2LANA

Nmr structure of ca2+-bound cabp1 n-domain with rdc
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
SLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein 1
publication title 1H, 15N, and 13C chemical shift assignments for CaBP1 with 3 Ca2+ bound
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lanA00
1Y1UA 2KI4B 1M39A 2FCEA 2KHNA 2ZKMX 4CLNA 2EHBA 1QX5B 4XJKB 2LMUA 2KYFA 2DOQA 1PVAA 4L9MA 4YGDB 3EVRA 3DF0A 2AUCA 2I7AA 1NUBA 2MJWB 4YRUA 2HQWA 1KK8B 3OB2B 1YX7A 2PRUA 1A29A 1SYMA 2LAPA 3PM8A 1PSBA 2PALA 2KNEA 1DJHA 4GBAA 2JT3A 2LMTA 2LVKA 1CFFA 1K8UA 3NXAA 3EK4A 2ZFDA 3SG2A 1YVHA 4E68A 1CM4A 3OX6A 1DJZA 3AKAA 2NLNA 1QS7A 2LC5A 1QV1A 2M3WA 2IS9A 3NSOA 3VROA 4GFTA 2AMIA 1YX8A 2L0PA 2WNDA 2BL0C 1ZUZA 1RWYA 1K96A 1SCMB 2COLB 3TUYB 3O78A 1CFDA 1V1GA 1CLLA 2A4JA 2EC6C 4PDZA 1RJVA 1Q80A 2M49B 1OQPA 4JQ0D 1UHHA 4N1GA 1B8RA 1QX7A 1KFUS 4A4BA 4JPZB 1YUUA 4GGNA 1ZFSA 4OV2A 3TDIA 3CGAA 3SG4A 1IJ5A 2ZRTA 3BUNB 1XVJA 3I5IB 4MBEA 1DF0A 3JTDB 4WQ2A 2JNXA 4FQOA 4QJ3B 5I2LA 2GGZA 1BT6A 2PSRA 3EVUA 5HKZA 1W7IB 1HQVA 2BCBA 3CLNA 1QIWA 2LVJA 3NSIA 1S6CA 3PN7C 1LVCD 2KQYA 4N5XA 2K2AA 5G08A 2M29A 2WCEA 3EK8A 1C7WA 1S6IA 3BUWB 3DVJA 3KO0A 2KFGA 5TNCA 2G9BA 2OS8C 2HF5A 2I94A 1IRJA 3BOWB 1JFJA 2NZ0A 3I5HC 3I5GB 2KSPA 1B9AA 1NCXA 2BECA 2KDHA 1BU3A 1MR8A 4A4CA 2SASA 1N2DA 5CSNA 1VRKA 2KAVA 1JF2A 1BOCA 4GGFC 3SIBA 1NSHA 5DKRA 1BR4B 1M46A 4YI9A 2LHIA 5I2OA 3SG7A 1KSOA 2L98A 1JF0A 1C7VA 1S5GZ 2JNFA 1WLZA 2K7BA 2LVIA 4FTGA 3CR4X 1IWQA 1ZMZA 3OX5A 4ZCUA 5JJGA 4CFQA 4M2OA 3CTNA 1A75A 1UHJA 1EL4A 3I5FB 3LLEA 2ZRSA 1UHNA 2AAOA 4BY4A 4GNKB 3JVTC 4M2QA 4YGBB 4CPVA 3GK1A 1GGWA 5KU1A 3H4SE 1G8IA 3DD4A 3EK7A 4MRXA 1F8HA 2OTGB 2I18A 1JSAA 1MWNA 3VRRA 4P2YB 1ZOTB 2FJUB 1EJ3A 2F8PA 2NCOA 2QPTA 1RROA 1U5IB 2CXJA 1KFXS 2KFFA 4GGFA 1SY9A 1ALWA 1TNXA 1SMGA 4WQ3A 3D0YB 3CWGA 1J7PA 2PASA 2F3YA 1DJWA 1OE9B 1DGVA 1KWOB 1ODBA 2CNPA 4I5LB 1LA3A 1SRAA 4C0KA 1FW4A 3IQQA 3AKBA 3ZNIA 1MXLC 1KK7Y 3KF9A 1KQMC 4JWQA 4QJ4B 1K93D 2LHLA 3RM1A 3FIAA 1BODA 1UUSA 2LLSA 1QXPA 3D10A 1NX1A 5D69A 1JC2A 4YI8A 1IQ5A 1SW8A 2Q4UA 1Y6WA 2KI4C 3O6BA 1XFUO 1M31A 1GQMA 1QATA 1WRKA 2QACA 1B7TY 2LNKA 1KK8C 2GV5A 1TCFA 1MXEA 4OR9B 1QVIY 3ICBA 4UPGA 4TNCA 1NPQA 1QIVA 1YUSA 3O4YA 1RTP1 1TTXA 1XFWO 1K9PA 2K7DA 1K94A 1V1FA 4IL1A 5FYXA 1M63B 3LL8B 1NWDA 1XFXO 4MLWA 1TNQA 1IH0A 2Q91A 1DJYA 2M9GA 4GAOA 1G4YR 1SCMC 2JT8A 1AVSA 1X02A 1J1EA 3TUYC 1CMFA 1BLQA 2ZN9A 1NX2A 2KQ6A 1WY9A 5DKQA 2L2EA 1PRWA 5CSJA 5AFPA 1WRLA 3SG3A 1KFUL 2LVVA 2LLUA 1WDCB 2P6BB 4MZJA 2FOTA 4XJKA 2JC2A 3I5IC 1FPWA 3JTDC 1TCOB 4N1FA 2KGRA 2BBMA 2BE6A 5HYDA 4I5JA 4ZCVA 1YTZC 1JWDA 3DVEA 3GOFA 3WHUB 2HPSA 4MN0A 2L4IA 3QRXA 2MLFC 2K7CA 3EKJA 1J7OA 2JXCA 1FF1A 1XK4C 1L2OB 1LKJA 3PSRA 1EG3A 3I5GC 2ZNDA 1H4BA 5I8NA 2TN4A 2LV7A 4PALA 3WHTB 1MHOA 1JBAA 2PMYA 2F33A 1F4QA 1WLMA 1F71A 1K9UA 1QASA 2JXLA 5GQQC 2ZN8A 3VRQA 1NP8A 5HKYA 2MAZA 1M45A 4DRWA 1TOPA 3VRNA 4PHKA 1K90D 1J7RA 2L4HA 2LUXA 5ER4X 2LANA 2KI6D 1D1OA 1GJYA 3I5FC 3CR5X 2JTTA 1QLSA 2M0RA 1CDNA 4ORBB 4PE1A 3SIAA 2ZNEA 1DT7B 3TDUA 1CLBA 2WCBA 2I2RE 3FWCA 2LLTA 1XK4A 2OTGC 5DKNA 5KSZA 2B1UA 3BUMB 1EXRA 3BOWA 1K2HA 3M0WA 4HRHA 2CT9A 1YUTA 2Y1MA 1KFXL 3LK1A 3AAJA 1NX0A 1A2XA 1LXFC 1S36A 2LM5A 1S5GY 5BPJA 3K21A 3ZWHA 2JTZA 5F6TA 5ER5A 4ORAB 1QTXA 2Y5IA 2OPOA 4WRIA 1LA0A 3F45A 1BR1B 1B8CA 1N0YA 1H8BA 1KWOC 1NCZA 3LK0A 5I2QA 3GK4X 4ETOA 4DIRA 1MF8B 4AQJA 4HREE 2M97A 3CS1A 1RECA 3OHMB 1K9KA 3TS5B 4NDBA 2K2FA 5HLOA 1CMGA 1CTRA 3KEVA 4CFRA 2LP3A 1TRFA 3MSEB 1AJ4A 1SL7A 2KBIA 1OSAA 4MSPA 4ICBA 1XFYO 1Y1XA 3CR2A 2Y1NA 1YRUB 1CDPA 3VGOA 4DS7A 4AQIA 4DCKA 1ALVA 1U5IA 2LCPA 5B8IB 5AERA 3PLFB 3AAKA 3BQ3A 3D0YA 3LCPC 2KBMA 1SCVA 1YVLA 2EGDA 3E3RA 2LUCA 1YR5A 4OVNF 4QJ5B 1F54A 4OKHA 2KYCA 3DF0B 2H61C 1SR6B 4CIDA 4XYNA 4GPLB 1NYAA 2O5GA 2MHHA 2WC8A 2F2PA 2HQ8A 3KPXA 4NDCA 4PE0A 1B1GA 1UWOA 4M2PA 2BE4A 3BYAA 2M7LA 4MZLA 5D7FA 1SNLA 1KQVA 1SKTA 2M8UA 4USLA 1UURA 2WCFA 1DJGA 1LINA 1KCYA 3SG6A 1SK6D 1CNPA 2E30A 1DVIA 2MA2A 1DMOA 1N65A 1UHIA 2F3ZA 1AHRA 1GGZA 3DVMA 2WOSA 1F70A 2HETA 2NXQA 1S6JA 3RLZA 4F0ZB 5K89A 4MZKA 1E8AA 1FI6A 1CLMA 1F4OA 1PALA 1OOJA 3IQOA 2H61A 4YGEB 1DF0B 1SL9A 2K0JA 3OP0A 2JZIA 1L2OC 1XA5A 2SCPA 4P5OE 4HRGA 1BF5A 3GK2A 1RK9A 1OMDA 5JOLA 3PFVA 4PHJA 1W7JB 2BKIB 2MLEC 1DGUA 2M1UA 5AEQA 1QJTA 1SPYA 2LMVA 5CSFA 3TDZA 1YRTB 2L51A 2M7NA 1BMOA 3BUXB 3OB1B 1OZOA 2BKHB 4PE4A 1PK0D 2RGIA 2H2KA 4MRYA 1UHKA 4MVFA 5HLVA 1IQ3A 2BL0B 1Y0VH 3FS7A 1IJ6A 1OMVA 3IF7A 1S1EA 2EC6B 2JT0A 2MBXA 1EH2A 2R2IA 1IG5A 1WRZA 1XO5A 2JOJA 1AJ5A 3WXAA 1CDMA 1QLKA 1SBJA 2K61A 2VRGA 4I5NB 3A4UB 4PE7A 3DVKA 4AOMA 1BG1A 2D8NA 1CB1A 1QV0A 2CTNA 2LE9B 1B47A 2PVBA 2ISDA 4PHMA 2MRDA 2LP2A 2BCAA 3WNXB 2KGBC 3HCMA 4MEWA 1C07A 1MQ1A 2JQ6A 2JWWA 1ZACA 2L5XB 1A75B 1MUXA 1NCYA 1K95A 1TN4A 1NX3A 3BUOB 4YGCB 2BCXA 3PN7B 1TIZA 1A4PA 4YGAA 1DTLA 3PALA 1AK8A 3FWBA 2K7OA 1AUIB 1EG4A 1OMRA 2OS8B 4NDDA 5CPVA 3KHEA 1Y1AA 4HSZA 5IBWA 3HX4A 2CBLA 3I5HB 3SJSA 1PSRA 5KTYA 3A8RA 1XYDA 3O2PA 1L7ZA 2JPTA 4PHNA 1XFVO 2KAYA 1CFCA 2E6WA 1DJIA 1BJFA 2O60A 1J1DA 3TS5C 4C0JA 1FI5A 1CKKA 1J7QA 5AANA 1CDLA 5AXIA 1PULA 1DJXA 1JUOA 2G2BA 3C1VA 2JU0A 4BY5A 1S26D 4I5KA 4DUQA 1PVBA 1SL8A 3EKHA 2KI6C 4YBHB 1B4CA 2JRFA 1AP4A 5PALA 4ORCB 3VRPA 1QX2A 2KAXA 1RFJA 2JULA 3JVTB 2GGMA 1J55A 5HKWA 1FBVA 1CM1A 1KK7Z 1TNWA 2K8MB 4OCIA 1YURA 2L50A 2M1KB 4Q04A 1R6PA 3PATA 3NSLA 1TNPA 4GUKA 4NQGA 4PCWA 1IGVA 1SR6C 1NIWA 2WORA 1OZSA 2BBNA 4U8DA 4C0LA 1B8LA 1S3PA 3CZTX 3NSKA 1F55A 1B7TZ 3BXKA 1G33A 2FCDA 5J3XA 2CCMA 2Y4QA 1KSMA 5CSIA 1QVIZ 1A03A 1HT9A 1R2UA 1JFKA 1UP5A 2KOTA 3SG5A 1IKUA 3EVVA 1KQMB 3TZ1A 4D1EA 2V53A 1CFPA 1WDCC 2NCPA 2F2OA 1XFZO 2KFHA 4R1EA
chains in the Genus database with same CATH superfamily
1Y1UA 4JKTA 2KI4B 1M39A 2FCEA 2KHNA 2ZKMX 4CLNA 2EHBA 1QX5B 4XJKB 2LMUA 2KYFA 2DOQA 1PVAA 4L9MA 4YGDB 1OOHA 3DF0A 2AUCA 2I7AA 1NUBA 2MJWB 2QEOA 3EVRA 4YRUA 2HQWA 1KK8B 3OB2B 1YX7A 1OW4A 2PRUA 1A29A 1SYMA 2LAPA 3S0GA 3PM8A 1PSBA 1QWVA 2PALA 2KNEA 1DJHA 4GBAA 2JT3A 2LMTA 2LVKA 1CFFA 1K8UA 3NXAA 3EK4A 2ZFDA 3SG2A 1YVHA 4E68A 1CM4A 3OX6A 1DJZA 3AKAA 2NLNA 1QS7A 1XFRA 2LC5A 1QV1A 2M3WA 2IS9A 3D75A 2WCHA 3NSOA 4GFTA 3VROA 2AMIA 1YX8A 2L0PA 2WNDA 2BL0C 2K60A 1ZUZA 1RWYA 1K96A 1SCMB 2COLB 3TUYB 3O78A 1CFDA 1V1GA 1CLLA 2A4JA 2EC6C 4PDZA 1RJVA 1Q80A 2M49B 1OQPA 4JQ0D 1UHHA 4N1GA 1B8RA 1QX7A 1KFUS 4A4BA 4JPZB 1YUUA 4GGNA 1ZFSA 4OV2A 3TDIA 3CGAA 3SG4A 1IJ5A 2ZRTA 3BUNB 1XVJA 3I5IB 4MBEA 1DF0A 3JTDB 4WQ2A 2JNXA 4FQOA 4QJ3B 5I2LA 3S0EA 2GGZA 1BT6A 2PSRA 3EVUA 4INWA 1W7IB 5HKZA 1HQVA 2BCBA 3CLNA 1QIWA 2LVJA 3NSIA 1S6CA 3PN7C 1LVCD 2KQYA 4N5XA 2K2AA 5G08A 2M29A 2WCEA 3EK8A 1C7WA 1S6IA 1T14A 3BUWB 3DVJA 3KO0A 4KYNA 2KFGA 2WCKA 2G9BA 2OS8C 2HF5A 5TNCA 2I94A 1IRJA 3BOWB 1JFJA 2NZ0A 3I5HC 1IIOA 3I5GB 3B6XA 2KSPA 1B9AA 1NCXA 2BECA 2KDHA 1BU3A 1MR8A 5HL1A 3RZSA 4A4CA 2SASA 1N2DA 5CSNA 1VRKA 3IVTA 2KAVA 1JF2A 3EG5B 1BOCA 4GGFC 3SIBA 1NSHA 5DKRA 1TWOA 2FJYA 1BR4B 1M46A 2KPHA 4YI9A 2LHIA 3BFHA 5I2OA 3SG7A 1KSOA 2L98A 1JF0A 1C7VA 1S5GZ 2JNFA 1WLZA 2K7BA 2LVIA 4FTGA 3CR4X 1IWQA 1ZMZA 3OX5A 4ZCUA 5JJGA 4CFQA 4M2OA 3CTNA 1A75A 1UHJA 1EL4A 2KLEA 3I5FB 2ZRSA 1UHNA 2AAOA 3LLEA 4BY4A 1DC1A 4GNKB 3CZ2A 3JVTC 4M2QA 4YGBB 4CPVA 3GK1A 1GGWA 3L4LA 5KU1A 3H4SE 1G8IA 3DD4A 3EK7A 4MRXA 1F8HA 3S0FA 2OTGB 2I18A 1C3ZA 1JSAA 1MWNA 4OZDA 3VRRA 4P2YB 1ZOTB 2FJUB 1EJ3A 2F8PA 2NCOA 2QPTA 1RROA 1U5IB 2CXJA 1KFXS 2KFFA 4GGFA 1SY9A 1ALWA 1TNXA 1SMGA 4WQ3A 3D0YB 3CWGA 2WCJA 1J7PA 2PASA 2F3YA 1DJWA 1OE9B 1DGVA 1KWOB 1ODBA 2CNPA 4I5LB 1LA3A 1SRAA 4C0KA 2KLDA 1FW4A 3IQQA 3AKBA 3ZNIA 1MXLC 1KK7Y 2WCLA 3KF9A 1KQMC 4JWQA 4QJ4B 1K93D 2LHLA 3RM1A 3FIAA 1BODA 1UUSA 2LLSA 1QXPA 3D10A 1NX1A 5D69A 1JC2A 4YI8A 1IQ5A 1SW8A 2Q4UA 1Y6WA 2KI4C 3O6BA 3R72A 1XFUO 3CYZA 3CDNA 3B87A 1M31A 3CABA 3BJHA 1GQMA 1QATA 1WRKA 2QACA 1B7TY 2LNKA 1KK8C 2GV5A 1TCFA 1MXEA 4OR9B 1QVIY 3ICBA 4UPGA 4TNCA 1NPQA 1QIVA 1YUSA 3O4YA 1RTP1 1TTXA 3BFAA 5DICA 1XFWO 2P70A 1K9PA 1P28A 2K7DA 3B7AA 1K94A 1V1FA 4IL1A 5FYXA 1M63B 3LL8B 1NWDA 1XFXO 4MLWA 1TNQA 1IH0A 2Q91A 1DJYA 2M9GA 4GAOA 1G4YR 1SCMC 2JT8A 1AVSA 1X02A 1J1EA 3TUYC 1CMFA 1BLQA 2ZN9A 1NX2A 3D73A 2KQ6A 1WY9A 2BAPA 5DKQA 2L2EA 1PRWA 5CSJA 5AFPA 2BNXA 1WRLA 3SG3A 1KFUL 2LVVA 2LLUA 1WDCB 2P6BB 3QMEA 4MZJA 5FI2A 2FOTA 4XJKA 3DYEA 2JC2A 3I5IC 1FPWA 3JTDC 1TCOB 4N1FA 2KGRA 2BBMA 2BE6A 5HYDA 4I5JA 4ZCVA 1YTZC 1JWDA 1TUJA 3DVEA 3GOFA 3WHUB 2HPSA 4MN0A 2L4IA 3QRXA 2MLFC 2K7CA 3EKJA 1J7OA 2JXCA 3OGNA 1FF1A 1XK4C 1L2OB 3CZ0A 1LKJA 3PSRA 1EG3A 3I5GC 2ZNDA 1H4BA 5I8NA 2TN4A 2LV7A 4PALA 2L5YA 3WHTB 1MHOA 1JBAA 2PMYA 2F33A 1F4QA 1WLMA 1F71A 1K9UA 1QASA 2JXLA 5GQQC 2ZN8A 3VRQA 1NP8A 5HKYA 2MAZA 3L47A 1M45A 4DRWA 1TOPA 3VRNA 4PHKA 1K90D 1J7RA 2YGUA 2L4HA 2H8VA 2LUXA 5ER4X 2LANA 2KI6D 3O4XA 1D1OA 1GJYA 3I5FC 3PJIA 3CR5X 2JTTA 1QLSA 2M0RA 1CDNA 4ORBB 4PE1A 3SIAA 2ZNEA 1DT7B 3TDUA 1CLBA 2WCBA 3BFBA 2I2RE 3FE8A 3FWCA 2LLTA 1XK4A 2OTGC 5DKNA 5KSZA 1W9ZA 2B1UA 3BUMB 1EXRA 3BOWA 1K2HA 3M0WA 4HRHA 2CT9A 1YUTA 2Y1MA 1KFXL 3LK1A 3AAJA 1NX0A 1A2XA 1LXFC 1S36A 2LM5A 1S5GY 5BPJA 3K21A 3ZWHA 2JTZA 5F6TA 5ER5A 2QEBA 4ORAB 1QTXA 2Y5IA 2OPOA 4WRIA 1LA0A 3F45A 1BR1B 1B8CA 1N0YA 3N7HA 1H8BA 1KWOC 1NCZA 3FE6A 3VB1A 3LK0A 3D77A 5I2QA 3GK4X 4ETOA 4DIRA 1MF8B 4F7FA 4AQJA 4HREE 2M97A 3CS1A 1RECA 3OHMB 1K9KA 3S0BA 3TS5B 4NDBA 2K2FA 4FQTA 5HLOA 1CMGA 2P71A 3D74A 1CTRA 2QEVA 3KEVA 4CFRA 2LP3A 1TRFA 3MSEB 1AJ4A 1SL7A 2KBIA 3CZ1A 1OSAA 3FE9A 4MSPA 4ICBA 1XFYO 1Y1XA 3CR2A 2Y1NA 1YRUB 1CDPA 3VGOA 4DS7A 4AQIA 4DCKA 1ALVA 1U5IA 2LCPA 5B8IB 5AERA 3PLFB 3AAKA 3BQ3A 3D0YA 1C3YA 3LCPC 2KBMA 1SCVA 1YVLA 2EGDA 3E3RA 2LUCA 3NHIA 1YR5A 4OVNF 4QJ5B 1F54A 2QDIA 4OKHA 2KYCA 3DF0B 2H61C 1SR6B 4CIDA 4XYNA 4GPLB 1NYAA 3Q8IA 1OOFA 2O5GA 2MHHA 2WC8A 2F2PA 3B86A 3DY9A 2HQ8A 3KPXA 3S0AA 4NDCA 4PE0A 1B1GA 1UWOA 4M2PA 2BE4A 3BYAA 2M7LA 4MZLA 5D7FA 1SNLA 3PM2A 1KQVA 1SKTA 2M8UA 4USLA 1UURA 2WCFA 4INXA 1DJGA 1LINA 3B88A 1KCYA 3SG6A 1SK6D 1CNPA 2E30A 1DVIA 2MA2A 1DMOA 1N65A 1UHIA 2F3ZA 1AHRA 1GGZA 3DVMA 2PQLA 2WOSA 1F70A 2HETA 2NXQA 1S6JA 3RLZA 3SS4A 4F0ZB 5K89A 4MZKA 1E8AA 2WCMA 1FI6A 1CLMA 1F4OA 1PALA 1OOJA 3IQOA 1TUZA 2H61A 4YGEB 1DF0B 1SL9A 2K0JA 3OP0A 2JZIA 1L2OC 1XA5A 2SCPA 4P5OE 4HRGA 1BF5A 3GK2A 1RK9A 1OMDA 3L4AA 5JOLA 2JPOA 3PFVA 4PHJA 1W7JB 2BKIB 2MLEC 1DGUA 2M1UA 5AEQA 1QJTA 1SPYA 2LMVA 5CSFA 3TDZA 3SS5A 2GTEA 1YRTB 2L51A 2M7NA 1BMOA 3BUXB 3NHTA 1OZOA 2BKHB 3OB1B 4IJ7A 4PE4A 1PK0D 2RGIA 2H2KA 4MRYA 1UHKA 4MVFA 1Z4HA 5HLVA 2BL0B 1Y0VH 3FS7A 1IQ3A 1IJ6A 1OMVA 3IF7A 5FI6A 4JD9A 1S1EA 2EC6B 2JT0A 2MBXA 1EH2A 2R2IA 1IG5A 1WRZA 1XO5A 2JOJA 1AJ5A 4PT1A 3WXAA 1CDMA 1QLKA 1SBJA 3V2LA 2K61A 2VRGA 4I5NB 1GM0A 3A4UB 4PE7A 3DVKA 4AOMA 1BG1A 2D8NA 1CB1A 1QV0A 1DEKA 2CTNA 1B47A 2LE9B 2PVBA 2ISDA 4PHMA 2MRDA 2WC5A 2LP2A 1DELA 2BCAA 3WNXB 2KGBC 3HCMA 4MEWA 1C07A 1Z2CB 1MQ1A 1OOGA 2JQ6A 1ZACA 2JWWA 1A75B 1MUXA 2L5XB 1NCYA 1K95A 1TN4A 3R1VA 1NX3A 3BUOB 4YGCB 2BCXA 3PN7B 1TIZA 3R1PA 1A4PA 4YGAA 1DTLA 3PALA 1AK8A 3FWBA 2K7OA 1AUIB 1EG4A 1OMRA 2OS8B 4NDDA 5CPVA 3KHEA 1Y1AA 4HSZA 5IBWA 2QEHA 3HX4A 2CBLA 3I5HB 3SJSA 1PSRA 5KTYA 3A8RA 1XYDA 3O2PA 3S0DA 1OOIX 1L7ZA 2JPTA 4PHNA 5EL2A 1XFVO 2KAYA 1CFCA 2E6WA 2L2CA 1DJIA 1BJFA 2O60A 1J1DA 3TS5C 4C0JA 1FI5A 1CKKA 3UNWA 1J7QA 5AANA 1CDLA 5AXIA 1PULA 1DJXA 1JUOA 2G2BA 3C1VA 2JU0A 5FI7A 1S26D 4I5KA 2ERBA 4BY5A 4DUQA 1PVBA 1SL8A 3EKHA 2KI6C 4YBHB 1B4CA 1DQEA 2JRFA 1AP4A 5PALA 4ORCB 3VRPA 1QX2A 2KAXA 1RFJA 2JULA 3JVTB 2GGMA 3K1EA 3UO9A 1J55A 3D76A 5HKWA 1FBVA 1CM1A 1KK7Z 1TNWA 2K8MB 4OCIA 1YURA 2L50A 1SSEB 2M1KB 3SS3A 4Q04A 1R6PA 3PATA 3NSLA 1TNPA 4GUKA 4NQGA 4PCWA 1IGVA 1SR6C 5D3OA 1NIWA 3D78A 3NGVA 2WORA 1OZSA 2BBNA 4U8DA 2WC6A 4C0LA 1B8LA 1LS8A 3R1OA 1S3PA 3CZTX 3NSKA 1F55A 1B7TZ 3BXKA 3OBVA 1G33A 2FCDA 5J3XA 2CCMA 2Y4QA 1KSMA 5CSIA 1QVIZ 1A03A 1HT9A 1R2UA 1JFKA 1ORGA 1UP5A 2KOTA 2PYQA 3SG5A 1IKUA 3DZTA 1KQMB 3EVVA 3TZ1A 2V53A 4D1EA 1CFPA 1WDCC 2NCPA 2F2OA 5I94A 3DXLA 1XFZO 2KFHA 4R1EA
chains in the Genus database with same CATH topology
1Y1UA 2KI4B 1M39A 2FCEA 2KHNA 2ZKMX 4CLNA 2EHBA 1QX5B 4XJKB 2LMUA 2KYFA 2DOQA 1PVAA 4L9MA 4YGDB 3EVRA 3DF0A 2AUCA 2I7AA 1NUBA 2MJWB 4YRUA 2HQWA 1KK8B 3OB2B 1YX7A 2PRUA 1A29A 1SYMA 2LAPA 3PM8A 1PSBA 2PALA 2KNEA 1DJHA 4GBAA 2JT3A 2LMTA 2LVKA 1CFFA 1K8UA 3NXAA 3EK4A 2ZFDA 3SG2A 1YVHA 4E68A 1CM4A 3OX6A 1DJZA 3AKAA 2NLNA 1QS7A 2LC5A 1QV1A 2M3WA 2IS9A 3NSOA 3VROA 4GFTA 2AMIA 1YX8A 2L0PA 2WNDA 2BL0C 1ZUZA 1RWYA 1K96A 1SCMB 2COLB 3TUYB 3O78A 1CFDA 1V1GA 1CLLA 2A4JA 2EC6C 4PDZA 1RJVA 1Q80A 2M49B 1OQPA 4JQ0D 1UHHA 4N1GA 1B8RA 1QX7A 1KFUS 4A4BA 4JPZB 1YUUA 4GGNA 1ZFSA 4OV2A 3TDIA 3CGAA 3SG4A 1IJ5A 2ZRTA 3BUNB 1XVJA 3I5IB 4MBEA 1DF0A 3JTDB 4WQ2A 2JNXA 4FQOA 4QJ3B 5I2LA 2GGZA 1BT6A 2PSRA 3EVUA 5HKZA 1W7IB 1HQVA 2BCBA 3CLNA 1QIWA 2LVJA 3NSIA 1S6CA 3PN7C 1LVCD 2KQYA 4N5XA 2K2AA 5G08A 2M29A 2WCEA 3EK8A 1C7WA 1S6IA 3BUWB 3DVJA 3KO0A 2KFGA 5TNCA 2G9BA 2OS8C 2HF5A 2I94A 1IRJA 3BOWB 1JFJA 2NZ0A 3I5HC 3I5GB 2KSPA 1B9AA 1NCXA 2BECA 2KDHA 1BU3A 1MR8A 4A4CA 2SASA 1N2DA 5CSNA 1VRKA 2KAVA 1JF2A 1BOCA 4GGFC 3SIBA 1NSHA 5DKRA 1BR4B 1M46A 4YI9A 2LHIA 5I2OA 3SG7A 1KSOA 2L98A 1JF0A 1C7VA 1S5GZ 2JNFA 1WLZA 2K7BA 2LVIA 4FTGA 3CR4X 1IWQA 1ZMZA 3OX5A 4ZCUA 5JJGA 4CFQA 4M2OA 3CTNA 1A75A 1UHJA 1EL4A 3I5FB 3LLEA 2ZRSA 1UHNA 2AAOA 4BY4A 4GNKB 3JVTC 4M2QA 4YGBB 4CPVA 3GK1A 1GGWA 5KU1A 3H4SE 1G8IA 3DD4A 3EK7A 4MRXA 1F8HA 2OTGB 2I18A 1JSAA 1MWNA 3VRRA 4P2YB 1ZOTB 2FJUB 1EJ3A 2F8PA 2NCOA 2QPTA 1RROA 1U5IB 2CXJA 1KFXS 2KFFA 4GGFA 1SY9A 1ALWA 1TNXA 1SMGA 4WQ3A 3D0YB 3CWGA 1J7PA 2PASA 2F3YA 1DJWA 1OE9B 1DGVA 1KWOB 1ODBA 2CNPA 4I5LB 1LA3A 1SRAA 4C0KA 1FW4A 3IQQA 3AKBA 3ZNIA 1MXLC 1KK7Y 3KF9A 1KQMC 4JWQA 4QJ4B 1K93D 2LHLA 3RM1A 3FIAA 1BODA 1UUSA 2LLSA 1QXPA 3D10A 1NX1A 5D69A 1JC2A 4YI8A 1IQ5A 1SW8A 2Q4UA 1Y6WA 2KI4C 3O6BA 1XFUO 1M31A 1GQMA 1QATA 1WRKA 2QACA 1B7TY 2LNKA 1KK8C 2GV5A 1TCFA 1MXEA 4OR9B 1QVIY 3ICBA 4UPGA 4TNCA 1NPQA 1QIVA 1YUSA 3O4YA 1RTP1 1TTXA 1XFWO 1K9PA 2K7DA 1K94A 1V1FA 4IL1A 5FYXA 1M63B 3LL8B 1NWDA 1XFXO 4MLWA 1TNQA 1IH0A 2Q91A 1DJYA 2M9GA 4GAOA 1G4YR 1SCMC 2JT8A 1AVSA 1X02A 1J1EA 3TUYC 1CMFA 1BLQA 2ZN9A 1NX2A 2KQ6A 1WY9A 5DKQA 2L2EA 1PRWA 5CSJA 5AFPA 1WRLA 3SG3A 1KFUL 2LVVA 2LLUA 1WDCB 2P6BB 4MZJA 2FOTA 4XJKA 2JC2A 3I5IC 1FPWA 3JTDC 1TCOB 4N1FA 2KGRA 2BBMA 2BE6A 5HYDA 4I5JA 4ZCVA 1YTZC 1JWDA 3DVEA 3GOFA 3WHUB 2HPSA 4MN0A 2L4IA 3QRXA 2MLFC 2K7CA 3EKJA 1J7OA 2JXCA 1FF1A 1XK4C 1L2OB 1LKJA 3PSRA 1EG3A 3I5GC 2ZNDA 1H4BA 5I8NA 2TN4A 2LV7A 4PALA 3WHTB 1MHOA 1JBAA 2PMYA 2F33A 1F4QA 1WLMA 1F71A 1K9UA 1QASA 2JXLA 5GQQC 2ZN8A 3VRQA 1NP8A 5HKYA 2MAZA 1M45A 4DRWA 1TOPA 3VRNA 4PHKA 1K90D 1J7RA 2L4HA 2LUXA 5ER4X 2LANA 2KI6D 1D1OA 1GJYA 3I5FC 3CR5X 2JTTA 1QLSA 2M0RA 1CDNA 4ORBB 4PE1A 3SIAA 2ZNEA 1DT7B 3TDUA 1CLBA 2WCBA 2I2RE 3FWCA 2LLTA 1XK4A 2OTGC 5DKNA 5KSZA 2B1UA 3BUMB 1EXRA 3BOWA 1K2HA 3M0WA 4HRHA 2CT9A 1YUTA 2Y1MA 1KFXL 3LK1A 3AAJA 1NX0A 1A2XA 1LXFC 1S36A 2LM5A 1S5GY 5BPJA 3K21A 3ZWHA 2JTZA 5F6TA 5ER5A 4ORAB 1QTXA 2Y5IA 2OPOA 4WRIA 1LA0A 3F45A 1BR1B 1B8CA 1N0YA 1H8BA 1KWOC 1NCZA 3LK0A 5I2QA 3GK4X 4ETOA 4DIRA 1MF8B 4AQJA 4HREE 2M97A 3CS1A 1RECA 3OHMB 1K9KA 3TS5B 4NDBA 2K2FA 5HLOA 1CMGA 1CTRA 3KEVA 4CFRA 2LP3A 1TRFA 3MSEB 1AJ4A 1SL7A 2KBIA 1OSAA 4MSPA 4ICBA 1XFYO 1Y1XA 3CR2A 2Y1NA 1YRUB 1CDPA 3VGOA 4DS7A 4AQIA 4DCKA 1ALVA 1U5IA 2LCPA 5B8IB 5AERA 3PLFB 3AAKA 3BQ3A 3D0YA 3LCPC 2KBMA 1SCVA 1YVLA 2EGDA 3E3RA 2LUCA 1YR5A 4OVNF 4QJ5B 1F54A 4OKHA 2KYCA 3DF0B 2H61C 1SR6B 4CIDA 4XYNA 4GPLB 1NYAA 2O5GA 2MHHA 2WC8A 2F2PA 2HQ8A 3KPXA 4NDCA 4PE0A 1B1GA 1UWOA 4M2PA 2BE4A 3BYAA 2M7LA 4MZLA 5D7FA 1SNLA 1KQVA 1SKTA 2M8UA 4USLA 1UURA 2WCFA 1DJGA 1LINA 1KCYA 3SG6A 1SK6D 1CNPA 2E30A 1DVIA 2MA2A 1DMOA 1N65A 1UHIA 2F3ZA 1AHRA 1GGZA 3DVMA 2WOSA 1F70A 2HETA 2NXQA 1S6JA 3RLZA 4F0ZB 5K89A 4MZKA 1E8AA 1FI6A 1CLMA 1F4OA 1PALA 1OOJA 3IQOA 2H61A 4YGEB 1DF0B 1SL9A 2K0JA 3OP0A 2JZIA 1L2OC 1XA5A 2SCPA 4P5OE 4HRGA 1BF5A 3GK2A 1RK9A 1OMDA 5JOLA 3PFVA 4PHJA 1W7JB 2BKIB 2MLEC 1DGUA 2M1UA 5AEQA 1QJTA 1SPYA 2LMVA 5CSFA 3TDZA 1YRTB 2L51A 2M7NA 1BMOA 3BUXB 3OB1B 1OZOA 2BKHB 4PE4A 1PK0D 2RGIA 2H2KA 4MRYA 1UHKA 4MVFA 5HLVA 1IQ3A 2BL0B 1Y0VH 3FS7A 1IJ6A 1OMVA 3IF7A 1S1EA 2EC6B 2JT0A 2MBXA 1EH2A 2R2IA 1IG5A 1WRZA 1XO5A 2JOJA 1AJ5A 3WXAA 1CDMA 1QLKA 1SBJA 2K61A 2VRGA 4I5NB 3A4UB 4PE7A 3DVKA 4AOMA 1BG1A 2D8NA 1CB1A 1QV0A 2CTNA 2LE9B 1B47A 2PVBA 2ISDA 4PHMA 2MRDA 2LP2A 2BCAA 3WNXB 2KGBC 3HCMA 4MEWA 1C07A 1MQ1A 2JQ6A 2JWWA 1ZACA 2L5XB 1A75B 1MUXA 1NCYA 1K95A 1TN4A 1NX3A 3BUOB 4YGCB 2BCXA 3PN7B 1TIZA 1A4PA 4YGAA 1DTLA 3PALA 1AK8A 3FWBA 2K7OA 1AUIB 1EG4A 1OMRA 2OS8B 4NDDA 5CPVA 3KHEA 1Y1AA 4HSZA 5IBWA 3HX4A 2CBLA 3I5HB 3SJSA 1PSRA 5KTYA 3A8RA 1XYDA 3O2PA 1L7ZA 2JPTA 4PHNA 1XFVO 2KAYA 1CFCA 2E6WA 1DJIA 1BJFA 2O60A 1J1DA 3TS5C 4C0JA 1FI5A 1CKKA 1J7QA 5AANA 1CDLA 5AXIA 1PULA 1DJXA 1JUOA 2G2BA 3C1VA 2JU0A 4BY5A 1S26D 4I5KA 4DUQA 1PVBA 1SL8A 3EKHA 2KI6C 4YBHB 1B4CA 2JRFA 1AP4A 5PALA 4ORCB 3VRPA 1QX2A 2KAXA 1RFJA 2JULA 3JVTB 2GGMA 1J55A 5HKWA 1FBVA 1CM1A 1KK7Z 1TNWA 2K8MB 4OCIA 1YURA 2L50A 2M1KB 4Q04A 1R6PA 3PATA 3NSLA 1TNPA 4GUKA 4NQGA 4PCWA 1IGVA 1SR6C 1NIWA 2WORA 1OZSA 2BBNA 4U8DA 4C0LA 1B8LA 1S3PA 3CZTX 3NSKA 1F55A 1B7TZ 3BXKA 1G33A 2FCDA 5J3XA 2CCMA 2Y4QA 1KSMA 5CSIA 1QVIZ 1A03A 1HT9A 1R2UA 1JFKA 1UP5A 2KOTA 3SG5A 1IKUA 3EVVA 1KQMB 3TZ1A 4D1EA 2V53A 1CFPA 1WDCC 2NCPA 2F2OA 1XFZO 2KFHA 4R1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1U A;  2KI4 B;  1M39 A;  2FCE A;  2KHN A;  2ZKM X;  4CLN A;  2EHB A;  1QX5 B;  4XJK B;  2LMU A;  2KYF A;  2DOQ A;  1PVA A;  4L9M A;  4YGD B;  3EVR A;  3DF0 A;  2AUC A;  2I7A A;  1NUB A;  2MJW B;  4YRU A;  2HQW A;  1KK8 B;  3OB2 B;  1YX7 A;  2PRU A;  1A29 A;  1SYM A;  2LAP A;  3PM8 A;  1PSB A;  2PAL A;  2KNE A;  1DJH A;  4GBA A;  2JT3 A;  2LMT A;  2LVK A;  1CFF A;  1K8U A;  3NXA A;  3EK4 A;  2ZFD A;  3SG2 A;  1YVH A;  4E68 A;  1CM4 A;  3OX6 A;  1DJZ A;  3AKA A;  2NLN A;  1QS7 A;  2LC5 A;  1QV1 A;  2M3W A;  2IS9 A;  3NSO A;  3VRO A;  4GFT A;  2AMI A;  1YX8 A;  2L0P A;  2WND A;  2BL0 C;  1ZUZ A;  1RWY A;  1K96 A;  1SCM B;  2COL B;  3TUY B;  3O78 A;  1CFD A;  1V1G A;  1CLL A;  2A4J A;  2EC6 C;  4PDZ A;  1RJV A;  1Q80 A;  2M49 B;  1OQP A;  4JQ0 D;  1UHH A;  4N1G A;  1B8R A;  1QX7 A;  1KFU S;  4A4B A;  4JPZ B;  1YUU A;  4GGN A;  1ZFS A;  4OV2 A;  3TDI A;  3CGA A;  3SG4 A;  1IJ5 A;  2ZRT A;  3BUN B;  1XVJ A;  3I5I B;  4MBE A;  1DF0 A;  3JTD B;  4WQ2 A;  2JNX A;  4FQO A;  4QJ3 B;  5I2L A;  2GGZ A;  1BT6 A;  2PSR A;  3EVU A;  5HKZ A;  1W7I B;  1HQV A;  2BCB A;  3CLN A;  1QIW A;  2LVJ A;  3NSI A;  1S6C A;  3PN7 C;  1LVC D;  2KQY A;  4N5X A;  2K2A A;  5G08 A;  2M29 A;  2WCE A;  3EK8 A;  1C7W A;  1S6I A;  3BUW B;  3DVJ A;  3KO0 A;  2KFG A;  5TNC A;  2G9B A;  2OS8 C;  2HF5 A;  2I94 A;  1IRJ A;  3BOW B;  1JFJ A;  2NZ0 A;  3I5H C;  3I5G B;  2KSP A;  1B9A A;  1NCX A;  2BEC A;  2KDH A;  1BU3 A;  1MR8 A;  4A4C A;  2SAS A;  1N2D A;  5CSN A;  1VRK A;  2KAV A;  1JF2 A;  1BOC A;  4GGF C;  3SIB A;  1NSH A;  5DKR A;  1BR4 B;  1M46 A;  4YI9 A;  2LHI A;  5I2O A;  3SG7 A;  1KSO A;  2L98 A;  1JF0 A;  1C7V A;  1S5G Z;  2JNF A;  1WLZ A;  2K7B A;  2LVI A;  4FTG A;  3CR4 X;  1IWQ A;  1ZMZ A;  3OX5 A;  4ZCU A;  5JJG A;  4CFQ A;  4M2O A;  3CTN A;  1A75 A;  1UHJ A;  1EL4 A;  3I5F B;  3LLE A;  2ZRS A;  1UHN A;  2AAO A;  4BY4 A;  4GNK B;  3JVT C;  4M2Q A;  4YGB B;  4CPV A;  3GK1 A;  1GGW A;  5KU1 A;  3H4S E;  1G8I A;  3DD4 A;  3EK7 A;  4MRX A;  1F8H A;  2OTG B;  2I18 A;  1JSA A;  1MWN A;  3VRR A;  4P2Y B;  1ZOT B;  2FJU B;  1EJ3 A;  2F8P A;  2NCO A;  2QPT A;  1RRO A;  1U5I B;  2CXJ A;  1KFX S;  2KFF A;  4GGF A;  1SY9 A;  1ALW A;  1TNX A;  1SMG A;  4WQ3 A;  3D0Y B;  3CWG A;  1J7P A;  2PAS A;  2F3Y A;  1DJW A;  1OE9 B;  1DGV A;  1KWO B;  1ODB A;  2CNP A;  4I5L B;  1LA3 A;  1SRA A;  4C0K A;  1FW4 A;  3IQQ A;  3AKB A;  3ZNI A;  1MXL C;  1KK7 Y;  3KF9 A;  1KQM C;  4JWQ A;  4QJ4 B;  1K93 D;  2LHL A;  3RM1 A;  3FIA A;  1BOD A;  1UUS A;  2LLS A;  1QXP A;  3D10 A;  1NX1 A;  5D69 A;  1JC2 A;  4YI8 A;  1IQ5 A;  1SW8 A;  2Q4U A;  1Y6W A;  2KI4 C;  3O6B A;  1XFU O;  1M31 A;  1GQM A;  1QAT A;  1WRK A;  2QAC A;  1B7T Y;  2LNK A;  1KK8 C;  2GV5 A;  1TCF A;  1MXE A;  4OR9 B;  1QVI Y;  3ICB A;  4UPG A;  4TNC A;  1NPQ A;  1QIV A;  1YUS A;  3O4Y A;  1RTP 1;  1TTX A;  1XFW O;  1K9P A;  2K7D A;  1K94 A;  1V1F A;  4IL1 A;  5FYX A;  1M63 B;  3LL8 B;  1NWD A;  1XFX O;  4MLW A;  1TNQ A;  1IH0 A;  2Q91 A;  1DJY A;  2M9G A;  4GAO A;  1G4Y R;  1SCM C;  2JT8 A;  1AVS A;  1X02 A;  1J1E A;  3TUY C;  1CMF A;  1BLQ A;  2ZN9 A;  1NX2 A;  2KQ6 A;  1WY9 A;  5DKQ A;  2L2E A;  1PRW A;  5CSJ A;  5AFP A;  1WRL A;  3SG3 A;  1KFU L;  2LVV A;  2LLU A;  1WDC B;  2P6B B;  4MZJ A;  2FOT A;  4XJK A;  2JC2 A;  3I5I C;  1FPW A;  3JTD C;  1TCO B;  4N1F A;  2KGR A;  2BBM A;  2BE6 A;  5HYD A;  4I5J A;  4ZCV A;  1YTZ C;  1JWD A;  3DVE A;  3GOF A;  3WHU B;  2HPS A;  4MN0 A;  2L4I A;  3QRX A;  2MLF C;  2K7C A;  3EKJ A;  1J7O A;  2JXC A;  1FF1 A;  1XK4 C;  1L2O B;  1LKJ A;  3PSR A;  1EG3 A;  3I5G C;  2ZND A;  1H4B A;  5I8N A;  2TN4 A;  2LV7 A;  4PAL A;  3WHT B;  1MHO A;  1JBA A;  2PMY A;  2F33 A;  1F4Q A;  1WLM A;  1F71 A;  1K9U A;  1QAS A;  2JXL A;  5GQQ C;  2ZN8 A;  3VRQ A;  1NP8 A;  5HKY A;  2MAZ A;  1M45 A;  4DRW A;  1TOP A;  3VRN A;  4PHK A;  1K90 D;  1J7R A;  2L4H A;  2LUX A;  5ER4 X;  2LAN A;  2KI6 D;  1D1O A;  1GJY A;  3I5F C;  3CR5 X;  2JTT A;  1QLS A;  2M0R A;  1CDN A;  4ORB B;  4PE1 A;  3SIA A;  2ZNE A;  1DT7 B;  3TDU A;  1CLB A;  2WCB A;  2I2R E;  3FWC A;  2LLT A;  1XK4 A;  2OTG C;  5DKN A;  5KSZ A;  2B1U A;  3BUM B;  1EXR A;  3BOW A;  1K2H A;  3M0W A;  4HRH A;  2CT9 A;  1YUT A;  2Y1M A;  1KFX L;  3LK1 A;  3AAJ A;  1NX0 A;  1A2X A;  1LXF C;  1S36 A;  2LM5 A;  1S5G Y;  5BPJ A;  3K21 A;  3ZWH A;  2JTZ A;  5F6T A;  5ER5 A;  4ORA B;  1QTX A;  2Y5I A;  2OPO A;  4WRI A;  1LA0 A;  3F45 A;  1BR1 B;  1B8C A;  1N0Y A;  1H8B A;  1KWO C;  1NCZ A;  3LK0 A;  5I2Q A;  3GK4 X;  4ETO A;  4DIR A;  1MF8 B;  4AQJ A;  4HRE E;  2M97 A;  3CS1 A;  1REC A;  3OHM B;  1K9K A;  3TS5 B;  4NDB A;  2K2F A;  5HLO A;  1CMG A;  1CTR A;  3KEV A;  4CFR A;  2LP3 A;  1TRF A;  3MSE B;  1AJ4 A;  1SL7 A;  2KBI A;  1OSA A;  4MSP A;  4ICB A;  1XFY O;  1Y1X A;  3CR2 A;  2Y1N A;  1YRU B;  1CDP A;  3VGO A;  4DS7 A;  4AQI A;  4DCK A;  1ALV A;  1U5I A;  2LCP A;  5B8I B;  5AER A;  3PLF B;  3AAK A;  3BQ3 A;  3D0Y A;  3LCP C;  2KBM A;  1SCV A;  1YVL A;  2EGD A;  3E3R A;  2LUC A;  1YR5 A;  4OVN F;  4QJ5 B;  1F54 A;  4OKH A;  2KYC A;  3DF0 B;  2H61 C;  1SR6 B;  4CID A;  4XYN A;  4GPL B;  1NYA A;  2O5G A;  2MHH A;  2WC8 A;  2F2P A;  2HQ8 A;  3KPX A;  4NDC A;  4PE0 A;  1B1G A;  1UWO A;  4M2P A;  2BE4 A;  3BYA A;  2M7L A;  4MZL A;  5D7F A;  1SNL A;  1KQV A;  1SKT A;  2M8U A;  4USL A;  1UUR A;  2WCF A;  1DJG A;  1LIN A;  1KCY A;  3SG6 A;  1SK6 D;  1CNP A;  2E30 A;  1DVI A;  2MA2 A;  1DMO A;  1N65 A;  1UHI A;  2F3Z A;  1AHR A;  1GGZ A;  3DVM A;  2WOS A;  1F70 A;  2HET A;  2NXQ A;  1S6J A;  3RLZ A;  4F0Z B;  5K89 A;  4MZK A;  1E8A A;  1FI6 A;  1CLM A;  1F4O A;  1PAL A;  1OOJ A;  3IQO A;  2H61 A;  4YGE B;  1DF0 B;  1SL9 A;  2K0J A;  3OP0 A;  2JZI A;  1L2O C;  1XA5 A;  2SCP A;  4P5O E;  4HRG A;  1BF5 A;  3GK2 A;  1RK9 A;  1OMD A;  5JOL A;  3PFV A;  4PHJ A;  1W7J B;  2BKI B;  2MLE C;  1DGU A;  2M1U A;  5AEQ A;  1QJT A;  1SPY A;  2LMV A;  5CSF A;  3TDZ A;  1YRT B;  2L51 A;  2M7N A;  1BMO A;  3BUX B;  3OB1 B;  1OZO A;  2BKH B;  4PE4 A;  1PK0 D;  2RGI A;  2H2K A;  4MRY A;  1UHK A;  4MVF A;  5HLV A;  1IQ3 A;  2BL0 B;  1Y0V H;  3FS7 A;  1IJ6 A;  1OMV A;  3IF7 A;  1S1E A;  2EC6 B;  2JT0 A;  2MBX A;  1EH2 A;  2R2I A;  1IG5 A;  1WRZ A;  1XO5 A;  2JOJ A;  1AJ5 A;  3WXA A;  1CDM A;  1QLK A;  1SBJ A;  2K61 A;  2VRG A;  4I5N B;  3A4U B;  4PE7 A;  3DVK A;  4AOM A;  1BG1 A;  2D8N A;  1CB1 A;  1QV0 A;  2CTN A;  2LE9 B;  1B47 A;  2PVB A;  2ISD A;  4PHM A;  2MRD A;  2LP2 A;  2BCA A;  3WNX B;  2KGB C;  3HCM A;  4MEW A;  1C07 A;  1MQ1 A;  2JQ6 A;  2JWW A;  1ZAC A;  2L5X B;  1A75 B;  1MUX A;  1NCY A;  1K95 A;  1TN4 A;  1NX3 A;  3BUO B;  4YGC B;  2BCX A;  3PN7 B;  1TIZ A;  1A4P A;  4YGA A;  1DTL A;  3PAL A;  1AK8 A;  3FWB A;  2K7O A;  1AUI B;  1EG4 A;  1OMR A;  2OS8 B;  4NDD A;  5CPV A;  3KHE A;  1Y1A A;  4HSZ A;  5IBW A;  3HX4 A;  2CBL A;  3I5H B;  3SJS A;  1PSR A;  5KTY A;  3A8R A;  1XYD A;  3O2P A;  1L7Z A;  2JPT A;  4PHN A;  1XFV O;  2KAY A;  1CFC A;  2E6W A;  1DJI A;  1BJF A;  2O60 A;  1J1D A;  3TS5 C;  4C0J A;  1FI5 A;  1CKK A;  1J7Q A;  5AAN A;  1CDL A;  5AXI A;  1PUL A;  1DJX A;  1JUO A;  2G2B A;  3C1V A;  2JU0 A;  4BY5 A;  1S26 D;  4I5K A;  4DUQ A;  1PVB A;  1SL8 A;  3EKH A;  2KI6 C;  4YBH B;  1B4C A;  2JRF A;  1AP4 A;  5PAL A;  4ORC B;  3VRP A;  1QX2 A;  2KAX A;  1RFJ A;  2JUL A;  3JVT B;  2GGM A;  1J55 A;  5HKW A;  1FBV A;  1CM1 A;  1KK7 Z;  1TNW A;  2K8M B;  4OCI A;  1YUR A;  2L50 A;  2M1K B;  4Q04 A;  1R6P A;  3PAT A;  3NSL A;  1TNP A;  4GUK A;  4NQG A;  4PCW A;  1IGV A;  1SR6 C;  1NIW A;  2WOR A;  1OZS A;  2BBN A;  4U8D A;  4C0L A;  1B8L A;  1S3P A;  3CZT X;  3NSK A;  1F55 A;  1B7T Z;  3BXK A;  1G33 A;  2FCD A;  5J3X A;  2CCM A;  2Y4Q A;  1KSM A;  5CSI A;  1QVI Z;  1A03 A;  1HT9 A;  1R2U A;  1JFK A;  1UP5 A;  2KOT A;  3SG5 A;  1IKU A;  3EVV A;  1KQM B;  3TZ1 A;  4D1E A;  2V53 A;  1CFP A;  1WDC C;  2NCP A;  2F2O A;  1XFZ O;  2KFH A;  4R1E A; 
#chains in the Genus database with same CATH topology
 1Y1U A;  4JKT A;  2KI4 B;  1M39 A;  2FCE A;  2KHN A;  2ZKM X;  4CLN A;  2EHB A;  1QX5 B;  4XJK B;  2LMU A;  2KYF A;  2DOQ A;  1PVA A;  4L9M A;  4YGD B;  1OOH A;  3DF0 A;  2AUC A;  2I7A A;  1NUB A;  2MJW B;  2QEO A;  3EVR A;  4YRU A;  2HQW A;  1KK8 B;  3OB2 B;  1YX7 A;  1OW4 A;  2PRU A;  1A29 A;  1SYM A;  2LAP A;  3S0G A;  3PM8 A;  1PSB A;  1QWV A;  2PAL A;  2KNE A;  1DJH A;  4GBA A;  2JT3 A;  2LMT A;  2LVK A;  1CFF A;  1K8U A;  3NXA A;  3EK4 A;  2ZFD A;  3SG2 A;  1YVH A;  4E68 A;  1CM4 A;  3OX6 A;  1DJZ A;  3AKA A;  2NLN A;  1QS7 A;  1XFR A;  2LC5 A;  1QV1 A;  2M3W A;  2IS9 A;  3D75 A;  2WCH A;  3NSO A;  4GFT A;  3VRO A;  2AMI A;  1YX8 A;  2L0P A;  2WND A;  2BL0 C;  2K60 A;  1ZUZ A;  1RWY A;  1K96 A;  1SCM B;  2COL B;  3TUY B;  3O78 A;  1CFD A;  1V1G A;  1CLL A;  2A4J A;  2EC6 C;  4PDZ A;  1RJV A;  1Q80 A;  2M49 B;  1OQP A;  4JQ0 D;  1UHH A;  4N1G A;  1B8R A;  1QX7 A;  1KFU S;  4A4B A;  4JPZ B;  1YUU A;  4GGN A;  1ZFS A;  4OV2 A;  3TDI A;  3CGA A;  3SG4 A;  1IJ5 A;  2ZRT A;  3BUN B;  1XVJ A;  3I5I B;  4MBE A;  1DF0 A;  3JTD B;  4WQ2 A;  2JNX A;  4FQO A;  4QJ3 B;  5I2L A;  3S0E A;  2GGZ A;  1BT6 A;  2PSR A;  3EVU A;  4INW A;  1W7I B;  5HKZ A;  1HQV A;  2BCB A;  3CLN A;  1QIW A;  2LVJ A;  3NSI A;  1S6C A;  3PN7 C;  1LVC D;  2KQY A;  4N5X A;  2K2A A;  5G08 A;  2M29 A;  2WCE A;  3EK8 A;  1C7W A;  1S6I A;  1T14 A;  3BUW B;  3DVJ A;  3KO0 A;  4KYN A;  2KFG A;  2WCK A;  2G9B A;  2OS8 C;  2HF5 A;  5TNC A;  2I94 A;  1IRJ A;  3BOW B;  1JFJ A;  2NZ0 A;  3I5H C;  1IIO A;  3I5G B;  3B6X A;  2KSP A;  1B9A A;  1NCX A;  2BEC A;  2KDH A;  1BU3 A;  1MR8 A;  5HL1 A;  3RZS A;  4A4C A;  2SAS A;  1N2D A;  5CSN A;  1VRK A;  3IVT A;  2KAV A;  1JF2 A;  3EG5 B;  1BOC A;  4GGF C;  3SIB A;  1NSH A;  5DKR A;  1TWO A;  2FJY A;  1BR4 B;  1M46 A;  2KPH A;  4YI9 A;  2LHI A;  3BFH A;  5I2O A;  3SG7 A;  1KSO A;  2L98 A;  1JF0 A;  1C7V A;  1S5G Z;  2JNF A;  1WLZ A;  2K7B A;  2LVI A;  4FTG A;  3CR4 X;  1IWQ A;  1ZMZ A;  3OX5 A;  4ZCU A;  5JJG A;  4CFQ A;  4M2O A;  3CTN A;  1A75 A;  1UHJ A;  1EL4 A;  2KLE A;  3I5F B;  2ZRS A;  1UHN A;  2AAO A;  3LLE A;  4BY4 A;  1DC1 A;  4GNK B;  3CZ2 A;  3JVT C;  4M2Q A;  4YGB B;  4CPV A;  3GK1 A;  1GGW A;  3L4L A;  5KU1 A;  3H4S E;  1G8I A;  3DD4 A;  3EK7 A;  4MRX A;  1F8H A;  3S0F A;  2OTG B;  2I18 A;  1C3Z A;  1JSA A;  1MWN A;  4OZD A;  3VRR A;  4P2Y B;  1ZOT B;  2FJU B;  1EJ3 A;  2F8P A;  2NCO A;  2QPT A;  1RRO A;  1U5I B;  2CXJ A;  1KFX S;  2KFF A;  4GGF A;  1SY9 A;  1ALW A;  1TNX A;  1SMG A;  4WQ3 A;  3D0Y B;  3CWG A;  2WCJ A;  1J7P A;  2PAS A;  2F3Y A;  1DJW A;  1OE9 B;  1DGV A;  1KWO B;  1ODB A;  2CNP A;  4I5L B;  1LA3 A;  1SRA A;  4C0K A;  2KLD A;  1FW4 A;  3IQQ A;  3AKB A;  3ZNI A;  1MXL C;  1KK7 Y;  2WCL A;  3KF9 A;  1KQM C;  4JWQ A;  4QJ4 B;  1K93 D;  2LHL A;  3RM1 A;  3FIA A;  1BOD A;  1UUS A;  2LLS A;  1QXP A;  3D10 A;  1NX1 A;  5D69 A;  1JC2 A;  4YI8 A;  1IQ5 A;  1SW8 A;  2Q4U A;  1Y6W A;  2KI4 C;  3O6B A;  3R72 A;  1XFU O;  3CYZ A;  3CDN A;  3B87 A;  1M31 A;  3CAB A;  3BJH A;  1GQM A;  1QAT A;  1WRK A;  2QAC A;  1B7T Y;  2LNK A;  1KK8 C;  2GV5 A;  1TCF A;  1MXE A;  4OR9 B;  1QVI Y;  3ICB A;  4UPG A;  4TNC A;  1NPQ A;  1QIV A;  1YUS A;  3O4Y A;  1RTP 1;  1TTX A;  3BFA A;  5DIC A;  1XFW O;  2P70 A;  1K9P A;  1P28 A;  2K7D A;  3B7A A;  1K94 A;  1V1F A;  4IL1 A;  5FYX A;  1M63 B;  3LL8 B;  1NWD A;  1XFX O;  4MLW A;  1TNQ A;  1IH0 A;  2Q91 A;  1DJY A;  2M9G A;  4GAO A;  1G4Y R;  1SCM C;  2JT8 A;  1AVS A;  1X02 A;  1J1E A;  3TUY C;  1CMF A;  1BLQ A;  2ZN9 A;  1NX2 A;  3D73 A;  2KQ6 A;  1WY9 A;  2BAP A;  5DKQ A;  2L2E A;  1PRW A;  5CSJ A;  5AFP A;  2BNX A;  1WRL A;  3SG3 A;  1KFU L;  2LVV A;  2LLU A;  1WDC B;  2P6B B;  3QME A;  4MZJ A;  5FI2 A;  2FOT A;  4XJK A;  3DYE A;  2JC2 A;  3I5I C;  1FPW A;  3JTD C;  1TCO B;  4N1F A;  2KGR A;  2BBM A;  2BE6 A;  5HYD A;  4I5J A;  4ZCV A;  1YTZ C;  1JWD A;  1TUJ A;  3DVE A;  3GOF A;  3WHU B;  2HPS A;  4MN0 A;  2L4I A;  3QRX A;  2MLF C;  2K7C A;  3EKJ A;  1J7O A;  2JXC A;  3OGN A;  1FF1 A;  1XK4 C;  1L2O B;  3CZ0 A;  1LKJ A;  3PSR A;  1EG3 A;  3I5G C;  2ZND A;  1H4B A;  5I8N A;  2TN4 A;  2LV7 A;  4PAL A;  2L5Y A;  3WHT B;  1MHO A;  1JBA A;  2PMY A;  2F33 A;  1F4Q A;  1WLM A;  1F71 A;  1K9U A;  1QAS A;  2JXL A;  5GQQ C;  2ZN8 A;  3VRQ A;  1NP8 A;  5HKY A;  2MAZ A;  3L47 A;  1M45 A;  4DRW A;  1TOP A;  3VRN A;  4PHK A;  1K90 D;  1J7R A;  2YGU A;  2L4H A;  2H8V A;  2LUX A;  5ER4 X;  2LAN A;  2KI6 D;  3O4X A;  1D1O A;  1GJY A;  3I5F C;  3PJI A;  3CR5 X;  2JTT A;  1QLS A;  2M0R A;  1CDN A;  4ORB B;  4PE1 A;  3SIA A;  2ZNE A;  1DT7 B;  3TDU A;  1CLB A;  2WCB A;  3BFB A;  2I2R E;  3FE8 A;  3FWC A;  2LLT A;  1XK4 A;  2OTG C;  5DKN A;  5KSZ A;  1W9Z A;  2B1U A;  3BUM B;  1EXR A;  3BOW A;  1K2H A;  3M0W A;  4HRH A;  2CT9 A;  1YUT A;  2Y1M A;  1KFX L;  3LK1 A;  3AAJ A;  1NX0 A;  1A2X A;  1LXF C;  1S36 A;  2LM5 A;  1S5G Y;  5BPJ A;  3K21 A;  3ZWH A;  2JTZ A;  5F6T A;  5ER5 A;  2QEB A;  4ORA B;  1QTX A;  2Y5I A;  2OPO A;  4WRI A;  1LA0 A;  3F45 A;  1BR1 B;  1B8C A;  1N0Y A;  3N7H A;  1H8B A;  1KWO C;  1NCZ A;  3FE6 A;  3VB1 A;  3LK0 A;  3D77 A;  5I2Q A;  3GK4 X;  4ETO A;  4DIR A;  1MF8 B;  4F7F A;  4AQJ A;  4HRE E;  2M97 A;  3CS1 A;  1REC A;  3OHM B;  1K9K A;  3S0B A;  3TS5 B;  4NDB A;  2K2F A;  4FQT A;  5HLO A;  1CMG A;  2P71 A;  3D74 A;  1CTR A;  2QEV A;  3KEV A;  4CFR A;  2LP3 A;  1TRF A;  3MSE B;  1AJ4 A;  1SL7 A;  2KBI A;  3CZ1 A;  1OSA A;  3FE9 A;  4MSP A;  4ICB A;  1XFY O;  1Y1X A;  3CR2 A;  2Y1N A;  1YRU B;  1CDP A;  3VGO A;  4DS7 A;  4AQI A;  4DCK A;  1ALV A;  1U5I A;  2LCP A;  5B8I B;  5AER A;  3PLF B;  3AAK A;  3BQ3 A;  3D0Y A;  1C3Y A;  3LCP C;  2KBM A;  1SCV A;  1YVL A;  2EGD A;  3E3R A;  2LUC A;  3NHI A;  1YR5 A;  4OVN F;  4QJ5 B;  1F54 A;  2QDI A;  4OKH A;  2KYC A;  3DF0 B;  2H61 C;  1SR6 B;  4CID A;  4XYN A;  4GPL B;  1NYA A;  3Q8I A;  1OOF A;  2O5G A;  2MHH A;  2WC8 A;  2F2P A;  3B86 A;  3DY9 A;  2HQ8 A;  3KPX A;  3S0A A;  4NDC A;  4PE0 A;  1B1G A;  1UWO A;  4M2P A;  2BE4 A;  3BYA A;  2M7L A;  4MZL A;  5D7F A;  1SNL A;  3PM2 A;  1KQV A;  1SKT A;  2M8U A;  4USL A;  1UUR A;  2WCF A;  4INX A;  1DJG A;  1LIN A;  3B88 A;  1KCY A;  3SG6 A;  1SK6 D;  1CNP A;  2E30 A;  1DVI A;  2MA2 A;  1DMO A;  1N65 A;  1UHI A;  2F3Z A;  1AHR A;  1GGZ A;  3DVM A;  2PQL A;  2WOS A;  1F70 A;  2HET A;  2NXQ A;  1S6J A;  3RLZ A;  3SS4 A;  4F0Z B;  5K89 A;  4MZK A;  1E8A A;  2WCM A;  1FI6 A;  1CLM A;  1F4O A;  1PAL A;  1OOJ A;  3IQO A;  1TUZ A;  2H61 A;  4YGE B;  1DF0 B;  1SL9 A;  2K0J A;  3OP0 A;  2JZI A;  1L2O C;  1XA5 A;  2SCP A;  4P5O E;  4HRG A;  1BF5 A;  3GK2 A;  1RK9 A;  1OMD A;  3L4A A;  5JOL A;  2JPO A;  3PFV A;  4PHJ A;  1W7J B;  2BKI B;  2MLE C;  1DGU A;  2M1U A;  5AEQ A;  1QJT A;  1SPY A;  2LMV A;  5CSF A;  3TDZ A;  3SS5 A;  2GTE A;  1YRT B;  2L51 A;  2M7N A;  1BMO A;  3BUX B;  3NHT A;  1OZO A;  2BKH B;  3OB1 B;  4IJ7 A;  4PE4 A;  1PK0 D;  2RGI A;  2H2K A;  4MRY A;  1UHK A;  4MVF A;  1Z4H A;  5HLV A;  2BL0 B;  1Y0V H;  3FS7 A;  1IQ3 A;  1IJ6 A;  1OMV A;  3IF7 A;  5FI6 A;  4JD9 A;  1S1E A;  2EC6 B;  2JT0 A;  2MBX A;  1EH2 A;  2R2I A;  1IG5 A;  1WRZ A;  1XO5 A;  2JOJ A;  1AJ5 A;  4PT1 A;  3WXA A;  1CDM A;  1QLK A;  1SBJ A;  3V2L A;  2K61 A;  2VRG A;  4I5N B;  1GM0 A;  3A4U B;  4PE7 A;  3DVK A;  4AOM A;  1BG1 A;  2D8N A;  1CB1 A;  1QV0 A;  1DEK A;  2CTN A;  1B47 A;  2LE9 B;  2PVB A;  2ISD A;  4PHM A;  2MRD A;  2WC5 A;  2LP2 A;  1DEL A;  2BCA A;  3WNX B;  2KGB C;  3HCM A;  4MEW A;  1C07 A;  1Z2C B;  1MQ1 A;  1OOG A;  2JQ6 A;  1ZAC A;  2JWW A;  1A75 B;  1MUX A;  2L5X B;  1NCY A;  1K95 A;  1TN4 A;  3R1V A;  1NX3 A;  3BUO B;  4YGC B;  2BCX A;  3PN7 B;  1TIZ A;  3R1P A;  1A4P A;  4YGA A;  1DTL A;  3PAL A;  1AK8 A;  3FWB A;  2K7O A;  1AUI B;  1EG4 A;  1OMR A;  2OS8 B;  4NDD A;  5CPV A;  3KHE A;  1Y1A A;  4HSZ A;  5IBW A;  2QEH A;  3HX4 A;  2CBL A;  3I5H B;  3SJS A;  1PSR A;  5KTY A;  3A8R A;  1XYD A;  3O2P A;  3S0D A;  1OOI X;  1L7Z A;  2JPT A;  4PHN A;  5EL2 A;  1XFV O;  2KAY A;  1CFC A;  2E6W A;  2L2C A;  1DJI A;  1BJF A;  2O60 A;  1J1D A;  3TS5 C;  4C0J A;  1FI5 A;  1CKK A;  3UNW A;  1J7Q A;  5AAN A;  1CDL A;  5AXI A;  1PUL A;  1DJX A;  1JUO A;  2G2B A;  3C1V A;  2JU0 A;  5FI7 A;  1S26 D;  4I5K A;  2ERB A;  4BY5 A;  4DUQ A;  1PVB A;  1SL8 A;  3EKH A;  2KI6 C;  4YBH B;  1B4C A;  1DQE A;  2JRF A;  1AP4 A;  5PAL A;  4ORC B;  3VRP A;  1QX2 A;  2KAX A;  1RFJ A;  2JUL A;  3JVT B;  2GGM A;  3K1E A;  3UO9 A;  1J55 A;  3D76 A;  5HKW A;  1FBV A;  1CM1 A;  1KK7 Z;  1TNW A;  2K8M B;  4OCI A;  1YUR A;  2L50 A;  1SSE B;  2M1K B;  3SS3 A;  4Q04 A;  1R6P A;  3PAT A;  3NSL A;  1TNP A;  4GUK A;  4NQG A;  4PCW A;  1IGV A;  1SR6 C;  5D3O A;  1NIW A;  3D78 A;  3NGV A;  2WOR A;  1OZS A;  2BBN A;  4U8D A;  2WC6 A;  4C0L A;  1B8L A;  1LS8 A;  3R1O A;  1S3P A;  3CZT X;  3NSK A;  1F55 A;  1B7T Z;  3BXK A;  3OBV A;  1G33 A;  2FCD A;  5J3X A;  2CCM A;  2Y4Q A;  1KSM A;  5CSI A;  1QVI Z;  1A03 A;  1HT9 A;  1R2U A;  1JFK A;  1ORG A;  1UP5 A;  2KOT A;  2PYQ A;  3SG5 A;  1IKU A;  3DZT A;  1KQM B;  3EVV A;  3TZ1 A;  2V53 A;  4D1E A;  1CFP A;  1WDC C;  2NCP A;  2F2O A;  5I94 A;  3DXL A;  1XFZ O;  2KFH A;  4R1E A; 
#chains in the Genus database with same CATH homology
 1Y1U A;  2KI4 B;  1M39 A;  2FCE A;  2KHN A;  2ZKM X;  4CLN A;  2EHB A;  1QX5 B;  4XJK B;  2LMU A;  2KYF A;  2DOQ A;  1PVA A;  4L9M A;  4YGD B;  3EVR A;  3DF0 A;  2AUC A;  2I7A A;  1NUB A;  2MJW B;  4YRU A;  2HQW A;  1KK8 B;  3OB2 B;  1YX7 A;  2PRU A;  1A29 A;  1SYM A;  2LAP A;  3PM8 A;  1PSB A;  2PAL A;  2KNE A;  1DJH A;  4GBA A;  2JT3 A;  2LMT A;  2LVK A;  1CFF A;  1K8U A;  3NXA A;  3EK4 A;  2ZFD A;  3SG2 A;  1YVH A;  4E68 A;  1CM4 A;  3OX6 A;  1DJZ A;  3AKA A;  2NLN A;  1QS7 A;  2LC5 A;  1QV1 A;  2M3W A;  2IS9 A;  3NSO A;  3VRO A;  4GFT A;  2AMI A;  1YX8 A;  2L0P A;  2WND A;  2BL0 C;  1ZUZ A;  1RWY A;  1K96 A;  1SCM B;  2COL B;  3TUY B;  3O78 A;  1CFD A;  1V1G A;  1CLL A;  2A4J A;  2EC6 C;  4PDZ A;  1RJV A;  1Q80 A;  2M49 B;  1OQP A;  4JQ0 D;  1UHH A;  4N1G A;  1B8R A;  1QX7 A;  1KFU S;  4A4B A;  4JPZ B;  1YUU A;  4GGN A;  1ZFS A;  4OV2 A;  3TDI A;  3CGA A;  3SG4 A;  1IJ5 A;  2ZRT A;  3BUN B;  1XVJ A;  3I5I B;  4MBE A;  1DF0 A;  3JTD B;  4WQ2 A;  2JNX A;  4FQO A;  4QJ3 B;  5I2L A;  2GGZ A;  1BT6 A;  2PSR A;  3EVU A;  5HKZ A;  1W7I B;  1HQV A;  2BCB A;  3CLN A;  1QIW A;  2LVJ A;  3NSI A;  1S6C A;  3PN7 C;  1LVC D;  2KQY A;  4N5X A;  2K2A A;  5G08 A;  2M29 A;  2WCE A;  3EK8 A;  1C7W A;  1S6I A;  3BUW B;  3DVJ A;  3KO0 A;  2KFG A;  5TNC A;  2G9B A;  2OS8 C;  2HF5 A;  2I94 A;  1IRJ A;  3BOW B;  1JFJ A;  2NZ0 A;  3I5H C;  3I5G B;  2KSP A;  1B9A A;  1NCX A;  2BEC A;  2KDH A;  1BU3 A;  1MR8 A;  4A4C A;  2SAS A;  1N2D A;  5CSN A;  1VRK A;  2KAV A;  1JF2 A;  1BOC A;  4GGF C;  3SIB A;  1NSH A;  5DKR A;  1BR4 B;  1M46 A;  4YI9 A;  2LHI A;  5I2O A;  3SG7 A;  1KSO A;  2L98 A;  1JF0 A;  1C7V A;  1S5G Z;  2JNF A;  1WLZ A;  2K7B A;  2LVI A;  4FTG A;  3CR4 X;  1IWQ A;  1ZMZ A;  3OX5 A;  4ZCU A;  5JJG A;  4CFQ A;  4M2O A;  3CTN A;  1A75 A;  1UHJ A;  1EL4 A;  3I5F B;  3LLE A;  2ZRS A;  1UHN A;  2AAO A;  4BY4 A;  4GNK B;  3JVT C;  4M2Q A;  4YGB B;  4CPV A;  3GK1 A;  1GGW A;  5KU1 A;  3H4S E;  1G8I A;  3DD4 A;  3EK7 A;  4MRX A;  1F8H A;  2OTG B;  2I18 A;  1JSA A;  1MWN A;  3VRR A;  4P2Y B;  1ZOT B;  2FJU B;  1EJ3 A;  2F8P A;  2NCO A;  2QPT A;  1RRO A;  1U5I B;  2CXJ A;  1KFX S;  2KFF A;  4GGF A;  1SY9 A;  1ALW A;  1TNX A;  1SMG A;  4WQ3 A;  3D0Y B;  3CWG A;  1J7P A;  2PAS A;  2F3Y A;  1DJW A;  1OE9 B;  1DGV A;  1KWO B;  1ODB A;  2CNP A;  4I5L B;  1LA3 A;  1SRA A;  4C0K A;  1FW4 A;  3IQQ A;  3AKB A;  3ZNI A;  1MXL C;  1KK7 Y;  3KF9 A;  1KQM C;  4JWQ A;  4QJ4 B;  1K93 D;  2LHL A;  3RM1 A;  3FIA A;  1BOD A;  1UUS A;  2LLS A;  1QXP A;  3D10 A;  1NX1 A;  5D69 A;  1JC2 A;  4YI8 A;  1IQ5 A;  1SW8 A;  2Q4U A;  1Y6W A;  2KI4 C;  3O6B A;  1XFU O;  1M31 A;  1GQM A;  1QAT A;  1WRK A;  2QAC A;  1B7T Y;  2LNK A;  1KK8 C;  2GV5 A;  1TCF A;  1MXE A;  4OR9 B;  1QVI Y;  3ICB A;  4UPG A;  4TNC A;  1NPQ A;  1QIV A;  1YUS A;  3O4Y A;  1RTP 1;  1TTX A;  1XFW O;  1K9P A;  2K7D A;  1K94 A;  1V1F A;  4IL1 A;  5FYX A;  1M63 B;  3LL8 B;  1NWD A;  1XFX O;  4MLW A;  1TNQ A;  1IH0 A;  2Q91 A;  1DJY A;  2M9G A;  4GAO A;  1G4Y R;  1SCM C;  2JT8 A;  1AVS A;  1X02 A;  1J1E A;  3TUY C;  1CMF A;  1BLQ A;  2ZN9 A;  1NX2 A;  2KQ6 A;  1WY9 A;  5DKQ A;  2L2E A;  1PRW A;  5CSJ A;  5AFP A;  1WRL A;  3SG3 A;  1KFU L;  2LVV A;  2LLU A;  1WDC B;  2P6B B;  4MZJ A;  2FOT A;  4XJK A;  2JC2 A;  3I5I C;  1FPW A;  3JTD C;  1TCO B;  4N1F A;  2KGR A;  2BBM A;  2BE6 A;  5HYD A;  4I5J A;  4ZCV A;  1YTZ C;  1JWD A;  3DVE A;  3GOF A;  3WHU B;  2HPS A;  4MN0 A;  2L4I A;  3QRX A;  2MLF C;  2K7C A;  3EKJ A;  1J7O A;  2JXC A;  1FF1 A;  1XK4 C;  1L2O B;  1LKJ A;  3PSR A;  1EG3 A;  3I5G C;  2ZND A;  1H4B A;  5I8N A;  2TN4 A;  2LV7 A;  4PAL A;  3WHT B;  1MHO A;  1JBA A;  2PMY A;  2F33 A;  1F4Q A;  1WLM A;  1F71 A;  1K9U A;  1QAS A;  2JXL A;  5GQQ C;  2ZN8 A;  3VRQ A;  1NP8 A;  5HKY A;  2MAZ A;  1M45 A;  4DRW A;  1TOP A;  3VRN A;  4PHK A;  1K90 D;  1J7R A;  2L4H A;  2LUX A;  5ER4 X;  2LAN A;  2KI6 D;  1D1O A;  1GJY A;  3I5F C;  3CR5 X;  2JTT A;  1QLS A;  2M0R A;  1CDN A;  4ORB B;  4PE1 A;  3SIA A;  2ZNE A;  1DT7 B;  3TDU A;  1CLB A;  2WCB A;  2I2R E;  3FWC A;  2LLT A;  1XK4 A;  2OTG C;  5DKN A;  5KSZ A;  2B1U A;  3BUM B;  1EXR A;  3BOW A;  1K2H A;  3M0W A;  4HRH A;  2CT9 A;  1YUT A;  2Y1M A;  1KFX L;  3LK1 A;  3AAJ A;  1NX0 A;  1A2X A;  1LXF C;  1S36 A;  2LM5 A;  1S5G Y;  5BPJ A;  3K21 A;  3ZWH A;  2JTZ A;  5F6T A;  5ER5 A;  4ORA B;  1QTX A;  2Y5I A;  2OPO A;  4WRI A;  1LA0 A;  3F45 A;  1BR1 B;  1B8C A;  1N0Y A;  1H8B A;  1KWO C;  1NCZ A;  3LK0 A;  5I2Q A;  3GK4 X;  4ETO A;  4DIR A;  1MF8 B;  4AQJ A;  4HRE E;  2M97 A;  3CS1 A;  1REC A;  3OHM B;  1K9K A;  3TS5 B;  4NDB A;  2K2F A;  5HLO A;  1CMG A;  1CTR A;  3KEV A;  4CFR A;  2LP3 A;  1TRF A;  3MSE B;  1AJ4 A;  1SL7 A;  2KBI A;  1OSA A;  4MSP A;  4ICB A;  1XFY O;  1Y1X A;  3CR2 A;  2Y1N A;  1YRU B;  1CDP A;  3VGO A;  4DS7 A;  4AQI A;  4DCK A;  1ALV A;  1U5I A;  2LCP A;  5B8I B;  5AER A;  3PLF B;  3AAK A;  3BQ3 A;  3D0Y A;  3LCP C;  2KBM A;  1SCV A;  1YVL A;  2EGD A;  3E3R A;  2LUC A;  1YR5 A;  4OVN F;  4QJ5 B;  1F54 A;  4OKH A;  2KYC A;  3DF0 B;  2H61 C;  1SR6 B;  4CID A;  4XYN A;  4GPL B;  1NYA A;  2O5G A;  2MHH A;  2WC8 A;  2F2P A;  2HQ8 A;  3KPX A;  4NDC A;  4PE0 A;  1B1G A;  1UWO A;  4M2P A;  2BE4 A;  3BYA A;  2M7L A;  4MZL A;  5D7F A;  1SNL A;  1KQV A;  1SKT A;  2M8U A;  4USL A;  1UUR A;  2WCF A;  1DJG A;  1LIN A;  1KCY A;  3SG6 A;  1SK6 D;  1CNP A;  2E30 A;  1DVI A;  2MA2 A;  1DMO A;  1N65 A;  1UHI A;  2F3Z A;  1AHR A;  1GGZ A;  3DVM A;  2WOS A;  1F70 A;  2HET A;  2NXQ A;  1S6J A;  3RLZ A;  4F0Z B;  5K89 A;  4MZK A;  1E8A A;  1FI6 A;  1CLM A;  1F4O A;  1PAL A;  1OOJ A;  3IQO A;  2H61 A;  4YGE B;  1DF0 B;  1SL9 A;  2K0J A;  3OP0 A;  2JZI A;  1L2O C;  1XA5 A;  2SCP A;  4P5O E;  4HRG A;  1BF5 A;  3GK2 A;  1RK9 A;  1OMD A;  5JOL A;  3PFV A;  4PHJ A;  1W7J B;  2BKI B;  2MLE C;  1DGU A;  2M1U A;  5AEQ A;  1QJT A;  1SPY A;  2LMV A;  5CSF A;  3TDZ A;  1YRT B;  2L51 A;  2M7N A;  1BMO A;  3BUX B;  3OB1 B;  1OZO A;  2BKH B;  4PE4 A;  1PK0 D;  2RGI A;  2H2K A;  4MRY A;  1UHK A;  4MVF A;  5HLV A;  1IQ3 A;  2BL0 B;  1Y0V H;  3FS7 A;  1IJ6 A;  1OMV A;  3IF7 A;  1S1E A;  2EC6 B;  2JT0 A;  2MBX A;  1EH2 A;  2R2I A;  1IG5 A;  1WRZ A;  1XO5 A;  2JOJ A;  1AJ5 A;  3WXA A;  1CDM A;  1QLK A;  1SBJ A;  2K61 A;  2VRG A;  4I5N B;  3A4U B;  4PE7 A;  3DVK A;  4AOM A;  1BG1 A;  2D8N A;  1CB1 A;  1QV0 A;  2CTN A;  2LE9 B;  1B47 A;  2PVB A;  2ISD A;  4PHM A;  2MRD A;  2LP2 A;  2BCA A;  3WNX B;  2KGB C;  3HCM A;  4MEW A;  1C07 A;  1MQ1 A;  2JQ6 A;  2JWW A;  1ZAC A;  2L5X B;  1A75 B;  1MUX A;  1NCY A;  1K95 A;  1TN4 A;  1NX3 A;  3BUO B;  4YGC B;  2BCX A;  3PN7 B;  1TIZ A;  1A4P A;  4YGA A;  1DTL A;  3PAL A;  1AK8 A;  3FWB A;  2K7O A;  1AUI B;  1EG4 A;  1OMR A;  2OS8 B;  4NDD A;  5CPV A;  3KHE A;  1Y1A A;  4HSZ A;  5IBW A;  3HX4 A;  2CBL A;  3I5H B;  3SJS A;  1PSR A;  5KTY A;  3A8R A;  1XYD A;  3O2P A;  1L7Z A;  2JPT A;  4PHN A;  1XFV O;  2KAY A;  1CFC A;  2E6W A;  1DJI A;  1BJF A;  2O60 A;  1J1D A;  3TS5 C;  4C0J A;  1FI5 A;  1CKK A;  1J7Q A;  5AAN A;  1CDL A;  5AXI A;  1PUL A;  1DJX A;  1JUO A;  2G2B A;  3C1V A;  2JU0 A;  4BY5 A;  1S26 D;  4I5K A;  4DUQ A;  1PVB A;  1SL8 A;  3EKH A;  2KI6 C;  4YBH B;  1B4C A;  2JRF A;  1AP4 A;  5PAL A;  4ORC B;  3VRP A;  1QX2 A;  2KAX A;  1RFJ A;  2JUL A;  3JVT B;  2GGM A;  1J55 A;  5HKW A;  1FBV A;  1CM1 A;  1KK7 Z;  1TNW A;  2K8M B;  4OCI A;  1YUR A;  2L50 A;  2M1K B;  4Q04 A;  1R6P A;  3PAT A;  3NSL A;  1TNP A;  4GUK A;  4NQG A;  4PCW A;  1IGV A;  1SR6 C;  1NIW A;  2WOR A;  1OZS A;  2BBN A;  4U8D A;  4C0L A;  1B8L A;  1S3P A;  3CZT X;  3NSK A;  1F55 A;  1B7T Z;  3BXK A;  1G33 A;  2FCD A;  5J3X A;  2CCM A;  2Y4Q A;  1KSM A;  5CSI A;  1QVI Z;  1A03 A;  1HT9 A;  1R2U A;  1JFK A;  1UP5 A;  2KOT A;  3SG5 A;  1IKU A;  3EVV A;  1KQM B;  3TZ1 A;  4D1E A;  2V53 A;  1CFP A;  1WDC C;  2NCP A;  2F2O A;  1XFZ O;  2KFH A;  4R1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...