1CDMA

Modulation of calmodulin plasticity in molecular recognition on the basis of x-ray structures
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
133
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II
publication title Modulation of calmodulin plasticity in molecular recognition on the basis of x-ray structures.
pubmed rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 46
structure length 133
sequence length 143
ec nomenclature
pdb deposition date 1993-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cdmA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cdmA02
2KI4B 1K9UA 4JWQA 2F8PA 5CSIA 1KSMA 2LMTA 2LP2A 1QVIY 2KFFA 4DRWA 3CR2A 3I5FC 4DS7A 3AKAA 1CM1A 1OMVA 3BQ3A 3MSEB 2O60A 1FF1A 2IS9A 1DJWA 1XYDA 2MHHA 4N1GA 1XVJA 3PM8A 4YGBB 5J3XA 4MZJA 1QLSA 1UHKA 2BKIB 5CPVA 1J7PA 1YTZC 3BOWB 3QRXA 3RM1A 5AERA 2FCEA 4PHKA 4I5JA 4C0LA 3TS5B 2KQYA 3I5GC 5HYDA 1KK8C 2K8MB 5CSFA 4BY4A 2BBMA 2E6WA 2EC6C 2OTGC 3IQOA 1A4PA 2F2OA 2L4IA 1YRUB 3EVVA 3LCPC 1J7OA 2JU0A 1Y6WA 1KWOB 1QTXA 1XFZO 5IBWA 1IG5A 4M2OA 2EHBA 1PRWA 3BOWA 2WCEA 1R2UA 4QJ5B 1KFUS 1EG4A 4GBAA 2KAYA 1K90D 1DVIA 2SCPA 1NCXA 2O5GA 2OS8B 5DKQA 4U8DA 1H4BA 1G33A 2MBXA 2BBNA 1XFUO 2V53A 4M2PA 1M45A 1KCYA 5D69A 1BODA 1YVLA 4CPVA 1KFXL 4GGFA 3EKHA 1JFJA 4PHNA 3PFVA 4DUQA 2KFHA 3O2PA 1IQ5A 4DCKA 1QIVA 5AXIA 1PSBA 2PALA 5I2QA 2ZN9A 4OCIA 4PDZA 2ISDA 2L4HA 3SG2A 3EK8A 1CDMA 3OX5A 2JXLA 3DVJA 3NSIA 4OKHA 2WC8A 1RFJA 4OVNF 2BL0B 1F55A 1TTXA 2L5XB 2JTZA 1SW8A 2Y1NA 2H61A 2M1KB 1CMGA 1OMRA 2PMYA 1IRJA 2LM5A 3DD4A 1NCYA 1NYAA 2M8UA 1ALWA 2LVJA 1SKTA 1CNPA 5CSNA 1XFYO 3TDUA 1DJHA 1F8HA 2CBLA 2KAVA 4BY5A 1K2HA 2F3ZA 4AQJA 3NSLA 3H4SE 4MRYA 1SMGA 5D7FA 3VRPA 1TNPA 1MQ1A 1L2OB 3SJSA 4QJ4B 1AK8A 1YVHA 3CZTX 3TUYC 1NP8A 4I5KA 1UHJA 1DJZA 3HX4A 1WLZA 1DGVA 3FIAA 4PE4A 1TN4A 2CXJA 2JTTA 1G4YR 1XK4C 3IQQA 1CFPA 3RLZA 1GQMA 3VRNA 4A4BA 2LC5A 3EVUA 3NXAA 2F33A 4PALA 2P6BB 3TDZA 2JC2A 1UHHA 4M2QA 1K9PA 2LVKA 2JPTA 4MEWA 1SL9A 3OB1B 5KU1A 3KF9A 1EJ3A 1TNQA 4YRUA 1SR6C 1JUOA 1OZSA 2ZKMX 2GGMA 4YGDB 1YRTB 5AANA 1B7TZ 3PLFB 1J1DA 1YX8A 1Y1XA 2NCPA 4I5LB 3SG5A 1DMOA 1YUUA 5F6TA 4ETOA 1XFVO 1CLBA 1IH0A 1FI5A 3O4YA 1HT9A 1WDCB 4PHJA 1GGWA 2K0JA 1B8RA 1Q80A 1IJ6A 1AJ4A 1BF5A 3JTDB 1JBAA 2FOTA 3BUNB 4N1FA 1YX7A 2TN4A 2E30A 2PASA 1QVIZ 2HQWA 2K7DA 2ZRTA 2LLSA 1S6JA 3EK7A 3FWCA 3I5GB 3SG6A 1KQMC 4FTGA 4WQ3A 2LLUA 2K7BA 2LANA 1F71A 4GNKB 1M31A 3HCMA 2JULA 4YI8A 1EG3A 2KHNA 5CSJA 3SG4A 4C0KA 2M9GA 2KI4C 4E68A 4MVFA 1RWYA 2LVVA 1NX3A 2LHIA 1DTLA 1K93D 2BCBA 1W7IB 3K21A 3ICBA 1IKUA 1YUSA 4NDBA 1DJGA 2KYCA 1BOCA 1BMOA 1XO5A 1UP5A 2A4JA 1UHNA 2RGIA 4OR9B 3CWGA 3LLEA 1C07A 2SASA 3GK2A 3CGAA 1U5IB 1JWDA 3CR4X 1NIWA 3PALA 2CTNA 1PVAA 1L7ZA 2NCOA 1KFUL 2LUCA 1YR5A 2KNEA 2Y1MA 4L9MA 3TS5C 1GGZA 2VRGA 4R1EA 1VRKA 2M49B 2JNFA 2JT0A 3CR5X 4HRHA 1CDNA 3GK4X 1WRLA 1KQVA 3OP0A 4OV2A 1TCOB 2EGDA 1QXPA 1DJIA 4YI9A 1B8LA 4DIRA 1SY9A 3JVTB 3BXKA 1KWOC 1QX7A 2BECA 3O6BA 2Q91A 2K7CA 3I5HB 1U5IA 2I18A 5K89A 4GPLB 5JOLA 1BJFA 4I5NB 1SCMB 1OE9B 1OZOA 4ORAB 5HKWA 5I2OA 2CNPA 5KSZA 1RTP1 1DT7B 1NSHA 1QATA 2BE4A 2OS8C 3GOFA 2FJUB 1B1GA 1LA0A 4AQIA 1V1GA 2COLB 2KGRA 2PVBA 3DVKA 1QLKA 1QJTA 2CT9A 2WOSA 2KBIA 1XFWO 5ER4X 3PN7C 3LK1A 3ZWHA 1K95A 1SK6D 3FWBA 2L0PA 2H61C 1CKKA 4HRGA 2JT3A 2MLFC 4JQ0D 1LKJA 4YGCB 1H8BA 1AUIB 1WRKA 3KHEA 1MXEA 1K96A 2WCBA 2JXCA 2R2IA 1F54A 1R6PA 3SIAA 4GUKA 2KI6C 1YURA 1K94A 5I2LA 2PRUA 2JNXA 1A75A 3EKJA 1IJ5A 3BUMB 1G8IA 1QX5B 3KPXA 1FW4A 3WNXB 4MLWA 1RECA 4USLA 2BL0C 3BUWB 5TNCA 4YBHB 1PK0D 5ER5A 2M0RA 3SG3A 3I5IC 1TOPA 4P5OE 4PCWA 2MA2A 4N5XA 4GFTA 2Q4UA 1J1EA 3AKBA 1QV0A 1IWQA 3FS7A 2KGBC 1SR6B 1F70A 2JOJA 1QIWA 1NX1A 1S26D 1XK4A 2BE6A 2G9BA 2LE9B 3BUXB 5HLVA 3KO0A 3WHUB 1MWNA 1YUTA 5AEQA 1ZMZA 2BKHB 2K7OA 1CB1A 1S5GY 3O78A 2KQ6A 1L2OC 4IL1A 1GJYA 1PSRA 2JZIA 2LUXA 1ODBA 2WCFA 3I5FB 1SPYA 3GK1A 3OB2B 2LP3A 1A2XA 4MBEA 5HLOA 2QPTA 1TCFA 4XJKA 1J7QA 1N65A 2LAPA 2M3WA 3CLNA 2KI6D 1BR4B 3DF0A 2ZNDA 2M7LA 1MF8B 2JT8A 4JPZB 3VGOA 2AMIA 2MJWB 1S6CA 2ZNEA 4YGAA 2BCXA 1NUBA 3OHMB 5G08A 3VRQA 3ZNIA 1S3PA 1KK7Y 4WQ2A 4FQOA 5I8NA 1SL8A 4ZCUA 2PSRA 2AAOA 4D1EA 3C1VA 2JWWA 1M39A 3TDIA 1KK8B 2DOQA 1EH2A 1K8UA 2EC6B 2OTGB 1LINA 1Y1UA 2LMVA 1KK7Z 2K61A 4C0JA 1FI6A 3SG7A 1UHIA 5PALA 3BUOB 5DKNA 4P2YB 4CFRA 1WDCC 1DF0A 3D0YB 2JRFA 1JF2A 3A8RA 4MZKA 3JTDC 1ZUZA 1TIZA 1MUXA 3AAKA 3VROA 3WHTB 4WRIA 1N2DA 2KFGA 2G2BA 1OQPA 4PHMA 1AVSA 4GAOA 1UWOA 2HF5A 2LV7A 1BU3A 3M0WA 3CTNA 1FPWA 1EL4A 1B9AA 1QASA 3E3RA 1NWDA 1A03A 1NCZA 2F2PA 3D0YA 1SYMA 3D10A 4YGEB 2HETA 3AAJA 5B8IB 2B1UA 2KAXA 1XFXO 2LLTA 3EK4A 2ZFDA 1CFCA 1WLMA 4CFQA 4GGNA 2M29A 2JQ6A 2I7AA 2I2RE 1FBVA 4GGFC 1CTRA 1LVCD 1C7WA 1IGVA 1HQVA 1KFXS 1SNLA 2F3YA 4XYNA 3NSKA 4CIDA 2NZ0A 1OSAA 2L2EA 2L98A 4TNCA 3WXAA 2HQ8A 1J55A 1JFKA 1MHOA 2H2KA 1J7RA 1PULA 3NSOA 1AHRA 1W7JB 5HKYA 3DVMA 2MRDA 1S36A 2Y5IA 1CLLA 1CDPA 1AP4A 1Y0VH 2ZRSA 4NDDA 1S1EA 3EVRA 3PN7B 3DVEA 1A75B 1LA3A 1JSAA 1QV1A 4ORBB 2MLEC 1B47A 1LXFC 3VRRA 1OOJA 2NXQA 1QS7A 2WNDA 3OX6A 3SIBA 3JVTC 3LK0A 1E8AA 5HKZA 1M46A 2GGZA 2BCAA 1Y1AA 3TZ1A 4PE1A 3I5HC 1XA5A 2L51A 1UUSA 2ZN8A 1F4OA 3TUYB 2D8NA 1QX2A 2HPSA 4ICBA 1PVBA 1SCMC 1N0YA 1JC2A 5FYXA 1SCVA 1BG1A 1D1OA 3F45A 1B4CA 1K9KA 1M63B 3IF7A 1SRAA 2M1UA 2LMUA 2KBMA 3I5IB 4MSPA 5DKRA 2CCMA 2OPOA 3PSRA 4CLNA 5BPJA 3KEVA 2LVIA 1V1FA 1X02A 1WY9A 3PATA 1NX0A 1RK9A 1OMDA 1CM4A 2KYFA 2AUCA 2LNKA 4NDCA 4MZLA 1TRFA 1TNXA 2KOTA 3A4UB 4XJKB 1CFFA 2WORA 2K2FA 2MAZA 1NPQA 2LCPA 1CFDA 1TNWA 2QACA 1PALA 3DF0B 4Q04A 4QJ3B 2FCDA 4HREE 1SL7A 4PE7A 4PE0A 1WRZA 4AOMA 5JJGA 2NLNA 4A4CA 1F4QA 4HSZA 4ORCB 1IQ3A 1SBJA 3LL8B 1BLQA 1CDLA 1DJXA 1MXLC 1A29A 2K2AA 2KDHA 4NQGA 1AJ5A 1S5GZ 1JF0A 4MRXA 1DJYA 2M7NA 1C7VA 1MR8A 1S6IA 2L50A 1B7TY 2Y4QA 4ZCVA 5KTYA 1B8CA 5AFPA 2GV5A 1BT6A 5GQQC 1RJVA 3BYAA 1ALVA 2KSPA 1RROA 1UURA 1KQMB 2M97A 3CS1A 1DF0B 4F0ZB 2LHLA 1KSOA 4MN0A 1NX2A 1BR1B 1EXRA 1ZACA 4UPGA 1ZFSA 1DGUA 2I94A 1CLMA 1ZOTB 1CMFA
chains in the Genus database with same CATH superfamily
2KI4B 1K9UA 4JWQA 2F8PA 5CSIA 1KSMA 2LMTA 2LP2A 1QVIY 2KFFA 4DRWA 3S0BA 3CR2A 3I5FC 4DS7A 3AKAA 1CM1A 1OMVA 3BQ3A 3FE6A 3MSEB 3BJHA 2O60A 1FF1A 2IS9A 3BFBA 1DJWA 1XYDA 2MHHA 2QEBA 4N1GA 1XVJA 3PM8A 4YGBB 5J3XA 4MZJA 1QLSA 1UHKA 2BKIB 3SS4A 5CPVA 1J7PA 1YTZC 3BOWB 3QRXA 3RM1A 5AERA 2FCEA 4PHKA 2WCMA 4I5JA 4C0LA 3TS5B 2KQYA 3I5GC 5HYDA 1KK8C 2K8MB 5CSFA 4BY4A 2BBMA 2E6WA 2EC6C 2OTGC 3IQOA 1A4PA 2F2OA 2L4IA 1YRUB 3EVVA 3LCPC 1J7OA 3R1PA 2JU0A 1Y6WA 1KWOB 1QTXA 1XFZO 5IBWA 1IG5A 4M2OA 2EHBA 1PRWA 3BOWA 2WCEA 1R2UA 4QJ5B 1KFUS 1EG4A 4GBAA 2KAYA 1K90D 1DVIA 2SCPA 1NCXA 2O5GA 2OS8B 5DKQA 4U8DA 3DZTA 1H4BA 1G33A 2MBXA 2BBNA 1XFUO 2V53A 4M2PA 1M45A 1KCYA 4JKTA 5D69A 1BODA 1YVLA 4CPVA 1KFXL 2L5YA 1DEKA 4GGFA 3EG5B 3EKHA 1JFJA 4PHNA 2WCKA 1P28A 3PFVA 4DUQA 2KFHA 3O2PA 1IQ5A 4DCKA 1QIVA 5AXIA 1PSBA 2PALA 5I2QA 2ZN9A 4OCIA 4PDZA 3S0EA 2ISDA 2L4HA 3SG2A 2BAPA 1CDMA 3EK8A 2JXLA 3OX5A 3BFAA 3DVJA 3NSIA 4OKHA 2WC8A 1RFJA 4OVNF 2BL0B 1F55A 1TTXA 2L5XB 2JTZA 1SW8A 2Y1NA 2H61A 2M1KB 1CMGA 1OMRA 2PMYA 1IRJA 2LM5A 3DD4A 1NCYA 1NYAA 2M8UA 1ALWA 2LVJA 1SKTA 1CNPA 5CSNA 1XFYO 3TDUA 4INWA 1DJHA 1F8HA 2CBLA 2KAVA 4BY5A 1K2HA 3CDNA 2F3ZA 4AQJA 3NSLA 3H4SE 4MRYA 2FJYA 1SMGA 5D7FA 3VRPA 1TNPA 1MQ1A 1L2OB 3SJSA 4QJ4B 1AK8A 1YVHA 3CZTX 3TUYC 1NP8A 4I5KA 1UHJA 1DJZA 3HX4A 1WLZA 1DGVA 3FIAA 1OOHA 4PE4A 1TN4A 2CXJA 2JTTA 1G4YR 1XK4C 3IQQA 1CFPA 3RLZA 1GQMA 3VRNA 1IIOA 4A4BA 2LC5A 3K1EA 4IJ7A 3EVUA 3NXAA 2F33A 4PALA 2P6BB 3TDZA 2JC2A 1UHHA 1DELA 4M2QA 1K9PA 2LVKA 2JPTA 4MEWA 1SL9A 3OB1B 5KU1A 4OZDA 3KF9A 1EJ3A 1TNQA 4YRUA 1SR6C 1JUOA 1OZSA 3FE9A 2ZKMX 2GGMA 3PM2A 3O4XA 4YGDB 1YRTB 1GM0A 1TWOA 5AANA 1B7TZ 3PLFB 2GTEA 1J1DA 1YX8A 2QEVA 1Y1XA 2NCPA 1LS8A 1OOFA 4I5LB 3SG5A 3B7AA 1DMOA 1YUUA 3R1OA 5F6TA 4ETOA 1XFVO 1CLBA 1IH0A 3CZ2A 3L4LA 3O4YA 1HT9A 1WDCB 4PHJA 1FI5A 1GGWA 2K0JA 3CYZA 1B8RA 1Q80A 1IJ6A 1AJ4A 1BF5A 3JTDB 1JBAA 2FOTA 3BUNB 4N1FA 1SSEB 1YX7A 2TN4A 2E30A 2PASA 1QVIZ 2HQWA 2K7DA 2ZRTA 2LLSA 1S6JA 1OOGA 3D76A 3EK7A 3FWCA 3I5GB 3SG6A 1KQMC 4FTGA 4WQ3A 2LLUA 2K7BA 2LANA 1F71A 4GNKB 1M31A 3HCMA 2JULA 4YI8A 1EG3A 2KHNA 5CSJA 3SG4A 4C0KA 3CABA 3B88A 5FI7A 2PYQA 2M9GA 2KI4C 4E68A 4MVFA 1RWYA 2LVVA 1NX3A 2LHIA 1DTLA 1K93D 2BCBA 1W7IB 3K21A 3ICBA 1IKUA 1YUSA 4NDBA 1DJGA 2KYCA 1BOCA 1BMOA 1XO5A 1UP5A 2A4JA 1UHNA 1XFRA 2RGIA 3CWGA 4OR9B 3LLEA 1C07A 2SASA 3GK2A 2H8VA 3CGAA 3D73A 1U5IB 1JWDA 3CR4X 1NIWA 3PALA 2CTNA 1PVAA 1L7ZA 2NCOA 1KFUL 2LUCA 4KYNA 1YR5A 2KNEA 2Y1MA 4L9MA 3TS5C 1GGZA 2VRGA 2QDIA 4R1EA 1VRKA 2M49B 2JNFA 2JT0A 3CR5X 3Q8IA 4HRHA 1CDNA 3GK4X 1WRLA 1KQVA 3S0GA 5I94A 3OP0A 4OV2A 1TCOB 2EGDA 1QXPA 1DJIA 4YI9A 1B8LA 4DIRA 1SY9A 3JVTB 3BXKA 1KWOC 3NHIA 1QX7A 2BECA 3N7HA 2Q91A 3O6BA 2K7CA 3I5HB 1U5IA 2I18A 5K89A 4GPLB 5JOLA 1BJFA 4I5NB 1SCMB 3S0DA 1OE9B 1OZOA 4ORAB 5HKWA 5I2OA 2CNPA 5KSZA 1RTP1 1DT7B 1NSHA 1QATA 3CZ0A 2BE4A 2OS8C 3GOFA 2FJUB 1B1GA 1LA0A 4AQIA 1V1GA 2COLB 2KGRA 2PVBA 3VB1A 1TUZA 3B6XA 3DVKA 1QLKA 1QJTA 2CT9A 2WCHA 2WOSA 2KBIA 1XFWO 5ER4X 3PN7C 1TUJA 3LK1A 3ZWHA 1K95A 1SK6D 3FWBA 2L0PA 2H61C 1CKKA 4HRGA 2JT3A 2MLFC 4JQ0D 1LKJA 4YGCB 1H8BA 1AUIB 1WRKA 3KHEA 1MXEA 1K96A 2WCBA 2JXCA 2R2IA 1F54A 1R6PA 3SIAA 4GUKA 2BNXA 2KI6C 1YURA 1K94A 5I2LA 2PRUA 2JNXA 1A75A 3EKJA 1IJ5A 3BUMB 1G8IA 1QX5B 3KPXA 1FW4A 3WNXB 4MLWA 1RECA 4USLA 2BL0C 3BUWB 5TNCA 4YBHB 1PK0D 5ER5A 2M0RA 3SG3A 3I5IC 5HL1A 1TOPA 3D77A 4P5OE 4PCWA 3V2LA 2MA2A 3R72A 4N5XA 4GFTA 2Q4UA 1J1EA 3AKBA 1QV0A 2KLEA 1IWQA 3FS7A 2KGBC 1SR6B 4F7FA 1F70A 2JOJA 1QIWA 1NX1A 1S26D 1XK4A 2BE6A 2G9BA 2JPOA 2LE9B 3BUXB 3KO0A 5HLVA 1MWNA 3WHUB 3S0FA 1YUTA 5AEQA 1ZMZA 2BKHB 2K7OA 3D75A 1CB1A 1S5GY 3O78A 2KQ6A 1L2OC 4IL1A 1GJYA 1PSRA 2JZIA 2YGUA 2LUXA 1ODBA 2WCFA 3I5FB 1SPYA 2QEOA 3GK1A 3OB2B 2LP3A 1A2XA 4MBEA 5HLOA 2QPTA 1TCFA 4XJKA 1J7QA 1N65A 2LAPA 2M3WA 3CLNA 2KI6D 1BR4B 3DF0A 2ZNDA 2M7LA 1MF8B 2JT8A 4JPZB 3VGOA 2AMIA 2MJWB 1S6CA 2ZNEA 4YGAA 2BCXA 1NUBA 3OHMB 5G08A 3VRQA 3ZNIA 1S3PA 1KK7Y 4WQ2A 4FQOA 5I8NA 1SL8A 4ZCUA 2PSRA 1OW4A 2AAOA 4D1EA 3C1VA 2JWWA 1M39A 3TDIA 1KK8B 2DOQA 1OOIX 3L4AA 1EH2A 1K8UA 2EC6B 2OTGB 3SS3A 1LINA 1Y1UA 2LMVA 1KK7Z 2K61A 4C0JA 1FI6A 3D74A 3SG7A 1UHIA 5PALA 2P71A 2WC5A 3BUOB 5D3OA 5DKNA 4P2YB 4CFRA 1WDCC 1Z4HA 1DF0A 3D0YB 2JRFA 1ORGA 1JF2A 3A8RA 4MZKA 3JTDC 3DXLA 1ZUZA 1TIZA 1MUXA 3AAKA 3OBVA 3VROA 3WHTB 4WRIA 1N2DA 2KFGA 3QMEA 2G2BA 3CZ1A 3NHTA 1OQPA 4PHMA 1AVSA 4GAOA 1UWOA 2HF5A 2LV7A 1BU3A 3M0WA 3CTNA 3NGVA 1FPWA 1EL4A 1B9AA 1QASA 3E3RA 1NWDA 2P70A 1A03A 1NCZA 2F2PA 1DQEA 3D0YA 1SYMA 3D10A 4YGEB 3DYEA 2HETA 3AAJA 5B8IB 2B1UA 2KAXA 1XFXO 2LLTA 3EK4A 2ZFDA 2WCLA 1CFCA 1WLMA 4CFQA 4GGNA 2L2CA 2ERBA 2M29A 2JQ6A 2I7AA 2I2RE 1FBVA 4GGFC 1CTRA 1LVCD 1C7WA 1IGVA 1HQVA 1KFXS 1SNLA 2F3YA 4XYNA 3NSKA 2K60A 4CIDA 2NZ0A 1OSAA 2L2EA 2KLDA 2L98A 4TNCA 3WXAA 1C3ZA 2HQ8A 1J55A 1JFKA 1MHOA 2H2KA 1J7RA 3L47A 1PULA 3NSOA 1AHRA 1W7JB 5HKYA 3DVMA 2MRDA 1S36A 2Y5IA 1CLLA 1CDPA 3R1VA 1AP4A 1Z2CB 1Y0VH 2ZRSA 4NDDA 1S1EA 3EVRA 3PN7B 3DVEA 1A75B 1LA3A 1JSAA 1QV1A 4ORBB 2MLEC 1B47A 1DC1A 1LXFC 3VRRA 1OOJA 2NXQA 1QS7A 2WNDA 3OX6A 3SIBA 3JVTC 3LK0A 1E8AA 5HKZA 1W9ZA 1M46A 5EL2A 2GGZA 2BCAA 1Y1AA 3TZ1A 3S0AA 3B86A 4PE1A 3I5HC 1XA5A 2L51A 1UUSA 2KPHA 1F4OA 2ZN8A 2D8NA 1QX2A 3TUYB 2HPSA 4ICBA 5FI2A 1PVBA 1SCMC 1N0YA 1JC2A 5FYXA 1SCVA 1BG1A 1D1OA 3F45A 1B4CA 1K9KA 1M63B 1T14A 1C3YA 3IF7A 1SRAA 2M1UA 2LMUA 2KBMA 3I5IB 4MSPA 5DKRA 2CCMA 2OPOA 3PSRA 4PT1A 4CLNA 5BPJA 3KEVA 3OGNA 2LVIA 1V1FA 1X02A 1QWVA 1WY9A 3PATA 1NX0A 3B87A 3UNWA 1RK9A 1OMDA 1CM4A 2KYFA 2AUCA 2LNKA 4NDCA 4MZLA 1TRFA 1TNXA 2KOTA 3A4UB 4XJKB 1CFFA 2WORA 3PJIA 2K2FA 2MAZA 1NPQA 2LCPA 1CFDA 1TNWA 2QACA 1PALA 3DF0B 4Q04A 4QJ3B 3SS5A 2FCDA 4HREE 1SL7A 4PE7A 4PE0A 3FE8A 1WRZA 4AOMA 2WCJA 5JJGA 2NLNA 4JD9A 5FI6A 4A4CA 1F4QA 4HSZA 4ORCB 2WC6A 3UO9A 3DY9A 1IQ3A 1SBJA 3LL8B 3RZSA 1BLQA 1CDLA 1DJXA 1MXLC 1A29A 2K2AA 2KDHA 4NQGA 1AJ5A 3IVTA 2PQLA 1S5GZ 1JF0A 4MRXA 1DJYA 2M7NA 3BFHA 1MR8A 1S6IA 1C7VA 2L50A 1B7TY 2Y4QA 4ZCVA 4INXA 5KTYA 1B8CA 5AFPA 3D78A 2GV5A 1BT6A 5GQQC 1RJVA 3BYAA 5DICA 1ALVA 2KSPA 1RROA 1UURA 1KQMB 2M97A 3CS1A 1DF0B 4F0ZB 2LHLA 2QEHA 1KSOA 4MN0A 1NX2A 1BR1B 1EXRA 1ZACA 4UPGA 1ZFSA 1DGUA 4FQTA 2I94A 1CLMA 1ZOTB 1CMFA
chains in the Genus database with same CATH topology
2KI4B 1K9UA 4JWQA 2F8PA 5CSIA 1KSMA 2LMTA 2LP2A 1QVIY 2KFFA 4DRWA 3CR2A 3I5FC 4DS7A 3AKAA 1CM1A 1OMVA 3BQ3A 3MSEB 2O60A 1FF1A 2IS9A 1DJWA 1XYDA 2MHHA 4N1GA 1XVJA 3PM8A 4YGBB 5J3XA 4MZJA 1QLSA 1UHKA 2BKIB 5CPVA 1J7PA 1YTZC 3BOWB 3QRXA 3RM1A 5AERA 2FCEA 4PHKA 4I5JA 4C0LA 3TS5B 2KQYA 3I5GC 5HYDA 1KK8C 2K8MB 5CSFA 4BY4A 2BBMA 2E6WA 2EC6C 2OTGC 3IQOA 1A4PA 2F2OA 2L4IA 1YRUB 3EVVA 3LCPC 1J7OA 2JU0A 1Y6WA 1KWOB 1QTXA 1XFZO 5IBWA 1IG5A 4M2OA 2EHBA 1PRWA 3BOWA 2WCEA 1R2UA 4QJ5B 1KFUS 1EG4A 4GBAA 2KAYA 1K90D 1DVIA 2SCPA 1NCXA 2O5GA 2OS8B 5DKQA 4U8DA 1H4BA 1G33A 2MBXA 2BBNA 1XFUO 2V53A 4M2PA 1M45A 1KCYA 5D69A 1BODA 1YVLA 4CPVA 1KFXL 4GGFA 3EKHA 1JFJA 4PHNA 3PFVA 4DUQA 2KFHA 3O2PA 1IQ5A 4DCKA 1QIVA 5AXIA 1PSBA 2PALA 5I2QA 2ZN9A 4OCIA 4PDZA 2ISDA 2L4HA 3SG2A 3EK8A 1CDMA 3OX5A 2JXLA 3DVJA 3NSIA 4OKHA 2WC8A 1RFJA 4OVNF 2BL0B 1F55A 1TTXA 2L5XB 2JTZA 1SW8A 2Y1NA 2H61A 2M1KB 1CMGA 1OMRA 2PMYA 1IRJA 2LM5A 3DD4A 1NCYA 1NYAA 2M8UA 1ALWA 2LVJA 1SKTA 1CNPA 5CSNA 1XFYO 3TDUA 1DJHA 1F8HA 2CBLA 2KAVA 4BY5A 1K2HA 2F3ZA 4AQJA 3NSLA 3H4SE 4MRYA 1SMGA 5D7FA 3VRPA 1TNPA 1MQ1A 1L2OB 3SJSA 4QJ4B 1AK8A 1YVHA 3CZTX 3TUYC 1NP8A 4I5KA 1UHJA 1DJZA 3HX4A 1WLZA 1DGVA 3FIAA 4PE4A 1TN4A 2CXJA 2JTTA 1G4YR 1XK4C 3IQQA 1CFPA 3RLZA 1GQMA 3VRNA 4A4BA 2LC5A 3EVUA 3NXAA 2F33A 4PALA 2P6BB 3TDZA 2JC2A 1UHHA 4M2QA 1K9PA 2LVKA 2JPTA 4MEWA 1SL9A 3OB1B 5KU1A 3KF9A 1EJ3A 1TNQA 4YRUA 1SR6C 1JUOA 1OZSA 2ZKMX 2GGMA 4YGDB 1YRTB 5AANA 1B7TZ 3PLFB 1J1DA 1YX8A 1Y1XA 2NCPA 4I5LB 3SG5A 1DMOA 1YUUA 5F6TA 4ETOA 1XFVO 1CLBA 1IH0A 1FI5A 3O4YA 1HT9A 1WDCB 4PHJA 1GGWA 2K0JA 1B8RA 1Q80A 1IJ6A 1AJ4A 1BF5A 3JTDB 1JBAA 2FOTA 3BUNB 4N1FA 1YX7A 2TN4A 2E30A 2PASA 1QVIZ 2HQWA 2K7DA 2ZRTA 2LLSA 1S6JA 3EK7A 3FWCA 3I5GB 3SG6A 1KQMC 4FTGA 4WQ3A 2LLUA 2K7BA 2LANA 1F71A 4GNKB 1M31A 3HCMA 2JULA 4YI8A 1EG3A 2KHNA 5CSJA 3SG4A 4C0KA 2M9GA 2KI4C 4E68A 4MVFA 1RWYA 2LVVA 1NX3A 2LHIA 1DTLA 1K93D 2BCBA 1W7IB 3K21A 3ICBA 1IKUA 1YUSA 4NDBA 1DJGA 2KYCA 1BOCA 1BMOA 1XO5A 1UP5A 2A4JA 1UHNA 2RGIA 4OR9B 3CWGA 3LLEA 1C07A 2SASA 3GK2A 3CGAA 1U5IB 1JWDA 3CR4X 1NIWA 3PALA 2CTNA 1PVAA 1L7ZA 2NCOA 1KFUL 2LUCA 1YR5A 2KNEA 2Y1MA 4L9MA 3TS5C 1GGZA 2VRGA 4R1EA 1VRKA 2M49B 2JNFA 2JT0A 3CR5X 4HRHA 1CDNA 3GK4X 1WRLA 1KQVA 3OP0A 4OV2A 1TCOB 2EGDA 1QXPA 1DJIA 4YI9A 1B8LA 4DIRA 1SY9A 3JVTB 3BXKA 1KWOC 1QX7A 2BECA 3O6BA 2Q91A 2K7CA 3I5HB 1U5IA 2I18A 5K89A 4GPLB 5JOLA 1BJFA 4I5NB 1SCMB 1OE9B 1OZOA 4ORAB 5HKWA 5I2OA 2CNPA 5KSZA 1RTP1 1DT7B 1NSHA 1QATA 2BE4A 2OS8C 3GOFA 2FJUB 1B1GA 1LA0A 4AQIA 1V1GA 2COLB 2KGRA 2PVBA 3DVKA 1QLKA 1QJTA 2CT9A 2WOSA 2KBIA 1XFWO 5ER4X 3PN7C 3LK1A 3ZWHA 1K95A 1SK6D 3FWBA 2L0PA 2H61C 1CKKA 4HRGA 2JT3A 2MLFC 4JQ0D 1LKJA 4YGCB 1H8BA 1AUIB 1WRKA 3KHEA 1MXEA 1K96A 2WCBA 2JXCA 2R2IA 1F54A 1R6PA 3SIAA 4GUKA 2KI6C 1YURA 1K94A 5I2LA 2PRUA 2JNXA 1A75A 3EKJA 1IJ5A 3BUMB 1G8IA 1QX5B 3KPXA 1FW4A 3WNXB 4MLWA 1RECA 4USLA 2BL0C 3BUWB 5TNCA 4YBHB 1PK0D 5ER5A 2M0RA 3SG3A 3I5IC 1TOPA 4P5OE 4PCWA 2MA2A 4N5XA 4GFTA 2Q4UA 1J1EA 3AKBA 1QV0A 1IWQA 3FS7A 2KGBC 1SR6B 1F70A 2JOJA 1QIWA 1NX1A 1S26D 1XK4A 2BE6A 2G9BA 2LE9B 3BUXB 5HLVA 3KO0A 3WHUB 1MWNA 1YUTA 5AEQA 1ZMZA 2BKHB 2K7OA 1CB1A 1S5GY 3O78A 2KQ6A 1L2OC 4IL1A 1GJYA 1PSRA 2JZIA 2LUXA 1ODBA 2WCFA 3I5FB 1SPYA 3GK1A 3OB2B 2LP3A 1A2XA 4MBEA 5HLOA 2QPTA 1TCFA 4XJKA 1J7QA 1N65A 2LAPA 2M3WA 3CLNA 2KI6D 1BR4B 3DF0A 2ZNDA 2M7LA 1MF8B 2JT8A 4JPZB 3VGOA 2AMIA 2MJWB 1S6CA 2ZNEA 4YGAA 2BCXA 1NUBA 3OHMB 5G08A 3VRQA 3ZNIA 1S3PA 1KK7Y 4WQ2A 4FQOA 5I8NA 1SL8A 4ZCUA 2PSRA 2AAOA 4D1EA 3C1VA 2JWWA 1M39A 3TDIA 1KK8B 2DOQA 1EH2A 1K8UA 2EC6B 2OTGB 1LINA 1Y1UA 2LMVA 1KK7Z 2K61A 4C0JA 1FI6A 3SG7A 1UHIA 5PALA 3BUOB 5DKNA 4P2YB 4CFRA 1WDCC 1DF0A 3D0YB 2JRFA 1JF2A 3A8RA 4MZKA 3JTDC 1ZUZA 1TIZA 1MUXA 3AAKA 3VROA 3WHTB 4WRIA 1N2DA 2KFGA 2G2BA 1OQPA 4PHMA 1AVSA 4GAOA 1UWOA 2HF5A 2LV7A 1BU3A 3M0WA 3CTNA 1FPWA 1EL4A 1B9AA 1QASA 3E3RA 1NWDA 1A03A 1NCZA 2F2PA 3D0YA 1SYMA 3D10A 4YGEB 2HETA 3AAJA 5B8IB 2B1UA 2KAXA 1XFXO 2LLTA 3EK4A 2ZFDA 1CFCA 1WLMA 4CFQA 4GGNA 2M29A 2JQ6A 2I7AA 2I2RE 1FBVA 4GGFC 1CTRA 1LVCD 1C7WA 1IGVA 1HQVA 1KFXS 1SNLA 2F3YA 4XYNA 3NSKA 4CIDA 2NZ0A 1OSAA 2L2EA 2L98A 4TNCA 3WXAA 2HQ8A 1J55A 1JFKA 1MHOA 2H2KA 1J7RA 1PULA 3NSOA 1AHRA 1W7JB 5HKYA 3DVMA 2MRDA 1S36A 2Y5IA 1CLLA 1CDPA 1AP4A 1Y0VH 2ZRSA 4NDDA 1S1EA 3EVRA 3PN7B 3DVEA 1A75B 1LA3A 1JSAA 1QV1A 4ORBB 2MLEC 1B47A 1LXFC 3VRRA 1OOJA 2NXQA 1QS7A 2WNDA 3OX6A 3SIBA 3JVTC 3LK0A 1E8AA 5HKZA 1M46A 2GGZA 2BCAA 1Y1AA 3TZ1A 4PE1A 3I5HC 1XA5A 2L51A 1UUSA 2ZN8A 1F4OA 3TUYB 2D8NA 1QX2A 2HPSA 4ICBA 1PVBA 1SCMC 1N0YA 1JC2A 5FYXA 1SCVA 1BG1A 1D1OA 3F45A 1B4CA 1K9KA 1M63B 3IF7A 1SRAA 2M1UA 2LMUA 2KBMA 3I5IB 4MSPA 5DKRA 2CCMA 2OPOA 3PSRA 4CLNA 5BPJA 3KEVA 2LVIA 1V1FA 1X02A 1WY9A 3PATA 1NX0A 1RK9A 1OMDA 1CM4A 2KYFA 2AUCA 2LNKA 4NDCA 4MZLA 1TRFA 1TNXA 2KOTA 3A4UB 4XJKB 1CFFA 2WORA 2K2FA 2MAZA 1NPQA 2LCPA 1CFDA 1TNWA 2QACA 1PALA 3DF0B 4Q04A 4QJ3B 2FCDA 4HREE 1SL7A 4PE7A 4PE0A 1WRZA 4AOMA 5JJGA 2NLNA 4A4CA 1F4QA 4HSZA 4ORCB 1IQ3A 1SBJA 3LL8B 1BLQA 1CDLA 1DJXA 1MXLC 1A29A 2K2AA 2KDHA 4NQGA 1AJ5A 1S5GZ 1JF0A 4MRXA 1DJYA 2M7NA 1C7VA 1MR8A 1S6IA 2L50A 1B7TY 2Y4QA 4ZCVA 5KTYA 1B8CA 5AFPA 2GV5A 1BT6A 5GQQC 1RJVA 3BYAA 1ALVA 2KSPA 1RROA 1UURA 1KQMB 2M97A 3CS1A 1DF0B 4F0ZB 2LHLA 1KSOA 4MN0A 1NX2A 1BR1B 1EXRA 1ZACA 4UPGA 1ZFSA 1DGUA 2I94A 1CLMA 1ZOTB 1CMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI4 B;  1K9U A;  4JWQ A;  2F8P A;  5CSI A;  1KSM A;  2LMT A;  2LP2 A;  1QVI Y;  2KFF A;  4DRW A;  3CR2 A;  3I5F C;  4DS7 A;  3AKA A;  1CM1 A;  1OMV A;  3BQ3 A;  3MSE B;  2O60 A;  1FF1 A;  2IS9 A;  1DJW A;  1XYD A;  2MHH A;  4N1G A;  1XVJ A;  3PM8 A;  4YGB B;  5J3X A;  4MZJ A;  1QLS A;  1UHK A;  2BKI B;  5CPV A;  1J7P A;  1YTZ C;  3BOW B;  3QRX A;  3RM1 A;  5AER A;  2FCE A;  4PHK A;  4I5J A;  4C0L A;  3TS5 B;  2KQY A;  3I5G C;  5HYD A;  1KK8 C;  2K8M B;  5CSF A;  4BY4 A;  2BBM A;  2E6W A;  2EC6 C;  2OTG C;  3IQO A;  1A4P A;  2F2O A;  2L4I A;  1YRU B;  3EVV A;  3LCP C;  1J7O A;  2JU0 A;  1Y6W A;  1KWO B;  1QTX A;  1XFZ O;  5IBW A;  1IG5 A;  4M2O A;  2EHB A;  1PRW A;  3BOW A;  2WCE A;  1R2U A;  4QJ5 B;  1KFU S;  1EG4 A;  4GBA A;  2KAY A;  1K90 D;  1DVI A;  2SCP A;  1NCX A;  2O5G A;  2OS8 B;  5DKQ A;  4U8D A;  1H4B A;  1G33 A;  2MBX A;  2BBN A;  1XFU O;  2V53 A;  4M2P A;  1M45 A;  1KCY A;  5D69 A;  1BOD A;  1YVL A;  4CPV A;  1KFX L;  4GGF A;  3EKH A;  1JFJ A;  4PHN A;  3PFV A;  4DUQ A;  2KFH A;  3O2P A;  1IQ5 A;  4DCK A;  1QIV A;  5AXI A;  1PSB A;  2PAL A;  5I2Q A;  2ZN9 A;  4OCI A;  4PDZ A;  2ISD A;  2L4H A;  3SG2 A;  3EK8 A;  1CDM A;  3OX5 A;  2JXL A;  3DVJ A;  3NSI A;  4OKH A;  2WC8 A;  1RFJ A;  4OVN F;  2BL0 B;  1F55 A;  1TTX A;  2L5X B;  2JTZ A;  1SW8 A;  2Y1N A;  2H61 A;  2M1K B;  1CMG A;  1OMR A;  2PMY A;  1IRJ A;  2LM5 A;  3DD4 A;  1NCY A;  1NYA A;  2M8U A;  1ALW A;  2LVJ A;  1SKT A;  1CNP A;  5CSN A;  1XFY O;  3TDU A;  1DJH A;  1F8H A;  2CBL A;  2KAV A;  4BY5 A;  1K2H A;  2F3Z A;  4AQJ A;  3NSL A;  3H4S E;  4MRY A;  1SMG A;  5D7F A;  3VRP A;  1TNP A;  1MQ1 A;  1L2O B;  3SJS A;  4QJ4 B;  1AK8 A;  1YVH A;  3CZT X;  3TUY C;  1NP8 A;  4I5K A;  1UHJ A;  1DJZ A;  3HX4 A;  1WLZ A;  1DGV A;  3FIA A;  4PE4 A;  1TN4 A;  2CXJ A;  2JTT A;  1G4Y R;  1XK4 C;  3IQQ A;  1CFP A;  3RLZ A;  1GQM A;  3VRN A;  4A4B A;  2LC5 A;  3EVU A;  3NXA A;  2F33 A;  4PAL A;  2P6B B;  3TDZ A;  2JC2 A;  1UHH A;  4M2Q A;  1K9P A;  2LVK A;  2JPT A;  4MEW A;  1SL9 A;  3OB1 B;  5KU1 A;  3KF9 A;  1EJ3 A;  1TNQ A;  4YRU A;  1SR6 C;  1JUO A;  1OZS A;  2ZKM X;  2GGM A;  4YGD B;  1YRT B;  5AAN A;  1B7T Z;  3PLF B;  1J1D A;  1YX8 A;  1Y1X A;  2NCP A;  4I5L B;  3SG5 A;  1DMO A;  1YUU A;  5F6T A;  4ETO A;  1XFV O;  1CLB A;  1IH0 A;  1FI5 A;  3O4Y A;  1HT9 A;  1WDC B;  4PHJ A;  1GGW A;  2K0J A;  1B8R A;  1Q80 A;  1IJ6 A;  1AJ4 A;  1BF5 A;  3JTD B;  1JBA A;  2FOT A;  3BUN B;  4N1F A;  1YX7 A;  2TN4 A;  2E30 A;  2PAS A;  1QVI Z;  2HQW A;  2K7D A;  2ZRT A;  2LLS A;  1S6J A;  3EK7 A;  3FWC A;  3I5G B;  3SG6 A;  1KQM C;  4FTG A;  4WQ3 A;  2LLU A;  2K7B A;  2LAN A;  1F71 A;  4GNK B;  1M31 A;  3HCM A;  2JUL A;  4YI8 A;  1EG3 A;  2KHN A;  5CSJ A;  3SG4 A;  4C0K A;  2M9G A;  2KI4 C;  4E68 A;  4MVF A;  1RWY A;  2LVV A;  1NX3 A;  2LHI A;  1DTL A;  1K93 D;  2BCB A;  1W7I B;  3K21 A;  3ICB A;  1IKU A;  1YUS A;  4NDB A;  1DJG A;  2KYC A;  1BOC A;  1BMO A;  1XO5 A;  1UP5 A;  2A4J A;  1UHN A;  2RGI A;  4OR9 B;  3CWG A;  3LLE A;  1C07 A;  2SAS A;  3GK2 A;  3CGA A;  1U5I B;  1JWD A;  3CR4 X;  1NIW A;  3PAL A;  2CTN A;  1PVA A;  1L7Z A;  2NCO A;  1KFU L;  2LUC A;  1YR5 A;  2KNE A;  2Y1M A;  4L9M A;  3TS5 C;  1GGZ A;  2VRG A;  4R1E A;  1VRK A;  2M49 B;  2JNF A;  2JT0 A;  3CR5 X;  4HRH A;  1CDN A;  3GK4 X;  1WRL A;  1KQV A;  3OP0 A;  4OV2 A;  1TCO B;  2EGD A;  1QXP A;  1DJI A;  4YI9 A;  1B8L A;  4DIR A;  1SY9 A;  3JVT B;  3BXK A;  1KWO C;  1QX7 A;  2BEC A;  3O6B A;  2Q91 A;  2K7C A;  3I5H B;  1U5I A;  2I18 A;  5K89 A;  4GPL B;  5JOL A;  1BJF A;  4I5N B;  1SCM B;  1OE9 B;  1OZO A;  4ORA B;  5HKW A;  5I2O A;  2CNP A;  5KSZ A;  1RTP 1;  1DT7 B;  1NSH A;  1QAT A;  2BE4 A;  2OS8 C;  3GOF A;  2FJU B;  1B1G A;  1LA0 A;  4AQI A;  1V1G A;  2COL B;  2KGR A;  2PVB A;  3DVK A;  1QLK A;  1QJT A;  2CT9 A;  2WOS A;  2KBI A;  1XFW O;  5ER4 X;  3PN7 C;  3LK1 A;  3ZWH A;  1K95 A;  1SK6 D;  3FWB A;  2L0P A;  2H61 C;  1CKK A;  4HRG A;  2JT3 A;  2MLF C;  4JQ0 D;  1LKJ A;  4YGC B;  1H8B A;  1AUI B;  1WRK A;  3KHE A;  1MXE A;  1K96 A;  2WCB A;  2JXC A;  2R2I A;  1F54 A;  1R6P A;  3SIA A;  4GUK A;  2KI6 C;  1YUR A;  1K94 A;  5I2L A;  2PRU A;  2JNX A;  1A75 A;  3EKJ A;  1IJ5 A;  3BUM B;  1G8I A;  1QX5 B;  3KPX A;  1FW4 A;  3WNX B;  4MLW A;  1REC A;  4USL A;  2BL0 C;  3BUW B;  5TNC A;  4YBH B;  1PK0 D;  5ER5 A;  2M0R A;  3SG3 A;  3I5I C;  1TOP A;  4P5O E;  4PCW A;  2MA2 A;  4N5X A;  4GFT A;  2Q4U A;  1J1E A;  3AKB A;  1QV0 A;  1IWQ A;  3FS7 A;  2KGB C;  1SR6 B;  1F70 A;  2JOJ A;  1QIW A;  1NX1 A;  1S26 D;  1XK4 A;  2BE6 A;  2G9B A;  2LE9 B;  3BUX B;  5HLV A;  3KO0 A;  3WHU B;  1MWN A;  1YUT A;  5AEQ A;  1ZMZ A;  2BKH B;  2K7O A;  1CB1 A;  1S5G Y;  3O78 A;  2KQ6 A;  1L2O C;  4IL1 A;  1GJY A;  1PSR A;  2JZI A;  2LUX A;  1ODB A;  2WCF A;  3I5F B;  1SPY A;  3GK1 A;  3OB2 B;  2LP3 A;  1A2X A;  4MBE A;  5HLO A;  2QPT A;  1TCF A;  4XJK A;  1J7Q A;  1N65 A;  2LAP A;  2M3W A;  3CLN A;  2KI6 D;  1BR4 B;  3DF0 A;  2ZND A;  2M7L A;  1MF8 B;  2JT8 A;  4JPZ B;  3VGO A;  2AMI A;  2MJW B;  1S6C A;  2ZNE A;  4YGA A;  2BCX A;  1NUB A;  3OHM B;  5G08 A;  3VRQ A;  3ZNI A;  1S3P A;  1KK7 Y;  4WQ2 A;  4FQO A;  5I8N A;  1SL8 A;  4ZCU A;  2PSR A;  2AAO A;  4D1E A;  3C1V A;  2JWW A;  1M39 A;  3TDI A;  1KK8 B;  2DOQ A;  1EH2 A;  1K8U A;  2EC6 B;  2OTG B;  1LIN A;  1Y1U A;  2LMV A;  1KK7 Z;  2K61 A;  4C0J A;  1FI6 A;  3SG7 A;  1UHI A;  5PAL A;  3BUO B;  5DKN A;  4P2Y B;  4CFR A;  1WDC C;  1DF0 A;  3D0Y B;  2JRF A;  1JF2 A;  3A8R A;  4MZK A;  3JTD C;  1ZUZ A;  1TIZ A;  1MUX A;  3AAK A;  3VRO A;  3WHT B;  4WRI A;  1N2D A;  2KFG A;  2G2B A;  1OQP A;  4PHM A;  1AVS A;  4GAO A;  1UWO A;  2HF5 A;  2LV7 A;  1BU3 A;  3M0W A;  3CTN A;  1FPW A;  1EL4 A;  1B9A A;  1QAS A;  3E3R A;  1NWD A;  1A03 A;  1NCZ A;  2F2P A;  3D0Y A;  1SYM A;  3D10 A;  4YGE B;  2HET A;  3AAJ A;  5B8I B;  2B1U A;  2KAX A;  1XFX O;  2LLT A;  3EK4 A;  2ZFD A;  1CFC A;  1WLM A;  4CFQ A;  4GGN A;  2M29 A;  2JQ6 A;  2I7A A;  2I2R E;  1FBV A;  4GGF C;  1CTR A;  1LVC D;  1C7W A;  1IGV A;  1HQV A;  1KFX S;  1SNL A;  2F3Y A;  4XYN A;  3NSK A;  4CID A;  2NZ0 A;  1OSA A;  2L2E A;  2L98 A;  4TNC A;  3WXA A;  2HQ8 A;  1J55 A;  1JFK A;  1MHO A;  2H2K A;  1J7R A;  1PUL A;  3NSO A;  1AHR A;  1W7J B;  5HKY A;  3DVM A;  2MRD A;  1S36 A;  2Y5I A;  1CLL A;  1CDP A;  1AP4 A;  1Y0V H;  2ZRS A;  4NDD A;  1S1E A;  3EVR A;  3PN7 B;  3DVE A;  1A75 B;  1LA3 A;  1JSA A;  1QV1 A;  4ORB B;  2MLE C;  1B47 A;  1LXF C;  3VRR A;  1OOJ A;  2NXQ A;  1QS7 A;  2WND A;  3OX6 A;  3SIB A;  3JVT C;  3LK0 A;  1E8A A;  5HKZ A;  1M46 A;  2GGZ A;  2BCA A;  1Y1A A;  3TZ1 A;  4PE1 A;  3I5H C;  1XA5 A;  2L51 A;  1UUS A;  2ZN8 A;  1F4O A;  3TUY B;  2D8N A;  1QX2 A;  2HPS A;  4ICB A;  1PVB A;  1SCM C;  1N0Y A;  1JC2 A;  5FYX A;  1SCV A;  1BG1 A;  1D1O A;  3F45 A;  1B4C A;  1K9K A;  1M63 B;  3IF7 A;  1SRA A;  2M1U A;  2LMU A;  2KBM A;  3I5I B;  4MSP A;  5DKR A;  2CCM A;  2OPO A;  3PSR A;  4CLN A;  5BPJ A;  3KEV A;  2LVI A;  1V1F A;  1X02 A;  1WY9 A;  3PAT A;  1NX0 A;  1RK9 A;  1OMD A;  1CM4 A;  2KYF A;  2AUC A;  2LNK A;  4NDC A;  4MZL A;  1TRF A;  1TNX A;  2KOT A;  3A4U B;  4XJK B;  1CFF A;  2WOR A;  2K2F A;  2MAZ A;  1NPQ A;  2LCP A;  1CFD A;  1TNW A;  2QAC A;  1PAL A;  3DF0 B;  4Q04 A;  4QJ3 B;  2FCD A;  4HRE E;  1SL7 A;  4PE7 A;  4PE0 A;  1WRZ A;  4AOM A;  5JJG A;  2NLN A;  4A4C A;  1F4Q A;  4HSZ A;  4ORC B;  1IQ3 A;  1SBJ A;  3LL8 B;  1BLQ A;  1CDL A;  1DJX A;  1MXL C;  1A29 A;  2K2A A;  2KDH A;  4NQG A;  1AJ5 A;  1S5G Z;  1JF0 A;  4MRX A;  1DJY A;  2M7N A;  1C7V A;  1MR8 A;  1S6I A;  2L50 A;  1B7T Y;  2Y4Q A;  4ZCV A;  5KTY A;  1B8C A;  5AFP A;  2GV5 A;  1BT6 A;  5GQQ C;  1RJV A;  3BYA A;  1ALV A;  2KSP A;  1RRO A;  1UUR A;  1KQM B;  2M97 A;  3CS1 A;  1DF0 B;  4F0Z B;  2LHL A;  1KSO A;  4MN0 A;  1NX2 A;  1BR1 B;  1EXR A;  1ZAC A;  4UPG A;  1ZFS A;  1DGU A;  2I94 A;  1CLM A;  1ZOT B;  1CMF A; 
#chains in the Genus database with same CATH topology
 2KI4 B;  1K9U A;  4JWQ A;  2F8P A;  5CSI A;  1KSM A;  2LMT A;  2LP2 A;  1QVI Y;  2KFF A;  4DRW A;  3S0B A;  3CR2 A;  3I5F C;  4DS7 A;  3AKA A;  1CM1 A;  1OMV A;  3BQ3 A;  3FE6 A;  3MSE B;  3BJH A;  2O60 A;  1FF1 A;  2IS9 A;  3BFB A;  1DJW A;  1XYD A;  2MHH A;  2QEB A;  4N1G A;  1XVJ A;  3PM8 A;  4YGB B;  5J3X A;  4MZJ A;  1QLS A;  1UHK A;  2BKI B;  3SS4 A;  5CPV A;  1J7P A;  1YTZ C;  3BOW B;  3QRX A;  3RM1 A;  5AER A;  2FCE A;  4PHK A;  2WCM A;  4I5J A;  4C0L A;  3TS5 B;  2KQY A;  3I5G C;  5HYD A;  1KK8 C;  2K8M B;  5CSF A;  4BY4 A;  2BBM A;  2E6W A;  2EC6 C;  2OTG C;  3IQO A;  1A4P A;  2F2O A;  2L4I A;  1YRU B;  3EVV A;  3LCP C;  1J7O A;  3R1P A;  2JU0 A;  1Y6W A;  1KWO B;  1QTX A;  1XFZ O;  5IBW A;  1IG5 A;  4M2O A;  2EHB A;  1PRW A;  3BOW A;  2WCE A;  1R2U A;  4QJ5 B;  1KFU S;  1EG4 A;  4GBA A;  2KAY A;  1K90 D;  1DVI A;  2SCP A;  1NCX A;  2O5G A;  2OS8 B;  5DKQ A;  4U8D A;  3DZT A;  1H4B A;  1G33 A;  2MBX A;  2BBN A;  1XFU O;  2V53 A;  4M2P A;  1M45 A;  1KCY A;  4JKT A;  5D69 A;  1BOD A;  1YVL A;  4CPV A;  1KFX L;  2L5Y A;  1DEK A;  4GGF A;  3EG5 B;  3EKH A;  1JFJ A;  4PHN A;  2WCK A;  1P28 A;  3PFV A;  4DUQ A;  2KFH A;  3O2P A;  1IQ5 A;  4DCK A;  1QIV A;  5AXI A;  1PSB A;  2PAL A;  5I2Q A;  2ZN9 A;  4OCI A;  4PDZ A;  3S0E A;  2ISD A;  2L4H A;  3SG2 A;  2BAP A;  1CDM A;  3EK8 A;  2JXL A;  3OX5 A;  3BFA A;  3DVJ A;  3NSI A;  4OKH A;  2WC8 A;  1RFJ A;  4OVN F;  2BL0 B;  1F55 A;  1TTX A;  2L5X B;  2JTZ A;  1SW8 A;  2Y1N A;  2H61 A;  2M1K B;  1CMG A;  1OMR A;  2PMY A;  1IRJ A;  2LM5 A;  3DD4 A;  1NCY A;  1NYA A;  2M8U A;  1ALW A;  2LVJ A;  1SKT A;  1CNP A;  5CSN A;  1XFY O;  3TDU A;  4INW A;  1DJH A;  1F8H A;  2CBL A;  2KAV A;  4BY5 A;  1K2H A;  3CDN A;  2F3Z A;  4AQJ A;  3NSL A;  3H4S E;  4MRY A;  2FJY A;  1SMG A;  5D7F A;  3VRP A;  1TNP A;  1MQ1 A;  1L2O B;  3SJS A;  4QJ4 B;  1AK8 A;  1YVH A;  3CZT X;  3TUY C;  1NP8 A;  4I5K A;  1UHJ A;  1DJZ A;  3HX4 A;  1WLZ A;  1DGV A;  3FIA A;  1OOH A;  4PE4 A;  1TN4 A;  2CXJ A;  2JTT A;  1G4Y R;  1XK4 C;  3IQQ A;  1CFP A;  3RLZ A;  1GQM A;  3VRN A;  1IIO A;  4A4B A;  2LC5 A;  3K1E A;  4IJ7 A;  3EVU A;  3NXA A;  2F33 A;  4PAL A;  2P6B B;  3TDZ A;  2JC2 A;  1UHH A;  1DEL A;  4M2Q A;  1K9P A;  2LVK A;  2JPT A;  4MEW A;  1SL9 A;  3OB1 B;  5KU1 A;  4OZD A;  3KF9 A;  1EJ3 A;  1TNQ A;  4YRU A;  1SR6 C;  1JUO A;  1OZS A;  3FE9 A;  2ZKM X;  2GGM A;  3PM2 A;  3O4X A;  4YGD B;  1YRT B;  1GM0 A;  1TWO A;  5AAN A;  1B7T Z;  3PLF B;  2GTE A;  1J1D A;  1YX8 A;  2QEV A;  1Y1X A;  2NCP A;  1LS8 A;  1OOF A;  4I5L B;  3SG5 A;  3B7A A;  1DMO A;  1YUU A;  3R1O A;  5F6T A;  4ETO A;  1XFV O;  1CLB A;  1IH0 A;  3CZ2 A;  3L4L A;  3O4Y A;  1HT9 A;  1WDC B;  4PHJ A;  1FI5 A;  1GGW A;  2K0J A;  3CYZ A;  1B8R A;  1Q80 A;  1IJ6 A;  1AJ4 A;  1BF5 A;  3JTD B;  1JBA A;  2FOT A;  3BUN B;  4N1F A;  1SSE B;  1YX7 A;  2TN4 A;  2E30 A;  2PAS A;  1QVI Z;  2HQW A;  2K7D A;  2ZRT A;  2LLS A;  1S6J A;  1OOG A;  3D76 A;  3EK7 A;  3FWC A;  3I5G B;  3SG6 A;  1KQM C;  4FTG A;  4WQ3 A;  2LLU A;  2K7B A;  2LAN A;  1F71 A;  4GNK B;  1M31 A;  3HCM A;  2JUL A;  4YI8 A;  1EG3 A;  2KHN A;  5CSJ A;  3SG4 A;  4C0K A;  3CAB A;  3B88 A;  5FI7 A;  2PYQ A;  2M9G A;  2KI4 C;  4E68 A;  4MVF A;  1RWY A;  2LVV A;  1NX3 A;  2LHI A;  1DTL A;  1K93 D;  2BCB A;  1W7I B;  3K21 A;  3ICB A;  1IKU A;  1YUS A;  4NDB A;  1DJG A;  2KYC A;  1BOC A;  1BMO A;  1XO5 A;  1UP5 A;  2A4J A;  1UHN A;  1XFR A;  2RGI A;  3CWG A;  4OR9 B;  3LLE A;  1C07 A;  2SAS A;  3GK2 A;  2H8V A;  3CGA A;  3D73 A;  1U5I B;  1JWD A;  3CR4 X;  1NIW A;  3PAL A;  2CTN A;  1PVA A;  1L7Z A;  2NCO A;  1KFU L;  2LUC A;  4KYN A;  1YR5 A;  2KNE A;  2Y1M A;  4L9M A;  3TS5 C;  1GGZ A;  2VRG A;  2QDI A;  4R1E A;  1VRK A;  2M49 B;  2JNF A;  2JT0 A;  3CR5 X;  3Q8I A;  4HRH A;  1CDN A;  3GK4 X;  1WRL A;  1KQV A;  3S0G A;  5I94 A;  3OP0 A;  4OV2 A;  1TCO B;  2EGD A;  1QXP A;  1DJI A;  4YI9 A;  1B8L A;  4DIR A;  1SY9 A;  3JVT B;  3BXK A;  1KWO C;  3NHI A;  1QX7 A;  2BEC A;  3N7H A;  2Q91 A;  3O6B A;  2K7C A;  3I5H B;  1U5I A;  2I18 A;  5K89 A;  4GPL B;  5JOL A;  1BJF A;  4I5N B;  1SCM B;  3S0D A;  1OE9 B;  1OZO A;  4ORA B;  5HKW A;  5I2O A;  2CNP A;  5KSZ A;  1RTP 1;  1DT7 B;  1NSH A;  1QAT A;  3CZ0 A;  2BE4 A;  2OS8 C;  3GOF A;  2FJU B;  1B1G A;  1LA0 A;  4AQI A;  1V1G A;  2COL B;  2KGR A;  2PVB A;  3VB1 A;  1TUZ A;  3B6X A;  3DVK A;  1QLK A;  1QJT A;  2CT9 A;  2WCH A;  2WOS A;  2KBI A;  1XFW O;  5ER4 X;  3PN7 C;  1TUJ A;  3LK1 A;  3ZWH A;  1K95 A;  1SK6 D;  3FWB A;  2L0P A;  2H61 C;  1CKK A;  4HRG A;  2JT3 A;  2MLF C;  4JQ0 D;  1LKJ A;  4YGC B;  1H8B A;  1AUI B;  1WRK A;  3KHE A;  1MXE A;  1K96 A;  2WCB A;  2JXC A;  2R2I A;  1F54 A;  1R6P A;  3SIA A;  4GUK A;  2BNX A;  2KI6 C;  1YUR A;  1K94 A;  5I2L A;  2PRU A;  2JNX A;  1A75 A;  3EKJ A;  1IJ5 A;  3BUM B;  1G8I A;  1QX5 B;  3KPX A;  1FW4 A;  3WNX B;  4MLW A;  1REC A;  4USL A;  2BL0 C;  3BUW B;  5TNC A;  4YBH B;  1PK0 D;  5ER5 A;  2M0R A;  3SG3 A;  3I5I C;  5HL1 A;  1TOP A;  3D77 A;  4P5O E;  4PCW A;  3V2L A;  2MA2 A;  3R72 A;  4N5X A;  4GFT A;  2Q4U A;  1J1E A;  3AKB A;  1QV0 A;  2KLE A;  1IWQ A;  3FS7 A;  2KGB C;  1SR6 B;  4F7F A;  1F70 A;  2JOJ A;  1QIW A;  1NX1 A;  1S26 D;  1XK4 A;  2BE6 A;  2G9B A;  2JPO A;  2LE9 B;  3BUX B;  3KO0 A;  5HLV A;  1MWN A;  3WHU B;  3S0F A;  1YUT A;  5AEQ A;  1ZMZ A;  2BKH B;  2K7O A;  3D75 A;  1CB1 A;  1S5G Y;  3O78 A;  2KQ6 A;  1L2O C;  4IL1 A;  1GJY A;  1PSR A;  2JZI A;  2YGU A;  2LUX A;  1ODB A;  2WCF A;  3I5F B;  1SPY A;  2QEO A;  3GK1 A;  3OB2 B;  2LP3 A;  1A2X A;  4MBE A;  5HLO A;  2QPT A;  1TCF A;  4XJK A;  1J7Q A;  1N65 A;  2LAP A;  2M3W A;  3CLN A;  2KI6 D;  1BR4 B;  3DF0 A;  2ZND A;  2M7L A;  1MF8 B;  2JT8 A;  4JPZ B;  3VGO A;  2AMI A;  2MJW B;  1S6C A;  2ZNE A;  4YGA A;  2BCX A;  1NUB A;  3OHM B;  5G08 A;  3VRQ A;  3ZNI A;  1S3P A;  1KK7 Y;  4WQ2 A;  4FQO A;  5I8N A;  1SL8 A;  4ZCU A;  2PSR A;  1OW4 A;  2AAO A;  4D1E A;  3C1V A;  2JWW A;  1M39 A;  3TDI A;  1KK8 B;  2DOQ A;  1OOI X;  3L4A A;  1EH2 A;  1K8U A;  2EC6 B;  2OTG B;  3SS3 A;  1LIN A;  1Y1U A;  2LMV A;  1KK7 Z;  2K61 A;  4C0J A;  1FI6 A;  3D74 A;  3SG7 A;  1UHI A;  5PAL A;  2P71 A;  2WC5 A;  3BUO B;  5D3O A;  5DKN A;  4P2Y B;  4CFR A;  1WDC C;  1Z4H A;  1DF0 A;  3D0Y B;  2JRF A;  1ORG A;  1JF2 A;  3A8R A;  4MZK A;  3JTD C;  3DXL A;  1ZUZ A;  1TIZ A;  1MUX A;  3AAK A;  3OBV A;  3VRO A;  3WHT B;  4WRI A;  1N2D A;  2KFG A;  3QME A;  2G2B A;  3CZ1 A;  3NHT A;  1OQP A;  4PHM A;  1AVS A;  4GAO A;  1UWO A;  2HF5 A;  2LV7 A;  1BU3 A;  3M0W A;  3CTN A;  3NGV A;  1FPW A;  1EL4 A;  1B9A A;  1QAS A;  3E3R A;  1NWD A;  2P70 A;  1A03 A;  1NCZ A;  2F2P A;  1DQE A;  3D0Y A;  1SYM A;  3D10 A;  4YGE B;  3DYE A;  2HET A;  3AAJ A;  5B8I B;  2B1U A;  2KAX A;  1XFX O;  2LLT A;  3EK4 A;  2ZFD A;  2WCL A;  1CFC A;  1WLM A;  4CFQ A;  4GGN A;  2L2C A;  2ERB A;  2M29 A;  2JQ6 A;  2I7A A;  2I2R E;  1FBV A;  4GGF C;  1CTR A;  1LVC D;  1C7W A;  1IGV A;  1HQV A;  1KFX S;  1SNL A;  2F3Y A;  4XYN A;  3NSK A;  2K60 A;  4CID A;  2NZ0 A;  1OSA A;  2L2E A;  2KLD A;  2L98 A;  4TNC A;  3WXA A;  1C3Z A;  2HQ8 A;  1J55 A;  1JFK A;  1MHO A;  2H2K A;  1J7R A;  3L47 A;  1PUL A;  3NSO A;  1AHR A;  1W7J B;  5HKY A;  3DVM A;  2MRD A;  1S36 A;  2Y5I A;  1CLL A;  1CDP A;  3R1V A;  1AP4 A;  1Z2C B;  1Y0V H;  2ZRS A;  4NDD A;  1S1E A;  3EVR A;  3PN7 B;  3DVE A;  1A75 B;  1LA3 A;  1JSA A;  1QV1 A;  4ORB B;  2MLE C;  1B47 A;  1DC1 A;  1LXF C;  3VRR A;  1OOJ A;  2NXQ A;  1QS7 A;  2WND A;  3OX6 A;  3SIB A;  3JVT C;  3LK0 A;  1E8A A;  5HKZ A;  1W9Z A;  1M46 A;  5EL2 A;  2GGZ A;  2BCA A;  1Y1A A;  3TZ1 A;  3S0A A;  3B86 A;  4PE1 A;  3I5H C;  1XA5 A;  2L51 A;  1UUS A;  2KPH A;  1F4O A;  2ZN8 A;  2D8N A;  1QX2 A;  3TUY B;  2HPS A;  4ICB A;  5FI2 A;  1PVB A;  1SCM C;  1N0Y A;  1JC2 A;  5FYX A;  1SCV A;  1BG1 A;  1D1O A;  3F45 A;  1B4C A;  1K9K A;  1M63 B;  1T14 A;  1C3Y A;  3IF7 A;  1SRA A;  2M1U A;  2LMU A;  2KBM A;  3I5I B;  4MSP A;  5DKR A;  2CCM A;  2OPO A;  3PSR A;  4PT1 A;  4CLN A;  5BPJ A;  3KEV A;  3OGN A;  2LVI A;  1V1F A;  1X02 A;  1QWV A;  1WY9 A;  3PAT A;  1NX0 A;  3B87 A;  3UNW A;  1RK9 A;  1OMD A;  1CM4 A;  2KYF A;  2AUC A;  2LNK A;  4NDC A;  4MZL A;  1TRF A;  1TNX A;  2KOT A;  3A4U B;  4XJK B;  1CFF A;  2WOR A;  3PJI A;  2K2F A;  2MAZ A;  1NPQ A;  2LCP A;  1CFD A;  1TNW A;  2QAC A;  1PAL A;  3DF0 B;  4Q04 A;  4QJ3 B;  3SS5 A;  2FCD A;  4HRE E;  1SL7 A;  4PE7 A;  4PE0 A;  3FE8 A;  1WRZ A;  4AOM A;  2WCJ A;  5JJG A;  2NLN A;  4JD9 A;  5FI6 A;  4A4C A;  1F4Q A;  4HSZ A;  4ORC B;  2WC6 A;  3UO9 A;  3DY9 A;  1IQ3 A;  1SBJ A;  3LL8 B;  3RZS A;  1BLQ A;  1CDL A;  1DJX A;  1MXL C;  1A29 A;  2K2A A;  2KDH A;  4NQG A;  1AJ5 A;  3IVT A;  2PQL A;  1S5G Z;  1JF0 A;  4MRX A;  1DJY A;  2M7N A;  3BFH A;  1MR8 A;  1S6I A;  1C7V A;  2L50 A;  1B7T Y;  2Y4Q A;  4ZCV A;  4INX A;  5KTY A;  1B8C A;  5AFP A;  3D78 A;  2GV5 A;  1BT6 A;  5GQQ C;  1RJV A;  3BYA A;  5DIC A;  1ALV A;  2KSP A;  1RRO A;  1UUR A;  1KQM B;  2M97 A;  3CS1 A;  1DF0 B;  4F0Z B;  2LHL A;  2QEH A;  1KSO A;  4MN0 A;  1NX2 A;  1BR1 B;  1EXR A;  1ZAC A;  4UPG A;  1ZFS A;  1DGU A;  4FQT A;  2I94 A;  1CLM A;  1ZOT B;  1CMF A; 
#chains in the Genus database with same CATH homology
 2KI4 B;  1K9U A;  4JWQ A;  2F8P A;  5CSI A;  1KSM A;  2LMT A;  2LP2 A;  1QVI Y;  2KFF A;  4DRW A;  3CR2 A;  3I5F C;  4DS7 A;  3AKA A;  1CM1 A;  1OMV A;  3BQ3 A;  3MSE B;  2O60 A;  1FF1 A;  2IS9 A;  1DJW A;  1XYD A;  2MHH A;  4N1G A;  1XVJ A;  3PM8 A;  4YGB B;  5J3X A;  4MZJ A;  1QLS A;  1UHK A;  2BKI B;  5CPV A;  1J7P A;  1YTZ C;  3BOW B;  3QRX A;  3RM1 A;  5AER A;  2FCE A;  4PHK A;  4I5J A;  4C0L A;  3TS5 B;  2KQY A;  3I5G C;  5HYD A;  1KK8 C;  2K8M B;  5CSF A;  4BY4 A;  2BBM A;  2E6W A;  2EC6 C;  2OTG C;  3IQO A;  1A4P A;  2F2O A;  2L4I A;  1YRU B;  3EVV A;  3LCP C;  1J7O A;  2JU0 A;  1Y6W A;  1KWO B;  1QTX A;  1XFZ O;  5IBW A;  1IG5 A;  4M2O A;  2EHB A;  1PRW A;  3BOW A;  2WCE A;  1R2U A;  4QJ5 B;  1KFU S;  1EG4 A;  4GBA A;  2KAY A;  1K90 D;  1DVI A;  2SCP A;  1NCX A;  2O5G A;  2OS8 B;  5DKQ A;  4U8D A;  1H4B A;  1G33 A;  2MBX A;  2BBN A;  1XFU O;  2V53 A;  4M2P A;  1M45 A;  1KCY A;  5D69 A;  1BOD A;  1YVL A;  4CPV A;  1KFX L;  4GGF A;  3EKH A;  1JFJ A;  4PHN A;  3PFV A;  4DUQ A;  2KFH A;  3O2P A;  1IQ5 A;  4DCK A;  1QIV A;  5AXI A;  1PSB A;  2PAL A;  5I2Q A;  2ZN9 A;  4OCI A;  4PDZ A;  2ISD A;  2L4H A;  3SG2 A;  3EK8 A;  1CDM A;  3OX5 A;  2JXL A;  3DVJ A;  3NSI A;  4OKH A;  2WC8 A;  1RFJ A;  4OVN F;  2BL0 B;  1F55 A;  1TTX A;  2L5X B;  2JTZ A;  1SW8 A;  2Y1N A;  2H61 A;  2M1K B;  1CMG A;  1OMR A;  2PMY A;  1IRJ A;  2LM5 A;  3DD4 A;  1NCY A;  1NYA A;  2M8U A;  1ALW A;  2LVJ A;  1SKT A;  1CNP A;  5CSN A;  1XFY O;  3TDU A;  1DJH A;  1F8H A;  2CBL A;  2KAV A;  4BY5 A;  1K2H A;  2F3Z A;  4AQJ A;  3NSL A;  3H4S E;  4MRY A;  1SMG A;  5D7F A;  3VRP A;  1TNP A;  1MQ1 A;  1L2O B;  3SJS A;  4QJ4 B;  1AK8 A;  1YVH A;  3CZT X;  3TUY C;  1NP8 A;  4I5K A;  1UHJ A;  1DJZ A;  3HX4 A;  1WLZ A;  1DGV A;  3FIA A;  4PE4 A;  1TN4 A;  2CXJ A;  2JTT A;  1G4Y R;  1XK4 C;  3IQQ A;  1CFP A;  3RLZ A;  1GQM A;  3VRN A;  4A4B A;  2LC5 A;  3EVU A;  3NXA A;  2F33 A;  4PAL A;  2P6B B;  3TDZ A;  2JC2 A;  1UHH A;  4M2Q A;  1K9P A;  2LVK A;  2JPT A;  4MEW A;  1SL9 A;  3OB1 B;  5KU1 A;  3KF9 A;  1EJ3 A;  1TNQ A;  4YRU A;  1SR6 C;  1JUO A;  1OZS A;  2ZKM X;  2GGM A;  4YGD B;  1YRT B;  5AAN A;  1B7T Z;  3PLF B;  1J1D A;  1YX8 A;  1Y1X A;  2NCP A;  4I5L B;  3SG5 A;  1DMO A;  1YUU A;  5F6T A;  4ETO A;  1XFV O;  1CLB A;  1IH0 A;  1FI5 A;  3O4Y A;  1HT9 A;  1WDC B;  4PHJ A;  1GGW A;  2K0J A;  1B8R A;  1Q80 A;  1IJ6 A;  1AJ4 A;  1BF5 A;  3JTD B;  1JBA A;  2FOT A;  3BUN B;  4N1F A;  1YX7 A;  2TN4 A;  2E30 A;  2PAS A;  1QVI Z;  2HQW A;  2K7D A;  2ZRT A;  2LLS A;  1S6J A;  3EK7 A;  3FWC A;  3I5G B;  3SG6 A;  1KQM C;  4FTG A;  4WQ3 A;  2LLU A;  2K7B A;  2LAN A;  1F71 A;  4GNK B;  1M31 A;  3HCM A;  2JUL A;  4YI8 A;  1EG3 A;  2KHN A;  5CSJ A;  3SG4 A;  4C0K A;  2M9G A;  2KI4 C;  4E68 A;  4MVF A;  1RWY A;  2LVV A;  1NX3 A;  2LHI A;  1DTL A;  1K93 D;  2BCB A;  1W7I B;  3K21 A;  3ICB A;  1IKU A;  1YUS A;  4NDB A;  1DJG A;  2KYC A;  1BOC A;  1BMO A;  1XO5 A;  1UP5 A;  2A4J A;  1UHN A;  2RGI A;  4OR9 B;  3CWG A;  3LLE A;  1C07 A;  2SAS A;  3GK2 A;  3CGA A;  1U5I B;  1JWD A;  3CR4 X;  1NIW A;  3PAL A;  2CTN A;  1PVA A;  1L7Z A;  2NCO A;  1KFU L;  2LUC A;  1YR5 A;  2KNE A;  2Y1M A;  4L9M A;  3TS5 C;  1GGZ A;  2VRG A;  4R1E A;  1VRK A;  2M49 B;  2JNF A;  2JT0 A;  3CR5 X;  4HRH A;  1CDN A;  3GK4 X;  1WRL A;  1KQV A;  3OP0 A;  4OV2 A;  1TCO B;  2EGD A;  1QXP A;  1DJI A;  4YI9 A;  1B8L A;  4DIR A;  1SY9 A;  3JVT B;  3BXK A;  1KWO C;  1QX7 A;  2BEC A;  3O6B A;  2Q91 A;  2K7C A;  3I5H B;  1U5I A;  2I18 A;  5K89 A;  4GPL B;  5JOL A;  1BJF A;  4I5N B;  1SCM B;  1OE9 B;  1OZO A;  4ORA B;  5HKW A;  5I2O A;  2CNP A;  5KSZ A;  1RTP 1;  1DT7 B;  1NSH A;  1QAT A;  2BE4 A;  2OS8 C;  3GOF A;  2FJU B;  1B1G A;  1LA0 A;  4AQI A;  1V1G A;  2COL B;  2KGR A;  2PVB A;  3DVK A;  1QLK A;  1QJT A;  2CT9 A;  2WOS A;  2KBI A;  1XFW O;  5ER4 X;  3PN7 C;  3LK1 A;  3ZWH A;  1K95 A;  1SK6 D;  3FWB A;  2L0P A;  2H61 C;  1CKK A;  4HRG A;  2JT3 A;  2MLF C;  4JQ0 D;  1LKJ A;  4YGC B;  1H8B A;  1AUI B;  1WRK A;  3KHE A;  1MXE A;  1K96 A;  2WCB A;  2JXC A;  2R2I A;  1F54 A;  1R6P A;  3SIA A;  4GUK A;  2KI6 C;  1YUR A;  1K94 A;  5I2L A;  2PRU A;  2JNX A;  1A75 A;  3EKJ A;  1IJ5 A;  3BUM B;  1G8I A;  1QX5 B;  3KPX A;  1FW4 A;  3WNX B;  4MLW A;  1REC A;  4USL A;  2BL0 C;  3BUW B;  5TNC A;  4YBH B;  1PK0 D;  5ER5 A;  2M0R A;  3SG3 A;  3I5I C;  1TOP A;  4P5O E;  4PCW A;  2MA2 A;  4N5X A;  4GFT A;  2Q4U A;  1J1E A;  3AKB A;  1QV0 A;  1IWQ A;  3FS7 A;  2KGB C;  1SR6 B;  1F70 A;  2JOJ A;  1QIW A;  1NX1 A;  1S26 D;  1XK4 A;  2BE6 A;  2G9B A;  2LE9 B;  3BUX B;  5HLV A;  3KO0 A;  3WHU B;  1MWN A;  1YUT A;  5AEQ A;  1ZMZ A;  2BKH B;  2K7O A;  1CB1 A;  1S5G Y;  3O78 A;  2KQ6 A;  1L2O C;  4IL1 A;  1GJY A;  1PSR A;  2JZI A;  2LUX A;  1ODB A;  2WCF A;  3I5F B;  1SPY A;  3GK1 A;  3OB2 B;  2LP3 A;  1A2X A;  4MBE A;  5HLO A;  2QPT A;  1TCF A;  4XJK A;  1J7Q A;  1N65 A;  2LAP A;  2M3W A;  3CLN A;  2KI6 D;  1BR4 B;  3DF0 A;  2ZND A;  2M7L A;  1MF8 B;  2JT8 A;  4JPZ B;  3VGO A;  2AMI A;  2MJW B;  1S6C A;  2ZNE A;  4YGA A;  2BCX A;  1NUB A;  3OHM B;  5G08 A;  3VRQ A;  3ZNI A;  1S3P A;  1KK7 Y;  4WQ2 A;  4FQO A;  5I8N A;  1SL8 A;  4ZCU A;  2PSR A;  2AAO A;  4D1E A;  3C1V A;  2JWW A;  1M39 A;  3TDI A;  1KK8 B;  2DOQ A;  1EH2 A;  1K8U A;  2EC6 B;  2OTG B;  1LIN A;  1Y1U A;  2LMV A;  1KK7 Z;  2K61 A;  4C0J A;  1FI6 A;  3SG7 A;  1UHI A;  5PAL A;  3BUO B;  5DKN A;  4P2Y B;  4CFR A;  1WDC C;  1DF0 A;  3D0Y B;  2JRF A;  1JF2 A;  3A8R A;  4MZK A;  3JTD C;  1ZUZ A;  1TIZ A;  1MUX A;  3AAK A;  3VRO A;  3WHT B;  4WRI A;  1N2D A;  2KFG A;  2G2B A;  1OQP A;  4PHM A;  1AVS A;  4GAO A;  1UWO A;  2HF5 A;  2LV7 A;  1BU3 A;  3M0W A;  3CTN A;  1FPW A;  1EL4 A;  1B9A A;  1QAS A;  3E3R A;  1NWD A;  1A03 A;  1NCZ A;  2F2P A;  3D0Y A;  1SYM A;  3D10 A;  4YGE B;  2HET A;  3AAJ A;  5B8I B;  2B1U A;  2KAX A;  1XFX O;  2LLT A;  3EK4 A;  2ZFD A;  1CFC A;  1WLM A;  4CFQ A;  4GGN A;  2M29 A;  2JQ6 A;  2I7A A;  2I2R E;  1FBV A;  4GGF C;  1CTR A;  1LVC D;  1C7W A;  1IGV A;  1HQV A;  1KFX S;  1SNL A;  2F3Y A;  4XYN A;  3NSK A;  4CID A;  2NZ0 A;  1OSA A;  2L2E A;  2L98 A;  4TNC A;  3WXA A;  2HQ8 A;  1J55 A;  1JFK A;  1MHO A;  2H2K A;  1J7R A;  1PUL A;  3NSO A;  1AHR A;  1W7J B;  5HKY A;  3DVM A;  2MRD A;  1S36 A;  2Y5I A;  1CLL A;  1CDP A;  1AP4 A;  1Y0V H;  2ZRS A;  4NDD A;  1S1E A;  3EVR A;  3PN7 B;  3DVE A;  1A75 B;  1LA3 A;  1JSA A;  1QV1 A;  4ORB B;  2MLE C;  1B47 A;  1LXF C;  3VRR A;  1OOJ A;  2NXQ A;  1QS7 A;  2WND A;  3OX6 A;  3SIB A;  3JVT C;  3LK0 A;  1E8A A;  5HKZ A;  1M46 A;  2GGZ A;  2BCA A;  1Y1A A;  3TZ1 A;  4PE1 A;  3I5H C;  1XA5 A;  2L51 A;  1UUS A;  2ZN8 A;  1F4O A;  3TUY B;  2D8N A;  1QX2 A;  2HPS A;  4ICB A;  1PVB A;  1SCM C;  1N0Y A;  1JC2 A;  5FYX A;  1SCV A;  1BG1 A;  1D1O A;  3F45 A;  1B4C A;  1K9K A;  1M63 B;  3IF7 A;  1SRA A;  2M1U A;  2LMU A;  2KBM A;  3I5I B;  4MSP A;  5DKR A;  2CCM A;  2OPO A;  3PSR A;  4CLN A;  5BPJ A;  3KEV A;  2LVI A;  1V1F A;  1X02 A;  1WY9 A;  3PAT A;  1NX0 A;  1RK9 A;  1OMD A;  1CM4 A;  2KYF A;  2AUC A;  2LNK A;  4NDC A;  4MZL A;  1TRF A;  1TNX A;  2KOT A;  3A4U B;  4XJK B;  1CFF A;  2WOR A;  2K2F A;  2MAZ A;  1NPQ A;  2LCP A;  1CFD A;  1TNW A;  2QAC A;  1PAL A;  3DF0 B;  4Q04 A;  4QJ3 B;  2FCD A;  4HRE E;  1SL7 A;  4PE7 A;  4PE0 A;  1WRZ A;  4AOM A;  5JJG A;  2NLN A;  4A4C A;  1F4Q A;  4HSZ A;  4ORC B;  1IQ3 A;  1SBJ A;  3LL8 B;  1BLQ A;  1CDL A;  1DJX A;  1MXL C;  1A29 A;  2K2A A;  2KDH A;  4NQG A;  1AJ5 A;  1S5G Z;  1JF0 A;  4MRX A;  1DJY A;  2M7N A;  1C7V A;  1MR8 A;  1S6I A;  2L50 A;  1B7T Y;  2Y4Q A;  4ZCV A;  5KTY A;  1B8C A;  5AFP A;  2GV5 A;  1BT6 A;  5GQQ C;  1RJV A;  3BYA A;  1ALV A;  2KSP A;  1RRO A;  1UUR A;  1KQM B;  2M97 A;  3CS1 A;  1DF0 B;  4F0Z B;  2LHL A;  1KSO A;  4MN0 A;  1NX2 A;  1BR1 B;  1EXR A;  1ZAC A;  4UPG A;  1ZFS A;  1DGU A;  2I94 A;  1CLM A;  1ZOT B;  1CMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...