1CDMA

Modulation of calmodulin plasticity in molecular recognition on the basis of x-ray structures
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
133
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II
publication title Modulation of calmodulin plasticity in molecular recognition on the basis of x-ray structures.
pubmed rcsb
source organism Bos taurus
total genus 46
structure length 133
sequence length 143
ec nomenclature
pdb deposition date 1993-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cdmA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cdmA02
1QTXA 1X02A 2KI4B 3I5IC 2O5GA 3O2PA 1KFUS 3EKJA 1CFDA 4NQGA 1SKTA 3CR2A 4CPVA 1CDNA 5AANA 3RLZA 1C07A 3H4SE 2V53A 2JTZA 1NUBA 1UWOA 4MLWA 3D10A 5CSNA 3GK2A 1PVAA 3OB1B 1YUTA 4YGAA 2CNPA 3FWCA 1RTP1 2M8UA 2WCFA 1SMGA 1OZSA 3TZ1A 1K8UA 2FCDA 4YRUA 3A4UB 2ZFDA 1RROA 2HQWA 2OS8B 3QRXA 4R1EA 4C0KA 3PN7C 4QJ5B 1DTLA 1SL9A 1EG4A 2EHBA 1FI6A 2M1UA 1NPQA 3OX6A 4I5KA 1QV1A 3AAKA 5I8NA 1K94A 1N2DA 2ZN9A 1DJZA 2KAYA 1V1FA 2G9BA 4CLNA 1JC2A 1G8IA 3PM8A 1QXPA 1K9UA 1XFUO 4PHNA 1WLZA 1CKKA 2LLTA 1B7TY 2K0JA 1R2UA 2JZIA 2KSPA 1J7OA 5DKRA 3EVUA 2BE6A 2KGRA 1K9KA 1LKJA 1KFUL 1ZMZA 5CSIA 4YI8A 3OHMB 4GGNA 4OV2A 1JFKA 1SRAA 1C7WA 1YRTB 3I5GB 4MRYA 2M7LA 4MEWA 3M0WA 2H61A 1J7QA 2VRGA 1BT6A 1SW8A 2ZNDA 3EK4A 4NDDA 1YRUB 2ZRSA 1RECA 1UUSA 2LNKA 3DVKA 1SL7A 2EC6C 1J1EA 1JFJA 2JT3A 1HQVA 1QX7A 1DGUA 2LV7A 2ZRTA 2KYFA 1F4OA 1SL8A 2R2IA 3BUNB 1JSAA 2L0PA 4NDBA 2LVIA 4USLA 1TCOB 1EJ3A 2LVJA 2ISDA 3JTDB 5PALA 1XFZO 1WLMA 2QPTA 5BPJA 1PRWA 1XO5A 3I5FC 1TOPA 3CS1A 1IJ6A 1WRKA 1KK7Y 4E68A 1D1OA 1NSHA 1A75A 1SR6C 1SBJA 3E3RA 1IWQA 1K90D 2HF5A 2L5XB 3MSEB 3O6BA 1XFXO 4TNCA 4AOMA 3OB2B 3ZNIA 1KK8B 3VRNA 1CLMA 3BXKA 4JQ0D 5ER5A 5KU1A 1DJGA 1M39A 1B47A 4GGFC 1QLKA 1CM1A 3PATA 3OX5A 1GQMA 1B9AA 1CDLA 2LMVA 1DJIA 2LVVA 1QJTA 2K61A 1AJ5A 1MR8A 1NX2A 2FOTA 1KWOB 1CB1A 2F3ZA 1CMFA 2B1UA 2JXCA 1WDCB 2CTNA 3TUYB 3KO0A 4GAOA 1SK6D 4F0ZB 1PK0D 3AKAA 2K7OA 1NP8A 4P2YB 1H4BA 1XK4C 2BCXA 1ZACA 2PASA 3F45A 1DJWA 4OR9B 1KQMB 2WOSA 2BECA 1IH0A 2Y1NA 2L4HA 1RFJA 3WHUB 2E30A 5CSFA 2Y1MA 3BYAA 1LVCD 2JWWA 1SPYA 1GGWA 2H2KA 3I5HC 1XYDA 1M45A 2Q91A 1F54A 2KFHA 1S5GY 2HQ8A 4M2OA 2JQ6A 5HLOA 2LLSA 2MJWB 1WY9A 5GQQC 1CFFA 1CDMA 1LA0A 5B8IB 4ORAB 2OTGC 4UPGA 1V1GA 1IQ5A 2MAZA 3NXAA 2WC8A 3WHTB 1CMGA 1PSBA 5JJGA 3CR4X 4ORCB 1AK8A 1DMOA 2COLB 3KF9A 4GNKB 4ICBA 1FI5A 1BMOA 4C0LA 1J7RA 2E6WA 2K7DA 3CZTX 1F71A 3FIAA 1CM4A 1CTRA 1Y6WA 2GGZA 2WORA 1ALWA 1Q80A 1UP5A 3FWBA 4GGFA 3EK7A 4PHJA 3GK1A 4XYNA 3C1VA 2PVBA 1KCYA 4XJKA 3NSIA 1DF0A 3JVTC 4N5XA 2IS9A 1A2XA 1L2OC 2FJUB 2I2RE 3KPXA 4MN0A 2LP2A 3RM1A 1NCYA 1TRFA 3PALA 2GV5A 4C0JA 1BG1A 1RWYA 1YX8A 2DOQA 3ICBA 1TNQA 4N1FA 3NSKA 4BY4A 3NSLA 1SCVA 1QIVA 1AHRA 1K95A 1A75B 1B8RA 1K9PA 1XK4A 3O78A 4GPLB 2WNDA 5K89A 3SIAA 1W7IB 2ZNEA 2BBNA 2I18A 1MXEA 2KAVA 3GK4X 2TN4A 2O60A 1G33A 2ZKMX 2EGDA 2LUCA 2L51A 4QJ3B 3VRPA 2MHHA 2JU0A 4GFTA 2M7NA 2AAOA 2JXLA 2JRFA 1S1EA 4WRIA 1FPWA 2LLUA 1VRKA 1YVLA 1JF2A 3CGAA 3I5GC 5AFPA 4MRXA 1H8BA 1MUXA 1QLSA 1G4YR 1ALVA 2AMIA 2PSRA 3OP0A 5KTYA 1SCMC 4DUQA 4A4CA 2BKHB 2M97A 1UHJA 4PHMA 1IRJA 1CDPA 1TN4A 5FYXA 3CTNA 1QS7A 3LCPC 1OMDA 1QVIZ 4ETOA 1CLBA 3WXAA 3EVRA 3DF0A 2Y5IA 3FS7A 4FTGA 1F55A 3VRQA 3SG6A 1AUIB 2EC6B 3PSRA 1YUSA 1K2HA 4QJ4B 3TDIA 1RK9A 4PE1A 1NX1A 1MXLC 1Y1UA 2JT0A 1DVIA 2CBLA 2KFFA 1E8AA 2JNFA 2K2AA 1BU3A 1MQ1A 3I5FB 3KHEA 2L50A 1W7JB 1QX5B 1SR6B 1KSMA 2BE4A 5KSZA 4YGBB 3ZWHA 4N1GA 1OSAA 1SYMA 4PHKA 1UURA 1TNXA 2K7BA 1ODBA 1BF5A 1CFCA 1DGVA 2M0RA 1B8CA 3TS5B 1K93D 2PMYA 2LHLA 1OQPA 1NIWA 1QATA 2LANA 4XJKB 4CIDA 3BOWA 1BOCA 3IF7A 5HYDA 3VGOA 1S6IA 1KSOA 1KWOC 5CSJA 5JOLA 1WDCC 1BR4B 2LAPA 1EH2A 4L9MA 1M31A 1M46A 2KBIA 1XFWO 3O4YA 1BR1B 4ZCUA 3DVMA 1AJ4A 4MZLA 1Y0VH 1KQMC 3SIBA 2OPOA 2L4IA 1MF8B 3D0YA 1FF1A 2FCEA 3BUWB 4CFRA 4ORBB 2LMUA 1DJXA 1TIZA 3TDZA 4JPZB 2F2OA 1CNPA 1GJYA 2BCBA 3SG7A 3SJSA 3IQQA 3SG5A 2MRDA 1B8LA 2KAXA 5CPVA 4Q04A 4WQ3A 2BKIB 2LMTA 2K8MB 2KHNA 2LUXA 2NCPA 3LK0A 5AERA 2CT9A 4YI9A 2BL0B 3IQOA 1KQVA 1XFVO 1JBAA 3I5HB 1NCXA 2KOTA 1MHOA 2JPTA 4YGDB 4WQ2A 3NSOA 1B4CA 1SY9A 2JNXA 2KI4C 2GGMA 1EG3A 4OVNF 2Y4QA 4M2QA 2LVKA 2HPSA 2KFGA 1NWDA 2OTGB 5HKWA 4HREE 1QIWA 3I5IB 2NLNA 2SASA 2KGBC 1N0YA 3BUOB 1OMRA 5IBWA 1FW4A 4YGCB 1IGVA 2CCMA 1XVJA 5I2OA 2F3YA 1AP4A 1SNLA 2A4JA 1PSRA 2M3WA 2PALA 4ZCVA 1CFPA 2OS8C 2MLFC 3DF0B 1MWNA 2QACA 2MLEC 1YR5A 1K96A 4PALA 1NX0A 4NDCA 3TDUA 5HKYA 3LL8B 1PVBA 3JVTB 5AEQA 1GGZA 1L2OB 3HX4A 3PN7B 4IL1A 1B1GA 2KI6C 3DVJA 4FQOA 1XFYO 3VRRA 2LCPA 3HCMA 5DKNA 4OKHA 2F8PA 2M49B 1HT9A 5HKZA 1S36A 1U5IA 2KI6D 2SCPA 1LA3A 2KNEA 2NXQA 4GUKA 1IG5A 3CR5X 4MSPA 1S3PA 1TTXA 1M63B 3BQ3A 5D7FA 2WCEA 1ZFSA 3BOWB 2LHIA 4PE7A 1QV0A 2F2PA 5HLVA 5F6TA 1YX7A 3LLEA 3SG4A 4DS7A 1QVIY 3AAJA 1B7TZ 2L98A 2LP3A 2M1KB 4DIRA 3SG3A 2F33A 3LK1A 2CXJA 2KDHA 1N65A 1ZUZA 1ZOTB 2M29A 4MZJA 4PDZA 1NX3A 2HETA 2NCOA 3D0YB 1IQ3A 4U8DA 5G08A 1TNWA 5AXIA 1SCMB 1F8HA 1YVHA 3JTDC 2P6BB 2LM5A 5J3XA 2LC5A 4PE4A 1JUOA 1QX2A 1R6PA 4JWQA 1BJFA 3CWGA 1S6JA 2D8NA 4D1EA 3BUMB 1UHNA 1S6CA 1C7VA 1KK8C 1LXFC 1YTZC 2K2FA 4MBEA 4BY5A 1NCZA 2WCBA 4YGEB 2KQ6A 3KEVA 5I2LA 2PRUA 3SG2A 4DCKA 4DRWA 2M9GA 2Q4UA 3GOFA 2AUCA 2NZ0A 1S26D 1KK7Z 2BCAA 2L2EA 1KFXS 3EK8A 4MZKA 4AQJA 1WRLA 2I7AA 4PCWA 3DVEA 1TCFA 5D69A 4A4BA 1DF0B 4MVFA 4I5JA 4GBAA 5I2QA 3TS5C 1AVSA 1A29A 1TNPA 4I5NB 1DT7B 2ZN8A 3TUYC 2G2BA 4AQIA 1PALA 1J1DA 2JT8A 1DJHA 1YUUA 1PULA 1IJ5A 2BBMA 3EKHA 1BLQA 3BUXB 1WRZA 2JTTA 1J7PA 1L7ZA 4HRHA 1BODA 1CLLA 2JC2A 1UHHA 3EVVA 3A8RA 1JWDA 4I5LB 1DJYA 4CFQA 3PFVA 5DKQA 1RJVA 1J55A 1OZOA 1Y1AA 2JULA 4P5OE 4PE0A 3K21A 1IKUA 1UHKA 1U5IB 2KQYA 4HRGA 1Y1XA 2I94A 1YURA 1F4QA 2KBMA 3AKBA 2MBXA 4M2PA 2BL0C 1F70A 2K7CA 1OOJA 3DD4A 2MA2A 3VROA 1OE9B 3WNXB 3PLFB 1JF0A 1FBVA 4OCIA 2JOJA 1KFXL 5TNCA 2KYCA 5ER4X 1LINA 1OMVA 1EL4A 1QASA 2H61C 2LE9B 1A4PA 4HSZA 1EXRA 1NYAA 1S5GZ 3CLNA 4YBHB 1UHIA 1XA5A 1A03A 2RGIA
chains in the Genus database with same CATH superfamily
1QTXA 1X02A 2KI4B 3D75A 3I5IC 2O5GA 3O2PA 1KFUS 3EKJA 1CFDA 3BFHA 4NQGA 1SKTA 3CR2A 5EL2A 4CPVA 1CDNA 5AANA 3RLZA 1C07A 3H4SE 2V53A 2JTZA 1NUBA 1UWOA 4MLWA 3D10A 5CSNA 3GK2A 1PVAA 3OB1B 1YUTA 4YGAA 2CNPA 3FWCA 1RTP1 2M8UA 2WCFA 3Q8IA 1SMGA 3FE9A 1OZSA 3TZ1A 1K8UA 2FCDA 4YRUA 3A4UB 2ZFDA 1RROA 2HQWA 2OS8B 3QRXA 4R1EA 4C0KA 3PN7C 3S0BA 4QJ5B 1DTLA 1SL9A 1EG4A 2EHBA 3N7HA 3R1PA 1FI6A 2M1UA 1XFRA 1NPQA 3K1EA 3OX6A 2FJYA 4I5KA 1QV1A 5HL1A 3B7AA 1TUZA 3AAKA 5I8NA 1K94A 1N2DA 2ZN9A 1DJZA 2KAYA 1V1FA 2G9BA 4CLNA 1JC2A 1G8IA 3PM8A 1QXPA 1K9UA 1XFUO 4PHNA 1WLZA 2KPHA 1CKKA 3NHTA 2LLTA 1B7TY 2K0JA 1R2UA 2JZIA 2KSPA 1J7OA 5DKRA 3EVUA 2BE6A 2KGRA 2BNXA 1K9KA 1LKJA 1KFUL 1ZMZA 5CSIA 4YI8A 3S0FA 3UNWA 3OHMB 4GGNA 4OV2A 1JFKA 1SRAA 1C7WA 1YRTB 3I5GB 3L47A 4MRYA 2M7LA 4MEWA 3M0WA 2H61A 1J7QA 2VRGA 1BT6A 1SW8A 2ZNDA 3EK4A 4NDDA 1YRUB 2ZRSA 1RECA 1UUSA 2LNKA 3D76A 1SL7A 3DVKA 3IVTA 2EC6C 1J1EA 3R1VA 1JFJA 2JT3A 1HQVA 1QX7A 1DGUA 2LV7A 2ZRTA 2KYFA 1F4OA 1SL8A 2R2IA 3B87A 3BUNB 5FI6A 1JSAA 2L0PA 2PQLA 4NDBA 2LVIA 4USLA 1TCOB 1EJ3A 2LVJA 2P70A 3SS3A 2ISDA 3JTDB 1Z2CB 5PALA 1XFZO 1WLMA 2QPTA 5BPJA 1PRWA 5D3OA 1XO5A 3I5FC 1TOPA 3CS1A 1IJ6A 1WRKA 1KK7Y 4E68A 1D1OA 1NSHA 4OZDA 1A75A 1SR6C 1SBJA 3E3RA 1IWQA 1K90D 2HF5A 2L5XB 3MSEB 3O6BA 1XFXO 3D74A 4TNCA 4AOMA 3OB2B 3ZNIA 1KK8B 3VRNA 1CLMA 3BXKA 4JQ0D 5ER5A 5KU1A 1DJGA 1M39A 1B47A 4GGFC 1QLKA 1CM1A 2WC6A 3PATA 1GM0A 3OX5A 1GQMA 1B9AA 1CDLA 2LMVA 1DJIA 2LVVA 1QJTA 2K61A 1AJ5A 1MR8A 1NX2A 2FOTA 1DQEA 1KWOB 1CB1A 1DELA 2F3ZA 1CMFA 2B1UA 2JXCA 1WDCB 2CTNA 3TUYB 3KO0A 4GAOA 1SK6D 2ERBA 3PM2A 1PK0D 3AKAA 2K7OA 1NP8A 4IJ7A 4P2YB 1XK4C 3VB1A 2BCXA 1H4BA 1ZACA 2PASA 3F45A 3NHIA 1DJWA 4OR9B 1KQMB 2WOSA 3S0GA 2BECA 1IH0A 2Y1NA 3BFBA 2L4HA 2WCMA 1RFJA 3WHUB 2E30A 4KYNA 5CSFA 2Y1MA 3BYAA 1LVCD 2JWWA 1SPYA 1GGWA 2H2KA 3I5HC 1XYDA 1M45A 1SSEB 2Q91A 1F54A 2KFHA 1S5GY 2HQ8A 4M2OA 2JQ6A 2L2CA 2LLSA 2MJWB 5HLOA 1WY9A 5GQQC 1CFFA 1CDMA 1LA0A 5B8IB 4ORAB 1P28A 2OTGC 4UPGA 1V1GA 1IQ5A 2MAZA 3NXAA 2WC8A 3WHTB 4F7FA 1CMGA 1PSBA 5JJGA 3CR4X 4ORCB 1AK8A 1DMOA 2COLB 3KF9A 3L4LA 4GNKB 4ICBA 1BMOA 4C0LA 1J7RA 2E6WA 2K7DA 3CZTX 1F71A 3DY9A 3FIAA 1CM4A 1CTRA 1Y6WA 2GGZA 2WORA 1ALWA 1Q80A 1UP5A 2WCJA 3FWBA 4INXA 4GGFA 3EK7A 4PHJA 3GK1A 4XYNA 3C1VA 2PVBA 1KCYA 3B88A 4XJKA 3UO9A 3S0AA 3NSIA 1DF0A 3JVTC 4JD9A 4N5XA 2IS9A 1A2XA 1L2OC 2FJUB 2I2RE 3KPXA 4MN0A 2LP2A 3RM1A 1NCYA 1TRFA 3PALA 1OOGA 2GV5A 4C0JA 1BG1A 1RWYA 3V2LA 1YX8A 2DOQA 3ICBA 1TNQA 4N1FA 3NSKA 4BY4A 3NSLA 1SCVA 1QIVA 3EG5B 1AHRA 1K95A 1A75B 1B8RA 1K9PA 1XK4A 3O78A 4GPLB 2WNDA 2QEOA 5K89A 3SIAA 1W7IB 2ZNEA 2BBNA 2I18A 1MXEA 2KAVA 3GK4X 2TN4A 2O60A 3B86A 1G33A 2ZKMX 2EGDA 2LUCA 2L51A 4QJ3B 3VRPA 2MHHA 2JU0A 4GFTA 2KLEA 2M7NA 1IIOA 2AAOA 2JXLA 2JRFA 1S1EA 4WRIA 1FPWA 1TUJA 2LLUA 1VRKA 1YVLA 1JF2A 3CGAA 3I5GC 5AFPA 4MRXA 1H8BA 1MUXA 1QLSA 1G4YR 1ALVA 2AMIA 2PSRA 3OP0A 5KTYA 1SCMC 1OOFA 4DUQA 4A4CA 2BKHB 2M97A 1UHJA 4PHMA 1IRJA 5DICA 1CDPA 5FI7A 1TN4A 5FYXA 3CTNA 1QS7A 3DZTA 3LCPC 1OMDA 1QVIZ 4ETOA 1CLBA 3WXAA 3EVRA 5FI2A 3DF0A 2Y5IA 3FS7A 4FTGA 1F55A 3VRQA 3SG6A 1LS8A 1AUIB 2EC6B 3PSRA 1YUSA 1K2HA 4QJ4B 3TDIA 1RK9A 4PE1A 1NX1A 1MXLC 1Y1UA 2JT0A 1DVIA 1QWVA 2CBLA 2KFFA 1E8AA 2JNFA 2K2AA 1BU3A 1MQ1A 3I5FB 2YGUA 3KHEA 1DC1A 2L50A 2H8VA 1W7JB 1QX5B 1SR6B 1KSMA 2BE4A 5KSZA 4YGBB 3ZWHA 4N1GA 1OSAA 1SYMA 4PHKA 1UURA 1TNXA 2K7BA 1ODBA 1BF5A 1CFCA 1DGVA 2M0RA 1B8CA 3TS5B 1K93D 2PMYA 2LHLA 1OQPA 3S0DA 1NIWA 1QATA 2LANA 4XJKB 4CIDA 3BOWA 1Z4HA 3IF7A 5HYDA 4FQTA 3VGOA 1BOCA 1S6IA 1KSOA 1KWOC 5CSJA 2WCHA 5JOLA 1WDCC 1BR4B 2LAPA 1EH2A 4L9MA 1M31A 1M46A 2KBIA 1XFWO 3O4YA 1BR1B 4ZCUA 1C3ZA 3DVMA 1AJ4A 4MZLA 1Y0VH 1KQMC 3SIBA 2OPOA 2L4IA 1MF8B 3D0YA 1FF1A 2FCEA 3BUWB 2GTEA 4CFRA 4ORBB 2LMUA 1DJXA 1TIZA 3TDZA 4JPZB 2F2OA 3RZSA 1GJYA 1CNPA 2BCBA 3SG7A 1T14A 3SJSA 3O4XA 3IQQA 3SG5A 2MRDA 1B8LA 2KAXA 5CPVA 4Q04A 4WQ3A 2BKIB 2LMTA 2K8MB 2KHNA 2LUXA 2NCPA 3LK0A 5AERA 2CT9A 4YI9A 2BL0B 3IQOA 1KQVA 1XFVO 1JBAA 3I5HB 1OOIX 1NCXA 2KOTA 1MHOA 2JPTA 4YGDB 4WQ2A 3NSOA 1C3YA 1B4CA 1SY9A 2JNXA 2KI4C 2GGMA 3BFAA 1EG3A 4OVNF 2Y4QA 4M2QA 2BAPA 2HPSA 2KFGA 2LVKA 1NWDA 2OTGB 5HKWA 4HREE 1QIWA 3I5IB 2NLNA 2SASA 2KGBC 1N0YA 3BUOB 1OMRA 5IBWA 1FW4A 4YGCB 1IGVA 2CCMA 1XVJA 5I2OA 2F3YA 1AP4A 1SNLA 2A4JA 1PSRA 2M3WA 2PALA 4ZCVA 1CFPA 2WCLA 2OS8C 2MLFC 3DF0B 1MWNA 1ORGA 2MLEC 2QACA 1YR5A 1K96A 4PALA 1NX0A 2L5YA 4NDCA 3TDUA 5HKYA 3LL8B 3PJIA 1PVBA 3JVTB 4PT1A 5AEQA 1GGZA 1L2OB 3HX4A 3PN7B 4IL1A 3R1OA 1B1GA 2KI6C 3DVJA 4FQOA 1XFYO 2PYQA 3VRRA 2LCPA 1TWOA 3HCMA 5DKNA 4OKHA 2F8PA 2M49B 3FE8A 1HT9A 5HKZA 1S36A 1U5IA 2KI6D 2SCPA 3D73A 1LA3A 2KNEA 2NXQA 4GUKA 3R72A 1IG5A 3CR5X 4MSPA 1S3PA 1TTXA 3DXLA 1M63B 3BQ3A 5D7FA 2WCEA 1ZFSA 3BOWB 2QEVA 3D78A 2LHIA 4PE7A 1QV0A 2F2PA 2JPOA 5F6TA 1YX7A 5HLVA 3LLEA 3SG4A 4DS7A 1QVIY 3AAJA 1B7TZ 2L98A 2LP3A 2M1KB 3CZ1A 4DIRA 3SG3A 2F33A 3LK1A 2CXJA 2KDHA 1N65A 1ZUZA 1ZOTB 1FI5A 2M29A 4MZJA 4PDZA 3CZ0A 1NX3A 2HETA 2NCOA 3D0YB 1IQ3A 4U8DA 5G08A 1TNWA 5AXIA 1SCMB 1F8HA 1YVHA 3JTDC 2P6BB 2LM5A 5J3XA 2LC5A 4PE4A 1W9ZA 1JUOA 1QX2A 1R6PA 4JWQA 1BJFA 3CWGA 1S6JA 2D8NA 3BJHA 4D1EA 1OOHA 3BUMB 1UHNA 3OGNA 1S6CA 2WC5A 5I94A 1C7VA 3CABA 3CZ2A 1KK8C 1LXFC 1YTZC 2K2FA 3CYZA 3OBVA 4MBEA 1NCZA 4BY5A 2WCBA 4YGEB 1DEKA 2KQ6A 3KEVA 5I2LA 2PRUA 3SG2A 2WCKA 4DCKA 4DRWA 2M9GA 2Q4UA 3GOFA 3D77A 2AUCA 2NZ0A 1S26D 1KK7Z 2BCAA 2L2EA 1KFXS 3EK8A 4MZKA 4AQJA 1WRLA 2QDIA 2I7AA 2P71A 4PCWA 3DVEA 1TCFA 5D69A 4INWA 1DF0B 4MVFA 4I5JA 4GBAA 4A4BA 5I2QA 3TS5C 1AVSA 1A29A 1TNPA 2QEHA 4I5NB 1DT7B 2ZN8A 3TUYC 3DYEA 2G2BA 4AQIA 1PALA 1J1DA 2JT8A 3QMEA 1DJHA 1YUUA 1PULA 3B6XA 1IJ5A 2BBMA 3EKHA 1BLQA 3BUXB 1WRZA 2JTTA 1J7PA 1L7ZA 4HRHA 1BODA 1CLLA 2QEBA 2JC2A 3FE6A 2K60A 1UHHA 3EVVA 3A8RA 1JWDA 4I5LB 1DJYA 4CFQA 3PFVA 2KLDA 5DKQA 1RJVA 1J55A 1OZOA 1Y1AA 2JULA 4P5OE 4PE0A 3K21A 1IKUA 1UHKA 1U5IB 2KQYA 4JKTA 4HRGA 1Y1XA 1OW4A 2I94A 1YURA 1F4QA 2KBMA 3AKBA 2MBXA 3SS4A 4M2PA 2BL0C 3NGVA 1F70A 2K7CA 1OOJA 3DD4A 2MA2A 3L4AA 3VROA 3CDNA 1OE9B 3WNXB 3PLFB 1JF0A 1FBVA 4OCIA 2JOJA 1KFXL 5TNCA 2KYCA 5ER4X 1LINA 1OMVA 1EL4A 1QASA 2H61C 2LE9B 1A4PA 3SS5A 4HSZA 1EXRA 1NYAA 1S5GZ 3CLNA 4YBHB 3S0EA 1UHIA 4F0ZB 1XA5A 1A03A 2RGIA
chains in the Genus database with same CATH topology
1QTXA 1X02A 2KI4B 3I5IC 2O5GA 3O2PA 1KFUS 3EKJA 1CFDA 4NQGA 1SKTA 3CR2A 4CPVA 1CDNA 5AANA 3RLZA 1C07A 3H4SE 2V53A 2JTZA 1NUBA 1UWOA 4MLWA 3D10A 5CSNA 3GK2A 1PVAA 3OB1B 1YUTA 4YGAA 2CNPA 3FWCA 1RTP1 2M8UA 2WCFA 1SMGA 1OZSA 3TZ1A 1K8UA 2FCDA 4YRUA 3A4UB 2ZFDA 1RROA 2HQWA 2OS8B 3QRXA 4R1EA 4C0KA 3PN7C 4QJ5B 1DTLA 1SL9A 1EG4A 2EHBA 1FI6A 2M1UA 1NPQA 3OX6A 4I5KA 1QV1A 3AAKA 5I8NA 1K94A 1N2DA 2ZN9A 1DJZA 2KAYA 1V1FA 2G9BA 4CLNA 1JC2A 1G8IA 3PM8A 1QXPA 1K9UA 1XFUO 4PHNA 1WLZA 1CKKA 2LLTA 1B7TY 2K0JA 1R2UA 2JZIA 2KSPA 1J7OA 5DKRA 3EVUA 2BE6A 2KGRA 1K9KA 1LKJA 1KFUL 1ZMZA 5CSIA 4YI8A 3OHMB 4GGNA 4OV2A 1JFKA 1SRAA 1C7WA 1YRTB 3I5GB 4MRYA 2M7LA 4MEWA 3M0WA 2H61A 1J7QA 2VRGA 1BT6A 1SW8A 2ZNDA 3EK4A 4NDDA 1YRUB 2ZRSA 1RECA 1UUSA 2LNKA 3DVKA 1SL7A 2EC6C 1J1EA 1JFJA 2JT3A 1HQVA 1QX7A 1DGUA 2LV7A 2ZRTA 2KYFA 1F4OA 1SL8A 2R2IA 3BUNB 1JSAA 2L0PA 4NDBA 2LVIA 4USLA 1TCOB 1EJ3A 2LVJA 2ISDA 3JTDB 5PALA 1XFZO 1WLMA 2QPTA 5BPJA 1PRWA 1XO5A 3I5FC 1TOPA 3CS1A 1IJ6A 1WRKA 1KK7Y 4E68A 1D1OA 1NSHA 1A75A 1SR6C 1SBJA 3E3RA 1IWQA 1K90D 2HF5A 2L5XB 3MSEB 3O6BA 1XFXO 4TNCA 4AOMA 3OB2B 3ZNIA 1KK8B 3VRNA 1CLMA 3BXKA 4JQ0D 5ER5A 5KU1A 1DJGA 1M39A 1B47A 4GGFC 1QLKA 1CM1A 3PATA 3OX5A 1GQMA 1B9AA 1CDLA 2LMVA 1DJIA 2LVVA 1QJTA 2K61A 1AJ5A 1MR8A 1NX2A 2FOTA 1KWOB 1CB1A 2F3ZA 1CMFA 2B1UA 2JXCA 1WDCB 2CTNA 3TUYB 3KO0A 4GAOA 1SK6D 4F0ZB 1PK0D 3AKAA 2K7OA 1NP8A 4P2YB 1H4BA 1XK4C 2BCXA 1ZACA 2PASA 3F45A 1DJWA 4OR9B 1KQMB 2WOSA 2BECA 1IH0A 2Y1NA 2L4HA 1RFJA 3WHUB 2E30A 5CSFA 2Y1MA 3BYAA 1LVCD 2JWWA 1SPYA 1GGWA 2H2KA 3I5HC 1XYDA 1M45A 2Q91A 1F54A 2KFHA 1S5GY 2HQ8A 4M2OA 2JQ6A 5HLOA 2LLSA 2MJWB 1WY9A 5GQQC 1CFFA 1CDMA 1LA0A 5B8IB 4ORAB 2OTGC 4UPGA 1V1GA 1IQ5A 2MAZA 3NXAA 2WC8A 3WHTB 1CMGA 1PSBA 5JJGA 3CR4X 4ORCB 1AK8A 1DMOA 2COLB 3KF9A 4GNKB 4ICBA 1FI5A 1BMOA 4C0LA 1J7RA 2E6WA 2K7DA 3CZTX 1F71A 3FIAA 1CM4A 1CTRA 1Y6WA 2GGZA 2WORA 1ALWA 1Q80A 1UP5A 3FWBA 4GGFA 3EK7A 4PHJA 3GK1A 4XYNA 3C1VA 2PVBA 1KCYA 4XJKA 3NSIA 1DF0A 3JVTC 4N5XA 2IS9A 1A2XA 1L2OC 2FJUB 2I2RE 3KPXA 4MN0A 2LP2A 3RM1A 1NCYA 1TRFA 3PALA 2GV5A 4C0JA 1BG1A 1RWYA 1YX8A 2DOQA 3ICBA 1TNQA 4N1FA 3NSKA 4BY4A 3NSLA 1SCVA 1QIVA 1AHRA 1K95A 1A75B 1B8RA 1K9PA 1XK4A 3O78A 4GPLB 2WNDA 5K89A 3SIAA 1W7IB 2ZNEA 2BBNA 2I18A 1MXEA 2KAVA 3GK4X 2TN4A 2O60A 1G33A 2ZKMX 2EGDA 2LUCA 2L51A 4QJ3B 3VRPA 2MHHA 2JU0A 4GFTA 2M7NA 2AAOA 2JXLA 2JRFA 1S1EA 4WRIA 1FPWA 2LLUA 1VRKA 1YVLA 1JF2A 3CGAA 3I5GC 5AFPA 4MRXA 1H8BA 1MUXA 1QLSA 1G4YR 1ALVA 2AMIA 2PSRA 3OP0A 5KTYA 1SCMC 4DUQA 4A4CA 2BKHB 2M97A 1UHJA 4PHMA 1IRJA 1CDPA 1TN4A 5FYXA 3CTNA 1QS7A 3LCPC 1OMDA 1QVIZ 4ETOA 1CLBA 3WXAA 3EVRA 3DF0A 2Y5IA 3FS7A 4FTGA 1F55A 3VRQA 3SG6A 1AUIB 2EC6B 3PSRA 1YUSA 1K2HA 4QJ4B 3TDIA 1RK9A 4PE1A 1NX1A 1MXLC 1Y1UA 2JT0A 1DVIA 2CBLA 2KFFA 1E8AA 2JNFA 2K2AA 1BU3A 1MQ1A 3I5FB 3KHEA 2L50A 1W7JB 1QX5B 1SR6B 1KSMA 2BE4A 5KSZA 4YGBB 3ZWHA 4N1GA 1OSAA 1SYMA 4PHKA 1UURA 1TNXA 2K7BA 1ODBA 1BF5A 1CFCA 1DGVA 2M0RA 1B8CA 3TS5B 1K93D 2PMYA 2LHLA 1OQPA 1NIWA 1QATA 2LANA 4XJKB 4CIDA 3BOWA 1BOCA 3IF7A 5HYDA 3VGOA 1S6IA 1KSOA 1KWOC 5CSJA 5JOLA 1WDCC 1BR4B 2LAPA 1EH2A 4L9MA 1M31A 1M46A 2KBIA 1XFWO 3O4YA 1BR1B 4ZCUA 3DVMA 1AJ4A 4MZLA 1Y0VH 1KQMC 3SIBA 2OPOA 2L4IA 1MF8B 3D0YA 1FF1A 2FCEA 3BUWB 4CFRA 4ORBB 2LMUA 1DJXA 1TIZA 3TDZA 4JPZB 2F2OA 1CNPA 1GJYA 2BCBA 3SG7A 3SJSA 3IQQA 3SG5A 2MRDA 1B8LA 2KAXA 5CPVA 4Q04A 4WQ3A 2BKIB 2LMTA 2K8MB 2KHNA 2LUXA 2NCPA 3LK0A 5AERA 2CT9A 4YI9A 2BL0B 3IQOA 1KQVA 1XFVO 1JBAA 3I5HB 1NCXA 2KOTA 1MHOA 2JPTA 4YGDB 4WQ2A 3NSOA 1B4CA 1SY9A 2JNXA 2KI4C 2GGMA 1EG3A 4OVNF 2Y4QA 4M2QA 2LVKA 2HPSA 2KFGA 1NWDA 2OTGB 5HKWA 4HREE 1QIWA 3I5IB 2NLNA 2SASA 2KGBC 1N0YA 3BUOB 1OMRA 5IBWA 1FW4A 4YGCB 1IGVA 2CCMA 1XVJA 5I2OA 2F3YA 1AP4A 1SNLA 2A4JA 1PSRA 2M3WA 2PALA 4ZCVA 1CFPA 2OS8C 2MLFC 3DF0B 1MWNA 2QACA 2MLEC 1YR5A 1K96A 4PALA 1NX0A 4NDCA 3TDUA 5HKYA 3LL8B 1PVBA 3JVTB 5AEQA 1GGZA 1L2OB 3HX4A 3PN7B 4IL1A 1B1GA 2KI6C 3DVJA 4FQOA 1XFYO 3VRRA 2LCPA 3HCMA 5DKNA 4OKHA 2F8PA 2M49B 1HT9A 5HKZA 1S36A 1U5IA 2KI6D 2SCPA 1LA3A 2KNEA 2NXQA 4GUKA 1IG5A 3CR5X 4MSPA 1S3PA 1TTXA 1M63B 3BQ3A 5D7FA 2WCEA 1ZFSA 3BOWB 2LHIA 4PE7A 1QV0A 2F2PA 5HLVA 5F6TA 1YX7A 3LLEA 3SG4A 4DS7A 1QVIY 3AAJA 1B7TZ 2L98A 2LP3A 2M1KB 4DIRA 3SG3A 2F33A 3LK1A 2CXJA 2KDHA 1N65A 1ZUZA 1ZOTB 2M29A 4MZJA 4PDZA 1NX3A 2HETA 2NCOA 3D0YB 1IQ3A 4U8DA 5G08A 1TNWA 5AXIA 1SCMB 1F8HA 1YVHA 3JTDC 2P6BB 2LM5A 5J3XA 2LC5A 4PE4A 1JUOA 1QX2A 1R6PA 4JWQA 1BJFA 3CWGA 1S6JA 2D8NA 4D1EA 3BUMB 1UHNA 1S6CA 1C7VA 1KK8C 1LXFC 1YTZC 2K2FA 4MBEA 4BY5A 1NCZA 2WCBA 4YGEB 2KQ6A 3KEVA 5I2LA 2PRUA 3SG2A 4DCKA 4DRWA 2M9GA 2Q4UA 3GOFA 2AUCA 2NZ0A 1S26D 1KK7Z 2BCAA 2L2EA 1KFXS 3EK8A 4MZKA 4AQJA 1WRLA 2I7AA 4PCWA 3DVEA 1TCFA 5D69A 4A4BA 1DF0B 4MVFA 4I5JA 4GBAA 5I2QA 3TS5C 1AVSA 1A29A 1TNPA 4I5NB 1DT7B 2ZN8A 3TUYC 2G2BA 4AQIA 1PALA 1J1DA 2JT8A 1DJHA 1YUUA 1PULA 1IJ5A 2BBMA 3EKHA 1BLQA 3BUXB 1WRZA 2JTTA 1J7PA 1L7ZA 4HRHA 1BODA 1CLLA 2JC2A 1UHHA 3EVVA 3A8RA 1JWDA 4I5LB 1DJYA 4CFQA 3PFVA 5DKQA 1RJVA 1J55A 1OZOA 1Y1AA 2JULA 4P5OE 4PE0A 3K21A 1IKUA 1UHKA 1U5IB 2KQYA 4HRGA 1Y1XA 2I94A 1YURA 1F4QA 2KBMA 3AKBA 2MBXA 4M2PA 2BL0C 1F70A 2K7CA 1OOJA 3DD4A 2MA2A 3VROA 1OE9B 3WNXB 3PLFB 1JF0A 1FBVA 4OCIA 2JOJA 1KFXL 5TNCA 2KYCA 5ER4X 1LINA 1OMVA 1EL4A 1QASA 2H61C 2LE9B 1A4PA 4HSZA 1EXRA 1NYAA 1S5GZ 3CLNA 4YBHB 1UHIA 1XA5A 1A03A 2RGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QTX A;  1X02 A;  2KI4 B;  3I5I C;  2O5G A;  3O2P A;  1KFU S;  3EKJ A;  1CFD A;  4NQG A;  1SKT A;  3CR2 A;  4CPV A;  1CDN A;  5AAN A;  3RLZ A;  1C07 A;  3H4S E;  2V53 A;  2JTZ A;  1NUB A;  1UWO A;  4MLW A;  3D10 A;  5CSN A;  3GK2 A;  1PVA A;  3OB1 B;  1YUT A;  4YGA A;  2CNP A;  3FWC A;  1RTP 1;  2M8U A;  2WCF A;  1SMG A;  1OZS A;  3TZ1 A;  1K8U A;  2FCD A;  4YRU A;  3A4U B;  2ZFD A;  1RRO A;  2HQW A;  2OS8 B;  3QRX A;  4R1E A;  4C0K A;  3PN7 C;  4QJ5 B;  1DTL A;  1SL9 A;  1EG4 A;  2EHB A;  1FI6 A;  2M1U A;  1NPQ A;  3OX6 A;  4I5K A;  1QV1 A;  3AAK A;  5I8N A;  1K94 A;  1N2D A;  2ZN9 A;  1DJZ A;  2KAY A;  1V1F A;  2G9B A;  4CLN A;  1JC2 A;  1G8I A;  3PM8 A;  1QXP A;  1K9U A;  1XFU O;  4PHN A;  1WLZ A;  1CKK A;  2LLT A;  1B7T Y;  2K0J A;  1R2U A;  2JZI A;  2KSP A;  1J7O A;  5DKR A;  3EVU A;  2BE6 A;  2KGR A;  1K9K A;  1LKJ A;  1KFU L;  1ZMZ A;  5CSI A;  4YI8 A;  3OHM B;  4GGN A;  4OV2 A;  1JFK A;  1SRA A;  1C7W A;  1YRT B;  3I5G B;  4MRY A;  2M7L A;  4MEW A;  3M0W A;  2H61 A;  1J7Q A;  2VRG A;  1BT6 A;  1SW8 A;  2ZND A;  3EK4 A;  4NDD A;  1YRU B;  2ZRS A;  1REC A;  1UUS A;  2LNK A;  3DVK A;  1SL7 A;  2EC6 C;  1J1E A;  1JFJ A;  2JT3 A;  1HQV A;  1QX7 A;  1DGU A;  2LV7 A;  2ZRT A;  2KYF A;  1F4O A;  1SL8 A;  2R2I A;  3BUN B;  1JSA A;  2L0P A;  4NDB A;  2LVI A;  4USL A;  1TCO B;  1EJ3 A;  2LVJ A;  2ISD A;  3JTD B;  5PAL A;  1XFZ O;  1WLM A;  2QPT A;  5BPJ A;  1PRW A;  1XO5 A;  3I5F C;  1TOP A;  3CS1 A;  1IJ6 A;  1WRK A;  1KK7 Y;  4E68 A;  1D1O A;  1NSH A;  1A75 A;  1SR6 C;  1SBJ A;  3E3R A;  1IWQ A;  1K90 D;  2HF5 A;  2L5X B;  3MSE B;  3O6B A;  1XFX O;  4TNC A;  4AOM A;  3OB2 B;  3ZNI A;  1KK8 B;  3VRN A;  1CLM A;  3BXK A;  4JQ0 D;  5ER5 A;  5KU1 A;  1DJG A;  1M39 A;  1B47 A;  4GGF C;  1QLK A;  1CM1 A;  3PAT A;  3OX5 A;  1GQM A;  1B9A A;  1CDL A;  2LMV A;  1DJI A;  2LVV A;  1QJT A;  2K61 A;  1AJ5 A;  1MR8 A;  1NX2 A;  2FOT A;  1KWO B;  1CB1 A;  2F3Z A;  1CMF A;  2B1U A;  2JXC A;  1WDC B;  2CTN A;  3TUY B;  3KO0 A;  4GAO A;  1SK6 D;  4F0Z B;  1PK0 D;  3AKA A;  2K7O A;  1NP8 A;  4P2Y B;  1H4B A;  1XK4 C;  2BCX A;  1ZAC A;  2PAS A;  3F45 A;  1DJW A;  4OR9 B;  1KQM B;  2WOS A;  2BEC A;  1IH0 A;  2Y1N A;  2L4H A;  1RFJ A;  3WHU B;  2E30 A;  5CSF A;  2Y1M A;  3BYA A;  1LVC D;  2JWW A;  1SPY A;  1GGW A;  2H2K A;  3I5H C;  1XYD A;  1M45 A;  2Q91 A;  1F54 A;  2KFH A;  1S5G Y;  2HQ8 A;  4M2O A;  2JQ6 A;  5HLO A;  2LLS A;  2MJW B;  1WY9 A;  5GQQ C;  1CFF A;  1CDM A;  1LA0 A;  5B8I B;  4ORA B;  2OTG C;  4UPG A;  1V1G A;  1IQ5 A;  2MAZ A;  3NXA A;  2WC8 A;  3WHT B;  1CMG A;  1PSB A;  5JJG A;  3CR4 X;  4ORC B;  1AK8 A;  1DMO A;  2COL B;  3KF9 A;  4GNK B;  4ICB A;  1FI5 A;  1BMO A;  4C0L A;  1J7R A;  2E6W A;  2K7D A;  3CZT X;  1F71 A;  3FIA A;  1CM4 A;  1CTR A;  1Y6W A;  2GGZ A;  2WOR A;  1ALW A;  1Q80 A;  1UP5 A;  3FWB A;  4GGF A;  3EK7 A;  4PHJ A;  3GK1 A;  4XYN A;  3C1V A;  2PVB A;  1KCY A;  4XJK A;  3NSI A;  1DF0 A;  3JVT C;  4N5X A;  2IS9 A;  1A2X A;  1L2O C;  2FJU B;  2I2R E;  3KPX A;  4MN0 A;  2LP2 A;  3RM1 A;  1NCY A;  1TRF A;  3PAL A;  2GV5 A;  4C0J A;  1BG1 A;  1RWY A;  1YX8 A;  2DOQ A;  3ICB A;  1TNQ A;  4N1F A;  3NSK A;  4BY4 A;  3NSL A;  1SCV A;  1QIV A;  1AHR A;  1K95 A;  1A75 B;  1B8R A;  1K9P A;  1XK4 A;  3O78 A;  4GPL B;  2WND A;  5K89 A;  3SIA A;  1W7I B;  2ZNE A;  2BBN A;  2I18 A;  1MXE A;  2KAV A;  3GK4 X;  2TN4 A;  2O60 A;  1G33 A;  2ZKM X;  2EGD A;  2LUC A;  2L51 A;  4QJ3 B;  3VRP A;  2MHH A;  2JU0 A;  4GFT A;  2M7N A;  2AAO A;  2JXL A;  2JRF A;  1S1E A;  4WRI A;  1FPW A;  2LLU A;  1VRK A;  1YVL A;  1JF2 A;  3CGA A;  3I5G C;  5AFP A;  4MRX A;  1H8B A;  1MUX A;  1QLS A;  1G4Y R;  1ALV A;  2AMI A;  2PSR A;  3OP0 A;  5KTY A;  1SCM C;  4DUQ A;  4A4C A;  2BKH B;  2M97 A;  1UHJ A;  4PHM A;  1IRJ A;  1CDP A;  1TN4 A;  5FYX A;  3CTN A;  1QS7 A;  3LCP C;  1OMD A;  1QVI Z;  4ETO A;  1CLB A;  3WXA A;  3EVR A;  3DF0 A;  2Y5I A;  3FS7 A;  4FTG A;  1F55 A;  3VRQ A;  3SG6 A;  1AUI B;  2EC6 B;  3PSR A;  1YUS A;  1K2H A;  4QJ4 B;  3TDI A;  1RK9 A;  4PE1 A;  1NX1 A;  1MXL C;  1Y1U A;  2JT0 A;  1DVI A;  2CBL A;  2KFF A;  1E8A A;  2JNF A;  2K2A A;  1BU3 A;  1MQ1 A;  3I5F B;  3KHE A;  2L50 A;  1W7J B;  1QX5 B;  1SR6 B;  1KSM A;  2BE4 A;  5KSZ A;  4YGB B;  3ZWH A;  4N1G A;  1OSA A;  1SYM A;  4PHK A;  1UUR A;  1TNX A;  2K7B A;  1ODB A;  1BF5 A;  1CFC A;  1DGV A;  2M0R A;  1B8C A;  3TS5 B;  1K93 D;  2PMY A;  2LHL A;  1OQP A;  1NIW A;  1QAT A;  2LAN A;  4XJK B;  4CID A;  3BOW A;  1BOC A;  3IF7 A;  5HYD A;  3VGO A;  1S6I A;  1KSO A;  1KWO C;  5CSJ A;  5JOL A;  1WDC C;  1BR4 B;  2LAP A;  1EH2 A;  4L9M A;  1M31 A;  1M46 A;  2KBI A;  1XFW O;  3O4Y A;  1BR1 B;  4ZCU A;  3DVM A;  1AJ4 A;  4MZL A;  1Y0V H;  1KQM C;  3SIB A;  2OPO A;  2L4I A;  1MF8 B;  3D0Y A;  1FF1 A;  2FCE A;  3BUW B;  4CFR A;  4ORB B;  2LMU A;  1DJX A;  1TIZ A;  3TDZ A;  4JPZ B;  2F2O A;  1CNP A;  1GJY A;  2BCB A;  3SG7 A;  3SJS A;  3IQQ A;  3SG5 A;  2MRD A;  1B8L A;  2KAX A;  5CPV A;  4Q04 A;  4WQ3 A;  2BKI B;  2LMT A;  2K8M B;  2KHN A;  2LUX A;  2NCP A;  3LK0 A;  5AER A;  2CT9 A;  4YI9 A;  2BL0 B;  3IQO A;  1KQV A;  1XFV O;  1JBA A;  3I5H B;  1NCX A;  2KOT A;  1MHO A;  2JPT A;  4YGD B;  4WQ2 A;  3NSO A;  1B4C A;  1SY9 A;  2JNX A;  2KI4 C;  2GGM A;  1EG3 A;  4OVN F;  2Y4Q A;  4M2Q A;  2LVK A;  2HPS A;  2KFG A;  1NWD A;  2OTG B;  5HKW A;  4HRE E;  1QIW A;  3I5I B;  2NLN A;  2SAS A;  2KGB C;  1N0Y A;  3BUO B;  1OMR A;  5IBW A;  1FW4 A;  4YGC B;  1IGV A;  2CCM A;  1XVJ A;  5I2O A;  2F3Y A;  1AP4 A;  1SNL A;  2A4J A;  1PSR A;  2M3W A;  2PAL A;  4ZCV A;  1CFP A;  2OS8 C;  2MLF C;  3DF0 B;  1MWN A;  2QAC A;  2MLE C;  1YR5 A;  1K96 A;  4PAL A;  1NX0 A;  4NDC A;  3TDU A;  5HKY A;  3LL8 B;  1PVB A;  3JVT B;  5AEQ A;  1GGZ A;  1L2O B;  3HX4 A;  3PN7 B;  4IL1 A;  1B1G A;  2KI6 C;  3DVJ A;  4FQO A;  1XFY O;  3VRR A;  2LCP A;  3HCM A;  5DKN A;  4OKH A;  2F8P A;  2M49 B;  1HT9 A;  5HKZ A;  1S36 A;  1U5I A;  2KI6 D;  2SCP A;  1LA3 A;  2KNE A;  2NXQ A;  4GUK A;  1IG5 A;  3CR5 X;  4MSP A;  1S3P A;  1TTX A;  1M63 B;  3BQ3 A;  5D7F A;  2WCE A;  1ZFS A;  3BOW B;  2LHI A;  4PE7 A;  1QV0 A;  2F2P A;  5HLV A;  5F6T A;  1YX7 A;  3LLE A;  3SG4 A;  4DS7 A;  1QVI Y;  3AAJ A;  1B7T Z;  2L98 A;  2LP3 A;  2M1K B;  4DIR A;  3SG3 A;  2F33 A;  3LK1 A;  2CXJ A;  2KDH A;  1N65 A;  1ZUZ A;  1ZOT B;  2M29 A;  4MZJ A;  4PDZ A;  1NX3 A;  2HET A;  2NCO A;  3D0Y B;  1IQ3 A;  4U8D A;  5G08 A;  1TNW A;  5AXI A;  1SCM B;  1F8H A;  1YVH A;  3JTD C;  2P6B B;  2LM5 A;  5J3X A;  2LC5 A;  4PE4 A;  1JUO A;  1QX2 A;  1R6P A;  4JWQ A;  1BJF A;  3CWG A;  1S6J A;  2D8N A;  4D1E A;  3BUM B;  1UHN A;  1S6C A;  1C7V A;  1KK8 C;  1LXF C;  1YTZ C;  2K2F A;  4MBE A;  4BY5 A;  1NCZ A;  2WCB A;  4YGE B;  2KQ6 A;  3KEV A;  5I2L A;  2PRU A;  3SG2 A;  4DCK A;  4DRW A;  2M9G A;  2Q4U A;  3GOF A;  2AUC A;  2NZ0 A;  1S26 D;  1KK7 Z;  2BCA A;  2L2E A;  1KFX S;  3EK8 A;  4MZK A;  4AQJ A;  1WRL A;  2I7A A;  4PCW A;  3DVE A;  1TCF A;  5D69 A;  4A4B A;  1DF0 B;  4MVF A;  4I5J A;  4GBA A;  5I2Q A;  3TS5 C;  1AVS A;  1A29 A;  1TNP A;  4I5N B;  1DT7 B;  2ZN8 A;  3TUY C;  2G2B A;  4AQI A;  1PAL A;  1J1D A;  2JT8 A;  1DJH A;  1YUU A;  1PUL A;  1IJ5 A;  2BBM A;  3EKH A;  1BLQ A;  3BUX B;  1WRZ A;  2JTT A;  1J7P A;  1L7Z A;  4HRH A;  1BOD A;  1CLL A;  2JC2 A;  1UHH A;  3EVV A;  3A8R A;  1JWD A;  4I5L B;  1DJY A;  4CFQ A;  3PFV A;  5DKQ A;  1RJV A;  1J55 A;  1OZO A;  1Y1A A;  2JUL A;  4P5O E;  4PE0 A;  3K21 A;  1IKU A;  1UHK A;  1U5I B;  2KQY A;  4HRG A;  1Y1X A;  2I94 A;  1YUR A;  1F4Q A;  2KBM A;  3AKB A;  2MBX A;  4M2P A;  2BL0 C;  1F70 A;  2K7C A;  1OOJ A;  3DD4 A;  2MA2 A;  3VRO A;  1OE9 B;  3WNX B;  3PLF B;  1JF0 A;  1FBV A;  4OCI A;  2JOJ A;  1KFX L;  5TNC A;  2KYC A;  5ER4 X;  1LIN A;  1OMV A;  1EL4 A;  1QAS A;  2H61 C;  2LE9 B;  1A4P A;  4HSZ A;  1EXR A;  1NYA A;  1S5G Z;  3CLN A;  4YBH B;  1UHI A;  1XA5 A;  1A03 A;  2RGI A; 
#chains in the Genus database with same CATH topology
 1QTX A;  1X02 A;  2KI4 B;  3D75 A;  3I5I C;  2O5G A;  3O2P A;  1KFU S;  3EKJ A;  1CFD A;  3BFH A;  4NQG A;  1SKT A;  3CR2 A;  5EL2 A;  4CPV A;  1CDN A;  5AAN A;  3RLZ A;  1C07 A;  3H4S E;  2V53 A;  2JTZ A;  1NUB A;  1UWO A;  4MLW A;  3D10 A;  5CSN A;  3GK2 A;  1PVA A;  3OB1 B;  1YUT A;  4YGA A;  2CNP A;  3FWC A;  1RTP 1;  2M8U A;  2WCF A;  3Q8I A;  1SMG A;  3FE9 A;  1OZS A;  3TZ1 A;  1K8U A;  2FCD A;  4YRU A;  3A4U B;  2ZFD A;  1RRO A;  2HQW A;  2OS8 B;  3QRX A;  4R1E A;  4C0K A;  3PN7 C;  3S0B A;  4QJ5 B;  1DTL A;  1SL9 A;  1EG4 A;  2EHB A;  3N7H A;  3R1P A;  1FI6 A;  2M1U A;  1XFR A;  1NPQ A;  3K1E A;  3OX6 A;  2FJY A;  4I5K A;  1QV1 A;  5HL1 A;  3B7A A;  1TUZ A;  3AAK A;  5I8N A;  1K94 A;  1N2D A;  2ZN9 A;  1DJZ A;  2KAY A;  1V1F A;  2G9B A;  4CLN A;  1JC2 A;  1G8I A;  3PM8 A;  1QXP A;  1K9U A;  1XFU O;  4PHN A;  1WLZ A;  2KPH A;  1CKK A;  3NHT A;  2LLT A;  1B7T Y;  2K0J A;  1R2U A;  2JZI A;  2KSP A;  1J7O A;  5DKR A;  3EVU A;  2BE6 A;  2KGR A;  2BNX A;  1K9K A;  1LKJ A;  1KFU L;  1ZMZ A;  5CSI A;  4YI8 A;  3S0F A;  3UNW A;  3OHM B;  4GGN A;  4OV2 A;  1JFK A;  1SRA A;  1C7W A;  1YRT B;  3I5G B;  3L47 A;  4MRY A;  2M7L A;  4MEW A;  3M0W A;  2H61 A;  1J7Q A;  2VRG A;  1BT6 A;  1SW8 A;  2ZND A;  3EK4 A;  4NDD A;  1YRU B;  2ZRS A;  1REC A;  1UUS A;  2LNK A;  3D76 A;  1SL7 A;  3DVK A;  3IVT A;  2EC6 C;  1J1E A;  3R1V A;  1JFJ A;  2JT3 A;  1HQV A;  1QX7 A;  1DGU A;  2LV7 A;  2ZRT A;  2KYF A;  1F4O A;  1SL8 A;  2R2I A;  3B87 A;  3BUN B;  5FI6 A;  1JSA A;  2L0P A;  2PQL A;  4NDB A;  2LVI A;  4USL A;  1TCO B;  1EJ3 A;  2LVJ A;  2P70 A;  3SS3 A;  2ISD A;  3JTD B;  1Z2C B;  5PAL A;  1XFZ O;  1WLM A;  2QPT A;  5BPJ A;  1PRW A;  5D3O A;  1XO5 A;  3I5F C;  1TOP A;  3CS1 A;  1IJ6 A;  1WRK A;  1KK7 Y;  4E68 A;  1D1O A;  1NSH A;  4OZD A;  1A75 A;  1SR6 C;  1SBJ A;  3E3R A;  1IWQ A;  1K90 D;  2HF5 A;  2L5X B;  3MSE B;  3O6B A;  1XFX O;  3D74 A;  4TNC A;  4AOM A;  3OB2 B;  3ZNI A;  1KK8 B;  3VRN A;  1CLM A;  3BXK A;  4JQ0 D;  5ER5 A;  5KU1 A;  1DJG A;  1M39 A;  1B47 A;  4GGF C;  1QLK A;  1CM1 A;  2WC6 A;  3PAT A;  1GM0 A;  3OX5 A;  1GQM A;  1B9A A;  1CDL A;  2LMV A;  1DJI A;  2LVV A;  1QJT A;  2K61 A;  1AJ5 A;  1MR8 A;  1NX2 A;  2FOT A;  1DQE A;  1KWO B;  1CB1 A;  1DEL A;  2F3Z A;  1CMF A;  2B1U A;  2JXC A;  1WDC B;  2CTN A;  3TUY B;  3KO0 A;  4GAO A;  1SK6 D;  2ERB A;  3PM2 A;  1PK0 D;  3AKA A;  2K7O A;  1NP8 A;  4IJ7 A;  4P2Y B;  1XK4 C;  3VB1 A;  2BCX A;  1H4B A;  1ZAC A;  2PAS A;  3F45 A;  3NHI A;  1DJW A;  4OR9 B;  1KQM B;  2WOS A;  3S0G A;  2BEC A;  1IH0 A;  2Y1N A;  3BFB A;  2L4H A;  2WCM A;  1RFJ A;  3WHU B;  2E30 A;  4KYN A;  5CSF A;  2Y1M A;  3BYA A;  1LVC D;  2JWW A;  1SPY A;  1GGW A;  2H2K A;  3I5H C;  1XYD A;  1M45 A;  1SSE B;  2Q91 A;  1F54 A;  2KFH A;  1S5G Y;  2HQ8 A;  4M2O A;  2JQ6 A;  2L2C A;  2LLS A;  2MJW B;  5HLO A;  1WY9 A;  5GQQ C;  1CFF A;  1CDM A;  1LA0 A;  5B8I B;  4ORA B;  1P28 A;  2OTG C;  4UPG A;  1V1G A;  1IQ5 A;  2MAZ A;  3NXA A;  2WC8 A;  3WHT B;  4F7F A;  1CMG A;  1PSB A;  5JJG A;  3CR4 X;  4ORC B;  1AK8 A;  1DMO A;  2COL B;  3KF9 A;  3L4L A;  4GNK B;  4ICB A;  1BMO A;  4C0L A;  1J7R A;  2E6W A;  2K7D A;  3CZT X;  1F71 A;  3DY9 A;  3FIA A;  1CM4 A;  1CTR A;  1Y6W A;  2GGZ A;  2WOR A;  1ALW A;  1Q80 A;  1UP5 A;  2WCJ A;  3FWB A;  4INX A;  4GGF A;  3EK7 A;  4PHJ A;  3GK1 A;  4XYN A;  3C1V A;  2PVB A;  1KCY A;  3B88 A;  4XJK A;  3UO9 A;  3S0A A;  3NSI A;  1DF0 A;  3JVT C;  4JD9 A;  4N5X A;  2IS9 A;  1A2X A;  1L2O C;  2FJU B;  2I2R E;  3KPX A;  4MN0 A;  2LP2 A;  3RM1 A;  1NCY A;  1TRF A;  3PAL A;  1OOG A;  2GV5 A;  4C0J A;  1BG1 A;  1RWY A;  3V2L A;  1YX8 A;  2DOQ A;  3ICB A;  1TNQ A;  4N1F A;  3NSK A;  4BY4 A;  3NSL A;  1SCV A;  1QIV A;  3EG5 B;  1AHR A;  1K95 A;  1A75 B;  1B8R A;  1K9P A;  1XK4 A;  3O78 A;  4GPL B;  2WND A;  2QEO A;  5K89 A;  3SIA A;  1W7I B;  2ZNE A;  2BBN A;  2I18 A;  1MXE A;  2KAV A;  3GK4 X;  2TN4 A;  2O60 A;  3B86 A;  1G33 A;  2ZKM X;  2EGD A;  2LUC A;  2L51 A;  4QJ3 B;  3VRP A;  2MHH A;  2JU0 A;  4GFT A;  2KLE A;  2M7N A;  1IIO A;  2AAO A;  2JXL A;  2JRF A;  1S1E A;  4WRI A;  1FPW A;  1TUJ A;  2LLU A;  1VRK A;  1YVL A;  1JF2 A;  3CGA A;  3I5G C;  5AFP A;  4MRX A;  1H8B A;  1MUX A;  1QLS A;  1G4Y R;  1ALV A;  2AMI A;  2PSR A;  3OP0 A;  5KTY A;  1SCM C;  1OOF A;  4DUQ A;  4A4C A;  2BKH B;  2M97 A;  1UHJ A;  4PHM A;  1IRJ A;  5DIC A;  1CDP A;  5FI7 A;  1TN4 A;  5FYX A;  3CTN A;  1QS7 A;  3DZT A;  3LCP C;  1OMD A;  1QVI Z;  4ETO A;  1CLB A;  3WXA A;  3EVR A;  5FI2 A;  3DF0 A;  2Y5I A;  3FS7 A;  4FTG A;  1F55 A;  3VRQ A;  3SG6 A;  1LS8 A;  1AUI B;  2EC6 B;  3PSR A;  1YUS A;  1K2H A;  4QJ4 B;  3TDI A;  1RK9 A;  4PE1 A;  1NX1 A;  1MXL C;  1Y1U A;  2JT0 A;  1DVI A;  1QWV A;  2CBL A;  2KFF A;  1E8A A;  2JNF A;  2K2A A;  1BU3 A;  1MQ1 A;  3I5F B;  2YGU A;  3KHE A;  1DC1 A;  2L50 A;  2H8V A;  1W7J B;  1QX5 B;  1SR6 B;  1KSM A;  2BE4 A;  5KSZ A;  4YGB B;  3ZWH A;  4N1G A;  1OSA A;  1SYM A;  4PHK A;  1UUR A;  1TNX A;  2K7B A;  1ODB A;  1BF5 A;  1CFC A;  1DGV A;  2M0R A;  1B8C A;  3TS5 B;  1K93 D;  2PMY A;  2LHL A;  1OQP A;  3S0D A;  1NIW A;  1QAT A;  2LAN A;  4XJK B;  4CID A;  3BOW A;  1Z4H A;  3IF7 A;  5HYD A;  4FQT A;  3VGO A;  1BOC A;  1S6I A;  1KSO A;  1KWO C;  5CSJ A;  2WCH A;  5JOL A;  1WDC C;  1BR4 B;  2LAP A;  1EH2 A;  4L9M A;  1M31 A;  1M46 A;  2KBI A;  1XFW O;  3O4Y A;  1BR1 B;  4ZCU A;  1C3Z A;  3DVM A;  1AJ4 A;  4MZL A;  1Y0V H;  1KQM C;  3SIB A;  2OPO A;  2L4I A;  1MF8 B;  3D0Y A;  1FF1 A;  2FCE A;  3BUW B;  2GTE A;  4CFR A;  4ORB B;  2LMU A;  1DJX A;  1TIZ A;  3TDZ A;  4JPZ B;  2F2O A;  3RZS A;  1GJY A;  1CNP A;  2BCB A;  3SG7 A;  1T14 A;  3SJS A;  3O4X A;  3IQQ A;  3SG5 A;  2MRD A;  1B8L A;  2KAX A;  5CPV A;  4Q04 A;  4WQ3 A;  2BKI B;  2LMT A;  2K8M B;  2KHN A;  2LUX A;  2NCP A;  3LK0 A;  5AER A;  2CT9 A;  4YI9 A;  2BL0 B;  3IQO A;  1KQV A;  1XFV O;  1JBA A;  3I5H B;  1OOI X;  1NCX A;  2KOT A;  1MHO A;  2JPT A;  4YGD B;  4WQ2 A;  3NSO A;  1C3Y A;  1B4C A;  1SY9 A;  2JNX A;  2KI4 C;  2GGM A;  3BFA A;  1EG3 A;  4OVN F;  2Y4Q A;  4M2Q A;  2BAP A;  2HPS A;  2KFG A;  2LVK A;  1NWD A;  2OTG B;  5HKW A;  4HRE E;  1QIW A;  3I5I B;  2NLN A;  2SAS A;  2KGB C;  1N0Y A;  3BUO B;  1OMR A;  5IBW A;  1FW4 A;  4YGC B;  1IGV A;  2CCM A;  1XVJ A;  5I2O A;  2F3Y A;  1AP4 A;  1SNL A;  2A4J A;  1PSR A;  2M3W A;  2PAL A;  4ZCV A;  1CFP A;  2WCL A;  2OS8 C;  2MLF C;  3DF0 B;  1MWN A;  1ORG A;  2MLE C;  2QAC A;  1YR5 A;  1K96 A;  4PAL A;  1NX0 A;  2L5Y A;  4NDC A;  3TDU A;  5HKY A;  3LL8 B;  3PJI A;  1PVB A;  3JVT B;  4PT1 A;  5AEQ A;  1GGZ A;  1L2O B;  3HX4 A;  3PN7 B;  4IL1 A;  3R1O A;  1B1G A;  2KI6 C;  3DVJ A;  4FQO A;  1XFY O;  2PYQ A;  3VRR A;  2LCP A;  1TWO A;  3HCM A;  5DKN A;  4OKH A;  2F8P A;  2M49 B;  3FE8 A;  1HT9 A;  5HKZ A;  1S36 A;  1U5I A;  2KI6 D;  2SCP A;  3D73 A;  1LA3 A;  2KNE A;  2NXQ A;  4GUK A;  3R72 A;  1IG5 A;  3CR5 X;  4MSP A;  1S3P A;  1TTX A;  3DXL A;  1M63 B;  3BQ3 A;  5D7F A;  2WCE A;  1ZFS A;  3BOW B;  2QEV A;  3D78 A;  2LHI A;  4PE7 A;  1QV0 A;  2F2P A;  2JPO A;  5F6T A;  1YX7 A;  5HLV A;  3LLE A;  3SG4 A;  4DS7 A;  1QVI Y;  3AAJ A;  1B7T Z;  2L98 A;  2LP3 A;  2M1K B;  3CZ1 A;  4DIR A;  3SG3 A;  2F33 A;  3LK1 A;  2CXJ A;  2KDH A;  1N65 A;  1ZUZ A;  1ZOT B;  1FI5 A;  2M29 A;  4MZJ A;  4PDZ A;  3CZ0 A;  1NX3 A;  2HET A;  2NCO A;  3D0Y B;  1IQ3 A;  4U8D A;  5G08 A;  1TNW A;  5AXI A;  1SCM B;  1F8H A;  1YVH A;  3JTD C;  2P6B B;  2LM5 A;  5J3X A;  2LC5 A;  4PE4 A;  1W9Z A;  1JUO A;  1QX2 A;  1R6P A;  4JWQ A;  1BJF A;  3CWG A;  1S6J A;  2D8N A;  3BJH A;  4D1E A;  1OOH A;  3BUM B;  1UHN A;  3OGN A;  1S6C A;  2WC5 A;  5I94 A;  1C7V A;  3CAB A;  3CZ2 A;  1KK8 C;  1LXF C;  1YTZ C;  2K2F A;  3CYZ A;  3OBV A;  4MBE A;  1NCZ A;  4BY5 A;  2WCB A;  4YGE B;  1DEK A;  2KQ6 A;  3KEV A;  5I2L A;  2PRU A;  3SG2 A;  2WCK A;  4DCK A;  4DRW A;  2M9G A;  2Q4U A;  3GOF A;  3D77 A;  2AUC A;  2NZ0 A;  1S26 D;  1KK7 Z;  2BCA A;  2L2E A;  1KFX S;  3EK8 A;  4MZK A;  4AQJ A;  1WRL A;  2QDI A;  2I7A A;  2P71 A;  4PCW A;  3DVE A;  1TCF A;  5D69 A;  4INW A;  1DF0 B;  4MVF A;  4I5J A;  4GBA A;  4A4B A;  5I2Q A;  3TS5 C;  1AVS A;  1A29 A;  1TNP A;  2QEH A;  4I5N B;  1DT7 B;  2ZN8 A;  3TUY C;  3DYE A;  2G2B A;  4AQI A;  1PAL A;  1J1D A;  2JT8 A;  3QME A;  1DJH A;  1YUU A;  1PUL A;  3B6X A;  1IJ5 A;  2BBM A;  3EKH A;  1BLQ A;  3BUX B;  1WRZ A;  2JTT A;  1J7P A;  1L7Z A;  4HRH A;  1BOD A;  1CLL A;  2QEB A;  2JC2 A;  3FE6 A;  2K60 A;  1UHH A;  3EVV A;  3A8R A;  1JWD A;  4I5L B;  1DJY A;  4CFQ A;  3PFV A;  2KLD A;  5DKQ A;  1RJV A;  1J55 A;  1OZO A;  1Y1A A;  2JUL A;  4P5O E;  4PE0 A;  3K21 A;  1IKU A;  1UHK A;  1U5I B;  2KQY A;  4JKT A;  4HRG A;  1Y1X A;  1OW4 A;  2I94 A;  1YUR A;  1F4Q A;  2KBM A;  3AKB A;  2MBX A;  3SS4 A;  4M2P A;  2BL0 C;  3NGV A;  1F70 A;  2K7C A;  1OOJ A;  3DD4 A;  2MA2 A;  3L4A A;  3VRO A;  3CDN A;  1OE9 B;  3WNX B;  3PLF B;  1JF0 A;  1FBV A;  4OCI A;  2JOJ A;  1KFX L;  5TNC A;  2KYC A;  5ER4 X;  1LIN A;  1OMV A;  1EL4 A;  1QAS A;  2H61 C;  2LE9 B;  1A4P A;  3SS5 A;  4HSZ A;  1EXR A;  1NYA A;  1S5G Z;  3CLN A;  4YBH B;  3S0E A;  1UHI A;  4F0Z B;  1XA5 A;  1A03 A;  2RGI A; 
#chains in the Genus database with same CATH homology
 1QTX A;  1X02 A;  2KI4 B;  3I5I C;  2O5G A;  3O2P A;  1KFU S;  3EKJ A;  1CFD A;  4NQG A;  1SKT A;  3CR2 A;  4CPV A;  1CDN A;  5AAN A;  3RLZ A;  1C07 A;  3H4S E;  2V53 A;  2JTZ A;  1NUB A;  1UWO A;  4MLW A;  3D10 A;  5CSN A;  3GK2 A;  1PVA A;  3OB1 B;  1YUT A;  4YGA A;  2CNP A;  3FWC A;  1RTP 1;  2M8U A;  2WCF A;  1SMG A;  1OZS A;  3TZ1 A;  1K8U A;  2FCD A;  4YRU A;  3A4U B;  2ZFD A;  1RRO A;  2HQW A;  2OS8 B;  3QRX A;  4R1E A;  4C0K A;  3PN7 C;  4QJ5 B;  1DTL A;  1SL9 A;  1EG4 A;  2EHB A;  1FI6 A;  2M1U A;  1NPQ A;  3OX6 A;  4I5K A;  1QV1 A;  3AAK A;  5I8N A;  1K94 A;  1N2D A;  2ZN9 A;  1DJZ A;  2KAY A;  1V1F A;  2G9B A;  4CLN A;  1JC2 A;  1G8I A;  3PM8 A;  1QXP A;  1K9U A;  1XFU O;  4PHN A;  1WLZ A;  1CKK A;  2LLT A;  1B7T Y;  2K0J A;  1R2U A;  2JZI A;  2KSP A;  1J7O A;  5DKR A;  3EVU A;  2BE6 A;  2KGR A;  1K9K A;  1LKJ A;  1KFU L;  1ZMZ A;  5CSI A;  4YI8 A;  3OHM B;  4GGN A;  4OV2 A;  1JFK A;  1SRA A;  1C7W A;  1YRT B;  3I5G B;  4MRY A;  2M7L A;  4MEW A;  3M0W A;  2H61 A;  1J7Q A;  2VRG A;  1BT6 A;  1SW8 A;  2ZND A;  3EK4 A;  4NDD A;  1YRU B;  2ZRS A;  1REC A;  1UUS A;  2LNK A;  3DVK A;  1SL7 A;  2EC6 C;  1J1E A;  1JFJ A;  2JT3 A;  1HQV A;  1QX7 A;  1DGU A;  2LV7 A;  2ZRT A;  2KYF A;  1F4O A;  1SL8 A;  2R2I A;  3BUN B;  1JSA A;  2L0P A;  4NDB A;  2LVI A;  4USL A;  1TCO B;  1EJ3 A;  2LVJ A;  2ISD A;  3JTD B;  5PAL A;  1XFZ O;  1WLM A;  2QPT A;  5BPJ A;  1PRW A;  1XO5 A;  3I5F C;  1TOP A;  3CS1 A;  1IJ6 A;  1WRK A;  1KK7 Y;  4E68 A;  1D1O A;  1NSH A;  1A75 A;  1SR6 C;  1SBJ A;  3E3R A;  1IWQ A;  1K90 D;  2HF5 A;  2L5X B;  3MSE B;  3O6B A;  1XFX O;  4TNC A;  4AOM A;  3OB2 B;  3ZNI A;  1KK8 B;  3VRN A;  1CLM A;  3BXK A;  4JQ0 D;  5ER5 A;  5KU1 A;  1DJG A;  1M39 A;  1B47 A;  4GGF C;  1QLK A;  1CM1 A;  3PAT A;  3OX5 A;  1GQM A;  1B9A A;  1CDL A;  2LMV A;  1DJI A;  2LVV A;  1QJT A;  2K61 A;  1AJ5 A;  1MR8 A;  1NX2 A;  2FOT A;  1KWO B;  1CB1 A;  2F3Z A;  1CMF A;  2B1U A;  2JXC A;  1WDC B;  2CTN A;  3TUY B;  3KO0 A;  4GAO A;  1SK6 D;  4F0Z B;  1PK0 D;  3AKA A;  2K7O A;  1NP8 A;  4P2Y B;  1H4B A;  1XK4 C;  2BCX A;  1ZAC A;  2PAS A;  3F45 A;  1DJW A;  4OR9 B;  1KQM B;  2WOS A;  2BEC A;  1IH0 A;  2Y1N A;  2L4H A;  1RFJ A;  3WHU B;  2E30 A;  5CSF A;  2Y1M A;  3BYA A;  1LVC D;  2JWW A;  1SPY A;  1GGW A;  2H2K A;  3I5H C;  1XYD A;  1M45 A;  2Q91 A;  1F54 A;  2KFH A;  1S5G Y;  2HQ8 A;  4M2O A;  2JQ6 A;  5HLO A;  2LLS A;  2MJW B;  1WY9 A;  5GQQ C;  1CFF A;  1CDM A;  1LA0 A;  5B8I B;  4ORA B;  2OTG C;  4UPG A;  1V1G A;  1IQ5 A;  2MAZ A;  3NXA A;  2WC8 A;  3WHT B;  1CMG A;  1PSB A;  5JJG A;  3CR4 X;  4ORC B;  1AK8 A;  1DMO A;  2COL B;  3KF9 A;  4GNK B;  4ICB A;  1FI5 A;  1BMO A;  4C0L A;  1J7R A;  2E6W A;  2K7D A;  3CZT X;  1F71 A;  3FIA A;  1CM4 A;  1CTR A;  1Y6W A;  2GGZ A;  2WOR A;  1ALW A;  1Q80 A;  1UP5 A;  3FWB A;  4GGF A;  3EK7 A;  4PHJ A;  3GK1 A;  4XYN A;  3C1V A;  2PVB A;  1KCY A;  4XJK A;  3NSI A;  1DF0 A;  3JVT C;  4N5X A;  2IS9 A;  1A2X A;  1L2O C;  2FJU B;  2I2R E;  3KPX A;  4MN0 A;  2LP2 A;  3RM1 A;  1NCY A;  1TRF A;  3PAL A;  2GV5 A;  4C0J A;  1BG1 A;  1RWY A;  1YX8 A;  2DOQ A;  3ICB A;  1TNQ A;  4N1F A;  3NSK A;  4BY4 A;  3NSL A;  1SCV A;  1QIV A;  1AHR A;  1K95 A;  1A75 B;  1B8R A;  1K9P A;  1XK4 A;  3O78 A;  4GPL B;  2WND A;  5K89 A;  3SIA A;  1W7I B;  2ZNE A;  2BBN A;  2I18 A;  1MXE A;  2KAV A;  3GK4 X;  2TN4 A;  2O60 A;  1G33 A;  2ZKM X;  2EGD A;  2LUC A;  2L51 A;  4QJ3 B;  3VRP A;  2MHH A;  2JU0 A;  4GFT A;  2M7N A;  2AAO A;  2JXL A;  2JRF A;  1S1E A;  4WRI A;  1FPW A;  2LLU A;  1VRK A;  1YVL A;  1JF2 A;  3CGA A;  3I5G C;  5AFP A;  4MRX A;  1H8B A;  1MUX A;  1QLS A;  1G4Y R;  1ALV A;  2AMI A;  2PSR A;  3OP0 A;  5KTY A;  1SCM C;  4DUQ A;  4A4C A;  2BKH B;  2M97 A;  1UHJ A;  4PHM A;  1IRJ A;  1CDP A;  1TN4 A;  5FYX A;  3CTN A;  1QS7 A;  3LCP C;  1OMD A;  1QVI Z;  4ETO A;  1CLB A;  3WXA A;  3EVR A;  3DF0 A;  2Y5I A;  3FS7 A;  4FTG A;  1F55 A;  3VRQ A;  3SG6 A;  1AUI B;  2EC6 B;  3PSR A;  1YUS A;  1K2H A;  4QJ4 B;  3TDI A;  1RK9 A;  4PE1 A;  1NX1 A;  1MXL C;  1Y1U A;  2JT0 A;  1DVI A;  2CBL A;  2KFF A;  1E8A A;  2JNF A;  2K2A A;  1BU3 A;  1MQ1 A;  3I5F B;  3KHE A;  2L50 A;  1W7J B;  1QX5 B;  1SR6 B;  1KSM A;  2BE4 A;  5KSZ A;  4YGB B;  3ZWH A;  4N1G A;  1OSA A;  1SYM A;  4PHK A;  1UUR A;  1TNX A;  2K7B A;  1ODB A;  1BF5 A;  1CFC A;  1DGV A;  2M0R A;  1B8C A;  3TS5 B;  1K93 D;  2PMY A;  2LHL A;  1OQP A;  1NIW A;  1QAT A;  2LAN A;  4XJK B;  4CID A;  3BOW A;  1BOC A;  3IF7 A;  5HYD A;  3VGO A;  1S6I A;  1KSO A;  1KWO C;  5CSJ A;  5JOL A;  1WDC C;  1BR4 B;  2LAP A;  1EH2 A;  4L9M A;  1M31 A;  1M46 A;  2KBI A;  1XFW O;  3O4Y A;  1BR1 B;  4ZCU A;  3DVM A;  1AJ4 A;  4MZL A;  1Y0V H;  1KQM C;  3SIB A;  2OPO A;  2L4I A;  1MF8 B;  3D0Y A;  1FF1 A;  2FCE A;  3BUW B;  4CFR A;  4ORB B;  2LMU A;  1DJX A;  1TIZ A;  3TDZ A;  4JPZ B;  2F2O A;  1CNP A;  1GJY A;  2BCB A;  3SG7 A;  3SJS A;  3IQQ A;  3SG5 A;  2MRD A;  1B8L A;  2KAX A;  5CPV A;  4Q04 A;  4WQ3 A;  2BKI B;  2LMT A;  2K8M B;  2KHN A;  2LUX A;  2NCP A;  3LK0 A;  5AER A;  2CT9 A;  4YI9 A;  2BL0 B;  3IQO A;  1KQV A;  1XFV O;  1JBA A;  3I5H B;  1NCX A;  2KOT A;  1MHO A;  2JPT A;  4YGD B;  4WQ2 A;  3NSO A;  1B4C A;  1SY9 A;  2JNX A;  2KI4 C;  2GGM A;  1EG3 A;  4OVN F;  2Y4Q A;  4M2Q A;  2LVK A;  2HPS A;  2KFG A;  1NWD A;  2OTG B;  5HKW A;  4HRE E;  1QIW A;  3I5I B;  2NLN A;  2SAS A;  2KGB C;  1N0Y A;  3BUO B;  1OMR A;  5IBW A;  1FW4 A;  4YGC B;  1IGV A;  2CCM A;  1XVJ A;  5I2O A;  2F3Y A;  1AP4 A;  1SNL A;  2A4J A;  1PSR A;  2M3W A;  2PAL A;  4ZCV A;  1CFP A;  2OS8 C;  2MLF C;  3DF0 B;  1MWN A;  2QAC A;  2MLE C;  1YR5 A;  1K96 A;  4PAL A;  1NX0 A;  4NDC A;  3TDU A;  5HKY A;  3LL8 B;  1PVB A;  3JVT B;  5AEQ A;  1GGZ A;  1L2O B;  3HX4 A;  3PN7 B;  4IL1 A;  1B1G A;  2KI6 C;  3DVJ A;  4FQO A;  1XFY O;  3VRR A;  2LCP A;  3HCM A;  5DKN A;  4OKH A;  2F8P A;  2M49 B;  1HT9 A;  5HKZ A;  1S36 A;  1U5I A;  2KI6 D;  2SCP A;  1LA3 A;  2KNE A;  2NXQ A;  4GUK A;  1IG5 A;  3CR5 X;  4MSP A;  1S3P A;  1TTX A;  1M63 B;  3BQ3 A;  5D7F A;  2WCE A;  1ZFS A;  3BOW B;  2LHI A;  4PE7 A;  1QV0 A;  2F2P A;  5HLV A;  5F6T A;  1YX7 A;  3LLE A;  3SG4 A;  4DS7 A;  1QVI Y;  3AAJ A;  1B7T Z;  2L98 A;  2LP3 A;  2M1K B;  4DIR A;  3SG3 A;  2F33 A;  3LK1 A;  2CXJ A;  2KDH A;  1N65 A;  1ZUZ A;  1ZOT B;  2M29 A;  4MZJ A;  4PDZ A;  1NX3 A;  2HET A;  2NCO A;  3D0Y B;  1IQ3 A;  4U8D A;  5G08 A;  1TNW A;  5AXI A;  1SCM B;  1F8H A;  1YVH A;  3JTD C;  2P6B B;  2LM5 A;  5J3X A;  2LC5 A;  4PE4 A;  1JUO A;  1QX2 A;  1R6P A;  4JWQ A;  1BJF A;  3CWG A;  1S6J A;  2D8N A;  4D1E A;  3BUM B;  1UHN A;  1S6C A;  1C7V A;  1KK8 C;  1LXF C;  1YTZ C;  2K2F A;  4MBE A;  4BY5 A;  1NCZ A;  2WCB A;  4YGE B;  2KQ6 A;  3KEV A;  5I2L A;  2PRU A;  3SG2 A;  4DCK A;  4DRW A;  2M9G A;  2Q4U A;  3GOF A;  2AUC A;  2NZ0 A;  1S26 D;  1KK7 Z;  2BCA A;  2L2E A;  1KFX S;  3EK8 A;  4MZK A;  4AQJ A;  1WRL A;  2I7A A;  4PCW A;  3DVE A;  1TCF A;  5D69 A;  4A4B A;  1DF0 B;  4MVF A;  4I5J A;  4GBA A;  5I2Q A;  3TS5 C;  1AVS A;  1A29 A;  1TNP A;  4I5N B;  1DT7 B;  2ZN8 A;  3TUY C;  2G2B A;  4AQI A;  1PAL A;  1J1D A;  2JT8 A;  1DJH A;  1YUU A;  1PUL A;  1IJ5 A;  2BBM A;  3EKH A;  1BLQ A;  3BUX B;  1WRZ A;  2JTT A;  1J7P A;  1L7Z A;  4HRH A;  1BOD A;  1CLL A;  2JC2 A;  1UHH A;  3EVV A;  3A8R A;  1JWD A;  4I5L B;  1DJY A;  4CFQ A;  3PFV A;  5DKQ A;  1RJV A;  1J55 A;  1OZO A;  1Y1A A;  2JUL A;  4P5O E;  4PE0 A;  3K21 A;  1IKU A;  1UHK A;  1U5I B;  2KQY A;  4HRG A;  1Y1X A;  2I94 A;  1YUR A;  1F4Q A;  2KBM A;  3AKB A;  2MBX A;  4M2P A;  2BL0 C;  1F70 A;  2K7C A;  1OOJ A;  3DD4 A;  2MA2 A;  3VRO A;  1OE9 B;  3WNX B;  3PLF B;  1JF0 A;  1FBV A;  4OCI A;  2JOJ A;  1KFX L;  5TNC A;  2KYC A;  5ER4 X;  1LIN A;  1OMV A;  1EL4 A;  1QAS A;  2H61 C;  2LE9 B;  1A4P A;  4HSZ A;  1EXR A;  1NYA A;  1S5G Z;  3CLN A;  4YBH B;  1UHI A;  1XA5 A;  1A03 A;  2RGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...