1CDMA

Modulation of calmodulin plasticity in molecular recognition on the basis of x-ray structures
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
133
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE CALMODULIN-DEPENDENT PROTEIN KINASE II
publication title Modulation of calmodulin plasticity in molecular recognition on the basis of x-ray structures.
pubmed rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 46
structure length 133
sequence length 143
ec nomenclature
pdb deposition date 1993-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cdmA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cdmA02
4YGCB 2L51A 2L2EA 2GGMA 1C7VA 3KHEA 5BPJA 1Y1XA 5HLVA 5J3XA 1DJHA 3PM8A 2AAOA 2KGRA 2V53A 4GBAA 2BCAA 2K7CA 1QV1A 1M63B 1YRTB 1EXRA 1TNQA 1SBJA 2HQWA 2LHLA 2LLUA 2MAZA 2ZKMX 1K2HA 1SNLA 1Y1AA 2KQ6A 2JXLA 4OV2A 3VGOA 1UHHA 1U5IA 4NDBA 1B7TZ 2MHHA 4GGFC 1L7ZA 2K8MB 3WHTB 1CFDA 2I94A 3I5GB 1UP5A 2A4JA 1RK9A 1MWNA 1Y6WA 1XFVO 2BBMA 3PN7B 4PHMA 1IRJA 1UHIA 2ZFDA 1RTP1 3RLZA 1AHRA 3PFVA 2Y1NA 3OB1B 1WLMA 1K9UA 4D1EA 3M0WA 2KBIA 1B4CA 2F2OA 2LUCA 2JRFA 3BOWA 1YUTA 4ZCUA 2KHNA 5F6TA 4HREE 3WHUB 1QLKA 1Y1UA 1CFFA 2FOTA 5I2LA 3EVUA 1CDNA 1FF1A 3VROA 5TNCA 2JWWA 2M1UA 4PHNA 1QTXA 4WQ3A 2KBMA 2NXQA 1KWOC 3CS1A 2L50A 4A4BA 1UHJA 1SYMA 2CTNA 3JTDC 1K9KA 1SCMC 2HF5A 1G8IA 1N65A 5HLOA 1QX2A 2BL0B 2ZN8A 2H61A 2LCPA 4QJ5B 1RECA 1YX7A 1WDCB 2JZIA 3GK4X 3EVRA 2CCMA 1NX1A 1TCOB 1GGZA 3CTNA 1VRKA 1ZACA 1NCXA 3O6BA 2O60A 3EVVA 2LMTA 1QIVA 3SG2A 1JC2A 1NX3A 4YGDB 2GGZA 4OR9B 2B1UA 4AQJA 3OX5A 2E30A 2OTGC 2NLNA 3GK1A 1NX0A 2KAVA 1CLMA 2ZNEA 2MLEC 1KSOA 2ZRSA 2JTTA 2LMUA 3IQOA 4GGNA 4AQIA 4R1EA 5KSZA 4MRXA 2H2KA 1ALVA 3OP0A 3DVMA 1A75A 1Q80A 1M45A 1DVIA 1WLZA 3E3RA 2LANA 5AANA 1LA3A 2IS9A 2M7NA 1CMGA 4OKHA 4CLNA 5DKRA 1OOJA 4PE0A 2HETA 5AXIA 2WC8A 1B47A 2LP2A 4DS7A 3I5GC 1S5GY 3I5HB 2KI4B 5AEQA 1IH0A 2K7BA 1KCYA 2CXJA 1RFJA 3PN7C 3CZTX 3F45A 5D7FA 1BT6A 1N2DA 1MF8B 5HKYA 2F33A 3NXAA 2NCPA 1F54A 2PRUA 5CSIA 1XA5A 2F3YA 3TDZA 2HQ8A 1RJVA 1FPWA 1ALWA 1TIZA 1SL8A 2LUXA 1NSHA 4WQ2A 1CB1A 4PDZA 1W7IB 1KK8B 3BUWB 4BY5A 1K93D 1L2OB 1HQVA 4PE1A 1MHOA 2KI6C 1BMOA 1IJ5A 1XFZO 1KSMA 3EK7A 1J7PA 5JOLA 4GGFA 4XYNA 4XJKB 4WRIA 1IJ6A 3AKAA 1MR8A 1DT7B 2JTZA 1SL7A 2CBLA 3BYAA 2BL0C 1CNPA 1TTXA 1S6JA 4F0ZB 1QATA 2K2AA 1WRKA 4E68A 5G08A 1JF2A 1J1DA 2AMIA 3LL8B 4MBEA 1YTZC 1CFCA 3H4SE 2KAYA 2JC2A 2Y5IA 1YR5A 5I2OA 1DF0B 5GQQC 4HSZA 4ETOA 3JVTB 1PALA 3QRXA 3SJSA 3D0YA 3FS7A 1SPYA 1XK4C 2WCEA 1NWDA 2SASA 1CMFA 3NSOA 2KFGA 2LHIA 3PLFB 1H4BA 1OQPA 2Y4QA 1IQ5A 3BQ3A 2LV7A 2M7LA 3VRPA 5JJGA 3O2PA 5K89A 5ER5A 1BU3A 3DF0A 2K7DA 2M3WA 2KQYA 1WRLA 1BR1B 1B9AA 4DCKA 1BLQA 2BECA 1AP4A 3DD4A 3FWBA 2MJWB 1J7RA 4N1GA 4I5NB 2JNFA 4C0KA 1LA0A 2DOQA 3I5HC 2QACA 2KGBC 1K96A 1SR6B 4QJ3B 2BBNA 1EL4A 3AKBA 1K9PA 4I5KA 2JOJA 1OMRA 2I2RE 2LLSA 2OS8C 1CM4A 3O78A 1CM1A 4JPZB 1QX5B 1S3PA 1OZOA 5HKZA 2LLTA 1F4QA 2WORA 2LVJA 1GJYA 2JNXA 1EH2A 5DKNA 1DJWA 1KFUL 4P2YB 4YGEB 2VRGA 1ODBA 4CFQA 3TDUA 2F3ZA 1KK8C 4QJ4B 4I5JA 1XYDA 3SIBA 1C07A 2O5GA 2LVIA 3RM1A 1AK8A 1MUXA 1EG3A 3A4UB 1L2OC 1A29A 3EK4A 1R6PA 1KK7Z 4GFTA 1B7TY 1RWYA 1TOPA 1TN4A 3DVJA 4FTGA 1PSBA 2K7OA 4C0LA 1C7WA 2JU0A 1J7QA 2LNKA 3PALA 4PCWA 1BR4B 1PVBA 2JQ6A 1QX7A 3EK8A 1B1GA 1QVIZ 2RGIA 3EKHA 1TNXA 2MBXA 2KSPA 1HT9A 5KTYA 2NZ0A 1BJFA 1S6IA 1EG4A 1CTRA 1F71A 1LVCD 3WXAA 1J1EA 1AJ4A 2KOTA 1QS7A 2SCPA 3HX4A 5I2QA 1CLBA 2D8NA 4NDCA 1JFJA 2L4IA 1NP8A 2NCOA 1XO5A 4ICBA 1LXFC 4C0JA 2BKIB 1QASA 1NX2A 2F8PA 1MXLC 3KEVA 3FIAA 2KYCA 1SKTA 3TS5B 2M49B 1MXEA 1MQ1A 1YVHA 3LK0A 4IL1A 1KFXS 3ZWHA 1TRFA 3KO0A 1YX8A 3KPXA 4MN0A 1NIWA 3ICBA 4YI8A 3DVEA 2PMYA 1KFXL 2BE6A 1U5IB 1V1FA 1M31A 5CPVA 1FI5A 2M29A 4DIRA 1LINA 1UWOA 5AFPA 3K21A 1SR6C 2COLB 4Q04A 4HRGA 1NUBA 3TUYB 4MLWA 3KF9A 1PULA 3CWGA 2PALA 2TN4A 2JT8A 4MEWA 3OB2B 4PALA 2LP3A 3O4YA 3SG7A 1CDMA 3LK1A 4GUKA 4U8DA 5B8IB 1XK4A 1SCMB 1PSRA 4DUQA 3WNXB 2EGDA 3EKJA 3VRNA 2EC6B 2CT9A 1ZFSA 3BOWB 3I5IB 1WDCC 1JBAA 2Q91A 3BUNB 1YURA 3C1VA 1F55A 1GGWA 2BCXA 1CDLA 2PASA 3I5FB 3PATA 1ZOTB 5AERA 3SG3A 4GAOA 2E6WA 1B8CA 2M97A 2M9GA 4YI9A 1J7OA 1CLLA 2FCEA 4I5LB 4CPVA 3OX6A 5D69A 1JWDA 3NSIA 2G9BA 3IQQA 4YGBB 4NQGA 2KDHA 3ZNIA 1V1GA 5FYXA 2ZRTA 3PSRA 4CFRA 5HKWA 1XFXO 3LLEA 2JT3A 1PRWA 1YUUA 1OZSA 1DMOA 2ZNDA 1QJTA 1XFUO 4NDDA 3A8RA 1S6CA 2JXCA 2KAXA 1Y0VH 1F70A 1PVAA 4CIDA 2AUCA 1TCFA 3CLNA 1OSAA 1CKKA 3IF7A 1ZMZA 2LMVA 1DJIA 4ORBB 2P6BB 1A2XA 1H8BA 1N0YA 3AAJA 4M2OA 2MA2A 5ER4X 2K61A 3SG6A 2KI4C 2KNEA 2JULA 2I7AA 3GK2A 4PHKA 1K95A 3TS5C 4PE7A 3CR4X 1IWQA 1KQMB 1WY9A 4ORAB 1QV0A 4XJKA 1DJZA 1J55A 1A75B 1KFUS 4YRUA 1OMVA 1R2UA 1BF5A 4OVNF 1OE9B 1UHNA 1RROA 1FBVA 5PALA 1CDPA 3NSKA 1BOCA 2LVKA 4MVFA 1AUIB 2KFHA 3VRRA 3SIAA 4DRWA 3OHMB 1DTLA 1F8HA 1LKJA 4YBHB 1NYAA 4M2QA 4TNCA 1G4YR 2ZN9A 3FWCA 4OCIA 3TUYC 2L4HA 1S5GZ 2OPOA 4M2PA 1DF0A 1F4OA 1QIWA 2QPTA 4MRYA 1DJYA 4GNKB 1FI6A 1BODA 3BUOB 3BUXB 3BXKA 3VRQA 2KI6D 3DVKA 3TDIA 3TZ1A 1AVSA 1GQMA 2EC6C 4JQ0D 1SRAA 3I5IC 4PE4A 5CSNA 4YGAA 1DGVA 3CR5X 1QLSA 2GV5A 2KFFA 2LAPA 1S1EA 4JWQA 1SCVA 1DJGA 1KQVA 2R2IA 5KU1A 3MSEB 3AAKA 1S26D 2PVBA 4L9MA 3I5FC 4GPLB 4N5XA 2WCBA 4BY4A 1IQ3A 4PHJA 1QXPA 4N1FA 1DJXA 2BKHB 2G2BA 3LCPC 2MLFC 3SG5A 1TNWA 3JVTC 1PK0D 1WRZA 4ZCVA 5I8NA 1D1OA 1YRUB 3CR2A 5CSJA 2H61C 1BG1A 2PSRA 1B8RA 1IGVA 1JF0A 1SK6D 3BUMB 1IKUA 1YVLA 1NCZA 2K2FA 1JFKA 2CNPA 4MSPA 1W7JB 2Y1MA 1SMGA 1X02A 3HCMA 1B8LA 2M8UA 4FQOA 1A4PA 2WNDA 5DKQA 1XFWO 2L98A 3D10A 1DGUA 2BE4A 3SG4A 1XVJA 4A4CA 2JT0A 1CFPA 1UUSA 1UURA 3NSLA 4MZLA 1NCYA 1XFYO 2HPSA 1E8AA 1OMDA 4UPGA 5HYDA 2M1KB 3GOFA 1NPQA 2LE9B 2LVVA 1KK7Y 3D0YB 1S36A 1JSAA 2I18A 4ORCB 1SW8A 1TNPA 1G33A 4P5OE 5IBWA 1SY9A 2K0JA 1KQMC 1YUSA 1M39A 4HRHA 2FJUB 2WOSA 1FW4A 1KWOB 2OS8B 5CSFA 1K8UA 1AJ5A 3JTDB 2LC5A 2WCFA 2MRDA 3CGAA 3DF0B 1QVIY 2BCBA 2ISDA 1IG5A 4MZKA 4USLA 1A03A 2L0PA 2M0RA 1M46A 1K90D 2L5XB 2Q4UA 2FCDA 1K94A 4MZJA 1UHKA 1ZUZA 1EJ3A 2LM5A 2KYFA 2F2PA 1SL9A 2EHBA 2JPTA 1JUOA 4AOMA 2OTGB
chains in the Genus database with same CATH superfamily
4YGCB 2L51A 2L2EA 2GGMA 1C7VA 3KHEA 1DEKA 5BPJA 1Y1XA 5HLVA 5J3XA 1DJHA 3PM8A 2AAOA 2BNXA 2KGRA 2QEVA 2V53A 4GBAA 2BCAA 2K7CA 1QV1A 1M63B 1YRTB 2K60A 1EXRA 1TNQA 1SBJA 2HQWA 2LHLA 2LLUA 2MAZA 2PYQA 2ZKMX 1K2HA 2P70A 1SNLA 1Y1AA 2KQ6A 2JXLA 3O4XA 4OV2A 3VGOA 1UHHA 1U5IA 4NDBA 1B7TZ 2MHHA 4GGFC 3CDNA 1L7ZA 2K8MB 3WHTB 1CFDA 2I94A 5EL2A 3I5GB 1UP5A 2A4JA 1RK9A 3PJIA 4JKTA 1MWNA 1Y6WA 1XFVO 2BBMA 3PN7B 4PHMA 1IRJA 1UHIA 2ZFDA 1RTP1 3RLZA 3Q8IA 1AHRA 3PFVA 3CZ0A 2Y1NA 3OB1B 1WLMA 1K9UA 4D1EA 3M0WA 2KBIA 1B4CA 2F2OA 2LUCA 2JRFA 3BOWA 1YUTA 4ZCUA 2KHNA 5F6TA 1TUZA 4HREE 3WHUB 1QLKA 1Y1UA 1CFFA 2FOTA 5I2LA 3EVUA 1CDNA 1FF1A 3VROA 5TNCA 2JWWA 2M1UA 4PHNA 1QTXA 4WQ3A 2KBMA 2NXQA 1KWOC 3OGNA 3CS1A 2L50A 4A4BA 1UHJA 1SYMA 2CTNA 3JTDC 1K9KA 3DXLA 1SCMC 2HF5A 1G8IA 1N65A 2ERBA 3NGVA 5HLOA 1QX2A 2BL0B 2ZN8A 2H61A 2LCPA 4QJ5B 1RECA 1YX7A 1WDCB 2JZIA 3GK4X 3EVRA 2CCMA 1NX1A 3B6XA 1TCOB 1GGZA 3CTNA 1VRKA 1ZACA 1NCXA 3O6BA 2O60A 3EVVA 2LMTA 1QIVA 3SG2A 3BFAA 1JC2A 1NX3A 4YGDB 2GGZA 4OR9B 1DQEA 2B1UA 4AQJA 1C3YA 3OX5A 2E30A 2OTGC 2NLNA 3GK1A 1NX0A 2KAVA 1CLMA 2ZNEA 2MLEC 1KSOA 2ZRSA 2JTTA 2LMUA 3IQOA 4GGNA 1SSEB 4AQIA 4R1EA 3CABA 5KSZA 4MRXA 2H2KA 3BFHA 3UNWA 1ALVA 3OP0A 3DVMA 1A75A 1Q80A 1M45A 3R72A 4INWA 1DVIA 1WLZA 3E3RA 2LANA 5AANA 1LA3A 2IS9A 2L5YA 2M7NA 1CMGA 4OKHA 3D75A 4CLNA 5DKRA 1OOJA 4PE0A 2HETA 3RZSA 5AXIA 2WC8A 1B47A 2QEHA 2LP2A 4DS7A 3I5GC 1S5GY 3I5HB 2KI4B 5AEQA 1IH0A 2K7BA 1KCYA 2WCJA 2CXJA 1RFJA 3PN7C 3CZTX 3F45A 5D7FA 1BT6A 1N2DA 1MF8B 5HKYA 2F33A 3NXAA 2NCPA 1F54A 2PRUA 5CSIA 3FE9A 1XA5A 2F3YA 3TDZA 2HQ8A 1RJVA 1FPWA 1DELA 1ALWA 1TIZA 1SL8A 3S0EA 2LUXA 1NSHA 4WQ2A 1CB1A 4PDZA 1W7IB 1KK8B 3BUWB 4BY5A 3B87A 3B86A 1K93D 3CYZA 1L2OB 1HQVA 4PE1A 1MHOA 2KI6C 1BMOA 1IJ5A 1XFZO 1KSMA 3EK7A 3R1OA 1J7PA 5JOLA 2PQLA 4GGFA 4XYNA 4XJKB 4WRIA 1IJ6A 3AKAA 3DZTA 1MR8A 1DT7B 2JTZA 1SL7A 2CBLA 3BYAA 2BL0C 1CNPA 1TTXA 1S6JA 4F0ZB 1QATA 2K2AA 1WRKA 4E68A 5G08A 2WCHA 1JF2A 1J1DA 2AMIA 3LL8B 3SS4A 4MBEA 1YTZC 4OZDA 1CFCA 3H4SE 2KAYA 2JC2A 2Y5IA 1YR5A 3S0FA 5I2OA 1DF0B 5GQQC 4HSZA 4ETOA 3JVTB 1PALA 3QRXA 3SJSA 3D0YA 3FS7A 1SPYA 1XK4C 2WCKA 2WCEA 1NWDA 3BJHA 2SASA 1CMFA 3NSOA 2KFGA 2LHIA 3PLFB 1H4BA 2P71A 1OQPA 1OOHA 1IQ5A 2Y4QA 2LV7A 3BQ3A 2M7LA 3VRPA 5JJGA 3O2PA 5K89A 2BAPA 5ER5A 1BU3A 3DF0A 2QDIA 2K7DA 2M3WA 2KQYA 1WRLA 1BR1B 1B9AA 4DCKA 1BLQA 2BECA 3NHIA 2WCLA 1AP4A 3DD4A 3FWBA 2MJWB 1J7RA 4N1GA 5FI7A 4I5NB 2JNFA 4C0KA 1LA0A 1OW4A 2DOQA 3I5HC 2QACA 2KGBC 2JPOA 1K96A 1SR6B 4QJ3B 2BBNA 1EL4A 1TWOA 1K9PA 3AKBA 4I5KA 2JOJA 1OMRA 2I2RE 2LLSA 2OS8C 1CM4A 3O78A 1CM1A 4JPZB 1QX5B 1S3PA 1OZOA 3D78A 5HKZA 3OBVA 2LLTA 1F4QA 2WORA 2LVJA 1GJYA 2JNXA 1EH2A 5DKNA 1DJWA 1KFUL 4P2YB 4YGEB 2VRGA 1ODBA 4CFQA 3TDUA 2F3ZA 1KK8C 4QJ4B 4I5JA 1XYDA 1Z4HA 3SIBA 2O5GA 2LVIA 3RM1A 1AK8A 1MUXA 1C07A 1EG3A 3IVTA 3A4UB 1L2OC 1A29A 3EK4A 1R6PA 1KK7Z 4GFTA 1B7TY 3R1VA 4JD9A 1RWYA 1TOPA 1TN4A 3DVJA 4FTGA 1PSBA 2K7OA 4C0LA 1C7WA 3D76A 4FQTA 2JU0A 1GM0A 2YGUA 1J7QA 2LNKA 3PALA 4PCWA 1BR4B 1PVBA 2JQ6A 1QX7A 3EK8A 1B1GA 1QVIZ 2RGIA 3EKHA 1TNXA 2MBXA 2KSPA 1HT9A 5KTYA 2NZ0A 1BJFA 1S6IA 1EG4A 1CTRA 3DYEA 1F71A 1LVCD 3WXAA 1J1EA 1AJ4A 2FJYA 2KOTA 3B7AA 1QS7A 2SCPA 3HX4A 5I2QA 1XFRA 2D8NA 4NDCA 1CLBA 3R1PA 2L4IA 1JFJA 1NP8A 2NCOA 1XO5A 4ICBA 1LXFC 4C0JA 1QASA 1NX2A 2BKIB 2F8PA 1MXLC 3KEVA 3FIAA 2KYCA 1DC1A 1SKTA 3TS5B 2M49B 1MXEA 1MQ1A 1YVHA 3NHTA 3LK0A 4IJ7A 4IL1A 1KFXS 3ZWHA 1TRFA 3KO0A 1YX8A 3KPXA 4MN0A 5DICA 3L4AA 1NIWA 3D74A 2WC5A 3CZ2A 3ICBA 4YI8A 3DVEA 2PMYA 1KFXL 2BE6A 1U5IB 1V1FA 1M31A 1TUJA 5CPVA 1ORGA 2M29A 4DIRA 1FI5A 1LINA 1UWOA 5AFPA 3K21A 1SR6C 1W9ZA 2COLB 4Q04A 4HRGA 1NUBA 3TUYB 5D3OA 4MLWA 3KF9A 1PULA 3CWGA 2PALA 2TN4A 3SS3A 2JT8A 4MEWA 3OB2B 4PALA 2LP3A 3O4YA 3SG7A 1P28A 1CDMA 2QEOA 3LK1A 4GUKA 4U8DA 1XK4A 1SCMB 5B8IB 1PSRA 4DUQA 3WNXB 2EGDA 3D73A 3EKJA 3CZ1A 3VRNA 2EC6B 2CT9A 1ZFSA 3BOWB 3I5IB 1WDCC 1JBAA 2Q91A 3BUNB 3L47A 1YURA 3C1VA 1F55A 1GGWA 3B88A 4PT1A 2BCXA 1CDLA 2PASA 3I5FB 3PATA 1ZOTB 5AERA 3SG3A 4GAOA 2E6WA 1B8CA 2M97A 2M9GA 4YI9A 1J7OA 1CLLA 2FCEA 4I5LB 4CPVA 3OX6A 2H8VA 5D69A 1JWDA 3NSIA 2G9BA 3IQQA 4YGBB 1OOIX 4NQGA 2KDHA 3ZNIA 1V1GA 5FYXA 2ZRTA 3PSRA 4CFRA 5HKWA 5FI2A 1XFXO 3LLEA 2JT3A 1PRWA 1YUUA 1OZSA 1DMOA 2ZNDA 1QJTA 1XFUO 4NDDA 3A8RA 1S6CA 2JXCA 2KAXA 1Y0VH 1F70A 1PVAA 4CIDA 2AUCA 3PM2A 1TCFA 3CLNA 1OSAA 3N7HA 3IF7A 1CKKA 1ZMZA 2LMVA 1DJIA 4ORBB 2P6BB 1A2XA 1H8BA 1LS8A 1N0YA 3UO9A 3AAJA 4M2OA 3S0DA 2MA2A 4KYNA 5ER4X 2K61A 3SG6A 2KI4C 2KNEA 2KPHA 2JULA 2I7AA 3GK2A 4PHKA 3QMEA 1K95A 3TS5C 4PE7A 3SS5A 3CR4X 1IWQA 1KQMB 1WY9A 4ORAB 1QV0A 4XJKA 1DJZA 1J55A 3V2LA 1A75B 1KFUS 4YRUA 1OMVA 1R2UA 1BF5A 4OVNF 1OE9B 1UHNA 1RROA 1FBVA 5PALA 2GTEA 1CDPA 3NSKA 1BOCA 2LVKA 1T14A 4MVFA 1AUIB 2KFHA 3VRRA 3S0BA 3SIAA 4DRWA 3OHMB 1DTLA 1F8HA 1LKJA 3EG5B 4YBHB 1NYAA 4M2QA 4TNCA 1G4YR 2ZN9A 3FWCA 4OCIA 3TUYC 2L4HA 1S5GZ 2OPOA 4M2PA 1DF0A 1F4OA 1QIWA 2QPTA 4MRYA 1DJYA 2WC6A 4GNKB 1FI6A 1BODA 3BUOB 3BUXB 3BXKA 3VRQA 2KI6D 3DVKA 3TDIA 3TZ1A 1AVSA 1GQMA 2EC6C 4JQ0D 1SRAA 3I5IC 4PE4A 5CSNA 4YGAA 1DGVA 3CR5X 1QLSA 2GV5A 2KFFA 2LAPA 4INXA 1S1EA 4JWQA 1SCVA 1DJGA 1KQVA 3S0AA 2R2IA 5KU1A 3MSEB 3AAKA 1IIOA 1S26D 2PVBA 3DY9A 3FE8A 3I5FC 4GPLB 2WCBA 4L9MA 4N5XA 4PHJA 4BY4A 5I94A 1QXPA 4N1FA 1DJXA 1IQ3A 2KLDA 2BKHB 2G2BA 2QEBA 3LCPC 4F7FA 2MLFC 3SG5A 1TNWA 3JVTC 1PK0D 1WRZA 4ZCVA 5I8NA 1D1OA 1QWVA 1YRUB 3CR2A 3FE6A 5CSJA 1OOGA 2H61C 1BG1A 2PSRA 1B8RA 1IGVA 1JF0A 1SK6D 3BUMB 1IKUA 1YVLA 1NCZA 2K2FA 1JFKA 2CNPA 4MSPA 1W7JB 2Y1MA 1SMGA 1X02A 3HCMA 1B8LA 3L4LA 2M8UA 4FQOA 5FI6A 1A4PA 2WNDA 5DKQA 1XFWO 2L98A 3D10A 1DGUA 2BE4A 3SG4A 1XVJA 4A4CA 2JT0A 1CFPA 3D77A 1UUSA 1UURA 3NSLA 3VB1A 4MZLA 1NCYA 1XFYO 2HPSA 1E8AA 1OMDA 4UPGA 5HYDA 2M1KB 3GOFA 1NPQA 2LE9B 2LVVA 1KK7Y 3D0YB 1S36A 1JSAA 2I18A 3K1EA 4ORCB 1SW8A 1TNPA 1G33A 4P5OE 5IBWA 1SY9A 2K0JA 1KQMC 2L2CA 1YUSA 1M39A 4HRHA 2FJUB 2WOSA 1FW4A 1KWOB 2OS8B 5CSFA 3BFBA 1K8UA 1AJ5A 3JTDB 2LC5A 2WCFA 2MRDA 3CGAA 3S0GA 3DF0B 1QVIY 2BCBA 2ISDA 1IG5A 4MZKA 4USLA 1A03A 2L0PA 2M0RA 1M46A 1K90D 2L5XB 2Q4UA 2FCDA 1K94A 4MZJA 1UHKA 1Z2CB 1ZUZA 1EJ3A 2LM5A 2KYFA 1C3ZA 2F2PA 2WCMA 1SL9A 2EHBA 2JPTA 1JUOA 5HL1A 1OOFA 2KLEA 4AOMA 2OTGB
chains in the Genus database with same CATH topology
4YGCB 2L51A 2L2EA 2GGMA 1C7VA 3KHEA 5BPJA 1Y1XA 5HLVA 5J3XA 1DJHA 3PM8A 2AAOA 2KGRA 2V53A 4GBAA 2BCAA 2K7CA 1QV1A 1M63B 1YRTB 1EXRA 1TNQA 1SBJA 2HQWA 2LHLA 2LLUA 2MAZA 2ZKMX 1K2HA 1SNLA 1Y1AA 2KQ6A 2JXLA 4OV2A 3VGOA 1UHHA 1U5IA 4NDBA 1B7TZ 2MHHA 4GGFC 1L7ZA 2K8MB 3WHTB 1CFDA 2I94A 3I5GB 1UP5A 2A4JA 1RK9A 1MWNA 1Y6WA 1XFVO 2BBMA 3PN7B 4PHMA 1IRJA 1UHIA 2ZFDA 1RTP1 3RLZA 1AHRA 3PFVA 2Y1NA 3OB1B 1WLMA 1K9UA 4D1EA 3M0WA 2KBIA 1B4CA 2F2OA 2LUCA 2JRFA 3BOWA 1YUTA 4ZCUA 2KHNA 5F6TA 4HREE 3WHUB 1QLKA 1Y1UA 1CFFA 2FOTA 5I2LA 3EVUA 1CDNA 1FF1A 3VROA 5TNCA 2JWWA 2M1UA 4PHNA 1QTXA 4WQ3A 2KBMA 2NXQA 1KWOC 3CS1A 2L50A 4A4BA 1UHJA 1SYMA 2CTNA 3JTDC 1K9KA 1SCMC 2HF5A 1G8IA 1N65A 5HLOA 1QX2A 2BL0B 2ZN8A 2H61A 2LCPA 4QJ5B 1RECA 1YX7A 1WDCB 2JZIA 3GK4X 3EVRA 2CCMA 1NX1A 1TCOB 1GGZA 3CTNA 1VRKA 1ZACA 1NCXA 3O6BA 2O60A 3EVVA 2LMTA 1QIVA 3SG2A 1JC2A 1NX3A 4YGDB 2GGZA 4OR9B 2B1UA 4AQJA 3OX5A 2E30A 2OTGC 2NLNA 3GK1A 1NX0A 2KAVA 1CLMA 2ZNEA 2MLEC 1KSOA 2ZRSA 2JTTA 2LMUA 3IQOA 4GGNA 4AQIA 4R1EA 5KSZA 4MRXA 2H2KA 1ALVA 3OP0A 3DVMA 1A75A 1Q80A 1M45A 1DVIA 1WLZA 3E3RA 2LANA 5AANA 1LA3A 2IS9A 2M7NA 1CMGA 4OKHA 4CLNA 5DKRA 1OOJA 4PE0A 2HETA 5AXIA 2WC8A 1B47A 2LP2A 4DS7A 3I5GC 1S5GY 3I5HB 2KI4B 5AEQA 1IH0A 2K7BA 1KCYA 2CXJA 1RFJA 3PN7C 3CZTX 3F45A 5D7FA 1BT6A 1N2DA 1MF8B 5HKYA 2F33A 3NXAA 2NCPA 1F54A 2PRUA 5CSIA 1XA5A 2F3YA 3TDZA 2HQ8A 1RJVA 1FPWA 1ALWA 1TIZA 1SL8A 2LUXA 1NSHA 4WQ2A 1CB1A 4PDZA 1W7IB 1KK8B 3BUWB 4BY5A 1K93D 1L2OB 1HQVA 4PE1A 1MHOA 2KI6C 1BMOA 1IJ5A 1XFZO 1KSMA 3EK7A 1J7PA 5JOLA 4GGFA 4XYNA 4XJKB 4WRIA 1IJ6A 3AKAA 1MR8A 1DT7B 2JTZA 1SL7A 2CBLA 3BYAA 2BL0C 1CNPA 1TTXA 1S6JA 4F0ZB 1QATA 2K2AA 1WRKA 4E68A 5G08A 1JF2A 1J1DA 2AMIA 3LL8B 4MBEA 1YTZC 1CFCA 3H4SE 2KAYA 2JC2A 2Y5IA 1YR5A 5I2OA 1DF0B 5GQQC 4HSZA 4ETOA 3JVTB 1PALA 3QRXA 3SJSA 3D0YA 3FS7A 1SPYA 1XK4C 2WCEA 1NWDA 2SASA 1CMFA 3NSOA 2KFGA 2LHIA 3PLFB 1H4BA 1OQPA 2Y4QA 1IQ5A 3BQ3A 2LV7A 2M7LA 3VRPA 5JJGA 3O2PA 5K89A 5ER5A 1BU3A 3DF0A 2K7DA 2M3WA 2KQYA 1WRLA 1BR1B 1B9AA 4DCKA 1BLQA 2BECA 1AP4A 3DD4A 3FWBA 2MJWB 1J7RA 4N1GA 4I5NB 2JNFA 4C0KA 1LA0A 2DOQA 3I5HC 2QACA 2KGBC 1K96A 1SR6B 4QJ3B 2BBNA 1EL4A 3AKBA 1K9PA 4I5KA 2JOJA 1OMRA 2I2RE 2LLSA 2OS8C 1CM4A 3O78A 1CM1A 4JPZB 1QX5B 1S3PA 1OZOA 5HKZA 2LLTA 1F4QA 2WORA 2LVJA 1GJYA 2JNXA 1EH2A 5DKNA 1DJWA 1KFUL 4P2YB 4YGEB 2VRGA 1ODBA 4CFQA 3TDUA 2F3ZA 1KK8C 4QJ4B 4I5JA 1XYDA 3SIBA 1C07A 2O5GA 2LVIA 3RM1A 1AK8A 1MUXA 1EG3A 3A4UB 1L2OC 1A29A 3EK4A 1R6PA 1KK7Z 4GFTA 1B7TY 1RWYA 1TOPA 1TN4A 3DVJA 4FTGA 1PSBA 2K7OA 4C0LA 1C7WA 2JU0A 1J7QA 2LNKA 3PALA 4PCWA 1BR4B 1PVBA 2JQ6A 1QX7A 3EK8A 1B1GA 1QVIZ 2RGIA 3EKHA 1TNXA 2MBXA 2KSPA 1HT9A 5KTYA 2NZ0A 1BJFA 1S6IA 1EG4A 1CTRA 1F71A 1LVCD 3WXAA 1J1EA 1AJ4A 2KOTA 1QS7A 2SCPA 3HX4A 5I2QA 1CLBA 2D8NA 4NDCA 1JFJA 2L4IA 1NP8A 2NCOA 1XO5A 4ICBA 1LXFC 4C0JA 2BKIB 1QASA 1NX2A 2F8PA 1MXLC 3KEVA 3FIAA 2KYCA 1SKTA 3TS5B 2M49B 1MXEA 1MQ1A 1YVHA 3LK0A 4IL1A 1KFXS 3ZWHA 1TRFA 3KO0A 1YX8A 3KPXA 4MN0A 1NIWA 3ICBA 4YI8A 3DVEA 2PMYA 1KFXL 2BE6A 1U5IB 1V1FA 1M31A 5CPVA 1FI5A 2M29A 4DIRA 1LINA 1UWOA 5AFPA 3K21A 1SR6C 2COLB 4Q04A 4HRGA 1NUBA 3TUYB 4MLWA 3KF9A 1PULA 3CWGA 2PALA 2TN4A 2JT8A 4MEWA 3OB2B 4PALA 2LP3A 3O4YA 3SG7A 1CDMA 3LK1A 4GUKA 4U8DA 5B8IB 1XK4A 1SCMB 1PSRA 4DUQA 3WNXB 2EGDA 3EKJA 3VRNA 2EC6B 2CT9A 1ZFSA 3BOWB 3I5IB 1WDCC 1JBAA 2Q91A 3BUNB 1YURA 3C1VA 1F55A 1GGWA 2BCXA 1CDLA 2PASA 3I5FB 3PATA 1ZOTB 5AERA 3SG3A 4GAOA 2E6WA 1B8CA 2M97A 2M9GA 4YI9A 1J7OA 1CLLA 2FCEA 4I5LB 4CPVA 3OX6A 5D69A 1JWDA 3NSIA 2G9BA 3IQQA 4YGBB 4NQGA 2KDHA 3ZNIA 1V1GA 5FYXA 2ZRTA 3PSRA 4CFRA 5HKWA 1XFXO 3LLEA 2JT3A 1PRWA 1YUUA 1OZSA 1DMOA 2ZNDA 1QJTA 1XFUO 4NDDA 3A8RA 1S6CA 2JXCA 2KAXA 1Y0VH 1F70A 1PVAA 4CIDA 2AUCA 1TCFA 3CLNA 1OSAA 1CKKA 3IF7A 1ZMZA 2LMVA 1DJIA 4ORBB 2P6BB 1A2XA 1H8BA 1N0YA 3AAJA 4M2OA 2MA2A 5ER4X 2K61A 3SG6A 2KI4C 2KNEA 2JULA 2I7AA 3GK2A 4PHKA 1K95A 3TS5C 4PE7A 3CR4X 1IWQA 1KQMB 1WY9A 4ORAB 1QV0A 4XJKA 1DJZA 1J55A 1A75B 1KFUS 4YRUA 1OMVA 1R2UA 1BF5A 4OVNF 1OE9B 1UHNA 1RROA 1FBVA 5PALA 1CDPA 3NSKA 1BOCA 2LVKA 4MVFA 1AUIB 2KFHA 3VRRA 3SIAA 4DRWA 3OHMB 1DTLA 1F8HA 1LKJA 4YBHB 1NYAA 4M2QA 4TNCA 1G4YR 2ZN9A 3FWCA 4OCIA 3TUYC 2L4HA 1S5GZ 2OPOA 4M2PA 1DF0A 1F4OA 1QIWA 2QPTA 4MRYA 1DJYA 4GNKB 1FI6A 1BODA 3BUOB 3BUXB 3BXKA 3VRQA 2KI6D 3DVKA 3TDIA 3TZ1A 1AVSA 1GQMA 2EC6C 4JQ0D 1SRAA 3I5IC 4PE4A 5CSNA 4YGAA 1DGVA 3CR5X 1QLSA 2GV5A 2KFFA 2LAPA 1S1EA 4JWQA 1SCVA 1DJGA 1KQVA 2R2IA 5KU1A 3MSEB 3AAKA 1S26D 2PVBA 4L9MA 3I5FC 4GPLB 4N5XA 2WCBA 4BY4A 1IQ3A 4PHJA 1QXPA 4N1FA 1DJXA 2BKHB 2G2BA 3LCPC 2MLFC 3SG5A 1TNWA 3JVTC 1PK0D 1WRZA 4ZCVA 5I8NA 1D1OA 1YRUB 3CR2A 5CSJA 2H61C 1BG1A 2PSRA 1B8RA 1IGVA 1JF0A 1SK6D 3BUMB 1IKUA 1YVLA 1NCZA 2K2FA 1JFKA 2CNPA 4MSPA 1W7JB 2Y1MA 1SMGA 1X02A 3HCMA 1B8LA 2M8UA 4FQOA 1A4PA 2WNDA 5DKQA 1XFWO 2L98A 3D10A 1DGUA 2BE4A 3SG4A 1XVJA 4A4CA 2JT0A 1CFPA 1UUSA 1UURA 3NSLA 4MZLA 1NCYA 1XFYO 2HPSA 1E8AA 1OMDA 4UPGA 5HYDA 2M1KB 3GOFA 1NPQA 2LE9B 2LVVA 1KK7Y 3D0YB 1S36A 1JSAA 2I18A 4ORCB 1SW8A 1TNPA 1G33A 4P5OE 5IBWA 1SY9A 2K0JA 1KQMC 1YUSA 1M39A 4HRHA 2FJUB 2WOSA 1FW4A 1KWOB 2OS8B 5CSFA 1K8UA 1AJ5A 3JTDB 2LC5A 2WCFA 2MRDA 3CGAA 3DF0B 1QVIY 2BCBA 2ISDA 1IG5A 4MZKA 4USLA 1A03A 2L0PA 2M0RA 1M46A 1K90D 2L5XB 2Q4UA 2FCDA 1K94A 4MZJA 1UHKA 1ZUZA 1EJ3A 2LM5A 2KYFA 2F2PA 1SL9A 2EHBA 2JPTA 1JUOA 4AOMA 2OTGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGC B;  2L51 A;  2L2E A;  2GGM A;  1C7V A;  3KHE A;  5BPJ A;  1Y1X A;  5HLV A;  5J3X A;  1DJH A;  3PM8 A;  2AAO A;  2KGR A;  2V53 A;  4GBA A;  2BCA A;  2K7C A;  1QV1 A;  1M63 B;  1YRT B;  1EXR A;  1TNQ A;  1SBJ A;  2HQW A;  2LHL A;  2LLU A;  2MAZ A;  2ZKM X;  1K2H A;  1SNL A;  1Y1A A;  2KQ6 A;  2JXL A;  4OV2 A;  3VGO A;  1UHH A;  1U5I A;  4NDB A;  1B7T Z;  2MHH A;  4GGF C;  1L7Z A;  2K8M B;  3WHT B;  1CFD A;  2I94 A;  3I5G B;  1UP5 A;  2A4J A;  1RK9 A;  1MWN A;  1Y6W A;  1XFV O;  2BBM A;  3PN7 B;  4PHM A;  1IRJ A;  1UHI A;  2ZFD A;  1RTP 1;  3RLZ A;  1AHR A;  3PFV A;  2Y1N A;  3OB1 B;  1WLM A;  1K9U A;  4D1E A;  3M0W A;  2KBI A;  1B4C A;  2F2O A;  2LUC A;  2JRF A;  3BOW A;  1YUT A;  4ZCU A;  2KHN A;  5F6T A;  4HRE E;  3WHU B;  1QLK A;  1Y1U A;  1CFF A;  2FOT A;  5I2L A;  3EVU A;  1CDN A;  1FF1 A;  3VRO A;  5TNC A;  2JWW A;  2M1U A;  4PHN A;  1QTX A;  4WQ3 A;  2KBM A;  2NXQ A;  1KWO C;  3CS1 A;  2L50 A;  4A4B A;  1UHJ A;  1SYM A;  2CTN A;  3JTD C;  1K9K A;  1SCM C;  2HF5 A;  1G8I A;  1N65 A;  5HLO A;  1QX2 A;  2BL0 B;  2ZN8 A;  2H61 A;  2LCP A;  4QJ5 B;  1REC A;  1YX7 A;  1WDC B;  2JZI A;  3GK4 X;  3EVR A;  2CCM A;  1NX1 A;  1TCO B;  1GGZ A;  3CTN A;  1VRK A;  1ZAC A;  1NCX A;  3O6B A;  2O60 A;  3EVV A;  2LMT A;  1QIV A;  3SG2 A;  1JC2 A;  1NX3 A;  4YGD B;  2GGZ A;  4OR9 B;  2B1U A;  4AQJ A;  3OX5 A;  2E30 A;  2OTG C;  2NLN A;  3GK1 A;  1NX0 A;  2KAV A;  1CLM A;  2ZNE A;  2MLE C;  1KSO A;  2ZRS A;  2JTT A;  2LMU A;  3IQO A;  4GGN A;  4AQI A;  4R1E A;  5KSZ A;  4MRX A;  2H2K A;  1ALV A;  3OP0 A;  3DVM A;  1A75 A;  1Q80 A;  1M45 A;  1DVI A;  1WLZ A;  3E3R A;  2LAN A;  5AAN A;  1LA3 A;  2IS9 A;  2M7N A;  1CMG A;  4OKH A;  4CLN A;  5DKR A;  1OOJ A;  4PE0 A;  2HET A;  5AXI A;  2WC8 A;  1B47 A;  2LP2 A;  4DS7 A;  3I5G C;  1S5G Y;  3I5H B;  2KI4 B;  5AEQ A;  1IH0 A;  2K7B A;  1KCY A;  2CXJ A;  1RFJ A;  3PN7 C;  3CZT X;  3F45 A;  5D7F A;  1BT6 A;  1N2D A;  1MF8 B;  5HKY A;  2F33 A;  3NXA A;  2NCP A;  1F54 A;  2PRU A;  5CSI A;  1XA5 A;  2F3Y A;  3TDZ A;  2HQ8 A;  1RJV A;  1FPW A;  1ALW A;  1TIZ A;  1SL8 A;  2LUX A;  1NSH A;  4WQ2 A;  1CB1 A;  4PDZ A;  1W7I B;  1KK8 B;  3BUW B;  4BY5 A;  1K93 D;  1L2O B;  1HQV A;  4PE1 A;  1MHO A;  2KI6 C;  1BMO A;  1IJ5 A;  1XFZ O;  1KSM A;  3EK7 A;  1J7P A;  5JOL A;  4GGF A;  4XYN A;  4XJK B;  4WRI A;  1IJ6 A;  3AKA A;  1MR8 A;  1DT7 B;  2JTZ A;  1SL7 A;  2CBL A;  3BYA A;  2BL0 C;  1CNP A;  1TTX A;  1S6J A;  4F0Z B;  1QAT A;  2K2A A;  1WRK A;  4E68 A;  5G08 A;  1JF2 A;  1J1D A;  2AMI A;  3LL8 B;  4MBE A;  1YTZ C;  1CFC A;  3H4S E;  2KAY A;  2JC2 A;  2Y5I A;  1YR5 A;  5I2O A;  1DF0 B;  5GQQ C;  4HSZ A;  4ETO A;  3JVT B;  1PAL A;  3QRX A;  3SJS A;  3D0Y A;  3FS7 A;  1SPY A;  1XK4 C;  2WCE A;  1NWD A;  2SAS A;  1CMF A;  3NSO A;  2KFG A;  2LHI A;  3PLF B;  1H4B A;  1OQP A;  2Y4Q A;  1IQ5 A;  3BQ3 A;  2LV7 A;  2M7L A;  3VRP A;  5JJG A;  3O2P A;  5K89 A;  5ER5 A;  1BU3 A;  3DF0 A;  2K7D A;  2M3W A;  2KQY A;  1WRL A;  1BR1 B;  1B9A A;  4DCK A;  1BLQ A;  2BEC A;  1AP4 A;  3DD4 A;  3FWB A;  2MJW B;  1J7R A;  4N1G A;  4I5N B;  2JNF A;  4C0K A;  1LA0 A;  2DOQ A;  3I5H C;  2QAC A;  2KGB C;  1K96 A;  1SR6 B;  4QJ3 B;  2BBN A;  1EL4 A;  3AKB A;  1K9P A;  4I5K A;  2JOJ A;  1OMR A;  2I2R E;  2LLS A;  2OS8 C;  1CM4 A;  3O78 A;  1CM1 A;  4JPZ B;  1QX5 B;  1S3P A;  1OZO A;  5HKZ A;  2LLT A;  1F4Q A;  2WOR A;  2LVJ A;  1GJY A;  2JNX A;  1EH2 A;  5DKN A;  1DJW A;  1KFU L;  4P2Y B;  4YGE B;  2VRG A;  1ODB A;  4CFQ A;  3TDU A;  2F3Z A;  1KK8 C;  4QJ4 B;  4I5J A;  1XYD A;  3SIB A;  1C07 A;  2O5G A;  2LVI A;  3RM1 A;  1AK8 A;  1MUX A;  1EG3 A;  3A4U B;  1L2O C;  1A29 A;  3EK4 A;  1R6P A;  1KK7 Z;  4GFT A;  1B7T Y;  1RWY A;  1TOP A;  1TN4 A;  3DVJ A;  4FTG A;  1PSB A;  2K7O A;  4C0L A;  1C7W A;  2JU0 A;  1J7Q A;  2LNK A;  3PAL A;  4PCW A;  1BR4 B;  1PVB A;  2JQ6 A;  1QX7 A;  3EK8 A;  1B1G A;  1QVI Z;  2RGI A;  3EKH A;  1TNX A;  2MBX A;  2KSP A;  1HT9 A;  5KTY A;  2NZ0 A;  1BJF A;  1S6I A;  1EG4 A;  1CTR A;  1F71 A;  1LVC D;  3WXA A;  1J1E A;  1AJ4 A;  2KOT A;  1QS7 A;  2SCP A;  3HX4 A;  5I2Q A;  1CLB A;  2D8N A;  4NDC A;  1JFJ A;  2L4I A;  1NP8 A;  2NCO A;  1XO5 A;  4ICB A;  1LXF C;  4C0J A;  2BKI B;  1QAS A;  1NX2 A;  2F8P A;  1MXL C;  3KEV A;  3FIA A;  2KYC A;  1SKT A;  3TS5 B;  2M49 B;  1MXE A;  1MQ1 A;  1YVH A;  3LK0 A;  4IL1 A;  1KFX S;  3ZWH A;  1TRF A;  3KO0 A;  1YX8 A;  3KPX A;  4MN0 A;  1NIW A;  3ICB A;  4YI8 A;  3DVE A;  2PMY A;  1KFX L;  2BE6 A;  1U5I B;  1V1F A;  1M31 A;  5CPV A;  1FI5 A;  2M29 A;  4DIR A;  1LIN A;  1UWO A;  5AFP A;  3K21 A;  1SR6 C;  2COL B;  4Q04 A;  4HRG A;  1NUB A;  3TUY B;  4MLW A;  3KF9 A;  1PUL A;  3CWG A;  2PAL A;  2TN4 A;  2JT8 A;  4MEW A;  3OB2 B;  4PAL A;  2LP3 A;  3O4Y A;  3SG7 A;  1CDM A;  3LK1 A;  4GUK A;  4U8D A;  5B8I B;  1XK4 A;  1SCM B;  1PSR A;  4DUQ A;  3WNX B;  2EGD A;  3EKJ A;  3VRN A;  2EC6 B;  2CT9 A;  1ZFS A;  3BOW B;  3I5I B;  1WDC C;  1JBA A;  2Q91 A;  3BUN B;  1YUR A;  3C1V A;  1F55 A;  1GGW A;  2BCX A;  1CDL A;  2PAS A;  3I5F B;  3PAT A;  1ZOT B;  5AER A;  3SG3 A;  4GAO A;  2E6W A;  1B8C A;  2M97 A;  2M9G A;  4YI9 A;  1J7O A;  1CLL A;  2FCE A;  4I5L B;  4CPV A;  3OX6 A;  5D69 A;  1JWD A;  3NSI A;  2G9B A;  3IQQ A;  4YGB B;  4NQG A;  2KDH A;  3ZNI A;  1V1G A;  5FYX A;  2ZRT A;  3PSR A;  4CFR A;  5HKW A;  1XFX O;  3LLE A;  2JT3 A;  1PRW A;  1YUU A;  1OZS A;  1DMO A;  2ZND A;  1QJT A;  1XFU O;  4NDD A;  3A8R A;  1S6C A;  2JXC A;  2KAX A;  1Y0V H;  1F70 A;  1PVA A;  4CID A;  2AUC A;  1TCF A;  3CLN A;  1OSA A;  1CKK A;  3IF7 A;  1ZMZ A;  2LMV A;  1DJI A;  4ORB B;  2P6B B;  1A2X A;  1H8B A;  1N0Y A;  3AAJ A;  4M2O A;  2MA2 A;  5ER4 X;  2K61 A;  3SG6 A;  2KI4 C;  2KNE A;  2JUL A;  2I7A A;  3GK2 A;  4PHK A;  1K95 A;  3TS5 C;  4PE7 A;  3CR4 X;  1IWQ A;  1KQM B;  1WY9 A;  4ORA B;  1QV0 A;  4XJK A;  1DJZ A;  1J55 A;  1A75 B;  1KFU S;  4YRU A;  1OMV A;  1R2U A;  1BF5 A;  4OVN F;  1OE9 B;  1UHN A;  1RRO A;  1FBV A;  5PAL A;  1CDP A;  3NSK A;  1BOC A;  2LVK A;  4MVF A;  1AUI B;  2KFH A;  3VRR A;  3SIA A;  4DRW A;  3OHM B;  1DTL A;  1F8H A;  1LKJ A;  4YBH B;  1NYA A;  4M2Q A;  4TNC A;  1G4Y R;  2ZN9 A;  3FWC A;  4OCI A;  3TUY C;  2L4H A;  1S5G Z;  2OPO A;  4M2P A;  1DF0 A;  1F4O A;  1QIW A;  2QPT A;  4MRY A;  1DJY A;  4GNK B;  1FI6 A;  1BOD A;  3BUO B;  3BUX B;  3BXK A;  3VRQ A;  2KI6 D;  3DVK A;  3TDI A;  3TZ1 A;  1AVS A;  1GQM A;  2EC6 C;  4JQ0 D;  1SRA A;  3I5I C;  4PE4 A;  5CSN A;  4YGA A;  1DGV A;  3CR5 X;  1QLS A;  2GV5 A;  2KFF A;  2LAP A;  1S1E A;  4JWQ A;  1SCV A;  1DJG A;  1KQV A;  2R2I A;  5KU1 A;  3MSE B;  3AAK A;  1S26 D;  2PVB A;  4L9M A;  3I5F C;  4GPL B;  4N5X A;  2WCB A;  4BY4 A;  1IQ3 A;  4PHJ A;  1QXP A;  4N1F A;  1DJX A;  2BKH B;  2G2B A;  3LCP C;  2MLF C;  3SG5 A;  1TNW A;  3JVT C;  1PK0 D;  1WRZ A;  4ZCV A;  5I8N A;  1D1O A;  1YRU B;  3CR2 A;  5CSJ A;  2H61 C;  1BG1 A;  2PSR A;  1B8R A;  1IGV A;  1JF0 A;  1SK6 D;  3BUM B;  1IKU A;  1YVL A;  1NCZ A;  2K2F A;  1JFK A;  2CNP A;  4MSP A;  1W7J B;  2Y1M A;  1SMG A;  1X02 A;  3HCM A;  1B8L A;  2M8U A;  4FQO A;  1A4P A;  2WND A;  5DKQ A;  1XFW O;  2L98 A;  3D10 A;  1DGU A;  2BE4 A;  3SG4 A;  1XVJ A;  4A4C A;  2JT0 A;  1CFP A;  1UUS A;  1UUR A;  3NSL A;  4MZL A;  1NCY A;  1XFY O;  2HPS A;  1E8A A;  1OMD A;  4UPG A;  5HYD A;  2M1K B;  3GOF A;  1NPQ A;  2LE9 B;  2LVV A;  1KK7 Y;  3D0Y B;  1S36 A;  1JSA A;  2I18 A;  4ORC B;  1SW8 A;  1TNP A;  1G33 A;  4P5O E;  5IBW A;  1SY9 A;  2K0J A;  1KQM C;  1YUS A;  1M39 A;  4HRH A;  2FJU B;  2WOS A;  1FW4 A;  1KWO B;  2OS8 B;  5CSF A;  1K8U A;  1AJ5 A;  3JTD B;  2LC5 A;  2WCF A;  2MRD A;  3CGA A;  3DF0 B;  1QVI Y;  2BCB A;  2ISD A;  1IG5 A;  4MZK A;  4USL A;  1A03 A;  2L0P A;  2M0R A;  1M46 A;  1K90 D;  2L5X B;  2Q4U A;  2FCD A;  1K94 A;  4MZJ A;  1UHK A;  1ZUZ A;  1EJ3 A;  2LM5 A;  2KYF A;  2F2P A;  1SL9 A;  2EHB A;  2JPT A;  1JUO A;  4AOM A;  2OTG B; 
#chains in the Genus database with same CATH topology
 4YGC B;  2L51 A;  2L2E A;  2GGM A;  1C7V A;  3KHE A;  1DEK A;  5BPJ A;  1Y1X A;  5HLV A;  5J3X A;  1DJH A;  3PM8 A;  2AAO A;  2BNX A;  2KGR A;  2QEV A;  2V53 A;  4GBA A;  2BCA A;  2K7C A;  1QV1 A;  1M63 B;  1YRT B;  2K60 A;  1EXR A;  1TNQ A;  1SBJ A;  2HQW A;  2LHL A;  2LLU A;  2MAZ A;  2PYQ A;  2ZKM X;  1K2H A;  2P70 A;  1SNL A;  1Y1A A;  2KQ6 A;  2JXL A;  3O4X A;  4OV2 A;  3VGO A;  1UHH A;  1U5I A;  4NDB A;  1B7T Z;  2MHH A;  4GGF C;  3CDN A;  1L7Z A;  2K8M B;  3WHT B;  1CFD A;  2I94 A;  5EL2 A;  3I5G B;  1UP5 A;  2A4J A;  1RK9 A;  3PJI A;  4JKT A;  1MWN A;  1Y6W A;  1XFV O;  2BBM A;  3PN7 B;  4PHM A;  1IRJ A;  1UHI A;  2ZFD A;  1RTP 1;  3RLZ A;  3Q8I A;  1AHR A;  3PFV A;  3CZ0 A;  2Y1N A;  3OB1 B;  1WLM A;  1K9U A;  4D1E A;  3M0W A;  2KBI A;  1B4C A;  2F2O A;  2LUC A;  2JRF A;  3BOW A;  1YUT A;  4ZCU A;  2KHN A;  5F6T A;  1TUZ A;  4HRE E;  3WHU B;  1QLK A;  1Y1U A;  1CFF A;  2FOT A;  5I2L A;  3EVU A;  1CDN A;  1FF1 A;  3VRO A;  5TNC A;  2JWW A;  2M1U A;  4PHN A;  1QTX A;  4WQ3 A;  2KBM A;  2NXQ A;  1KWO C;  3OGN A;  3CS1 A;  2L50 A;  4A4B A;  1UHJ A;  1SYM A;  2CTN A;  3JTD C;  1K9K A;  3DXL A;  1SCM C;  2HF5 A;  1G8I A;  1N65 A;  2ERB A;  3NGV A;  5HLO A;  1QX2 A;  2BL0 B;  2ZN8 A;  2H61 A;  2LCP A;  4QJ5 B;  1REC A;  1YX7 A;  1WDC B;  2JZI A;  3GK4 X;  3EVR A;  2CCM A;  1NX1 A;  3B6X A;  1TCO B;  1GGZ A;  3CTN A;  1VRK A;  1ZAC A;  1NCX A;  3O6B A;  2O60 A;  3EVV A;  2LMT A;  1QIV A;  3SG2 A;  3BFA A;  1JC2 A;  1NX3 A;  4YGD B;  2GGZ A;  4OR9 B;  1DQE A;  2B1U A;  4AQJ A;  1C3Y A;  3OX5 A;  2E30 A;  2OTG C;  2NLN A;  3GK1 A;  1NX0 A;  2KAV A;  1CLM A;  2ZNE A;  2MLE C;  1KSO A;  2ZRS A;  2JTT A;  2LMU A;  3IQO A;  4GGN A;  1SSE B;  4AQI A;  4R1E A;  3CAB A;  5KSZ A;  4MRX A;  2H2K A;  3BFH A;  3UNW A;  1ALV A;  3OP0 A;  3DVM A;  1A75 A;  1Q80 A;  1M45 A;  3R72 A;  4INW A;  1DVI A;  1WLZ A;  3E3R A;  2LAN A;  5AAN A;  1LA3 A;  2IS9 A;  2L5Y A;  2M7N A;  1CMG A;  4OKH A;  3D75 A;  4CLN A;  5DKR A;  1OOJ A;  4PE0 A;  2HET A;  3RZS A;  5AXI A;  2WC8 A;  1B47 A;  2QEH A;  2LP2 A;  4DS7 A;  3I5G C;  1S5G Y;  3I5H B;  2KI4 B;  5AEQ A;  1IH0 A;  2K7B A;  1KCY A;  2WCJ A;  2CXJ A;  1RFJ A;  3PN7 C;  3CZT X;  3F45 A;  5D7F A;  1BT6 A;  1N2D A;  1MF8 B;  5HKY A;  2F33 A;  3NXA A;  2NCP A;  1F54 A;  2PRU A;  5CSI A;  3FE9 A;  1XA5 A;  2F3Y A;  3TDZ A;  2HQ8 A;  1RJV A;  1FPW A;  1DEL A;  1ALW A;  1TIZ A;  1SL8 A;  3S0E A;  2LUX A;  1NSH A;  4WQ2 A;  1CB1 A;  4PDZ A;  1W7I B;  1KK8 B;  3BUW B;  4BY5 A;  3B87 A;  3B86 A;  1K93 D;  3CYZ A;  1L2O B;  1HQV A;  4PE1 A;  1MHO A;  2KI6 C;  1BMO A;  1IJ5 A;  1XFZ O;  1KSM A;  3EK7 A;  3R1O A;  1J7P A;  5JOL A;  2PQL A;  4GGF A;  4XYN A;  4XJK B;  4WRI A;  1IJ6 A;  3AKA A;  3DZT A;  1MR8 A;  1DT7 B;  2JTZ A;  1SL7 A;  2CBL A;  3BYA A;  2BL0 C;  1CNP A;  1TTX A;  1S6J A;  4F0Z B;  1QAT A;  2K2A A;  1WRK A;  4E68 A;  5G08 A;  2WCH A;  1JF2 A;  1J1D A;  2AMI A;  3LL8 B;  3SS4 A;  4MBE A;  1YTZ C;  4OZD A;  1CFC A;  3H4S E;  2KAY A;  2JC2 A;  2Y5I A;  1YR5 A;  3S0F A;  5I2O A;  1DF0 B;  5GQQ C;  4HSZ A;  4ETO A;  3JVT B;  1PAL A;  3QRX A;  3SJS A;  3D0Y A;  3FS7 A;  1SPY A;  1XK4 C;  2WCK A;  2WCE A;  1NWD A;  3BJH A;  2SAS A;  1CMF A;  3NSO A;  2KFG A;  2LHI A;  3PLF B;  1H4B A;  2P71 A;  1OQP A;  1OOH A;  1IQ5 A;  2Y4Q A;  2LV7 A;  3BQ3 A;  2M7L A;  3VRP A;  5JJG A;  3O2P A;  5K89 A;  2BAP A;  5ER5 A;  1BU3 A;  3DF0 A;  2QDI A;  2K7D A;  2M3W A;  2KQY A;  1WRL A;  1BR1 B;  1B9A A;  4DCK A;  1BLQ A;  2BEC A;  3NHI A;  2WCL A;  1AP4 A;  3DD4 A;  3FWB A;  2MJW B;  1J7R A;  4N1G A;  5FI7 A;  4I5N B;  2JNF A;  4C0K A;  1LA0 A;  1OW4 A;  2DOQ A;  3I5H C;  2QAC A;  2KGB C;  2JPO A;  1K96 A;  1SR6 B;  4QJ3 B;  2BBN A;  1EL4 A;  1TWO A;  1K9P A;  3AKB A;  4I5K A;  2JOJ A;  1OMR A;  2I2R E;  2LLS A;  2OS8 C;  1CM4 A;  3O78 A;  1CM1 A;  4JPZ B;  1QX5 B;  1S3P A;  1OZO A;  3D78 A;  5HKZ A;  3OBV A;  2LLT A;  1F4Q A;  2WOR A;  2LVJ A;  1GJY A;  2JNX A;  1EH2 A;  5DKN A;  1DJW A;  1KFU L;  4P2Y B;  4YGE B;  2VRG A;  1ODB A;  4CFQ A;  3TDU A;  2F3Z A;  1KK8 C;  4QJ4 B;  4I5J A;  1XYD A;  1Z4H A;  3SIB A;  2O5G A;  2LVI A;  3RM1 A;  1AK8 A;  1MUX A;  1C07 A;  1EG3 A;  3IVT A;  3A4U B;  1L2O C;  1A29 A;  3EK4 A;  1R6P A;  1KK7 Z;  4GFT A;  1B7T Y;  3R1V A;  4JD9 A;  1RWY A;  1TOP A;  1TN4 A;  3DVJ A;  4FTG A;  1PSB A;  2K7O A;  4C0L A;  1C7W A;  3D76 A;  4FQT A;  2JU0 A;  1GM0 A;  2YGU A;  1J7Q A;  2LNK A;  3PAL A;  4PCW A;  1BR4 B;  1PVB A;  2JQ6 A;  1QX7 A;  3EK8 A;  1B1G A;  1QVI Z;  2RGI A;  3EKH A;  1TNX A;  2MBX A;  2KSP A;  1HT9 A;  5KTY A;  2NZ0 A;  1BJF A;  1S6I A;  1EG4 A;  1CTR A;  3DYE A;  1F71 A;  1LVC D;  3WXA A;  1J1E A;  1AJ4 A;  2FJY A;  2KOT A;  3B7A A;  1QS7 A;  2SCP A;  3HX4 A;  5I2Q A;  1XFR A;  2D8N A;  4NDC A;  1CLB A;  3R1P A;  2L4I A;  1JFJ A;  1NP8 A;  2NCO A;  1XO5 A;  4ICB A;  1LXF C;  4C0J A;  1QAS A;  1NX2 A;  2BKI B;  2F8P A;  1MXL C;  3KEV A;  3FIA A;  2KYC A;  1DC1 A;  1SKT A;  3TS5 B;  2M49 B;  1MXE A;  1MQ1 A;  1YVH A;  3NHT A;  3LK0 A;  4IJ7 A;  4IL1 A;  1KFX S;  3ZWH A;  1TRF A;  3KO0 A;  1YX8 A;  3KPX A;  4MN0 A;  5DIC A;  3L4A A;  1NIW A;  3D74 A;  2WC5 A;  3CZ2 A;  3ICB A;  4YI8 A;  3DVE A;  2PMY A;  1KFX L;  2BE6 A;  1U5I B;  1V1F A;  1M31 A;  1TUJ A;  5CPV A;  1ORG A;  2M29 A;  4DIR A;  1FI5 A;  1LIN A;  1UWO A;  5AFP A;  3K21 A;  1SR6 C;  1W9Z A;  2COL B;  4Q04 A;  4HRG A;  1NUB A;  3TUY B;  5D3O A;  4MLW A;  3KF9 A;  1PUL A;  3CWG A;  2PAL A;  2TN4 A;  3SS3 A;  2JT8 A;  4MEW A;  3OB2 B;  4PAL A;  2LP3 A;  3O4Y A;  3SG7 A;  1P28 A;  1CDM A;  2QEO A;  3LK1 A;  4GUK A;  4U8D A;  1XK4 A;  1SCM B;  5B8I B;  1PSR A;  4DUQ A;  3WNX B;  2EGD A;  3D73 A;  3EKJ A;  3CZ1 A;  3VRN A;  2EC6 B;  2CT9 A;  1ZFS A;  3BOW B;  3I5I B;  1WDC C;  1JBA A;  2Q91 A;  3BUN B;  3L47 A;  1YUR A;  3C1V A;  1F55 A;  1GGW A;  3B88 A;  4PT1 A;  2BCX A;  1CDL A;  2PAS A;  3I5F B;  3PAT A;  1ZOT B;  5AER A;  3SG3 A;  4GAO A;  2E6W A;  1B8C A;  2M97 A;  2M9G A;  4YI9 A;  1J7O A;  1CLL A;  2FCE A;  4I5L B;  4CPV A;  3OX6 A;  2H8V A;  5D69 A;  1JWD A;  3NSI A;  2G9B A;  3IQQ A;  4YGB B;  1OOI X;  4NQG A;  2KDH A;  3ZNI A;  1V1G A;  5FYX A;  2ZRT A;  3PSR A;  4CFR A;  5HKW A;  5FI2 A;  1XFX O;  3LLE A;  2JT3 A;  1PRW A;  1YUU A;  1OZS A;  1DMO A;  2ZND A;  1QJT A;  1XFU O;  4NDD A;  3A8R A;  1S6C A;  2JXC A;  2KAX A;  1Y0V H;  1F70 A;  1PVA A;  4CID A;  2AUC A;  3PM2 A;  1TCF A;  3CLN A;  1OSA A;  3N7H A;  3IF7 A;  1CKK A;  1ZMZ A;  2LMV A;  1DJI A;  4ORB B;  2P6B B;  1A2X A;  1H8B A;  1LS8 A;  1N0Y A;  3UO9 A;  3AAJ A;  4M2O A;  3S0D A;  2MA2 A;  4KYN A;  5ER4 X;  2K61 A;  3SG6 A;  2KI4 C;  2KNE A;  2KPH A;  2JUL A;  2I7A A;  3GK2 A;  4PHK A;  3QME A;  1K95 A;  3TS5 C;  4PE7 A;  3SS5 A;  3CR4 X;  1IWQ A;  1KQM B;  1WY9 A;  4ORA B;  1QV0 A;  4XJK A;  1DJZ A;  1J55 A;  3V2L A;  1A75 B;  1KFU S;  4YRU A;  1OMV A;  1R2U A;  1BF5 A;  4OVN F;  1OE9 B;  1UHN A;  1RRO A;  1FBV A;  5PAL A;  2GTE A;  1CDP A;  3NSK A;  1BOC A;  2LVK A;  1T14 A;  4MVF A;  1AUI B;  2KFH A;  3VRR A;  3S0B A;  3SIA A;  4DRW A;  3OHM B;  1DTL A;  1F8H A;  1LKJ A;  3EG5 B;  4YBH B;  1NYA A;  4M2Q A;  4TNC A;  1G4Y R;  2ZN9 A;  3FWC A;  4OCI A;  3TUY C;  2L4H A;  1S5G Z;  2OPO A;  4M2P A;  1DF0 A;  1F4O A;  1QIW A;  2QPT A;  4MRY A;  1DJY A;  2WC6 A;  4GNK B;  1FI6 A;  1BOD A;  3BUO B;  3BUX B;  3BXK A;  3VRQ A;  2KI6 D;  3DVK A;  3TDI A;  3TZ1 A;  1AVS A;  1GQM A;  2EC6 C;  4JQ0 D;  1SRA A;  3I5I C;  4PE4 A;  5CSN A;  4YGA A;  1DGV A;  3CR5 X;  1QLS A;  2GV5 A;  2KFF A;  2LAP A;  4INX A;  1S1E A;  4JWQ A;  1SCV A;  1DJG A;  1KQV A;  3S0A A;  2R2I A;  5KU1 A;  3MSE B;  3AAK A;  1IIO A;  1S26 D;  2PVB A;  3DY9 A;  3FE8 A;  3I5F C;  4GPL B;  2WCB A;  4L9M A;  4N5X A;  4PHJ A;  4BY4 A;  5I94 A;  1QXP A;  4N1F A;  1DJX A;  1IQ3 A;  2KLD A;  2BKH B;  2G2B A;  2QEB A;  3LCP C;  4F7F A;  2MLF C;  3SG5 A;  1TNW A;  3JVT C;  1PK0 D;  1WRZ A;  4ZCV A;  5I8N A;  1D1O A;  1QWV A;  1YRU B;  3CR2 A;  3FE6 A;  5CSJ A;  1OOG A;  2H61 C;  1BG1 A;  2PSR A;  1B8R A;  1IGV A;  1JF0 A;  1SK6 D;  3BUM B;  1IKU A;  1YVL A;  1NCZ A;  2K2F A;  1JFK A;  2CNP A;  4MSP A;  1W7J B;  2Y1M A;  1SMG A;  1X02 A;  3HCM A;  1B8L A;  3L4L A;  2M8U A;  4FQO A;  5FI6 A;  1A4P A;  2WND A;  5DKQ A;  1XFW O;  2L98 A;  3D10 A;  1DGU A;  2BE4 A;  3SG4 A;  1XVJ A;  4A4C A;  2JT0 A;  1CFP A;  3D77 A;  1UUS A;  1UUR A;  3NSL A;  3VB1 A;  4MZL A;  1NCY A;  1XFY O;  2HPS A;  1E8A A;  1OMD A;  4UPG A;  5HYD A;  2M1K B;  3GOF A;  1NPQ A;  2LE9 B;  2LVV A;  1KK7 Y;  3D0Y B;  1S36 A;  1JSA A;  2I18 A;  3K1E A;  4ORC B;  1SW8 A;  1TNP A;  1G33 A;  4P5O E;  5IBW A;  1SY9 A;  2K0J A;  1KQM C;  2L2C A;  1YUS A;  1M39 A;  4HRH A;  2FJU B;  2WOS A;  1FW4 A;  1KWO B;  2OS8 B;  5CSF A;  3BFB A;  1K8U A;  1AJ5 A;  3JTD B;  2LC5 A;  2WCF A;  2MRD A;  3CGA A;  3S0G A;  3DF0 B;  1QVI Y;  2BCB A;  2ISD A;  1IG5 A;  4MZK A;  4USL A;  1A03 A;  2L0P A;  2M0R A;  1M46 A;  1K90 D;  2L5X B;  2Q4U A;  2FCD A;  1K94 A;  4MZJ A;  1UHK A;  1Z2C B;  1ZUZ A;  1EJ3 A;  2LM5 A;  2KYF A;  1C3Z A;  2F2P A;  2WCM A;  1SL9 A;  2EHB A;  2JPT A;  1JUO A;  5HL1 A;  1OOF A;  2KLE A;  4AOM A;  2OTG B; 
#chains in the Genus database with same CATH homology
 4YGC B;  2L51 A;  2L2E A;  2GGM A;  1C7V A;  3KHE A;  5BPJ A;  1Y1X A;  5HLV A;  5J3X A;  1DJH A;  3PM8 A;  2AAO A;  2KGR A;  2V53 A;  4GBA A;  2BCA A;  2K7C A;  1QV1 A;  1M63 B;  1YRT B;  1EXR A;  1TNQ A;  1SBJ A;  2HQW A;  2LHL A;  2LLU A;  2MAZ A;  2ZKM X;  1K2H A;  1SNL A;  1Y1A A;  2KQ6 A;  2JXL A;  4OV2 A;  3VGO A;  1UHH A;  1U5I A;  4NDB A;  1B7T Z;  2MHH A;  4GGF C;  1L7Z A;  2K8M B;  3WHT B;  1CFD A;  2I94 A;  3I5G B;  1UP5 A;  2A4J A;  1RK9 A;  1MWN A;  1Y6W A;  1XFV O;  2BBM A;  3PN7 B;  4PHM A;  1IRJ A;  1UHI A;  2ZFD A;  1RTP 1;  3RLZ A;  1AHR A;  3PFV A;  2Y1N A;  3OB1 B;  1WLM A;  1K9U A;  4D1E A;  3M0W A;  2KBI A;  1B4C A;  2F2O A;  2LUC A;  2JRF A;  3BOW A;  1YUT A;  4ZCU A;  2KHN A;  5F6T A;  4HRE E;  3WHU B;  1QLK A;  1Y1U A;  1CFF A;  2FOT A;  5I2L A;  3EVU A;  1CDN A;  1FF1 A;  3VRO A;  5TNC A;  2JWW A;  2M1U A;  4PHN A;  1QTX A;  4WQ3 A;  2KBM A;  2NXQ A;  1KWO C;  3CS1 A;  2L50 A;  4A4B A;  1UHJ A;  1SYM A;  2CTN A;  3JTD C;  1K9K A;  1SCM C;  2HF5 A;  1G8I A;  1N65 A;  5HLO A;  1QX2 A;  2BL0 B;  2ZN8 A;  2H61 A;  2LCP A;  4QJ5 B;  1REC A;  1YX7 A;  1WDC B;  2JZI A;  3GK4 X;  3EVR A;  2CCM A;  1NX1 A;  1TCO B;  1GGZ A;  3CTN A;  1VRK A;  1ZAC A;  1NCX A;  3O6B A;  2O60 A;  3EVV A;  2LMT A;  1QIV A;  3SG2 A;  1JC2 A;  1NX3 A;  4YGD B;  2GGZ A;  4OR9 B;  2B1U A;  4AQJ A;  3OX5 A;  2E30 A;  2OTG C;  2NLN A;  3GK1 A;  1NX0 A;  2KAV A;  1CLM A;  2ZNE A;  2MLE C;  1KSO A;  2ZRS A;  2JTT A;  2LMU A;  3IQO A;  4GGN A;  4AQI A;  4R1E A;  5KSZ A;  4MRX A;  2H2K A;  1ALV A;  3OP0 A;  3DVM A;  1A75 A;  1Q80 A;  1M45 A;  1DVI A;  1WLZ A;  3E3R A;  2LAN A;  5AAN A;  1LA3 A;  2IS9 A;  2M7N A;  1CMG A;  4OKH A;  4CLN A;  5DKR A;  1OOJ A;  4PE0 A;  2HET A;  5AXI A;  2WC8 A;  1B47 A;  2LP2 A;  4DS7 A;  3I5G C;  1S5G Y;  3I5H B;  2KI4 B;  5AEQ A;  1IH0 A;  2K7B A;  1KCY A;  2CXJ A;  1RFJ A;  3PN7 C;  3CZT X;  3F45 A;  5D7F A;  1BT6 A;  1N2D A;  1MF8 B;  5HKY A;  2F33 A;  3NXA A;  2NCP A;  1F54 A;  2PRU A;  5CSI A;  1XA5 A;  2F3Y A;  3TDZ A;  2HQ8 A;  1RJV A;  1FPW A;  1ALW A;  1TIZ A;  1SL8 A;  2LUX A;  1NSH A;  4WQ2 A;  1CB1 A;  4PDZ A;  1W7I B;  1KK8 B;  3BUW B;  4BY5 A;  1K93 D;  1L2O B;  1HQV A;  4PE1 A;  1MHO A;  2KI6 C;  1BMO A;  1IJ5 A;  1XFZ O;  1KSM A;  3EK7 A;  1J7P A;  5JOL A;  4GGF A;  4XYN A;  4XJK B;  4WRI A;  1IJ6 A;  3AKA A;  1MR8 A;  1DT7 B;  2JTZ A;  1SL7 A;  2CBL A;  3BYA A;  2BL0 C;  1CNP A;  1TTX A;  1S6J A;  4F0Z B;  1QAT A;  2K2A A;  1WRK A;  4E68 A;  5G08 A;  1JF2 A;  1J1D A;  2AMI A;  3LL8 B;  4MBE A;  1YTZ C;  1CFC A;  3H4S E;  2KAY A;  2JC2 A;  2Y5I A;  1YR5 A;  5I2O A;  1DF0 B;  5GQQ C;  4HSZ A;  4ETO A;  3JVT B;  1PAL A;  3QRX A;  3SJS A;  3D0Y A;  3FS7 A;  1SPY A;  1XK4 C;  2WCE A;  1NWD A;  2SAS A;  1CMF A;  3NSO A;  2KFG A;  2LHI A;  3PLF B;  1H4B A;  1OQP A;  2Y4Q A;  1IQ5 A;  3BQ3 A;  2LV7 A;  2M7L A;  3VRP A;  5JJG A;  3O2P A;  5K89 A;  5ER5 A;  1BU3 A;  3DF0 A;  2K7D A;  2M3W A;  2KQY A;  1WRL A;  1BR1 B;  1B9A A;  4DCK A;  1BLQ A;  2BEC A;  1AP4 A;  3DD4 A;  3FWB A;  2MJW B;  1J7R A;  4N1G A;  4I5N B;  2JNF A;  4C0K A;  1LA0 A;  2DOQ A;  3I5H C;  2QAC A;  2KGB C;  1K96 A;  1SR6 B;  4QJ3 B;  2BBN A;  1EL4 A;  3AKB A;  1K9P A;  4I5K A;  2JOJ A;  1OMR A;  2I2R E;  2LLS A;  2OS8 C;  1CM4 A;  3O78 A;  1CM1 A;  4JPZ B;  1QX5 B;  1S3P A;  1OZO A;  5HKZ A;  2LLT A;  1F4Q A;  2WOR A;  2LVJ A;  1GJY A;  2JNX A;  1EH2 A;  5DKN A;  1DJW A;  1KFU L;  4P2Y B;  4YGE B;  2VRG A;  1ODB A;  4CFQ A;  3TDU A;  2F3Z A;  1KK8 C;  4QJ4 B;  4I5J A;  1XYD A;  3SIB A;  1C07 A;  2O5G A;  2LVI A;  3RM1 A;  1AK8 A;  1MUX A;  1EG3 A;  3A4U B;  1L2O C;  1A29 A;  3EK4 A;  1R6P A;  1KK7 Z;  4GFT A;  1B7T Y;  1RWY A;  1TOP A;  1TN4 A;  3DVJ A;  4FTG A;  1PSB A;  2K7O A;  4C0L A;  1C7W A;  2JU0 A;  1J7Q A;  2LNK A;  3PAL A;  4PCW A;  1BR4 B;  1PVB A;  2JQ6 A;  1QX7 A;  3EK8 A;  1B1G A;  1QVI Z;  2RGI A;  3EKH A;  1TNX A;  2MBX A;  2KSP A;  1HT9 A;  5KTY A;  2NZ0 A;  1BJF A;  1S6I A;  1EG4 A;  1CTR A;  1F71 A;  1LVC D;  3WXA A;  1J1E A;  1AJ4 A;  2KOT A;  1QS7 A;  2SCP A;  3HX4 A;  5I2Q A;  1CLB A;  2D8N A;  4NDC A;  1JFJ A;  2L4I A;  1NP8 A;  2NCO A;  1XO5 A;  4ICB A;  1LXF C;  4C0J A;  2BKI B;  1QAS A;  1NX2 A;  2F8P A;  1MXL C;  3KEV A;  3FIA A;  2KYC A;  1SKT A;  3TS5 B;  2M49 B;  1MXE A;  1MQ1 A;  1YVH A;  3LK0 A;  4IL1 A;  1KFX S;  3ZWH A;  1TRF A;  3KO0 A;  1YX8 A;  3KPX A;  4MN0 A;  1NIW A;  3ICB A;  4YI8 A;  3DVE A;  2PMY A;  1KFX L;  2BE6 A;  1U5I B;  1V1F A;  1M31 A;  5CPV A;  1FI5 A;  2M29 A;  4DIR A;  1LIN A;  1UWO A;  5AFP A;  3K21 A;  1SR6 C;  2COL B;  4Q04 A;  4HRG A;  1NUB A;  3TUY B;  4MLW A;  3KF9 A;  1PUL A;  3CWG A;  2PAL A;  2TN4 A;  2JT8 A;  4MEW A;  3OB2 B;  4PAL A;  2LP3 A;  3O4Y A;  3SG7 A;  1CDM A;  3LK1 A;  4GUK A;  4U8D A;  5B8I B;  1XK4 A;  1SCM B;  1PSR A;  4DUQ A;  3WNX B;  2EGD A;  3EKJ A;  3VRN A;  2EC6 B;  2CT9 A;  1ZFS A;  3BOW B;  3I5I B;  1WDC C;  1JBA A;  2Q91 A;  3BUN B;  1YUR A;  3C1V A;  1F55 A;  1GGW A;  2BCX A;  1CDL A;  2PAS A;  3I5F B;  3PAT A;  1ZOT B;  5AER A;  3SG3 A;  4GAO A;  2E6W A;  1B8C A;  2M97 A;  2M9G A;  4YI9 A;  1J7O A;  1CLL A;  2FCE A;  4I5L B;  4CPV A;  3OX6 A;  5D69 A;  1JWD A;  3NSI A;  2G9B A;  3IQQ A;  4YGB B;  4NQG A;  2KDH A;  3ZNI A;  1V1G A;  5FYX A;  2ZRT A;  3PSR A;  4CFR A;  5HKW A;  1XFX O;  3LLE A;  2JT3 A;  1PRW A;  1YUU A;  1OZS A;  1DMO A;  2ZND A;  1QJT A;  1XFU O;  4NDD A;  3A8R A;  1S6C A;  2JXC A;  2KAX A;  1Y0V H;  1F70 A;  1PVA A;  4CID A;  2AUC A;  1TCF A;  3CLN A;  1OSA A;  1CKK A;  3IF7 A;  1ZMZ A;  2LMV A;  1DJI A;  4ORB B;  2P6B B;  1A2X A;  1H8B A;  1N0Y A;  3AAJ A;  4M2O A;  2MA2 A;  5ER4 X;  2K61 A;  3SG6 A;  2KI4 C;  2KNE A;  2JUL A;  2I7A A;  3GK2 A;  4PHK A;  1K95 A;  3TS5 C;  4PE7 A;  3CR4 X;  1IWQ A;  1KQM B;  1WY9 A;  4ORA B;  1QV0 A;  4XJK A;  1DJZ A;  1J55 A;  1A75 B;  1KFU S;  4YRU A;  1OMV A;  1R2U A;  1BF5 A;  4OVN F;  1OE9 B;  1UHN A;  1RRO A;  1FBV A;  5PAL A;  1CDP A;  3NSK A;  1BOC A;  2LVK A;  4MVF A;  1AUI B;  2KFH A;  3VRR A;  3SIA A;  4DRW A;  3OHM B;  1DTL A;  1F8H A;  1LKJ A;  4YBH B;  1NYA A;  4M2Q A;  4TNC A;  1G4Y R;  2ZN9 A;  3FWC A;  4OCI A;  3TUY C;  2L4H A;  1S5G Z;  2OPO A;  4M2P A;  1DF0 A;  1F4O A;  1QIW A;  2QPT A;  4MRY A;  1DJY A;  4GNK B;  1FI6 A;  1BOD A;  3BUO B;  3BUX B;  3BXK A;  3VRQ A;  2KI6 D;  3DVK A;  3TDI A;  3TZ1 A;  1AVS A;  1GQM A;  2EC6 C;  4JQ0 D;  1SRA A;  3I5I C;  4PE4 A;  5CSN A;  4YGA A;  1DGV A;  3CR5 X;  1QLS A;  2GV5 A;  2KFF A;  2LAP A;  1S1E A;  4JWQ A;  1SCV A;  1DJG A;  1KQV A;  2R2I A;  5KU1 A;  3MSE B;  3AAK A;  1S26 D;  2PVB A;  4L9M A;  3I5F C;  4GPL B;  4N5X A;  2WCB A;  4BY4 A;  1IQ3 A;  4PHJ A;  1QXP A;  4N1F A;  1DJX A;  2BKH B;  2G2B A;  3LCP C;  2MLF C;  3SG5 A;  1TNW A;  3JVT C;  1PK0 D;  1WRZ A;  4ZCV A;  5I8N A;  1D1O A;  1YRU B;  3CR2 A;  5CSJ A;  2H61 C;  1BG1 A;  2PSR A;  1B8R A;  1IGV A;  1JF0 A;  1SK6 D;  3BUM B;  1IKU A;  1YVL A;  1NCZ A;  2K2F A;  1JFK A;  2CNP A;  4MSP A;  1W7J B;  2Y1M A;  1SMG A;  1X02 A;  3HCM A;  1B8L A;  2M8U A;  4FQO A;  1A4P A;  2WND A;  5DKQ A;  1XFW O;  2L98 A;  3D10 A;  1DGU A;  2BE4 A;  3SG4 A;  1XVJ A;  4A4C A;  2JT0 A;  1CFP A;  1UUS A;  1UUR A;  3NSL A;  4MZL A;  1NCY A;  1XFY O;  2HPS A;  1E8A A;  1OMD A;  4UPG A;  5HYD A;  2M1K B;  3GOF A;  1NPQ A;  2LE9 B;  2LVV A;  1KK7 Y;  3D0Y B;  1S36 A;  1JSA A;  2I18 A;  4ORC B;  1SW8 A;  1TNP A;  1G33 A;  4P5O E;  5IBW A;  1SY9 A;  2K0J A;  1KQM C;  1YUS A;  1M39 A;  4HRH A;  2FJU B;  2WOS A;  1FW4 A;  1KWO B;  2OS8 B;  5CSF A;  1K8U A;  1AJ5 A;  3JTD B;  2LC5 A;  2WCF A;  2MRD A;  3CGA A;  3DF0 B;  1QVI Y;  2BCB A;  2ISD A;  1IG5 A;  4MZK A;  4USL A;  1A03 A;  2L0P A;  2M0R A;  1M46 A;  1K90 D;  2L5X B;  2Q4U A;  2FCD A;  1K94 A;  4MZJ A;  1UHK A;  1ZUZ A;  1EJ3 A;  2LM5 A;  2KYF A;  2F2P A;  1SL9 A;  2EHB A;  2JPT A;  1JUO A;  4AOM A;  2OTG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...