2LANA

Nmr structure of ca2+-bound cabp1 n-domain with rdc
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
SLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein 1
publication title 1H, 15N, and 13C chemical shift assignments for CaBP1 with 3 Ca2+ bound
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lanA00
4ZCUA 2L4IA 2K7BA 3FIAA 4BY4A 3O6BA 2K7OA 3TDUA 5AFPA 4PHJA 2OS8C 3A8RA 3LLEA 4QJ3B 2F3YA 1DF0A 2JU0A 1RROA 3KF9A 1YRTB 3OX6A 2LLSA 4ORBB 3WHTB 4GPLB 1W7IB 3WXAA 5JJGA 2M0RA 2NLNA 2CT9A 2KI6C 2O60A 3KEVA 5ER5A 1NWDA 1QVIY 1YX8A 2BKHB 2WORA 1ZACA 2E6WA 3D10A 5AEQA 2H2KA 2PRUA 1UHJA 5CSNA 3JTDC 5HKWA 2D8NA 1N0YA 2JTZA 1J1EA 1LA3A 1SL9A 4YGAA 1CDLA 2FCDA 2LV7A 3TZ1A 4C0JA 1XVJA 1RJVA 1GGZA 1YUTA 3LK1A 3LK0A 4HRHA 3TDZA 1NUBA 2LVKA 2LE9B 3PFVA 1K9UA 1IWQA 2LMVA 5TNCA 1S5GY 4MEWA 2ZNDA 3GK2A 3I5GB 4YGDB 3GK1A 4N5XA 1F55A 1QS7A 1SBJA 1U5IB 1DVIA 2BCXA 2JTTA 2M9GA 2ZRSA 1EXRA 1CM4A 4NDCA 4QJ5B 1RWYA 2F2OA 2Q4UA 2KSPA 1IRJA 2PVBA 3PN7B 2CXJA 3PM8A 3CWGA 1DJZA 2B1UA 1NX0A 1JBAA 1TOPA 1KQMB 4DRWA 1BT6A 2KNEA 1BMOA 2JRFA 2LC5A 1K95A 1LINA 1BF5A 3VRQA 4FTGA 1RECA 1PSRA 4OVNF 5HLVA 4P5OE 2KBIA 4ORCB 3BUWB 5FYXA 3F45A 3SG7A 1AJ5A 3AAKA 2FJUB 4C0KA 2EC6B 1TIZA 5JOLA 4A4CA 2KAXA 1R2UA 3CTNA 1PVAA 1CLBA 1SR6B 1OZOA 1QVIZ 4GNKB 3OX5A 3WNXB 2BECA 1K9KA 2A4JA 1OMVA 1SY9A 2H61A 2MLFC 2TN4A 2ZRTA 4R1EA 2K8MB 4WQ2A 2F3ZA 5DKNA 3EK8A 3SIBA 2DOQA 2PSRA 1F8HA 1RFJA 2KGRA 2L0PA 2QACA 1FI5A 1YVHA 2IS9A 3JTDB 4YGEB 1WLMA 2JWWA 1SRAA 2JPTA 3O78A 4JWQA 4YGBB 2AAOA 1WRZA 3NSKA 3NXAA 1TRFA 2KQ6A 3M0WA 2KAYA 1F4QA 1KSMA 2LP3A 3OP0A 5B8IB 3DD4A 1YURA 1XFVO 3GOFA 2VRGA 3IQOA 4CIDA 1S5GZ 4N1FA 1FF1A 1B4CA 2JNFA 2KAVA 4I5LB 2KQYA 3K21A 1EL4A 1FW4A 1LVCD 2MA2A 1K96A 1PVBA 5HLOA 1XFUO 2KI4C 1S6IA 1NYAA 1L2OB 1DJYA 2HQ8A 2ZN8A 5I2QA 1MUXA 1Y1UA 2WCFA 3BUMB 5AXIA 2BCBA 2JZIA 1XA5A 1A4PA 2GV5A 3HX4A 1JSAA 2R2IA 1C07A 2AMIA 1F71A 3FWCA 2KFGA 4PE4A 2LP2A 2PASA 1QLSA 3FWBA 2L50A 1IKUA 3EVVA 5BPJA 3I5IC 1KWOC 2KOTA 1Y6WA 3LCPC 1KK8C 1DJWA 4GBAA 1QIVA 2NCPA 5AERA 1MR8A 4HSZA 3DVMA 1JFJA 2BBNA 2P6BB 1BR1B 1UURA 3VROA 1TNPA 3BXKA 1NPQA 2M7LA 3AKAA 2LANA 1B9AA 2GGMA 2NXQA 3EK4A 1DJHA 1EG4A 2LAPA 1DJXA 3TS5C 2PALA 1FBVA 2BCAA 4DIRA 1QIWA 1NX2A 1M39A 4PCWA 2EHBA 4BY5A 1UHIA 1YUUA 2CCMA 2MRDA 4M2QA 1DGVA 2L4HA 3H4SE 1TCOB 1JUOA 3I5FB 1PSBA 1LXFC 4MLWA 5J3XA 1S1EA 3AAJA 4XJKA 1CMGA 1PK0D 1BLQA 3EKHA 2KI4B 2EGDA 1B8CA 4FQOA 4QJ4B 4DUQA 4D1EA 1SK6D 2RGIA 2K7CA 4MBEA 5KTYA 3VRPA 2AUCA 2I7AA 4JQ0D 2LMTA 4Q04A 1J7OA 4F0ZB 1QXPA 1JWDA 1E8AA 1BJFA 1SPYA 2I2RE 4I5KA 1J1DA 3PSRA 1CDPA 1A75B 1SCMB 2Y1NA 1GGWA 3BOWA 1QV1A 5I8NA 1IGVA 5ER4X 4M2OA 2M3WA 1F54A 1J7RA 1HQVA 3ZNIA 1YR5A 3I5IB 1QATA 3C1VA 4IL1A 4CFRA 5CSFA 4PALA 1BG1A 1CFDA 1SCVA 1UWOA 2KYCA 1AP4A 1K94A 4GGNA 2JT3A 1JF0A 2LNKA 4MRYA 3O4YA 1QASA 1ZOTB 3CLNA 3NSIA 2JOJA 5HKYA 2SCPA 1G8IA 2L5XB 1C7WA 2ZNEA 1A29A 5CSJA 4NDDA 3ICBA 2CBLA 1SYMA 1XYDA 1YRUB 2OS8B 1N65A 4OR9B 3TS5B 1M31A 2E30A 4USLA 1BR4B 1YUSA 1TNQA 1DTLA 4OKHA 1TTXA 2LVJA 1V1GA 2JT8A 3CS1A 4WQ3A 2FOTA 1JC2A 3D0YB 2KFFA 3E3RA 4GUKA 2LLTA 5HYDA 1KFXS 1NX3A 2HQWA 1KFUS 2G2BA 2K61A 1MHOA 3GK4X 1QX7A 1MXEA 1B1GA 2LMUA 1OZSA 3CR2A 1DF0B 4XYNA 1CFCA 1XFXO 2HF5A 1ALWA 1DJGA 3KO0A 1XO5A 3ZWHA 4A4BA 1CTRA 1IG5A 5CSIA 4XJKB 2M1KB 2K7DA 1C7VA 4DS7A 4MZLA 1OOJA 3TUYC 5G08A 1DT7B 1M46A 3A4UB 4ETOA 4CLNA 1ZUZA 3O2PA 2LVVA 3WHUB 1B8LA 1DMOA 1DGUA 1S6CA 2L51A 2V53A 1KSOA 4P2YB 1OSAA 3BOWB 4YI9A 1QTXA 1CFFA 2MLEC 1K93D 1LKJA 2SASA 1TN4A 2F33A 3NSLA 4ZCVA 1NX1A 1VRKA 2Y5IA 1QJTA 1WRLA 1YTZC 1S36A 2KGBC 1AHRA 1AJ4A 1K90D 2L98A 1J7PA 2OTGC 1AUIB 1CB1A 1J7QA 3I5HC 4WRIA 2MAZA 3CR4X 3IQQA 5HKZA 1NCZA 1MF8B 3VGOA 1QV0A 3EVRA 1TNXA 2L2EA 1YVLA 3PLFB 1KQVA 1S3PA 2Y1MA 4MVFA 1PRWA 4N1GA 2M29A 2M7NA 5D69A 1CKKA 5KU1A 4YBHB 3SG5A 5GQQC 1SKTA 1M63B 2BKIB 4YGCB 2BL0C 1CDNA 1A2XA 2M49B 1BU3A 1NSHA 1FI6A 4CFQA 1UHNA 2K2AA 2G9BA 3SG6A 1ALVA 1HT9A 3DF0A 1KCYA 4PHMA 1BODA 4NDBA 4MZKA 1N2DA 2LVIA 3I5GC 3TUYB 1M45A 1K2HA 1CNPA 4TNCA 1EG3A 1B47A 1XK4C 1QX2A 4GAOA 2I94A 5CPVA 2O5GA 1OMDA 5D7FA 1A03A 3EKJA 2Q91A 1B7TY 3PN7C 3AKBA 1KQMC 1TCFA 2COLB 2KYFA 1LA0A 1JFKA 3JVTC 3OB1B 1CMFA 1CDMA 1EJ3A 3CR5X 2K0JA 1B8RA 2MJWB 2WC8A 2EC6C 5IBWA 4AQJA 2LM5A 2BBMA 3DVKA 1TNWA 2LLUA 2OTGB 1SR6C 3CGAA 1KK7Y 2JNXA 1MWNA 1SL8A 3I5HB 1SNLA 4AOMA 1SMGA 1KWOB 1RK9A 2CNPA 2OPOA 3BYAA 3HCMA 4PE1A 1QX5B 1KK8B 1XFYO 1K8UA 2KFHA 2M1UA 1MXLC 3SG2A 3SG3A 4DCKA 4YRUA 1NIWA 3PALA 1XFWO 1IH0A 1AVSA 1ZFSA 2M8UA 1L7ZA 2BL0B 1OMRA 1WRKA 1JF2A 3KHEA 4U8DA 1F4OA 3PATA 1WDCC 1Q80A 1BOCA 3QRXA 4NQGA 1S6JA 2JULA 5F6TA 3FS7A 2JC2A 4HRGA 1MQ1A 2ZN9A 1L2OC 2I18A 4PHKA 2BE6A 4PE0A 3BUXB 1B7TZ 1GJYA 3BQ3A 2JQ6A 2KDHA 3DF0B 1NP8A 1FPWA 1CM1A 2K2FA 2F2PA 3SJSA 2ZFDA 1EH2A 3JVTB 2HETA 1R6PA 2HPSA 2JXLA 2JXCA 4GGFA 1UP5A 1PALA 3SG4A 2LHLA 3VRNA 3SIAA 5I2LA 1KK7Z 1ODBA 2MHHA 1V1FA 4I5NB 1WY9A 4UPGA 4MSPA 1UHHA 4OCIA 1PULA 5I2OA 4L9MA 1SW8A 1WLZA 2PMYA 3EK7A 4GGFC 4PHNA 2KHNA 3RM1A 4JPZB 1KFXL 2MBXA 1KFUL 1D1OA 4PDZA 1CLLA 5PALA 5DKQA 1UHKA 1DJIA 3CZTX 2ISDA 4ICBA 5KSZA 1F70A 1H8BA 2BE4A 2WNDA 2H61C 1IQ5A 1OE9B 1Y1XA 2Y4QA 4MZJA 3DVJA 1WDCB 2FCEA 1CFPA 1RTP1 3I5FC 2F8PA 1K9PA 4I5JA 1GQMA 1UUSA 1SL7A 2JT0A 4GFTA 1A75A 2LUXA 3KPXA 1YX7A 1NCXA 5AANA 2ZKMX 3OB2B 1IQ3A 1ZMZA 3DVEA 4MN0A 4YI8A 4E68A 3MSEB 2GGZA 1AK8A 1W7JB 2WCBA 2KBMA 3NSOA 2M97A 1U5IA 1H4BA 2WCEA 1IJ6A 1J55A 1SCMC 2NZ0A 1S26D 1CLMA 4CPVA 1X02A 1XK4A 1Y0VH 1QLKA 3BUOB 2WOSA 5DKRA 3OHMB 1NCYA 3VRRA 4MRXA 3TDIA 4C0LA 2LHIA 2KI6D 2NCOA 4AQIA 3BUNB 5K89A 1IJ5A 1G33A 4ORAB 1G4YR 2LUCA 4HREE 3IF7A 3RLZA 3LL8B 1Y1AA 1OQPA 2LCPA 2CTNA 3D0YA 2QPTA 3EVUA 4PE7A 1XFZO 4M2PA 4OV2A
chains in the Genus database with same CATH superfamily
3QMEA 2L4IA 2K7BA 3FIAA 4ZCUA 1OOHA 4BY4A 3O6BA 2K7OA 3EG5B 3TDUA 3DY9A 2QEBA 5AFPA 4PHJA 2OS8C 3A8RA 3LLEA 4QJ3B 2F3YA 1DF0A 2JU0A 1RROA 3KF9A 1YRTB 3OX6A 2LLSA 4ORBB 3WHTB 4GPLB 3CYZA 1LS8A 1W7IB 3R1PA 3WXAA 5JJGA 2M0RA 2NLNA 2CT9A 2P70A 2KI6C 2O60A 3KEVA 5ER5A 1NWDA 1QWVA 1QVIY 1YX8A 2BKHB 2WORA 1ZACA 2E6WA 3D10A 5AEQA 3SS3A 2H2KA 2PRUA 1UHJA 5CSNA 3JTDC 5HKWA 2D8NA 1N0YA 2JTZA 1J1EA 1LA3A 1SL9A 4YGAA 1CDLA 2FCDA 2LV7A 3TZ1A 4C0JA 1OW4A 1XVJA 1RJVA 1GGZA 1YUTA 3LK1A 3UO9A 3LK0A 4HRHA 3TDZA 3L4LA 1NUBA 2LVKA 2LE9B 3PFVA 1K9UA 1IWQA 2LMVA 5TNCA 1S5GY 1TUJA 4MEWA 2ZNDA 2JPOA 1Z2CB 3GK2A 3I5GB 4YGDB 3GK1A 4N5XA 1F55A 1QS7A 1SBJA 1U5IB 1DVIA 2BCXA 2JTTA 2M9GA 2ZRSA 1EXRA 1CM4A 3D74A 4NDCA 4QJ5B 1RWYA 2F2OA 1TWOA 2KPHA 2Q4UA 3BFHA 2KSPA 1IRJA 2PVBA 3PN7B 2CXJA 3PM8A 3CWGA 1DJZA 2B1UA 1NX0A 1JBAA 1TOPA 1KQMB 4DRWA 1BT6A 2KNEA 1BMOA 2JRFA 2LC5A 1K95A 1LINA 1BF5A 3VRQA 4FTGA 1RECA 1PSRA 4OVNF 5HLVA 5I94A 3S0FA 4P5OE 2KBIA 2WCKA 4ORCB 3BUWB 3CDNA 5FYXA 3S0AA 3F45A 3SG7A 1AJ5A 3AAKA 3SS4A 2FJUB 4C0KA 2EC6B 1TIZA 5JOLA 4A4CA 2KAXA 1R2UA 3CTNA 1PVAA 1CLBA 1SR6B 1OZOA 1QVIZ 4GNKB 3OX5A 3WNXB 2BECA 1K9KA 2A4JA 1OMVA 1SY9A 2H61A 2MLFC 2TN4A 2ZRTA 4R1EA 2K8MB 4WQ2A 2F3ZA 5DKNA 3BFBA 3EK8A 2DOQA 2PSRA 3SIBA 1F8HA 1RFJA 1T14A 2KGRA 2L0PA 2QACA 1FI5A 1YVHA 2IS9A 3JTDB 4YGEB 1WLMA 2JWWA 1SRAA 2JPTA 3K1EA 3O78A 4JWQA 4YGBB 2AAOA 1WRZA 3NSKA 3NXAA 1TRFA 2KQ6A 3M0WA 2KAYA 1F4QA 3DXLA 1KSMA 2LP3A 3OP0A 5B8IB 3DD4A 1YURA 1XFVO 3GOFA 2VRGA 3IQOA 4CIDA 1S5GZ 4N1FA 1FF1A 1B4CA 2JNFA 2KAVA 3N7HA 2KQYA 4I5LB 3K21A 1EL4A 1FW4A 1LVCD 2H8VA 1K96A 1PVBA 2MA2A 5HLOA 1XFUO 3V2LA 2KI4C 1S6IA 1NYAA 1L2OB 1DJYA 2HQ8A 2ZN8A 5I2QA 1Y1UA 1MUXA 2WCFA 3BUMB 3D77A 5AXIA 3BJHA 2BCBA 2JZIA 1XA5A 1A4PA 2GV5A 3HX4A 1JSAA 3FE8A 2R2IA 1C07A 2AMIA 1F71A 3FWCA 2KFGA 4PE4A 2LP2A 2PASA 1QLSA 3FWBA 3FE9A 2L50A 2YGUA 3EVVA 5BPJA 1IKUA 3R72A 3I5IC 1KWOC 3UNWA 2KOTA 1Y6WA 5EL2A 3LCPC 1KK8C 1DJWA 2WCHA 2WCMA 1QIVA 2NCPA 4GBAA 5AERA 1MR8A 4HSZA 3DVMA 1JFJA 2BBNA 3S0BA 2P6BB 3B87A 4KYNA 1BR1B 1UURA 3VROA 1TNPA 3BXKA 1NPQA 2M7LA 3AKAA 3B88A 2LANA 2WC6A 1B9AA 2GGMA 2NXQA 3EK4A 1DJHA 1EG4A 2LAPA 1DJXA 3TS5C 2PALA 1FBVA 2BCAA 5FI6A 4DIRA 1QIWA 1NX2A 1M39A 4PCWA 2EHBA 5FI2A 4BY5A 1UHIA 1YUUA 1W9ZA 2CCMA 2MRDA 4M2QA 1DGVA 2FJYA 2L4HA 3H4SE 1TCOB 1JUOA 3I5FB 1PSBA 1LXFC 4MLWA 5J3XA 1S1EA 3AAJA 4XJKA 1CMGA 1PK0D 1BLQA 3EKHA 2KI4B 2EGDA 1B8CA 4FQOA 4QJ4B 4DUQA 4D1EA 1SK6D 2RGIA 2K7CA 4MBEA 5KTYA 3VRPA 2AUCA 2I7AA 1OOGA 2LMTA 2WCJA 4JQ0D 4Q04A 3D73A 4F0ZB 1QXPA 1J7OA 1JWDA 1E8AA 1BJFA 1SPYA 2I2RE 2QEHA 4I5KA 1J1DA 3PSRA 1CDPA 1A75B 1SCMB 2Y1NA 1GGWA 2BNXA 1QV1A 3BOWA 1IGVA 5I8NA 5ER4X 4M2OA 2M3WA 1F54A 1J7RA 1HQVA 3ZNIA 1YR5A 3I5IB 1QATA 3C1VA 4IL1A 4CFRA 5CSFA 4PALA 1BG1A 1CFDA 1SCVA 1UWOA 2KYCA 3D76A 1K94A 1AP4A 4GGNA 4JD9A 4INXA 2JT3A 1JF0A 2LNKA 4MRYA 3O4YA 1QASA 1ZOTB 3CLNA 3NSIA 2JOJA 3RZSA 5HKYA 2SCPA 1G8IA 2L5XB 1C7WA 3CZ1A 2ZNEA 1A29A 5CSJA 4NDDA 3ICBA 2CBLA 1SYMA 1XYDA 1YRUB 2OS8B 1N65A 4OR9B 3Q8IA 3TS5B 1M31A 2E30A 3PM2A 1BR4B 1YUSA 1TNQA 1DTLA 4OKHA 4USLA 1TTXA 2LVJA 1V1GA 2JT8A 3CS1A 4WQ3A 2FOTA 1JC2A 3D0YB 2KFFA 3E3RA 4GUKA 2LLTA 5HYDA 3L47A 1KFXS 1NX3A 2HQWA 1KFUS 3CABA 2G2BA 2K61A 1MHOA 3GK4X 1QX7A 1MXEA 1B1GA 2LMUA 1OZSA 3CR2A 1DF0B 4XYNA 2PYQA 1DEKA 1CFCA 1XFXO 2HF5A 1ALWA 1DJGA 1OOFA 3KO0A 1XO5A 3ZWHA 4A4BA 1DELA 1CTRA 2QDIA 1IG5A 3OBVA 5CSIA 4XJKB 2M1KB 3S0EA 2K7DA 3BFAA 1C7VA 1GM0A 4DS7A 4FQTA 1OOJA 4MZLA 5G08A 3TUYC 1DT7B 1M46A 3A4UB 4ETOA 1IIOA 4CLNA 3CZ2A 1ZUZA 3O2PA 2LVVA 3B7AA 3WHUB 1B8LA 2L5YA 4IJ7A 1DMOA 1DGUA 1S6CA 2L51A 2ERBA 2V53A 1KSOA 2WCLA 4P2YB 3B6XA 1OSAA 3NGVA 3BOWB 4YI9A 1QTXA 1CFFA 2MLEC 1K93D 1LKJA 2SASA 1TN4A 2F33A 3NSLA 4ZCVA 1NX1A 1VRKA 2Y5IA 1QJTA 1WRLA 1YTZC 1S36A 2KGBC 1AHRA 1AJ4A 1K90D 3NHTA 2L98A 1J7PA 2OTGC 1AUIB 1CB1A 1J7QA 3I5HC 4WRIA 2MAZA 3CR4X 3IQQA 5HKZA 1NCZA 3FE6A 1MF8B 3VGOA 1DC1A 3OGNA 1QV0A 3EVRA 1TNXA 2L2EA 1YVLA 3PLFB 1KQVA 1S3PA 2Y1MA 4MVFA 1PRWA 4N1GA 2M29A 2M7NA 5D69A 1CKKA 5KU1A 4YBHB 3SG5A 5GQQC 1SKTA 1M63B 2BKIB 4YGCB 2BL0C 3O4XA 5DICA 1CDNA 5HL1A 1A2XA 2M49B 1BU3A 1NSHA 1FI6A 4CFQA 1UHNA 2K2AA 2G9BA 3CZ0A 3SG6A 1ALVA 1HT9A 3DF0A 1C3YA 1KCYA 4PHMA 1BODA 1Z4HA 3D78A 4NDBA 4MZKA 1N2DA 4OZDA 2LVIA 3I5GC 3TUYB 1M45A 1K2HA 1CNPA 4TNCA 1EG3A 1B47A 1XK4C 1QX2A 2QEVA 2I94A 4GAOA 2O5GA 5CPVA 1OMDA 5D7FA 1A03A 3EKJA 2Q91A 1B7TY 3PN7C 3AKBA 1KQMC 1TCFA 2COLB 2KYFA 1LA0A 1JFKA 3JVTC 5FI7A 3OB1B 1CMFA 1CDMA 1EJ3A 3CR5X 1DQEA 2K0JA 1B8RA 2MJWB 2WC8A 2EC6C 5IBWA 4AQJA 2LM5A 2BBMA 3DVKA 1TNWA 2LLUA 2OTGB 1SR6C 3CGAA 1KK7Y 2JNXA 1MWNA 1OOIX 1SL8A 3I5HB 1SNLA 3S0GA 4AOMA 1SMGA 1KWOB 1RK9A 2CNPA 2OPOA 3BYAA 3HCMA 4PE1A 1QX5B 1KK8B 1XFYO 1C3ZA 4PT1A 1K8UA 2KFHA 2M1UA 1MXLC 3SG2A 3SG3A 4DCKA 4YRUA 1NIWA 3PALA 1XFWO 1IH0A 1AVSA 1ZFSA 2M8UA 1L7ZA 2BL0B 2WC5A 3NHIA 3SS5A 1OMRA 1WRKA 1JF2A 3KHEA 4U8DA 3B86A 1F4OA 3PATA 1WDCC 1Q80A 3R1VA 1BOCA 3QRXA 4NQGA 1S6JA 2JULA 5F6TA 2BAPA 3FS7A 2JC2A 4HRGA 1MQ1A 2ZN9A 1L2OC 2I18A 4PHKA 2BE6A 3D75A 4PE0A 3BUXB 1B7TZ 1GJYA 3BQ3A 2JQ6A 2K60A 2KDHA 3DF0B 1SSEB 1NP8A 1FPWA 1CM1A 2K2FA 2KLDA 2F2PA 1P28A 3SJSA 2ZFDA 1EH2A 4JKTA 3JVTB 2QEOA 2HETA 1R6PA 3S0DA 2HPSA 2JXLA 4F7FA 2JXCA 4GGFA 1UP5A 1PALA 3SG4A 2LHLA 3VRNA 3SIAA 5I2LA 1KK7Z 1ODBA 2MHHA 1V1FA 4I5NB 1WY9A 4UPGA 4MSPA 1UHHA 4OCIA 1PULA 5I2OA 4L9MA 1SW8A 1WLZA 2PMYA 3R1OA 3EK7A 4GGFC 4PHNA 2KHNA 3RM1A 3IVTA 3DYEA 4JPZB 1KFXL 2MBXA 1KFUL 1TUZA 1D1OA 4PDZA 1CLLA 5PALA 5DKQA 1UHKA 1DJIA 3CZTX 2ISDA 3VB1A 4ICBA 5KSZA 1F70A 1H8BA 2BE4A 2WNDA 2H61C 1IQ5A 1OE9B 1Y1XA 2Y4QA 4MZJA 2KLEA 1WDCB 2FCEA 3DVJA 1CFPA 1RTP1 3I5FC 4INWA 3L4AA 2F8PA 1K9PA 4I5JA 1GQMA 1UUSA 1SL7A 2JT0A 4GFTA 1A75A 2LUXA 3KPXA 1YX7A 1NCXA 5AANA 2ZKMX 3OB2B 1IQ3A 1ZMZA 2PQLA 3DVEA 4MN0A 4YI8A 4E68A 3MSEB 3DZTA 2GGZA 1AK8A 1W7JB 5D3OA 2WCBA 2KBMA 3NSOA 2M97A 1U5IA 1H4BA 2WCEA 1IJ6A 1J55A 1SCMC 2NZ0A 1S26D 1CLMA 4CPVA 1X02A 1XK4A 1Y0VH 1QLKA 3BUOB 2WOSA 5DKRA 3OHMB 1NCYA 3VRRA 4MRXA 2GTEA 3TDIA 4C0LA 2LHIA 2KI6D 2NCOA 2L2CA 3PJIA 1XFRA 4AQIA 3BUNB 5K89A 1IJ5A 1G33A 4ORAB 1G4YR 2LUCA 2P71A 4HREE 1ORGA 3IF7A 3RLZA 3LL8B 1Y1AA 1OQPA 2LCPA 2CTNA 3D0YA 2QPTA 3EVUA 4PE7A 1XFZO 4M2PA 4OV2A
chains in the Genus database with same CATH topology
4ZCUA 2L4IA 2K7BA 3FIAA 4BY4A 3O6BA 2K7OA 3TDUA 5AFPA 4PHJA 2OS8C 3A8RA 3LLEA 4QJ3B 2F3YA 1DF0A 2JU0A 1RROA 3KF9A 1YRTB 3OX6A 2LLSA 4ORBB 3WHTB 4GPLB 1W7IB 3WXAA 5JJGA 2M0RA 2NLNA 2CT9A 2KI6C 2O60A 3KEVA 5ER5A 1NWDA 1QVIY 1YX8A 2BKHB 2WORA 1ZACA 2E6WA 3D10A 5AEQA 2H2KA 2PRUA 1UHJA 5CSNA 3JTDC 5HKWA 2D8NA 1N0YA 2JTZA 1J1EA 1LA3A 1SL9A 4YGAA 1CDLA 2FCDA 2LV7A 3TZ1A 4C0JA 1XVJA 1RJVA 1GGZA 1YUTA 3LK1A 3LK0A 4HRHA 3TDZA 1NUBA 2LVKA 2LE9B 3PFVA 1K9UA 1IWQA 2LMVA 5TNCA 1S5GY 4MEWA 2ZNDA 3GK2A 3I5GB 4YGDB 3GK1A 4N5XA 1F55A 1QS7A 1SBJA 1U5IB 1DVIA 2BCXA 2JTTA 2M9GA 2ZRSA 1EXRA 1CM4A 4NDCA 4QJ5B 1RWYA 2F2OA 2Q4UA 2KSPA 1IRJA 2PVBA 3PN7B 2CXJA 3PM8A 3CWGA 1DJZA 2B1UA 1NX0A 1JBAA 1TOPA 1KQMB 4DRWA 1BT6A 2KNEA 1BMOA 2JRFA 2LC5A 1K95A 1LINA 1BF5A 3VRQA 4FTGA 1RECA 1PSRA 4OVNF 5HLVA 4P5OE 2KBIA 4ORCB 3BUWB 5FYXA 3F45A 3SG7A 1AJ5A 3AAKA 2FJUB 4C0KA 2EC6B 1TIZA 5JOLA 4A4CA 2KAXA 1R2UA 3CTNA 1PVAA 1CLBA 1SR6B 1OZOA 1QVIZ 4GNKB 3OX5A 3WNXB 2BECA 1K9KA 2A4JA 1OMVA 1SY9A 2H61A 2MLFC 2TN4A 2ZRTA 4R1EA 2K8MB 4WQ2A 2F3ZA 5DKNA 3EK8A 3SIBA 2DOQA 2PSRA 1F8HA 1RFJA 2KGRA 2L0PA 2QACA 1FI5A 1YVHA 2IS9A 3JTDB 4YGEB 1WLMA 2JWWA 1SRAA 2JPTA 3O78A 4JWQA 4YGBB 2AAOA 1WRZA 3NSKA 3NXAA 1TRFA 2KQ6A 3M0WA 2KAYA 1F4QA 1KSMA 2LP3A 3OP0A 5B8IB 3DD4A 1YURA 1XFVO 3GOFA 2VRGA 3IQOA 4CIDA 1S5GZ 4N1FA 1FF1A 1B4CA 2JNFA 2KAVA 4I5LB 2KQYA 3K21A 1EL4A 1FW4A 1LVCD 2MA2A 1K96A 1PVBA 5HLOA 1XFUO 2KI4C 1S6IA 1NYAA 1L2OB 1DJYA 2HQ8A 2ZN8A 5I2QA 1MUXA 1Y1UA 2WCFA 3BUMB 5AXIA 2BCBA 2JZIA 1XA5A 1A4PA 2GV5A 3HX4A 1JSAA 2R2IA 1C07A 2AMIA 1F71A 3FWCA 2KFGA 4PE4A 2LP2A 2PASA 1QLSA 3FWBA 2L50A 1IKUA 3EVVA 5BPJA 3I5IC 1KWOC 2KOTA 1Y6WA 3LCPC 1KK8C 1DJWA 4GBAA 1QIVA 2NCPA 5AERA 1MR8A 4HSZA 3DVMA 1JFJA 2BBNA 2P6BB 1BR1B 1UURA 3VROA 1TNPA 3BXKA 1NPQA 2M7LA 3AKAA 2LANA 1B9AA 2GGMA 2NXQA 3EK4A 1DJHA 1EG4A 2LAPA 1DJXA 3TS5C 2PALA 1FBVA 2BCAA 4DIRA 1QIWA 1NX2A 1M39A 4PCWA 2EHBA 4BY5A 1UHIA 1YUUA 2CCMA 2MRDA 4M2QA 1DGVA 2L4HA 3H4SE 1TCOB 1JUOA 3I5FB 1PSBA 1LXFC 4MLWA 5J3XA 1S1EA 3AAJA 4XJKA 1CMGA 1PK0D 1BLQA 3EKHA 2KI4B 2EGDA 1B8CA 4FQOA 4QJ4B 4DUQA 4D1EA 1SK6D 2RGIA 2K7CA 4MBEA 5KTYA 3VRPA 2AUCA 2I7AA 4JQ0D 2LMTA 4Q04A 1J7OA 4F0ZB 1QXPA 1JWDA 1E8AA 1BJFA 1SPYA 2I2RE 4I5KA 1J1DA 3PSRA 1CDPA 1A75B 1SCMB 2Y1NA 1GGWA 3BOWA 1QV1A 5I8NA 1IGVA 5ER4X 4M2OA 2M3WA 1F54A 1J7RA 1HQVA 3ZNIA 1YR5A 3I5IB 1QATA 3C1VA 4IL1A 4CFRA 5CSFA 4PALA 1BG1A 1CFDA 1SCVA 1UWOA 2KYCA 1AP4A 1K94A 4GGNA 2JT3A 1JF0A 2LNKA 4MRYA 3O4YA 1QASA 1ZOTB 3CLNA 3NSIA 2JOJA 5HKYA 2SCPA 1G8IA 2L5XB 1C7WA 2ZNEA 1A29A 5CSJA 4NDDA 3ICBA 2CBLA 1SYMA 1XYDA 1YRUB 2OS8B 1N65A 4OR9B 3TS5B 1M31A 2E30A 4USLA 1BR4B 1YUSA 1TNQA 1DTLA 4OKHA 1TTXA 2LVJA 1V1GA 2JT8A 3CS1A 4WQ3A 2FOTA 1JC2A 3D0YB 2KFFA 3E3RA 4GUKA 2LLTA 5HYDA 1KFXS 1NX3A 2HQWA 1KFUS 2G2BA 2K61A 1MHOA 3GK4X 1QX7A 1MXEA 1B1GA 2LMUA 1OZSA 3CR2A 1DF0B 4XYNA 1CFCA 1XFXO 2HF5A 1ALWA 1DJGA 3KO0A 1XO5A 3ZWHA 4A4BA 1CTRA 1IG5A 5CSIA 4XJKB 2M1KB 2K7DA 1C7VA 4DS7A 4MZLA 1OOJA 3TUYC 5G08A 1DT7B 1M46A 3A4UB 4ETOA 4CLNA 1ZUZA 3O2PA 2LVVA 3WHUB 1B8LA 1DMOA 1DGUA 1S6CA 2L51A 2V53A 1KSOA 4P2YB 1OSAA 3BOWB 4YI9A 1QTXA 1CFFA 2MLEC 1K93D 1LKJA 2SASA 1TN4A 2F33A 3NSLA 4ZCVA 1NX1A 1VRKA 2Y5IA 1QJTA 1WRLA 1YTZC 1S36A 2KGBC 1AHRA 1AJ4A 1K90D 2L98A 1J7PA 2OTGC 1AUIB 1CB1A 1J7QA 3I5HC 4WRIA 2MAZA 3CR4X 3IQQA 5HKZA 1NCZA 1MF8B 3VGOA 1QV0A 3EVRA 1TNXA 2L2EA 1YVLA 3PLFB 1KQVA 1S3PA 2Y1MA 4MVFA 1PRWA 4N1GA 2M29A 2M7NA 5D69A 1CKKA 5KU1A 4YBHB 3SG5A 5GQQC 1SKTA 1M63B 2BKIB 4YGCB 2BL0C 1CDNA 1A2XA 2M49B 1BU3A 1NSHA 1FI6A 4CFQA 1UHNA 2K2AA 2G9BA 3SG6A 1ALVA 1HT9A 3DF0A 1KCYA 4PHMA 1BODA 4NDBA 4MZKA 1N2DA 2LVIA 3I5GC 3TUYB 1M45A 1K2HA 1CNPA 4TNCA 1EG3A 1B47A 1XK4C 1QX2A 4GAOA 2I94A 5CPVA 2O5GA 1OMDA 5D7FA 1A03A 3EKJA 2Q91A 1B7TY 3PN7C 3AKBA 1KQMC 1TCFA 2COLB 2KYFA 1LA0A 1JFKA 3JVTC 3OB1B 1CMFA 1CDMA 1EJ3A 3CR5X 2K0JA 1B8RA 2MJWB 2WC8A 2EC6C 5IBWA 4AQJA 2LM5A 2BBMA 3DVKA 1TNWA 2LLUA 2OTGB 1SR6C 3CGAA 1KK7Y 2JNXA 1MWNA 1SL8A 3I5HB 1SNLA 4AOMA 1SMGA 1KWOB 1RK9A 2CNPA 2OPOA 3BYAA 3HCMA 4PE1A 1QX5B 1KK8B 1XFYO 1K8UA 2KFHA 2M1UA 1MXLC 3SG2A 3SG3A 4DCKA 4YRUA 1NIWA 3PALA 1XFWO 1IH0A 1AVSA 1ZFSA 2M8UA 1L7ZA 2BL0B 1OMRA 1WRKA 1JF2A 3KHEA 4U8DA 1F4OA 3PATA 1WDCC 1Q80A 1BOCA 3QRXA 4NQGA 1S6JA 2JULA 5F6TA 3FS7A 2JC2A 4HRGA 1MQ1A 2ZN9A 1L2OC 2I18A 4PHKA 2BE6A 4PE0A 3BUXB 1B7TZ 1GJYA 3BQ3A 2JQ6A 2KDHA 3DF0B 1NP8A 1FPWA 1CM1A 2K2FA 2F2PA 3SJSA 2ZFDA 1EH2A 3JVTB 2HETA 1R6PA 2HPSA 2JXLA 2JXCA 4GGFA 1UP5A 1PALA 3SG4A 2LHLA 3VRNA 3SIAA 5I2LA 1KK7Z 1ODBA 2MHHA 1V1FA 4I5NB 1WY9A 4UPGA 4MSPA 1UHHA 4OCIA 1PULA 5I2OA 4L9MA 1SW8A 1WLZA 2PMYA 3EK7A 4GGFC 4PHNA 2KHNA 3RM1A 4JPZB 1KFXL 2MBXA 1KFUL 1D1OA 4PDZA 1CLLA 5PALA 5DKQA 1UHKA 1DJIA 3CZTX 2ISDA 4ICBA 5KSZA 1F70A 1H8BA 2BE4A 2WNDA 2H61C 1IQ5A 1OE9B 1Y1XA 2Y4QA 4MZJA 3DVJA 1WDCB 2FCEA 1CFPA 1RTP1 3I5FC 2F8PA 1K9PA 4I5JA 1GQMA 1UUSA 1SL7A 2JT0A 4GFTA 1A75A 2LUXA 3KPXA 1YX7A 1NCXA 5AANA 2ZKMX 3OB2B 1IQ3A 1ZMZA 3DVEA 4MN0A 4YI8A 4E68A 3MSEB 2GGZA 1AK8A 1W7JB 2WCBA 2KBMA 3NSOA 2M97A 1U5IA 1H4BA 2WCEA 1IJ6A 1J55A 1SCMC 2NZ0A 1S26D 1CLMA 4CPVA 1X02A 1XK4A 1Y0VH 1QLKA 3BUOB 2WOSA 5DKRA 3OHMB 1NCYA 3VRRA 4MRXA 3TDIA 4C0LA 2LHIA 2KI6D 2NCOA 4AQIA 3BUNB 5K89A 1IJ5A 1G33A 4ORAB 1G4YR 2LUCA 4HREE 3IF7A 3RLZA 3LL8B 1Y1AA 1OQPA 2LCPA 2CTNA 3D0YA 2QPTA 3EVUA 4PE7A 1XFZO 4M2PA 4OV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZCU A;  2L4I A;  2K7B A;  3FIA A;  4BY4 A;  3O6B A;  2K7O A;  3TDU A;  5AFP A;  4PHJ A;  2OS8 C;  3A8R A;  3LLE A;  4QJ3 B;  2F3Y A;  1DF0 A;  2JU0 A;  1RRO A;  3KF9 A;  1YRT B;  3OX6 A;  2LLS A;  4ORB B;  3WHT B;  4GPL B;  1W7I B;  3WXA A;  5JJG A;  2M0R A;  2NLN A;  2CT9 A;  2KI6 C;  2O60 A;  3KEV A;  5ER5 A;  1NWD A;  1QVI Y;  1YX8 A;  2BKH B;  2WOR A;  1ZAC A;  2E6W A;  3D10 A;  5AEQ A;  2H2K A;  2PRU A;  1UHJ A;  5CSN A;  3JTD C;  5HKW A;  2D8N A;  1N0Y A;  2JTZ A;  1J1E A;  1LA3 A;  1SL9 A;  4YGA A;  1CDL A;  2FCD A;  2LV7 A;  3TZ1 A;  4C0J A;  1XVJ A;  1RJV A;  1GGZ A;  1YUT A;  3LK1 A;  3LK0 A;  4HRH A;  3TDZ A;  1NUB A;  2LVK A;  2LE9 B;  3PFV A;  1K9U A;  1IWQ A;  2LMV A;  5TNC A;  1S5G Y;  4MEW A;  2ZND A;  3GK2 A;  3I5G B;  4YGD B;  3GK1 A;  4N5X A;  1F55 A;  1QS7 A;  1SBJ A;  1U5I B;  1DVI A;  2BCX A;  2JTT A;  2M9G A;  2ZRS A;  1EXR A;  1CM4 A;  4NDC A;  4QJ5 B;  1RWY A;  2F2O A;  2Q4U A;  2KSP A;  1IRJ A;  2PVB A;  3PN7 B;  2CXJ A;  3PM8 A;  3CWG A;  1DJZ A;  2B1U A;  1NX0 A;  1JBA A;  1TOP A;  1KQM B;  4DRW A;  1BT6 A;  2KNE A;  1BMO A;  2JRF A;  2LC5 A;  1K95 A;  1LIN A;  1BF5 A;  3VRQ A;  4FTG A;  1REC A;  1PSR A;  4OVN F;  5HLV A;  4P5O E;  2KBI A;  4ORC B;  3BUW B;  5FYX A;  3F45 A;  3SG7 A;  1AJ5 A;  3AAK A;  2FJU B;  4C0K A;  2EC6 B;  1TIZ A;  5JOL A;  4A4C A;  2KAX A;  1R2U A;  3CTN A;  1PVA A;  1CLB A;  1SR6 B;  1OZO A;  1QVI Z;  4GNK B;  3OX5 A;  3WNX B;  2BEC A;  1K9K A;  2A4J A;  1OMV A;  1SY9 A;  2H61 A;  2MLF C;  2TN4 A;  2ZRT A;  4R1E A;  2K8M B;  4WQ2 A;  2F3Z A;  5DKN A;  3EK8 A;  3SIB A;  2DOQ A;  2PSR A;  1F8H A;  1RFJ A;  2KGR A;  2L0P A;  2QAC A;  1FI5 A;  1YVH A;  2IS9 A;  3JTD B;  4YGE B;  1WLM A;  2JWW A;  1SRA A;  2JPT A;  3O78 A;  4JWQ A;  4YGB B;  2AAO A;  1WRZ A;  3NSK A;  3NXA A;  1TRF A;  2KQ6 A;  3M0W A;  2KAY A;  1F4Q A;  1KSM A;  2LP3 A;  3OP0 A;  5B8I B;  3DD4 A;  1YUR A;  1XFV O;  3GOF A;  2VRG A;  3IQO A;  4CID A;  1S5G Z;  4N1F A;  1FF1 A;  1B4C A;  2JNF A;  2KAV A;  4I5L B;  2KQY A;  3K21 A;  1EL4 A;  1FW4 A;  1LVC D;  2MA2 A;  1K96 A;  1PVB A;  5HLO A;  1XFU O;  2KI4 C;  1S6I A;  1NYA A;  1L2O B;  1DJY A;  2HQ8 A;  2ZN8 A;  5I2Q A;  1MUX A;  1Y1U A;  2WCF A;  3BUM B;  5AXI A;  2BCB A;  2JZI A;  1XA5 A;  1A4P A;  2GV5 A;  3HX4 A;  1JSA A;  2R2I A;  1C07 A;  2AMI A;  1F71 A;  3FWC A;  2KFG A;  4PE4 A;  2LP2 A;  2PAS A;  1QLS A;  3FWB A;  2L50 A;  1IKU A;  3EVV A;  5BPJ A;  3I5I C;  1KWO C;  2KOT A;  1Y6W A;  3LCP C;  1KK8 C;  1DJW A;  4GBA A;  1QIV A;  2NCP A;  5AER A;  1MR8 A;  4HSZ A;  3DVM A;  1JFJ A;  2BBN A;  2P6B B;  1BR1 B;  1UUR A;  3VRO A;  1TNP A;  3BXK A;  1NPQ A;  2M7L A;  3AKA A;  2LAN A;  1B9A A;  2GGM A;  2NXQ A;  3EK4 A;  1DJH A;  1EG4 A;  2LAP A;  1DJX A;  3TS5 C;  2PAL A;  1FBV A;  2BCA A;  4DIR A;  1QIW A;  1NX2 A;  1M39 A;  4PCW A;  2EHB A;  4BY5 A;  1UHI A;  1YUU A;  2CCM A;  2MRD A;  4M2Q A;  1DGV A;  2L4H A;  3H4S E;  1TCO B;  1JUO A;  3I5F B;  1PSB A;  1LXF C;  4MLW A;  5J3X A;  1S1E A;  3AAJ A;  4XJK A;  1CMG A;  1PK0 D;  1BLQ A;  3EKH A;  2KI4 B;  2EGD A;  1B8C A;  4FQO A;  4QJ4 B;  4DUQ A;  4D1E A;  1SK6 D;  2RGI A;  2K7C A;  4MBE A;  5KTY A;  3VRP A;  2AUC A;  2I7A A;  4JQ0 D;  2LMT A;  4Q04 A;  1J7O A;  4F0Z B;  1QXP A;  1JWD A;  1E8A A;  1BJF A;  1SPY A;  2I2R E;  4I5K A;  1J1D A;  3PSR A;  1CDP A;  1A75 B;  1SCM B;  2Y1N A;  1GGW A;  3BOW A;  1QV1 A;  5I8N A;  1IGV A;  5ER4 X;  4M2O A;  2M3W A;  1F54 A;  1J7R A;  1HQV A;  3ZNI A;  1YR5 A;  3I5I B;  1QAT A;  3C1V A;  4IL1 A;  4CFR A;  5CSF A;  4PAL A;  1BG1 A;  1CFD A;  1SCV A;  1UWO A;  2KYC A;  1AP4 A;  1K94 A;  4GGN A;  2JT3 A;  1JF0 A;  2LNK A;  4MRY A;  3O4Y A;  1QAS A;  1ZOT B;  3CLN A;  3NSI A;  2JOJ A;  5HKY A;  2SCP A;  1G8I A;  2L5X B;  1C7W A;  2ZNE A;  1A29 A;  5CSJ A;  4NDD A;  3ICB A;  2CBL A;  1SYM A;  1XYD A;  1YRU B;  2OS8 B;  1N65 A;  4OR9 B;  3TS5 B;  1M31 A;  2E30 A;  4USL A;  1BR4 B;  1YUS A;  1TNQ A;  1DTL A;  4OKH A;  1TTX A;  2LVJ A;  1V1G A;  2JT8 A;  3CS1 A;  4WQ3 A;  2FOT A;  1JC2 A;  3D0Y B;  2KFF A;  3E3R A;  4GUK A;  2LLT A;  5HYD A;  1KFX S;  1NX3 A;  2HQW A;  1KFU S;  2G2B A;  2K61 A;  1MHO A;  3GK4 X;  1QX7 A;  1MXE A;  1B1G A;  2LMU A;  1OZS A;  3CR2 A;  1DF0 B;  4XYN A;  1CFC A;  1XFX O;  2HF5 A;  1ALW A;  1DJG A;  3KO0 A;  1XO5 A;  3ZWH A;  4A4B A;  1CTR A;  1IG5 A;  5CSI A;  4XJK B;  2M1K B;  2K7D A;  1C7V A;  4DS7 A;  4MZL A;  1OOJ A;  3TUY C;  5G08 A;  1DT7 B;  1M46 A;  3A4U B;  4ETO A;  4CLN A;  1ZUZ A;  3O2P A;  2LVV A;  3WHU B;  1B8L A;  1DMO A;  1DGU A;  1S6C A;  2L51 A;  2V53 A;  1KSO A;  4P2Y B;  1OSA A;  3BOW B;  4YI9 A;  1QTX A;  1CFF A;  2MLE C;  1K93 D;  1LKJ A;  2SAS A;  1TN4 A;  2F33 A;  3NSL A;  4ZCV A;  1NX1 A;  1VRK A;  2Y5I A;  1QJT A;  1WRL A;  1YTZ C;  1S36 A;  2KGB C;  1AHR A;  1AJ4 A;  1K90 D;  2L98 A;  1J7P A;  2OTG C;  1AUI B;  1CB1 A;  1J7Q A;  3I5H C;  4WRI A;  2MAZ A;  3CR4 X;  3IQQ A;  5HKZ A;  1NCZ A;  1MF8 B;  3VGO A;  1QV0 A;  3EVR A;  1TNX A;  2L2E A;  1YVL A;  3PLF B;  1KQV A;  1S3P A;  2Y1M A;  4MVF A;  1PRW A;  4N1G A;  2M29 A;  2M7N A;  5D69 A;  1CKK A;  5KU1 A;  4YBH B;  3SG5 A;  5GQQ C;  1SKT A;  1M63 B;  2BKI B;  4YGC B;  2BL0 C;  1CDN A;  1A2X A;  2M49 B;  1BU3 A;  1NSH A;  1FI6 A;  4CFQ A;  1UHN A;  2K2A A;  2G9B A;  3SG6 A;  1ALV A;  1HT9 A;  3DF0 A;  1KCY A;  4PHM A;  1BOD A;  4NDB A;  4MZK A;  1N2D A;  2LVI A;  3I5G C;  3TUY B;  1M45 A;  1K2H A;  1CNP A;  4TNC A;  1EG3 A;  1B47 A;  1XK4 C;  1QX2 A;  4GAO A;  2I94 A;  5CPV A;  2O5G A;  1OMD A;  5D7F A;  1A03 A;  3EKJ A;  2Q91 A;  1B7T Y;  3PN7 C;  3AKB A;  1KQM C;  1TCF A;  2COL B;  2KYF A;  1LA0 A;  1JFK A;  3JVT C;  3OB1 B;  1CMF A;  1CDM A;  1EJ3 A;  3CR5 X;  2K0J A;  1B8R A;  2MJW B;  2WC8 A;  2EC6 C;  5IBW A;  4AQJ A;  2LM5 A;  2BBM A;  3DVK A;  1TNW A;  2LLU A;  2OTG B;  1SR6 C;  3CGA A;  1KK7 Y;  2JNX A;  1MWN A;  1SL8 A;  3I5H B;  1SNL A;  4AOM A;  1SMG A;  1KWO B;  1RK9 A;  2CNP A;  2OPO A;  3BYA A;  3HCM A;  4PE1 A;  1QX5 B;  1KK8 B;  1XFY O;  1K8U A;  2KFH A;  2M1U A;  1MXL C;  3SG2 A;  3SG3 A;  4DCK A;  4YRU A;  1NIW A;  3PAL A;  1XFW O;  1IH0 A;  1AVS A;  1ZFS A;  2M8U A;  1L7Z A;  2BL0 B;  1OMR A;  1WRK A;  1JF2 A;  3KHE A;  4U8D A;  1F4O A;  3PAT A;  1WDC C;  1Q80 A;  1BOC A;  3QRX A;  4NQG A;  1S6J A;  2JUL A;  5F6T A;  3FS7 A;  2JC2 A;  4HRG A;  1MQ1 A;  2ZN9 A;  1L2O C;  2I18 A;  4PHK A;  2BE6 A;  4PE0 A;  3BUX B;  1B7T Z;  1GJY A;  3BQ3 A;  2JQ6 A;  2KDH A;  3DF0 B;  1NP8 A;  1FPW A;  1CM1 A;  2K2F A;  2F2P A;  3SJS A;  2ZFD A;  1EH2 A;  3JVT B;  2HET A;  1R6P A;  2HPS A;  2JXL A;  2JXC A;  4GGF A;  1UP5 A;  1PAL A;  3SG4 A;  2LHL A;  3VRN A;  3SIA A;  5I2L A;  1KK7 Z;  1ODB A;  2MHH A;  1V1F A;  4I5N B;  1WY9 A;  4UPG A;  4MSP A;  1UHH A;  4OCI A;  1PUL A;  5I2O A;  4L9M A;  1SW8 A;  1WLZ A;  2PMY A;  3EK7 A;  4GGF C;  4PHN A;  2KHN A;  3RM1 A;  4JPZ B;  1KFX L;  2MBX A;  1KFU L;  1D1O A;  4PDZ A;  1CLL A;  5PAL A;  5DKQ A;  1UHK A;  1DJI A;  3CZT X;  2ISD A;  4ICB A;  5KSZ A;  1F70 A;  1H8B A;  2BE4 A;  2WND A;  2H61 C;  1IQ5 A;  1OE9 B;  1Y1X A;  2Y4Q A;  4MZJ A;  3DVJ A;  1WDC B;  2FCE A;  1CFP A;  1RTP 1;  3I5F C;  2F8P A;  1K9P A;  4I5J A;  1GQM A;  1UUS A;  1SL7 A;  2JT0 A;  4GFT A;  1A75 A;  2LUX A;  3KPX A;  1YX7 A;  1NCX A;  5AAN A;  2ZKM X;  3OB2 B;  1IQ3 A;  1ZMZ A;  3DVE A;  4MN0 A;  4YI8 A;  4E68 A;  3MSE B;  2GGZ A;  1AK8 A;  1W7J B;  2WCB A;  2KBM A;  3NSO A;  2M97 A;  1U5I A;  1H4B A;  2WCE A;  1IJ6 A;  1J55 A;  1SCM C;  2NZ0 A;  1S26 D;  1CLM A;  4CPV A;  1X02 A;  1XK4 A;  1Y0V H;  1QLK A;  3BUO B;  2WOS A;  5DKR A;  3OHM B;  1NCY A;  3VRR A;  4MRX A;  3TDI A;  4C0L A;  2LHI A;  2KI6 D;  2NCO A;  4AQI A;  3BUN B;  5K89 A;  1IJ5 A;  1G33 A;  4ORA B;  1G4Y R;  2LUC A;  4HRE E;  3IF7 A;  3RLZ A;  3LL8 B;  1Y1A A;  1OQP A;  2LCP A;  2CTN A;  3D0Y A;  2QPT A;  3EVU A;  4PE7 A;  1XFZ O;  4M2P A;  4OV2 A; 
#chains in the Genus database with same CATH topology
 3QME A;  2L4I A;  2K7B A;  3FIA A;  4ZCU A;  1OOH A;  4BY4 A;  3O6B A;  2K7O A;  3EG5 B;  3TDU A;  3DY9 A;  2QEB A;  5AFP A;  4PHJ A;  2OS8 C;  3A8R A;  3LLE A;  4QJ3 B;  2F3Y A;  1DF0 A;  2JU0 A;  1RRO A;  3KF9 A;  1YRT B;  3OX6 A;  2LLS A;  4ORB B;  3WHT B;  4GPL B;  3CYZ A;  1LS8 A;  1W7I B;  3R1P A;  3WXA A;  5JJG A;  2M0R A;  2NLN A;  2CT9 A;  2P70 A;  2KI6 C;  2O60 A;  3KEV A;  5ER5 A;  1NWD A;  1QWV A;  1QVI Y;  1YX8 A;  2BKH B;  2WOR A;  1ZAC A;  2E6W A;  3D10 A;  5AEQ A;  3SS3 A;  2H2K A;  2PRU A;  1UHJ A;  5CSN A;  3JTD C;  5HKW A;  2D8N A;  1N0Y A;  2JTZ A;  1J1E A;  1LA3 A;  1SL9 A;  4YGA A;  1CDL A;  2FCD A;  2LV7 A;  3TZ1 A;  4C0J A;  1OW4 A;  1XVJ A;  1RJV A;  1GGZ A;  1YUT A;  3LK1 A;  3UO9 A;  3LK0 A;  4HRH A;  3TDZ A;  3L4L A;  1NUB A;  2LVK A;  2LE9 B;  3PFV A;  1K9U A;  1IWQ A;  2LMV A;  5TNC A;  1S5G Y;  1TUJ A;  4MEW A;  2ZND A;  2JPO A;  1Z2C B;  3GK2 A;  3I5G B;  4YGD B;  3GK1 A;  4N5X A;  1F55 A;  1QS7 A;  1SBJ A;  1U5I B;  1DVI A;  2BCX A;  2JTT A;  2M9G A;  2ZRS A;  1EXR A;  1CM4 A;  3D74 A;  4NDC A;  4QJ5 B;  1RWY A;  2F2O A;  1TWO A;  2KPH A;  2Q4U A;  3BFH A;  2KSP A;  1IRJ A;  2PVB A;  3PN7 B;  2CXJ A;  3PM8 A;  3CWG A;  1DJZ A;  2B1U A;  1NX0 A;  1JBA A;  1TOP A;  1KQM B;  4DRW A;  1BT6 A;  2KNE A;  1BMO A;  2JRF A;  2LC5 A;  1K95 A;  1LIN A;  1BF5 A;  3VRQ A;  4FTG A;  1REC A;  1PSR A;  4OVN F;  5HLV A;  5I94 A;  3S0F A;  4P5O E;  2KBI A;  2WCK A;  4ORC B;  3BUW B;  3CDN A;  5FYX A;  3S0A A;  3F45 A;  3SG7 A;  1AJ5 A;  3AAK A;  3SS4 A;  2FJU B;  4C0K A;  2EC6 B;  1TIZ A;  5JOL A;  4A4C A;  2KAX A;  1R2U A;  3CTN A;  1PVA A;  1CLB A;  1SR6 B;  1OZO A;  1QVI Z;  4GNK B;  3OX5 A;  3WNX B;  2BEC A;  1K9K A;  2A4J A;  1OMV A;  1SY9 A;  2H61 A;  2MLF C;  2TN4 A;  2ZRT A;  4R1E A;  2K8M B;  4WQ2 A;  2F3Z A;  5DKN A;  3BFB A;  3EK8 A;  2DOQ A;  2PSR A;  3SIB A;  1F8H A;  1RFJ A;  1T14 A;  2KGR A;  2L0P A;  2QAC A;  1FI5 A;  1YVH A;  2IS9 A;  3JTD B;  4YGE B;  1WLM A;  2JWW A;  1SRA A;  2JPT A;  3K1E A;  3O78 A;  4JWQ A;  4YGB B;  2AAO A;  1WRZ A;  3NSK A;  3NXA A;  1TRF A;  2KQ6 A;  3M0W A;  2KAY A;  1F4Q A;  3DXL A;  1KSM A;  2LP3 A;  3OP0 A;  5B8I B;  3DD4 A;  1YUR A;  1XFV O;  3GOF A;  2VRG A;  3IQO A;  4CID A;  1S5G Z;  4N1F A;  1FF1 A;  1B4C A;  2JNF A;  2KAV A;  3N7H A;  2KQY A;  4I5L B;  3K21 A;  1EL4 A;  1FW4 A;  1LVC D;  2H8V A;  1K96 A;  1PVB A;  2MA2 A;  5HLO A;  1XFU O;  3V2L A;  2KI4 C;  1S6I A;  1NYA A;  1L2O B;  1DJY A;  2HQ8 A;  2ZN8 A;  5I2Q A;  1Y1U A;  1MUX A;  2WCF A;  3BUM B;  3D77 A;  5AXI A;  3BJH A;  2BCB A;  2JZI A;  1XA5 A;  1A4P A;  2GV5 A;  3HX4 A;  1JSA A;  3FE8 A;  2R2I A;  1C07 A;  2AMI A;  1F71 A;  3FWC A;  2KFG A;  4PE4 A;  2LP2 A;  2PAS A;  1QLS A;  3FWB A;  3FE9 A;  2L50 A;  2YGU A;  3EVV A;  5BPJ A;  1IKU A;  3R72 A;  3I5I C;  1KWO C;  3UNW A;  2KOT A;  1Y6W A;  5EL2 A;  3LCP C;  1KK8 C;  1DJW A;  2WCH A;  2WCM A;  1QIV A;  2NCP A;  4GBA A;  5AER A;  1MR8 A;  4HSZ A;  3DVM A;  1JFJ A;  2BBN A;  3S0B A;  2P6B B;  3B87 A;  4KYN A;  1BR1 B;  1UUR A;  3VRO A;  1TNP A;  3BXK A;  1NPQ A;  2M7L A;  3AKA A;  3B88 A;  2LAN A;  2WC6 A;  1B9A A;  2GGM A;  2NXQ A;  3EK4 A;  1DJH A;  1EG4 A;  2LAP A;  1DJX A;  3TS5 C;  2PAL A;  1FBV A;  2BCA A;  5FI6 A;  4DIR A;  1QIW A;  1NX2 A;  1M39 A;  4PCW A;  2EHB A;  5FI2 A;  4BY5 A;  1UHI A;  1YUU A;  1W9Z A;  2CCM A;  2MRD A;  4M2Q A;  1DGV A;  2FJY A;  2L4H A;  3H4S E;  1TCO B;  1JUO A;  3I5F B;  1PSB A;  1LXF C;  4MLW A;  5J3X A;  1S1E A;  3AAJ A;  4XJK A;  1CMG A;  1PK0 D;  1BLQ A;  3EKH A;  2KI4 B;  2EGD A;  1B8C A;  4FQO A;  4QJ4 B;  4DUQ A;  4D1E A;  1SK6 D;  2RGI A;  2K7C A;  4MBE A;  5KTY A;  3VRP A;  2AUC A;  2I7A A;  1OOG A;  2LMT A;  2WCJ A;  4JQ0 D;  4Q04 A;  3D73 A;  4F0Z B;  1QXP A;  1J7O A;  1JWD A;  1E8A A;  1BJF A;  1SPY A;  2I2R E;  2QEH A;  4I5K A;  1J1D A;  3PSR A;  1CDP A;  1A75 B;  1SCM B;  2Y1N A;  1GGW A;  2BNX A;  1QV1 A;  3BOW A;  1IGV A;  5I8N A;  5ER4 X;  4M2O A;  2M3W A;  1F54 A;  1J7R A;  1HQV A;  3ZNI A;  1YR5 A;  3I5I B;  1QAT A;  3C1V A;  4IL1 A;  4CFR A;  5CSF A;  4PAL A;  1BG1 A;  1CFD A;  1SCV A;  1UWO A;  2KYC A;  3D76 A;  1K94 A;  1AP4 A;  4GGN A;  4JD9 A;  4INX A;  2JT3 A;  1JF0 A;  2LNK A;  4MRY A;  3O4Y A;  1QAS A;  1ZOT B;  3CLN A;  3NSI A;  2JOJ A;  3RZS A;  5HKY A;  2SCP A;  1G8I A;  2L5X B;  1C7W A;  3CZ1 A;  2ZNE A;  1A29 A;  5CSJ A;  4NDD A;  3ICB A;  2CBL A;  1SYM A;  1XYD A;  1YRU B;  2OS8 B;  1N65 A;  4OR9 B;  3Q8I A;  3TS5 B;  1M31 A;  2E30 A;  3PM2 A;  1BR4 B;  1YUS A;  1TNQ A;  1DTL A;  4OKH A;  4USL A;  1TTX A;  2LVJ A;  1V1G A;  2JT8 A;  3CS1 A;  4WQ3 A;  2FOT A;  1JC2 A;  3D0Y B;  2KFF A;  3E3R A;  4GUK A;  2LLT A;  5HYD A;  3L47 A;  1KFX S;  1NX3 A;  2HQW A;  1KFU S;  3CAB A;  2G2B A;  2K61 A;  1MHO A;  3GK4 X;  1QX7 A;  1MXE A;  1B1G A;  2LMU A;  1OZS A;  3CR2 A;  1DF0 B;  4XYN A;  2PYQ A;  1DEK A;  1CFC A;  1XFX O;  2HF5 A;  1ALW A;  1DJG A;  1OOF A;  3KO0 A;  1XO5 A;  3ZWH A;  4A4B A;  1DEL A;  1CTR A;  2QDI A;  1IG5 A;  3OBV A;  5CSI A;  4XJK B;  2M1K B;  3S0E A;  2K7D A;  3BFA A;  1C7V A;  1GM0 A;  4DS7 A;  4FQT A;  1OOJ A;  4MZL A;  5G08 A;  3TUY C;  1DT7 B;  1M46 A;  3A4U B;  4ETO A;  1IIO A;  4CLN A;  3CZ2 A;  1ZUZ A;  3O2P A;  2LVV A;  3B7A A;  3WHU B;  1B8L A;  2L5Y A;  4IJ7 A;  1DMO A;  1DGU A;  1S6C A;  2L51 A;  2ERB A;  2V53 A;  1KSO A;  2WCL A;  4P2Y B;  3B6X A;  1OSA A;  3NGV A;  3BOW B;  4YI9 A;  1QTX A;  1CFF A;  2MLE C;  1K93 D;  1LKJ A;  2SAS A;  1TN4 A;  2F33 A;  3NSL A;  4ZCV A;  1NX1 A;  1VRK A;  2Y5I A;  1QJT A;  1WRL A;  1YTZ C;  1S36 A;  2KGB C;  1AHR A;  1AJ4 A;  1K90 D;  3NHT A;  2L98 A;  1J7P A;  2OTG C;  1AUI B;  1CB1 A;  1J7Q A;  3I5H C;  4WRI A;  2MAZ A;  3CR4 X;  3IQQ A;  5HKZ A;  1NCZ A;  3FE6 A;  1MF8 B;  3VGO A;  1DC1 A;  3OGN A;  1QV0 A;  3EVR A;  1TNX A;  2L2E A;  1YVL A;  3PLF B;  1KQV A;  1S3P A;  2Y1M A;  4MVF A;  1PRW A;  4N1G A;  2M29 A;  2M7N A;  5D69 A;  1CKK A;  5KU1 A;  4YBH B;  3SG5 A;  5GQQ C;  1SKT A;  1M63 B;  2BKI B;  4YGC B;  2BL0 C;  3O4X A;  5DIC A;  1CDN A;  5HL1 A;  1A2X A;  2M49 B;  1BU3 A;  1NSH A;  1FI6 A;  4CFQ A;  1UHN A;  2K2A A;  2G9B A;  3CZ0 A;  3SG6 A;  1ALV A;  1HT9 A;  3DF0 A;  1C3Y A;  1KCY A;  4PHM A;  1BOD A;  1Z4H A;  3D78 A;  4NDB A;  4MZK A;  1N2D A;  4OZD A;  2LVI A;  3I5G C;  3TUY B;  1M45 A;  1K2H A;  1CNP A;  4TNC A;  1EG3 A;  1B47 A;  1XK4 C;  1QX2 A;  2QEV A;  2I94 A;  4GAO A;  2O5G A;  5CPV A;  1OMD A;  5D7F A;  1A03 A;  3EKJ A;  2Q91 A;  1B7T Y;  3PN7 C;  3AKB A;  1KQM C;  1TCF A;  2COL B;  2KYF A;  1LA0 A;  1JFK A;  3JVT C;  5FI7 A;  3OB1 B;  1CMF A;  1CDM A;  1EJ3 A;  3CR5 X;  1DQE A;  2K0J A;  1B8R A;  2MJW B;  2WC8 A;  2EC6 C;  5IBW A;  4AQJ A;  2LM5 A;  2BBM A;  3DVK A;  1TNW A;  2LLU A;  2OTG B;  1SR6 C;  3CGA A;  1KK7 Y;  2JNX A;  1MWN A;  1OOI X;  1SL8 A;  3I5H B;  1SNL A;  3S0G A;  4AOM A;  1SMG A;  1KWO B;  1RK9 A;  2CNP A;  2OPO A;  3BYA A;  3HCM A;  4PE1 A;  1QX5 B;  1KK8 B;  1XFY O;  1C3Z A;  4PT1 A;  1K8U A;  2KFH A;  2M1U A;  1MXL C;  3SG2 A;  3SG3 A;  4DCK A;  4YRU A;  1NIW A;  3PAL A;  1XFW O;  1IH0 A;  1AVS A;  1ZFS A;  2M8U A;  1L7Z A;  2BL0 B;  2WC5 A;  3NHI A;  3SS5 A;  1OMR A;  1WRK A;  1JF2 A;  3KHE A;  4U8D A;  3B86 A;  1F4O A;  3PAT A;  1WDC C;  1Q80 A;  3R1V A;  1BOC A;  3QRX A;  4NQG A;  1S6J A;  2JUL A;  5F6T A;  2BAP A;  3FS7 A;  2JC2 A;  4HRG A;  1MQ1 A;  2ZN9 A;  1L2O C;  2I18 A;  4PHK A;  2BE6 A;  3D75 A;  4PE0 A;  3BUX B;  1B7T Z;  1GJY A;  3BQ3 A;  2JQ6 A;  2K60 A;  2KDH A;  3DF0 B;  1SSE B;  1NP8 A;  1FPW A;  1CM1 A;  2K2F A;  2KLD A;  2F2P A;  1P28 A;  3SJS A;  2ZFD A;  1EH2 A;  4JKT A;  3JVT B;  2QEO A;  2HET A;  1R6P A;  3S0D A;  2HPS A;  2JXL A;  4F7F A;  2JXC A;  4GGF A;  1UP5 A;  1PAL A;  3SG4 A;  2LHL A;  3VRN A;  3SIA A;  5I2L A;  1KK7 Z;  1ODB A;  2MHH A;  1V1F A;  4I5N B;  1WY9 A;  4UPG A;  4MSP A;  1UHH A;  4OCI A;  1PUL A;  5I2O A;  4L9M A;  1SW8 A;  1WLZ A;  2PMY A;  3R1O A;  3EK7 A;  4GGF C;  4PHN A;  2KHN A;  3RM1 A;  3IVT A;  3DYE A;  4JPZ B;  1KFX L;  2MBX A;  1KFU L;  1TUZ A;  1D1O A;  4PDZ A;  1CLL A;  5PAL A;  5DKQ A;  1UHK A;  1DJI A;  3CZT X;  2ISD A;  3VB1 A;  4ICB A;  5KSZ A;  1F70 A;  1H8B A;  2BE4 A;  2WND A;  2H61 C;  1IQ5 A;  1OE9 B;  1Y1X A;  2Y4Q A;  4MZJ A;  2KLE A;  1WDC B;  2FCE A;  3DVJ A;  1CFP A;  1RTP 1;  3I5F C;  4INW A;  3L4A A;  2F8P A;  1K9P A;  4I5J A;  1GQM A;  1UUS A;  1SL7 A;  2JT0 A;  4GFT A;  1A75 A;  2LUX A;  3KPX A;  1YX7 A;  1NCX A;  5AAN A;  2ZKM X;  3OB2 B;  1IQ3 A;  1ZMZ A;  2PQL A;  3DVE A;  4MN0 A;  4YI8 A;  4E68 A;  3MSE B;  3DZT A;  2GGZ A;  1AK8 A;  1W7J B;  5D3O A;  2WCB A;  2KBM A;  3NSO A;  2M97 A;  1U5I A;  1H4B A;  2WCE A;  1IJ6 A;  1J55 A;  1SCM C;  2NZ0 A;  1S26 D;  1CLM A;  4CPV A;  1X02 A;  1XK4 A;  1Y0V H;  1QLK A;  3BUO B;  2WOS A;  5DKR A;  3OHM B;  1NCY A;  3VRR A;  4MRX A;  2GTE A;  3TDI A;  4C0L A;  2LHI A;  2KI6 D;  2NCO A;  2L2C A;  3PJI A;  1XFR A;  4AQI A;  3BUN B;  5K89 A;  1IJ5 A;  1G33 A;  4ORA B;  1G4Y R;  2LUC A;  2P71 A;  4HRE E;  1ORG A;  3IF7 A;  3RLZ A;  3LL8 B;  1Y1A A;  1OQP A;  2LCP A;  2CTN A;  3D0Y A;  2QPT A;  3EVU A;  4PE7 A;  1XFZ O;  4M2P A;  4OV2 A; 
#chains in the Genus database with same CATH homology
 4ZCU A;  2L4I A;  2K7B A;  3FIA A;  4BY4 A;  3O6B A;  2K7O A;  3TDU A;  5AFP A;  4PHJ A;  2OS8 C;  3A8R A;  3LLE A;  4QJ3 B;  2F3Y A;  1DF0 A;  2JU0 A;  1RRO A;  3KF9 A;  1YRT B;  3OX6 A;  2LLS A;  4ORB B;  3WHT B;  4GPL B;  1W7I B;  3WXA A;  5JJG A;  2M0R A;  2NLN A;  2CT9 A;  2KI6 C;  2O60 A;  3KEV A;  5ER5 A;  1NWD A;  1QVI Y;  1YX8 A;  2BKH B;  2WOR A;  1ZAC A;  2E6W A;  3D10 A;  5AEQ A;  2H2K A;  2PRU A;  1UHJ A;  5CSN A;  3JTD C;  5HKW A;  2D8N A;  1N0Y A;  2JTZ A;  1J1E A;  1LA3 A;  1SL9 A;  4YGA A;  1CDL A;  2FCD A;  2LV7 A;  3TZ1 A;  4C0J A;  1XVJ A;  1RJV A;  1GGZ A;  1YUT A;  3LK1 A;  3LK0 A;  4HRH A;  3TDZ A;  1NUB A;  2LVK A;  2LE9 B;  3PFV A;  1K9U A;  1IWQ A;  2LMV A;  5TNC A;  1S5G Y;  4MEW A;  2ZND A;  3GK2 A;  3I5G B;  4YGD B;  3GK1 A;  4N5X A;  1F55 A;  1QS7 A;  1SBJ A;  1U5I B;  1DVI A;  2BCX A;  2JTT A;  2M9G A;  2ZRS A;  1EXR A;  1CM4 A;  4NDC A;  4QJ5 B;  1RWY A;  2F2O A;  2Q4U A;  2KSP A;  1IRJ A;  2PVB A;  3PN7 B;  2CXJ A;  3PM8 A;  3CWG A;  1DJZ A;  2B1U A;  1NX0 A;  1JBA A;  1TOP A;  1KQM B;  4DRW A;  1BT6 A;  2KNE A;  1BMO A;  2JRF A;  2LC5 A;  1K95 A;  1LIN A;  1BF5 A;  3VRQ A;  4FTG A;  1REC A;  1PSR A;  4OVN F;  5HLV A;  4P5O E;  2KBI A;  4ORC B;  3BUW B;  5FYX A;  3F45 A;  3SG7 A;  1AJ5 A;  3AAK A;  2FJU B;  4C0K A;  2EC6 B;  1TIZ A;  5JOL A;  4A4C A;  2KAX A;  1R2U A;  3CTN A;  1PVA A;  1CLB A;  1SR6 B;  1OZO A;  1QVI Z;  4GNK B;  3OX5 A;  3WNX B;  2BEC A;  1K9K A;  2A4J A;  1OMV A;  1SY9 A;  2H61 A;  2MLF C;  2TN4 A;  2ZRT A;  4R1E A;  2K8M B;  4WQ2 A;  2F3Z A;  5DKN A;  3EK8 A;  3SIB A;  2DOQ A;  2PSR A;  1F8H A;  1RFJ A;  2KGR A;  2L0P A;  2QAC A;  1FI5 A;  1YVH A;  2IS9 A;  3JTD B;  4YGE B;  1WLM A;  2JWW A;  1SRA A;  2JPT A;  3O78 A;  4JWQ A;  4YGB B;  2AAO A;  1WRZ A;  3NSK A;  3NXA A;  1TRF A;  2KQ6 A;  3M0W A;  2KAY A;  1F4Q A;  1KSM A;  2LP3 A;  3OP0 A;  5B8I B;  3DD4 A;  1YUR A;  1XFV O;  3GOF A;  2VRG A;  3IQO A;  4CID A;  1S5G Z;  4N1F A;  1FF1 A;  1B4C A;  2JNF A;  2KAV A;  4I5L B;  2KQY A;  3K21 A;  1EL4 A;  1FW4 A;  1LVC D;  2MA2 A;  1K96 A;  1PVB A;  5HLO A;  1XFU O;  2KI4 C;  1S6I A;  1NYA A;  1L2O B;  1DJY A;  2HQ8 A;  2ZN8 A;  5I2Q A;  1MUX A;  1Y1U A;  2WCF A;  3BUM B;  5AXI A;  2BCB A;  2JZI A;  1XA5 A;  1A4P A;  2GV5 A;  3HX4 A;  1JSA A;  2R2I A;  1C07 A;  2AMI A;  1F71 A;  3FWC A;  2KFG A;  4PE4 A;  2LP2 A;  2PAS A;  1QLS A;  3FWB A;  2L50 A;  1IKU A;  3EVV A;  5BPJ A;  3I5I C;  1KWO C;  2KOT A;  1Y6W A;  3LCP C;  1KK8 C;  1DJW A;  4GBA A;  1QIV A;  2NCP A;  5AER A;  1MR8 A;  4HSZ A;  3DVM A;  1JFJ A;  2BBN A;  2P6B B;  1BR1 B;  1UUR A;  3VRO A;  1TNP A;  3BXK A;  1NPQ A;  2M7L A;  3AKA A;  2LAN A;  1B9A A;  2GGM A;  2NXQ A;  3EK4 A;  1DJH A;  1EG4 A;  2LAP A;  1DJX A;  3TS5 C;  2PAL A;  1FBV A;  2BCA A;  4DIR A;  1QIW A;  1NX2 A;  1M39 A;  4PCW A;  2EHB A;  4BY5 A;  1UHI A;  1YUU A;  2CCM A;  2MRD A;  4M2Q A;  1DGV A;  2L4H A;  3H4S E;  1TCO B;  1JUO A;  3I5F B;  1PSB A;  1LXF C;  4MLW A;  5J3X A;  1S1E A;  3AAJ A;  4XJK A;  1CMG A;  1PK0 D;  1BLQ A;  3EKH A;  2KI4 B;  2EGD A;  1B8C A;  4FQO A;  4QJ4 B;  4DUQ A;  4D1E A;  1SK6 D;  2RGI A;  2K7C A;  4MBE A;  5KTY A;  3VRP A;  2AUC A;  2I7A A;  4JQ0 D;  2LMT A;  4Q04 A;  1J7O A;  4F0Z B;  1QXP A;  1JWD A;  1E8A A;  1BJF A;  1SPY A;  2I2R E;  4I5K A;  1J1D A;  3PSR A;  1CDP A;  1A75 B;  1SCM B;  2Y1N A;  1GGW A;  3BOW A;  1QV1 A;  5I8N A;  1IGV A;  5ER4 X;  4M2O A;  2M3W A;  1F54 A;  1J7R A;  1HQV A;  3ZNI A;  1YR5 A;  3I5I B;  1QAT A;  3C1V A;  4IL1 A;  4CFR A;  5CSF A;  4PAL A;  1BG1 A;  1CFD A;  1SCV A;  1UWO A;  2KYC A;  1AP4 A;  1K94 A;  4GGN A;  2JT3 A;  1JF0 A;  2LNK A;  4MRY A;  3O4Y A;  1QAS A;  1ZOT B;  3CLN A;  3NSI A;  2JOJ A;  5HKY A;  2SCP A;  1G8I A;  2L5X B;  1C7W A;  2ZNE A;  1A29 A;  5CSJ A;  4NDD A;  3ICB A;  2CBL A;  1SYM A;  1XYD A;  1YRU B;  2OS8 B;  1N65 A;  4OR9 B;  3TS5 B;  1M31 A;  2E30 A;  4USL A;  1BR4 B;  1YUS A;  1TNQ A;  1DTL A;  4OKH A;  1TTX A;  2LVJ A;  1V1G A;  2JT8 A;  3CS1 A;  4WQ3 A;  2FOT A;  1JC2 A;  3D0Y B;  2KFF A;  3E3R A;  4GUK A;  2LLT A;  5HYD A;  1KFX S;  1NX3 A;  2HQW A;  1KFU S;  2G2B A;  2K61 A;  1MHO A;  3GK4 X;  1QX7 A;  1MXE A;  1B1G A;  2LMU A;  1OZS A;  3CR2 A;  1DF0 B;  4XYN A;  1CFC A;  1XFX O;  2HF5 A;  1ALW A;  1DJG A;  3KO0 A;  1XO5 A;  3ZWH A;  4A4B A;  1CTR A;  1IG5 A;  5CSI A;  4XJK B;  2M1K B;  2K7D A;  1C7V A;  4DS7 A;  4MZL A;  1OOJ A;  3TUY C;  5G08 A;  1DT7 B;  1M46 A;  3A4U B;  4ETO A;  4CLN A;  1ZUZ A;  3O2P A;  2LVV A;  3WHU B;  1B8L A;  1DMO A;  1DGU A;  1S6C A;  2L51 A;  2V53 A;  1KSO A;  4P2Y B;  1OSA A;  3BOW B;  4YI9 A;  1QTX A;  1CFF A;  2MLE C;  1K93 D;  1LKJ A;  2SAS A;  1TN4 A;  2F33 A;  3NSL A;  4ZCV A;  1NX1 A;  1VRK A;  2Y5I A;  1QJT A;  1WRL A;  1YTZ C;  1S36 A;  2KGB C;  1AHR A;  1AJ4 A;  1K90 D;  2L98 A;  1J7P A;  2OTG C;  1AUI B;  1CB1 A;  1J7Q A;  3I5H C;  4WRI A;  2MAZ A;  3CR4 X;  3IQQ A;  5HKZ A;  1NCZ A;  1MF8 B;  3VGO A;  1QV0 A;  3EVR A;  1TNX A;  2L2E A;  1YVL A;  3PLF B;  1KQV A;  1S3P A;  2Y1M A;  4MVF A;  1PRW A;  4N1G A;  2M29 A;  2M7N A;  5D69 A;  1CKK A;  5KU1 A;  4YBH B;  3SG5 A;  5GQQ C;  1SKT A;  1M63 B;  2BKI B;  4YGC B;  2BL0 C;  1CDN A;  1A2X A;  2M49 B;  1BU3 A;  1NSH A;  1FI6 A;  4CFQ A;  1UHN A;  2K2A A;  2G9B A;  3SG6 A;  1ALV A;  1HT9 A;  3DF0 A;  1KCY A;  4PHM A;  1BOD A;  4NDB A;  4MZK A;  1N2D A;  2LVI A;  3I5G C;  3TUY B;  1M45 A;  1K2H A;  1CNP A;  4TNC A;  1EG3 A;  1B47 A;  1XK4 C;  1QX2 A;  4GAO A;  2I94 A;  5CPV A;  2O5G A;  1OMD A;  5D7F A;  1A03 A;  3EKJ A;  2Q91 A;  1B7T Y;  3PN7 C;  3AKB A;  1KQM C;  1TCF A;  2COL B;  2KYF A;  1LA0 A;  1JFK A;  3JVT C;  3OB1 B;  1CMF A;  1CDM A;  1EJ3 A;  3CR5 X;  2K0J A;  1B8R A;  2MJW B;  2WC8 A;  2EC6 C;  5IBW A;  4AQJ A;  2LM5 A;  2BBM A;  3DVK A;  1TNW A;  2LLU A;  2OTG B;  1SR6 C;  3CGA A;  1KK7 Y;  2JNX A;  1MWN A;  1SL8 A;  3I5H B;  1SNL A;  4AOM A;  1SMG A;  1KWO B;  1RK9 A;  2CNP A;  2OPO A;  3BYA A;  3HCM A;  4PE1 A;  1QX5 B;  1KK8 B;  1XFY O;  1K8U A;  2KFH A;  2M1U A;  1MXL C;  3SG2 A;  3SG3 A;  4DCK A;  4YRU A;  1NIW A;  3PAL A;  1XFW O;  1IH0 A;  1AVS A;  1ZFS A;  2M8U A;  1L7Z A;  2BL0 B;  1OMR A;  1WRK A;  1JF2 A;  3KHE A;  4U8D A;  1F4O A;  3PAT A;  1WDC C;  1Q80 A;  1BOC A;  3QRX A;  4NQG A;  1S6J A;  2JUL A;  5F6T A;  3FS7 A;  2JC2 A;  4HRG A;  1MQ1 A;  2ZN9 A;  1L2O C;  2I18 A;  4PHK A;  2BE6 A;  4PE0 A;  3BUX B;  1B7T Z;  1GJY A;  3BQ3 A;  2JQ6 A;  2KDH A;  3DF0 B;  1NP8 A;  1FPW A;  1CM1 A;  2K2F A;  2F2P A;  3SJS A;  2ZFD A;  1EH2 A;  3JVT B;  2HET A;  1R6P A;  2HPS A;  2JXL A;  2JXC A;  4GGF A;  1UP5 A;  1PAL A;  3SG4 A;  2LHL A;  3VRN A;  3SIA A;  5I2L A;  1KK7 Z;  1ODB A;  2MHH A;  1V1F A;  4I5N B;  1WY9 A;  4UPG A;  4MSP A;  1UHH A;  4OCI A;  1PUL A;  5I2O A;  4L9M A;  1SW8 A;  1WLZ A;  2PMY A;  3EK7 A;  4GGF C;  4PHN A;  2KHN A;  3RM1 A;  4JPZ B;  1KFX L;  2MBX A;  1KFU L;  1D1O A;  4PDZ A;  1CLL A;  5PAL A;  5DKQ A;  1UHK A;  1DJI A;  3CZT X;  2ISD A;  4ICB A;  5KSZ A;  1F70 A;  1H8B A;  2BE4 A;  2WND A;  2H61 C;  1IQ5 A;  1OE9 B;  1Y1X A;  2Y4Q A;  4MZJ A;  3DVJ A;  1WDC B;  2FCE A;  1CFP A;  1RTP 1;  3I5F C;  2F8P A;  1K9P A;  4I5J A;  1GQM A;  1UUS A;  1SL7 A;  2JT0 A;  4GFT A;  1A75 A;  2LUX A;  3KPX A;  1YX7 A;  1NCX A;  5AAN A;  2ZKM X;  3OB2 B;  1IQ3 A;  1ZMZ A;  3DVE A;  4MN0 A;  4YI8 A;  4E68 A;  3MSE B;  2GGZ A;  1AK8 A;  1W7J B;  2WCB A;  2KBM A;  3NSO A;  2M97 A;  1U5I A;  1H4B A;  2WCE A;  1IJ6 A;  1J55 A;  1SCM C;  2NZ0 A;  1S26 D;  1CLM A;  4CPV A;  1X02 A;  1XK4 A;  1Y0V H;  1QLK A;  3BUO B;  2WOS A;  5DKR A;  3OHM B;  1NCY A;  3VRR A;  4MRX A;  3TDI A;  4C0L A;  2LHI A;  2KI6 D;  2NCO A;  4AQI A;  3BUN B;  5K89 A;  1IJ5 A;  1G33 A;  4ORA B;  1G4Y R;  2LUC A;  4HRE E;  3IF7 A;  3RLZ A;  3LL8 B;  1Y1A A;  1OQP A;  2LCP A;  2CTN A;  3D0Y A;  2QPT A;  3EVU A;  4PE7 A;  1XFZ O;  4M2P A;  4OV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...