2LANA

Nmr structure of ca2+-bound cabp1 n-domain with rdc
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
b'SLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein 1
publication title 1H, 15N, and 13C chemical shift assignments for CaBP1 with 3 Ca2+ bound
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lanA00
2JULA 2MHHA 1F4OA 4N5XA 5ER4X 1UUSA 2BKIB 5KSZA 1IQ3A 4PDZA 1A4PA 1S36A 2I94A 1G33A 1CB1A 1B7TY 2KI4C 2OS8C 1OQPA 2JTTA 3CS1A 1M31A 1TTXA 2GGZA 2ZN9A 1PALA 3CR2A 1DF0A 2RGIA 3PN7C 4HREE 2G2BA 1DF0B 1LVCD 3GOFA 1QLKA 2DOQA 1SL7A 2E30A 1KQMC 5I2QA 1R2UA 3EKJA 1M46A 4GUKA 1KSMA 1K9UA 1YRTB 3EK7A 3O6BA 2NCOA 2KAVA 3AAKA 1CDMA 2WCEA 3EVVA 2CXJA 1F70A 3DF0A 2IS9A 3JTDC 2LVVA 3OP0A 3DF0B 5HYDA 1EH2A 3OB1B 5HKYA 2LNKA 4CLNA 2L4HA 1M45A 1NX2A 1N65A 2FCDA 3OX5A 3SG3A 4PE1A 5AFPA 3DVMA 1YR5A 2CNPA 3SG6A 3VGOA 2LP2A 5FYXA 4PHMA 1CM1A 1SCMB 1K9KA 3BXKA 1RTP1 1U5IA 1IG5A 2L50A 1F71A 2LVKA 1U5IB 2H2KA 2AUCA 4I5KA 1G8IA 2KI6C 3LK1A 1K93D 2MLFC 1LXFC 1QLSA 1B47A 4A4CA 2BBNA 3PLFB 2I2RE 3BUWB 1J7PA 2M7LA 5D69A 1VRKA 2GGMA 1B7TZ 5CSIA 2JWWA 1XYDA 2BECA 1K96A 5ER5A 1CMGA 1QATA 1FF1A 1N0YA 2I18A 2M3WA 1LINA 2BE6A 4FTGA 4PHKA 2SCPA 3AAJA 1EG4A 1UHIA 1F55A 1CFPA 3LLEA 2KBIA 3I5IC 4DRWA 1B9AA 3TUYC 2JZIA 2FOTA 1QS7A 4NDCA 3IQOA 2BKHB 2KBMA 1NSHA 4Q04A 5IBWA 1K95A 1YTZC 2MBXA 4DUQA 4YGBB 1AJ4A 2LV7A 2JNXA 1H4BA 3JVTB 2LUCA 2KYCA 2Y4QA 4OKHA 1ZUZA 1A75A 1DJWA 1NX0A 5AANA 5DKNA 3LCPC 4BY5A 1MF8B 1UHNA 2CTNA 1V1FA 1A75B 2KFHA 5F6TA 2EC6B 1TIZA 3NSLA 4P5OE 3CTNA 4YBHB 3O78A 2BE4A 4P2YB 1QX2A 1CFCA 1JC2A 1F4QA 1J7QA 1C7WA 1IQ5A 1Y0VH 1W7JB 3NXAA 4GGFA 3TDUA 1DJHA 1YUUA 1CMFA 2K7CA 4OCIA 1N2DA 5AXIA 4F0ZB 2LMTA 4MRYA 1IJ5A 1CDLA 1GGWA 1S6IA 4YGDB 1V1GA 2KGRA 3WHTB 1SR6B 2KFFA 4YGAA 4HRGA 1IWQA 4ORBB 2JC2A 2O5GA 4GBAA 3RM1A 5DKRA 1QV0A 1NPQA 2KQ6A 1LA3A 3FIAA 3HCMA 5I2LA 3NSKA 2HQWA 5J3XA 2SASA 1DVIA 3D0YA 2LCPA 2JXCA 4MSPA 1WRKA 3EVRA 3ZWHA 2JXLA 3I5GB 2PALA 1WLZA 4CPVA 3O4YA 1C7VA 4D1EA 2QPTA 3EKHA 3VRPA 1OSAA 2K7OA 1S1EA 1QVIY 2M1UA 4YGEB 2H61C 1ZOTB 1AVSA 1SKTA 1WDCC 1AK8A 2LAPA 2R2IA 1ZACA 1GJYA 2KAYA 3TS5C 1TNXA 2ZKMX 3ICBA 3F45A 4YGCB 1OZSA 1EL4A 3CR5X 1WRZA 4MZJA 4AQJA 4PE4A 1PVBA 4HRHA 1EXRA 1WY9A 4DS7A 1MQ1A 2BL0B 1D1OA 1X02A 1KFUL 4YI9A 3I5FB 3O2PA 1SBJA 2Y1MA 2TN4A 4JPZB 2M29A 5JOLA 5CSJA 4YI8A 2COLB 2L0PA 3GK4X 1OE9B 4NDBA 1TNQA 2F8PA 1S3PA 3OB2B 4OVNF 2JU0A 1KWOB 1QXPA 1Y1UA 2KAXA 2WORA 2ZN8A 2MLEC 3PSRA 4QJ4B 1B4CA 2LMUA 2M8UA 4A4BA 1FI6A 2LM5A 1YURA 2LP3A 3RLZA 1TNWA 4WQ3A 1QIVA 2P6BB 2CCMA 1DJIA 1XFZO 1FBVA 4DIRA 1NWDA 2OTGB 3GK2A 3KF9A 4MZKA 3M0WA 1HT9A 4ETOA 1S26D 3A4UB 2HQ8A 1C07A 1KCYA 1K94A 5K89A 2KFGA 1RK9A 2JNFA 1L2OB 1QVIZ 5PALA 1B1GA 2FCEA 3CR4X 1PULA 2MA2A 1NCZA 3SG4A 3SIAA 1YVLA 3C1VA 1AP4A 3CLNA 3FS7A 2ZNEA 4ORAB 1KFUS 2HETA 1KFXL 2F2OA 2HPSA 3I5HB 1UURA 2K2FA 1AJ5A 1B8RA 2JT3A 2QACA 4GNKB 4QJ3B 2LC5A 1J1EA 1BJFA 1SYMA 3H4SE 4M2OA 4PHJA 3D10A 1XA5A 2CT9A 1MR8A 3EVUA 5B8IB 1B8LA 1JF2A 1QV1A 1KK8B 1PK0D 1XK4A 5CSFA 1EG3A 4ZCUA 1RECA 1F8HA 2L51A 1FPWA 1ALVA 1DTLA 1TN4A 1JFJA 1G4YR 1TCFA 2KI6D 2F3ZA 4C0KA 1BR4B 4M2PA 2BCBA 2LMVA 4CIDA 1JFKA 1WRLA 3BQ3A 3BUNB 4YRUA 1DJXA 4PE7A 1OOJA 1TCOB 3EK8A 2PSRA 1IJ6A 1GGZA 1SNLA 1ODBA 2L98A 2L5XB 4XYNA 1CTRA 2F33A 4MVFA 2M9GA 2WC8A 3SG2A 1QJTA 3KHEA 1RFJA 2KYFA 2AMIA 1YVHA 4MRXA 1SCMC 3CZTX 1CLLA 5HKZA 1KFXS 1BT6A 2KDHA 3IQQA 5JJGA 1MXEA 2PMYA 4MZLA 1NCXA 3BOWA 1CDPA 1XFYO 2KI4B 2MJWB 3BOWB 3WHUB 4UPGA 2OS8B 1S6JA 1E8AA 1XO5A 2KHNA 4MBEA 4CFRA 1NX1A 3PATA 4GGNA 2KNEA 2LLTA 3PN7B 2NXQA 2WCBA 1IKUA 1J7RA 2LVJA 1LA0A 2K7DA 3BUOB 1KQMB 3D0YB 4OR9B 5I8NA 1JBAA 2JRFA 3WNXB 2WOSA 2AAOA 5GQQC 2JTZA 1QIWA 1OZOA 4PCWA 4C0LA 2E6WA 4TNCA 3BYAA 1CLBA 5AEQA 2NZ0A 2ZRSA 2JT0A 3JTDB 1JSAA 2BBMA 1XFWO 3DVJA 4FQOA 4ZCVA 3JVTC 2M1KB 4NQGA 5G08A 1AHRA 2LE9B 1JF0A 4U8DA 3PM8A 1BMOA 1XFVO 2LUXA 3AKAA 1OMRA 4USLA 2EHBA 3FWCA 2EC6C 2WCFA 2MAZA 1TRFA 1H8BA 1B8CA 1PRWA 4OV2A 1QTXA 3A8RA 3TDIA 2L2EA 5D7FA 1KSOA 2K2AA 4MN0A 1M63B 2LLSA 2JT8A 4XJKA 4N1GA 3SG5A 2NLNA 2WNDA 1DJZA 4XJKB 1XVJA 1HQVA 1SK6D 4GGFC 2BCXA 1DGVA 1PSRA 2F2PA 1NCYA 5KU1A 1CFDA 1BU3A 2K0JA 1SR6C 2OPOA 4E68A 3PALA 1RROA 1QX5B 4GFTA 1BLQA 1FI5A 1W7IB 1S5GY 2M97A 1UHHA 2Y1NA 1CM4A 1J1DA 3KPXA 3DVKA 2FJUB 3ZNIA 1DMOA 1PSBA 1YX8A 2ZNDA 2Q91A 3DVEA 1SPYA 3I5IB 4PHNA 2PASA 3I5GC 5CSNA 2LHIA 3OX6A 3TUYB 1BODA 1TOPA 2Y5IA 2MRDA 2V53A 4PALA 3NSIA 1DT7B 1S6CA 1SL8A 2JPTA 2L4IA 2LANA 1K90D 2M49B 3SIBA 4ICBA 2KQYA 1CFFA 5HKWA 1BOCA 1SCVA 2K8MB 4WQ2A 1NP8A 1NYAA 1LKJA 3FWBA 2BL0C 2M7NA 3TDZA 3VRNA 1L7ZA 1BR1B 2B1UA 2G9BA 1RJVA 3LL8B 4DCKA 1JWDA 2K61A 1YRUB 3BUMB 3I5FC 1MXLC 1QASA 1J55A 4R1EA 2D8NA 3LK0A 1YX7A 1XFUO 4I5JA 2NCPA 1YUSA 1RWYA 1M39A 3AKBA 4QJ5B 3GK1A 1KK7Y 1K2HA 1TNPA 1ZFSA 2HF5A 1NX3A 3BUXB 3WXAA 4GAOA 2Q4UA 1DJGA 1KWOC 5HLOA 2LLUA 1R6PA 1Y1XA 3MSEB 1K9PA 2ZRTA 4AQIA 1F54A 2M0RA 1A29A 1Y1AA 1AUIB 4AOMA 4CFQA 1S5GZ 2ZFDA 1BG1A 1CNPA 2OTGC 1DGUA 5KTYA 1CKKA 3IF7A 3SG7A 2H61A 1PVAA 2A4JA 5CPVA 1JUOA 4JQ0D 4NDDA 5AERA 1ALWA 1WDCB 2O60A 3K21A 5DKQA 1L2OC 3TS5B 3TZ1A 1UHKA 1SMGA 1EJ3A 2GV5A 2KSPA 2PVBA 4L9MA 2ISDA 4I5LB 3VROA 3EK4A 3I5HC 4MLWA 2K7BA 4IL1A 5BPJA 4GPLB 2VRGA 3HX4A 4M2QA 1SW8A 1CDNA 4N1FA 4WRIA 1A2XA 3QRXA 4MEWA 1SL9A 1MHOA 4ORCB 1XFXO 4HSZA 4BY4A 1KQVA 1KK8C 3PFVA 1UHJA 1BF5A 5I2OA 1UP5A 2CBLA 3SJSA 3CWGA 1WLMA 1KK7Z 1XK4C 1IRJA 3VRRA 4JWQA 2I7AA 1NIWA 4I5NB 5HLVA 1J7OA 1OMDA 2BCAA 2JOJA 1IGVA 1MUXA 1CLMA 3KEVA 1Q80A 3CGAA 4C0JA 3KO0A 2EGDA 2PRUA 1K8UA 3DD4A 1YUTA 3VRQA 2KOTA 1QX7A 1OMVA 1UWOA 1ZMZA 3NSOA 2F3YA 1MWNA 3OHMB 1SRAA 5TNCA 1A03A 1Y6WA 1IH0A 1NUBA 1SY9A 2KGBC 1FW4A 1DJYA 3E3RA 4PE0A 1GQMA 2LHLA 2JQ6A 2LVIA
chains in the Genus database with same CATH superfamily
2JULA 2MHHA 1F4OA 4N5XA 5ER4X 1UUSA 2BKIB 5KSZA 1IQ3A 2FJYA 4OZDA 4PDZA 1A4PA 1S36A 2I94A 1G33A 1CB1A 1B7TY 2KI4C 2OS8C 1OQPA 2JTTA 3CS1A 1M31A 1TTXA 2GGZA 2WCKA 2ZN9A 1PALA 3CR2A 3EG5B 1DF0A 2RGIA 3PN7C 4HREE 2G2BA 1DF0B 1LVCD 3GOFA 1QLKA 2DOQA 1SL7A 2E30A 2L2CA 1KQMC 5I2QA 1R2UA 3EKJA 1M46A 4GUKA 1KSMA 1K9UA 1YRTB 3EK7A 3BJHA 3O6BA 3BFHA 2NCOA 2KAVA 3AAKA 1CDMA 2WCEA 2QEBA 3EVVA 2CXJA 1F70A 3DF0A 3OBVA 2IS9A 1GM0A 3JTDC 3R1VA 2LVVA 3OP0A 3DF0B 5HYDA 1EH2A 3OB1B 5HKYA 2WCMA 2LNKA 3DXLA 4CLNA 2L4HA 1M45A 1NX2A 1W9ZA 1N65A 2FCDA 3OX5A 3SG3A 4PE1A 5AFPA 3DVMA 1YR5A 3R1OA 2CNPA 3SG6A 3FE8A 3VGOA 3N7HA 2LP2A 5FYXA 3L47A 4PHMA 1CM1A 1SCMB 5FI6A 1K9KA 3BXKA 1RTP1 1U5IA 1IG5A 2L50A 1F71A 2LVKA 1U5IB 2H2KA 2AUCA 4I5KA 1G8IA 2KI6C 3LK1A 1K93D 2MLFC 2JPOA 1LXFC 1QLSA 1B47A 4A4CA 5EL2A 2BBNA 3PLFB 2I2RE 1LS8A 3BUWB 3R72A 1J7PA 3CZ1A 4INXA 2M7LA 1Z4HA 5D69A 1VRKA 2GGMA 1B7TZ 2PQLA 3L4LA 2JWWA 5CSIA 1XYDA 2BECA 2WC6A 1K96A 3B6XA 5ER5A 1CMGA 1QATA 1FF1A 1N0YA 2I18A 2M3WA 1LINA 2BE6A 4FTGA 4PHKA 2SCPA 1OOIX 3AAJA 1EG4A 1UHIA 1F55A 1CFPA 3LLEA 2KBIA 3I5IC 4DRWA 1B9AA 3TUYC 2JZIA 2FOTA 1QS7A 1QWVA 2WCLA 4NDCA 2WCJA 3IQOA 1IIOA 2BKHB 2KBMA 1NSHA 4Q04A 5IBWA 1K95A 1YTZC 2MBXA 4DUQA 4JD9A 4YGBB 1AJ4A 2LV7A 2JNXA 1H4BA 3JVTB 2LUCA 3PM2A 2KYCA 2Y4QA 4OKHA 1ZUZA 1A75A 1DJWA 1NX0A 5AANA 5DKNA 3LCPC 2ERBA 1MF8B 1UHNA 2CTNA 1V1FA 1A75B 2KFHA 3FE6A 5F6TA 3UO9A 2EC6B 1TIZA 3NSLA 3D75A 4P5OE 3CTNA 4INWA 4YBHB 3O78A 2BE4A 4P2YB 1QX2A 1CFCA 1OW4A 2GTEA 1F4QA 1JC2A 1TUJA 1ORGA 1J7QA 1C7WA 1IQ5A 1Y0VH 1W7JB 3NXAA 4GGFA 3TDUA 1DJHA 1YUUA 1CMFA 2K7CA 4OCIA 1N2DA 5AXIA 3OGNA 2LMTA 4MRYA 1IJ5A 4F0ZB 1CDLA 1GGWA 1S6IA 4YGDB 1V1GA 2KGRA 2WC5A 3WHTB 3S0FA 1SR6B 2KFFA 4YGAA 4HRGA 1IWQA 4ORBB 2JC2A 2O5GA 4GBAA 3RM1A 5DKRA 2KLEA 1QV0A 1NPQA 2KQ6A 1LA3A 3FIAA 3HCMA 5I2LA 3NSKA 2HQWA 5J3XA 2SASA 1DVIA 3D0YA 2LCPA 2JXCA 4MSPA 1WRKA 3EVRA 3ZWHA 2JXLA 2YGUA 3I5GB 3SS5A 2PALA 1WLZA 4CPVA 3O4YA 1C7VA 2QDIA 2QPTA 3EKHA 3VRPA 3B87A 1OSAA 4D1EA 2K7OA 1S1EA 1QVIY 2M1UA 3D73A 4YGEB 2H61C 1ZOTB 1AVSA 1SKTA 1WDCC 1AK8A 2LAPA 2BAPA 2R2IA 1ZACA 1GJYA 2KAYA 3IVTA 1TNXA 3TS5C 2ZKMX 3ICBA 3F45A 4YGCB 4PT1A 1OZSA 1EL4A 3CR5X 1WRZA 4MZJA 4AQJA 4PE4A 1PVBA 4HRHA 1EXRA 1WY9A 4DS7A 1MQ1A 2BL0B 3CABA 1D1OA 1X02A 1KFUL 4YI9A 3I5FB 2K60A 1SBJA 3O2PA 2Y1MA 2TN4A 1T14A 3CZ2A 4JPZB 2M29A 5JOLA 5CSJA 4YI8A 2COLB 2L0PA 3GK4X 1OE9B 4NDBA 1TNQA 2F8PA 1S3PA 3OB2B 4OVNF 2JU0A 1KWOB 1QXPA 1Y1UA 2KAXA 2WORA 2ZN8A 2MLEC 3PSRA 4QJ4B 1B4CA 2LMUA 2M8UA 3VB1A 4A4BA 1FI6A 5DICA 3UNWA 2LM5A 1YURA 2LP3A 3RLZA 1TNWA 4WQ3A 1QIVA 3NGVA 1C3YA 2P6BB 2CCMA 1DJIA 1XFZO 1FBVA 4DIRA 1NWDA 2QEHA 2OTGB 3GK2A 3KF9A 4KYNA 4MZKA 3M0WA 1HT9A 4ETOA 1S26D 3A4UB 2HQ8A 1C07A 1KCYA 1K94A 5K89A 2QEOA 2KFGA 1RK9A 2JNFA 1L2OB 1QVIZ 2KPHA 5PALA 1B1GA 2FCEA 3CR4X 1PULA 2MA2A 1NCZA 3SG4A 3SIAA 1YVLA 3C1VA 1AP4A 3CLNA 3FS7A 2ZNEA 4ORAB 2BNXA 1KFUS 2HETA 1KFXL 2F2OA 2HPSA 1TWOA 1UURA 3I5HB 3S0AA 2K2FA 1AJ5A 1B8RA 2JT3A 2QACA 4GNKB 4QJ3B 2LC5A 1J1EA 1BJFA 1SYMA 3H4SE 4M2OA 4PHJA 3D10A 1XA5A 2CT9A 1MR8A 3EVUA 5B8IB 1B8LA 1JF2A 1OOFA 1QV1A 1KK8B 1PK0D 3DY9A 5I94A 1XK4A 5CSFA 1EG3A 4ZCUA 1RECA 1F8HA 2L51A 1FPWA 1ALVA 1DTLA 1TN4A 1TUZA 3L4AA 1JFJA 1G4YR 1TCFA 3PJIA 3S0EA 2KI6D 2F3ZA 4C0KA 1BR4B 1C3ZA 2BCBA 4M2PA 2P71A 2LMVA 4CIDA 1JFKA 1WRLA 3BQ3A 3BUNB 4YRUA 2H8VA 1DJXA 4PE7A 1OOJA 1P28A 1TCOB 3EK8A 2PSRA 1IJ6A 1GGZA 1SNLA 1ODBA 2L98A 2L5XB 4XYNA 1CTRA 3RZSA 2F33A 3B88A 4MVFA 2M9GA 2WC8A 3SG2A 1QJTA 3KHEA 1RFJA 2KYFA 2AMIA 1YVHA 4MRXA 1SCMC 3CZTX 1CLLA 5HKZA 1KFXS 1BT6A 2KDHA 3D74A 3IQQA 3SS4A 5JJGA 4F7FA 1MXEA 2PMYA 4MZLA 1NCXA 1OOHA 3V2LA 3BOWA 1CDPA 1XFYO 2KI4B 2MJWB 3BOWB 3WHUB 4UPGA 2OS8B 1S6JA 1E8AA 1XO5A 2KHNA 4MBEA 4CFRA 1NX1A 1XFRA 3PATA 4GGNA 2KNEA 2LLTA 3PN7B 3R1PA 2NXQA 3K1EA 2WCBA 1IKUA 1J7RA 3DZTA 2LVJA 1LA0A 2K7DA 3BUOB 1KQMB 3D0YB 4OR9B 5I8NA 1JBAA 2JRFA 3WNXB 2WOSA 2AAOA 1Z2CB 5GQQC 2JTZA 1QIWA 1OZOA 4PCWA 4C0LA 2L5YA 2E6WA 4TNCA 3D78A 3BYAA 1CLBA 5AEQA 2NZ0A 2ZRSA 2JT0A 3JTDB 1JSAA 2BBMA 1XFWO 3DVJA 4FQOA 4ZCVA 3JVTC 2M1KB 4NQGA 5G08A 1AHRA 2LE9B 1JF0A 4U8DA 3PM8A 1BMOA 1XFVO 2LUXA 2KLDA 1OMRA 3AKAA 4USLA 2EHBA 3FWCA 2EC6C 2WCFA 2MAZA 1TRFA 1H8BA 1B8CA 1PRWA 4OV2A 1QTXA 3A8RA 3TDIA 2L2EA 5D7FA 1DC1A 1KSOA 2K2AA 4MN0A 1M63B 2LLSA 2JT8A 3QMEA 4XJKA 4N1GA 3SG5A 2NLNA 3NHTA 2PYQA 2WNDA 1DJZA 4XJKB 1XVJA 1HQVA 1OOGA 1SK6D 4GGFC 2BCXA 1DGVA 1PSRA 2F2PA 1NCYA 5KU1A 1CFDA 1BU3A 2K0JA 1SR6C 2OPOA 4JKTA 3PALA 3S0DA 3S0BA 1RROA 1QX5B 4GFTA 4E68A 1BLQA 1FI5A 1W7IB 1S5GY 2M97A 1UHHA 2Y1NA 1CM4A 1J1DA 3KPXA 3DVKA 2FJUB 3ZNIA 1DMOA 1PSBA 1YX8A 2ZNDA 2Q91A 3DVEA 1SPYA 3D77A 3I5IB 3O4XA 2PASA 4PHNA 3I5GC 2WCHA 2LHIA 3OX6A 5CSNA 3TUYB 1BODA 1TOPA 2Y5IA 2MRDA 2V53A 4PALA 3NSIA 1DT7B 1S6CA 1SL8A 2JPTA 2L4IA 2LANA 4FQTA 1K90D 2M49B 3SIBA 4ICBA 2KQYA 1CFFA 5HKWA 1BOCA 1SCVA 2K8MB 3CDNA 3DYEA 4WQ2A 1NP8A 1NYAA 1LKJA 5D3OA 3FWBA 2BL0C 2M7NA 3TDZA 3VRNA 1L7ZA 1BR1B 2B1UA 2G9BA 1RJVA 3LL8B 3S0GA 4DCKA 1JWDA 2K61A 1YRUB 3BUMB 3I5FC 1MXLC 1QASA 1J55A 4R1EA 2D8NA 3LK0A 1YX7A 1XFUO 3BFAA 4I5JA 2NCPA 1YUSA 1RWYA 1M39A 3AKBA 3D76A 4QJ5B 3GK1A 1KK7Y 1K2HA 1TNPA 1ZFSA 2HF5A 1NX3A 3BUXB 3WXAA 4GAOA 2Q4UA 1DJGA 1KWOC 5HLOA 2LLUA 1R6PA 1Y1XA 3MSEB 1DELA 1K9PA 2ZRTA 4AQIA 1F54A 2M0RA 1A29A 3CZ0A 1Y1AA 1AUIB 4AOMA 4CFQA 1S5GZ 2QEVA 2ZFDA 3Q8IA 5FI2A 1BG1A 1CNPA 2OTGC 1DGUA 5KTYA 1CKKA 3IF7A 3SG7A 2H61A 1PVAA 2A4JA 5CPVA 1JUOA 4BY5A 4JQ0D 4NDDA 1DEKA 5AERA 1ALWA 1WDCB 2O60A 3K21A 5DKQA 1L2OC 3TS5B 3TZ1A 1UHKA 1SMGA 1EJ3A 2GV5A 2KSPA 2PVBA 4L9MA 2ISDA 4I5LB 3VROA 3EK4A 3FE9A 3I5HC 4MLWA 2K7BA 4IL1A 5BPJA 4IJ7A 5HL1A 1SSEB 4GPLB 2VRGA 3HX4A 4M2QA 1SW8A 1CDNA 4N1FA 3NHIA 4WRIA 1A2XA 3QRXA 4MEWA 1SL9A 2P70A 3B7AA 1MHOA 4ORCB 1XFXO 4HSZA 4BY4A 1KQVA 1KK8C 3PFVA 1UHJA 1BF5A 5I2OA 1UP5A 2CBLA 3SJSA 3CWGA 1DQEA 1WLMA 1KK7Z 1XK4C 3BFBA 1IRJA 3VRRA 4JWQA 2I7AA 1NIWA 3B86A 4I5NB 5HLVA 1J7OA 1OMDA 2BCAA 2JOJA 1IGVA 1MUXA 1CLMA 3KEVA 1Q80A 3CGAA 4C0JA 3KO0A 2EGDA 2PRUA 1K8UA 3DD4A 1YUTA 3VRQA 2KOTA 1QX7A 1OMVA 1UWOA 1ZMZA 3NSOA 5FI7A 3SS3A 2F3YA 1MWNA 3OHMB 1SRAA 5TNCA 1A03A 1Y6WA 1IH0A 1NUBA 1SY9A 2KGBC 3CYZA 1FW4A 1DJYA 3E3RA 4PE0A 1GQMA 2LHLA 2JQ6A 2LVIA
chains in the Genus database with same CATH topology
2JULA 2MHHA 1F4OA 4N5XA 5ER4X 1UUSA 2BKIB 5KSZA 1IQ3A 4PDZA 1A4PA 1S36A 2I94A 1G33A 1CB1A 1B7TY 2KI4C 2OS8C 1OQPA 2JTTA 3CS1A 1M31A 1TTXA 2GGZA 2ZN9A 1PALA 3CR2A 1DF0A 2RGIA 3PN7C 4HREE 2G2BA 1DF0B 1LVCD 3GOFA 1QLKA 2DOQA 1SL7A 2E30A 1KQMC 5I2QA 1R2UA 3EKJA 1M46A 4GUKA 1KSMA 1K9UA 1YRTB 3EK7A 3O6BA 2NCOA 2KAVA 3AAKA 1CDMA 2WCEA 3EVVA 2CXJA 1F70A 3DF0A 2IS9A 3JTDC 2LVVA 3OP0A 3DF0B 5HYDA 1EH2A 3OB1B 5HKYA 2LNKA 4CLNA 2L4HA 1M45A 1NX2A 1N65A 2FCDA 3OX5A 3SG3A 4PE1A 5AFPA 3DVMA 1YR5A 2CNPA 3SG6A 3VGOA 2LP2A 5FYXA 4PHMA 1CM1A 1SCMB 1K9KA 3BXKA 1RTP1 1U5IA 1IG5A 2L50A 1F71A 2LVKA 1U5IB 2H2KA 2AUCA 4I5KA 1G8IA 2KI6C 3LK1A 1K93D 2MLFC 1LXFC 1QLSA 1B47A 4A4CA 2BBNA 3PLFB 2I2RE 3BUWB 1J7PA 2M7LA 5D69A 1VRKA 2GGMA 1B7TZ 5CSIA 2JWWA 1XYDA 2BECA 1K96A 5ER5A 1CMGA 1QATA 1FF1A 1N0YA 2I18A 2M3WA 1LINA 2BE6A 4FTGA 4PHKA 2SCPA 3AAJA 1EG4A 1UHIA 1F55A 1CFPA 3LLEA 2KBIA 3I5IC 4DRWA 1B9AA 3TUYC 2JZIA 2FOTA 1QS7A 4NDCA 3IQOA 2BKHB 2KBMA 1NSHA 4Q04A 5IBWA 1K95A 1YTZC 2MBXA 4DUQA 4YGBB 1AJ4A 2LV7A 2JNXA 1H4BA 3JVTB 2LUCA 2KYCA 2Y4QA 4OKHA 1ZUZA 1A75A 1DJWA 1NX0A 5AANA 5DKNA 3LCPC 4BY5A 1MF8B 1UHNA 2CTNA 1V1FA 1A75B 2KFHA 5F6TA 2EC6B 1TIZA 3NSLA 4P5OE 3CTNA 4YBHB 3O78A 2BE4A 4P2YB 1QX2A 1CFCA 1JC2A 1F4QA 1J7QA 1C7WA 1IQ5A 1Y0VH 1W7JB 3NXAA 4GGFA 3TDUA 1DJHA 1YUUA 1CMFA 2K7CA 4OCIA 1N2DA 5AXIA 4F0ZB 2LMTA 4MRYA 1IJ5A 1CDLA 1GGWA 1S6IA 4YGDB 1V1GA 2KGRA 3WHTB 1SR6B 2KFFA 4YGAA 4HRGA 1IWQA 4ORBB 2JC2A 2O5GA 4GBAA 3RM1A 5DKRA 1QV0A 1NPQA 2KQ6A 1LA3A 3FIAA 3HCMA 5I2LA 3NSKA 2HQWA 5J3XA 2SASA 1DVIA 3D0YA 2LCPA 2JXCA 4MSPA 1WRKA 3EVRA 3ZWHA 2JXLA 3I5GB 2PALA 1WLZA 4CPVA 3O4YA 1C7VA 4D1EA 2QPTA 3EKHA 3VRPA 1OSAA 2K7OA 1S1EA 1QVIY 2M1UA 4YGEB 2H61C 1ZOTB 1AVSA 1SKTA 1WDCC 1AK8A 2LAPA 2R2IA 1ZACA 1GJYA 2KAYA 3TS5C 1TNXA 2ZKMX 3ICBA 3F45A 4YGCB 1OZSA 1EL4A 3CR5X 1WRZA 4MZJA 4AQJA 4PE4A 1PVBA 4HRHA 1EXRA 1WY9A 4DS7A 1MQ1A 2BL0B 1D1OA 1X02A 1KFUL 4YI9A 3I5FB 3O2PA 1SBJA 2Y1MA 2TN4A 4JPZB 2M29A 5JOLA 5CSJA 4YI8A 2COLB 2L0PA 3GK4X 1OE9B 4NDBA 1TNQA 2F8PA 1S3PA 3OB2B 4OVNF 2JU0A 1KWOB 1QXPA 1Y1UA 2KAXA 2WORA 2ZN8A 2MLEC 3PSRA 4QJ4B 1B4CA 2LMUA 2M8UA 4A4BA 1FI6A 2LM5A 1YURA 2LP3A 3RLZA 1TNWA 4WQ3A 1QIVA 2P6BB 2CCMA 1DJIA 1XFZO 1FBVA 4DIRA 1NWDA 2OTGB 3GK2A 3KF9A 4MZKA 3M0WA 1HT9A 4ETOA 1S26D 3A4UB 2HQ8A 1C07A 1KCYA 1K94A 5K89A 2KFGA 1RK9A 2JNFA 1L2OB 1QVIZ 5PALA 1B1GA 2FCEA 3CR4X 1PULA 2MA2A 1NCZA 3SG4A 3SIAA 1YVLA 3C1VA 1AP4A 3CLNA 3FS7A 2ZNEA 4ORAB 1KFUS 2HETA 1KFXL 2F2OA 2HPSA 3I5HB 1UURA 2K2FA 1AJ5A 1B8RA 2JT3A 2QACA 4GNKB 4QJ3B 2LC5A 1J1EA 1BJFA 1SYMA 3H4SE 4M2OA 4PHJA 3D10A 1XA5A 2CT9A 1MR8A 3EVUA 5B8IB 1B8LA 1JF2A 1QV1A 1KK8B 1PK0D 1XK4A 5CSFA 1EG3A 4ZCUA 1RECA 1F8HA 2L51A 1FPWA 1ALVA 1DTLA 1TN4A 1JFJA 1G4YR 1TCFA 2KI6D 2F3ZA 4C0KA 1BR4B 4M2PA 2BCBA 2LMVA 4CIDA 1JFKA 1WRLA 3BQ3A 3BUNB 4YRUA 1DJXA 4PE7A 1OOJA 1TCOB 3EK8A 2PSRA 1IJ6A 1GGZA 1SNLA 1ODBA 2L98A 2L5XB 4XYNA 1CTRA 2F33A 4MVFA 2M9GA 2WC8A 3SG2A 1QJTA 3KHEA 1RFJA 2KYFA 2AMIA 1YVHA 4MRXA 1SCMC 3CZTX 1CLLA 5HKZA 1KFXS 1BT6A 2KDHA 3IQQA 5JJGA 1MXEA 2PMYA 4MZLA 1NCXA 3BOWA 1CDPA 1XFYO 2KI4B 2MJWB 3BOWB 3WHUB 4UPGA 2OS8B 1S6JA 1E8AA 1XO5A 2KHNA 4MBEA 4CFRA 1NX1A 3PATA 4GGNA 2KNEA 2LLTA 3PN7B 2NXQA 2WCBA 1IKUA 1J7RA 2LVJA 1LA0A 2K7DA 3BUOB 1KQMB 3D0YB 4OR9B 5I8NA 1JBAA 2JRFA 3WNXB 2WOSA 2AAOA 5GQQC 2JTZA 1QIWA 1OZOA 4PCWA 4C0LA 2E6WA 4TNCA 3BYAA 1CLBA 5AEQA 2NZ0A 2ZRSA 2JT0A 3JTDB 1JSAA 2BBMA 1XFWO 3DVJA 4FQOA 4ZCVA 3JVTC 2M1KB 4NQGA 5G08A 1AHRA 2LE9B 1JF0A 4U8DA 3PM8A 1BMOA 1XFVO 2LUXA 3AKAA 1OMRA 4USLA 2EHBA 3FWCA 2EC6C 2WCFA 2MAZA 1TRFA 1H8BA 1B8CA 1PRWA 4OV2A 1QTXA 3A8RA 3TDIA 2L2EA 5D7FA 1KSOA 2K2AA 4MN0A 1M63B 2LLSA 2JT8A 4XJKA 4N1GA 3SG5A 2NLNA 2WNDA 1DJZA 4XJKB 1XVJA 1HQVA 1SK6D 4GGFC 2BCXA 1DGVA 1PSRA 2F2PA 1NCYA 5KU1A 1CFDA 1BU3A 2K0JA 1SR6C 2OPOA 4E68A 3PALA 1RROA 1QX5B 4GFTA 1BLQA 1FI5A 1W7IB 1S5GY 2M97A 1UHHA 2Y1NA 1CM4A 1J1DA 3KPXA 3DVKA 2FJUB 3ZNIA 1DMOA 1PSBA 1YX8A 2ZNDA 2Q91A 3DVEA 1SPYA 3I5IB 4PHNA 2PASA 3I5GC 5CSNA 2LHIA 3OX6A 3TUYB 1BODA 1TOPA 2Y5IA 2MRDA 2V53A 4PALA 3NSIA 1DT7B 1S6CA 1SL8A 2JPTA 2L4IA 2LANA 1K90D 2M49B 3SIBA 4ICBA 2KQYA 1CFFA 5HKWA 1BOCA 1SCVA 2K8MB 4WQ2A 1NP8A 1NYAA 1LKJA 3FWBA 2BL0C 2M7NA 3TDZA 3VRNA 1L7ZA 1BR1B 2B1UA 2G9BA 1RJVA 3LL8B 4DCKA 1JWDA 2K61A 1YRUB 3BUMB 3I5FC 1MXLC 1QASA 1J55A 4R1EA 2D8NA 3LK0A 1YX7A 1XFUO 4I5JA 2NCPA 1YUSA 1RWYA 1M39A 3AKBA 4QJ5B 3GK1A 1KK7Y 1K2HA 1TNPA 1ZFSA 2HF5A 1NX3A 3BUXB 3WXAA 4GAOA 2Q4UA 1DJGA 1KWOC 5HLOA 2LLUA 1R6PA 1Y1XA 3MSEB 1K9PA 2ZRTA 4AQIA 1F54A 2M0RA 1A29A 1Y1AA 1AUIB 4AOMA 4CFQA 1S5GZ 2ZFDA 1BG1A 1CNPA 2OTGC 1DGUA 5KTYA 1CKKA 3IF7A 3SG7A 2H61A 1PVAA 2A4JA 5CPVA 1JUOA 4JQ0D 4NDDA 5AERA 1ALWA 1WDCB 2O60A 3K21A 5DKQA 1L2OC 3TS5B 3TZ1A 1UHKA 1SMGA 1EJ3A 2GV5A 2KSPA 2PVBA 4L9MA 2ISDA 4I5LB 3VROA 3EK4A 3I5HC 4MLWA 2K7BA 4IL1A 5BPJA 4GPLB 2VRGA 3HX4A 4M2QA 1SW8A 1CDNA 4N1FA 4WRIA 1A2XA 3QRXA 4MEWA 1SL9A 1MHOA 4ORCB 1XFXO 4HSZA 4BY4A 1KQVA 1KK8C 3PFVA 1UHJA 1BF5A 5I2OA 1UP5A 2CBLA 3SJSA 3CWGA 1WLMA 1KK7Z 1XK4C 1IRJA 3VRRA 4JWQA 2I7AA 1NIWA 4I5NB 5HLVA 1J7OA 1OMDA 2BCAA 2JOJA 1IGVA 1MUXA 1CLMA 3KEVA 1Q80A 3CGAA 4C0JA 3KO0A 2EGDA 2PRUA 1K8UA 3DD4A 1YUTA 3VRQA 2KOTA 1QX7A 1OMVA 1UWOA 1ZMZA 3NSOA 2F3YA 1MWNA 3OHMB 1SRAA 5TNCA 1A03A 1Y6WA 1IH0A 1NUBA 1SY9A 2KGBC 1FW4A 1DJYA 3E3RA 4PE0A 1GQMA 2LHLA 2JQ6A 2LVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUL A;  2MHH A;  1F4O A;  4N5X A;  5ER4 X;  1UUS A;  2BKI B;  5KSZ A;  1IQ3 A;  4PDZ A;  1A4P A;  1S36 A;  2I94 A;  1G33 A;  1CB1 A;  1B7T Y;  2KI4 C;  2OS8 C;  1OQP A;  2JTT A;  3CS1 A;  1M31 A;  1TTX A;  2GGZ A;  2ZN9 A;  1PAL A;  3CR2 A;  1DF0 A;  2RGI A;  3PN7 C;  4HRE E;  2G2B A;  1DF0 B;  1LVC D;  3GOF A;  1QLK A;  2DOQ A;  1SL7 A;  2E30 A;  1KQM C;  5I2Q A;  1R2U A;  3EKJ A;  1M46 A;  4GUK A;  1KSM A;  1K9U A;  1YRT B;  3EK7 A;  3O6B A;  2NCO A;  2KAV A;  3AAK A;  1CDM A;  2WCE A;  3EVV A;  2CXJ A;  1F70 A;  3DF0 A;  2IS9 A;  3JTD C;  2LVV A;  3OP0 A;  3DF0 B;  5HYD A;  1EH2 A;  3OB1 B;  5HKY A;  2LNK A;  4CLN A;  2L4H A;  1M45 A;  1NX2 A;  1N65 A;  2FCD A;  3OX5 A;  3SG3 A;  4PE1 A;  5AFP A;  3DVM A;  1YR5 A;  2CNP A;  3SG6 A;  3VGO A;  2LP2 A;  5FYX A;  4PHM A;  1CM1 A;  1SCM B;  1K9K A;  3BXK A;  1RTP 1;  1U5I A;  1IG5 A;  2L50 A;  1F71 A;  2LVK A;  1U5I B;  2H2K A;  2AUC A;  4I5K A;  1G8I A;  2KI6 C;  3LK1 A;  1K93 D;  2MLF C;  1LXF C;  1QLS A;  1B47 A;  4A4C A;  2BBN A;  3PLF B;  2I2R E;  3BUW B;  1J7P A;  2M7L A;  5D69 A;  1VRK A;  2GGM A;  1B7T Z;  5CSI A;  2JWW A;  1XYD A;  2BEC A;  1K96 A;  5ER5 A;  1CMG A;  1QAT A;  1FF1 A;  1N0Y A;  2I18 A;  2M3W A;  1LIN A;  2BE6 A;  4FTG A;  4PHK A;  2SCP A;  3AAJ A;  1EG4 A;  1UHI A;  1F55 A;  1CFP A;  3LLE A;  2KBI A;  3I5I C;  4DRW A;  1B9A A;  3TUY C;  2JZI A;  2FOT A;  1QS7 A;  4NDC A;  3IQO A;  2BKH B;  2KBM A;  1NSH A;  4Q04 A;  5IBW A;  1K95 A;  1YTZ C;  2MBX A;  4DUQ A;  4YGB B;  1AJ4 A;  2LV7 A;  2JNX A;  1H4B A;  3JVT B;  2LUC A;  2KYC A;  2Y4Q A;  4OKH A;  1ZUZ A;  1A75 A;  1DJW A;  1NX0 A;  5AAN A;  5DKN A;  3LCP C;  4BY5 A;  1MF8 B;  1UHN A;  2CTN A;  1V1F A;  1A75 B;  2KFH A;  5F6T A;  2EC6 B;  1TIZ A;  3NSL A;  4P5O E;  3CTN A;  4YBH B;  3O78 A;  2BE4 A;  4P2Y B;  1QX2 A;  1CFC A;  1JC2 A;  1F4Q A;  1J7Q A;  1C7W A;  1IQ5 A;  1Y0V H;  1W7J B;  3NXA A;  4GGF A;  3TDU A;  1DJH A;  1YUU A;  1CMF A;  2K7C A;  4OCI A;  1N2D A;  5AXI A;  4F0Z B;  2LMT A;  4MRY A;  1IJ5 A;  1CDL A;  1GGW A;  1S6I A;  4YGD B;  1V1G A;  2KGR A;  3WHT B;  1SR6 B;  2KFF A;  4YGA A;  4HRG A;  1IWQ A;  4ORB B;  2JC2 A;  2O5G A;  4GBA A;  3RM1 A;  5DKR A;  1QV0 A;  1NPQ A;  2KQ6 A;  1LA3 A;  3FIA A;  3HCM A;  5I2L A;  3NSK A;  2HQW A;  5J3X A;  2SAS A;  1DVI A;  3D0Y A;  2LCP A;  2JXC A;  4MSP A;  1WRK A;  3EVR A;  3ZWH A;  2JXL A;  3I5G B;  2PAL A;  1WLZ A;  4CPV A;  3O4Y A;  1C7V A;  4D1E A;  2QPT A;  3EKH A;  3VRP A;  1OSA A;  2K7O A;  1S1E A;  1QVI Y;  2M1U A;  4YGE B;  2H61 C;  1ZOT B;  1AVS A;  1SKT A;  1WDC C;  1AK8 A;  2LAP A;  2R2I A;  1ZAC A;  1GJY A;  2KAY A;  3TS5 C;  1TNX A;  2ZKM X;  3ICB A;  3F45 A;  4YGC B;  1OZS A;  1EL4 A;  3CR5 X;  1WRZ A;  4MZJ A;  4AQJ A;  4PE4 A;  1PVB A;  4HRH A;  1EXR A;  1WY9 A;  4DS7 A;  1MQ1 A;  2BL0 B;  1D1O A;  1X02 A;  1KFU L;  4YI9 A;  3I5F B;  3O2P A;  1SBJ A;  2Y1M A;  2TN4 A;  4JPZ B;  2M29 A;  5JOL A;  5CSJ A;  4YI8 A;  2COL B;  2L0P A;  3GK4 X;  1OE9 B;  4NDB A;  1TNQ A;  2F8P A;  1S3P A;  3OB2 B;  4OVN F;  2JU0 A;  1KWO B;  1QXP A;  1Y1U A;  2KAX A;  2WOR A;  2ZN8 A;  2MLE C;  3PSR A;  4QJ4 B;  1B4C A;  2LMU A;  2M8U A;  4A4B A;  1FI6 A;  2LM5 A;  1YUR A;  2LP3 A;  3RLZ A;  1TNW A;  4WQ3 A;  1QIV A;  2P6B B;  2CCM A;  1DJI A;  1XFZ O;  1FBV A;  4DIR A;  1NWD A;  2OTG B;  3GK2 A;  3KF9 A;  4MZK A;  3M0W A;  1HT9 A;  4ETO A;  1S26 D;  3A4U B;  2HQ8 A;  1C07 A;  1KCY A;  1K94 A;  5K89 A;  2KFG A;  1RK9 A;  2JNF A;  1L2O B;  1QVI Z;  5PAL A;  1B1G A;  2FCE A;  3CR4 X;  1PUL A;  2MA2 A;  1NCZ A;  3SG4 A;  3SIA A;  1YVL A;  3C1V A;  1AP4 A;  3CLN A;  3FS7 A;  2ZNE A;  4ORA B;  1KFU S;  2HET A;  1KFX L;  2F2O A;  2HPS A;  3I5H B;  1UUR A;  2K2F A;  1AJ5 A;  1B8R A;  2JT3 A;  2QAC A;  4GNK B;  4QJ3 B;  2LC5 A;  1J1E A;  1BJF A;  1SYM A;  3H4S E;  4M2O A;  4PHJ A;  3D10 A;  1XA5 A;  2CT9 A;  1MR8 A;  3EVU A;  5B8I B;  1B8L A;  1JF2 A;  1QV1 A;  1KK8 B;  1PK0 D;  1XK4 A;  5CSF A;  1EG3 A;  4ZCU A;  1REC A;  1F8H A;  2L51 A;  1FPW A;  1ALV A;  1DTL A;  1TN4 A;  1JFJ A;  1G4Y R;  1TCF A;  2KI6 D;  2F3Z A;  4C0K A;  1BR4 B;  4M2P A;  2BCB A;  2LMV A;  4CID A;  1JFK A;  1WRL A;  3BQ3 A;  3BUN B;  4YRU A;  1DJX A;  4PE7 A;  1OOJ A;  1TCO B;  3EK8 A;  2PSR A;  1IJ6 A;  1GGZ A;  1SNL A;  1ODB A;  2L98 A;  2L5X B;  4XYN A;  1CTR A;  2F33 A;  4MVF A;  2M9G A;  2WC8 A;  3SG2 A;  1QJT A;  3KHE A;  1RFJ A;  2KYF A;  2AMI A;  1YVH A;  4MRX A;  1SCM C;  3CZT X;  1CLL A;  5HKZ A;  1KFX S;  1BT6 A;  2KDH A;  3IQQ A;  5JJG A;  1MXE A;  2PMY A;  4MZL A;  1NCX A;  3BOW A;  1CDP A;  1XFY O;  2KI4 B;  2MJW B;  3BOW B;  3WHU B;  4UPG A;  2OS8 B;  1S6J A;  1E8A A;  1XO5 A;  2KHN A;  4MBE A;  4CFR A;  1NX1 A;  3PAT A;  4GGN A;  2KNE A;  2LLT A;  3PN7 B;  2NXQ A;  2WCB A;  1IKU A;  1J7R A;  2LVJ A;  1LA0 A;  2K7D A;  3BUO B;  1KQM B;  3D0Y B;  4OR9 B;  5I8N A;  1JBA A;  2JRF A;  3WNX B;  2WOS A;  2AAO A;  5GQQ C;  2JTZ A;  1QIW A;  1OZO A;  4PCW A;  4C0L A;  2E6W A;  4TNC A;  3BYA A;  1CLB A;  5AEQ A;  2NZ0 A;  2ZRS A;  2JT0 A;  3JTD B;  1JSA A;  2BBM A;  1XFW O;  3DVJ A;  4FQO A;  4ZCV A;  3JVT C;  2M1K B;  4NQG A;  5G08 A;  1AHR A;  2LE9 B;  1JF0 A;  4U8D A;  3PM8 A;  1BMO A;  1XFV O;  2LUX A;  3AKA A;  1OMR A;  4USL A;  2EHB A;  3FWC A;  2EC6 C;  2WCF A;  2MAZ A;  1TRF A;  1H8B A;  1B8C A;  1PRW A;  4OV2 A;  1QTX A;  3A8R A;  3TDI A;  2L2E A;  5D7F A;  1KSO A;  2K2A A;  4MN0 A;  1M63 B;  2LLS A;  2JT8 A;  4XJK A;  4N1G A;  3SG5 A;  2NLN A;  2WND A;  1DJZ A;  4XJK B;  1XVJ A;  1HQV A;  1SK6 D;  4GGF C;  2BCX A;  1DGV A;  1PSR A;  2F2P A;  1NCY A;  5KU1 A;  1CFD A;  1BU3 A;  2K0J A;  1SR6 C;  2OPO A;  4E68 A;  3PAL A;  1RRO A;  1QX5 B;  4GFT A;  1BLQ A;  1FI5 A;  1W7I B;  1S5G Y;  2M97 A;  1UHH A;  2Y1N A;  1CM4 A;  1J1D A;  3KPX A;  3DVK A;  2FJU B;  3ZNI A;  1DMO A;  1PSB A;  1YX8 A;  2ZND A;  2Q91 A;  3DVE A;  1SPY A;  3I5I B;  4PHN A;  2PAS A;  3I5G C;  5CSN A;  2LHI A;  3OX6 A;  3TUY B;  1BOD A;  1TOP A;  2Y5I A;  2MRD A;  2V53 A;  4PAL A;  3NSI A;  1DT7 B;  1S6C A;  1SL8 A;  2JPT A;  2L4I A;  2LAN A;  1K90 D;  2M49 B;  3SIB A;  4ICB A;  2KQY A;  1CFF A;  5HKW A;  1BOC A;  1SCV A;  2K8M B;  4WQ2 A;  1NP8 A;  1NYA A;  1LKJ A;  3FWB A;  2BL0 C;  2M7N A;  3TDZ A;  3VRN A;  1L7Z A;  1BR1 B;  2B1U A;  2G9B A;  1RJV A;  3LL8 B;  4DCK A;  1JWD A;  2K61 A;  1YRU B;  3BUM B;  3I5F C;  1MXL C;  1QAS A;  1J55 A;  4R1E A;  2D8N A;  3LK0 A;  1YX7 A;  1XFU O;  4I5J A;  2NCP A;  1YUS A;  1RWY A;  1M39 A;  3AKB A;  4QJ5 B;  3GK1 A;  1KK7 Y;  1K2H A;  1TNP A;  1ZFS A;  2HF5 A;  1NX3 A;  3BUX B;  3WXA A;  4GAO A;  2Q4U A;  1DJG A;  1KWO C;  5HLO A;  2LLU A;  1R6P A;  1Y1X A;  3MSE B;  1K9P A;  2ZRT A;  4AQI A;  1F54 A;  2M0R A;  1A29 A;  1Y1A A;  1AUI B;  4AOM A;  4CFQ A;  1S5G Z;  2ZFD A;  1BG1 A;  1CNP A;  2OTG C;  1DGU A;  5KTY A;  1CKK A;  3IF7 A;  3SG7 A;  2H61 A;  1PVA A;  2A4J A;  5CPV A;  1JUO A;  4JQ0 D;  4NDD A;  5AER A;  1ALW A;  1WDC B;  2O60 A;  3K21 A;  5DKQ A;  1L2O C;  3TS5 B;  3TZ1 A;  1UHK A;  1SMG A;  1EJ3 A;  2GV5 A;  2KSP A;  2PVB A;  4L9M A;  2ISD A;  4I5L B;  3VRO A;  3EK4 A;  3I5H C;  4MLW A;  2K7B A;  4IL1 A;  5BPJ A;  4GPL B;  2VRG A;  3HX4 A;  4M2Q A;  1SW8 A;  1CDN A;  4N1F A;  4WRI A;  1A2X A;  3QRX A;  4MEW A;  1SL9 A;  1MHO A;  4ORC B;  1XFX O;  4HSZ A;  4BY4 A;  1KQV A;  1KK8 C;  3PFV A;  1UHJ A;  1BF5 A;  5I2O A;  1UP5 A;  2CBL A;  3SJS A;  3CWG A;  1WLM A;  1KK7 Z;  1XK4 C;  1IRJ A;  3VRR A;  4JWQ A;  2I7A A;  1NIW A;  4I5N B;  5HLV A;  1J7O A;  1OMD A;  2BCA A;  2JOJ A;  1IGV A;  1MUX A;  1CLM A;  3KEV A;  1Q80 A;  3CGA A;  4C0J A;  3KO0 A;  2EGD A;  2PRU A;  1K8U A;  3DD4 A;  1YUT A;  3VRQ A;  2KOT A;  1QX7 A;  1OMV A;  1UWO A;  1ZMZ A;  3NSO A;  2F3Y A;  1MWN A;  3OHM B;  1SRA A;  5TNC A;  1A03 A;  1Y6W A;  1IH0 A;  1NUB A;  1SY9 A;  2KGB C;  1FW4 A;  1DJY A;  3E3R A;  4PE0 A;  1GQM A;  2LHL A;  2JQ6 A;  2LVI A; 
#chains in the Genus database with same CATH topology
 2JUL A;  2MHH A;  1F4O A;  4N5X A;  5ER4 X;  1UUS A;  2BKI B;  5KSZ A;  1IQ3 A;  2FJY A;  4OZD A;  4PDZ A;  1A4P A;  1S36 A;  2I94 A;  1G33 A;  1CB1 A;  1B7T Y;  2KI4 C;  2OS8 C;  1OQP A;  2JTT A;  3CS1 A;  1M31 A;  1TTX A;  2GGZ A;  2WCK A;  2ZN9 A;  1PAL A;  3CR2 A;  3EG5 B;  1DF0 A;  2RGI A;  3PN7 C;  4HRE E;  2G2B A;  1DF0 B;  1LVC D;  3GOF A;  1QLK A;  2DOQ A;  1SL7 A;  2E30 A;  2L2C A;  1KQM C;  5I2Q A;  1R2U A;  3EKJ A;  1M46 A;  4GUK A;  1KSM A;  1K9U A;  1YRT B;  3EK7 A;  3BJH A;  3O6B A;  3BFH A;  2NCO A;  2KAV A;  3AAK A;  1CDM A;  2WCE A;  2QEB A;  3EVV A;  2CXJ A;  1F70 A;  3DF0 A;  3OBV A;  2IS9 A;  1GM0 A;  3JTD C;  3R1V A;  2LVV A;  3OP0 A;  3DF0 B;  5HYD A;  1EH2 A;  3OB1 B;  5HKY A;  2WCM A;  2LNK A;  3DXL A;  4CLN A;  2L4H A;  1M45 A;  1NX2 A;  1W9Z A;  1N65 A;  2FCD A;  3OX5 A;  3SG3 A;  4PE1 A;  5AFP A;  3DVM A;  1YR5 A;  3R1O A;  2CNP A;  3SG6 A;  3FE8 A;  3VGO A;  3N7H A;  2LP2 A;  5FYX A;  3L47 A;  4PHM A;  1CM1 A;  1SCM B;  5FI6 A;  1K9K A;  3BXK A;  1RTP 1;  1U5I A;  1IG5 A;  2L50 A;  1F71 A;  2LVK A;  1U5I B;  2H2K A;  2AUC A;  4I5K A;  1G8I A;  2KI6 C;  3LK1 A;  1K93 D;  2MLF C;  2JPO A;  1LXF C;  1QLS A;  1B47 A;  4A4C A;  5EL2 A;  2BBN A;  3PLF B;  2I2R E;  1LS8 A;  3BUW B;  3R72 A;  1J7P A;  3CZ1 A;  4INX A;  2M7L A;  1Z4H A;  5D69 A;  1VRK A;  2GGM A;  1B7T Z;  2PQL A;  3L4L A;  2JWW A;  5CSI A;  1XYD A;  2BEC A;  2WC6 A;  1K96 A;  3B6X A;  5ER5 A;  1CMG A;  1QAT A;  1FF1 A;  1N0Y A;  2I18 A;  2M3W A;  1LIN A;  2BE6 A;  4FTG A;  4PHK A;  2SCP A;  1OOI X;  3AAJ A;  1EG4 A;  1UHI A;  1F55 A;  1CFP A;  3LLE A;  2KBI A;  3I5I C;  4DRW A;  1B9A A;  3TUY C;  2JZI A;  2FOT A;  1QS7 A;  1QWV A;  2WCL A;  4NDC A;  2WCJ A;  3IQO A;  1IIO A;  2BKH B;  2KBM A;  1NSH A;  4Q04 A;  5IBW A;  1K95 A;  1YTZ C;  2MBX A;  4DUQ A;  4JD9 A;  4YGB B;  1AJ4 A;  2LV7 A;  2JNX A;  1H4B A;  3JVT B;  2LUC A;  3PM2 A;  2KYC A;  2Y4Q A;  4OKH A;  1ZUZ A;  1A75 A;  1DJW A;  1NX0 A;  5AAN A;  5DKN A;  3LCP C;  2ERB A;  1MF8 B;  1UHN A;  2CTN A;  1V1F A;  1A75 B;  2KFH A;  3FE6 A;  5F6T A;  3UO9 A;  2EC6 B;  1TIZ A;  3NSL A;  3D75 A;  4P5O E;  3CTN A;  4INW A;  4YBH B;  3O78 A;  2BE4 A;  4P2Y B;  1QX2 A;  1CFC A;  1OW4 A;  2GTE A;  1F4Q A;  1JC2 A;  1TUJ A;  1ORG A;  1J7Q A;  1C7W A;  1IQ5 A;  1Y0V H;  1W7J B;  3NXA A;  4GGF A;  3TDU A;  1DJH A;  1YUU A;  1CMF A;  2K7C A;  4OCI A;  1N2D A;  5AXI A;  3OGN A;  2LMT A;  4MRY A;  1IJ5 A;  4F0Z B;  1CDL A;  1GGW A;  1S6I A;  4YGD B;  1V1G A;  2KGR A;  2WC5 A;  3WHT B;  3S0F A;  1SR6 B;  2KFF A;  4YGA A;  4HRG A;  1IWQ A;  4ORB B;  2JC2 A;  2O5G A;  4GBA A;  3RM1 A;  5DKR A;  2KLE A;  1QV0 A;  1NPQ A;  2KQ6 A;  1LA3 A;  3FIA A;  3HCM A;  5I2L A;  3NSK A;  2HQW A;  5J3X A;  2SAS A;  1DVI A;  3D0Y A;  2LCP A;  2JXC A;  4MSP A;  1WRK A;  3EVR A;  3ZWH A;  2JXL A;  2YGU A;  3I5G B;  3SS5 A;  2PAL A;  1WLZ A;  4CPV A;  3O4Y A;  1C7V A;  2QDI A;  2QPT A;  3EKH A;  3VRP A;  3B87 A;  1OSA A;  4D1E A;  2K7O A;  1S1E A;  1QVI Y;  2M1U A;  3D73 A;  4YGE B;  2H61 C;  1ZOT B;  1AVS A;  1SKT A;  1WDC C;  1AK8 A;  2LAP A;  2BAP A;  2R2I A;  1ZAC A;  1GJY A;  2KAY A;  3IVT A;  1TNX A;  3TS5 C;  2ZKM X;  3ICB A;  3F45 A;  4YGC B;  4PT1 A;  1OZS A;  1EL4 A;  3CR5 X;  1WRZ A;  4MZJ A;  4AQJ A;  4PE4 A;  1PVB A;  4HRH A;  1EXR A;  1WY9 A;  4DS7 A;  1MQ1 A;  2BL0 B;  3CAB A;  1D1O A;  1X02 A;  1KFU L;  4YI9 A;  3I5F B;  2K60 A;  1SBJ A;  3O2P A;  2Y1M A;  2TN4 A;  1T14 A;  3CZ2 A;  4JPZ B;  2M29 A;  5JOL A;  5CSJ A;  4YI8 A;  2COL B;  2L0P A;  3GK4 X;  1OE9 B;  4NDB A;  1TNQ A;  2F8P A;  1S3P A;  3OB2 B;  4OVN F;  2JU0 A;  1KWO B;  1QXP A;  1Y1U A;  2KAX A;  2WOR A;  2ZN8 A;  2MLE C;  3PSR A;  4QJ4 B;  1B4C A;  2LMU A;  2M8U A;  3VB1 A;  4A4B A;  1FI6 A;  5DIC A;  3UNW A;  2LM5 A;  1YUR A;  2LP3 A;  3RLZ A;  1TNW A;  4WQ3 A;  1QIV A;  3NGV A;  1C3Y A;  2P6B B;  2CCM A;  1DJI A;  1XFZ O;  1FBV A;  4DIR A;  1NWD A;  2QEH A;  2OTG B;  3GK2 A;  3KF9 A;  4KYN A;  4MZK A;  3M0W A;  1HT9 A;  4ETO A;  1S26 D;  3A4U B;  2HQ8 A;  1C07 A;  1KCY A;  1K94 A;  5K89 A;  2QEO A;  2KFG A;  1RK9 A;  2JNF A;  1L2O B;  1QVI Z;  2KPH A;  5PAL A;  1B1G A;  2FCE A;  3CR4 X;  1PUL A;  2MA2 A;  1NCZ A;  3SG4 A;  3SIA A;  1YVL A;  3C1V A;  1AP4 A;  3CLN A;  3FS7 A;  2ZNE A;  4ORA B;  2BNX A;  1KFU S;  2HET A;  1KFX L;  2F2O A;  2HPS A;  1TWO A;  1UUR A;  3I5H B;  3S0A A;  2K2F A;  1AJ5 A;  1B8R A;  2JT3 A;  2QAC A;  4GNK B;  4QJ3 B;  2LC5 A;  1J1E A;  1BJF A;  1SYM A;  3H4S E;  4M2O A;  4PHJ A;  3D10 A;  1XA5 A;  2CT9 A;  1MR8 A;  3EVU A;  5B8I B;  1B8L A;  1JF2 A;  1OOF A;  1QV1 A;  1KK8 B;  1PK0 D;  3DY9 A;  5I94 A;  1XK4 A;  5CSF A;  1EG3 A;  4ZCU A;  1REC A;  1F8H A;  2L51 A;  1FPW A;  1ALV A;  1DTL A;  1TN4 A;  1TUZ A;  3L4A A;  1JFJ A;  1G4Y R;  1TCF A;  3PJI A;  3S0E A;  2KI6 D;  2F3Z A;  4C0K A;  1BR4 B;  1C3Z A;  2BCB A;  4M2P A;  2P71 A;  2LMV A;  4CID A;  1JFK A;  1WRL A;  3BQ3 A;  3BUN B;  4YRU A;  2H8V A;  1DJX A;  4PE7 A;  1OOJ A;  1P28 A;  1TCO B;  3EK8 A;  2PSR A;  1IJ6 A;  1GGZ A;  1SNL A;  1ODB A;  2L98 A;  2L5X B;  4XYN A;  1CTR A;  3RZS A;  2F33 A;  3B88 A;  4MVF A;  2M9G A;  2WC8 A;  3SG2 A;  1QJT A;  3KHE A;  1RFJ A;  2KYF A;  2AMI A;  1YVH A;  4MRX A;  1SCM C;  3CZT X;  1CLL A;  5HKZ A;  1KFX S;  1BT6 A;  2KDH A;  3D74 A;  3IQQ A;  3SS4 A;  5JJG A;  4F7F A;  1MXE A;  2PMY A;  4MZL A;  1NCX A;  1OOH A;  3V2L A;  3BOW A;  1CDP A;  1XFY O;  2KI4 B;  2MJW B;  3BOW B;  3WHU B;  4UPG A;  2OS8 B;  1S6J A;  1E8A A;  1XO5 A;  2KHN A;  4MBE A;  4CFR A;  1NX1 A;  1XFR A;  3PAT A;  4GGN A;  2KNE A;  2LLT A;  3PN7 B;  3R1P A;  2NXQ A;  3K1E A;  2WCB A;  1IKU A;  1J7R A;  3DZT A;  2LVJ A;  1LA0 A;  2K7D A;  3BUO B;  1KQM B;  3D0Y B;  4OR9 B;  5I8N A;  1JBA A;  2JRF A;  3WNX B;  2WOS A;  2AAO A;  1Z2C B;  5GQQ C;  2JTZ A;  1QIW A;  1OZO A;  4PCW A;  4C0L A;  2L5Y A;  2E6W A;  4TNC A;  3D78 A;  3BYA A;  1CLB A;  5AEQ A;  2NZ0 A;  2ZRS A;  2JT0 A;  3JTD B;  1JSA A;  2BBM A;  1XFW O;  3DVJ A;  4FQO A;  4ZCV A;  3JVT C;  2M1K B;  4NQG A;  5G08 A;  1AHR A;  2LE9 B;  1JF0 A;  4U8D A;  3PM8 A;  1BMO A;  1XFV O;  2LUX A;  2KLD A;  1OMR A;  3AKA A;  4USL A;  2EHB A;  3FWC A;  2EC6 C;  2WCF A;  2MAZ A;  1TRF A;  1H8B A;  1B8C A;  1PRW A;  4OV2 A;  1QTX A;  3A8R A;  3TDI A;  2L2E A;  5D7F A;  1DC1 A;  1KSO A;  2K2A A;  4MN0 A;  1M63 B;  2LLS A;  2JT8 A;  3QME A;  4XJK A;  4N1G A;  3SG5 A;  2NLN A;  3NHT A;  2PYQ A;  2WND A;  1DJZ A;  4XJK B;  1XVJ A;  1HQV A;  1OOG A;  1SK6 D;  4GGF C;  2BCX A;  1DGV A;  1PSR A;  2F2P A;  1NCY A;  5KU1 A;  1CFD A;  1BU3 A;  2K0J A;  1SR6 C;  2OPO A;  4JKT A;  3PAL A;  3S0D A;  3S0B A;  1RRO A;  1QX5 B;  4GFT A;  4E68 A;  1BLQ A;  1FI5 A;  1W7I B;  1S5G Y;  2M97 A;  1UHH A;  2Y1N A;  1CM4 A;  1J1D A;  3KPX A;  3DVK A;  2FJU B;  3ZNI A;  1DMO A;  1PSB A;  1YX8 A;  2ZND A;  2Q91 A;  3DVE A;  1SPY A;  3D77 A;  3I5I B;  3O4X A;  2PAS A;  4PHN A;  3I5G C;  2WCH A;  2LHI A;  3OX6 A;  5CSN A;  3TUY B;  1BOD A;  1TOP A;  2Y5I A;  2MRD A;  2V53 A;  4PAL A;  3NSI A;  1DT7 B;  1S6C A;  1SL8 A;  2JPT A;  2L4I A;  2LAN A;  4FQT A;  1K90 D;  2M49 B;  3SIB A;  4ICB A;  2KQY A;  1CFF A;  5HKW A;  1BOC A;  1SCV A;  2K8M B;  3CDN A;  3DYE A;  4WQ2 A;  1NP8 A;  1NYA A;  1LKJ A;  5D3O A;  3FWB A;  2BL0 C;  2M7N A;  3TDZ A;  3VRN A;  1L7Z A;  1BR1 B;  2B1U A;  2G9B A;  1RJV A;  3LL8 B;  3S0G A;  4DCK A;  1JWD A;  2K61 A;  1YRU B;  3BUM B;  3I5F C;  1MXL C;  1QAS A;  1J55 A;  4R1E A;  2D8N A;  3LK0 A;  1YX7 A;  1XFU O;  3BFA A;  4I5J A;  2NCP A;  1YUS A;  1RWY A;  1M39 A;  3AKB A;  3D76 A;  4QJ5 B;  3GK1 A;  1KK7 Y;  1K2H A;  1TNP A;  1ZFS A;  2HF5 A;  1NX3 A;  3BUX B;  3WXA A;  4GAO A;  2Q4U A;  1DJG A;  1KWO C;  5HLO A;  2LLU A;  1R6P A;  1Y1X A;  3MSE B;  1DEL A;  1K9P A;  2ZRT A;  4AQI A;  1F54 A;  2M0R A;  1A29 A;  3CZ0 A;  1Y1A A;  1AUI B;  4AOM A;  4CFQ A;  1S5G Z;  2QEV A;  2ZFD A;  3Q8I A;  5FI2 A;  1BG1 A;  1CNP A;  2OTG C;  1DGU A;  5KTY A;  1CKK A;  3IF7 A;  3SG7 A;  2H61 A;  1PVA A;  2A4J A;  5CPV A;  1JUO A;  4BY5 A;  4JQ0 D;  4NDD A;  1DEK A;  5AER A;  1ALW A;  1WDC B;  2O60 A;  3K21 A;  5DKQ A;  1L2O C;  3TS5 B;  3TZ1 A;  1UHK A;  1SMG A;  1EJ3 A;  2GV5 A;  2KSP A;  2PVB A;  4L9M A;  2ISD A;  4I5L B;  3VRO A;  3EK4 A;  3FE9 A;  3I5H C;  4MLW A;  2K7B A;  4IL1 A;  5BPJ A;  4IJ7 A;  5HL1 A;  1SSE B;  4GPL B;  2VRG A;  3HX4 A;  4M2Q A;  1SW8 A;  1CDN A;  4N1F A;  3NHI A;  4WRI A;  1A2X A;  3QRX A;  4MEW A;  1SL9 A;  2P70 A;  3B7A A;  1MHO A;  4ORC B;  1XFX O;  4HSZ A;  4BY4 A;  1KQV A;  1KK8 C;  3PFV A;  1UHJ A;  1BF5 A;  5I2O A;  1UP5 A;  2CBL A;  3SJS A;  3CWG A;  1DQE A;  1WLM A;  1KK7 Z;  1XK4 C;  3BFB A;  1IRJ A;  3VRR A;  4JWQ A;  2I7A A;  1NIW A;  3B86 A;  4I5N B;  5HLV A;  1J7O A;  1OMD A;  2BCA A;  2JOJ A;  1IGV A;  1MUX A;  1CLM A;  3KEV A;  1Q80 A;  3CGA A;  4C0J A;  3KO0 A;  2EGD A;  2PRU A;  1K8U A;  3DD4 A;  1YUT A;  3VRQ A;  2KOT A;  1QX7 A;  1OMV A;  1UWO A;  1ZMZ A;  3NSO A;  5FI7 A;  3SS3 A;  2F3Y A;  1MWN A;  3OHM B;  1SRA A;  5TNC A;  1A03 A;  1Y6W A;  1IH0 A;  1NUB A;  1SY9 A;  2KGB C;  3CYZ A;  1FW4 A;  1DJY A;  3E3R A;  4PE0 A;  1GQM A;  2LHL A;  2JQ6 A;  2LVI A; 
#chains in the Genus database with same CATH homology
 2JUL A;  2MHH A;  1F4O A;  4N5X A;  5ER4 X;  1UUS A;  2BKI B;  5KSZ A;  1IQ3 A;  4PDZ A;  1A4P A;  1S36 A;  2I94 A;  1G33 A;  1CB1 A;  1B7T Y;  2KI4 C;  2OS8 C;  1OQP A;  2JTT A;  3CS1 A;  1M31 A;  1TTX A;  2GGZ A;  2ZN9 A;  1PAL A;  3CR2 A;  1DF0 A;  2RGI A;  3PN7 C;  4HRE E;  2G2B A;  1DF0 B;  1LVC D;  3GOF A;  1QLK A;  2DOQ A;  1SL7 A;  2E30 A;  1KQM C;  5I2Q A;  1R2U A;  3EKJ A;  1M46 A;  4GUK A;  1KSM A;  1K9U A;  1YRT B;  3EK7 A;  3O6B A;  2NCO A;  2KAV A;  3AAK A;  1CDM A;  2WCE A;  3EVV A;  2CXJ A;  1F70 A;  3DF0 A;  2IS9 A;  3JTD C;  2LVV A;  3OP0 A;  3DF0 B;  5HYD A;  1EH2 A;  3OB1 B;  5HKY A;  2LNK A;  4CLN A;  2L4H A;  1M45 A;  1NX2 A;  1N65 A;  2FCD A;  3OX5 A;  3SG3 A;  4PE1 A;  5AFP A;  3DVM A;  1YR5 A;  2CNP A;  3SG6 A;  3VGO A;  2LP2 A;  5FYX A;  4PHM A;  1CM1 A;  1SCM B;  1K9K A;  3BXK A;  1RTP 1;  1U5I A;  1IG5 A;  2L50 A;  1F71 A;  2LVK A;  1U5I B;  2H2K A;  2AUC A;  4I5K A;  1G8I A;  2KI6 C;  3LK1 A;  1K93 D;  2MLF C;  1LXF C;  1QLS A;  1B47 A;  4A4C A;  2BBN A;  3PLF B;  2I2R E;  3BUW B;  1J7P A;  2M7L A;  5D69 A;  1VRK A;  2GGM A;  1B7T Z;  5CSI A;  2JWW A;  1XYD A;  2BEC A;  1K96 A;  5ER5 A;  1CMG A;  1QAT A;  1FF1 A;  1N0Y A;  2I18 A;  2M3W A;  1LIN A;  2BE6 A;  4FTG A;  4PHK A;  2SCP A;  3AAJ A;  1EG4 A;  1UHI A;  1F55 A;  1CFP A;  3LLE A;  2KBI A;  3I5I C;  4DRW A;  1B9A A;  3TUY C;  2JZI A;  2FOT A;  1QS7 A;  4NDC A;  3IQO A;  2BKH B;  2KBM A;  1NSH A;  4Q04 A;  5IBW A;  1K95 A;  1YTZ C;  2MBX A;  4DUQ A;  4YGB B;  1AJ4 A;  2LV7 A;  2JNX A;  1H4B A;  3JVT B;  2LUC A;  2KYC A;  2Y4Q A;  4OKH A;  1ZUZ A;  1A75 A;  1DJW A;  1NX0 A;  5AAN A;  5DKN A;  3LCP C;  4BY5 A;  1MF8 B;  1UHN A;  2CTN A;  1V1F A;  1A75 B;  2KFH A;  5F6T A;  2EC6 B;  1TIZ A;  3NSL A;  4P5O E;  3CTN A;  4YBH B;  3O78 A;  2BE4 A;  4P2Y B;  1QX2 A;  1CFC A;  1JC2 A;  1F4Q A;  1J7Q A;  1C7W A;  1IQ5 A;  1Y0V H;  1W7J B;  3NXA A;  4GGF A;  3TDU A;  1DJH A;  1YUU A;  1CMF A;  2K7C A;  4OCI A;  1N2D A;  5AXI A;  4F0Z B;  2LMT A;  4MRY A;  1IJ5 A;  1CDL A;  1GGW A;  1S6I A;  4YGD B;  1V1G A;  2KGR A;  3WHT B;  1SR6 B;  2KFF A;  4YGA A;  4HRG A;  1IWQ A;  4ORB B;  2JC2 A;  2O5G A;  4GBA A;  3RM1 A;  5DKR A;  1QV0 A;  1NPQ A;  2KQ6 A;  1LA3 A;  3FIA A;  3HCM A;  5I2L A;  3NSK A;  2HQW A;  5J3X A;  2SAS A;  1DVI A;  3D0Y A;  2LCP A;  2JXC A;  4MSP A;  1WRK A;  3EVR A;  3ZWH A;  2JXL A;  3I5G B;  2PAL A;  1WLZ A;  4CPV A;  3O4Y A;  1C7V A;  4D1E A;  2QPT A;  3EKH A;  3VRP A;  1OSA A;  2K7O A;  1S1E A;  1QVI Y;  2M1U A;  4YGE B;  2H61 C;  1ZOT B;  1AVS A;  1SKT A;  1WDC C;  1AK8 A;  2LAP A;  2R2I A;  1ZAC A;  1GJY A;  2KAY A;  3TS5 C;  1TNX A;  2ZKM X;  3ICB A;  3F45 A;  4YGC B;  1OZS A;  1EL4 A;  3CR5 X;  1WRZ A;  4MZJ A;  4AQJ A;  4PE4 A;  1PVB A;  4HRH A;  1EXR A;  1WY9 A;  4DS7 A;  1MQ1 A;  2BL0 B;  1D1O A;  1X02 A;  1KFU L;  4YI9 A;  3I5F B;  3O2P A;  1SBJ A;  2Y1M A;  2TN4 A;  4JPZ B;  2M29 A;  5JOL A;  5CSJ A;  4YI8 A;  2COL B;  2L0P A;  3GK4 X;  1OE9 B;  4NDB A;  1TNQ A;  2F8P A;  1S3P A;  3OB2 B;  4OVN F;  2JU0 A;  1KWO B;  1QXP A;  1Y1U A;  2KAX A;  2WOR A;  2ZN8 A;  2MLE C;  3PSR A;  4QJ4 B;  1B4C A;  2LMU A;  2M8U A;  4A4B A;  1FI6 A;  2LM5 A;  1YUR A;  2LP3 A;  3RLZ A;  1TNW A;  4WQ3 A;  1QIV A;  2P6B B;  2CCM A;  1DJI A;  1XFZ O;  1FBV A;  4DIR A;  1NWD A;  2OTG B;  3GK2 A;  3KF9 A;  4MZK A;  3M0W A;  1HT9 A;  4ETO A;  1S26 D;  3A4U B;  2HQ8 A;  1C07 A;  1KCY A;  1K94 A;  5K89 A;  2KFG A;  1RK9 A;  2JNF A;  1L2O B;  1QVI Z;  5PAL A;  1B1G A;  2FCE A;  3CR4 X;  1PUL A;  2MA2 A;  1NCZ A;  3SG4 A;  3SIA A;  1YVL A;  3C1V A;  1AP4 A;  3CLN A;  3FS7 A;  2ZNE A;  4ORA B;  1KFU S;  2HET A;  1KFX L;  2F2O A;  2HPS A;  3I5H B;  1UUR A;  2K2F A;  1AJ5 A;  1B8R A;  2JT3 A;  2QAC A;  4GNK B;  4QJ3 B;  2LC5 A;  1J1E A;  1BJF A;  1SYM A;  3H4S E;  4M2O A;  4PHJ A;  3D10 A;  1XA5 A;  2CT9 A;  1MR8 A;  3EVU A;  5B8I B;  1B8L A;  1JF2 A;  1QV1 A;  1KK8 B;  1PK0 D;  1XK4 A;  5CSF A;  1EG3 A;  4ZCU A;  1REC A;  1F8H A;  2L51 A;  1FPW A;  1ALV A;  1DTL A;  1TN4 A;  1JFJ A;  1G4Y R;  1TCF A;  2KI6 D;  2F3Z A;  4C0K A;  1BR4 B;  4M2P A;  2BCB A;  2LMV A;  4CID A;  1JFK A;  1WRL A;  3BQ3 A;  3BUN B;  4YRU A;  1DJX A;  4PE7 A;  1OOJ A;  1TCO B;  3EK8 A;  2PSR A;  1IJ6 A;  1GGZ A;  1SNL A;  1ODB A;  2L98 A;  2L5X B;  4XYN A;  1CTR A;  2F33 A;  4MVF A;  2M9G A;  2WC8 A;  3SG2 A;  1QJT A;  3KHE A;  1RFJ A;  2KYF A;  2AMI A;  1YVH A;  4MRX A;  1SCM C;  3CZT X;  1CLL A;  5HKZ A;  1KFX S;  1BT6 A;  2KDH A;  3IQQ A;  5JJG A;  1MXE A;  2PMY A;  4MZL A;  1NCX A;  3BOW A;  1CDP A;  1XFY O;  2KI4 B;  2MJW B;  3BOW B;  3WHU B;  4UPG A;  2OS8 B;  1S6J A;  1E8A A;  1XO5 A;  2KHN A;  4MBE A;  4CFR A;  1NX1 A;  3PAT A;  4GGN A;  2KNE A;  2LLT A;  3PN7 B;  2NXQ A;  2WCB A;  1IKU A;  1J7R A;  2LVJ A;  1LA0 A;  2K7D A;  3BUO B;  1KQM B;  3D0Y B;  4OR9 B;  5I8N A;  1JBA A;  2JRF A;  3WNX B;  2WOS A;  2AAO A;  5GQQ C;  2JTZ A;  1QIW A;  1OZO A;  4PCW A;  4C0L A;  2E6W A;  4TNC A;  3BYA A;  1CLB A;  5AEQ A;  2NZ0 A;  2ZRS A;  2JT0 A;  3JTD B;  1JSA A;  2BBM A;  1XFW O;  3DVJ A;  4FQO A;  4ZCV A;  3JVT C;  2M1K B;  4NQG A;  5G08 A;  1AHR A;  2LE9 B;  1JF0 A;  4U8D A;  3PM8 A;  1BMO A;  1XFV O;  2LUX A;  3AKA A;  1OMR A;  4USL A;  2EHB A;  3FWC A;  2EC6 C;  2WCF A;  2MAZ A;  1TRF A;  1H8B A;  1B8C A;  1PRW A;  4OV2 A;  1QTX A;  3A8R A;  3TDI A;  2L2E A;  5D7F A;  1KSO A;  2K2A A;  4MN0 A;  1M63 B;  2LLS A;  2JT8 A;  4XJK A;  4N1G A;  3SG5 A;  2NLN A;  2WND A;  1DJZ A;  4XJK B;  1XVJ A;  1HQV A;  1SK6 D;  4GGF C;  2BCX A;  1DGV A;  1PSR A;  2F2P A;  1NCY A;  5KU1 A;  1CFD A;  1BU3 A;  2K0J A;  1SR6 C;  2OPO A;  4E68 A;  3PAL A;  1RRO A;  1QX5 B;  4GFT A;  1BLQ A;  1FI5 A;  1W7I B;  1S5G Y;  2M97 A;  1UHH A;  2Y1N A;  1CM4 A;  1J1D A;  3KPX A;  3DVK A;  2FJU B;  3ZNI A;  1DMO A;  1PSB A;  1YX8 A;  2ZND A;  2Q91 A;  3DVE A;  1SPY A;  3I5I B;  4PHN A;  2PAS A;  3I5G C;  5CSN A;  2LHI A;  3OX6 A;  3TUY B;  1BOD A;  1TOP A;  2Y5I A;  2MRD A;  2V53 A;  4PAL A;  3NSI A;  1DT7 B;  1S6C A;  1SL8 A;  2JPT A;  2L4I A;  2LAN A;  1K90 D;  2M49 B;  3SIB A;  4ICB A;  2KQY A;  1CFF A;  5HKW A;  1BOC A;  1SCV A;  2K8M B;  4WQ2 A;  1NP8 A;  1NYA A;  1LKJ A;  3FWB A;  2BL0 C;  2M7N A;  3TDZ A;  3VRN A;  1L7Z A;  1BR1 B;  2B1U A;  2G9B A;  1RJV A;  3LL8 B;  4DCK A;  1JWD A;  2K61 A;  1YRU B;  3BUM B;  3I5F C;  1MXL C;  1QAS A;  1J55 A;  4R1E A;  2D8N A;  3LK0 A;  1YX7 A;  1XFU O;  4I5J A;  2NCP A;  1YUS A;  1RWY A;  1M39 A;  3AKB A;  4QJ5 B;  3GK1 A;  1KK7 Y;  1K2H A;  1TNP A;  1ZFS A;  2HF5 A;  1NX3 A;  3BUX B;  3WXA A;  4GAO A;  2Q4U A;  1DJG A;  1KWO C;  5HLO A;  2LLU A;  1R6P A;  1Y1X A;  3MSE B;  1K9P A;  2ZRT A;  4AQI A;  1F54 A;  2M0R A;  1A29 A;  1Y1A A;  1AUI B;  4AOM A;  4CFQ A;  1S5G Z;  2ZFD A;  1BG1 A;  1CNP A;  2OTG C;  1DGU A;  5KTY A;  1CKK A;  3IF7 A;  3SG7 A;  2H61 A;  1PVA A;  2A4J A;  5CPV A;  1JUO A;  4JQ0 D;  4NDD A;  5AER A;  1ALW A;  1WDC B;  2O60 A;  3K21 A;  5DKQ A;  1L2O C;  3TS5 B;  3TZ1 A;  1UHK A;  1SMG A;  1EJ3 A;  2GV5 A;  2KSP A;  2PVB A;  4L9M A;  2ISD A;  4I5L B;  3VRO A;  3EK4 A;  3I5H C;  4MLW A;  2K7B A;  4IL1 A;  5BPJ A;  4GPL B;  2VRG A;  3HX4 A;  4M2Q A;  1SW8 A;  1CDN A;  4N1F A;  4WRI A;  1A2X A;  3QRX A;  4MEW A;  1SL9 A;  1MHO A;  4ORC B;  1XFX O;  4HSZ A;  4BY4 A;  1KQV A;  1KK8 C;  3PFV A;  1UHJ A;  1BF5 A;  5I2O A;  1UP5 A;  2CBL A;  3SJS A;  3CWG A;  1WLM A;  1KK7 Z;  1XK4 C;  1IRJ A;  3VRR A;  4JWQ A;  2I7A A;  1NIW A;  4I5N B;  5HLV A;  1J7O A;  1OMD A;  2BCA A;  2JOJ A;  1IGV A;  1MUX A;  1CLM A;  3KEV A;  1Q80 A;  3CGA A;  4C0J A;  3KO0 A;  2EGD A;  2PRU A;  1K8U A;  3DD4 A;  1YUT A;  3VRQ A;  2KOT A;  1QX7 A;  1OMV A;  1UWO A;  1ZMZ A;  3NSO A;  2F3Y A;  1MWN A;  3OHM B;  1SRA A;  5TNC A;  1A03 A;  1Y6W A;  1IH0 A;  1NUB A;  1SY9 A;  2KGB C;  1FW4 A;  1DJY A;  3E3R A;  4PE0 A;  1GQM A;  2LHL A;  2JQ6 A;  2LVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...