2L98A

Structure of trans-resveratrol in complex with the cardiac regulatory protein troponin c
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure of trans-Resveratrol in Complex with the Cardiac Regulatory Protein Troponin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2l98A00
4HRGA 3BOWA 2ZKMX 2Y1MA 1BLQA 1JC2A 2H61C 3CR5X 4F0ZB 5HLOA 4GUKA 1WLMA 1A29A 1DJHA 3AKBA 2F2OA 1C07A 1IG5A 2KAXA 1NP8A 1S26D 1MQ1A 1A75A 2MJWB 1MXEA 3KO0A 5I8NA 1CNPA 1OQPA 1J7QA 1S6CA 1PVAA 1XFYO 3LCPC 1BR4B 1EG3A 1CKKA 3PN7B 4CPVA 1HQVA 5CSFA 1GGZA 1PVBA 4CFQA 2BKHB 2I2RE 3SG4A 1DTLA 2LE9B 2LLTA 1EL4A 1K94A 4GAOA 1U5IB 2LVIA 4YI8A 4DRWA 3GOFA 4NDCA 3BUXB 1F8HA 1N2DA 3O78A 1FI6A 3H4SE 2BL0C 4DCKA 1YURA 2KBIA 1MXLC 3OHMB 5HKZA 3HX4A 3I5HC 4I5KA 3DVMA 4WRIA 4PALA 1QTXA 1SPYA 4ZCVA 1B1GA 1MF8B 2PSRA 2HQ8A 4XJKB 3TDUA 4AQIA 2WCEA 3PFVA 1WDCC 2KGRA 4DIRA 1M39A 1NIWA 1YTZC 2ZN9A 1CTRA 1KK8C 3BUOB 2M1UA 2G9BA 2COLB 5DKQA 3BUWB 1CM4A 1XFVO 2GGMA 1IQ3A 1SYMA 1RFJA 1SBJA 2JT3A 1B8RA 4DUQA 2ZFDA 1BT6A 1CLBA 3I5IB 3BXKA 3SG3A 3WHUB 2H2KA 2ZNDA 3ZWHA 1J7RA 1FF1A 4WQ3A 3IQQA 1ZFSA 1E8AA 1Y6WA 1EJ3A 4C0KA 3O6BA 2JU0A 1ZOTB 1TNQA 2KI6C 2L4IA 3MSEB 1LXFC 1TRFA 1LKJA 1WY9A 1YVHA 2M1KB 5JOLA 1IJ6A 5CPVA 4N5XA 1RJVA 4PHNA 2BE6A 2D8NA 2L5XB 3EKHA 3PM8A 2R2IA 4MN0A 1SL7A 2LUXA 2I7AA 1NX2A 1OMDA 2JZIA 1SRAA 3WHTB 1TNPA 2KAYA 2PMYA 1QVIY 3EVRA 2LMUA 3TUYB 1SKTA 2PVBA 4PE1A 1IWQA 1Q80A 3IF7A 2BCXA 1LVCD 1CDLA 3CLNA 1IQ5A 4OCIA 2LNKA 1DJYA 1KK7Z 5JJGA 1KSOA 1SL8A 1WLZA 2JNFA 1PRWA 3D0YB 3KPXA 1BU3A 4M2PA 1S5GY 2L98A 3JVTC 4BY4A 2EC6C 3I5FB 1F54A 2M29A 2NCOA 1SY9A 2Q4UA 4JQ0D 1JSAA 4M2OA 4A4BA 3LK0A 1TNXA 3DF0B 4OR9B 2GGZA 1OOJA 4GGFA 2E30A 5AANA 3D10A 3M0WA 2LVVA 2OTGC 5TNCA 4AQJA 3AAKA 1UHIA 2OS8B 2AAOA 1DT7B 2RGIA 3DVJA 2JNXA 1DVIA 4QJ4B 4AOMA 2KI4B 2HF5A 5GQQC 2FCDA 4YGDB 2ZN8A 5KU1A 1K2HA 1HT9A 2BCBA 3TS5C 1CLMA 2B1UA 3KHEA 2K8MB 1S6IA 3BUMB 1B7TZ 4YGCB 3CS1A 3WXAA 2CXJA 3CGAA 5KTYA 1DJZA 1K90D 1CB1A 2LP2A 1J7OA 3SG5A 3E3RA 4MZKA 1TCFA 5AXIA 1OMRA 2LLUA 1TTXA 3WNXB 2CTNA 1YRTB 1KSMA 2JTTA 4TNCA 1AJ5A 4CIDA 4A4CA 1V1FA 2KBMA 4GGFC 2K7BA 3NSOA 3LK1A 1CFPA 1M63B 1SCVA 1OE9B 4HRHA 4ICBA 2HETA 1IGVA 1RK9A 3A8RA 2F3ZA 1K9PA 1B8CA 3BQ3A 1H8BA 1SCMC 1JUOA 3EKJA 4ETOA 1PALA 4E68A 2I18A 4GBAA 1AP4A 1FBVA 1QATA 1N0YA 1JF2A 1A03A 1PULA 1ODBA 2P6BB 2JRFA 4XYNA 1SR6C 4GPLB 2JTZA 2KGBC 5HLVA 5DKRA 3VRPA 2EGDA 2LV7A 5HYDA 1GGWA 2DOQA 3GK2A 2JC2A 4OKHA 5AFPA 3O4YA 4WQ2A 2OS8C 1KWOC 2V53A 5PALA 5BPJA 5I2OA 1F4OA 1IJ5A 1RTP1 1U5IA 2JT0A 4MRYA 2LVJA 2KFHA 1DJIA 3GK4X 2LAPA 2CT9A 3OB2B 1KQMB 1L2OB 1F4QA 4CFRA 2NZ0A 1DJGA 2WORA 3PATA 5HKWA 1B7TY 1IRJA 3OX5A 2HPSA 4XJKA 4YI9A 4ORAB 4GNKB 1CM1A 2M9GA 1KFUS 4MBEA 4D1EA 1X02A 3PN7C 2M8UA 1XK4A 1KFXS 2KYFA 3EVUA 3PALA 3SG7A 1M46A 1QX7A 1CFDA 1AJ4A 1UHKA 1FW4A 1S6JA 4I5LB 4YGBB 1TN4A 4L9MA 4PCWA 1NCYA 3KF9A 1FI5A 3SG6A 2M0RA 2L0PA 2LLSA 1Y1XA 1QV0A 1M45A 1QIVA 2KQ6A 1BR1B 1YUTA 3NSKA 1BJFA 2JPTA 3AKAA 1B9AA 1DGUA 3IQOA 2MHHA 1KFUL 1EH2A 2LM5A 4PDZA 1BF5A 2K7OA 4FTGA 3NSLA 1KFXL 3FWBA 3RM1A 2KFGA 1B4CA 1NPQA 3JTDB 2TN4A 2WCFA 3VRQA 4DS7A 1KQVA 4ORBB 4QJ3B 4N1FA 2AMIA 2F33A 3VRNA 2BKIB 3NSIA 2MBXA 1J55A 4OVNF 1XK4C 1DGVA 2KDHA 2KQYA 1AHRA 3OP0A 5F6TA 1MUXA 2AUCA 1OZOA 2M49B 2JXCA 1N65A 1WRZA 2LC5A 1XFZO 1LINA 1UHNA 3I5IC 1ZACA 1PSBA 2KNEA 3K21A 1NCZA 4Q04A 1NSHA 4PE4A 1NUBA 4GGNA 1QJTA 3D0YA 1B8LA 4I5JA 5IBWA 5K89A 4N1GA 5G08A 2A4JA 3BUNB 1F71A 1SK6D 1QIWA 2LMTA 5J3XA 1JFJA 3KEVA 1XFXO 5B8IB 4MVFA 2BBMA 2MRDA 2K2AA 1ALWA 3DF0A 1PK0D 4MEWA 4C0LA 1PSRA 4HSZA 2BL0B 4I5NB 2O5GA 3RLZA 1NX1A 1K9KA 2LHIA 2SASA 2Y5IA 3I5HB 2L4HA 3BOWB 1BODA 3DVEA 3OX6A 1F55A 1ZUZA 2MAZA 1NX3A 2L50A 1CLLA 1MWNA 3PSRA 2LMVA 1XA5A 3EK7A 3TUYC 4M2QA 2Y4QA 3TZ1A 1H4BA 5CSJA 3TDZA 2K7DA 2JULA 4QJ5B 1A75B 2QPTA 3QRXA 3CR4X 2KOTA 1WDCB 2MLEC 2JQ6A 1G4YR 1UP5A 1TIZA 1YX8A 2MA2A 1KK8B 2ZRTA 3DVKA 4HREE 1A2XA 1KK7Y 1MR8A 2EHBA 1QX2A 2M3WA 1YRUB 2F2PA 2CBLA 2KHNA 4IL1A 5I2LA 4FQOA 2JWWA 1TOPA 4MLWA 3I5FC 1CFFA 2BE4A 2LCPA 1QASA 2JT8A 2QACA 3SIAA 4P2YB 1TCOB 3EK8A 1GJYA 1NCXA 3VRRA 1BOCA 3DD4A 1J1DA 1XYDA 3ZNIA 1RWYA 2K61A 1CDNA 3ICBA 1SMGA 3NXAA 1S1EA 3EVVA 1YR5A 1AUIB 4MZLA 1V1GA 1MHOA 3TDIA 5AEQA 2NCPA 2KI4C 4P5OE 1WRLA 3SG2A 1JFKA 1AK8A 1YUUA 4R1EA 2M7LA 1BG1A 1XVJA 3GK1A 1UHHA 2NXQA 1F70A 4MZJA 1KCYA 5CSIA 2FOTA 1QVIZ 1J7PA 1SL9A 2FCEA 2Q91A 2JXLA 1NYAA 1UURA 2F3YA 2LANA 4PHKA 1QS7A 4OV2A 1R6PA 1J1EA 1IH0A 2BCAA 5I2QA 1K95A 1A4PA 1DJWA 1S5GZ 1WRKA 2WNDA 4JWQA 2PASA 1TNWA 5AERA 2BECA 1DF0B 2KSPA 1OSAA 1RROA 1B47A 3FWCA 3LL8B 3JVTB 2FJUB 2EC6B 3FIAA 1CFCA 4PE0A 5ER4X 3VGOA 1W7JB 2ZRSA 4U8DA 4GFTA 1XO5A 4BY5A 3HCMA 1UUSA 2SCPA 3I5GB 3CWGA 5HKYA 2I94A 1UWOA 2NLNA 1Y1AA 3AAJA 4ZCUA 1ZMZA 1Y0VH 1QLSA 1XFUO 2OTGB 4MSPA 5KSZA 1D1OA 3A4UB 4MRXA 1DF0A 1EXRA 3OB1B 2E6WA 4NQGA 4ORCB 3CR2A 4C0JA 1GQMA 5D69A 1K9UA 2G2BA 2L2EA 1QLKA 2WCBA 1YX7A 1QV1A 1QX5B 1C7WA 1UHJA 2VRGA 1JBAA 3TS5B 3CZTX 4UPGA 1YUSA 3CTNA 4USLA 1KQMC 1K8UA 1L2OC 1OZSA 2L51A 2CCMA 1NX0A 2LVKA 1W7IB 4YBHB 2IS9A 4JPZB 1XFWO 4YGAA 5FYXA 1NWDA 3C1VA 1JWDA 3VROA 1JF0A 1CDPA 3O2PA 1CMGA 1AVSA 1LA0A 2LP3A 1VRKA 1C7VA 2HQWA 1EG4A 2WC8A 4CLNA 2LUCA 1G33A 1G8IA 1L7ZA 2LHLA 4PE7A 2GV5A 2M7NA 2ZNEA 2K0JA 1DJXA 1M31A 4NDBA 3SJSA 3F45A 4NDDA 1Y1UA 2ISDA 4YRUA 2F8PA 3LLEA 1RECA 1SCMB 2KYCA 2H61A 5ER5A 1FPWA 1K96A 2KI6D 1S3PA 2O60A 1S36A 2Y1NA 1DMOA 1R2UA 1SR6B 1CMFA 3I5GC 5CSNA 2JOJA 5D7FA 4YGEB 4PHMA 3SIBA 2KFFA 2PRUA 2CNPA 2M97A 2WOSA 2K2FA 1YVLA 3FS7A 1OMVA 1KWOB 2BBNA 1SNLA 3PLFB 2MLFC 2PALA 1K93D 5DKNA 1SW8A 2KAVA 3JTDC 4PHJA 3EK4A 1IKUA 2K7CA 2OPOA 3BYAA 1ALVA 1LA3A 1QXPA 1CDMA 1BMOA
chains in the Genus database with same CATH superfamily
4HRGA 2WCLA 3BOWA 2ZKMX 2Y1MA 3FE9A 1BLQA 1JC2A 2H61C 3CR5X 5EL2A 5HLOA 4GUKA 1WLMA 1A29A 1DJHA 4F0ZB 3AKBA 2F2OA 1C07A 1IG5A 3B7AA 2KAXA 1NP8A 1S26D 1MQ1A 1A75A 2MJWB 1MXEA 3KO0A 5I8NA 1CNPA 1OQPA 1J7QA 3O4XA 1S6CA 1PVAA 1XFYO 3LCPC 5D3OA 1BR4B 1EG3A 2L5YA 3PN7B 1CKKA 4CPVA 2YGUA 1HQVA 1OOIX 1OOHA 5CSFA 1GGZA 1QWVA 1PVBA 4CFQA 2BKHB 3CZ2A 2FJYA 3OBVA 2I2RE 3SG4A 1DTLA 3NHIA 2LE9B 1LS8A 2LLTA 1EL4A 1K94A 4GAOA 1U5IB 2LVIA 4YI8A 3S0DA 4DRWA 3GOFA 4NDCA 3BUXB 1F8HA 1N2DA 3O78A 1FI6A 3H4SE 2BL0C 4DCKA 1YURA 2KBIA 1MXLC 3OHMB 5HKZA 3HX4A 3I5HC 4I5KA 3DVMA 4WRIA 4PALA 2PYQA 1QTXA 1SPYA 4ZCVA 1B1GA 1MF8B 2PSRA 2HQ8A 4XJKB 3TDUA 4AQIA 2WCEA 3PFVA 1WDCC 2KGRA 5DICA 1M39A 1NIWA 1YTZC 2ZN9A 1CTRA 4DIRA 1KK8C 3BUOB 2M1UA 2G9BA 2COLB 5DKQA 3BUWB 1CM4A 1XFVO 2GGMA 1IQ3A 1SYMA 1RFJA 1SBJA 2JT3A 1B8RA 4DUQA 2ZFDA 1BT6A 1CLBA 3I5IB 3BXKA 3SG3A 3WHUB 1Z2CB 2H2KA 2ZNDA 3ZWHA 1J7RA 1FF1A 4WQ3A 3IQQA 1ZFSA 1E8AA 1Y6WA 1EJ3A 4C0KA 3O6BA 2JU0A 1ZOTB 1TNQA 2KI6C 2L4IA 3MSEB 1LXFC 1TRFA 1LKJA 1WY9A 3D75A 1TUJA 3B86A 1YVHA 3FE8A 2M1KB 4FQTA 5JOLA 1IJ6A 3SS3A 3EG5B 5CPVA 4N5XA 1RJVA 4PHNA 3OGNA 2BE6A 2D8NA 2L5XB 3EKHA 3PM8A 3D73A 2R2IA 4MN0A 1SL7A 2LUXA 2I7AA 3R1VA 1NX2A 1OMDA 2JZIA 1SRAA 3S0GA 3WHTB 1TNPA 2KAYA 2PMYA 1QVIY 3EVRA 2LMUA 3TUYB 3CYZA 1SKTA 2PVBA 4PE1A 1IWQA 1Q80A 3IF7A 2BCXA 1LVCD 1CDLA 3CLNA 1IQ5A 4OCIA 2LNKA 3BFBA 1DJYA 1KK7Z 5JJGA 1KSOA 1SL8A 1WLZA 2JNFA 1PRWA 3D0YB 3KPXA 1BU3A 4M2PA 1S5GY 3CDNA 3V2LA 2L98A 3JVTC 4BY4A 1C3YA 2EC6C 3I5FB 1F54A 2M29A 2NCOA 1SY9A 2Q4UA 4JQ0D 1JSAA 4M2OA 3NGVA 1P28A 4A4BA 3LK0A 1TNXA 3DF0B 4OR9B 2GGZA 3R1OA 1OOJA 4GGFA 2E30A 5AANA 3D10A 3M0WA 4INXA 2LVVA 2OTGC 2K60A 5TNCA 4AQJA 3AAKA 1UHIA 2OS8B 2AAOA 1DT7B 2RGIA 3DVJA 2JNXA 1DVIA 5HL1A 4QJ4B 4AOMA 2KI4B 2HF5A 5GQQC 2FCDA 4YGDB 2ZN8A 3L47A 5KU1A 1K2HA 1HT9A 2BCBA 3TS5C 1CLMA 2B1UA 3KHEA 2K8MB 1S6IA 3BUMB 1B7TZ 4YGCB 3CS1A 4JKTA 3WXAA 2CXJA 3CGAA 5KTYA 1DJZA 1K90D 1CB1A 2LP2A 1J7OA 3SG5A 3E3RA 4MZKA 1TCFA 5AXIA 1OMRA 2L2CA 2LLUA 1TTXA 3D78A 3WNXB 1OOFA 2CTNA 3FE6A 1YRTB 1KSMA 2JTTA 4TNCA 1AJ5A 4CIDA 4A4CA 1V1FA 2KBMA 4GGFC 2WCMA 2K7BA 3NSOA 3LK1A 1CFPA 1M63B 1SCVA 1OE9B 4HRHA 4ICBA 2HETA 1IGVA 1RK9A 3A8RA 2F3ZA 1K9PA 1B8CA 3BQ3A 4IJ7A 1H8BA 1SCMC 1JUOA 3EKJA 4ETOA 1PALA 4E68A 2I18A 4GBAA 4F7FA 1AP4A 1FBVA 1QATA 1N0YA 1JF2A 1A03A 1PULA 3S0AA 1ODBA 2P6BB 2JRFA 4XYNA 3RZSA 1SR6C 4GPLB 2PQLA 2JTZA 2KGBC 5HLVA 5DKRA 3VRPA 2EGDA 2LV7A 5HYDA 1GGWA 2DOQA 3GK2A 2JC2A 2QEVA 4JD9A 1W9ZA 3B87A 4OKHA 3O4YA 4INWA 5AFPA 4WQ2A 2OS8C 1KWOC 2V53A 5PALA 5BPJA 1OOGA 5I2OA 1F4OA 1IJ5A 1RTP1 1U5IA 2JT0A 4MRYA 2LVJA 2KFHA 1DJIA 3GK4X 2LAPA 2CT9A 3OB2B 3CABA 1KQMB 1L2OB 2KLEA 1F4QA 4CFRA 2NZ0A 1DJGA 2WORA 3PATA 5HKWA 1B7TY 1IRJA 3OX5A 2HPSA 4XJKA 4YI9A 4ORAB 4GNKB 1CM1A 2M9GA 1ORGA 1KFUS 3NHTA 2WCHA 4MBEA 4D1EA 1T14A 1X02A 3PN7C 2M8UA 1XK4A 1KFXS 2KYFA 3EVUA 3PALA 3SG7A 3SS4A 1Z4HA 1M46A 1QX7A 3S0EA 1CFDA 1AJ4A 1UHKA 1FW4A 1S6JA 1DEKA 4I5LB 4YGBB 1TN4A 4L9MA 4PCWA 1NCYA 3KF9A 1FI5A 3SG6A 2M0RA 2L0PA 2LLSA 1Y1XA 1QV0A 1M45A 1QIVA 3R1PA 2KQ6A 1BR1B 1YUTA 3NSKA 1BJFA 2JPTA 3AKAA 1B9AA 3CZ1A 1DGUA 3IQOA 2MHHA 1KFUL 1DQEA 1EH2A 2LM5A 4PDZA 3CZ0A 1BF5A 2K7OA 2QDIA 3Q8IA 4FTGA 3NSLA 1KFXL 3FWBA 3RM1A 2KFGA 1B4CA 1NPQA 1IIOA 3DYEA 2TN4A 2WCFA 3JTDB 3VRQA 4DS7A 1KQVA 4ORBB 4QJ3B 4N1FA 2AMIA 2F33A 3VRNA 2BKIB 3NSIA 3BJHA 1J55A 4OVNF 1XK4C 1DGVA 2KDHA 2KQYA 2MBXA 1AHRA 3OP0A 1OW4A 2JPOA 5F6TA 1MUXA 1C3ZA 2AUCA 1OZOA 2M49B 1TWOA 2JXCA 1XFRA 3BFHA 1N65A 1WRZA 2LC5A 1XFZO 1LINA 1UHNA 3I5IC 1ZACA 5FI7A 1PSBA 2KNEA 3K21A 3PJIA 1NCZA 4Q04A 1NSHA 4PE4A 1NUBA 4GGNA 1QJTA 3D0YA 3UNWA 1B8LA 2KPHA 4I5JA 5IBWA 5K89A 4N1GA 5G08A 2A4JA 3BUNB 1F71A 1SK6D 1QIWA 2LMTA 5J3XA 1JFJA 3KEVA 1XFXO 5B8IB 4MVFA 3B6XA 2BBMA 2MRDA 4PT1A 2K2AA 1ALWA 3DF0A 1PK0D 3DXLA 4MEWA 1PSRA 4HSZA 4C0LA 2BL0B 4I5NB 2O5GA 3RLZA 1NX1A 1K9KA 2LHIA 2SASA 2Y5IA 3IVTA 3I5HB 3QMEA 2L4HA 3BOWB 1BODA 3DVEA 3OX6A 1F55A 1ZUZA 2MAZA 1NX3A 2L50A 1CLLA 1MWNA 3PSRA 2LMVA 1XA5A 3EK7A 3D74A 4M2QA 3TUYC 2Y4QA 3TZ1A 1H4BA 5CSJA 3TDZA 2K7DA 2JULA 3D77A 1A75B 2QPTA 3QRXA 3CR4X 4QJ5B 2KOTA 1WDCB 2MLEC 2JQ6A 1G4YR 1UP5A 3SS5A 1TIZA 1YX8A 2MA2A 1KK8B 2ZRTA 3DVKA 4HREE 1A2XA 1KK7Y 1MR8A 2EHBA 1QX2A 2M3WA 1YRUB 2F2PA 2CBLA 2KLDA 2KHNA 3DY9A 4IL1A 5I2LA 3K1EA 4FQOA 2JWWA 1TOPA 4MLWA 3I5FC 1CFFA 2BE4A 2LCPA 1QASA 2P70A 2JT8A 2WCKA 2QACA 3SIAA 4P2YB 1TCOB 3EK8A 1GJYA 1NCXA 3VRRA 1BOCA 3DD4A 1J1DA 1XYDA 3ZNIA 1RWYA 2K61A 1CDNA 3ICBA 3BFAA 1SMGA 3NXAA 1S1EA 3N7HA 3EVVA 1YR5A 1AUIB 4MZLA 1V1GA 1MHOA 3TDIA 2WC6A 5AEQA 2NCPA 3PM2A 2KI4C 4P5OE 1WRLA 3SG2A 1JFKA 1AK8A 1YUUA 4R1EA 2M7LA 1BG1A 1XVJA 3GK1A 1UHHA 2NXQA 3S0BA 1F70A 4MZJA 1KCYA 5CSIA 2FOTA 1QVIZ 4OZDA 1J7PA 1SL9A 2FCEA 2Q91A 2JXLA 1NYAA 1UURA 2F3YA 2LANA 4PHKA 1QS7A 4OV2A 1R6PA 5FI2A 1J1EA 3L4AA 1IH0A 2BCAA 5FI6A 5I2QA 1K95A 1A4PA 1DJWA 1S5GZ 1WRKA 2WNDA 4JWQA 2PASA 1TNWA 2GTEA 3R72A 5AERA 2BECA 1DF0B 2KSPA 1OSAA 1RROA 1B47A 2WC5A 3FWCA 3JVTB 3LL8B 2FJUB 2EC6B 3FIAA 1CFCA 2QEBA 4PE0A 5ER4X 3VGOA 1W7JB 2ZRSA 4U8DA 4GFTA 1XO5A 4BY5A 3HCMA 2P71A 1UUSA 2SCPA 3I5GB 3CWGA 5HKYA 2I94A 1UWOA 2NLNA 3UO9A 1Y1AA 3AAJA 4ZCUA 1ZMZA 3B88A 1GM0A 1Y0VH 3S0FA 1QLSA 1XFUO 2OTGB 4MSPA 5KSZA 1D1OA 3A4UB 4MRXA 1DF0A 1EXRA 3OB1B 2E6WA 4NQGA 4ORCB 3CR2A 4C0JA 1GQMA 2H8VA 5D69A 1K9UA 2G2BA 2QEHA 2L2EA 1QLKA 2WCBA 1YX7A 1QV1A 1QX5B 1C7WA 1UHJA 2VRGA 1JBAA 3TS5B 5I94A 3CZTX 4UPGA 1YUSA 3CTNA 4USLA 3DZTA 1KQMC 1K8UA 1L2OC 1OZSA 2L51A 2CCMA 1NX0A 2LVKA 1W7IB 4YBHB 3VB1A 2IS9A 4JPZB 1XFWO 4YGAA 5FYXA 1NWDA 3C1VA 1JWDA 3VROA 1JF0A 1CDPA 3O2PA 1CMGA 1AVSA 1LA0A 2LP3A 1VRKA 1C7VA 2BAPA 2HQWA 1EG4A 2QEOA 2WC8A 4CLNA 2LUCA 1G33A 1G8IA 1L7ZA 2LHLA 4PE7A 2GV5A 2M7NA 1DC1A 2ZNEA 2K0JA 1DJXA 1M31A 4NDBA 3SJSA 3F45A 4NDDA 1Y1UA 2ISDA 4YRUA 2F8PA 3LLEA 1RECA 1SCMB 2KYCA 2H61A 5ER5A 1FPWA 1K96A 2KI6D 1S3PA 2O60A 1S36A 2Y1NA 1DMOA 1R2UA 1SR6B 1CMFA 1DELA 1TUZA 3I5GC 3L4LA 5CSNA 2JOJA 5D7FA 4YGEB 4PHMA 3SIBA 2KFFA 2PRUA 2CNPA 2M97A 2WOSA 2K2FA 1YVLA 3FS7A 1SSEB 1OMVA 1KWOB 2BBNA 1SNLA 2ERBA 3PLFB 2MLFC 2PALA 1K93D 5DKNA 1SW8A 2KAVA 3D76A 3JTDC 4PHJA 2WCJA 3EK4A 1IKUA 2K7CA 2OPOA 3BYAA 1ALVA 1LA3A 1QXPA 2BNXA 4KYNA 1CDMA 1BMOA
chains in the Genus database with same CATH topology
4HRGA 3BOWA 2ZKMX 2Y1MA 1BLQA 1JC2A 2H61C 3CR5X 4F0ZB 5HLOA 4GUKA 1WLMA 1A29A 1DJHA 3AKBA 2F2OA 1C07A 1IG5A 2KAXA 1NP8A 1S26D 1MQ1A 1A75A 2MJWB 1MXEA 3KO0A 5I8NA 1CNPA 1OQPA 1J7QA 1S6CA 1PVAA 1XFYO 3LCPC 1BR4B 1EG3A 1CKKA 3PN7B 4CPVA 1HQVA 5CSFA 1GGZA 1PVBA 4CFQA 2BKHB 2I2RE 3SG4A 1DTLA 2LE9B 2LLTA 1EL4A 1K94A 4GAOA 1U5IB 2LVIA 4YI8A 4DRWA 3GOFA 4NDCA 3BUXB 1F8HA 1N2DA 3O78A 1FI6A 3H4SE 2BL0C 4DCKA 1YURA 2KBIA 1MXLC 3OHMB 5HKZA 3HX4A 3I5HC 4I5KA 3DVMA 4WRIA 4PALA 1QTXA 1SPYA 4ZCVA 1B1GA 1MF8B 2PSRA 2HQ8A 4XJKB 3TDUA 4AQIA 2WCEA 3PFVA 1WDCC 2KGRA 4DIRA 1M39A 1NIWA 1YTZC 2ZN9A 1CTRA 1KK8C 3BUOB 2M1UA 2G9BA 2COLB 5DKQA 3BUWB 1CM4A 1XFVO 2GGMA 1IQ3A 1SYMA 1RFJA 1SBJA 2JT3A 1B8RA 4DUQA 2ZFDA 1BT6A 1CLBA 3I5IB 3BXKA 3SG3A 3WHUB 2H2KA 2ZNDA 3ZWHA 1J7RA 1FF1A 4WQ3A 3IQQA 1ZFSA 1E8AA 1Y6WA 1EJ3A 4C0KA 3O6BA 2JU0A 1ZOTB 1TNQA 2KI6C 2L4IA 3MSEB 1LXFC 1TRFA 1LKJA 1WY9A 1YVHA 2M1KB 5JOLA 1IJ6A 5CPVA 4N5XA 1RJVA 4PHNA 2BE6A 2D8NA 2L5XB 3EKHA 3PM8A 2R2IA 4MN0A 1SL7A 2LUXA 2I7AA 1NX2A 1OMDA 2JZIA 1SRAA 3WHTB 1TNPA 2KAYA 2PMYA 1QVIY 3EVRA 2LMUA 3TUYB 1SKTA 2PVBA 4PE1A 1IWQA 1Q80A 3IF7A 2BCXA 1LVCD 1CDLA 3CLNA 1IQ5A 4OCIA 2LNKA 1DJYA 1KK7Z 5JJGA 1KSOA 1SL8A 1WLZA 2JNFA 1PRWA 3D0YB 3KPXA 1BU3A 4M2PA 1S5GY 2L98A 3JVTC 4BY4A 2EC6C 3I5FB 1F54A 2M29A 2NCOA 1SY9A 2Q4UA 4JQ0D 1JSAA 4M2OA 4A4BA 3LK0A 1TNXA 3DF0B 4OR9B 2GGZA 1OOJA 4GGFA 2E30A 5AANA 3D10A 3M0WA 2LVVA 2OTGC 5TNCA 4AQJA 3AAKA 1UHIA 2OS8B 2AAOA 1DT7B 2RGIA 3DVJA 2JNXA 1DVIA 4QJ4B 4AOMA 2KI4B 2HF5A 5GQQC 2FCDA 4YGDB 2ZN8A 5KU1A 1K2HA 1HT9A 2BCBA 3TS5C 1CLMA 2B1UA 3KHEA 2K8MB 1S6IA 3BUMB 1B7TZ 4YGCB 3CS1A 3WXAA 2CXJA 3CGAA 5KTYA 1DJZA 1K90D 1CB1A 2LP2A 1J7OA 3SG5A 3E3RA 4MZKA 1TCFA 5AXIA 1OMRA 2LLUA 1TTXA 3WNXB 2CTNA 1YRTB 1KSMA 2JTTA 4TNCA 1AJ5A 4CIDA 4A4CA 1V1FA 2KBMA 4GGFC 2K7BA 3NSOA 3LK1A 1CFPA 1M63B 1SCVA 1OE9B 4HRHA 4ICBA 2HETA 1IGVA 1RK9A 3A8RA 2F3ZA 1K9PA 1B8CA 3BQ3A 1H8BA 1SCMC 1JUOA 3EKJA 4ETOA 1PALA 4E68A 2I18A 4GBAA 1AP4A 1FBVA 1QATA 1N0YA 1JF2A 1A03A 1PULA 1ODBA 2P6BB 2JRFA 4XYNA 1SR6C 4GPLB 2JTZA 2KGBC 5HLVA 5DKRA 3VRPA 2EGDA 2LV7A 5HYDA 1GGWA 2DOQA 3GK2A 2JC2A 4OKHA 5AFPA 3O4YA 4WQ2A 2OS8C 1KWOC 2V53A 5PALA 5BPJA 5I2OA 1F4OA 1IJ5A 1RTP1 1U5IA 2JT0A 4MRYA 2LVJA 2KFHA 1DJIA 3GK4X 2LAPA 2CT9A 3OB2B 1KQMB 1L2OB 1F4QA 4CFRA 2NZ0A 1DJGA 2WORA 3PATA 5HKWA 1B7TY 1IRJA 3OX5A 2HPSA 4XJKA 4YI9A 4ORAB 4GNKB 1CM1A 2M9GA 1KFUS 4MBEA 4D1EA 1X02A 3PN7C 2M8UA 1XK4A 1KFXS 2KYFA 3EVUA 3PALA 3SG7A 1M46A 1QX7A 1CFDA 1AJ4A 1UHKA 1FW4A 1S6JA 4I5LB 4YGBB 1TN4A 4L9MA 4PCWA 1NCYA 3KF9A 1FI5A 3SG6A 2M0RA 2L0PA 2LLSA 1Y1XA 1QV0A 1M45A 1QIVA 2KQ6A 1BR1B 1YUTA 3NSKA 1BJFA 2JPTA 3AKAA 1B9AA 1DGUA 3IQOA 2MHHA 1KFUL 1EH2A 2LM5A 4PDZA 1BF5A 2K7OA 4FTGA 3NSLA 1KFXL 3FWBA 3RM1A 2KFGA 1B4CA 1NPQA 3JTDB 2TN4A 2WCFA 3VRQA 4DS7A 1KQVA 4ORBB 4QJ3B 4N1FA 2AMIA 2F33A 3VRNA 2BKIB 3NSIA 2MBXA 1J55A 4OVNF 1XK4C 1DGVA 2KDHA 2KQYA 1AHRA 3OP0A 5F6TA 1MUXA 2AUCA 1OZOA 2M49B 2JXCA 1N65A 1WRZA 2LC5A 1XFZO 1LINA 1UHNA 3I5IC 1ZACA 1PSBA 2KNEA 3K21A 1NCZA 4Q04A 1NSHA 4PE4A 1NUBA 4GGNA 1QJTA 3D0YA 1B8LA 4I5JA 5IBWA 5K89A 4N1GA 5G08A 2A4JA 3BUNB 1F71A 1SK6D 1QIWA 2LMTA 5J3XA 1JFJA 3KEVA 1XFXO 5B8IB 4MVFA 2BBMA 2MRDA 2K2AA 1ALWA 3DF0A 1PK0D 4MEWA 4C0LA 1PSRA 4HSZA 2BL0B 4I5NB 2O5GA 3RLZA 1NX1A 1K9KA 2LHIA 2SASA 2Y5IA 3I5HB 2L4HA 3BOWB 1BODA 3DVEA 3OX6A 1F55A 1ZUZA 2MAZA 1NX3A 2L50A 1CLLA 1MWNA 3PSRA 2LMVA 1XA5A 3EK7A 3TUYC 4M2QA 2Y4QA 3TZ1A 1H4BA 5CSJA 3TDZA 2K7DA 2JULA 4QJ5B 1A75B 2QPTA 3QRXA 3CR4X 2KOTA 1WDCB 2MLEC 2JQ6A 1G4YR 1UP5A 1TIZA 1YX8A 2MA2A 1KK8B 2ZRTA 3DVKA 4HREE 1A2XA 1KK7Y 1MR8A 2EHBA 1QX2A 2M3WA 1YRUB 2F2PA 2CBLA 2KHNA 4IL1A 5I2LA 4FQOA 2JWWA 1TOPA 4MLWA 3I5FC 1CFFA 2BE4A 2LCPA 1QASA 2JT8A 2QACA 3SIAA 4P2YB 1TCOB 3EK8A 1GJYA 1NCXA 3VRRA 1BOCA 3DD4A 1J1DA 1XYDA 3ZNIA 1RWYA 2K61A 1CDNA 3ICBA 1SMGA 3NXAA 1S1EA 3EVVA 1YR5A 1AUIB 4MZLA 1V1GA 1MHOA 3TDIA 5AEQA 2NCPA 2KI4C 4P5OE 1WRLA 3SG2A 1JFKA 1AK8A 1YUUA 4R1EA 2M7LA 1BG1A 1XVJA 3GK1A 1UHHA 2NXQA 1F70A 4MZJA 1KCYA 5CSIA 2FOTA 1QVIZ 1J7PA 1SL9A 2FCEA 2Q91A 2JXLA 1NYAA 1UURA 2F3YA 2LANA 4PHKA 1QS7A 4OV2A 1R6PA 1J1EA 1IH0A 2BCAA 5I2QA 1K95A 1A4PA 1DJWA 1S5GZ 1WRKA 2WNDA 4JWQA 2PASA 1TNWA 5AERA 2BECA 1DF0B 2KSPA 1OSAA 1RROA 1B47A 3FWCA 3LL8B 3JVTB 2FJUB 2EC6B 3FIAA 1CFCA 4PE0A 5ER4X 3VGOA 1W7JB 2ZRSA 4U8DA 4GFTA 1XO5A 4BY5A 3HCMA 1UUSA 2SCPA 3I5GB 3CWGA 5HKYA 2I94A 1UWOA 2NLNA 1Y1AA 3AAJA 4ZCUA 1ZMZA 1Y0VH 1QLSA 1XFUO 2OTGB 4MSPA 5KSZA 1D1OA 3A4UB 4MRXA 1DF0A 1EXRA 3OB1B 2E6WA 4NQGA 4ORCB 3CR2A 4C0JA 1GQMA 5D69A 1K9UA 2G2BA 2L2EA 1QLKA 2WCBA 1YX7A 1QV1A 1QX5B 1C7WA 1UHJA 2VRGA 1JBAA 3TS5B 3CZTX 4UPGA 1YUSA 3CTNA 4USLA 1KQMC 1K8UA 1L2OC 1OZSA 2L51A 2CCMA 1NX0A 2LVKA 1W7IB 4YBHB 2IS9A 4JPZB 1XFWO 4YGAA 5FYXA 1NWDA 3C1VA 1JWDA 3VROA 1JF0A 1CDPA 3O2PA 1CMGA 1AVSA 1LA0A 2LP3A 1VRKA 1C7VA 2HQWA 1EG4A 2WC8A 4CLNA 2LUCA 1G33A 1G8IA 1L7ZA 2LHLA 4PE7A 2GV5A 2M7NA 2ZNEA 2K0JA 1DJXA 1M31A 4NDBA 3SJSA 3F45A 4NDDA 1Y1UA 2ISDA 4YRUA 2F8PA 3LLEA 1RECA 1SCMB 2KYCA 2H61A 5ER5A 1FPWA 1K96A 2KI6D 1S3PA 2O60A 1S36A 2Y1NA 1DMOA 1R2UA 1SR6B 1CMFA 3I5GC 5CSNA 2JOJA 5D7FA 4YGEB 4PHMA 3SIBA 2KFFA 2PRUA 2CNPA 2M97A 2WOSA 2K2FA 1YVLA 3FS7A 1OMVA 1KWOB 2BBNA 1SNLA 3PLFB 2MLFC 2PALA 1K93D 5DKNA 1SW8A 2KAVA 3JTDC 4PHJA 3EK4A 1IKUA 2K7CA 2OPOA 3BYAA 1ALVA 1LA3A 1QXPA 1CDMA 1BMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRG A;  3BOW A;  2ZKM X;  2Y1M A;  1BLQ A;  1JC2 A;  2H61 C;  3CR5 X;  4F0Z B;  5HLO A;  4GUK A;  1WLM A;  1A29 A;  1DJH A;  3AKB A;  2F2O A;  1C07 A;  1IG5 A;  2KAX A;  1NP8 A;  1S26 D;  1MQ1 A;  1A75 A;  2MJW B;  1MXE A;  3KO0 A;  5I8N A;  1CNP A;  1OQP A;  1J7Q A;  1S6C A;  1PVA A;  1XFY O;  3LCP C;  1BR4 B;  1EG3 A;  1CKK A;  3PN7 B;  4CPV A;  1HQV A;  5CSF A;  1GGZ A;  1PVB A;  4CFQ A;  2BKH B;  2I2R E;  3SG4 A;  1DTL A;  2LE9 B;  2LLT A;  1EL4 A;  1K94 A;  4GAO A;  1U5I B;  2LVI A;  4YI8 A;  4DRW A;  3GOF A;  4NDC A;  3BUX B;  1F8H A;  1N2D A;  3O78 A;  1FI6 A;  3H4S E;  2BL0 C;  4DCK A;  1YUR A;  2KBI A;  1MXL C;  3OHM B;  5HKZ A;  3HX4 A;  3I5H C;  4I5K A;  3DVM A;  4WRI A;  4PAL A;  1QTX A;  1SPY A;  4ZCV A;  1B1G A;  1MF8 B;  2PSR A;  2HQ8 A;  4XJK B;  3TDU A;  4AQI A;  2WCE A;  3PFV A;  1WDC C;  2KGR A;  4DIR A;  1M39 A;  1NIW A;  1YTZ C;  2ZN9 A;  1CTR A;  1KK8 C;  3BUO B;  2M1U A;  2G9B A;  2COL B;  5DKQ A;  3BUW B;  1CM4 A;  1XFV O;  2GGM A;  1IQ3 A;  1SYM A;  1RFJ A;  1SBJ A;  2JT3 A;  1B8R A;  4DUQ A;  2ZFD A;  1BT6 A;  1CLB A;  3I5I B;  3BXK A;  3SG3 A;  3WHU B;  2H2K A;  2ZND A;  3ZWH A;  1J7R A;  1FF1 A;  4WQ3 A;  3IQQ A;  1ZFS A;  1E8A A;  1Y6W A;  1EJ3 A;  4C0K A;  3O6B A;  2JU0 A;  1ZOT B;  1TNQ A;  2KI6 C;  2L4I A;  3MSE B;  1LXF C;  1TRF A;  1LKJ A;  1WY9 A;  1YVH A;  2M1K B;  5JOL A;  1IJ6 A;  5CPV A;  4N5X A;  1RJV A;  4PHN A;  2BE6 A;  2D8N A;  2L5X B;  3EKH A;  3PM8 A;  2R2I A;  4MN0 A;  1SL7 A;  2LUX A;  2I7A A;  1NX2 A;  1OMD A;  2JZI A;  1SRA A;  3WHT B;  1TNP A;  2KAY A;  2PMY A;  1QVI Y;  3EVR A;  2LMU A;  3TUY B;  1SKT A;  2PVB A;  4PE1 A;  1IWQ A;  1Q80 A;  3IF7 A;  2BCX A;  1LVC D;  1CDL A;  3CLN A;  1IQ5 A;  4OCI A;  2LNK A;  1DJY A;  1KK7 Z;  5JJG A;  1KSO A;  1SL8 A;  1WLZ A;  2JNF A;  1PRW A;  3D0Y B;  3KPX A;  1BU3 A;  4M2P A;  1S5G Y;  2L98 A;  3JVT C;  4BY4 A;  2EC6 C;  3I5F B;  1F54 A;  2M29 A;  2NCO A;  1SY9 A;  2Q4U A;  4JQ0 D;  1JSA A;  4M2O A;  4A4B A;  3LK0 A;  1TNX A;  3DF0 B;  4OR9 B;  2GGZ A;  1OOJ A;  4GGF A;  2E30 A;  5AAN A;  3D10 A;  3M0W A;  2LVV A;  2OTG C;  5TNC A;  4AQJ A;  3AAK A;  1UHI A;  2OS8 B;  2AAO A;  1DT7 B;  2RGI A;  3DVJ A;  2JNX A;  1DVI A;  4QJ4 B;  4AOM A;  2KI4 B;  2HF5 A;  5GQQ C;  2FCD A;  4YGD B;  2ZN8 A;  5KU1 A;  1K2H A;  1HT9 A;  2BCB A;  3TS5 C;  1CLM A;  2B1U A;  3KHE A;  2K8M B;  1S6I A;  3BUM B;  1B7T Z;  4YGC B;  3CS1 A;  3WXA A;  2CXJ A;  3CGA A;  5KTY A;  1DJZ A;  1K90 D;  1CB1 A;  2LP2 A;  1J7O A;  3SG5 A;  3E3R A;  4MZK A;  1TCF A;  5AXI A;  1OMR A;  2LLU A;  1TTX A;  3WNX B;  2CTN A;  1YRT B;  1KSM A;  2JTT A;  4TNC A;  1AJ5 A;  4CID A;  4A4C A;  1V1F A;  2KBM A;  4GGF C;  2K7B A;  3NSO A;  3LK1 A;  1CFP A;  1M63 B;  1SCV A;  1OE9 B;  4HRH A;  4ICB A;  2HET A;  1IGV A;  1RK9 A;  3A8R A;  2F3Z A;  1K9P A;  1B8C A;  3BQ3 A;  1H8B A;  1SCM C;  1JUO A;  3EKJ A;  4ETO A;  1PAL A;  4E68 A;  2I18 A;  4GBA A;  1AP4 A;  1FBV A;  1QAT A;  1N0Y A;  1JF2 A;  1A03 A;  1PUL A;  1ODB A;  2P6B B;  2JRF A;  4XYN A;  1SR6 C;  4GPL B;  2JTZ A;  2KGB C;  5HLV A;  5DKR A;  3VRP A;  2EGD A;  2LV7 A;  5HYD A;  1GGW A;  2DOQ A;  3GK2 A;  2JC2 A;  4OKH A;  5AFP A;  3O4Y A;  4WQ2 A;  2OS8 C;  1KWO C;  2V53 A;  5PAL A;  5BPJ A;  5I2O A;  1F4O A;  1IJ5 A;  1RTP 1;  1U5I A;  2JT0 A;  4MRY A;  2LVJ A;  2KFH A;  1DJI A;  3GK4 X;  2LAP A;  2CT9 A;  3OB2 B;  1KQM B;  1L2O B;  1F4Q A;  4CFR A;  2NZ0 A;  1DJG A;  2WOR A;  3PAT A;  5HKW A;  1B7T Y;  1IRJ A;  3OX5 A;  2HPS A;  4XJK A;  4YI9 A;  4ORA B;  4GNK B;  1CM1 A;  2M9G A;  1KFU S;  4MBE A;  4D1E A;  1X02 A;  3PN7 C;  2M8U A;  1XK4 A;  1KFX S;  2KYF A;  3EVU A;  3PAL A;  3SG7 A;  1M46 A;  1QX7 A;  1CFD A;  1AJ4 A;  1UHK A;  1FW4 A;  1S6J A;  4I5L B;  4YGB B;  1TN4 A;  4L9M A;  4PCW A;  1NCY A;  3KF9 A;  1FI5 A;  3SG6 A;  2M0R A;  2L0P A;  2LLS A;  1Y1X A;  1QV0 A;  1M45 A;  1QIV A;  2KQ6 A;  1BR1 B;  1YUT A;  3NSK A;  1BJF A;  2JPT A;  3AKA A;  1B9A A;  1DGU A;  3IQO A;  2MHH A;  1KFU L;  1EH2 A;  2LM5 A;  4PDZ A;  1BF5 A;  2K7O A;  4FTG A;  3NSL A;  1KFX L;  3FWB A;  3RM1 A;  2KFG A;  1B4C A;  1NPQ A;  3JTD B;  2TN4 A;  2WCF A;  3VRQ A;  4DS7 A;  1KQV A;  4ORB B;  4QJ3 B;  4N1F A;  2AMI A;  2F33 A;  3VRN A;  2BKI B;  3NSI A;  2MBX A;  1J55 A;  4OVN F;  1XK4 C;  1DGV A;  2KDH A;  2KQY A;  1AHR A;  3OP0 A;  5F6T A;  1MUX A;  2AUC A;  1OZO A;  2M49 B;  2JXC A;  1N65 A;  1WRZ A;  2LC5 A;  1XFZ O;  1LIN A;  1UHN A;  3I5I C;  1ZAC A;  1PSB A;  2KNE A;  3K21 A;  1NCZ A;  4Q04 A;  1NSH A;  4PE4 A;  1NUB A;  4GGN A;  1QJT A;  3D0Y A;  1B8L A;  4I5J A;  5IBW A;  5K89 A;  4N1G A;  5G08 A;  2A4J A;  3BUN B;  1F71 A;  1SK6 D;  1QIW A;  2LMT A;  5J3X A;  1JFJ A;  3KEV A;  1XFX O;  5B8I B;  4MVF A;  2BBM A;  2MRD A;  2K2A A;  1ALW A;  3DF0 A;  1PK0 D;  4MEW A;  4C0L A;  1PSR A;  4HSZ A;  2BL0 B;  4I5N B;  2O5G A;  3RLZ A;  1NX1 A;  1K9K A;  2LHI A;  2SAS A;  2Y5I A;  3I5H B;  2L4H A;  3BOW B;  1BOD A;  3DVE A;  3OX6 A;  1F55 A;  1ZUZ A;  2MAZ A;  1NX3 A;  2L50 A;  1CLL A;  1MWN A;  3PSR A;  2LMV A;  1XA5 A;  3EK7 A;  3TUY C;  4M2Q A;  2Y4Q A;  3TZ1 A;  1H4B A;  5CSJ A;  3TDZ A;  2K7D A;  2JUL A;  4QJ5 B;  1A75 B;  2QPT A;  3QRX A;  3CR4 X;  2KOT A;  1WDC B;  2MLE C;  2JQ6 A;  1G4Y R;  1UP5 A;  1TIZ A;  1YX8 A;  2MA2 A;  1KK8 B;  2ZRT A;  3DVK A;  4HRE E;  1A2X A;  1KK7 Y;  1MR8 A;  2EHB A;  1QX2 A;  2M3W A;  1YRU B;  2F2P A;  2CBL A;  2KHN A;  4IL1 A;  5I2L A;  4FQO A;  2JWW A;  1TOP A;  4MLW A;  3I5F C;  1CFF A;  2BE4 A;  2LCP A;  1QAS A;  2JT8 A;  2QAC A;  3SIA A;  4P2Y B;  1TCO B;  3EK8 A;  1GJY A;  1NCX A;  3VRR A;  1BOC A;  3DD4 A;  1J1D A;  1XYD A;  3ZNI A;  1RWY A;  2K61 A;  1CDN A;  3ICB A;  1SMG A;  3NXA A;  1S1E A;  3EVV A;  1YR5 A;  1AUI B;  4MZL A;  1V1G A;  1MHO A;  3TDI A;  5AEQ A;  2NCP A;  2KI4 C;  4P5O E;  1WRL A;  3SG2 A;  1JFK A;  1AK8 A;  1YUU A;  4R1E A;  2M7L A;  1BG1 A;  1XVJ A;  3GK1 A;  1UHH A;  2NXQ A;  1F70 A;  4MZJ A;  1KCY A;  5CSI A;  2FOT A;  1QVI Z;  1J7P A;  1SL9 A;  2FCE A;  2Q91 A;  2JXL A;  1NYA A;  1UUR A;  2F3Y A;  2LAN A;  4PHK A;  1QS7 A;  4OV2 A;  1R6P A;  1J1E A;  1IH0 A;  2BCA A;  5I2Q A;  1K95 A;  1A4P A;  1DJW A;  1S5G Z;  1WRK A;  2WND A;  4JWQ A;  2PAS A;  1TNW A;  5AER A;  2BEC A;  1DF0 B;  2KSP A;  1OSA A;  1RRO A;  1B47 A;  3FWC A;  3LL8 B;  3JVT B;  2FJU B;  2EC6 B;  3FIA A;  1CFC A;  4PE0 A;  5ER4 X;  3VGO A;  1W7J B;  2ZRS A;  4U8D A;  4GFT A;  1XO5 A;  4BY5 A;  3HCM A;  1UUS A;  2SCP A;  3I5G B;  3CWG A;  5HKY A;  2I94 A;  1UWO A;  2NLN A;  1Y1A A;  3AAJ A;  4ZCU A;  1ZMZ A;  1Y0V H;  1QLS A;  1XFU O;  2OTG B;  4MSP A;  5KSZ A;  1D1O A;  3A4U B;  4MRX A;  1DF0 A;  1EXR A;  3OB1 B;  2E6W A;  4NQG A;  4ORC B;  3CR2 A;  4C0J A;  1GQM A;  5D69 A;  1K9U A;  2G2B A;  2L2E A;  1QLK A;  2WCB A;  1YX7 A;  1QV1 A;  1QX5 B;  1C7W A;  1UHJ A;  2VRG A;  1JBA A;  3TS5 B;  3CZT X;  4UPG A;  1YUS A;  3CTN A;  4USL A;  1KQM C;  1K8U A;  1L2O C;  1OZS A;  2L51 A;  2CCM A;  1NX0 A;  2LVK A;  1W7I B;  4YBH B;  2IS9 A;  4JPZ B;  1XFW O;  4YGA A;  5FYX A;  1NWD A;  3C1V A;  1JWD A;  3VRO A;  1JF0 A;  1CDP A;  3O2P A;  1CMG A;  1AVS A;  1LA0 A;  2LP3 A;  1VRK A;  1C7V A;  2HQW A;  1EG4 A;  2WC8 A;  4CLN A;  2LUC A;  1G33 A;  1G8I A;  1L7Z A;  2LHL A;  4PE7 A;  2GV5 A;  2M7N A;  2ZNE A;  2K0J A;  1DJX A;  1M31 A;  4NDB A;  3SJS A;  3F45 A;  4NDD A;  1Y1U A;  2ISD A;  4YRU A;  2F8P A;  3LLE A;  1REC A;  1SCM B;  2KYC A;  2H61 A;  5ER5 A;  1FPW A;  1K96 A;  2KI6 D;  1S3P A;  2O60 A;  1S36 A;  2Y1N A;  1DMO A;  1R2U A;  1SR6 B;  1CMF A;  3I5G C;  5CSN A;  2JOJ A;  5D7F A;  4YGE B;  4PHM A;  3SIB A;  2KFF A;  2PRU A;  2CNP A;  2M97 A;  2WOS A;  2K2F A;  1YVL A;  3FS7 A;  1OMV A;  1KWO B;  2BBN A;  1SNL A;  3PLF B;  2MLF C;  2PAL A;  1K93 D;  5DKN A;  1SW8 A;  2KAV A;  3JTD C;  4PHJ A;  3EK4 A;  1IKU A;  2K7C A;  2OPO A;  3BYA A;  1ALV A;  1LA3 A;  1QXP A;  1CDM A;  1BMO A; 
#chains in the Genus database with same CATH topology
 4HRG A;  2WCL A;  3BOW A;  2ZKM X;  2Y1M A;  3FE9 A;  1BLQ A;  1JC2 A;  2H61 C;  3CR5 X;  5EL2 A;  5HLO A;  4GUK A;  1WLM A;  1A29 A;  1DJH A;  4F0Z B;  3AKB A;  2F2O A;  1C07 A;  1IG5 A;  3B7A A;  2KAX A;  1NP8 A;  1S26 D;  1MQ1 A;  1A75 A;  2MJW B;  1MXE A;  3KO0 A;  5I8N A;  1CNP A;  1OQP A;  1J7Q A;  3O4X A;  1S6C A;  1PVA A;  1XFY O;  3LCP C;  5D3O A;  1BR4 B;  1EG3 A;  2L5Y A;  3PN7 B;  1CKK A;  4CPV A;  2YGU A;  1HQV A;  1OOI X;  1OOH A;  5CSF A;  1GGZ A;  1QWV A;  1PVB A;  4CFQ A;  2BKH B;  3CZ2 A;  2FJY A;  3OBV A;  2I2R E;  3SG4 A;  1DTL A;  3NHI A;  2LE9 B;  1LS8 A;  2LLT A;  1EL4 A;  1K94 A;  4GAO A;  1U5I B;  2LVI A;  4YI8 A;  3S0D A;  4DRW A;  3GOF A;  4NDC A;  3BUX B;  1F8H A;  1N2D A;  3O78 A;  1FI6 A;  3H4S E;  2BL0 C;  4DCK A;  1YUR A;  2KBI A;  1MXL C;  3OHM B;  5HKZ A;  3HX4 A;  3I5H C;  4I5K A;  3DVM A;  4WRI A;  4PAL A;  2PYQ A;  1QTX A;  1SPY A;  4ZCV A;  1B1G A;  1MF8 B;  2PSR A;  2HQ8 A;  4XJK B;  3TDU A;  4AQI A;  2WCE A;  3PFV A;  1WDC C;  2KGR A;  5DIC A;  1M39 A;  1NIW A;  1YTZ C;  2ZN9 A;  1CTR A;  4DIR A;  1KK8 C;  3BUO B;  2M1U A;  2G9B A;  2COL B;  5DKQ A;  3BUW B;  1CM4 A;  1XFV O;  2GGM A;  1IQ3 A;  1SYM A;  1RFJ A;  1SBJ A;  2JT3 A;  1B8R A;  4DUQ A;  2ZFD A;  1BT6 A;  1CLB A;  3I5I B;  3BXK A;  3SG3 A;  3WHU B;  1Z2C B;  2H2K A;  2ZND A;  3ZWH A;  1J7R A;  1FF1 A;  4WQ3 A;  3IQQ A;  1ZFS A;  1E8A A;  1Y6W A;  1EJ3 A;  4C0K A;  3O6B A;  2JU0 A;  1ZOT B;  1TNQ A;  2KI6 C;  2L4I A;  3MSE B;  1LXF C;  1TRF A;  1LKJ A;  1WY9 A;  3D75 A;  1TUJ A;  3B86 A;  1YVH A;  3FE8 A;  2M1K B;  4FQT A;  5JOL A;  1IJ6 A;  3SS3 A;  3EG5 B;  5CPV A;  4N5X A;  1RJV A;  4PHN A;  3OGN A;  2BE6 A;  2D8N A;  2L5X B;  3EKH A;  3PM8 A;  3D73 A;  2R2I A;  4MN0 A;  1SL7 A;  2LUX A;  2I7A A;  3R1V A;  1NX2 A;  1OMD A;  2JZI A;  1SRA A;  3S0G A;  3WHT B;  1TNP A;  2KAY A;  2PMY A;  1QVI Y;  3EVR A;  2LMU A;  3TUY B;  3CYZ A;  1SKT A;  2PVB A;  4PE1 A;  1IWQ A;  1Q80 A;  3IF7 A;  2BCX A;  1LVC D;  1CDL A;  3CLN A;  1IQ5 A;  4OCI A;  2LNK A;  3BFB A;  1DJY A;  1KK7 Z;  5JJG A;  1KSO A;  1SL8 A;  1WLZ A;  2JNF A;  1PRW A;  3D0Y B;  3KPX A;  1BU3 A;  4M2P A;  1S5G Y;  3CDN A;  3V2L A;  2L98 A;  3JVT C;  4BY4 A;  1C3Y A;  2EC6 C;  3I5F B;  1F54 A;  2M29 A;  2NCO A;  1SY9 A;  2Q4U A;  4JQ0 D;  1JSA A;  4M2O A;  3NGV A;  1P28 A;  4A4B A;  3LK0 A;  1TNX A;  3DF0 B;  4OR9 B;  2GGZ A;  3R1O A;  1OOJ A;  4GGF A;  2E30 A;  5AAN A;  3D10 A;  3M0W A;  4INX A;  2LVV A;  2OTG C;  2K60 A;  5TNC A;  4AQJ A;  3AAK A;  1UHI A;  2OS8 B;  2AAO A;  1DT7 B;  2RGI A;  3DVJ A;  2JNX A;  1DVI A;  5HL1 A;  4QJ4 B;  4AOM A;  2KI4 B;  2HF5 A;  5GQQ C;  2FCD A;  4YGD B;  2ZN8 A;  3L47 A;  5KU1 A;  1K2H A;  1HT9 A;  2BCB A;  3TS5 C;  1CLM A;  2B1U A;  3KHE A;  2K8M B;  1S6I A;  3BUM B;  1B7T Z;  4YGC B;  3CS1 A;  4JKT A;  3WXA A;  2CXJ A;  3CGA A;  5KTY A;  1DJZ A;  1K90 D;  1CB1 A;  2LP2 A;  1J7O A;  3SG5 A;  3E3R A;  4MZK A;  1TCF A;  5AXI A;  1OMR A;  2L2C A;  2LLU A;  1TTX A;  3D78 A;  3WNX B;  1OOF A;  2CTN A;  3FE6 A;  1YRT B;  1KSM A;  2JTT A;  4TNC A;  1AJ5 A;  4CID A;  4A4C A;  1V1F A;  2KBM A;  4GGF C;  2WCM A;  2K7B A;  3NSO A;  3LK1 A;  1CFP A;  1M63 B;  1SCV A;  1OE9 B;  4HRH A;  4ICB A;  2HET A;  1IGV A;  1RK9 A;  3A8R A;  2F3Z A;  1K9P A;  1B8C A;  3BQ3 A;  4IJ7 A;  1H8B A;  1SCM C;  1JUO A;  3EKJ A;  4ETO A;  1PAL A;  4E68 A;  2I18 A;  4GBA A;  4F7F A;  1AP4 A;  1FBV A;  1QAT A;  1N0Y A;  1JF2 A;  1A03 A;  1PUL A;  3S0A A;  1ODB A;  2P6B B;  2JRF A;  4XYN A;  3RZS A;  1SR6 C;  4GPL B;  2PQL A;  2JTZ A;  2KGB C;  5HLV A;  5DKR A;  3VRP A;  2EGD A;  2LV7 A;  5HYD A;  1GGW A;  2DOQ A;  3GK2 A;  2JC2 A;  2QEV A;  4JD9 A;  1W9Z A;  3B87 A;  4OKH A;  3O4Y A;  4INW A;  5AFP A;  4WQ2 A;  2OS8 C;  1KWO C;  2V53 A;  5PAL A;  5BPJ A;  1OOG A;  5I2O A;  1F4O A;  1IJ5 A;  1RTP 1;  1U5I A;  2JT0 A;  4MRY A;  2LVJ A;  2KFH A;  1DJI A;  3GK4 X;  2LAP A;  2CT9 A;  3OB2 B;  3CAB A;  1KQM B;  1L2O B;  2KLE A;  1F4Q A;  4CFR A;  2NZ0 A;  1DJG A;  2WOR A;  3PAT A;  5HKW A;  1B7T Y;  1IRJ A;  3OX5 A;  2HPS A;  4XJK A;  4YI9 A;  4ORA B;  4GNK B;  1CM1 A;  2M9G A;  1ORG A;  1KFU S;  3NHT A;  2WCH A;  4MBE A;  4D1E A;  1T14 A;  1X02 A;  3PN7 C;  2M8U A;  1XK4 A;  1KFX S;  2KYF A;  3EVU A;  3PAL A;  3SG7 A;  3SS4 A;  1Z4H A;  1M46 A;  1QX7 A;  3S0E A;  1CFD A;  1AJ4 A;  1UHK A;  1FW4 A;  1S6J A;  1DEK A;  4I5L B;  4YGB B;  1TN4 A;  4L9M A;  4PCW A;  1NCY A;  3KF9 A;  1FI5 A;  3SG6 A;  2M0R A;  2L0P A;  2LLS A;  1Y1X A;  1QV0 A;  1M45 A;  1QIV A;  3R1P A;  2KQ6 A;  1BR1 B;  1YUT A;  3NSK A;  1BJF A;  2JPT A;  3AKA A;  1B9A A;  3CZ1 A;  1DGU A;  3IQO A;  2MHH A;  1KFU L;  1DQE A;  1EH2 A;  2LM5 A;  4PDZ A;  3CZ0 A;  1BF5 A;  2K7O A;  2QDI A;  3Q8I A;  4FTG A;  3NSL A;  1KFX L;  3FWB A;  3RM1 A;  2KFG A;  1B4C A;  1NPQ A;  1IIO A;  3DYE A;  2TN4 A;  2WCF A;  3JTD B;  3VRQ A;  4DS7 A;  1KQV A;  4ORB B;  4QJ3 B;  4N1F A;  2AMI A;  2F33 A;  3VRN A;  2BKI B;  3NSI A;  3BJH A;  1J55 A;  4OVN F;  1XK4 C;  1DGV A;  2KDH A;  2KQY A;  2MBX A;  1AHR A;  3OP0 A;  1OW4 A;  2JPO A;  5F6T A;  1MUX A;  1C3Z A;  2AUC A;  1OZO A;  2M49 B;  1TWO A;  2JXC A;  1XFR A;  3BFH A;  1N65 A;  1WRZ A;  2LC5 A;  1XFZ O;  1LIN A;  1UHN A;  3I5I C;  1ZAC A;  5FI7 A;  1PSB A;  2KNE A;  3K21 A;  3PJI A;  1NCZ A;  4Q04 A;  1NSH A;  4PE4 A;  1NUB A;  4GGN A;  1QJT A;  3D0Y A;  3UNW A;  1B8L A;  2KPH A;  4I5J A;  5IBW A;  5K89 A;  4N1G A;  5G08 A;  2A4J A;  3BUN B;  1F71 A;  1SK6 D;  1QIW A;  2LMT A;  5J3X A;  1JFJ A;  3KEV A;  1XFX O;  5B8I B;  4MVF A;  3B6X A;  2BBM A;  2MRD A;  4PT1 A;  2K2A A;  1ALW A;  3DF0 A;  1PK0 D;  3DXL A;  4MEW A;  1PSR A;  4HSZ A;  4C0L A;  2BL0 B;  4I5N B;  2O5G A;  3RLZ A;  1NX1 A;  1K9K A;  2LHI A;  2SAS A;  2Y5I A;  3IVT A;  3I5H B;  3QME A;  2L4H A;  3BOW B;  1BOD A;  3DVE A;  3OX6 A;  1F55 A;  1ZUZ A;  2MAZ A;  1NX3 A;  2L50 A;  1CLL A;  1MWN A;  3PSR A;  2LMV A;  1XA5 A;  3EK7 A;  3D74 A;  4M2Q A;  3TUY C;  2Y4Q A;  3TZ1 A;  1H4B A;  5CSJ A;  3TDZ A;  2K7D A;  2JUL A;  3D77 A;  1A75 B;  2QPT A;  3QRX A;  3CR4 X;  4QJ5 B;  2KOT A;  1WDC B;  2MLE C;  2JQ6 A;  1G4Y R;  1UP5 A;  3SS5 A;  1TIZ A;  1YX8 A;  2MA2 A;  1KK8 B;  2ZRT A;  3DVK A;  4HRE E;  1A2X A;  1KK7 Y;  1MR8 A;  2EHB A;  1QX2 A;  2M3W A;  1YRU B;  2F2P A;  2CBL A;  2KLD A;  2KHN A;  3DY9 A;  4IL1 A;  5I2L A;  3K1E A;  4FQO A;  2JWW A;  1TOP A;  4MLW A;  3I5F C;  1CFF A;  2BE4 A;  2LCP A;  1QAS A;  2P70 A;  2JT8 A;  2WCK A;  2QAC A;  3SIA A;  4P2Y B;  1TCO B;  3EK8 A;  1GJY A;  1NCX A;  3VRR A;  1BOC A;  3DD4 A;  1J1D A;  1XYD A;  3ZNI A;  1RWY A;  2K61 A;  1CDN A;  3ICB A;  3BFA A;  1SMG A;  3NXA A;  1S1E A;  3N7H A;  3EVV A;  1YR5 A;  1AUI B;  4MZL A;  1V1G A;  1MHO A;  3TDI A;  2WC6 A;  5AEQ A;  2NCP A;  3PM2 A;  2KI4 C;  4P5O E;  1WRL A;  3SG2 A;  1JFK A;  1AK8 A;  1YUU A;  4R1E A;  2M7L A;  1BG1 A;  1XVJ A;  3GK1 A;  1UHH A;  2NXQ A;  3S0B A;  1F70 A;  4MZJ A;  1KCY A;  5CSI A;  2FOT A;  1QVI Z;  4OZD A;  1J7P A;  1SL9 A;  2FCE A;  2Q91 A;  2JXL A;  1NYA A;  1UUR A;  2F3Y A;  2LAN A;  4PHK A;  1QS7 A;  4OV2 A;  1R6P A;  5FI2 A;  1J1E A;  3L4A A;  1IH0 A;  2BCA A;  5FI6 A;  5I2Q A;  1K95 A;  1A4P A;  1DJW A;  1S5G Z;  1WRK A;  2WND A;  4JWQ A;  2PAS A;  1TNW A;  2GTE A;  3R72 A;  5AER A;  2BEC A;  1DF0 B;  2KSP A;  1OSA A;  1RRO A;  1B47 A;  2WC5 A;  3FWC A;  3JVT B;  3LL8 B;  2FJU B;  2EC6 B;  3FIA A;  1CFC A;  2QEB A;  4PE0 A;  5ER4 X;  3VGO A;  1W7J B;  2ZRS A;  4U8D A;  4GFT A;  1XO5 A;  4BY5 A;  3HCM A;  2P71 A;  1UUS A;  2SCP A;  3I5G B;  3CWG A;  5HKY A;  2I94 A;  1UWO A;  2NLN A;  3UO9 A;  1Y1A A;  3AAJ A;  4ZCU A;  1ZMZ A;  3B88 A;  1GM0 A;  1Y0V H;  3S0F A;  1QLS A;  1XFU O;  2OTG B;  4MSP A;  5KSZ A;  1D1O A;  3A4U B;  4MRX A;  1DF0 A;  1EXR A;  3OB1 B;  2E6W A;  4NQG A;  4ORC B;  3CR2 A;  4C0J A;  1GQM A;  2H8V A;  5D69 A;  1K9U A;  2G2B A;  2QEH A;  2L2E A;  1QLK A;  2WCB A;  1YX7 A;  1QV1 A;  1QX5 B;  1C7W A;  1UHJ A;  2VRG A;  1JBA A;  3TS5 B;  5I94 A;  3CZT X;  4UPG A;  1YUS A;  3CTN A;  4USL A;  3DZT A;  1KQM C;  1K8U A;  1L2O C;  1OZS A;  2L51 A;  2CCM A;  1NX0 A;  2LVK A;  1W7I B;  4YBH B;  3VB1 A;  2IS9 A;  4JPZ B;  1XFW O;  4YGA A;  5FYX A;  1NWD A;  3C1V A;  1JWD A;  3VRO A;  1JF0 A;  1CDP A;  3O2P A;  1CMG A;  1AVS A;  1LA0 A;  2LP3 A;  1VRK A;  1C7V A;  2BAP A;  2HQW A;  1EG4 A;  2QEO A;  2WC8 A;  4CLN A;  2LUC A;  1G33 A;  1G8I A;  1L7Z A;  2LHL A;  4PE7 A;  2GV5 A;  2M7N A;  1DC1 A;  2ZNE A;  2K0J A;  1DJX A;  1M31 A;  4NDB A;  3SJS A;  3F45 A;  4NDD A;  1Y1U A;  2ISD A;  4YRU A;  2F8P A;  3LLE A;  1REC A;  1SCM B;  2KYC A;  2H61 A;  5ER5 A;  1FPW A;  1K96 A;  2KI6 D;  1S3P A;  2O60 A;  1S36 A;  2Y1N A;  1DMO A;  1R2U A;  1SR6 B;  1CMF A;  1DEL A;  1TUZ A;  3I5G C;  3L4L A;  5CSN A;  2JOJ A;  5D7F A;  4YGE B;  4PHM A;  3SIB A;  2KFF A;  2PRU A;  2CNP A;  2M97 A;  2WOS A;  2K2F A;  1YVL A;  3FS7 A;  1SSE B;  1OMV A;  1KWO B;  2BBN A;  1SNL A;  2ERB A;  3PLF B;  2MLF C;  2PAL A;  1K93 D;  5DKN A;  1SW8 A;  2KAV A;  3D76 A;  3JTD C;  4PHJ A;  2WCJ A;  3EK4 A;  1IKU A;  2K7C A;  2OPO A;  3BYA A;  1ALV A;  1LA3 A;  1QXP A;  2BNX A;  4KYN A;  1CDM A;  1BMO A; 
#chains in the Genus database with same CATH homology
 4HRG A;  3BOW A;  2ZKM X;  2Y1M A;  1BLQ A;  1JC2 A;  2H61 C;  3CR5 X;  4F0Z B;  5HLO A;  4GUK A;  1WLM A;  1A29 A;  1DJH A;  3AKB A;  2F2O A;  1C07 A;  1IG5 A;  2KAX A;  1NP8 A;  1S26 D;  1MQ1 A;  1A75 A;  2MJW B;  1MXE A;  3KO0 A;  5I8N A;  1CNP A;  1OQP A;  1J7Q A;  1S6C A;  1PVA A;  1XFY O;  3LCP C;  1BR4 B;  1EG3 A;  1CKK A;  3PN7 B;  4CPV A;  1HQV A;  5CSF A;  1GGZ A;  1PVB A;  4CFQ A;  2BKH B;  2I2R E;  3SG4 A;  1DTL A;  2LE9 B;  2LLT A;  1EL4 A;  1K94 A;  4GAO A;  1U5I B;  2LVI A;  4YI8 A;  4DRW A;  3GOF A;  4NDC A;  3BUX B;  1F8H A;  1N2D A;  3O78 A;  1FI6 A;  3H4S E;  2BL0 C;  4DCK A;  1YUR A;  2KBI A;  1MXL C;  3OHM B;  5HKZ A;  3HX4 A;  3I5H C;  4I5K A;  3DVM A;  4WRI A;  4PAL A;  1QTX A;  1SPY A;  4ZCV A;  1B1G A;  1MF8 B;  2PSR A;  2HQ8 A;  4XJK B;  3TDU A;  4AQI A;  2WCE A;  3PFV A;  1WDC C;  2KGR A;  4DIR A;  1M39 A;  1NIW A;  1YTZ C;  2ZN9 A;  1CTR A;  1KK8 C;  3BUO B;  2M1U A;  2G9B A;  2COL B;  5DKQ A;  3BUW B;  1CM4 A;  1XFV O;  2GGM A;  1IQ3 A;  1SYM A;  1RFJ A;  1SBJ A;  2JT3 A;  1B8R A;  4DUQ A;  2ZFD A;  1BT6 A;  1CLB A;  3I5I B;  3BXK A;  3SG3 A;  3WHU B;  2H2K A;  2ZND A;  3ZWH A;  1J7R A;  1FF1 A;  4WQ3 A;  3IQQ A;  1ZFS A;  1E8A A;  1Y6W A;  1EJ3 A;  4C0K A;  3O6B A;  2JU0 A;  1ZOT B;  1TNQ A;  2KI6 C;  2L4I A;  3MSE B;  1LXF C;  1TRF A;  1LKJ A;  1WY9 A;  1YVH A;  2M1K B;  5JOL A;  1IJ6 A;  5CPV A;  4N5X A;  1RJV A;  4PHN A;  2BE6 A;  2D8N A;  2L5X B;  3EKH A;  3PM8 A;  2R2I A;  4MN0 A;  1SL7 A;  2LUX A;  2I7A A;  1NX2 A;  1OMD A;  2JZI A;  1SRA A;  3WHT B;  1TNP A;  2KAY A;  2PMY A;  1QVI Y;  3EVR A;  2LMU A;  3TUY B;  1SKT A;  2PVB A;  4PE1 A;  1IWQ A;  1Q80 A;  3IF7 A;  2BCX A;  1LVC D;  1CDL A;  3CLN A;  1IQ5 A;  4OCI A;  2LNK A;  1DJY A;  1KK7 Z;  5JJG A;  1KSO A;  1SL8 A;  1WLZ A;  2JNF A;  1PRW A;  3D0Y B;  3KPX A;  1BU3 A;  4M2P A;  1S5G Y;  2L98 A;  3JVT C;  4BY4 A;  2EC6 C;  3I5F B;  1F54 A;  2M29 A;  2NCO A;  1SY9 A;  2Q4U A;  4JQ0 D;  1JSA A;  4M2O A;  4A4B A;  3LK0 A;  1TNX A;  3DF0 B;  4OR9 B;  2GGZ A;  1OOJ A;  4GGF A;  2E30 A;  5AAN A;  3D10 A;  3M0W A;  2LVV A;  2OTG C;  5TNC A;  4AQJ A;  3AAK A;  1UHI A;  2OS8 B;  2AAO A;  1DT7 B;  2RGI A;  3DVJ A;  2JNX A;  1DVI A;  4QJ4 B;  4AOM A;  2KI4 B;  2HF5 A;  5GQQ C;  2FCD A;  4YGD B;  2ZN8 A;  5KU1 A;  1K2H A;  1HT9 A;  2BCB A;  3TS5 C;  1CLM A;  2B1U A;  3KHE A;  2K8M B;  1S6I A;  3BUM B;  1B7T Z;  4YGC B;  3CS1 A;  3WXA A;  2CXJ A;  3CGA A;  5KTY A;  1DJZ A;  1K90 D;  1CB1 A;  2LP2 A;  1J7O A;  3SG5 A;  3E3R A;  4MZK A;  1TCF A;  5AXI A;  1OMR A;  2LLU A;  1TTX A;  3WNX B;  2CTN A;  1YRT B;  1KSM A;  2JTT A;  4TNC A;  1AJ5 A;  4CID A;  4A4C A;  1V1F A;  2KBM A;  4GGF C;  2K7B A;  3NSO A;  3LK1 A;  1CFP A;  1M63 B;  1SCV A;  1OE9 B;  4HRH A;  4ICB A;  2HET A;  1IGV A;  1RK9 A;  3A8R A;  2F3Z A;  1K9P A;  1B8C A;  3BQ3 A;  1H8B A;  1SCM C;  1JUO A;  3EKJ A;  4ETO A;  1PAL A;  4E68 A;  2I18 A;  4GBA A;  1AP4 A;  1FBV A;  1QAT A;  1N0Y A;  1JF2 A;  1A03 A;  1PUL A;  1ODB A;  2P6B B;  2JRF A;  4XYN A;  1SR6 C;  4GPL B;  2JTZ A;  2KGB C;  5HLV A;  5DKR A;  3VRP A;  2EGD A;  2LV7 A;  5HYD A;  1GGW A;  2DOQ A;  3GK2 A;  2JC2 A;  4OKH A;  5AFP A;  3O4Y A;  4WQ2 A;  2OS8 C;  1KWO C;  2V53 A;  5PAL A;  5BPJ A;  5I2O A;  1F4O A;  1IJ5 A;  1RTP 1;  1U5I A;  2JT0 A;  4MRY A;  2LVJ A;  2KFH A;  1DJI A;  3GK4 X;  2LAP A;  2CT9 A;  3OB2 B;  1KQM B;  1L2O B;  1F4Q A;  4CFR A;  2NZ0 A;  1DJG A;  2WOR A;  3PAT A;  5HKW A;  1B7T Y;  1IRJ A;  3OX5 A;  2HPS A;  4XJK A;  4YI9 A;  4ORA B;  4GNK B;  1CM1 A;  2M9G A;  1KFU S;  4MBE A;  4D1E A;  1X02 A;  3PN7 C;  2M8U A;  1XK4 A;  1KFX S;  2KYF A;  3EVU A;  3PAL A;  3SG7 A;  1M46 A;  1QX7 A;  1CFD A;  1AJ4 A;  1UHK A;  1FW4 A;  1S6J A;  4I5L B;  4YGB B;  1TN4 A;  4L9M A;  4PCW A;  1NCY A;  3KF9 A;  1FI5 A;  3SG6 A;  2M0R A;  2L0P A;  2LLS A;  1Y1X A;  1QV0 A;  1M45 A;  1QIV A;  2KQ6 A;  1BR1 B;  1YUT A;  3NSK A;  1BJF A;  2JPT A;  3AKA A;  1B9A A;  1DGU A;  3IQO A;  2MHH A;  1KFU L;  1EH2 A;  2LM5 A;  4PDZ A;  1BF5 A;  2K7O A;  4FTG A;  3NSL A;  1KFX L;  3FWB A;  3RM1 A;  2KFG A;  1B4C A;  1NPQ A;  3JTD B;  2TN4 A;  2WCF A;  3VRQ A;  4DS7 A;  1KQV A;  4ORB B;  4QJ3 B;  4N1F A;  2AMI A;  2F33 A;  3VRN A;  2BKI B;  3NSI A;  2MBX A;  1J55 A;  4OVN F;  1XK4 C;  1DGV A;  2KDH A;  2KQY A;  1AHR A;  3OP0 A;  5F6T A;  1MUX A;  2AUC A;  1OZO A;  2M49 B;  2JXC A;  1N65 A;  1WRZ A;  2LC5 A;  1XFZ O;  1LIN A;  1UHN A;  3I5I C;  1ZAC A;  1PSB A;  2KNE A;  3K21 A;  1NCZ A;  4Q04 A;  1NSH A;  4PE4 A;  1NUB A;  4GGN A;  1QJT A;  3D0Y A;  1B8L A;  4I5J A;  5IBW A;  5K89 A;  4N1G A;  5G08 A;  2A4J A;  3BUN B;  1F71 A;  1SK6 D;  1QIW A;  2LMT A;  5J3X A;  1JFJ A;  3KEV A;  1XFX O;  5B8I B;  4MVF A;  2BBM A;  2MRD A;  2K2A A;  1ALW A;  3DF0 A;  1PK0 D;  4MEW A;  4C0L A;  1PSR A;  4HSZ A;  2BL0 B;  4I5N B;  2O5G A;  3RLZ A;  1NX1 A;  1K9K A;  2LHI A;  2SAS A;  2Y5I A;  3I5H B;  2L4H A;  3BOW B;  1BOD A;  3DVE A;  3OX6 A;  1F55 A;  1ZUZ A;  2MAZ A;  1NX3 A;  2L50 A;  1CLL A;  1MWN A;  3PSR A;  2LMV A;  1XA5 A;  3EK7 A;  3TUY C;  4M2Q A;  2Y4Q A;  3TZ1 A;  1H4B A;  5CSJ A;  3TDZ A;  2K7D A;  2JUL A;  4QJ5 B;  1A75 B;  2QPT A;  3QRX A;  3CR4 X;  2KOT A;  1WDC B;  2MLE C;  2JQ6 A;  1G4Y R;  1UP5 A;  1TIZ A;  1YX8 A;  2MA2 A;  1KK8 B;  2ZRT A;  3DVK A;  4HRE E;  1A2X A;  1KK7 Y;  1MR8 A;  2EHB A;  1QX2 A;  2M3W A;  1YRU B;  2F2P A;  2CBL A;  2KHN A;  4IL1 A;  5I2L A;  4FQO A;  2JWW A;  1TOP A;  4MLW A;  3I5F C;  1CFF A;  2BE4 A;  2LCP A;  1QAS A;  2JT8 A;  2QAC A;  3SIA A;  4P2Y B;  1TCO B;  3EK8 A;  1GJY A;  1NCX A;  3VRR A;  1BOC A;  3DD4 A;  1J1D A;  1XYD A;  3ZNI A;  1RWY A;  2K61 A;  1CDN A;  3ICB A;  1SMG A;  3NXA A;  1S1E A;  3EVV A;  1YR5 A;  1AUI B;  4MZL A;  1V1G A;  1MHO A;  3TDI A;  5AEQ A;  2NCP A;  2KI4 C;  4P5O E;  1WRL A;  3SG2 A;  1JFK A;  1AK8 A;  1YUU A;  4R1E A;  2M7L A;  1BG1 A;  1XVJ A;  3GK1 A;  1UHH A;  2NXQ A;  1F70 A;  4MZJ A;  1KCY A;  5CSI A;  2FOT A;  1QVI Z;  1J7P A;  1SL9 A;  2FCE A;  2Q91 A;  2JXL A;  1NYA A;  1UUR A;  2F3Y A;  2LAN A;  4PHK A;  1QS7 A;  4OV2 A;  1R6P A;  1J1E A;  1IH0 A;  2BCA A;  5I2Q A;  1K95 A;  1A4P A;  1DJW A;  1S5G Z;  1WRK A;  2WND A;  4JWQ A;  2PAS A;  1TNW A;  5AER A;  2BEC A;  1DF0 B;  2KSP A;  1OSA A;  1RRO A;  1B47 A;  3FWC A;  3LL8 B;  3JVT B;  2FJU B;  2EC6 B;  3FIA A;  1CFC A;  4PE0 A;  5ER4 X;  3VGO A;  1W7J B;  2ZRS A;  4U8D A;  4GFT A;  1XO5 A;  4BY5 A;  3HCM A;  1UUS A;  2SCP A;  3I5G B;  3CWG A;  5HKY A;  2I94 A;  1UWO A;  2NLN A;  1Y1A A;  3AAJ A;  4ZCU A;  1ZMZ A;  1Y0V H;  1QLS A;  1XFU O;  2OTG B;  4MSP A;  5KSZ A;  1D1O A;  3A4U B;  4MRX A;  1DF0 A;  1EXR A;  3OB1 B;  2E6W A;  4NQG A;  4ORC B;  3CR2 A;  4C0J A;  1GQM A;  5D69 A;  1K9U A;  2G2B A;  2L2E A;  1QLK A;  2WCB A;  1YX7 A;  1QV1 A;  1QX5 B;  1C7W A;  1UHJ A;  2VRG A;  1JBA A;  3TS5 B;  3CZT X;  4UPG A;  1YUS A;  3CTN A;  4USL A;  1KQM C;  1K8U A;  1L2O C;  1OZS A;  2L51 A;  2CCM A;  1NX0 A;  2LVK A;  1W7I B;  4YBH B;  2IS9 A;  4JPZ B;  1XFW O;  4YGA A;  5FYX A;  1NWD A;  3C1V A;  1JWD A;  3VRO A;  1JF0 A;  1CDP A;  3O2P A;  1CMG A;  1AVS A;  1LA0 A;  2LP3 A;  1VRK A;  1C7V A;  2HQW A;  1EG4 A;  2WC8 A;  4CLN A;  2LUC A;  1G33 A;  1G8I A;  1L7Z A;  2LHL A;  4PE7 A;  2GV5 A;  2M7N A;  2ZNE A;  2K0J A;  1DJX A;  1M31 A;  4NDB A;  3SJS A;  3F45 A;  4NDD A;  1Y1U A;  2ISD A;  4YRU A;  2F8P A;  3LLE A;  1REC A;  1SCM B;  2KYC A;  2H61 A;  5ER5 A;  1FPW A;  1K96 A;  2KI6 D;  1S3P A;  2O60 A;  1S36 A;  2Y1N A;  1DMO A;  1R2U A;  1SR6 B;  1CMF A;  3I5G C;  5CSN A;  2JOJ A;  5D7F A;  4YGE B;  4PHM A;  3SIB A;  2KFF A;  2PRU A;  2CNP A;  2M97 A;  2WOS A;  2K2F A;  1YVL A;  3FS7 A;  1OMV A;  1KWO B;  2BBN A;  1SNL A;  3PLF B;  2MLF C;  2PAL A;  1K93 D;  5DKN A;  1SW8 A;  2KAV A;  3JTD C;  4PHJ A;  3EK4 A;  1IKU A;  2K7C A;  2OPO A;  3BYA A;  1ALV A;  1LA3 A;  1QXP A;  1CDM A;  1BMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...