A;  3BOW A;  1ALW A;  1DTL A;  1BG1 A;  5I2L A;  2KYC A;  1AP4 A;  2PSR A;  1CDP A;  1SMG A;  3HX4 A;  4WQ2 A;  5AER A;  1R6P A;  1XYD A;  1BR4 B;  3DD4 A;  1NX2 A;  2LAN A;  2RGI A;  1CM4 A;  1KCY A;  2H61 A;  4M2Q A;  5DKQ A;  4CID A;  1NX1 A;  1SYM A;  4L9M A;  1NCZ A;  3AKA A;  4PHJ A;  1YUR A;  4GFT A;  3LCP C;  2F3Y A;  2E6W A;  2LVV A;  2NCO A;  4OCI A;  1LA0 A;  1N0Y A;  1LVC D;  1CNP A;  1U5I B;  1S5G Y;  4PE1 A;  2ZND A;  1NWD A;  3PLF B;  2JNF A;  4YGA A;  4GGF C;  2LNK A;  4D1E A;  2QPT A;  1SW8 A;  2L51 A;  4GAO A;  3TUY B;  3CZT X;  1KK7 Y;  4ETO A;  3JVT B;  2M8U A;  2EC6 B;  3WNX B;  2KGB C;  1CDL A;  2MRD A;  3DVK A;  1DF0 A;  1QAS A;  4JPZ B;  1M39 A;  4NDC A;  1C7W A;  4I5J A;  1NYA A;  2JT3 A;  1MR8 A;  1B8R A;  2KGR A;  2P6B B;  2JXL A;  1K9K A;  1UWO A;  2M1K B;  1BOC A;  1LXF C;  1B4C A;  1KFU S;  2BCA A;  1L2O B;  2BE4 A;  1F55 A;  2HQW A;  3CGA A;  2Y1M A;  1M63 B;  3BUX B;  2FCE A;  2WOR A;  1XFW O;  1CTR A;  1DJG A;  5CSN A;  1TNP A;  4YGD B;  1C7V A;  2MLF C;  2PAL A;  2M7L A;  1AK8 A;  1UUS A;  3D0Y A;  4I5N B;  1ZUZ A;  3TUY C;  1YVL A;  3RM1 A;  5HYD A;  2K7D A;  1J7R A;  3JVT C;  3O2P A;  2EC6 C;  2KI4 B;  4DCK A;  1TIZ A;  4GGF A;  2KQ6 A;  1V1F A;  1MHO A;  1KFU L;  1QXP A;  2I94 A;  1CDM A;  4PDZ A;  2K7O A;  1J7P A;  1YR5 A;  3CLN A;  1YTZ C;  4M2P A;  3KEV A;  3MSE B;  2CBL A;  1UHJ A;  1DJX A;  1L2O C;  2MLE C;  1TRF A;  1CFP A;  4ICB A;  1PVA A;  1RFJ A;  1TN4 A;  2M7N A;  4C0K A;  1UHN A;  1M31 A;  1YRU B;  3NSK A;  3O6B A;  3LL8 B;  1MXE A;  2CTN A;  1FBV A;  1IH0 A;  1MQ1 A;  1H8B A;  3AKB A;  3NSI A;  3OX6 A;  2LVJ A;  3KHE A;  2JRF A;  1PK0 D;  1OMV A;  2BEC A;  1U5I A;  1IWQ A;  3FS7 A;  3WXA A;  1TTX A;  2PVB A;  3ZNI A;  1IKU A;  1XFX O;  4OVN F;  2JXC A;  1KQM B;  1J1D A;  2EGD A;  5CSF A;  3SG5 A;  3DVJ A;  2L98 A;  2ZRT A;  3CTN A;  2LUX A;  3EK8 A;  2LHI A;  2KBM A;  2PAS A;  1OMR A;  1TCO B;  1B8C A;  4WQ3 A;  1SL7 A;  2LVK A;  3EKJ A;  3EKH A;  1CMG A;  1G4Y R;  2NZ0 A;  5BPJ A;  1PAL A;  2KQY A;  2MAZ A;  5DKR A;  2JT8 A;  2FOT A;  1BF5 A;  4CFQ A;  1B7T Y;  3KO0 A;  4MZL A;  4ORA B;  3SG6 A;  2KAV A;  4N1F A;  3O4Y A;  1AHR A;  2M29 A;  5AFP A;  1KFX S;  3TS5 B;  1A29 A;  1M45 A;  4HRG A;  2K0J A;  1F4O A;  1AJ4 A;  2NXQ A;  4P5O E;  2K8M B;  5F6T A;  2ZN9 A;  4E68 A;  2CNP A;  1DMO A;  3GOF A;  1K94 A;  1WLZ A;  1KQM C;  2K61 A;  1DJZ A;  3FIA A;  4YGE B;  1PSB A;  1H4B A;  1IQ5 A;  1AVS A;  1OZO A;  2KYF A;  3BUO B;  1QV0 A;  1GGZ A;  1G8I A;  3LK0 A;  4C0J A;  4DUQ A;  2BCX A;  2LC5 A;  3EK7 A;  4ZCV A;  3OX5 A;  1SRA A;  2VRG A;  5CSJ A;  4YI8 A;  1KFX L;  3SJS A;  4UPG A;  1MUX A;  1DJW A;  2ZKM X;  2F8P A;  4GUK A;  4F0Z B;  1TOP A;  1B9A A;  5KSZ A;  3DVM A;  3QRX A;  2BE6 A;  1UUR A;  3CR5 X;  2LMU A;  5D69 A;  3BUW B;  2F2O A;  1B47 A;  3TZ1 A;  1ALV A;  4QJ4 B;  3CR4 X;  3TS5 C;  4MLW A;  5JOL A;  1RWY A;  1BMO A;  4GBA A;  4NQG A;  2ZRS A;  2JQ6 A;  1DVI A;  4YBH B;  4DS7 A;  1QV1 A;  1YUU A;  3WHU B;  4MZJ A;  1D1O A;  4YGC B;  3CS1 A;  2L2E A;  3BUN B;  3VRP A;  2JWW A;  1C07 A;  2M9G A;  2Q91 A;  1OSA A;  3IQO A;  2PRU A;  2AMI A;  2BL0 B;  5J3X A;  1LIN A;  1R2U A;  2CT9 A;  1PRW A;  4PHN A;  1F71 A;  3DVE A;  2LUC A;  4A4C A;  1ODB A;  3AAJ A;  5DKN A;  2L4H A;  2LE9 B;  2M97 A;  2MA2 A;  3OHM B;  2HQ8 A;  2GV5 A;  3BUM B;  5IBW A;  1FI5 A;  4GGN A;  2HF5 A;  2CXJ A;  2LP3 A;  3PAT A;  2HET A;  1JSA A;  1CFC A;  3KPX A;  1RJV A;  1KSO A;  1MXL C;  2KFF A;  4PE7 A;  2AAO A;  4FTG A;  2KBI A;  4PCW A;  1KSM A;  2MJW B;  1DJI A;  2ZN8 A;  1RK9 A;  1ZMZ A;  2LHL A;  5TNC A;  1QS7 A;  2WOS A;  1QVI Z;  1K90 D;  2I18 A;  3OP0 A;  5K89 A;  1CFF A;  3A4U B;  1NX3 A;  2BL0 C;  2IS9 A;  1Y1X A;  2LMV A;  4I5K A;  4JQ0 D;  1IQ3 A;  1EG3 A;  4PHK A;  5AAN A;  2FJU B;  3VRN A;  2JUL A;  1S6J A;  3JTD B;  2KOT A;  4GNK B;  2M3W A;  4MRX A;  1SL8 A;  3I5G B;  1GGW A;  1YX8 A;  1SY9 A;  1M46 A;  2LMT A;  4FQO A;  1SK6 D;  4P2Y B;  4WRI A;  1CFD A;  1TNX A;  1OQP A;  1BR1 B;  1JUO A;  2AUC A;  4YI9 A;  2D8N A;  2KI4 C;  1NIW A;  3PSR A;  1K95 A;  5I2O A;  2BKI B;  1HT9 A;  5HLO A;  2B1U A;  1QLS A;  4U8D A;  2M0R A;  1V1G A;  3SG4 A;  1SCM B;  1XFV O;  1FW4 A;  1WRL A;  1S1E A;  2LAP A;  1NX0 A;  2BCB A;  1XVJ A;  1WLM A;  1DJH A;  2WC8 A;  3H4S E;  2LLT A;  2WCF A;  3PAL A;  1E8A A;  4JWQ A;  1UHI A;  5CSI A;  3EVR A;  1J7Q A;  2TN4 A;  1UHH A;  3LK1 A;  3C1V A;  4OR9 B;  1F4Q A;  2WND A; 
#chains in the Genus database with same CATH topology
 3F45 A;  1NUB A;  1REC A;  3I5G C;  1AUI B;  3O4X A;  1WDC B;  1YVH A;  2KLD A;  3D76 A;  3I5F B;  4CLN A;  1L7Z A;  3GK1 A;  2ZNE A;  2WCK A;  1Y0V H;  2BBN A;  1WY9 A;  4MVF A;  1F70 A;  1Q80 A;  2LLS A;  3KF9 A;  2H2K A;  3A8R A;  3HCM A;  1QIV A;  5KU1 A;  2JOJ A;  1JWD A;  3SG2 A;  2LCP A;  4R1E A;  3BYA A;  2Q4U A;  1K93 D;  3FWB A;  3FWC A;  5CPV A;  5JJG A;  2G2B A;  2NCP A;  3S0E A;  3DYE A;  1CB1 A;  2LVI A;  4TNC A;  1QX2 A;  1WRK A;  2BKH B;  1TCF A;  2F3Z A;  1BU3 A;  1SNL A;  2PYQ A;  1BOD A;  1SCM C;  4OKH A;  3D0Y B;  3O78 A;  5ER5 A;  1J1E A;  3SIA A;  2HPS A;  2JC2 A;  1NCY A;  2I2R E;  1KK8 B;  1XFU O;  2MBX A;  3GK4 X;  2BBM A;  1GQM A;  1LKJ A;  1CKK A;  1OMD A;  3ZWH A;  1DT7 B;  1MWN A;  2JPT A;  1Y1U A;  2EHB A;  4PE4 A;  5HKZ A;  3EK4 A;  1TNQ A;  1RTP 1;  3PM8 A;  4AQJ A;  3AAK A;  2SCP A;  2E30 A;  3DZT A;  1FPW A;  3VGO A;  4QJ5 B;  1KWO B;  1S5G Z;  1K9U A;  4AQI A;  2PQL A;  1MF8 B;  2GGZ A;  1WDC C;  2ERB A;  3I5F C;  2ISD A;  4CFR A;  1CMF A;  1IJ5 A;  1IJ6 A;  2P70 A;  2Y4Q A;  1JFK A;  1GJY A;  2M49 B;  3I5I B;  1KK7 Z;  1YUT A;  3DF0 B;  4NDB A;  2Y5I A;  2LV7 A;  2F33 A;  4PE0 A;  1K8U A;  2OTG B;  1CLL A;  5HKY A;  3NXA A;  1S6I A;  3CWG A;  4HRE E;  1F54 A;  1HQV A;  1ZAC A;  2L5Y A;  5D7F A;  1BLQ A;  3SG7 A;  5G08 A;  1SPY A;  3TDZ A;  3NHT A;  1A75 B;  2L50 A;  1NPQ A;  5FYX A;  2Y1N A;  1KK8 C;  2DOQ A;  2ZFD A;  3E3R A;  3ICB A;  3NSL A;  4M2O A;  4MSP A;  3WHT B;  4CPV A;  1A4P A;  1WRZ A;  4XJK B;  1YUS A;  3D73 A;  3SIB A;  3S0A A;  1KQV A;  1G33 A;  1OOG A;  1KWO C;  3PN7 B;  1DJY A;  1YRT B;  4PHM A;  1UHK A;  4XYN A;  2OS8 B;  1QX7 A;  1OOJ A;  1QTX A;  1W7J B;  2O5G A;  4NDD A;  3I5I C;  1XK4 C;  2KI6 C;  1JF0 A;  2MHH A;  3LLE A;  1YX7 A;  2G9B A;  3VRO A;  2JTT A;  2OTG C;  3NSO A;  1J55 A;  1QJT A;  4C0L A;  5GQQ C;  2LM5 A;  3L47 A;  5B8I B;  1W9Z A;  3EVU A;  5ER4 X;  1X02 A;  4MN0 A;  2L5X B;  3BQ3 A;  2JU0 A;  3CR2 A;  1RRO A;  2L4I A;  1PVB A;  4BY4 A;  5KTY A;  1JBA A;  1N2D A;  1Y1A A;  1FI6 A;  3TDU A;  2KDH A;  1S3P A;  2KAY A;  1EH2 A;  3RLZ A;  4IL1 A;  1K96 A;  1OE9 B;  2F2P A;  1QIW A;  4ZCU A;  1EL4 A;  2KFG A;  3S0F A;  3L4A A;  3BOW B;  1AJ5 A;  4PAL A;  3PN7 C;  2V53 A;  3CAB A;  5DIC A;  1JC2 A;  1JF2 A;  2KPH A;  4MRY A;  2GTE A;  2QAC A;  3VRQ A;  2OS8 C;  3I5H B;  1XFZ O;  1QAT A;  1QVI Y;  2K7C A;  2OPO A;  1BJF A;  2KSP A;  1IGV A;  1SKT A;  2PMY A;  4Q04 A;  1Y6W A;  1B8L A;  2JNX A;  5HL1 A;  1SR6 B;  1OZS A;  1SCV A;  1XK4 A;  4N1G A;  1SBJ A;  3DF0 A;  1UP5 A;  3TDI A;  2NLN A;  2M1U A;  4QJ3 B;  3SS3 A;  1CLM A;  1SSE B;  3BFA A;  1B1G A;  1DGV A;  1K9P A;  2GGM A;  5PAL A;  1BT6 A;  1NP8 A;  3M0W A;  2K2A A;  3CZ0 A;  1NCX A;  4I5L B;  1NSH A;  1ZFS A;  1GM0 A;  4YRU A;  2LLU A;  4MEW A;  1PUL A;  3BXK A;  1DF0 B;  2KI6 D;  1CLB A;  4HRH A;  1FF1 A;  1A75 A;  1LA3 A;  3JTD C;  4GPL B;  1S6C A;  3OB2 B;  2WCB A;  1EG4 A;  1K2H A;  1N65 A;  1B7T Z;  1IG5 A;  1CM1 A;  1S26 D;  4MZK A;  4XJK A;  1VRK A;  2KHN A;  2SAS A;  3D75 A;  4AOM A;  1A03 A;  3NHI A;  5HKW A;  4ORC B;  4YGB B;  1EJ3 A;  5I2Q A;  1DGU A;  3I5H C;  4HSZ A;  1W7I B;  2COL B;  2H61 C;  2CCM A;  3SG3 A;  2K7B A;  4DRW A;  1S36 A;  2O60 A;  1JFJ A;  2LP2 A;  2KAX A;  4MBE A;  1SR6 C;  5I8N A;  4USL A;  2K2F A;  4BY5 A;  3EVV A;  3VRR A;  1PSR A;  1F8H A;  4OV2 A;  3CDN A;  1OOF A;  3FE9 A;  2I7A A;  1QLK A;  1QX5 B;  1TNW A;  3OB1 B;  1XO5 A;  2R2I A;  3D10 A;  3PFV A;  1A2X A;  5AXI A;  3IF7 A;  3GK2 A;  2FCD A;  1SL9 A;  4A4B A;  1IRJ A;  1EXR A;  2WC5 A;  3K21 A;  4N5X A;  2KFH A;  4ORB B;  1XA5 A;  3IQQ A;  1J7O A;  2A4J A;  2JTZ A;  5AEQ A;  2WCE A;  1XFY O;  4DIR A;  1ZOT B;  5HLV A;  2WCL A;  5EL2 A;  1CDN A;  2JZI A;  2L0P A;  2JT0 A;  2KNE A;  3BOW A;  1ALW A;  1DTL A;  1BG1 A;  5I2L A;  2KYC A;  1AP4 A;  2PSR A;  1CDP A;  1SMG A;  3HX4 A;  4WQ2 A;  5AER A;  1R6P A;  1XYD A;  1BR4 B;  3DD4 A;  1NX2 A;  2LAN A;  2RGI A;  1CM4 A;  1KCY A;  2H61 A;  4M2Q A;  5DKQ A;  4CID A;  1NX1 A;  1SYM A;  2QEO A;  4L9M A;  1NCZ A;  3AKA A;  4PHJ A;  1YUR A;  4GFT A;  3LCP C;  2F3Y A;  2E6W A;  2LVV A;  2NCO A;  4OCI A;  1LA0 A;  1N0Y A;  1LVC D;  1CNP A;  1U5I B;  1S5G Y;  4PE1 A;  2ZND A;  1NWD A;  3PLF B;  2JNF A;  4YGA A;  4GGF C;  2LNK A;  4D1E A;  2QPT A;  1SW8 A;  2L51 A;  4GAO A;  3CZ2 A;  4OZD A;  3TUY B;  3CZT X;  1KK7 Y;  4ETO A;  3JVT B;  2M8U A;  2EC6 B;  3WNX B;  2H8V A;  2KGB C;  1CDL A;  2MRD A;  3DVK A;  1DF0 A;  1QAS A;  4JPZ B;  3SS5 A;  1M39 A;  1DEL A;  4NDC A;  1C7W A;  4I5J A;  1NYA A;  2JT3 A;  1MR8 A;  1B8R A;  2KGR A;  3L4L A;  2P6B B;  3S0B A;  3K1E A;  2JXL A;  1K9K A;  1UWO A;  2M1K B;  3D77 A;  1LXF C;  1B4C A;  1BOC A;  1KFU S;  2BCA A;  1L2O B;  2BE4 A;  1F55 A;  2HQW A;  3CGA A;  2Y1M A;  3NGV A;  5D3O A;  3QME A;  1M63 B;  3BUX B;  2FCE A;  2WOR A;  1XFW O;  1CTR A;  3B6X A;  1DJG A;  5CSN A;  1TNP A;  4YGD B;  1C7V A;  2MLF C;  2PAL A;  2M7L A;  1AK8 A;  1UUS A;  3D0Y A;  4I5N B;  1ZUZ A;  4JKT A;  3TUY C;  1YVL A;  3RM1 A;  5HYD A;  2K7D A;  1J7R A;  3JVT C;  3O2P A;  2EC6 C;  2KI4 B;  3D74 A;  3R1V A;  1TIZ A;  4GGF A;  4DCK A;  2KQ6 A;  1V1F A;  1MHO A;  1KFU L;  1QXP A;  2I94 A;  1CDM A;  1ORG A;  3S0D A;  4PDZ A;  3B87 A;  2K7O A;  2KLE A;  1J7P A;  3DXL A;  4F7F A;  1YR5 A;  3CLN A;  1YTZ C;  4M2P A;  3BJH A;  3PM2 A;  1OW4 A;  3KEV A;  3MSE B;  2CBL A;  1UHJ A;  1DJX A;  1L2O C;  2MLE C;  1TRF A;  3EG5 B;  1CFP A;  4ICB A;  1PVA A;  5FI6 A;  1RFJ A;  2QEB A;  1TN4 A;  2M7N A;  2QEH A;  4C0K A;  1UHN A;  1M31 A;  1YRU B;  3N7H A;  3NSK A;  3LL8 B;  3O6B A;  1MXE A;  1LS8 A;  1FBV A;  2CTN A;  1IH0 A;  1MQ1 A;  3R1P A;  1DEK A;  1H8B A;  3AKB A;  3NSI A;  3OX6 A;  2LVJ A;  3KHE A;  2JRF A;  3Q8I A;  1PK0 D;  1OMV A;  2BEC A;  1U5I A;  1IWQ A;  2FJY A;  3B86 A;  3FS7 A;  3WXA A;  1TTX A;  2PVB A;  3OBV A;  3ZNI A;  1IKU A;  1XFX O;  4OVN F;  2JXC A;  1KQM B;  1J1D A;  2EGD A;  5CSF A;  3SG5 A;  3DVJ A;  2L98 A;  2ZRT A;  3CTN A;  2LUX A;  3EK8 A;  2LHI A;  2KBM A;  2PAS A;  1OMR A;  3BFB A;  1TCO B;  1B8C A;  4WQ3 A;  1SL7 A;  2LVK A;  3EKJ A;  3EKH A;  1CMG A;  1G4Y R;  2NZ0 A;  5BPJ A;  1PAL A;  2KQY A;  2MAZ A;  5DKR A;  2JT8 A;  2FOT A;  1BF5 A;  4CFQ A;  1B7T Y;  3KO0 A;  4MZL A;  4ORA B;  3SG6 A;  2KAV A;  4N1F A;  1TWO A;  1AHR A;  2M29 A;  3O4Y A;  5AFP A;  1KFX S;  3TS5 B;  5FI2 A;  1A29 A;  1M45 A;  4HRG A;  2K0J A;  1DC1 A;  1F4O A;  1AJ4 A;  2NXQ A;  2L2C A;  2K8M B;  4P5O E;  2ZN9 A;  5F6T A;  2CNP A;  3UO9 A;  4E68 A;  2P71 A;  3GOF A;  2BAP A;  1K94 A;  1WLZ A;  3OGN A;  1KQM C;  2K61 A;  1DJZ A;  2QDI A;  3FIA A;  1PSB A;  4YGE B;  1H4B A;  1IQ5 A;  1AVS A;  5I94 A;  1OZO A;  2KYF A;  3BUO B;  1QV0 A;  1GGZ A;  1G8I A;  3R1O A;  3LK0 A;  4C0J A;  4DUQ A;  2BCX A;  2LC5 A;  1DMO A;  3FE6 A;  3EK7 A;  4ZCV A;  3OX5 A;  1SRA A;  1C3Z A;  2VRG A;  5CSJ A;  4YI8 A;  1KFX L;  3SJS A;  4UPG A;  1MUX A;  1DJW A;  2ZKM X;  2F8P A;  4GUK A;  4F0Z B;  1TOP A;  1B9A A;  5KSZ A;  3B88 A;  1TUJ A;  3DVM A;  3QRX A;  2BE6 A;  3SS4 A;  1UUR A;  3CR5 X;  2LMU A;  5D69 A;  3BUW B;  2F2O A;  1B47 A;  2WCH A;  3TZ1 A;  1ALV A;  4QJ4 B;  3RZS A;  3CR4 X;  3TS5 C;  4MLW A;  5JOL A;  1RWY A;  1BMO A;  4GBA A;  4NQG A;  2ZRS A;  4PT1 A;  2JQ6 A;  1DVI A;  1P28 A;  4YBH B;  4DS7 A;  1QV1 A;  1YUU A;  3WHU B;  4MZJ A;  1D1O A;  4YGC B;  3PJI A;  3CS1 A;  2L2E A;  1IIO A;  1OOH A;  3BUN B;  1Z2C B;  2JWW A;  3VRP A;  2K60 A;  1C07 A;  2M9G A;  2Q91 A;  1OSA A;  3IQO A;  2PRU A;  2AMI A;  2BL0 B;  5J3X A;  1LIN A;  1R2U A;  2CT9 A;  1PRW A;  2WC6 A;  4IJ7 A;  4PHN A;  1F71 A;  3DVE A;  2LUC A;  4A4C A;  1ODB A;  3AAJ A;  5DKN A;  2L4H A;  2LE9 B;  2M97 A;  2MA2 A;  2YGU A;  2WCJ A;  3FE8 A;  3BFH A;  3OHM B;  1TUZ A;  2HQ8 A;  2GV5 A;  3BUM B;  4JD9 A;  5IBW A;  1FI5 A;  1QWV A;  4GGN A;  2HF5 A;  2CXJ A;  2LP3 A;  3PAT A;  2HET A;  1JSA A;  1CFC A;  3CZ1 A;  3KPX A;  1RJV A;  1KSO A;  1MXL C;  2KFF A;  1XFR A;  4INW A;  5FI7 A;  1DQE A;  4PE7 A;  2AAO A;  1Z4H A;  4FTG A;  2KBI A;  4PCW A;  1KSM A;  2MJW B;  1DJI A;  2ZN8 A;  1RK9 A;  1ZMZ A;  2LHL A;  5TNC A;  1QS7 A;  2WCM A;  1QVI Z;  2WOS A;  1K90 D;  2I18 A;  2QEV A;  3OP0 A;  3CYZ A;  5K89 A;  1CFF A;  3A4U B;  1NX3 A;  2BL0 C;  3VB1 A;  2IS9 A;  1Y1X A;  2LMV A;  3R72 A;  4I5K A;  4JQ0 D;  1EG3 A;  1IQ3 A;  4PHK A;  5AAN A;  2FJU B;  3IVT A;  3VRN A;  2JUL A;  1S6J A;  3JTD B;  2KOT A;  4GNK B;  2M3W A;  4MRX A;  1SL8 A;  3I5G B;  1GGW A;  3B7A A;  3DY9 A;  3V2L A;  1YX8 A;  1SY9 A;  1M46 A;  2LMT A;  4FQO A;  1SK6 D;  4INX A;  4P2Y B;  4WRI A;  4FQT A;  1CFD A;  1OOI X;  1OQP A;  1BR1 B;  1JUO A;  1TNX A;  2AUC A;  2D8N A;  2KI4 C;  4YI9 A;  1NIW A;  3PSR A;  1K95 A;  5I2O A;  2BKI B;  2JPO A;  3D78 A;  1HT9 A;  1T14 A;  3UNW A;  5HLO A;  2B1U A;  1QLS A;  2BNX A;  4U8D A;  2M0R A;  1V1G A;  3SG4 A;  1SCM B;  1XFV O;  1FW4 A;  1WRL A;  1S1E A;  2LAP A;  1NX0 A;  2BCB A;  1XVJ A;  1WLM A;  1DJH A;  2WC8 A;  3H4S E;  3S0G A;  2LLT A;  2WCF A;  4KYN A;  3PAL A;  1C3Y A;  1E8A A;  4JWQ A;  1UHI A;  5CSI A;  3EVR A;  1J7Q A;  2TN4 A;  1UHH A;  3LK1 A;  3C1V A;  4OR9 B;  1F4Q A;  2WND A; 
#chains in the Genus database with same CATH homology
 3F45 A;  1NUB A;  1REC A;  3I5G C;  1AUI B;  1WDC B;  1YVH A;  3I5F B;  1CLB A;  4CLN A;  1L7Z A;  3GK1 A;  2ZNE A;  1Y0V H;  2BBN A;  1WY9 A;  4MVF A;  1F70 A;  1Q80 A;  2LLS A;  3KF9 A;  2H2K A;  3A8R A;  3HCM A;  1QIV A;  5KU1 A;  2JOJ A;  1JWD A;  3SG2 A;  2LCP A;  4R1E A;  3BYA A;  2Q4U A;  1K93 D;  3FWB A;  3FWC A;  5CPV A;  5JJG A;  2G2B A;  2NCP A;  1CB1 A;  2LVI A;  4TNC A;  1QX2 A;  1WRK A;  2BKH B;  1TCF A;  2F3Z A;  1BU3 A;  1SNL A;  1BOD A;  1SCM C;  4OKH A;  3D0Y B;  3O78 A;  5ER5 A;  1J1E A;  3SIA A;  2HPS A;  2JC2 A;  1NCY A;  2I2R E;  1KK8 B;  1XFU O;  2MBX A;  3GK4 X;  2BBM A;  1GQM A;  1LKJ A;  1CKK A;  1OMD A;  3ZWH A;  1DT7 B;  1MWN A;  2JPT A;  1Y1U A;  2EHB A;  4PE4 A;  5HKZ A;  3EK4 A;  1TNQ A;  1RTP 1;  3PM8 A;  4AQJ A;  3AAK A;  2SCP A;  2E30 A;  1FPW A;  3VGO A;  4QJ5 B;  1KWO B;  1S5G Z;  1K9U A;  4AQI A;  1MF8 B;  2GGZ A;  1WDC C;  3I5F C;  2ISD A;  4CFR A;  1CMF A;  1IJ5 A;  1IJ6 A;  2Y4Q A;  1JFK A;  1GJY A;  2M49 B;  3I5I B;  1KK7 Z;  1YUT A;  3DF0 B;  4NDB A;  2Y5I A;  2LV7 A;  2F33 A;  4PE0 A;  1K8U A;  2OTG B;  1CLL A;  5HKY A;  3NXA A;  1S6I A;  3CWG A;  4HRE E;  1F54 A;  1HQV A;  1ZAC A;  5D7F A;  1BLQ A;  3SG7 A;  5G08 A;  1SPY A;  3TDZ A;  1A75 B;  2L50 A;  1NPQ A;  5FYX A;  2Y1N A;  1KK8 C;  2DOQ A;  2ZFD A;  3E3R A;  3ICB A;  3NSL A;  4M2O A;  4MSP A;  3WHT B;  4CPV A;  1A4P A;  1WRZ A;  4XJK B;  1YUS A;  3SIB A;  1KQV A;  1G33 A;  1KWO C;  3PN7 B;  1DJY A;  1YRT B;  4PHM A;  1UHK A;  4XYN A;  2OS8 B;  1QX7 A;  1OOJ A;  1QTX A;  1W7J B;  2O5G A;  4NDD A;  3I5I C;  1XK4 C;  2KI6 C;  1JF0 A;  2MHH A;  3LLE A;  1YX7 A;  2G9B A;  3VRO A;  2JTT A;  2OTG C;  3NSO A;  1J55 A;  1QJT A;  4C0L A;  5GQQ C;  2LM5 A;  5B8I B;  3EVU A;  5ER4 X;  1X02 A;  4MN0 A;  2L5X B;  3BQ3 A;  2JU0 A;  3CR2 A;  1RRO A;  2L4I A;  1PVB A;  4BY4 A;  5KTY A;  1JBA A;  1N2D A;  1Y1A A;  1FI6 A;  3TDU A;  2KDH A;  1S3P A;  2KAY A;  1EH2 A;  3RLZ A;  4IL1 A;  1K96 A;  1OE9 B;  2F2P A;  1QIW A;  4ZCU A;  1EL4 A;  2KFG A;  3BOW B;  1AJ5 A;  4PAL A;  3PN7 C;  2V53 A;  1JC2 A;  1JF2 A;  4MRY A;  2QAC A;  3VRQ A;  2OS8 C;  3I5H B;  1XFZ O;  1QAT A;  1QVI Y;  2K7C A;  2OPO A;  1BJF A;  2KSP A;  1IGV A;  1SKT A;  2PMY A;  4Q04 A;  1Y6W A;  1B8L A;  2JNX A;  1SR6 B;  1OZS A;  1SCV A;  1XK4 A;  4N1G A;  1SBJ A;  3DF0 A;  1UP5 A;  3TDI A;  2NLN A;  2M1U A;  4QJ3 B;  1CLM A;  1B1G A;  1DGV A;  1K9P A;  2GGM A;  5PAL A;  1BT6 A;  1NP8 A;  3M0W A;  2K2A A;  4I5L B;  1NCX A;  1NSH A;  1ZFS A;  4YRU A;  2LLU A;  4MEW A;  1PUL A;  3BXK A;  1DF0 B;  2KI6 D;  4HRH A;  1FF1 A;  1A75 A;  1LA3 A;  3JTD C;  4GPL B;  1S6C A;  3OB2 B;  2WCB A;  1EG4 A;  1K2H A;  1N65 A;  1B7T Z;  1IG5 A;  1CM1 A;  1S26 D;  4MZK A;  4XJK A;  1VRK A;  2KHN A;  2SAS A;  4AOM A;  1A03 A;  5HKW A;  4ORC B;  4YGB B;  1EJ3 A;  5I2Q A;  1DGU A;  3I5H C;  4HSZ A;  1W7I B;  2COL B;  2H61 C;  2CCM A;  3SG3 A;  2K7B A;  4DRW A;  1S36 A;  2O60 A;  1JFJ A;  2LP2 A;  2KAX A;  4MBE A;  1SR6 C;  5I8N A;  4USL A;  2K2F A;  4BY5 A;  3EVV A;  3VRR A;  1PSR A;  1F8H A;  4OV2 A;  2I7A A;  1QLK A;  1QX5 B;  1TNW A;  3OB1 B;  1XO5 A;  2R2I A;  3D10 A;  3PFV A;  1A2X A;  5AXI A;  3IF7 A;  3GK2 A;  2FCD A;  1SL9 A;  4A4B A;  1IRJ A;  1EXR A;  3K21 A;  4N5X A;  2KFH A;  4ORB B;  1XA5 A;  3IQQ A;  1J7O A;  2A4J A;  2JTZ A;  5AEQ A;  2WCE A;  1XFY O;  4DIR A;  1ZOT B;  5HLV A;  1CDN A;  2JZI A;  2L0P A;  2JT0 A;  2KNE A;  3BOW A;  1ALW A;  1DTL A;  1BG1 A;  5I2L A;  2KYC A;  1AP4 A;  2PSR A;  1CDP A;  1SMG A;  3HX4 A;  4WQ2 A;  5AER A;  1R6P A;  1XYD A;  1BR4 B;  3DD4 A;  1NX2 A;  2LAN A;  2RGI A;  1CM4 A;  1KCY A;  2H61 A;  4M2Q A;  5DKQ A;  4CID A;  1NX1 A;  1SYM A;  4L9M A;  1NCZ A;  3AKA A;  4PHJ A;  1YUR A;  4GFT A;  3LCP C;  2F3Y A;  2E6W A;  2LVV A;  2NCO A;  4OCI A;  1LA0 A;  1N0Y A;  1LVC D;  1CNP A;  1U5I B;  1S5G Y;  4PE1 A;  2ZND A;  1NWD A;  3PLF B;  2JNF A;  4YGA A;  4GGF C;  2LNK A;  4D1E A;  2QPT A;  1SW8 A;  2L51 A;  4GAO A;  3TUY B;  3CZT X;  1KK7 Y;  4ETO A;  3JVT B;  2M8U A;  2EC6 B;  3WNX B;  2KGB C;  1CDL A;  2MRD A;  3DVK A;  1DF0 A;  1QAS A;  4JPZ B;  1M39 A;  4NDC A;  1C7W A;  4I5J A;  1NYA A;  2JT3 A;  1MR8 A;  1B8R A;  2KGR A;  2P6B B;  2JXL A;  1K9K A;  1UWO A;  2M1K B;  1BOC A;  1LXF C;  1B4C A;  1KFU S;  2BCA A;  1L2O B;  2BE4 A;  1F55 A;  2HQW A;  3CGA A;  2Y1M A;  1M63 B;  3BUX B;  2FCE A;  2WOR A;  1XFW O;  1CTR A;  1DJG A;  5CSN A;  1TNP A;  4YGD B;  1C7V A;  2MLF C;  2PAL A;  2M7L A;  1AK8 A;  1UUS A;  3D0Y A;  4I5N B;  1ZUZ A;  3TUY C;  1YVL A;  3RM1 A;  5HYD A;  2K7D A;  1J7R A;  3JVT C;  3O2P A;  2EC6 C;  2KI4 B;  4DCK A;  1TIZ A;  4GGF A;  2KQ6 A;  1V1F A;  1MHO A;  1KFU L;  1QXP A;  2I94 A;  1CDM A;  4PDZ A;  2K7O A;  1J7P A;  1YR5 A;  3CLN A;  1YTZ C;  4M2P A;  3KEV A;  3MSE B;  2CBL A;  1UHJ A;  1DJX A;  1L2O C;  2MLE C;  1TRF A;  1CFP A;  4ICB A;  1PVA A;  1RFJ A;  1TN4 A;  2M7N A;  4C0K A;  1UHN A;  1M31 A;  1YRU B;  3NSK A;  3O6B A;  3LL8 B;  1MXE A;  2CTN A;  1FBV A;  1IH0 A;  1MQ1 A;  1H8B A;  3AKB A;  3NSI A;  3OX6 A;  2LVJ A;  3KHE A;  2JRF A;  1PK0 D;  1OMV A;  2BEC A;  1U5I A;  1IWQ A;  3FS7 A;  3WXA A;  1TTX A;  2PVB A;  3ZNI A;  1IKU A;  1XFX O;  4OVN F;  2JXC A;  1KQM B;  1J1D A;  2EGD A;  5CSF A;  3SG5 A;  3DVJ A;  2L98 A;  2ZRT A;  3CTN A;  2LUX A;  3EK8 A;  2LHI A;  2KBM A;  2PAS A;  1OMR A;  1TCO B;  1B8C A;  4WQ3 A;  1SL7 A;  2LVK A;  3EKJ A;  3EKH A;  1CMG A;  1G4Y R;  2NZ0 A;  5BPJ A;  1PAL A;  2KQY A;  2MAZ A;  5DKR A;  2JT8 A;  2FOT A;  1BF5 A;  4CFQ A;  1B7T Y;  3KO0 A;  4MZL A;  4ORA B;  3SG6 A;  2KAV A;  4N1F A;  3O4Y A;  1AHR A;  2M29 A;  5AFP A;  1KFX S;  3TS5 B;  1A29 A;  1M45 A;  4HRG A;  2K0J A;  1F4O A;  1AJ4 A;  2NXQ A;  4P5O E;  2K8M B;  5F6T A;  2ZN9 A;  4E68 A;  2CNP A;  1DMO A;  3GOF A;  1K94 A;  1WLZ A;  1KQM C;  2K61 A;  1DJZ A;  3FIA A;  4YGE B;  1PSB A;  1H4B A;  1IQ5 A;  1AVS A;  1OZO A;  2KYF A;  3BUO B;  1QV0 A;  1GGZ A;  1G8I A;  3LK0 A;  4C0J A;  4DUQ A;  2BCX A;  2LC5 A;  3EK7 A;  4ZCV A;  3OX5 A;  1SRA A;  2VRG A;  5CSJ A;  4YI8 A;  1KFX L;  3SJS A;  4UPG A;  1MUX A;  1DJW A;  2ZKM X;  2F8P A;  4GUK A;  4F0Z B;  1TOP A;  1B9A A;  5KSZ A;  3DVM A;  3QRX A;  2BE6 A;  1UUR A;  3CR5 X;  2LMU A;  5D69 A;  3BUW B;  2F2O A;  1B47 A;  3TZ1 A;  1ALV A;  4QJ4 B;  3CR4 X;  3TS5 C;  4MLW A;  5JOL A;  1RWY A;  1BMO A;  4GBA A;  4NQG A;  2ZRS A;  2JQ6 A;  1DVI A;  4YBH B;  4DS7 A;  1QV1 A;  1YUU A;  3WHU B;  4MZJ A;  1D1O A;  4YGC B;  3CS1 A;  2L2E A;  3BUN B;  3VRP A;  2JWW A;  1C07 A;  2M9G A;  2Q91 A;  1OSA A;  3IQO A;  2PRU A;  2AMI A;  2BL0 B;  5J3X A;  1LIN A;  1R2U A;  2CT9 A;  1PRW A;  4PHN A;  1F71 A;  3DVE A;  2LUC A;  4A4C A;  1ODB A;  3AAJ A;  5DKN A;  2L4H A;  2LE9 B;  2M97 A;  2MA2 A;  3OHM B;  2HQ8 A;  2GV5 A;  3BUM B;  5IBW A;  1FI5 A;  4GGN A;  2HF5 A;  2CXJ A;  2LP3 A;  3PAT A;  2HET A;  1JSA A;  1CFC A;  3KPX A;  1RJV A;  1KSO A;  1MXL C;  2KFF A;  4PE7 A;  2AAO A;  4FTG A;  2KBI A;  4PCW A;  1KSM A;  2MJW B;  1DJI A;  2ZN8 A;  1RK9 A;  1ZMZ A;  2LHL A;  5TNC A;  1QS7 A;  2WOS A;  1QVI Z;  1K90 D;  2I18 A;  3OP0 A;  5K89 A;  1CFF A;  3A4U B;  1NX3 A;  2BL0 C;  2IS9 A;  1Y1X A;  2LMV A;  4I5K A;  4JQ0 D;  1IQ3 A;  1EG3 A;  4PHK A;  5AAN A;  2FJU B;  3VRN A;  2JUL A;  1S6J A;  3JTD B;  2KOT A;  4GNK B;  2M3W A;  4MRX A;  1SL8 A;  3I5G B;  1GGW A;  1YX8 A;  1SY9 A;  1M46 A;  2LMT A;  4FQO A;  1SK6 D;  4P2Y B;  4WRI A;  1CFD A;  1TNX A;  1OQP A;  1BR1 B;  1JUO A;  2AUC A;  4YI9 A;  2D8N A;  2KI4 C;  1NIW A;  3PSR A;  1K95 A;  5I2O A;  2BKI B;  1HT9 A;  5HLO A;  2B1U A;  1QLS A;  4U8D A;  2M0R A;  1V1G A;  3SG4 A;  1SCM B;  1XFV O;  1FW4 A;  1WRL A;  1S1E A;  2LAP A;  1NX0 A;  2BCB A;  1XVJ A;  1WLM A;  1DJH A;  2WC8 A;  3H4S E;  2LLT A;  2WCF A;  3PAL A;  1E8A A;  4JWQ A;  1UHI A;  5CSI A;  3EVR A;  1J7Q A;  2TN4 A;  1UHH A;  3LK1 A;  3C1V A;  4OR9 B;  1F4Q A;  2WND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...