2LANA

Nmr structure of ca2+-bound cabp1 n-domain with rdc
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
SLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calcium-binding protein 1
publication title 1H, 15N, and 13C chemical shift assignments for CaBP1 with 3 Ca2+ bound
rcsb
source organism Homo sapiens
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lanA00
4C0LA 1CFPA 1SCMC 1HQVA 4GGFC 1RECA 3CR2A 2PRUA 1C7WA 1AVSA 1J55A 2K2AA 1ALWA 4HSZA 1K9PA 2COLB 1XFWO 1F8HA 3BUOB 2M9GA 4UPGA 1U5IB 3I5IB 4M2PA 1S5GY 2PMYA 1KWOC 4M2OA 4PHNA 1QLSA 1C7VA 2OTGC 2KI6D 4IL1A 4TNCA 1KK8C 1RK9A 1G33A 4WQ3A 1NPQA 1XFVO 3BUXB 1IWQA 2LMTA 4YGDB 2LVKA 1NYAA 2K7CA 3PSRA 3LK0A 2WNDA 4MBEA 5I2OA 1XFUO 1CMFA 2JWWA 3DVEA 2K8MB 2H61C 1XO5A 1VRKA 1KQMC 1V1GA 2GGZA 5HYDA 1ZMZA 1NWDA 1YUSA 2EC6C 2JNXA 5JOLA 5D69A 1TIZA 3HX4A 2KOTA 5G08A 2KFHA 1DJHA 2F3ZA 3CLNA 1B8RA 5HKZA 3NSOA 4MZLA 1B8LA 3AKBA 1S3PA 1MXLC 5CSJA 1G8IA 1R2UA 1ALVA 3I5GC 5FYXA 5HLVA 4OCIA 1FI5A 1NSHA 3EK7A 1SW8A 1NUBA 1JUOA 4PE1A 2ZFDA 1Q80A 2MLEC 4ZCVA 1LINA 1YUUA 1BR4B 1OZOA 4MEWA 1JWDA 2CT9A 1CLLA 5ER4X 2LMUA 2BBMA 1SR6C 1M39A 1UHIA 2V53A 1XVJA 1S6IA 4YGCB 2P6BB 2LV7A 1K94A 2LUCA 3WHUB 2KYFA 1IQ3A 2LHIA 1QVIY 4I5LB 2G9BA 3SG2A 1GGZA 1A03A 1SCMB 2LP3A 1MUXA 3SIAA 5DKQA 1EJ3A 1M46A 3KEVA 3PM8A 4L9MA 5K89A 2JQ6A 4OKHA 3BOWB 1QTXA 1SL9A 1YRUB 2KAXA 3BXKA 2CXJA 3OB2B 1UWOA 1TNWA 3VRNA 1NCZA 3I5IC 1FPWA 4GUKA 3KPXA 4BY5A 1W7JB 2LHLA 1NIWA 2I2RE 4ORCB 2B1UA 1SNLA 4PHJA 1JBAA 2KSPA 1AUIB 1ZACA 4U8DA 4YI8A 2HPSA 1TCOB 2NZ0A 3IF7A 3OX5A 1JSAA 1A2XA 4PCWA 1IKUA 2I94A 2K7OA 1KSMA 3D0YA 2JTZA 4A4BA 4AQIA 3WXAA 1LA0A 4MRYA 2Y1MA 4GGNA 1CDLA 2EHBA 2AAOA 3MSEB 1JFJA 1OMDA 1IJ5A 1CM4A 2KHNA 3IQQA 4I5KA 1TN4A 3CTNA 1CFFA 2LUXA 2L2EA 4GBAA 2F2OA 3E3RA 4MSPA 2BE4A 1RWYA 5CSNA 5I2LA 4OVNF 3C1VA 1L2OB 4ETOA 1R6PA 4HRGA 4BY4A 1BT6A 3CZTX 2WC8A 1KK7Y 2F8PA 4USLA 3CWGA 2H2KA 3NXAA 2CCMA 1DJIA 1KSOA 2NLNA 1EL4A 3DF0A 3EK4A 1F70A 2O60A 1H8BA 2KDHA 1MHOA 1SKTA 2KFGA 2L0PA 3OHMB 1QX7A 1CTRA 1QJTA 3O4YA 3SG6A 2JC2A 2JT3A 1AJ5A 1K9UA 2WOSA 2GGMA 2JU0A 3EKHA 1UURA 3SIBA 2Q4UA 4XJKA 2MA2A 1K9KA 1XFYO 3SG3A 1DJZA 3EK8A 1W7IB 1AHRA 1LKJA 2KQYA 1MR8A 2HQWA 1WRLA 4JWQA 1LVCD 1BOCA 2FOTA 2FCEA 1AP4A 2K0JA 5KTYA 4NDCA 1BJFA 2LLTA 1KFUS 2IS9A 2VRGA 3M0WA 2CNPA 2BKIB 1J1EA 1XFXO 4PE7A 1XK4A 2LLUA 3CR5X 1K96A 4Q04A 5DKNA 1DJXA 1B7TY 2BCAA 4AQJA 1KQVA 3A8RA 1UHKA 2JNFA 4WRIA 2M7LA 3DVJA 1FF1A 5D7FA 4CFRA 1YRTB 3JTDB 4A4CA 1B8CA 1SRAA 1J7QA 4NQGA 3F45A 1OQPA 4DRWA 1BU3A 3BUMB 1Y1AA 1F71A 1XFZO 2E6WA 2MRDA 2G2BA 4ICBA 2M1KB 1QV0A 1QATA 4HREE 1CLBA 3LK1A 3GK1A 4YI9A 3VRRA 1N2DA 2MAZA 2SASA 2ISDA 2BL0B 2LAPA 5PALA 3WHTB 1IQ5A 1L2OC 4PE4A 3TZ1A 2DOQA 3D0YB 3LCPC 1JFKA 1TRFA 3TDIA 2OPOA 1QS7A 1F54A 1K93D 2AUCA 3I5FB 3NSIA 2BCXA 3NSKA 4R1EA 1J7RA 1OMVA 3GK2A 1DVIA 1CDNA 1L7ZA 1QX2A 1TNXA 5CSIA 2O5GA 2L5XB 1S5GZ 2Q91A 1CFCA 1BODA 1NX2A 1F4OA 3TDZA 3FWCA 1SCVA 1TCFA 1J7OA 1GJYA 1IH0A 1Y6WA 3EVUA 1N65A 2LCPA 2JXLA 3DF0B 4HRHA 1OOJA 4CIDA 4GAOA 2ZRSA 5HKYA 4OV2A 1RTP1 1DF0A 5KU1A 1J1DA 1WLZA 3BYAA 3ICBA 1DT7B 4QJ4B 5JJGA 1B1GA 2JT0A 2NCOA 3JVTB 5HLOA 2LLSA 5AANA 2FCDA 1K90D 3PFVA 5ER5A 1NCXA 1S26D 4XJKB 1QIWA 4YGAA 1WRZA 1YVLA 1CB1A 2GV5A 3PALA 2ZNDA 5AERA 1UHHA 2KFFA 3JTDC 1A75A 1NX1A 1YURA 3D10A 3GOFA 4E68A 2L4HA 3BUNB 2ZN9A 1WY9A 3CR4X 2M0RA 1AJ4A 1DGVA 1QX5B 4PDZA 1UP5A 3PN7C 2EGDA 2BECA 2PASA 3TS5C 2KGBC 1KFUL 1YR5A 4FTGA 1SMGA 2E30A 4MN0A 3RLZA 2F33A 1HT9A 1UHNA 1CLMA 1CDPA 3VGOA 3FIAA 5TNCA 1PK0D 2OS8C 1E8AA 5I8NA 1OSAA 3ZNIA 2MBXA 1JF0A 1QVIZ 2QPTA 2BL0C 4MVFA 1NCYA 3OX6A 1TOPA 1KFXS 1BMOA 1FBVA 4PALA 1YX8A 1CDMA 1DGUA 3I5FC 2ZKMX 4JPZB 4WQ2A 1XA5A 1K2HA 1DTLA 1OE9B 3OB1B 5DKRA 1UUSA 4GFTA 5GQQC 2KI4B 1D1OA 3AKAA 3GK4X 1MF8B 2KYCA 3VROA 1CKKA 2I7AA 5B8IB 1DJYA 1YUTA 3CGAA 1CMGA 1MQ1A 1PSBA 1Y0VH 5AFPA 4QJ3B 3ZWHA 4I5NB 4I5JA 3TUYB 1JF2A 2L4IA 1SL8A 1PSRA 4PHKA 1Y1UA 2ZNEA 1NP8A 3DD4A 1M63B 2M8UA 3JVTC 3KO0A 5CPVA 3A4UB 1B9AA 3BQ3A 3DVMA 3RM1A 2H61A 4MZKA 2LC5A 1B4CA 2F3YA 3SG4A 2WCEA 1DF0B 1OZSA 1PVAA 2KNEA 5IBWA 5F6TA 2WCFA 1KK7Z 3PN7B 3TS5B 1V1FA 3K21A 5CSFA 2LANA 2LMVA 2WCBA 1F55A 4GNKB 4GPLB 2LVIA 4DCKA 1K95A 3CS1A 1XYDA 2OS8B 3EVVA 4NDDA 2I18A 1XK4C 1PULA 3HCMA 4YGBB 3NSLA 1IRJA 1J7PA 2LVVA 2KAVA 1EG4A 1IJ6A 1MXEA 1SL7A 4DUQA 2Y4QA 5KSZA 2ZN8A 3FS7A 4FQOA 3DVKA 3PLFB 4NDBA 3BUWB 1A75B 1YVHA 2KBMA 2A4JA 1WDCB 3I5HB 4N1FA 4PE0A 5I2QA 1SY9A 1BF5A 1FW4A 1IG5A 1QV1A 4P2YB 2KGRA 2BE6A 4YBHB 3VRQA 1DJGA 2JRFA 1TNQA 2KI6C 1C07A 1DMOA 1FI6A 1BLQA 4ORAB 1KCYA 2LNKA 1ZFSA 2MLFC 3WNXB 1PVBA 2JT8A 3VRPA 2AMIA 3FWBA 1UHJA 2JULA 2L98A 2PSRA 4QJ5B 1F4QA 3TDUA 3KHEA 2NXQA 1B7TZ 2KI4C 4PHMA 1MWNA 2HQ8A 2K7DA 4N1GA 5HKWA 2CBLA 2R2IA 3SG7A 4CLNA 1KFXL 2SCPA 1QLKA 4C0KA 5AXIA 1U5IA 1S36A 2D8NA 2F2PA 2KBIA 2Y1NA 3TUYC 1QIVA 2L51A 3IQOA 2MHHA 1SPYA 4DS7A 4XYNA 2RGIA 1WLMA 1CNPA 1PALA 5BPJA 2K2FA 2ZRTA 2PVBA 2HF5A 3AAKA 2QACA 4CPVA 2JOJA 3SG5A 1AK8A 1K8UA 2BKHB 2JXCA 2NCPA 1CFDA 2WORA 1GQMA 4YRUA 1KWOB 3O2PA 5AEQA 1G4YR 2M29A 2OTGB 1ZUZA 3O6BA 4MZJA 1S6CA 4N5XA 1KK8B 1DJWA 1PRWA 2CTNA 4DIRA 4D1EA 1IGVA 1ZOTB 3LL8B 1SYMA 4ORBB 1ODBA 2PALA 1GGWA 2KAYA 1A29A 2LM5A 1OMRA 1KQMB 1H4BA 4MLWA 1EH2A 1LXFC 4JQ0D 2M49B 2EC6B 4OR9B 1QXPA 1BG1A 3KF9A 2MJWB 3LLEA 1BR1B 3QRXA 1B47A 1WDCC 3EVRA 3I5HC 1S6JA 1M45A 1RFJA 4AOMA 4M2QA 1RROA 1S1EA 1YTZC 4YGEB 2HETA 2K7BA 3I5GB 4ZCUA 5J3XA 3PATA 2K61A 4F0ZB 4MRXA 1RJVA 2JTTA 1A4PA 1Y1XA 1YX7A 4GGFA 2Y5IA 3EKJA 1N0YA 2KQ6A 2BBNA 3H4SE 2M7NA 2JPTA 1EG3A 3SJSA 1SR6B 2TN4A 2LP2A 3BOWA 1X02A 2M3WA 3OP0A 1CM1A 1JC2A 4P5OE 2M1UA 1M31A 3O78A 2FJUB 2LVJA 2LE9B 1EXRA 1SBJA 1NX3A 4CFQA 1TNPA 2BCBA 1LA3A 2JZIA 1SK6D 2M97A 1TTXA 4C0JA 3AAJA 2L50A 1NX0A 1WRKA 1QASA
chains in the Genus database with same CATH superfamily
3CZ1A 4C0LA 1CFPA 1SCMC 1HQVA 4GGFC 1RECA 3CR2A 2PRUA 2WCKA 1C7WA 1AVSA 1J55A 2K2AA 1ALWA 3D76A 1K9PA 2COLB 1XFWO 4HSZA 1F8HA 3BUOB 2M9GA 4UPGA 1U5IB 3I5IB 4M2PA 1S5GY 2PMYA 3SS3A 3BFHA 1KWOC 4M2OA 4PHNA 1QLSA 3B86A 2OTGC 2KI6D 3EG5B 4IL1A 1C7VA 3PM2A 4INWA 4TNCA 1KK8C 1RK9A 1G33A 4WQ3A 1NPQA 3CABA 1XFVO 3BUXB 1IWQA 2LMTA 4YGDB 2LVKA 1NYAA 2K7CA 3PSRA 3LK0A 2WNDA 4MBEA 5I2OA 1XFUO 4JD9A 3RZSA 2JWWA 3DVEA 1CMFA 2K8MB 2QEOA 2H61C 1XO5A 1LS8A 1VRKA 1KQMC 1V1GA 2GGZA 5HYDA 1ZMZA 1NWDA 1YUSA 2EC6C 2JNXA 5JOLA 5D69A 4INXA 1TIZA 3HX4A 2KOTA 5G08A 2KFHA 1DJHA 2F3ZA 3CLNA 5FI6A 1B8RA 3SS4A 5HKZA 3NSOA 4MZLA 1B8LA 3AKBA 1S3PA 1MXLC 5CSJA 5FI2A 1G8IA 1R2UA 1ALVA 3I5GC 5FYXA 5HLVA 4OCIA 1FI5A 1NSHA 3EK7A 1SW8A 3UO9A 1NUBA 1JUOA 4PE1A 2ZFDA 1Q80A 2MLEC 4ZCVA 1LINA 3B87A 1YUUA 1BR4B 1OZOA 4MEWA 1JWDA 2CT9A 1CLLA 2P70A 5ER4X 2LMUA 2BBMA 1SR6C 1M39A 1UHIA 2V53A 1XVJA 1S6IA 2PQLA 4YGCB 2P6BB 2LV7A 1K94A 2LUCA 3WHUB 2KYFA 1IQ3A 2LHIA 1QVIY 4I5LB 2G9BA 3SG2A 1GGZA 1A03A 2WCMA 3CZ2A 1SCMB 2LP3A 1MUXA 2WCJA 3D74A 3SIAA 5DKQA 1EJ3A 1M46A 3CYZA 3KEVA 3PM8A 4L9MA 2JQ6A 5K89A 1TWOA 1T14A 4OKHA 2KLDA 3BOWB 1QTXA 1SL9A 1YRUB 2KAXA 3BXKA 2CXJA 3OB2B 1P28A 1UWOA 3SS5A 1TNWA 1OOIX 3VRNA 1NCZA 3I5IC 1FPWA 4GUKA 5KSZA 3KPXA 4BY5A 1W7JB 2LHLA 4IJ7A 1NIWA 2I2RE 4ORCB 1DC1A 2B1UA 1SNLA 4PHJA 1JBAA 2KSPA 1AUIB 1ZACA 4U8DA 4YI8A 2HPSA 1TCOB 2NZ0A 3IF7A 3OX5A 1JSAA 1A2XA 4PCWA 1IKUA 2I94A 2K7OA 1KSMA 3S0DA 3D0YA 2JTZA 4A4BA 4AQIA 3WXAA 2L2CA 1LA0A 4MRYA 2Y1MA 4GGNA 1CDLA 1DEKA 2EHBA 2AAOA 3MSEB 1JFJA 1OMDA 1IJ5A 1CM4A 2KHNA 1ORGA 3IQQA 4I5KA 1TN4A 2ERBA 3CTNA 1CFFA 2LUXA 1W9ZA 2L2EA 2F2OA 3E3RA 4GBAA 2BE4A 1RWYA 4MSPA 5CSNA 4OVNF 3C1VA 5I2LA 1L2OB 4ETOA 1R6PA 4HRGA 4BY4A 1BT6A 3CZTX 2WC8A 1KK7Y 2F8PA 4USLA 3CWGA 2H2KA 4OZDA 3S0AA 3NXAA 1OW4A 2CCMA 1DJIA 1KSOA 1OOGA 2NLNA 1EL4A 3DF0A 2QEHA 3EK4A 1F70A 2O60A 1H8BA 2KDHA 3NHIA 1MHOA 1SKTA 2KFGA 2L0PA 3OHMB 1QX7A 4KYNA 1CTRA 1QJTA 3O4YA 3SG6A 2JC2A 2JT3A 1AJ5A 1K9UA 2WOSA 2GGMA 2JU0A 3EKHA 1UURA 3SIBA 2WC6A 2Q4UA 4XJKA 2MA2A 1K9KA 1XFYO 1GM0A 3L47A 1DJZA 3SG3A 3EK8A 1W7IB 1AHRA 3D73A 1LKJA 2KQYA 1MR8A 2HQWA 5EL2A 1WRLA 4JWQA 1LVCD 1BOCA 2FOTA 2FCEA 1AP4A 2K0JA 5KTYA 4NDCA 1BJFA 2LLTA 3OGNA 1KFUS 2IS9A 2VRGA 3M0WA 2CNPA 2BKIB 1J1EA 1XFXO 4PE7A 1XK4A 2LLUA 3CR5X 1K96A 4Q04A 5DKNA 1DJXA 1B7TY 2BCAA 4AQJA 1KQVA 3A8RA 1UHKA 2JNFA 4WRIA 2M7LA 3DVJA 1FF1A 5D7FA 4CFRA 1YRTB 3JTDB 4A4CA 1B8CA 1SRAA 1J7QA 4NQGA 3F45A 1OQPA 4DRWA 1BU3A 3BUMB 2P71A 1Y1AA 1OOHA 2KPHA 1F71A 4F7FA 1XFZO 2E6WA 2MRDA 2G2BA 4ICBA 3UNWA 2M1KB 1QV0A 1QATA 4HREE 1CLBA 3LK1A 3GK1A 2L5YA 4YI9A 1N2DA 2MAZA 3VRRA 2SASA 2ISDA 2BL0B 2LAPA 5PALA 3WHTB 1IQ5A 1L2OC 2PYQA 4PE4A 3TZ1A 2DOQA 3D0YB 2YGUA 2K60A 3LCPC 1JFKA 1TRFA 3TDIA 3S0EA 2OPOA 1QS7A 1F54A 1K93D 2AUCA 3I5FB 3NSIA 2BCXA 3NSKA 4R1EA 1J7RA 1OMVA 3GK2A 1DVIA 1CDNA 1L7ZA 1QX2A 1TNXA 5CSIA 2O5GA 2L5XB 1S5GZ 2Q91A 1CFCA 1BODA 1NX2A 1F4OA 3TDZA 3FWCA 3S0FA 1SCVA 1TCFA 1J7OA 1GJYA 1IH0A 1Y6WA 3EVUA 1N65A 2LCPA 2JXLA 3DF0B 4HRHA 2H8VA 1OOJA 4CIDA 4GAOA 3IVTA 2ZRSA 5HKYA 4OV2A 1RTP1 3BJHA 1DF0A 5KU1A 1J1DA 1WLZA 3BYAA 3ICBA 3DYEA 1DT7B 4QJ4B 5JJGA 1B1GA 2JT0A 3DY9A 2NCOA 3PJIA 3JVTB 5HLOA 2LLSA 1DQEA 3O4XA 5AANA 2FCDA 1K90D 3PFVA 5ER5A 1NCXA 1S26D 4XJKB 1QIWA 4YGAA 1WRZA 3N7HA 1YVLA 1CB1A 2GV5A 3PALA 2ZNDA 5AERA 1UHHA 3D78A 2KFFA 3JTDC 1A75A 1NX1A 1YURA 3D10A 3GOFA 4E68A 2L4HA 4PT1A 3BUNB 2ZN9A 1WY9A 3CR4X 2M0RA 1AJ4A 1DGVA 1QX5B 3QMEA 4PDZA 1UP5A 5FI7A 3PN7C 2EGDA 2BECA 2PASA 3NGVA 3TS5C 2KGBC 3BFBA 1KFUL 1YR5A 4FTGA 1SMGA 2E30A 4MN0A 3RLZA 2F33A 1HT9A 1UHNA 1CLMA 1CDPA 3VGOA 3FIAA 5TNCA 1PK0D 2OS8C 3R1PA 1E8AA 5I8NA 1OSAA 3ZNIA 2MBXA 1JF0A 1QVIZ 1C3ZA 2QPTA 2BL0C 5I2QA 4MVFA 1NCYA 3OX6A 1TOPA 3Q8IA 2BAPA 1KFXS 1BMOA 1FBVA 4PALA 1YX8A 1CDMA 1DGUA 3I5FC 2ZKMX 4JPZB 4WQ2A 1XA5A 1K2HA 1DTLA 1OE9B 3OB1B 3NHTA 5DKRA 1OOFA 1UUSA 3FE6A 4GFTA 5GQQC 3OBVA 2KI4B 1D1OA 3AKAA 3GK4X 1MF8B 2KYCA 3VROA 1CKKA 2I7AA 5B8IB 1DJYA 1YUTA 3CGAA 1CMGA 1MQ1A 1PSBA 1Y0VH 5AFPA 4QJ3B 3ZWHA 4I5NB 4I5JA 3TUYB 1JF2A 2L4IA 1SL8A 1PSRA 2WCLA 4PHKA 1Y1UA 2ZNEA 1NP8A 3DD4A 1M63B 2M8UA 3JVTC 3KO0A 5CPVA 3A4UB 1B9AA 3BQ3A 3B88A 3DVMA 3RM1A 2H61A 4MZKA 2LC5A 1B4CA 2F3YA 3SG4A 2WCEA 1DF0B 1OZSA 1PVAA 1QWVA 2KNEA 2WC5A 5IBWA 5F6TA 2WCFA 1KK7Z 3PN7B 3TS5B 5HL1A 1V1FA 3K21A 4JKTA 2LANA 2LMVA 2WCBA 5CSFA 1BF5A 1F55A 4GNKB 4GPLB 2LVIA 4DCKA 1K95A 3CS1A 1XYDA 2OS8B 3EVVA 4FQTA 2I18A 4NDDA 1XK4C 1PULA 2QEVA 3HCMA 3R1VA 4YGBB 3NSLA 1IRJA 1J7PA 2LVVA 2KAVA 1EG4A 1IJ6A 1SL7A 1Z4HA 1MXEA 2Y4QA 4DUQA 2ZN8A 3FS7A 4FQOA 3DVKA 3PLFB 4NDBA 3BUWB 2KLEA 1A75B 1YVHA 2FJYA 1TUJA 2KBMA 3S0BA 3S0GA 3FE8A 2A4JA 1WDCB 3I5HB 4N1FA 4PE0A 3FE9A 1SY9A 3V2LA 1FW4A 1IG5A 1QV1A 4P2YB 2KGRA 2BE6A 4YBHB 3DZTA 3VRQA 1DJGA 2JRFA 1TNQA 2KI6C 3R1OA 3DXLA 1C07A 1DMOA 1FI6A 1BLQA 4ORAB 1KCYA 2LNKA 1ZFSA 2MLFC 3WNXB 1PVBA 2JT8A 3VRPA 2AMIA 3FWBA 1UHJA 2JULA 2BNXA 2L98A 2PSRA 4QJ5B 1F4QA 3TDUA 3KHEA 2NXQA 1B7TZ 2KI4C 4PHMA 1MWNA 2HQ8A 2K7DA 4N1GA 5HKWA 2CBLA 2R2IA 5D3OA 3SG7A 4CLNA 1IIOA 1KFXL 2JPOA 2SCPA 1QLKA 4C0KA 5AXIA 1U5IA 1S36A 2D8NA 2F2PA 2KBIA 2Y1NA 3TUYC 3K1EA 1QIVA 2L51A 3IQOA 2MHHA 1SPYA 1XFRA 4DS7A 3CZ0A 4XYNA 2RGIA 1WLMA 1CNPA 1C3YA 1PALA 5BPJA 2K2FA 2ZRTA 2PVBA 2HF5A 3AAKA 2QACA 4CPVA 2JOJA 3SG5A 2WCHA 1AK8A 1K8UA 2BKHB 2JXCA 1SSEB 2GTEA 2NCPA 1CFDA 2WORA 1GQMA 4YRUA 1KWOB 3O2PA 5AEQA 1G4YR 3B6XA 2M29A 2OTGB 1ZUZA 3O6BA 4MZJA 1S6CA 4N5XA 1KK8B 3CDNA 1DJWA 1PRWA 2CTNA 4DIRA 4D1EA 1IGVA 1ZOTB 3LL8B 1SYMA 4ORBB 3L4LA 1DELA 1ODBA 2PALA 3R72A 5I94A 1GGWA 2KAYA 1A29A 2LM5A 1OMRA 1KQMB 3D77A 1H4BA 4MLWA 1EH2A 1LXFC 4JQ0D 2M49B 2EC6B 4OR9B 1QXPA 1BG1A 3L4AA 3KF9A 2MJWB 3LLEA 1BR1B 3QRXA 1B47A 1WDCC 3EVRA 3I5HC 1S6JA 2QDIA 1M45A 3VB1A 1RFJA 4AOMA 4M2QA 1RROA 1S1EA 1YTZC 4YGEB 2HETA 1TUZA 2K7BA 3I5GB 4ZCUA 5J3XA 3PATA 2K61A 4F0ZB 4MRXA 1RJVA 1Z2CB 1A4PA 2JTTA 1Y1XA 1YX7A 4GGFA 2Y5IA 3EKJA 1N0YA 5DICA 2KQ6A 2BBNA 3H4SE 2M7NA 3B7AA 2JPTA 1EG3A 3SJSA 1SR6B 2QEBA 2TN4A 2LP2A 3D75A 3BOWA 1X02A 2M3WA 3OP0A 1CM1A 1JC2A 4P5OE 2M1UA 1M31A 3O78A 2FJUB 2LVJA 2LE9B 1EXRA 1SBJA 1NX3A 3BFAA 1TNPA 4CFQA 1LA3A 2BCBA 2JZIA 1SK6D 2M97A 1TTXA 4C0JA 3AAJA 2L50A 1NX0A 1WRKA 1QASA
chains in the Genus database with same CATH topology
4C0LA 1CFPA 1SCMC 1HQVA 4GGFC 1RECA 3CR2A 2PRUA 1C7WA 1AVSA 1J55A 2K2AA 1ALWA 4HSZA 1K9PA 2COLB 1XFWO 1F8HA 3BUOB 2M9GA 4UPGA 1U5IB 3I5IB 4M2PA 1S5GY 2PMYA 1KWOC 4M2OA 4PHNA 1QLSA 1C7VA 2OTGC 2KI6D 4IL1A 4TNCA 1KK8C 1RK9A 1G33A 4WQ3A 1NPQA 1XFVO 3BUXB 1IWQA 2LMTA 4YGDB 2LVKA 1NYAA 2K7CA 3PSRA 3LK0A 2WNDA 4MBEA 5I2OA 1XFUO 1CMFA 2JWWA 3DVEA 2K8MB 2H61C 1XO5A 1VRKA 1KQMC 1V1GA 2GGZA 5HYDA 1ZMZA 1NWDA 1YUSA 2EC6C 2JNXA 5JOLA 5D69A 1TIZA 3HX4A 2KOTA 5G08A 2KFHA 1DJHA 2F3ZA 3CLNA 1B8RA 5HKZA 3NSOA 4MZLA 1B8LA 3AKBA 1S3PA 1MXLC 5CSJA 1G8IA 1R2UA 1ALVA 3I5GC 5FYXA 5HLVA 4OCIA 1FI5A 1NSHA 3EK7A 1SW8A 1NUBA 1JUOA 4PE1A 2ZFDA 1Q80A 2MLEC 4ZCVA 1LINA 1YUUA 1BR4B 1OZOA 4MEWA 1JWDA 2CT9A 1CLLA 5ER4X 2LMUA 2BBMA 1SR6C 1M39A 1UHIA 2V53A 1XVJA 1S6IA 4YGCB 2P6BB 2LV7A 1K94A 2LUCA 3WHUB 2KYFA 1IQ3A 2LHIA 1QVIY 4I5LB 2G9BA 3SG2A 1GGZA 1A03A 1SCMB 2LP3A 1MUXA 3SIAA 5DKQA 1EJ3A 1M46A 3KEVA 3PM8A 4L9MA 5K89A 2JQ6A 4OKHA 3BOWB 1QTXA 1SL9A 1YRUB 2KAXA 3BXKA 2CXJA 3OB2B 1UWOA 1TNWA 3VRNA 1NCZA 3I5IC 1FPWA 4GUKA 3KPXA 4BY5A 1W7JB 2LHLA 1NIWA 2I2RE 4ORCB 2B1UA 1SNLA 4PHJA 1JBAA 2KSPA 1AUIB 1ZACA 4U8DA 4YI8A 2HPSA 1TCOB 2NZ0A 3IF7A 3OX5A 1JSAA 1A2XA 4PCWA 1IKUA 2I94A 2K7OA 1KSMA 3D0YA 2JTZA 4A4BA 4AQIA 3WXAA 1LA0A 4MRYA 2Y1MA 4GGNA 1CDLA 2EHBA 2AAOA 3MSEB 1JFJA 1OMDA 1IJ5A 1CM4A 2KHNA 3IQQA 4I5KA 1TN4A 3CTNA 1CFFA 2LUXA 2L2EA 4GBAA 2F2OA 3E3RA 4MSPA 2BE4A 1RWYA 5CSNA 5I2LA 4OVNF 3C1VA 1L2OB 4ETOA 1R6PA 4HRGA 4BY4A 1BT6A 3CZTX 2WC8A 1KK7Y 2F8PA 4USLA 3CWGA 2H2KA 3NXAA 2CCMA 1DJIA 1KSOA 2NLNA 1EL4A 3DF0A 3EK4A 1F70A 2O60A 1H8BA 2KDHA 1MHOA 1SKTA 2KFGA 2L0PA 3OHMB 1QX7A 1CTRA 1QJTA 3O4YA 3SG6A 2JC2A 2JT3A 1AJ5A 1K9UA 2WOSA 2GGMA 2JU0A 3EKHA 1UURA 3SIBA 2Q4UA 4XJKA 2MA2A 1K9KA 1XFYO 3SG3A 1DJZA 3EK8A 1W7IB 1AHRA 1LKJA 2KQYA 1MR8A 2HQWA 1WRLA 4JWQA 1LVCD 1BOCA 2FOTA 2FCEA 1AP4A 2K0JA 5KTYA 4NDCA 1BJFA 2LLTA 1KFUS 2IS9A 2VRGA 3M0WA 2CNPA 2BKIB 1J1EA 1XFXO 4PE7A 1XK4A 2LLUA 3CR5X 1K96A 4Q04A 5DKNA 1DJXA 1B7TY 2BCAA 4AQJA 1KQVA 3A8RA 1UHKA 2JNFA 4WRIA 2M7LA 3DVJA 1FF1A 5D7FA 4CFRA 1YRTB 3JTDB 4A4CA 1B8CA 1SRAA 1J7QA 4NQGA 3F45A 1OQPA 4DRWA 1BU3A 3BUMB 1Y1AA 1F71A 1XFZO 2E6WA 2MRDA 2G2BA 4ICBA 2M1KB 1QV0A 1QATA 4HREE 1CLBA 3LK1A 3GK1A 4YI9A 3VRRA 1N2DA 2MAZA 2SASA 2ISDA 2BL0B 2LAPA 5PALA 3WHTB 1IQ5A 1L2OC 4PE4A 3TZ1A 2DOQA 3D0YB 3LCPC 1JFKA 1TRFA 3TDIA 2OPOA 1QS7A 1F54A 1K93D 2AUCA 3I5FB 3NSIA 2BCXA 3NSKA 4R1EA 1J7RA 1OMVA 3GK2A 1DVIA 1CDNA 1L7ZA 1QX2A 1TNXA 5CSIA 2O5GA 2L5XB 1S5GZ 2Q91A 1CFCA 1BODA 1NX2A 1F4OA 3TDZA 3FWCA 1SCVA 1TCFA 1J7OA 1GJYA 1IH0A 1Y6WA 3EVUA 1N65A 2LCPA 2JXLA 3DF0B 4HRHA 1OOJA 4CIDA 4GAOA 2ZRSA 5HKYA 4OV2A 1RTP1 1DF0A 5KU1A 1J1DA 1WLZA 3BYAA 3ICBA 1DT7B 4QJ4B 5JJGA 1B1GA 2JT0A 2NCOA 3JVTB 5HLOA 2LLSA 5AANA 2FCDA 1K90D 3PFVA 5ER5A 1NCXA 1S26D 4XJKB 1QIWA 4YGAA 1WRZA 1YVLA 1CB1A 2GV5A 3PALA 2ZNDA 5AERA 1UHHA 2KFFA 3JTDC 1A75A 1NX1A 1YURA 3D10A 3GOFA 4E68A 2L4HA 3BUNB 2ZN9A 1WY9A 3CR4X 2M0RA 1AJ4A 1DGVA 1QX5B 4PDZA 1UP5A 3PN7C 2EGDA 2BECA 2PASA 3TS5C 2KGBC 1KFUL 1YR5A 4FTGA 1SMGA 2E30A 4MN0A 3RLZA 2F33A 1HT9A 1UHNA 1CLMA 1CDPA 3VGOA 3FIAA 5TNCA 1PK0D 2OS8C 1E8AA 5I8NA 1OSAA 3ZNIA 2MBXA 1JF0A 1QVIZ 2QPTA 2BL0C 4MVFA 1NCYA 3OX6A 1TOPA 1KFXS 1BMOA 1FBVA 4PALA 1YX8A 1CDMA 1DGUA 3I5FC 2ZKMX 4JPZB 4WQ2A 1XA5A 1K2HA 1DTLA 1OE9B 3OB1B 5DKRA 1UUSA 4GFTA 5GQQC 2KI4B 1D1OA 3AKAA 3GK4X 1MF8B 2KYCA 3VROA 1CKKA 2I7AA 5B8IB 1DJYA 1YUTA 3CGAA 1CMGA 1MQ1A 1PSBA 1Y0VH 5AFPA 4QJ3B 3ZWHA 4I5NB 4I5JA 3TUYB 1JF2A 2L4IA 1SL8A 1PSRA 4PHKA 1Y1UA 2ZNEA 1NP8A 3DD4A 1M63B 2M8UA 3JVTC 3KO0A 5CPVA 3A4UB 1B9AA 3BQ3A 3DVMA 3RM1A 2H61A 4MZKA 2LC5A 1B4CA 2F3YA 3SG4A 2WCEA 1DF0B 1OZSA 1PVAA 2KNEA 5IBWA 5F6TA 2WCFA 1KK7Z 3PN7B 3TS5B 1V1FA 3K21A 5CSFA 2LANA 2LMVA 2WCBA 1F55A 4GNKB 4GPLB 2LVIA 4DCKA 1K95A 3CS1A 1XYDA 2OS8B 3EVVA 4NDDA 2I18A 1XK4C 1PULA 3HCMA 4YGBB 3NSLA 1IRJA 1J7PA 2LVVA 2KAVA 1EG4A 1IJ6A 1MXEA 1SL7A 4DUQA 2Y4QA 5KSZA 2ZN8A 3FS7A 4FQOA 3DVKA 3PLFB 4NDBA 3BUWB 1A75B 1YVHA 2KBMA 2A4JA 1WDCB 3I5HB 4N1FA 4PE0A 5I2QA 1SY9A 1BF5A 1FW4A 1IG5A 1QV1A 4P2YB 2KGRA 2BE6A 4YBHB 3VRQA 1DJGA 2JRFA 1TNQA 2KI6C 1C07A 1DMOA 1FI6A 1BLQA 4ORAB 1KCYA 2LNKA 1ZFSA 2MLFC 3WNXB 1PVBA 2JT8A 3VRPA 2AMIA 3FWBA 1UHJA 2JULA 2L98A 2PSRA 4QJ5B 1F4QA 3TDUA 3KHEA 2NXQA 1B7TZ 2KI4C 4PHMA 1MWNA 2HQ8A 2K7DA 4N1GA 5HKWA 2CBLA 2R2IA 3SG7A 4CLNA 1KFXL 2SCPA 1QLKA 4C0KA 5AXIA 1U5IA 1S36A 2D8NA 2F2PA 2KBIA 2Y1NA 3TUYC 1QIVA 2L51A 3IQOA 2MHHA 1SPYA 4DS7A 4XYNA 2RGIA 1WLMA 1CNPA 1PALA 5BPJA 2K2FA 2ZRTA 2PVBA 2HF5A 3AAKA 2QACA 4CPVA 2JOJA 3SG5A 1AK8A 1K8UA 2BKHB 2JXCA 2NCPA 1CFDA 2WORA 1GQMA 4YRUA 1KWOB 3O2PA 5AEQA 1G4YR 2M29A 2OTGB 1ZUZA 3O6BA 4MZJA 1S6CA 4N5XA 1KK8B 1DJWA 1PRWA 2CTNA 4DIRA 4D1EA 1IGVA 1ZOTB 3LL8B 1SYMA 4ORBB 1ODBA 2PALA 1GGWA 2KAYA 1A29A 2LM5A 1OMRA 1KQMB 1H4BA 4MLWA 1EH2A 1LXFC 4JQ0D 2M49B 2EC6B 4OR9B 1QXPA 1BG1A 3KF9A 2MJWB 3LLEA 1BR1B 3QRXA 1B47A 1WDCC 3EVRA 3I5HC 1S6JA 1M45A 1RFJA 4AOMA 4M2QA 1RROA 1S1EA 1YTZC 4YGEB 2HETA 2K7BA 3I5GB 4ZCUA 5J3XA 3PATA 2K61A 4F0ZB 4MRXA 1RJVA 2JTTA 1A4PA 1Y1XA 1YX7A 4GGFA 2Y5IA 3EKJA 1N0YA 2KQ6A 2BBNA 3H4SE 2M7NA 2JPTA 1EG3A 3SJSA 1SR6B 2TN4A 2LP2A 3BOWA 1X02A 2M3WA 3OP0A 1CM1A 1JC2A 4P5OE 2M1UA 1M31A 3O78A 2FJUB 2LVJA 2LE9B 1EXRA 1SBJA 1NX3A 4CFQA 1TNPA 2BCBA 1LA3A 2JZIA 1SK6D 2M97A 1TTXA 4C0JA 3AAJA 2L50A 1NX0A 1WRKA 1QASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0L A;  1CFP A;  1SCM C;  1HQV A;  4GGF C;  1REC A;  3CR2 A;  2PRU A;  1C7W A;  1AVS A;  1J55 A;  2K2A A;  1ALW A;  4HSZ A;  1K9P A;  2COL B;  1XFW O;  1F8H A;  3BUO B;  2M9G A;  4UPG A;  1U5I B;  3I5I B;  4M2P A;  1S5G Y;  2PMY A;  1KWO C;  4M2O A;  4PHN A;  1QLS A;  1C7V A;  2OTG C;  2KI6 D;  4IL1 A;  4TNC A;  1KK8 C;  1RK9 A;  1G33 A;  4WQ3 A;  1NPQ A;  1XFV O;  3BUX B;  1IWQ A;  2LMT A;  4YGD B;  2LVK A;  1NYA A;  2K7C A;  3PSR A;  3LK0 A;  2WND A;  4MBE A;  5I2O A;  1XFU O;  1CMF A;  2JWW A;  3DVE A;  2K8M B;  2H61 C;  1XO5 A;  1VRK A;  1KQM C;  1V1G A;  2GGZ A;  5HYD A;  1ZMZ A;  1NWD A;  1YUS A;  2EC6 C;  2JNX A;  5JOL A;  5D69 A;  1TIZ A;  3HX4 A;  2KOT A;  5G08 A;  2KFH A;  1DJH A;  2F3Z A;  3CLN A;  1B8R A;  5HKZ A;  3NSO A;  4MZL A;  1B8L A;  3AKB A;  1S3P A;  1MXL C;  5CSJ A;  1G8I A;  1R2U A;  1ALV A;  3I5G C;  5FYX A;  5HLV A;  4OCI A;  1FI5 A;  1NSH A;  3EK7 A;  1SW8 A;  1NUB A;  1JUO A;  4PE1 A;  2ZFD A;  1Q80 A;  2MLE C;  4ZCV A;  1LIN A;  1YUU A;  1BR4 B;  1OZO A;  4MEW A;  1JWD A;  2CT9 A;  1CLL A;  5ER4 X;  2LMU A;  2BBM A;  1SR6 C;  1M39 A;  1UHI A;  2V53 A;  1XVJ A;  1S6I A;  4YGC B;  2P6B B;  2LV7 A;  1K94 A;  2LUC A;  3WHU B;  2KYF A;  1IQ3 A;  2LHI A;  1QVI Y;  4I5L B;  2G9B A;  3SG2 A;  1GGZ A;  1A03 A;  1SCM B;  2LP3 A;  1MUX A;  3SIA A;  5DKQ A;  1EJ3 A;  1M46 A;  3KEV A;  3PM8 A;  4L9M A;  5K89 A;  2JQ6 A;  4OKH A;  3BOW B;  1QTX A;  1SL9 A;  1YRU B;  2KAX A;  3BXK A;  2CXJ A;  3OB2 B;  1UWO A;  1TNW A;  3VRN A;  1NCZ A;  3I5I C;  1FPW A;  4GUK A;  3KPX A;  4BY5 A;  1W7J B;  2LHL A;  1NIW A;  2I2R E;  4ORC B;  2B1U A;  1SNL A;  4PHJ A;  1JBA A;  2KSP A;  1AUI B;  1ZAC A;  4U8D A;  4YI8 A;  2HPS A;  1TCO B;  2NZ0 A;  3IF7 A;  3OX5 A;  1JSA A;  1A2X A;  4PCW A;  1IKU A;  2I94 A;  2K7O A;  1KSM A;  3D0Y A;  2JTZ A;  4A4B A;  4AQI A;  3WXA A;  1LA0 A;  4MRY A;  2Y1M A;  4GGN A;  1CDL A;  2EHB A;  2AAO A;  3MSE B;  1JFJ A;  1OMD A;  1IJ5 A;  1CM4 A;  2KHN A;  3IQQ A;  4I5K A;  1TN4 A;  3CTN A;  1CFF A;  2LUX A;  2L2E A;  4GBA A;  2F2O A;  3E3R A;  4MSP A;  2BE4 A;  1RWY A;  5CSN A;  5I2L A;  4OVN F;  3C1V A;  1L2O B;  4ETO A;  1R6P A;  4HRG A;  4BY4 A;  1BT6 A;  3CZT X;  2WC8 A;  1KK7 Y;  2F8P A;  4USL A;  3CWG A;  2H2K A;  3NXA A;  2CCM A;  1DJI A;  1KSO A;  2NLN A;  1EL4 A;  3DF0 A;  3EK4 A;  1F70 A;  2O60 A;  1H8B A;  2KDH A;  1MHO A;  1SKT A;  2KFG A;  2L0P A;  3OHM B;  1QX7 A;  1CTR A;  1QJT A;  3O4Y A;  3SG6 A;  2JC2 A;  2JT3 A;  1AJ5 A;  1K9U A;  2WOS A;  2GGM A;  2JU0 A;  3EKH A;  1UUR A;  3SIB A;  2Q4U A;  4XJK A;  2MA2 A;  1K9K A;  1XFY O;  3SG3 A;  1DJZ A;  3EK8 A;  1W7I B;  1AHR A;  1LKJ A;  2KQY A;  1MR8 A;  2HQW A;  1WRL A;  4JWQ A;  1LVC D;  1BOC A;  2FOT A;  2FCE A;  1AP4 A;  2K0J A;  5KTY A;  4NDC A;  1BJF A;  2LLT A;  1KFU S;  2IS9 A;  2VRG A;  3M0W A;  2CNP A;  2BKI B;  1J1E A;  1XFX O;  4PE7 A;  1XK4 A;  2LLU A;  3CR5 X;  1K96 A;  4Q04 A;  5DKN A;  1DJX A;  1B7T Y;  2BCA A;  4AQJ A;  1KQV A;  3A8R A;  1UHK A;  2JNF A;  4WRI A;  2M7L A;  3DVJ A;  1FF1 A;  5D7F A;  4CFR A;  1YRT B;  3JTD B;  4A4C A;  1B8C A;  1SRA A;  1J7Q A;  4NQG A;  3F45 A;  1OQP A;  4DRW A;  1BU3 A;  3BUM B;  1Y1A A;  1F71 A;  1XFZ O;  2E6W A;  2MRD A;  2G2B A;  4ICB A;  2M1K B;  1QV0 A;  1QAT A;  4HRE E;  1CLB A;  3LK1 A;  3GK1 A;  4YI9 A;  3VRR A;  1N2D A;  2MAZ A;  2SAS A;  2ISD A;  2BL0 B;  2LAP A;  5PAL A;  3WHT B;  1IQ5 A;  1L2O C;  4PE4 A;  3TZ1 A;  2DOQ A;  3D0Y B;  3LCP C;  1JFK A;  1TRF A;  3TDI A;  2OPO A;  1QS7 A;  1F54 A;  1K93 D;  2AUC A;  3I5F B;  3NSI A;  2BCX A;  3NSK A;  4R1E A;  1J7R A;  1OMV A;  3GK2 A;  1DVI A;  1CDN A;  1L7Z A;  1QX2 A;  1TNX A;  5CSI A;  2O5G A;  2L5X B;  1S5G Z;  2Q91 A;  1CFC A;  1BOD A;  1NX2 A;  1F4O A;  3TDZ A;  3FWC A;  1SCV A;  1TCF A;  1J7O A;  1GJY A;  1IH0 A;  1Y6W A;  3EVU A;  1N65 A;  2LCP A;  2JXL A;  3DF0 B;  4HRH A;  1OOJ A;  4CID A;  4GAO A;  2ZRS A;  5HKY A;  4OV2 A;  1RTP 1;  1DF0 A;  5KU1 A;  1J1D A;  1WLZ A;  3BYA A;  3ICB A;  1DT7 B;  4QJ4 B;  5JJG A;  1B1G A;  2JT0 A;  2NCO A;  3JVT B;  5HLO A;  2LLS A;  5AAN A;  2FCD A;  1K90 D;  3PFV A;  5ER5 A;  1NCX A;  1S26 D;  4XJK B;  1QIW A;  4YGA A;  1WRZ A;  1YVL A;  1CB1 A;  2GV5 A;  3PAL A;  2ZND A;  5AER A;  1UHH A;  2KFF A;  3JTD C;  1A75 A;  1NX1 A;  1YUR A;  3D10 A;  3GOF A;  4E68 A;  2L4H A;  3BUN B;  2ZN9 A;  1WY9 A;  3CR4 X;  2M0R A;  1AJ4 A;  1DGV A;  1QX5 B;  4PDZ A;  1UP5 A;  3PN7 C;  2EGD A;  2BEC A;  2PAS A;  3TS5 C;  2KGB C;  1KFU L;  1YR5 A;  4FTG A;  1SMG A;  2E30 A;  4MN0 A;  3RLZ A;  2F33 A;  1HT9 A;  1UHN A;  1CLM A;  1CDP A;  3VGO A;  3FIA A;  5TNC A;  1PK0 D;  2OS8 C;  1E8A A;  5I8N A;  1OSA A;  3ZNI A;  2MBX A;  1JF0 A;  1QVI Z;  2QPT A;  2BL0 C;  4MVF A;  1NCY A;  3OX6 A;  1TOP A;  1KFX S;  1BMO A;  1FBV A;  4PAL A;  1YX8 A;  1CDM A;  1DGU A;  3I5F C;  2ZKM X;  4JPZ B;  4WQ2 A;  1XA5 A;  1K2H A;  1DTL A;  1OE9 B;  3OB1 B;  5DKR A;  1UUS A;  4GFT A;  5GQQ C;  2KI4 B;  1D1O A;  3AKA A;  3GK4 X;  1MF8 B;  2KYC A;  3VRO A;  1CKK A;  2I7A A;  5B8I B;  1DJY A;  1YUT A;  3CGA A;  1CMG A;  1MQ1 A;  1PSB A;  1Y0V H;  5AFP A;  4QJ3 B;  3ZWH A;  4I5N B;  4I5J A;  3TUY B;  1JF2 A;  2L4I A;  1SL8 A;  1PSR A;  4PHK A;  1Y1U A;  2ZNE A;  1NP8 A;  3DD4 A;  1M63 B;  2M8U A;  3JVT C;  3KO0 A;  5CPV A;  3A4U B;  1B9A A;  3BQ3 A;  3DVM A;  3RM1 A;  2H61 A;  4MZK A;  2LC5 A;  1B4C A;  2F3Y A;  3SG4 A;  2WCE A;  1DF0 B;  1OZS A;  1PVA A;  2KNE A;  5IBW A;  5F6T A;  2WCF A;  1KK7 Z;  3PN7 B;  3TS5 B;  1V1F A;  3K21 A;  5CSF A;  2LAN A;  2LMV A;  2WCB A;  1F55 A;  4GNK B;  4GPL B;  2LVI A;  4DCK A;  1K95 A;  3CS1 A;  1XYD A;  2OS8 B;  3EVV A;  4NDD A;  2I18 A;  1XK4 C;  1PUL A;  3HCM A;  4YGB B;  3NSL A;  1IRJ A;  1J7P A;  2LVV A;  2KAV A;  1EG4 A;  1IJ6 A;  1MXE A;  1SL7 A;  4DUQ A;  2Y4Q A;  5KSZ A;  2ZN8 A;  3FS7 A;  4FQO A;  3DVK A;  3PLF B;  4NDB A;  3BUW B;  1A75 B;  1YVH A;  2KBM A;  2A4J A;  1WDC B;  3I5H B;  4N1F A;  4PE0 A;  5I2Q A;  1SY9 A;  1BF5 A;  1FW4 A;  1IG5 A;  1QV1 A;  4P2Y B;  2KGR A;  2BE6 A;  4YBH B;  3VRQ A;  1DJG A;  2JRF A;  1TNQ A;  2KI6 C;  1C07 A;  1DMO A;  1FI6 A;  1BLQ A;  4ORA B;  1KCY A;  2LNK A;  1ZFS A;  2MLF C;  3WNX B;  1PVB A;  2JT8 A;  3VRP A;  2AMI A;  3FWB A;  1UHJ A;  2JUL A;  2L98 A;  2PSR A;  4QJ5 B;  1F4Q A;  3TDU A;  3KHE A;  2NXQ A;  1B7T Z;  2KI4 C;  4PHM A;  1MWN A;  2HQ8 A;  2K7D A;  4N1G A;  5HKW A;  2CBL A;  2R2I A;  3SG7 A;  4CLN A;  1KFX L;  2SCP A;  1QLK A;  4C0K A;  5AXI A;  1U5I A;  1S36 A;  2D8N A;  2F2P A;  2KBI A;  2Y1N A;  3TUY C;  1QIV A;  2L51 A;  3IQO A;  2MHH A;  1SPY A;  4DS7 A;  4XYN A;  2RGI A;  1WLM A;  1CNP A;  1PAL A;  5BPJ A;  2K2F A;  2ZRT A;  2PVB A;  2HF5 A;  3AAK A;  2QAC A;  4CPV A;  2JOJ A;  3SG5 A;  1AK8 A;  1K8U A;  2BKH B;  2JXC A;  2NCP A;  1CFD A;  2WOR A;  1GQM A;  4YRU A;  1KWO B;  3O2P A;  5AEQ A;  1G4Y R;  2M29 A;  2OTG B;  1ZUZ A;  3O6B A;  4MZJ A;  1S6C A;  4N5X A;  1KK8 B;  1DJW A;  1PRW A;  2CTN A;  4DIR A;  4D1E A;  1IGV A;  1ZOT B;  3LL8 B;  1SYM A;  4ORB B;  1ODB A;  2PAL A;  1GGW A;  2KAY A;  1A29 A;  2LM5 A;  1OMR A;  1KQM B;  1H4B A;  4MLW A;  1EH2 A;  1LXF C;  4JQ0 D;  2M49 B;  2EC6 B;  4OR9 B;  1QXP A;  1BG1 A;  3KF9 A;  2MJW B;  3LLE A;  1BR1 B;  3QRX A;  1B47 A;  1WDC C;  3EVR A;  3I5H C;  1S6J A;  1M45 A;  1RFJ A;  4AOM A;  4M2Q A;  1RRO A;  1S1E A;  1YTZ C;  4YGE B;  2HET A;  2K7B A;  3I5G B;  4ZCU A;  5J3X A;  3PAT A;  2K61 A;  4F0Z B;  4MRX A;  1RJV A;  2JTT A;  1A4P A;  1Y1X A;  1YX7 A;  4GGF A;  2Y5I A;  3EKJ A;  1N0Y A;  2KQ6 A;  2BBN A;  3H4S E;  2M7N A;  2JPT A;  1EG3 A;  3SJS A;  1SR6 B;  2TN4 A;  2LP2 A;  3BOW A;  1X02 A;  2M3W A;  3OP0 A;  1CM1 A;  1JC2 A;  4P5O E;  2M1U A;  1M31 A;  3O78 A;  2FJU B;  2LVJ A;  2LE9 B;  1EXR A;  1SBJ A;  1NX3 A;  4CFQ A;  1TNP A;  2BCB A;  1LA3 A;  2JZI A;  1SK6 D;  2M97 A;  1TTX A;  4C0J A;  3AAJ A;  2L50 A;  1NX0 A;  1WRK A;  1QAS A; 
#chains in the Genus database with same CATH topology
 3CZ1 A;  4C0L A;  1CFP A;  1SCM C;  1HQV A;  4GGF C;  1REC A;  3CR2 A;  2PRU A;  2WCK A;  1C7W A;  1AVS A;  1J55 A;  2K2A A;  1ALW A;  3D76 A;  1K9P A;  2COL B;  1XFW O;  4HSZ A;  1F8H A;  3BUO B;  2M9G A;  4UPG A;  1U5I B;  3I5I B;  4M2P A;  1S5G Y;  2PMY A;  3SS3 A;  3BFH A;  1KWO C;  4M2O A;  4PHN A;  1QLS A;  3B86 A;  2OTG C;  2KI6 D;  3EG5 B;  4IL1 A;  1C7V A;  3PM2 A;  4INW A;  4TNC A;  1KK8 C;  1RK9 A;  1G33 A;  4WQ3 A;  1NPQ A;  3CAB A;  1XFV O;  3BUX B;  1IWQ A;  2LMT A;  4YGD B;  2LVK A;  1NYA A;  2K7C A;  3PSR A;  3LK0 A;  2WND A;  4MBE A;  5I2O A;  1XFU O;  4JD9 A;  3RZS A;  2JWW A;  3DVE A;  1CMF A;  2K8M B;  2QEO A;  2H61 C;  1XO5 A;  1LS8 A;  1VRK A;  1KQM C;  1V1G A;  2GGZ A;  5HYD A;  1ZMZ A;  1NWD A;  1YUS A;  2EC6 C;  2JNX A;  5JOL A;  5D69 A;  4INX A;  1TIZ A;  3HX4 A;  2KOT A;  5G08 A;  2KFH A;  1DJH A;  2F3Z A;  3CLN A;  5FI6 A;  1B8R A;  3SS4 A;  5HKZ A;  3NSO A;  4MZL A;  1B8L A;  3AKB A;  1S3P A;  1MXL C;  5CSJ A;  5FI2 A;  1G8I A;  1R2U A;  1ALV A;  3I5G C;  5FYX A;  5HLV A;  4OCI A;  1FI5 A;  1NSH A;  3EK7 A;  1SW8 A;  3UO9 A;  1NUB A;  1JUO A;  4PE1 A;  2ZFD A;  1Q80 A;  2MLE C;  4ZCV A;  1LIN A;  3B87 A;  1YUU A;  1BR4 B;  1OZO A;  4MEW A;  1JWD A;  2CT9 A;  1CLL A;  2P70 A;  5ER4 X;  2LMU A;  2BBM A;  1SR6 C;  1M39 A;  1UHI A;  2V53 A;  1XVJ A;  1S6I A;  2PQL A;  4YGC B;  2P6B B;  2LV7 A;  1K94 A;  2LUC A;  3WHU B;  2KYF A;  1IQ3 A;  2LHI A;  1QVI Y;  4I5L B;  2G9B A;  3SG2 A;  1GGZ A;  1A03 A;  2WCM A;  3CZ2 A;  1SCM B;  2LP3 A;  1MUX A;  2WCJ A;  3D74 A;  3SIA A;  5DKQ A;  1EJ3 A;  1M46 A;  3CYZ A;  3KEV A;  3PM8 A;  4L9M A;  2JQ6 A;  5K89 A;  1TWO A;  1T14 A;  4OKH A;  2KLD A;  3BOW B;  1QTX A;  1SL9 A;  1YRU B;  2KAX A;  3BXK A;  2CXJ A;  3OB2 B;  1P28 A;  1UWO A;  3SS5 A;  1TNW A;  1OOI X;  3VRN A;  1NCZ A;  3I5I C;  1FPW A;  4GUK A;  5KSZ A;  3KPX A;  4BY5 A;  1W7J B;  2LHL A;  4IJ7 A;  1NIW A;  2I2R E;  4ORC B;  1DC1 A;  2B1U A;  1SNL A;  4PHJ A;  1JBA A;  2KSP A;  1AUI B;  1ZAC A;  4U8D A;  4YI8 A;  2HPS A;  1TCO B;  2NZ0 A;  3IF7 A;  3OX5 A;  1JSA A;  1A2X A;  4PCW A;  1IKU A;  2I94 A;  2K7O A;  1KSM A;  3S0D A;  3D0Y A;  2JTZ A;  4A4B A;  4AQI A;  3WXA A;  2L2C A;  1LA0 A;  4MRY A;  2Y1M A;  4GGN A;  1CDL A;  1DEK A;  2EHB A;  2AAO A;  3MSE B;  1JFJ A;  1OMD A;  1IJ5 A;  1CM4 A;  2KHN A;  1ORG A;  3IQQ A;  4I5K A;  1TN4 A;  2ERB A;  3CTN A;  1CFF A;  2LUX A;  1W9Z A;  2L2E A;  2F2O A;  3E3R A;  4GBA A;  2BE4 A;  1RWY A;  4MSP A;  5CSN A;  4OVN F;  3C1V A;  5I2L A;  1L2O B;  4ETO A;  1R6P A;  4HRG A;  4BY4 A;  1BT6 A;  3CZT X;  2WC8 A;  1KK7 Y;  2F8P A;  4USL A;  3CWG A;  2H2K A;  4OZD A;  3S0A A;  3NXA A;  1OW4 A;  2CCM A;  1DJI A;  1KSO A;  1OOG A;  2NLN A;  1EL4 A;  3DF0 A;  2QEH A;  3EK4 A;  1F70 A;  2O60 A;  1H8B A;  2KDH A;  3NHI A;  1MHO A;  1SKT A;  2KFG A;  2L0P A;  3OHM B;  1QX7 A;  4KYN A;  1CTR A;  1QJT A;  3O4Y A;  3SG6 A;  2JC2 A;  2JT3 A;  1AJ5 A;  1K9U A;  2WOS A;  2GGM A;  2JU0 A;  3EKH A;  1UUR A;  3SIB A;  2WC6 A;  2Q4U A;  4XJK A;  2MA2 A;  1K9K A;  1XFY O;  1GM0 A;  3L47 A;  1DJZ A;  3SG3 A;  3EK8 A;  1W7I B;  1AHR A;  3D73 A;  1LKJ A;  2KQY A;  1MR8 A;  2HQW A;  5EL2 A;  1WRL A;  4JWQ A;  1LVC D;  1BOC A;  2FOT A;  2FCE A;  1AP4 A;  2K0J A;  5KTY A;  4NDC A;  1BJF A;  2LLT A;  3OGN A;  1KFU S;  2IS9 A;  2VRG A;  3M0W A;  2CNP A;  2BKI B;  1J1E A;  1XFX O;  4PE7 A;  1XK4 A;  2LLU A;  3CR5 X;  1K96 A;  4Q04 A;  5DKN A;  1DJX A;  1B7T Y;  2BCA A;  4AQJ A;  1KQV A;  3A8R A;  1UHK A;  2JNF A;  4WRI A;  2M7L A;  3DVJ A;  1FF1 A;  5D7F A;  4CFR A;  1YRT B;  3JTD B;  4A4C A;  1B8C A;  1SRA A;  1J7Q A;  4NQG A;  3F45 A;  1OQP A;  4DRW A;  1BU3 A;  3BUM B;  2P71 A;  1Y1A A;  1OOH A;  2KPH A;  1F71 A;  4F7F A;  1XFZ O;  2E6W A;  2MRD A;  2G2B A;  4ICB A;  3UNW A;  2M1K B;  1QV0 A;  1QAT A;  4HRE E;  1CLB A;  3LK1 A;  3GK1 A;  2L5Y A;  4YI9 A;  1N2D A;  2MAZ A;  3VRR A;  2SAS A;  2ISD A;  2BL0 B;  2LAP A;  5PAL A;  3WHT B;  1IQ5 A;  1L2O C;  2PYQ A;  4PE4 A;  3TZ1 A;  2DOQ A;  3D0Y B;  2YGU A;  2K60 A;  3LCP C;  1JFK A;  1TRF A;  3TDI A;  3S0E A;  2OPO A;  1QS7 A;  1F54 A;  1K93 D;  2AUC A;  3I5F B;  3NSI A;  2BCX A;  3NSK A;  4R1E A;  1J7R A;  1OMV A;  3GK2 A;  1DVI A;  1CDN A;  1L7Z A;  1QX2 A;  1TNX A;  5CSI A;  2O5G A;  2L5X B;  1S5G Z;  2Q91 A;  1CFC A;  1BOD A;  1NX2 A;  1F4O A;  3TDZ A;  3FWC A;  3S0F A;  1SCV A;  1TCF A;  1J7O A;  1GJY A;  1IH0 A;  1Y6W A;  3EVU A;  1N65 A;  2LCP A;  2JXL A;  3DF0 B;  4HRH A;  2H8V A;  1OOJ A;  4CID A;  4GAO A;  3IVT A;  2ZRS A;  5HKY A;  4OV2 A;  1RTP 1;  3BJH A;  1DF0 A;  5KU1 A;  1J1D A;  1WLZ A;  3BYA A;  3ICB A;  3DYE A;  1DT7 B;  4QJ4 B;  5JJG A;  1B1G A;  2JT0 A;  3DY9 A;  2NCO A;  3PJI A;  3JVT B;  5HLO A;  2LLS A;  1DQE A;  3O4X A;  5AAN A;  2FCD A;  1K90 D;  3PFV A;  5ER5 A;  1NCX A;  1S26 D;  4XJK B;  1QIW A;  4YGA A;  1WRZ A;  3N7H A;  1YVL A;  1CB1 A;  2GV5 A;  3PAL A;  2ZND A;  5AER A;  1UHH A;  3D78 A;  2KFF A;  3JTD C;  1A75 A;  1NX1 A;  1YUR A;  3D10 A;  3GOF A;  4E68 A;  2L4H A;  4PT1 A;  3BUN B;  2ZN9 A;  1WY9 A;  3CR4 X;  2M0R A;  1AJ4 A;  1DGV A;  1QX5 B;  3QME A;  4PDZ A;  1UP5 A;  5FI7 A;  3PN7 C;  2EGD A;  2BEC A;  2PAS A;  3NGV A;  3TS5 C;  2KGB C;  3BFB A;  1KFU L;  1YR5 A;  4FTG A;  1SMG A;  2E30 A;  4MN0 A;  3RLZ A;  2F33 A;  1HT9 A;  1UHN A;  1CLM A;  1CDP A;  3VGO A;  3FIA A;  5TNC A;  1PK0 D;  2OS8 C;  3R1P A;  1E8A A;  5I8N A;  1OSA A;  3ZNI A;  2MBX A;  1JF0 A;  1QVI Z;  1C3Z A;  2QPT A;  2BL0 C;  5I2Q A;  4MVF A;  1NCY A;  3OX6 A;  1TOP A;  3Q8I A;  2BAP A;  1KFX S;  1BMO A;  1FBV A;  4PAL A;  1YX8 A;  1CDM A;  1DGU A;  3I5F C;  2ZKM X;  4JPZ B;  4WQ2 A;  1XA5 A;  1K2H A;  1DTL A;  1OE9 B;  3OB1 B;  3NHT A;  5DKR A;  1OOF A;  1UUS A;  3FE6 A;  4GFT A;  5GQQ C;  3OBV A;  2KI4 B;  1D1O A;  3AKA A;  3GK4 X;  1MF8 B;  2KYC A;  3VRO A;  1CKK A;  2I7A A;  5B8I B;  1DJY A;  1YUT A;  3CGA A;  1CMG A;  1MQ1 A;  1PSB A;  1Y0V H;  5AFP A;  4QJ3 B;  3ZWH A;  4I5N B;  4I5J A;  3TUY B;  1JF2 A;  2L4I A;  1SL8 A;  1PSR A;  2WCL A;  4PHK A;  1Y1U A;  2ZNE A;  1NP8 A;  3DD4 A;  1M63 B;  2M8U A;  3JVT C;  3KO0 A;  5CPV A;  3A4U B;  1B9A A;  3BQ3 A;  3B88 A;  3DVM A;  3RM1 A;  2H61 A;  4MZK A;  2LC5 A;  1B4C A;  2F3Y A;  3SG4 A;  2WCE A;  1DF0 B;  1OZS A;  1PVA A;  1QWV A;  2KNE A;  2WC5 A;  5IBW A;  5F6T A;  2WCF A;  1KK7 Z;  3PN7 B;  3TS5 B;  5HL1 A;  1V1F A;  3K21 A;  4JKT A;  2LAN A;  2LMV A;  2WCB A;  5CSF A;  1BF5 A;  1F55 A;  4GNK B;  4GPL B;  2LVI A;  4DCK A;  1K95 A;  3CS1 A;  1XYD A;  2OS8 B;  3EVV A;  4FQT A;  2I18 A;  4NDD A;  1XK4 C;  1PUL A;  2QEV A;  3HCM A;  3R1V A;  4YGB B;  3NSL A;  1IRJ A;  1J7P A;  2LVV A;  2KAV A;  1EG4 A;  1IJ6 A;  1SL7 A;  1Z4H A;  1MXE A;  2Y4Q A;  4DUQ A;  2ZN8 A;  3FS7 A;  4FQO A;  3DVK A;  3PLF B;  4NDB A;  3BUW B;  2KLE A;  1A75 B;  1YVH A;  2FJY A;  1TUJ A;  2KBM A;  3S0B A;  3S0G A;  3FE8 A;  2A4J A;  1WDC B;  3I5H B;  4N1F A;  4PE0 A;  3FE9 A;  1SY9 A;  3V2L A;  1FW4 A;  1IG5 A;  1QV1 A;  4P2Y B;  2KGR A;  2BE6 A;  4YBH B;  3DZT A;  3VRQ A;  1DJG A;  2JRF A;  1TNQ A;  2KI6 C;  3R1O A;  3DXL A;  1C07 A;  1DMO A;  1FI6 A;  1BLQ A;  4ORA B;  1KCY A;  2LNK A;  1ZFS A;  2MLF C;  3WNX B;  1PVB A;  2JT8 A;  3VRP A;  2AMI A;  3FWB A;  1UHJ A;  2JUL A;  2BNX A;  2L98 A;  2PSR A;  4QJ5 B;  1F4Q A;  3TDU A;  3KHE A;  2NXQ A;  1B7T Z;  2KI4 C;  4PHM A;  1MWN A;  2HQ8 A;  2K7D A;  4N1G A;  5HKW A;  2CBL A;  2R2I A;  5D3O A;  3SG7 A;  4CLN A;  1IIO A;  1KFX L;  2JPO A;  2SCP A;  1QLK A;  4C0K A;  5AXI A;  1U5I A;  1S36 A;  2D8N A;  2F2P A;  2KBI A;  2Y1N A;  3TUY C;  3K1E A;  1QIV A;  2L51 A;  3IQO A;  2MHH A;  1SPY A;  1XFR A;  4DS7 A;  3CZ0 A;  4XYN A;  2RGI A;  1WLM A;  1CNP A;  1C3Y A;  1PAL A;  5BPJ A;  2K2F A;  2ZRT A;  2PVB A;  2HF5 A;  3AAK A;  2QAC A;  4CPV A;  2JOJ A;  3SG5 A;  2WCH A;  1AK8 A;  1K8U A;  2BKH B;  2JXC A;  1SSE B;  2GTE A;  2NCP A;  1CFD A;  2WOR A;  1GQM A;  4YRU A;  1KWO B;  3O2P A;  5AEQ A;  1G4Y R;  3B6X A;  2M29 A;  2OTG B;  1ZUZ A;  3O6B A;  4MZJ A;  1S6C A;  4N5X A;  1KK8 B;  3CDN A;  1DJW A;  1PRW A;  2CTN A;  4DIR A;  4D1E A;  1IGV A;  1ZOT B;  3LL8 B;  1SYM A;  4ORB B;  3L4L A;  1DEL A;  1ODB A;  2PAL A;  3R72 A;  5I94 A;  1GGW A;  2KAY A;  1A29 A;  2LM5 A;  1OMR A;  1KQM B;  3D77 A;  1H4B A;  4MLW A;  1EH2 A;  1LXF C;  4JQ0 D;  2M49 B;  2EC6 B;  4OR9 B;  1QXP A;  1BG1 A;  3L4A A;  3KF9 A;  2MJW B;  3LLE A;  1BR1 B;  3QRX A;  1B47 A;  1WDC C;  3EVR A;  3I5H C;  1S6J A;  2QDI A;  1M45 A;  3VB1 A;  1RFJ A;  4AOM A;  4M2Q A;  1RRO A;  1S1E A;  1YTZ C;  4YGE B;  2HET A;  1TUZ A;  2K7B A;  3I5G B;  4ZCU A;  5J3X A;  3PAT A;  2K61 A;  4F0Z B;  4MRX A;  1RJV A;  1Z2C B;  1A4P A;  2JTT A;  1Y1X A;  1YX7 A;  4GGF A;  2Y5I A;  3EKJ A;  1N0Y A;  5DIC A;  2KQ6 A;  2BBN A;  3H4S E;  2M7N A;  3B7A A;  2JPT A;  1EG3 A;  3SJS A;  1SR6 B;  2QEB A;  2TN4 A;  2LP2 A;  3D75 A;  3BOW A;  1X02 A;  2M3W A;  3OP0 A;  1CM1 A;  1JC2 A;  4P5O E;  2M1U A;  1M31 A;  3O78 A;  2FJU B;  2LVJ A;  2LE9 B;  1EXR A;  1SBJ A;  1NX3 A;  3BFA A;  1TNP A;  4CFQ A;  1LA3 A;  2BCB A;  2JZI A;  1SK6 D;  2M97 A;  1TTX A;  4C0J A;  3AAJ A;  2L50 A;  1NX0 A;  1WRK A;  1QAS A; 
#chains in the Genus database with same CATH homology
 4C0L A;  1CFP A;  1SCM C;  1HQV A;  4GGF C;  1REC A;  3CR2 A;  2PRU A;  1C7W A;  1AVS A;  1J55 A;  2K2A A;  1ALW A;  4HSZ A;  1K9P A;  2COL B;  1XFW O;  1F8H A;  3BUO B;  2M9G A;  4UPG A;  1U5I B;  3I5I B;  4M2P A;  1S5G Y;  2PMY A;  1KWO C;  4M2O A;  4PHN A;  1QLS A;  1C7V A;  2OTG C;  2KI6 D;  4IL1 A;  4TNC A;  1KK8 C;  1RK9 A;  1G33 A;  4WQ3 A;  1NPQ A;  1XFV O;  3BUX B;  1IWQ A;  2LMT A;  4YGD B;  2LVK A;  1NYA A;  2K7C A;  3PSR A;  3LK0 A;  2WND A;  4MBE A;  5I2O A;  1XFU O;  1CMF A;  2JWW A;  3DVE A;  2K8M B;  2H61 C;  1XO5 A;  1VRK A;  1KQM C;  1V1G A;  2GGZ A;  5HYD A;  1ZMZ A;  1NWD A;  1YUS A;  2EC6 C;  2JNX A;  5JOL A;  5D69 A;  1TIZ A;  3HX4 A;  2KOT A;  5G08 A;  2KFH A;  1DJH A;  2F3Z A;  3CLN A;  1B8R A;  5HKZ A;  3NSO A;  4MZL A;  1B8L A;  3AKB A;  1S3P A;  1MXL C;  5CSJ A;  1G8I A;  1R2U A;  1ALV A;  3I5G C;  5FYX A;  5HLV A;  4OCI A;  1FI5 A;  1NSH A;  3EK7 A;  1SW8 A;  1NUB A;  1JUO A;  4PE1 A;  2ZFD A;  1Q80 A;  2MLE C;  4ZCV A;  1LIN A;  1YUU A;  1BR4 B;  1OZO A;  4MEW A;  1JWD A;  2CT9 A;  1CLL A;  5ER4 X;  2LMU A;  2BBM A;  1SR6 C;  1M39 A;  1UHI A;  2V53 A;  1XVJ A;  1S6I A;  4YGC B;  2P6B B;  2LV7 A;  1K94 A;  2LUC A;  3WHU B;  2KYF A;  1IQ3 A;  2LHI A;  1QVI Y;  4I5L B;  2G9B A;  3SG2 A;  1GGZ A;  1A03 A;  1SCM B;  2LP3 A;  1MUX A;  3SIA A;  5DKQ A;  1EJ3 A;  1M46 A;  3KEV A;  3PM8 A;  4L9M A;  5K89 A;  2JQ6 A;  4OKH A;  3BOW B;  1QTX A;  1SL9 A;  1YRU B;  2KAX A;  3BXK A;  2CXJ A;  3OB2 B;  1UWO A;  1TNW A;  3VRN A;  1NCZ A;  3I5I C;  1FPW A;  4GUK A;  3KPX A;  4BY5 A;  1W7J B;  2LHL A;  1NIW A;  2I2R E;  4ORC B;  2B1U A;  1SNL A;  4PHJ A;  1JBA A;  2KSP A;  1AUI B;  1ZAC A;  4U8D A;  4YI8 A;  2HPS A;  1TCO B;  2NZ0 A;  3IF7 A;  3OX5 A;  1JSA A;  1A2X A;  4PCW A;  1IKU A;  2I94 A;  2K7O A;  1KSM A;  3D0Y A;  2JTZ A;  4A4B A;  4AQI A;  3WXA A;  1LA0 A;  4MRY A;  2Y1M A;  4GGN A;  1CDL A;  2EHB A;  2AAO A;  3MSE B;  1JFJ A;  1OMD A;  1IJ5 A;  1CM4 A;  2KHN A;  3IQQ A;  4I5K A;  1TN4 A;  3CTN A;  1CFF A;  2LUX A;  2L2E A;  4GBA A;  2F2O A;  3E3R A;  4MSP A;  2BE4 A;  1RWY A;  5CSN A;  5I2L A;  4OVN F;  3C1V A;  1L2O B;  4ETO A;  1R6P A;  4HRG A;  4BY4 A;  1BT6 A;  3CZT X;  2WC8 A;  1KK7 Y;  2F8P A;  4USL A;  3CWG A;  2H2K A;  3NXA A;  2CCM A;  1DJI A;  1KSO A;  2NLN A;  1EL4 A;  3DF0 A;  3EK4 A;  1F70 A;  2O60 A;  1H8B A;  2KDH A;  1MHO A;  1SKT A;  2KFG A;  2L0P A;  3OHM B;  1QX7 A;  1CTR A;  1QJT A;  3O4Y A;  3SG6 A;  2JC2 A;  2JT3 A;  1AJ5 A;  1K9U A;  2WOS A;  2GGM A;  2JU0 A;  3EKH A;  1UUR A;  3SIB A;  2Q4U A;  4XJK A;  2MA2 A;  1K9K A;  1XFY O;  3SG3 A;  1DJZ A;  3EK8 A;  1W7I B;  1AHR A;  1LKJ A;  2KQY A;  1MR8 A;  2HQW A;  1WRL A;  4JWQ A;  1LVC D;  1BOC A;  2FOT A;  2FCE A;  1AP4 A;  2K0J A;  5KTY A;  4NDC A;  1BJF A;  2LLT A;  1KFU S;  2IS9 A;  2VRG A;  3M0W A;  2CNP A;  2BKI B;  1J1E A;  1XFX O;  4PE7 A;  1XK4 A;  2LLU A;  3CR5 X;  1K96 A;  4Q04 A;  5DKN A;  1DJX A;  1B7T Y;  2BCA A;  4AQJ A;  1KQV A;  3A8R A;  1UHK A;  2JNF A;  4WRI A;  2M7L A;  3DVJ A;  1FF1 A;  5D7F A;  4CFR A;  1YRT B;  3JTD B;  4A4C A;  1B8C A;  1SRA A;  1J7Q A;  4NQG A;  3F45 A;  1OQP A;  4DRW A;  1BU3 A;  3BUM B;  1Y1A A;  1F71 A;  1XFZ O;  2E6W A;  2MRD A;  2G2B A;  4ICB A;  2M1K B;  1QV0 A;  1QAT A;  4HRE E;  1CLB A;  3LK1 A;  3GK1 A;  4YI9 A;  3VRR A;  1N2D A;  2MAZ A;  2SAS A;  2ISD A;  2BL0 B;  2LAP A;  5PAL A;  3WHT B;  1IQ5 A;  1L2O C;  4PE4 A;  3TZ1 A;  2DOQ A;  3D0Y B;  3LCP C;  1JFK A;  1TRF A;  3TDI A;  2OPO A;  1QS7 A;  1F54 A;  1K93 D;  2AUC A;  3I5F B;  3NSI A;  2BCX A;  3NSK A;  4R1E A;  1J7R A;  1OMV A;  3GK2 A;  1DVI A;  1CDN A;  1L7Z A;  1QX2 A;  1TNX A;  5CSI A;  2O5G A;  2L5X B;  1S5G Z;  2Q91 A;  1CFC A;  1BOD A;  1NX2 A;  1F4O A;  3TDZ A;  3FWC A;  1SCV A;  1TCF A;  1J7O A;  1GJY A;  1IH0 A;  1Y6W A;  3EVU A;  1N65 A;  2LCP A;  2JXL A;  3DF0 B;  4HRH A;  1OOJ A;  4CID A;  4GAO A;  2ZRS A;  5HKY A;  4OV2 A;  1RTP 1;  1DF0 A;  5KU1 A;  1J1D A;  1WLZ A;  3BYA A;  3ICB A;  1DT7 B;  4QJ4 B;  5JJG A;  1B1G A;  2JT0 A;  2NCO A;  3JVT B;  5HLO A;  2LLS A;  5AAN A;  2FCD A;  1K90 D;  3PFV A;  5ER5 A;  1NCX A;  1S26 D;  4XJK B;  1QIW A;  4YGA A;  1WRZ A;  1YVL A;  1CB1 A;  2GV5 A;  3PAL A;  2ZND A;  5AER A;  1UHH A;  2KFF A;  3JTD C;  1A75 A;  1NX1 A;  1YUR A;  3D10 A;  3GOF A;  4E68 A;  2L4H A;  3BUN B;  2ZN9 A;  1WY9 A;  3CR4 X;  2M0R A;  1AJ4 A;  1DGV A;  1QX5 B;  4PDZ A;  1UP5 A;  3PN7 C;  2EGD A;  2BEC A;  2PAS A;  3TS5 C;  2KGB C;  1KFU L;  1YR5 A;  4FTG A;  1SMG A;  2E30 A;  4MN0 A;  3RLZ A;  2F33 A;  1HT9 A;  1UHN A;  1CLM A;  1CDP A;  3VGO A;  3FIA A;  5TNC A;  1PK0 D;  2OS8 C;  1E8A A;  5I8N A;  1OSA A;  3ZNI A;  2MBX A;  1JF0 A;  1QVI Z;  2QPT A;  2BL0 C;  4MVF A;  1NCY A;  3OX6 A;  1TOP A;  1KFX S;  1BMO A;  1FBV A;  4PAL A;  1YX8 A;  1CDM A;  1DGU A;  3I5F C;  2ZKM X;  4JPZ B;  4WQ2 A;  1XA5 A;  1K2H A;  1DTL A;  1OE9 B;  3OB1 B;  5DKR A;  1UUS A;  4GFT A;  5GQQ C;  2KI4 B;  1D1O A;  3AKA A;  3GK4 X;  1MF8 B;  2KYC A;  3VRO A;  1CKK A;  2I7A A;  5B8I B;  1DJY A;  1YUT A;  3CGA A;  1CMG A;  1MQ1 A;  1PSB A;  1Y0V H;  5AFP A;  4QJ3 B;  3ZWH A;  4I5N B;  4I5J A;  3TUY B;  1JF2 A;  2L4I A;  1SL8 A;  1PSR A;  4PHK A;  1Y1U A;  2ZNE A;  1NP8 A;  3DD4 A;  1M63 B;  2M8U A;  3JVT C;  3KO0 A;  5CPV A;  3A4U B;  1B9A A;  3BQ3 A;  3DVM A;  3RM1 A;  2H61 A;  4MZK A;  2LC5 A;  1B4C A;  2F3Y A;  3SG4 A;  2WCE A;  1DF0 B;  1OZS A;  1PVA A;  2KNE A;  5IBW A;  5F6T A;  2WCF A;  1KK7 Z;  3PN7 B;  3TS5 B;  1V1F A;  3K21 A;  5CSF A;  2LAN A;  2LMV A;  2WCB A;  1F55 A;  4GNK B;  4GPL B;  2LVI A;  4DCK A;  1K95 A;  3CS1 A;  1XYD A;  2OS8 B;  3EVV A;  4NDD A;  2I18 A;  1XK4 C;  1PUL A;  3HCM A;  4YGB B;  3NSL A;  1IRJ A;  1J7P A;  2LVV A;  2KAV A;  1EG4 A;  1IJ6 A;  1MXE A;  1SL7 A;  4DUQ A;  2Y4Q A;  5KSZ A;  2ZN8 A;  3FS7 A;  4FQO A;  3DVK A;  3PLF B;  4NDB A;  3BUW B;  1A75 B;  1YVH A;  2KBM A;  2A4J A;  1WDC B;  3I5H B;  4N1F A;  4PE0 A;  5I2Q A;  1SY9 A;  1BF5 A;  1FW4 A;  1IG5 A;  1QV1 A;  4P2Y B;  2KGR A;  2BE6 A;  4YBH B;  3VRQ A;  1DJG A;  2JRF A;  1TNQ A;  2KI6 C;  1C07 A;  1DMO A;  1FI6 A;  1BLQ A;  4ORA B;  1KCY A;  2LNK A;  1ZFS A;  2MLF C;  3WNX B;  1PVB A;  2JT8 A;  3VRP A;  2AMI A;  3FWB A;  1UHJ A;  2JUL A;  2L98 A;  2PSR A;  4QJ5 B;  1F4Q A;  3TDU A;  3KHE A;  2NXQ A;  1B7T Z;  2KI4 C;  4PHM A;  1MWN A;  2HQ8 A;  2K7D A;  4N1G A;  5HKW A;  2CBL A;  2R2I A;  3SG7 A;  4CLN A;  1KFX L;  2SCP A;  1QLK A;  4C0K A;  5AXI A;  1U5I A;  1S36 A;  2D8N A;  2F2P A;  2KBI A;  2Y1N A;  3TUY C;  1QIV A;  2L51 A;  3IQO A;  2MHH A;  1SPY A;  4DS7 A;  4XYN A;  2RGI A;  1WLM A;  1CNP A;  1PAL A;  5BPJ A;  2K2F A;  2ZRT A;  2PVB A;  2HF5 A;  3AAK A;  2QAC A;  4CPV A;  2JOJ A;  3SG5 A;  1AK8 A;  1K8U A;  2BKH B;  2JXC A;  2NCP A;  1CFD A;  2WOR A;  1GQM A;  4YRU A;  1KWO B;  3O2P A;  5AEQ A;  1G4Y R;  2M29 A;  2OTG B;  1ZUZ A;  3O6B A;  4MZJ A;  1S6C A;  4N5X A;  1KK8 B;  1DJW A;  1PRW A;  2CTN A;  4DIR A;  4D1E A;  1IGV A;  1ZOT B;  3LL8 B;  1SYM A;  4ORB B;  1ODB A;  2PAL A;  1GGW A;  2KAY A;  1A29 A;  2LM5 A;  1OMR A;  1KQM B;  1H4B A;  4MLW A;  1EH2 A;  1LXF C;  4JQ0 D;  2M49 B;  2EC6 B;  4OR9 B;  1QXP A;  1BG1 A;  3KF9 A;  2MJW B;  3LLE A;  1BR1 B;  3QRX A;  1B47 A;  1WDC C;  3EVR A;  3I5H C;  1S6J A;  1M45 A;  1RFJ A;  4AOM A;  4M2Q A;  1RRO A;  1S1E A;  1YTZ C;  4YGE B;  2HET A;  2K7B A;  3I5G B;  4ZCU A;  5J3X A;  3PAT A;  2K61 A;  4F0Z B;  4MRX A;  1RJV A;  2JTT A;  1A4P A;  1Y1X A;  1YX7 A;  4GGF A;  2Y5I A;  3EKJ A;  1N0Y A;  2KQ6 A;  2BBN A;  3H4S E;  2M7N A;  2JPT A;  1EG3 A;  3SJS A;  1SR6 B;  2TN4 A;  2LP2 A;  3BOW A;  1X02 A;  2M3W A;  3OP0 A;  1CM1 A;  1JC2 A;  4P5O E;  2M1U A;  1M31 A;  3O78 A;  2FJU B;  2LVJ A;  2LE9 B;  1EXR A;  1SBJ A;  1NX3 A;  4CFQ A;  1TNP A;  2BCB A;  1LA3 A;  2JZI A;  1SK6 D;  2M97 A;  1TTX A;  4C0J A;  3AAJ A;  2L50 A;  1NX0 A;  1WRK A;  1QAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...