2L98A

Structure of trans-resveratrol in complex with the cardiac regulatory protein troponin c
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure of trans-Resveratrol in Complex with the Cardiac Regulatory Protein Troponin C.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2l98A00
5HKZA 1IJ5A 3JVTC 1UHNA 2L50A 3NSOA 4ETOA 1BT6A 1QV1A 3KO0A 4YBHB 1K93D 2KAVA 2L4HA 1XFUO 1J1DA 1IWQA 1YTZC 1RROA 1JBAA 2KQ6A 2LM5A 1DJZA 2KDHA 1JFJA 1SNLA 2JWWA 4PE4A 4GGNA 2KYFA 3DF0B 4PE7A 4TNCA 1YURA 1AP4A 2M9GA 2COLB 4MVFA 1J7RA 1AJ5A 1SCVA 2LHIA 2CXJA 1DF0A 2JC2A 5J3XA 1Y1XA 3CGAA 3JTDB 1KFUL 1PSBA 1NYAA 4QJ4B 2NCPA 4CIDA 2OS8C 2I94A 1YRTB 3EVUA 3PATA 3ZNIA 1H4BA 2JTTA 1WLZA 2H61A 3SG5A 1DJWA 2SASA 3JVTB 1ALVA 2JTZA 5HKYA 4GAOA 4N1FA 1OMVA 3KHEA 4OCIA 4GFTA 1QS7A 4A4BA 3EK7A 3KPXA 1DJIA 2BBNA 1PRWA 2K7CA 1Y6WA 4YI8A 2LVVA 2A4JA 1CM4A 1L7ZA 1PSRA 1LA0A 5D69A 1CMGA 1SK6D 1J7PA 1BMOA 3BOWA 4OR9B 1YX8A 2KAXA 3D0YB 1J55A 2NLNA 3FS7A 1GJYA 2K2AA 1GGWA 1SL7A 3EVVA 5HLOA 2MA2A 4FQOA 1BU3A 1XA5A 1WDCC 4PHJA 3GOFA 1S5GY 1KK8C 1CLMA 2L5XB 1F4QA 3VROA 1K90D 2I18A 4UPGA 3BUMB 4ICBA 1DVIA 2OPOA 1S5GZ 3WHTB 3O6BA 4CLNA 1LKJA 2JZIA 4Q04A 2PALA 1BJFA 3CR2A 2WORA 3AAKA 2LUCA 3GK1A 3LLEA 3TZ1A 1SCMB 3MSEB 4MRYA 1B1GA 2ZN9A 2QACA 1U5IB 1AUIB 1M46A 1RECA 3D10A 1CLBA 1RWYA 1Y1UA 1CTRA 2M1UA 2PASA 2F2OA 1OQPA 1F4OA 1YRUB 1DJHA 3IF7A 1A2XA 1CMFA 1BR4B 2M7NA 3SJSA 1MWNA 1SR6C 2NCOA 1L2OB 2JT0A 5I8NA 1A75B 3I5GB 1ZMZA 2M3WA 2NXQA 4NQGA 3TUYC 2JT8A 4YGDB 2BCXA 3BXKA 3FIAA 1PVBA 3GK4X 1QIVA 1X02A 1DMOA 1JF2A 3PFVA 3FWBA 2KI4B 5K89A 3AKBA 1YUUA 2Y5IA 4BY5A 2VRGA 4JQ0D 1SY9A 1B47A 2KNEA 3FWCA 3OB2B 2NZ0A 1K9UA 1NX3A 2GGZA 1TNXA 3AKAA 1XFYO 4PALA 3CS1A 1J7QA 3QRXA 2KOTA 1KCYA 1Y1AA 3IQQA 2L0PA 1R2UA 1FW4A 1EL4A 1ZFSA 1Q80A 2LMVA 2MJWB 2Q91A 2BKIB 1NP8A 1DGVA 3OX5A 3LK1A 2JULA 2LLSA 1XK4C 1EJ3A 2F3ZA 5D7FA 3BQ3A 5I2QA 3DVJA 2SCPA 3K21A 1WRKA 1HT9A 1KFXS 1OMRA 2JNXA 3H4SE 4I5KA 3C1VA 1TIZA 4MZJA 3I5HC 5JJGA 1BLQA 1YUTA 2BCAA 2KYCA 3TDUA 1AHRA 1G8IA 2G2BA 3DVMA 2KQYA 4GGFC 4MZKA 1DF0B 1CLLA 2KFHA 4OV2A 2M1KB 4HRHA 1LA3A 2LAPA 2V53A 3HCMA 4OKHA 2ISDA 1S26D 1MF8B 1OMDA 1G4YR 1VRKA 1SL8A 3SIAA 2EGDA 4YI9A 1F70A 1CDMA 1OSAA 4GUKA 1PK0D 5ER4X 1TCOB 4GBAA 4BY4A 1KWOB 2CT9A 2MLEC 1S6CA 1JUOA 3CR4X 2WCBA 3DVKA 1BG1A 1UHHA 3O4YA 1S6IA 3PLFB 1NPQA 2EC6C 1K95A 5KSZA 4M2PA 2LP2A 3RM1A 2KAYA 4AQJA 1CDNA 3WNXB 3I5FB 1XO5A 1CNPA 2K7BA 1AK8A 2LNKA 5AFPA 1A03A 2OTGC 2E30A 1BODA 1XFXO 4DCKA 3SG6A 1ODBA 3KF9A 1HQVA 2ZRSA 1XK4A 2KBIA 1SPYA 1M31A 2WCFA 3PSRA 1RK9A 3NSKA 4USLA 4OVNF 4ORBB 1YVLA 2BBMA 1BOCA 1OZSA 3CLNA 1YVHA 5F6TA 2BL0C 3KEVA 1J1EA 3PN7C 1S36A 3VRRA 4XJKA 4PHMA 1EG3A 2KBMA 1K8UA 3GK2A 3TS5C 4F0ZB 3CTNA 4GGFA 4P5OE 1K2HA 2IS9A 2EC6B 1WLMA 2F33A 3DF0A 1SW8A 1QLKA 1XFZO 4YGBB 1B8RA 2OS8B 1JF0A 1IRJA 4M2OA 1UURA 1NIWA 2BECA 2LVIA 3I5IC 1F54A 5CSFA 1QJTA 1IH0A 1TNQA 4NDBA 1XFVO 1NSHA 2M49B 1AJ4A 2WNDA 2LLTA 2LVJA 5AXIA 4NDDA 4ZCVA 1K94A 3VRNA 1UHIA 4ORAB 3AAJA 1DGUA 1LINA 1QASA 2HF5A 1QATA 1KQVA 4PHKA 2LUXA 4MLWA 1CFCA 2JOJA 1FBVA 2I7AA 1RFJA 1V1FA 1RJVA 3A8RA 4HRGA 1CFPA 2KSPA 1UUSA 5TNCA 1IQ5A 1KQMC 1B8LA 2CCMA 4FTGA 1QIWA 2F3YA 1MUXA 1TN4A 1W7JB 1WDCB 2CTNA 1JC2A 1KK8B 4I5LB 1OZOA 1B7TZ 5GQQC 2PRUA 1PALA 1TNPA 2LC5A 2WC8A 3CR5X 4PDZA 4PE1A 3CWGA 5BPJA 1D1OA 1LVCD 1N0YA 4U8DA 2LP3A 1F71A 3EK8A 2HQ8A 2D8NA 1TCFA 3F45A 2MHHA 2ZKMX 2JT3A 5DKRA 3SG4A 5KTYA 2BE4A 1MXEA 1QX2A 1B8CA 1N2DA 3BUNB 2MLFC 2LE9B 1M63B 2O5GA 4AQIA 1F55A 1TRFA 4YRUA 2KHNA 2L2EA 2JU0A 3DD4A 1N65A 2AMIA 1DJGA 4DUQA 1CDLA 1IJ6A 1SR6B 2L98A 2LMUA 2LANA 2LVKA 1A29A 2Y4QA 1CKKA 1B4CA 4XYNA 4PHNA 3TUYB 4QJ5B 3O78A 2BKHB 1KFXL 1MHOA 2KFGA 3NXAA 5HYDA 1OE9B 2HETA 1CDPA 1NUBA 2JPTA 2ZRTA 3PM8A 4AOMA 4HREE 4GNKB 2G9BA 1QXPA 1DJYA 1M45A 4C0KA 1MR8A 2L4IA 3VGOA 1BR1B 3EK4A 2K7OA 2ZNDA 4NDCA 2AAOA 2ZNEA 3JTDC 4MBEA 2HQWA 4CPVA 4QJ3B 2Y1MA 1QLSA 5AERA 3BUWB 4MEWA 1QX7A 5KU1A 2Q4UA 3EKHA 2KGBC 4ORCB 3SG2A 2WCEA 4N1GA 5IBWA 1LXFC 2ZFDA 5AANA 2JQ6A 1V1GA 4DIRA 3IQOA 3I5HB 1QX5B 4GPLB 5AEQA 2JRFA 2O60A 2BE6A 1PVAA 1QVIY 1NWDA 4JPZB 1M39A 1TTXA 4L9MA 4XJKB 1J7OA 1B9AA 2ZN8A 3BOWB 2K2FA 1QVIZ 2DOQA 5DKNA 4ZCUA 1AVSA 1EG4A 2PSRA 1YUSA 1NX1A 2WOSA 1CFDA 1KFUS 3PALA 3BUXB 1KK7Y 4E68A 2FCDA 1WY9A 1SKTA 1SYMA 4HSZA 1KK7Z 1NCYA 3E3RA 4MRXA 5DKQA 1WRZA 5CSJA 3NSIA 4WQ3A 1TNWA 2Y1NA 1W7IB 4I5JA 3TDIA 4CFQA 3DVEA 4WQ2A 2LV7A 2RGIA 2M8UA 2M0RA 5JOLA 1OOJA 5ER5A 1A4PA 3EKJA 4MZLA 2JXCA 5I2LA 3SG7A 1FPWA 5CPVA 1SCMC 2K8MB 1G33A 2H2KA 4DRWA 1S3PA 2OTGB 1CM1A 2LLUA 5CSIA 5CSNA 1CFFA 2K0JA 1MXLC 3HX4A 3O2PA 4N5XA 1DT7B 1NCXA 1E8AA 3ICBA 5HKWA 1C7WA 1SMGA 4I5NB 4R1EA 3RLZA 2BL0B 1R6PA 5G08A 2I2RE 2KFFA 3PN7B 4M2QA 1Y0VH 4C0LA 3ZWHA 3WXAA 1ZOTB 1L2OC 3TS5B 1FI6A 1XYDA 2KI6D 3SG3A 3I5GC 1KSMA 1K96A 1YR5A 2EHBA 3LL8B 1H8BA 2MAZA 1FI5A 3OHMB 1B7TY 2F8PA 1CB1A 1S1EA 2KI4C 1UWOA 2FCEA 4YGAA 5HLVA 4DS7A 1QV0A 2R2IA 1UP5A 2HPSA 3D0YA 3OP0A 4JWQA 4YGCB 3VRPA 2TN4A 3M0WA 4YGEB 3I5IB 4D1EA 1UHKA 4MSPA 2GGMA 1IGVA 1FF1A 1SBJA 1XFWO 1SL9A 3CZTX 2JXLA 4PE0A 2K61A 1K9PA 2LMTA 3VRQA 4C0JA 2M29A 3OB1B 5I2OA 1IKUA 1S6JA 2KI6C 3EVRA 1WRLA 2M97A 1EXRA 3BYAA 1F8HA 1JWDA 1U5IA 2CBLA 2FOTA 1NCZA 2LCPA 2B1UA 2BCBA 1KSOA 2QPTA 1XVJA 2E6WA 3LK0A 1ZACA 1JSAA 1KQMB 2KGRA 3OX6A 1C07A 1K9KA 4IL1A 5B8IB 1IQ3A 2CNPA 1YX7A 4WRIA 4A4CA 2K7DA 2P6BB 3BUOB 3A4UB 2LHLA 1GQMA 1SRAA 1NX0A 1DJXA 2PVBA 3TDZA 2L51A 1ALWA 1A75A 1JFKA 2AUCA 2H61C 2FJUB 2MRDA 1C7VA 5PALA 1KWOC 2M7LA 2JNFA 5FYXA 4CFRA 3SIBA 1MQ1A 2F2PA 3WHUB 1EH2A 4PCWA 1PULA 1NX2A 1RTP1 3LCPC 1UHJA 1DTLA 1TOPA 1ZUZA 3NSLA 1BF5A 3I5FC 1IG5A 2MBXA 4P2YB 1GGZA 1QTXA 4MN0A 2PMYA 2GV5A
chains in the Genus database with same CATH superfamily
5HKZA 1IJ5A 3JVTC 1UHNA 2L50A 3NSOA 4ETOA 1BT6A 1ORGA 1QV1A 3BFBA 3KO0A 4YBHB 1K93D 2KAVA 2L4HA 1XFUO 1J1DA 1IWQA 1YTZC 1RROA 1JBAA 2KQ6A 2LM5A 1DJZA 2KDHA 1JFJA 1SNLA 2JWWA 4PE4A 4GGNA 2KYFA 3DF0B 4PE7A 4TNCA 1YURA 1AP4A 2M9GA 2COLB 4MVFA 1TWOA 1J7RA 1AJ5A 2GTEA 1SCVA 2LHIA 2CXJA 1DF0A 2JC2A 5J3XA 1Y1XA 3CGAA 3CZ1A 3JTDB 1KFUL 1PSBA 1NYAA 3BFAA 4QJ4B 2NCPA 4CIDA 2OS8C 3CYZA 2I94A 1YRTB 3EVUA 3PATA 3ZNIA 1H4BA 2JTTA 1WLZA 2H61A 5HL1A 3SG5A 1DJWA 2SASA 3JVTB 1ALVA 2JTZA 2K60A 5HKYA 4GAOA 4N1FA 1OMVA 3KHEA 3SS3A 2KLEA 4OCIA 4GFTA 1QS7A 4A4BA 5D3OA 3EK7A 3KPXA 1DJIA 2BBNA 1PRWA 2K7CA 1TUZA 1Y6WA 4YI8A 2LVVA 3QMEA 2A4JA 1CM4A 1L7ZA 1PSRA 1OW4A 1LA0A 5D69A 1CMGA 1SK6D 3EG5B 1J7PA 1BMOA 3BOWA 4OR9B 1YX8A 2KAXA 2QEVA 1J55A 2NLNA 3D0YB 3FS7A 2WCKA 1GJYA 2K2AA 3FE9A 1SL7A 1GGWA 3EVVA 5HLOA 2MA2A 4FQOA 1BU3A 1XA5A 1WDCC 4PHJA 3GOFA 1S5GY 1KK8C 1CLMA 2L5XB 1F4QA 3VROA 1K90D 2I18A 4UPGA 3BUMB 4ICBA 1DVIA 2OPOA 3R72A 1S5GZ 3WHTB 3O6BA 4CLNA 1LKJA 2JZIA 2WCMA 4Q04A 2PALA 1BJFA 3CR2A 2WORA 1SSEB 2LUCA 2WCHA 3AAKA 3GK1A 1SCMB 3CABA 3MSEB 4MRYA 3SS5A 2ZN9A 3TZ1A 2QACA 1U5IB 1AUIB 1M46A 1RECA 3D10A 2H8VA 1RWYA 2L2CA 3IVTA 1CLBA 1Y1UA 1CTRA 2M1UA 2PASA 2F2OA 1OQPA 1F4OA 1YRUB 1DJHA 3IF7A 1A2XA 1CMFA 1BR4B 1P28A 2M7NA 3SJSA 1MWNA 1SR6C 2NCOA 1L2OB 1OOIX 2JT0A 3FE8A 5I8NA 1A75B 3I5GB 3UO9A 1ZMZA 2M3WA 2NXQA 4NQGA 3TUYC 2JT8A 4YGDB 2BCXA 3BXKA 3FIAA 1PVBA 3GK4X 1QIVA 1X02A 3FE6A 1JF2A 3PFVA 3FWBA 2KI4B 5K89A 3AKBA 1DMOA 1YUUA 2Y5IA 4BY5A 2VRGA 1C3YA 4JQ0D 1SY9A 4OZDA 1B47A 3VB1A 2KNEA 3FWCA 3OB2B 2NZ0A 3V2LA 1K9UA 1NX3A 2GGZA 1TNXA 3AKAA 1XFYO 4PALA 3CS1A 1J7QA 2BAPA 3QRXA 2KOTA 1KCYA 1Y1AA 3IQQA 3BFHA 2L0PA 1R2UA 1FW4A 1EL4A 1ZFSA 1Q80A 2LMVA 2MJWB 2Q91A 2BKIB 1NP8A 1DGVA 1Z4HA 3OX5A 3LK1A 2JULA 2LLSA 1XK4C 1EJ3A 2F3ZA 5D7FA 3BQ3A 5I2QA 3DVJA 2SCPA 2QEOA 1WRKA 1HT9A 3K21A 1KFXS 1OMRA 2JNXA 3H4SE 4I5KA 3C1VA 1TIZA 4MZJA 3I5HC 5JJGA 1BLQA 1YUTA 2BCAA 2KYCA 3TDUA 1AHRA 1G8IA 2G2BA 3DVMA 2KQYA 4GGFC 4MZKA 1DF0B 1DC1A 1CLLA 2KFHA 4OV2A 2M1KB 4HRHA 2QDIA 1LA3A 2LAPA 2V53A 3HCMA 4OKHA 2ISDA 1S26D 1MF8B 1OMDA 1G4YR 3OGNA 1VRKA 1SL8A 4INXA 3SIAA 2EGDA 4YI9A 3L4AA 1F70A 1CDMA 1B1GA 1OSAA 4GUKA 1PK0D 5ER4X 1TCOB 4GBAA 4BY4A 1KWOB 2CT9A 2MLEC 1S6CA 1JUOA 3CR4X 2WCBA 3B86A 3DVKA 1BG1A 1DQEA 1UHHA 3O4YA 1S6IA 3PLFB 1NPQA 2EC6C 1K95A 5KSZA 4M2PA 2LP2A 2JPOA 3RM1A 2KAYA 2WC6A 4AQJA 1CDNA 3WNXB 3I5FB 1XO5A 1CNPA 2K7BA 1AK8A 2LNKA 5AFPA 1A03A 2OTGC 2E30A 1BODA 1XFXO 4DCKA 3SG6A 1ODBA 3KF9A 1HQVA 2ZRSA 1XK4A 2KBIA 1SPYA 1M31A 2WCFA 3S0DA 3PSRA 1RK9A 3NSKA 4USLA 4OVNF 3B7AA 4ORBB 1YVLA 2BBMA 1BOCA 1OZSA 3CLNA 1YVHA 5F6TA 2BL0C 3KEVA 2BNXA 1J1EA 3PN7C 1S36A 3VRRA 4XJKA 4PHMA 1EG3A 2KBMA 1K8UA 3GK2A 3TS5C 4F0ZB 3CTNA 3K1EA 4GGFA 4P5OE 5FI2A 1K2HA 2IS9A 2EC6B 2QEBA 1WLMA 2F33A 3DF0A 1SW8A 1C3ZA 1QLKA 1XFZO 4YGBB 1B8RA 2OS8B 3R1VA 1JF0A 1IRJA 4M2OA 1UURA 4JD9A 1NIWA 3S0GA 2BECA 2LVIA 3I5IC 1F54A 5CSFA 1QJTA 1IH0A 1TNQA 3N7HA 4NDBA 5I94A 1XFVO 1NSHA 4FQTA 2QEHA 2M49B 1AJ4A 2WNDA 2LLTA 2LVJA 5AXIA 4NDDA 4ZCVA 1K94A 3VRNA 1UHIA 4ORAB 3AAJA 1DGUA 1LINA 1QASA 2HF5A 1QATA 1KQVA 4PHKA 2LUXA 4MLWA 1CFCA 2JOJA 1FBVA 2I7AA 1RFJA 1V1FA 1RJVA 3A8RA 1OOGA 4HRGA 1CFPA 2KSPA 1UUSA 5TNCA 1IQ5A 3DXLA 1KQMC 1B8LA 2CCMA 4FTGA 1QIWA 2F3YA 1MUXA 1TN4A 5FI6A 1W7JB 1WDCB 2CTNA 2WCJA 1KK8B 4I5LB 1OZOA 1JC2A 1B7TZ 1T14A 5GQQC 3RZSA 2PYQA 2PRUA 1PALA 1TNPA 2LC5A 2P70A 2WC8A 1W9ZA 3CR5X 4PDZA 4PE1A 3CWGA 5BPJA 1D1OA 1LVCD 1N0YA 3R1PA 4U8DA 2LP3A 3NHTA 1F71A 3EK8A 2HQ8A 2D8NA 1TCFA 3F45A 2MHHA 2WCLA 2JT3A 2ZKMX 1DEKA 5DKRA 3SG4A 2BE4A 1MXEA 5KTYA 1QX2A 1B8CA 1N2DA 3BUNB 2MLFC 2FJYA 2LE9B 1M63B 2O5GA 4AQIA 1F55A 1TRFA 4YRUA 2KHNA 2L2EA 2JU0A 3DD4A 1N65A 2AMIA 1DJGA 4DUQA 1CDLA 1IJ6A 1SR6B 2L98A 2LMUA 2LANA 2LVKA 1A29A 2Y4QA 1CKKA 3SS4A 1B4CA 2YGUA 4XYNA 4PHNA 3TUYB 4QJ5B 3O78A 2BKHB 1KFXL 1MHOA 2KFGA 3NXAA 5HYDA 1OE9B 2HETA 1CDPA 1NUBA 2JPTA 2ZRTA 3PM8A 3D76A 4AOMA 4HREE 3B87A 4GNKB 2G9BA 1QXPA 1DJYA 1M45A 4C0KA 1MR8A 2L4IA 3VGOA 1BR1B 3EK4A 2K7OA 2ZNDA 2ERBA 4NDCA 2AAOA 2ZNEA 3JTDC 4MBEA 2HQWA 4CPVA 4QJ3B 2Y1MA 1QLSA 5AERA 3BUWB 4MEWA 1QX7A 5KU1A 2Q4UA 3EKHA 2KGBC 4ORCB 2PQLA 3SG2A 2WCEA 4N1GA 5IBWA 3L47A 1LXFC 2ZFDA 5AANA 1IIOA 2JQ6A 3O4XA 1V1GA 4DIRA 3IQOA 3I5HB 1QX5B 4GPLB 5AEQA 2JRFA 2O60A 3DZTA 2BE6A 1PVAA 1QVIY 1NWDA 4JPZB 1M39A 1TTXA 4L9MA 4XJKB 1J7OA 1B9AA 2ZN8A 3BOWB 2K2FA 1QVIZ 2DOQA 3L4LA 4INWA 5DKNA 4ZCUA 1AVSA 1EG4A 2PSRA 2WC5A 1Z2CB 1YUSA 1NX1A 2WOSA 5FI7A 1CFDA 1KFUS 3PALA 3BUXB 1KK7Y 4E68A 1GM0A 3CDNA 2FCDA 1WY9A 3D77A 3S0BA 1SKTA 1SYMA 4HSZA 1KK7Z 5EL2A 1OOHA 3LLEA 1NCYA 3E3RA 4MRXA 3CZ2A 1WRZA 2L5YA 3NSIA 4WQ3A 5CSJA 5DKQA 1TNWA 2Y1NA 1W7IB 4I5JA 3TDIA 4CFQA 3DVEA 4WQ2A 2LV7A 2RGIA 3D75A 2M8UA 3Q8IA 3UNWA 2M0RA 5JOLA 1OOJA 5ER5A 1A4PA 3EKJA 4MZLA 2JXCA 5I2LA 3SG7A 1FPWA 3D73A 5CPVA 1SCMC 2K8MB 1G33A 2H2KA 4DRWA 1S3PA 3CZ0A 2OTGB 3DY9A 1CM1A 2LLUA 5CSIA 5CSNA 1CFFA 2K0JA 1OOFA 3S0AA 1MXLC 3HX4A 3O2PA 4N5XA 1DT7B 1NCXA 1E8AA 3S0EA 3ICBA 5HKWA 1C7WA 1SMGA 4I5NB 4R1EA 3RLZA 2BL0B 1R6PA 5G08A 2I2RE 2KFFA 3PN7B 4M2QA 1Y0VH 5DICA 4C0LA 4PT1A 3WXAA 1ZOTB 3ZWHA 1L2OC 3TS5B 1FI6A 1XYDA 2KI6D 3D78A 3SG3A 3I5GC 1KSMA 3PM2A 1K96A 1YR5A 2EHBA 3LL8B 1H8BA 2MAZA 1FI5A 3OHMB 4F7FA 3S0FA 1B7TY 2F8PA 1CB1A 1S1EA 2KI4C 1UWOA 2FCEA 4YGAA 2KPHA 5HLVA 1QV0A 4DS7A 2R2IA 1UP5A 2HPSA 3D0YA 3OP0A 3PJIA 4JWQA 4YGCB 3VRPA 2TN4A 3M0WA 1TUJA 4JKTA 3I5IB 4YGEB 4IJ7A 4D1EA 1UHKA 4KYNA 4MSPA 3D74A 2GGMA 1IGVA 1FF1A 1SBJA 3BJHA 1XFWO 1SL9A 3CZTX 2JXLA 4PE0A 2K61A 1K9PA 2LMTA 3VRQA 4C0JA 2M29A 3OB1B 5I2OA 1IKUA 1S6JA 2KI6C 3EVRA 1WRLA 2M97A 1EXRA 3BYAA 1F8HA 1JWDA 1U5IA 2CBLA 2FOTA 1NCZA 2LCPA 2KLDA 2B1UA 2BCBA 1KSOA 2QPTA 1XVJA 2E6WA 3LK0A 1ZACA 1JSAA 1KQMB 2KGRA 3OX6A 1C07A 1K9KA 4IL1A 5B8IB 1IQ3A 2CNPA 1YX7A 4WRIA 1LS8A 4A4CA 2K7DA 3DYEA 2P71A 1DELA 2P6BB 1XFRA 3BUOB 3A4UB 3OBVA 2LHLA 1GQMA 1SRAA 1NX0A 1DJXA 2PVBA 3TDZA 2L51A 1ALWA 1A75A 1JFKA 2AUCA 3NHIA 2H61C 2FJUB 2MRDA 1C7VA 5PALA 1KWOC 2M7LA 2JNFA 5FYXA 3B88A 4CFRA 3SIBA 1MQ1A 2F2PA 3WHUB 3R1OA 1EH2A 3NGVA 1PULA 1NX2A 1RTP1 4PCWA 3LCPC 1UHJA 1DTLA 1TOPA 1ZUZA 3NSLA 1BF5A 3B6XA 3I5FC 1IG5A 2MBXA 4P2YB 1GGZA 1QTXA 4MN0A 2PMYA 2GV5A 1QWVA
chains in the Genus database with same CATH topology
5HKZA 1IJ5A 3JVTC 1UHNA 2L50A 3NSOA 4ETOA 1BT6A 1QV1A 3KO0A 4YBHB 1K93D 2KAVA 2L4HA 1XFUO 1J1DA 1IWQA 1YTZC 1RROA 1JBAA 2KQ6A 2LM5A 1DJZA 2KDHA 1JFJA 1SNLA 2JWWA 4PE4A 4GGNA 2KYFA 3DF0B 4PE7A 4TNCA 1YURA 1AP4A 2M9GA 2COLB 4MVFA 1J7RA 1AJ5A 1SCVA 2LHIA 2CXJA 1DF0A 2JC2A 5J3XA 1Y1XA 3CGAA 3JTDB 1KFUL 1PSBA 1NYAA 4QJ4B 2NCPA 4CIDA 2OS8C 2I94A 1YRTB 3EVUA 3PATA 3ZNIA 1H4BA 2JTTA 1WLZA 2H61A 3SG5A 1DJWA 2SASA 3JVTB 1ALVA 2JTZA 5HKYA 4GAOA 4N1FA 1OMVA 3KHEA 4OCIA 4GFTA 1QS7A 4A4BA 3EK7A 3KPXA 1DJIA 2BBNA 1PRWA 2K7CA 1Y6WA 4YI8A 2LVVA 2A4JA 1CM4A 1L7ZA 1PSRA 1LA0A 5D69A 1CMGA 1SK6D 1J7PA 1BMOA 3BOWA 4OR9B 1YX8A 2KAXA 3D0YB 1J55A 2NLNA 3FS7A 1GJYA 2K2AA 1GGWA 1SL7A 3EVVA 5HLOA 2MA2A 4FQOA 1BU3A 1XA5A 1WDCC 4PHJA 3GOFA 1S5GY 1KK8C 1CLMA 2L5XB 1F4QA 3VROA 1K90D 2I18A 4UPGA 3BUMB 4ICBA 1DVIA 2OPOA 1S5GZ 3WHTB 3O6BA 4CLNA 1LKJA 2JZIA 4Q04A 2PALA 1BJFA 3CR2A 2WORA 3AAKA 2LUCA 3GK1A 3LLEA 3TZ1A 1SCMB 3MSEB 4MRYA 1B1GA 2ZN9A 2QACA 1U5IB 1AUIB 1M46A 1RECA 3D10A 1CLBA 1RWYA 1Y1UA 1CTRA 2M1UA 2PASA 2F2OA 1OQPA 1F4OA 1YRUB 1DJHA 3IF7A 1A2XA 1CMFA 1BR4B 2M7NA 3SJSA 1MWNA 1SR6C 2NCOA 1L2OB 2JT0A 5I8NA 1A75B 3I5GB 1ZMZA 2M3WA 2NXQA 4NQGA 3TUYC 2JT8A 4YGDB 2BCXA 3BXKA 3FIAA 1PVBA 3GK4X 1QIVA 1X02A 1DMOA 1JF2A 3PFVA 3FWBA 2KI4B 5K89A 3AKBA 1YUUA 2Y5IA 4BY5A 2VRGA 4JQ0D 1SY9A 1B47A 2KNEA 3FWCA 3OB2B 2NZ0A 1K9UA 1NX3A 2GGZA 1TNXA 3AKAA 1XFYO 4PALA 3CS1A 1J7QA 3QRXA 2KOTA 1KCYA 1Y1AA 3IQQA 2L0PA 1R2UA 1FW4A 1EL4A 1ZFSA 1Q80A 2LMVA 2MJWB 2Q91A 2BKIB 1NP8A 1DGVA 3OX5A 3LK1A 2JULA 2LLSA 1XK4C 1EJ3A 2F3ZA 5D7FA 3BQ3A 5I2QA 3DVJA 2SCPA 3K21A 1WRKA 1HT9A 1KFXS 1OMRA 2JNXA 3H4SE 4I5KA 3C1VA 1TIZA 4MZJA 3I5HC 5JJGA 1BLQA 1YUTA 2BCAA 2KYCA 3TDUA 1AHRA 1G8IA 2G2BA 3DVMA 2KQYA 4GGFC 4MZKA 1DF0B 1CLLA 2KFHA 4OV2A 2M1KB 4HRHA 1LA3A 2LAPA 2V53A 3HCMA 4OKHA 2ISDA 1S26D 1MF8B 1OMDA 1G4YR 1VRKA 1SL8A 3SIAA 2EGDA 4YI9A 1F70A 1CDMA 1OSAA 4GUKA 1PK0D 5ER4X 1TCOB 4GBAA 4BY4A 1KWOB 2CT9A 2MLEC 1S6CA 1JUOA 3CR4X 2WCBA 3DVKA 1BG1A 1UHHA 3O4YA 1S6IA 3PLFB 1NPQA 2EC6C 1K95A 5KSZA 4M2PA 2LP2A 3RM1A 2KAYA 4AQJA 1CDNA 3WNXB 3I5FB 1XO5A 1CNPA 2K7BA 1AK8A 2LNKA 5AFPA 1A03A 2OTGC 2E30A 1BODA 1XFXO 4DCKA 3SG6A 1ODBA 3KF9A 1HQVA 2ZRSA 1XK4A 2KBIA 1SPYA 1M31A 2WCFA 3PSRA 1RK9A 3NSKA 4USLA 4OVNF 4ORBB 1YVLA 2BBMA 1BOCA 1OZSA 3CLNA 1YVHA 5F6TA 2BL0C 3KEVA 1J1EA 3PN7C 1S36A 3VRRA 4XJKA 4PHMA 1EG3A 2KBMA 1K8UA 3GK2A 3TS5C 4F0ZB 3CTNA 4GGFA 4P5OE 1K2HA 2IS9A 2EC6B 1WLMA 2F33A 3DF0A 1SW8A 1QLKA 1XFZO 4YGBB 1B8RA 2OS8B 1JF0A 1IRJA 4M2OA 1UURA 1NIWA 2BECA 2LVIA 3I5IC 1F54A 5CSFA 1QJTA 1IH0A 1TNQA 4NDBA 1XFVO 1NSHA 2M49B 1AJ4A 2WNDA 2LLTA 2LVJA 5AXIA 4NDDA 4ZCVA 1K94A 3VRNA 1UHIA 4ORAB 3AAJA 1DGUA 1LINA 1QASA 2HF5A 1QATA 1KQVA 4PHKA 2LUXA 4MLWA 1CFCA 2JOJA 1FBVA 2I7AA 1RFJA 1V1FA 1RJVA 3A8RA 4HRGA 1CFPA 2KSPA 1UUSA 5TNCA 1IQ5A 1KQMC 1B8LA 2CCMA 4FTGA 1QIWA 2F3YA 1MUXA 1TN4A 1W7JB 1WDCB 2CTNA 1JC2A 1KK8B 4I5LB 1OZOA 1B7TZ 5GQQC 2PRUA 1PALA 1TNPA 2LC5A 2WC8A 3CR5X 4PDZA 4PE1A 3CWGA 5BPJA 1D1OA 1LVCD 1N0YA 4U8DA 2LP3A 1F71A 3EK8A 2HQ8A 2D8NA 1TCFA 3F45A 2MHHA 2ZKMX 2JT3A 5DKRA 3SG4A 5KTYA 2BE4A 1MXEA 1QX2A 1B8CA 1N2DA 3BUNB 2MLFC 2LE9B 1M63B 2O5GA 4AQIA 1F55A 1TRFA 4YRUA 2KHNA 2L2EA 2JU0A 3DD4A 1N65A 2AMIA 1DJGA 4DUQA 1CDLA 1IJ6A 1SR6B 2L98A 2LMUA 2LANA 2LVKA 1A29A 2Y4QA 1CKKA 1B4CA 4XYNA 4PHNA 3TUYB 4QJ5B 3O78A 2BKHB 1KFXL 1MHOA 2KFGA 3NXAA 5HYDA 1OE9B 2HETA 1CDPA 1NUBA 2JPTA 2ZRTA 3PM8A 4AOMA 4HREE 4GNKB 2G9BA 1QXPA 1DJYA 1M45A 4C0KA 1MR8A 2L4IA 3VGOA 1BR1B 3EK4A 2K7OA 2ZNDA 4NDCA 2AAOA 2ZNEA 3JTDC 4MBEA 2HQWA 4CPVA 4QJ3B 2Y1MA 1QLSA 5AERA 3BUWB 4MEWA 1QX7A 5KU1A 2Q4UA 3EKHA 2KGBC 4ORCB 3SG2A 2WCEA 4N1GA 5IBWA 1LXFC 2ZFDA 5AANA 2JQ6A 1V1GA 4DIRA 3IQOA 3I5HB 1QX5B 4GPLB 5AEQA 2JRFA 2O60A 2BE6A 1PVAA 1QVIY 1NWDA 4JPZB 1M39A 1TTXA 4L9MA 4XJKB 1J7OA 1B9AA 2ZN8A 3BOWB 2K2FA 1QVIZ 2DOQA 5DKNA 4ZCUA 1AVSA 1EG4A 2PSRA 1YUSA 1NX1A 2WOSA 1CFDA 1KFUS 3PALA 3BUXB 1KK7Y 4E68A 2FCDA 1WY9A 1SKTA 1SYMA 4HSZA 1KK7Z 1NCYA 3E3RA 4MRXA 5DKQA 1WRZA 5CSJA 3NSIA 4WQ3A 1TNWA 2Y1NA 1W7IB 4I5JA 3TDIA 4CFQA 3DVEA 4WQ2A 2LV7A 2RGIA 2M8UA 2M0RA 5JOLA 1OOJA 5ER5A 1A4PA 3EKJA 4MZLA 2JXCA 5I2LA 3SG7A 1FPWA 5CPVA 1SCMC 2K8MB 1G33A 2H2KA 4DRWA 1S3PA 2OTGB 1CM1A 2LLUA 5CSIA 5CSNA 1CFFA 2K0JA 1MXLC 3HX4A 3O2PA 4N5XA 1DT7B 1NCXA 1E8AA 3ICBA 5HKWA 1C7WA 1SMGA 4I5NB 4R1EA 3RLZA 2BL0B 1R6PA 5G08A 2I2RE 2KFFA 3PN7B 4M2QA 1Y0VH 4C0LA 3ZWHA 3WXAA 1ZOTB 1L2OC 3TS5B 1FI6A 1XYDA 2KI6D 3SG3A 3I5GC 1KSMA 1K96A 1YR5A 2EHBA 3LL8B 1H8BA 2MAZA 1FI5A 3OHMB 1B7TY 2F8PA 1CB1A 1S1EA 2KI4C 1UWOA 2FCEA 4YGAA 5HLVA 4DS7A 1QV0A 2R2IA 1UP5A 2HPSA 3D0YA 3OP0A 4JWQA 4YGCB 3VRPA 2TN4A 3M0WA 4YGEB 3I5IB 4D1EA 1UHKA 4MSPA 2GGMA 1IGVA 1FF1A 1SBJA 1XFWO 1SL9A 3CZTX 2JXLA 4PE0A 2K61A 1K9PA 2LMTA 3VRQA 4C0JA 2M29A 3OB1B 5I2OA 1IKUA 1S6JA 2KI6C 3EVRA 1WRLA 2M97A 1EXRA 3BYAA 1F8HA 1JWDA 1U5IA 2CBLA 2FOTA 1NCZA 2LCPA 2B1UA 2BCBA 1KSOA 2QPTA 1XVJA 2E6WA 3LK0A 1ZACA 1JSAA 1KQMB 2KGRA 3OX6A 1C07A 1K9KA 4IL1A 5B8IB 1IQ3A 2CNPA 1YX7A 4WRIA 4A4CA 2K7DA 2P6BB 3BUOB 3A4UB 2LHLA 1GQMA 1SRAA 1NX0A 1DJXA 2PVBA 3TDZA 2L51A 1ALWA 1A75A 1JFKA 2AUCA 2H61C 2FJUB 2MRDA 1C7VA 5PALA 1KWOC 2M7LA 2JNFA 5FYXA 4CFRA 3SIBA 1MQ1A 2F2PA 3WHUB 1EH2A 4PCWA 1PULA 1NX2A 1RTP1 3LCPC 1UHJA 1DTLA 1TOPA 1ZUZA 3NSLA 1BF5A 3I5FC 1IG5A 2MBXA 4P2YB 1GGZA 1QTXA 4MN0A 2PMYA 2GV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKZ A;  1IJ5 A;  3JVT C;  1UHN A;  2L50 A;  3NSO A;  4ETO A;  1BT6 A;  1QV1 A;  3KO0 A;  4YBH B;  1K93 D;  2KAV A;  2L4H A;  1XFU O;  1J1D A;  1IWQ A;  1YTZ C;  1RRO A;  1JBA A;  2KQ6 A;  2LM5 A;  1DJZ A;  2KDH A;  1JFJ A;  1SNL A;  2JWW A;  4PE4 A;  4GGN A;  2KYF A;  3DF0 B;  4PE7 A;  4TNC A;  1YUR A;  1AP4 A;  2M9G A;  2COL B;  4MVF A;  1J7R A;  1AJ5 A;  1SCV A;  2LHI A;  2CXJ A;  1DF0 A;  2JC2 A;  5J3X A;  1Y1X A;  3CGA A;  3JTD B;  1KFU L;  1PSB A;  1NYA A;  4QJ4 B;  2NCP A;  4CID A;  2OS8 C;  2I94 A;  1YRT B;  3EVU A;  3PAT A;  3ZNI A;  1H4B A;  2JTT A;  1WLZ A;  2H61 A;  3SG5 A;  1DJW A;  2SAS A;  3JVT B;  1ALV A;  2JTZ A;  5HKY A;  4GAO A;  4N1F A;  1OMV A;  3KHE A;  4OCI A;  4GFT A;  1QS7 A;  4A4B A;  3EK7 A;  3KPX A;  1DJI A;  2BBN A;  1PRW A;  2K7C A;  1Y6W A;  4YI8 A;  2LVV A;  2A4J A;  1CM4 A;  1L7Z A;  1PSR A;  1LA0 A;  5D69 A;  1CMG A;  1SK6 D;  1J7P A;  1BMO A;  3BOW A;  4OR9 B;  1YX8 A;  2KAX A;  3D0Y B;  1J55 A;  2NLN A;  3FS7 A;  1GJY A;  2K2A A;  1GGW A;  1SL7 A;  3EVV A;  5HLO A;  2MA2 A;  4FQO A;  1BU3 A;  1XA5 A;  1WDC C;  4PHJ A;  3GOF A;  1S5G Y;  1KK8 C;  1CLM A;  2L5X B;  1F4Q A;  3VRO A;  1K90 D;  2I18 A;  4UPG A;  3BUM B;  4ICB A;  1DVI A;  2OPO A;  1S5G Z;  3WHT B;  3O6B A;  4CLN A;  1LKJ A;  2JZI A;  4Q04 A;  2PAL A;  1BJF A;  3CR2 A;  2WOR A;  3AAK A;  2LUC A;  3GK1 A;  3LLE A;  3TZ1 A;  1SCM B;  3MSE B;  4MRY A;  1B1G A;  2ZN9 A;  2QAC A;  1U5I B;  1AUI B;  1M46 A;  1REC A;  3D10 A;  1CLB A;  1RWY A;  1Y1U A;  1CTR A;  2M1U A;  2PAS A;  2F2O A;  1OQP A;  1F4O A;  1YRU B;  1DJH A;  3IF7 A;  1A2X A;  1CMF A;  1BR4 B;  2M7N A;  3SJS A;  1MWN A;  1SR6 C;  2NCO A;  1L2O B;  2JT0 A;  5I8N A;  1A75 B;  3I5G B;  1ZMZ A;  2M3W A;  2NXQ A;  4NQG A;  3TUY C;  2JT8 A;  4YGD B;  2BCX A;  3BXK A;  3FIA A;  1PVB A;  3GK4 X;  1QIV A;  1X02 A;  1DMO A;  1JF2 A;  3PFV A;  3FWB A;  2KI4 B;  5K89 A;  3AKB A;  1YUU A;  2Y5I A;  4BY5 A;  2VRG A;  4JQ0 D;  1SY9 A;  1B47 A;  2KNE A;  3FWC A;  3OB2 B;  2NZ0 A;  1K9U A;  1NX3 A;  2GGZ A;  1TNX A;  3AKA A;  1XFY O;  4PAL A;  3CS1 A;  1J7Q A;  3QRX A;  2KOT A;  1KCY A;  1Y1A A;  3IQQ A;  2L0P A;  1R2U A;  1FW4 A;  1EL4 A;  1ZFS A;  1Q80 A;  2LMV A;  2MJW B;  2Q91 A;  2BKI B;  1NP8 A;  1DGV A;  3OX5 A;  3LK1 A;  2JUL A;  2LLS A;  1XK4 C;  1EJ3 A;  2F3Z A;  5D7F A;  3BQ3 A;  5I2Q A;  3DVJ A;  2SCP A;  3K21 A;  1WRK A;  1HT9 A;  1KFX S;  1OMR A;  2JNX A;  3H4S E;  4I5K A;  3C1V A;  1TIZ A;  4MZJ A;  3I5H C;  5JJG A;  1BLQ A;  1YUT A;  2BCA A;  2KYC A;  3TDU A;  1AHR A;  1G8I A;  2G2B A;  3DVM A;  2KQY A;  4GGF C;  4MZK A;  1DF0 B;  1CLL A;  2KFH A;  4OV2 A;  2M1K B;  4HRH A;  1LA3 A;  2LAP A;  2V53 A;  3HCM A;  4OKH A;  2ISD A;  1S26 D;  1MF8 B;  1OMD A;  1G4Y R;  1VRK A;  1SL8 A;  3SIA A;  2EGD A;  4YI9 A;  1F70 A;  1CDM A;  1OSA A;  4GUK A;  1PK0 D;  5ER4 X;  1TCO B;  4GBA A;  4BY4 A;  1KWO B;  2CT9 A;  2MLE C;  1S6C A;  1JUO A;  3CR4 X;  2WCB A;  3DVK A;  1BG1 A;  1UHH A;  3O4Y A;  1S6I A;  3PLF B;  1NPQ A;  2EC6 C;  1K95 A;  5KSZ A;  4M2P A;  2LP2 A;  3RM1 A;  2KAY A;  4AQJ A;  1CDN A;  3WNX B;  3I5F B;  1XO5 A;  1CNP A;  2K7B A;  1AK8 A;  2LNK A;  5AFP A;  1A03 A;  2OTG C;  2E30 A;  1BOD A;  1XFX O;  4DCK A;  3SG6 A;  1ODB A;  3KF9 A;  1HQV A;  2ZRS A;  1XK4 A;  2KBI A;  1SPY A;  1M31 A;  2WCF A;  3PSR A;  1RK9 A;  3NSK A;  4USL A;  4OVN F;  4ORB B;  1YVL A;  2BBM A;  1BOC A;  1OZS A;  3CLN A;  1YVH A;  5F6T A;  2BL0 C;  3KEV A;  1J1E A;  3PN7 C;  1S36 A;  3VRR A;  4XJK A;  4PHM A;  1EG3 A;  2KBM A;  1K8U A;  3GK2 A;  3TS5 C;  4F0Z B;  3CTN A;  4GGF A;  4P5O E;  1K2H A;  2IS9 A;  2EC6 B;  1WLM A;  2F33 A;  3DF0 A;  1SW8 A;  1QLK A;  1XFZ O;  4YGB B;  1B8R A;  2OS8 B;  1JF0 A;  1IRJ A;  4M2O A;  1UUR A;  1NIW A;  2BEC A;  2LVI A;  3I5I C;  1F54 A;  5CSF A;  1QJT A;  1IH0 A;  1TNQ A;  4NDB A;  1XFV O;  1NSH A;  2M49 B;  1AJ4 A;  2WND A;  2LLT A;  2LVJ A;  5AXI A;  4NDD A;  4ZCV A;  1K94 A;  3VRN A;  1UHI A;  4ORA B;  3AAJ A;  1DGU A;  1LIN A;  1QAS A;  2HF5 A;  1QAT A;  1KQV A;  4PHK A;  2LUX A;  4MLW A;  1CFC A;  2JOJ A;  1FBV A;  2I7A A;  1RFJ A;  1V1F A;  1RJV A;  3A8R A;  4HRG A;  1CFP A;  2KSP A;  1UUS A;  5TNC A;  1IQ5 A;  1KQM C;  1B8L A;  2CCM A;  4FTG A;  1QIW A;  2F3Y A;  1MUX A;  1TN4 A;  1W7J B;  1WDC B;  2CTN A;  1JC2 A;  1KK8 B;  4I5L B;  1OZO A;  1B7T Z;  5GQQ C;  2PRU A;  1PAL A;  1TNP A;  2LC5 A;  2WC8 A;  3CR5 X;  4PDZ A;  4PE1 A;  3CWG A;  5BPJ A;  1D1O A;  1LVC D;  1N0Y A;  4U8D A;  2LP3 A;  1F71 A;  3EK8 A;  2HQ8 A;  2D8N A;  1TCF A;  3F45 A;  2MHH A;  2ZKM X;  2JT3 A;  5DKR A;  3SG4 A;  5KTY A;  2BE4 A;  1MXE A;  1QX2 A;  1B8C A;  1N2D A;  3BUN B;  2MLF C;  2LE9 B;  1M63 B;  2O5G A;  4AQI A;  1F55 A;  1TRF A;  4YRU A;  2KHN A;  2L2E A;  2JU0 A;  3DD4 A;  1N65 A;  2AMI A;  1DJG A;  4DUQ A;  1CDL A;  1IJ6 A;  1SR6 B;  2L98 A;  2LMU A;  2LAN A;  2LVK A;  1A29 A;  2Y4Q A;  1CKK A;  1B4C A;  4XYN A;  4PHN A;  3TUY B;  4QJ5 B;  3O78 A;  2BKH B;  1KFX L;  1MHO A;  2KFG A;  3NXA A;  5HYD A;  1OE9 B;  2HET A;  1CDP A;  1NUB A;  2JPT A;  2ZRT A;  3PM8 A;  4AOM A;  4HRE E;  4GNK B;  2G9B A;  1QXP A;  1DJY A;  1M45 A;  4C0K A;  1MR8 A;  2L4I A;  3VGO A;  1BR1 B;  3EK4 A;  2K7O A;  2ZND A;  4NDC A;  2AAO A;  2ZNE A;  3JTD C;  4MBE A;  2HQW A;  4CPV A;  4QJ3 B;  2Y1M A;  1QLS A;  5AER A;  3BUW B;  4MEW A;  1QX7 A;  5KU1 A;  2Q4U A;  3EKH A;  2KGB C;  4ORC B;  3SG2 A;  2WCE A;  4N1G A;  5IBW A;  1LXF C;  2ZFD A;  5AAN A;  2JQ6 A;  1V1G A;  4DIR A;  3IQO A;  3I5H B;  1QX5 B;  4GPL B;  5AEQ A;  2JRF A;  2O60 A;  2BE6 A;  1PVA A;  1QVI Y;  1NWD A;  4JPZ B;  1M39 A;  1TTX A;  4L9M A;  4XJK B;  1J7O A;  1B9A A;  2ZN8 A;  3BOW B;  2K2F A;  1QVI Z;  2DOQ A;  5DKN A;  4ZCU A;  1AVS A;  1EG4 A;  2PSR A;  1YUS A;  1NX1 A;  2WOS A;  1CFD A;  1KFU S;  3PAL A;  3BUX B;  1KK7 Y;  4E68 A;  2FCD A;  1WY9 A;  1SKT A;  1SYM A;  4HSZ A;  1KK7 Z;  1NCY A;  3E3R A;  4MRX A;  5DKQ A;  1WRZ A;  5CSJ A;  3NSI A;  4WQ3 A;  1TNW A;  2Y1N A;  1W7I B;  4I5J A;  3TDI A;  4CFQ A;  3DVE A;  4WQ2 A;  2LV7 A;  2RGI A;  2M8U A;  2M0R A;  5JOL A;  1OOJ A;  5ER5 A;  1A4P A;  3EKJ A;  4MZL A;  2JXC A;  5I2L A;  3SG7 A;  1FPW A;  5CPV A;  1SCM C;  2K8M B;  1G33 A;  2H2K A;  4DRW A;  1S3P A;  2OTG B;  1CM1 A;  2LLU A;  5CSI A;  5CSN A;  1CFF A;  2K0J A;  1MXL C;  3HX4 A;  3O2P A;  4N5X A;  1DT7 B;  1NCX A;  1E8A A;  3ICB A;  5HKW A;  1C7W A;  1SMG A;  4I5N B;  4R1E A;  3RLZ A;  2BL0 B;  1R6P A;  5G08 A;  2I2R E;  2KFF A;  3PN7 B;  4M2Q A;  1Y0V H;  4C0L A;  3ZWH A;  3WXA A;  1ZOT B;  1L2O C;  3TS5 B;  1FI6 A;  1XYD A;  2KI6 D;  3SG3 A;  3I5G C;  1KSM A;  1K96 A;  1YR5 A;  2EHB A;  3LL8 B;  1H8B A;  2MAZ A;  1FI5 A;  3OHM B;  1B7T Y;  2F8P A;  1CB1 A;  1S1E A;  2KI4 C;  1UWO A;  2FCE A;  4YGA A;  5HLV A;  4DS7 A;  1QV0 A;  2R2I A;  1UP5 A;  2HPS A;  3D0Y A;  3OP0 A;  4JWQ A;  4YGC B;  3VRP A;  2TN4 A;  3M0W A;  4YGE B;  3I5I B;  4D1E A;  1UHK A;  4MSP A;  2GGM A;  1IGV A;  1FF1 A;  1SBJ A;  1XFW O;  1SL9 A;  3CZT X;  2JXL A;  4PE0 A;  2K61 A;  1K9P A;  2LMT A;  3VRQ A;  4C0J A;  2M29 A;  3OB1 B;  5I2O A;  1IKU A;  1S6J A;  2KI6 C;  3EVR A;  1WRL A;  2M97 A;  1EXR A;  3BYA A;  1F8H A;  1JWD A;  1U5I A;  2CBL A;  2FOT A;  1NCZ A;  2LCP A;  2B1U A;  2BCB A;  1KSO A;  2QPT A;  1XVJ A;  2E6W A;  3LK0 A;  1ZAC A;  1JSA A;  1KQM B;  2KGR A;  3OX6 A;  1C07 A;  1K9K A;  4IL1 A;  5B8I B;  1IQ3 A;  2CNP A;  1YX7 A;  4WRI A;  4A4C A;  2K7D A;  2P6B B;  3BUO B;  3A4U B;  2LHL A;  1GQM A;  1SRA A;  1NX0 A;  1DJX A;  2PVB A;  3TDZ A;  2L51 A;  1ALW A;  1A75 A;  1JFK A;  2AUC A;  2H61 C;  2FJU B;  2MRD A;  1C7V A;  5PAL A;  1KWO C;  2M7L A;  2JNF A;  5FYX A;  4CFR A;  3SIB A;  1MQ1 A;  2F2P A;  3WHU B;  1EH2 A;  4PCW A;  1PUL A;  1NX2 A;  1RTP 1;  3LCP C;  1UHJ A;  1DTL A;  1TOP A;  1ZUZ A;  3NSL A;  1BF5 A;  3I5F C;  1IG5 A;  2MBX A;  4P2Y B;  1GGZ A;  1QTX A;  4MN0 A;  2PMY A;  2GV5 A; 
#chains in the Genus database with same CATH topology
 5HKZ A;  1IJ5 A;  3JVT C;  1UHN A;  2L50 A;  3NSO A;  4ETO A;  1BT6 A;  1ORG A;  1QV1 A;  3BFB A;  3KO0 A;  4YBH B;  1K93 D;  2KAV A;  2L4H A;  1XFU O;  1J1D A;  1IWQ A;  1YTZ C;  1RRO A;  1JBA A;  2KQ6 A;  2LM5 A;  1DJZ A;  2KDH A;  1JFJ A;  1SNL A;  2JWW A;  4PE4 A;  4GGN A;  2KYF A;  3DF0 B;  4PE7 A;  4TNC A;  1YUR A;  1AP4 A;  2M9G A;  2COL B;  4MVF A;  1TWO A;  1J7R A;  1AJ5 A;  2GTE A;  1SCV A;  2LHI A;  2CXJ A;  1DF0 A;  2JC2 A;  5J3X A;  1Y1X A;  3CGA A;  3CZ1 A;  3JTD B;  1KFU L;  1PSB A;  1NYA A;  3BFA A;  4QJ4 B;  2NCP A;  4CID A;  2OS8 C;  3CYZ A;  2I94 A;  1YRT B;  3EVU A;  3PAT A;  3ZNI A;  1H4B A;  2JTT A;  1WLZ A;  2H61 A;  5HL1 A;  3SG5 A;  1DJW A;  2SAS A;  3JVT B;  1ALV A;  2JTZ A;  2K60 A;  5HKY A;  4GAO A;  4N1F A;  1OMV A;  3KHE A;  3SS3 A;  2KLE A;  4OCI A;  4GFT A;  1QS7 A;  4A4B A;  5D3O A;  3EK7 A;  3KPX A;  1DJI A;  2BBN A;  1PRW A;  2K7C A;  1TUZ A;  1Y6W A;  4YI8 A;  2LVV A;  3QME A;  2A4J A;  1CM4 A;  1L7Z A;  1PSR A;  1OW4 A;  1LA0 A;  5D69 A;  1CMG A;  1SK6 D;  3EG5 B;  1J7P A;  1BMO A;  3BOW A;  4OR9 B;  1YX8 A;  2KAX A;  2QEV A;  1J55 A;  2NLN A;  3D0Y B;  3FS7 A;  2WCK A;  1GJY A;  2K2A A;  3FE9 A;  1SL7 A;  1GGW A;  3EVV A;  5HLO A;  2MA2 A;  4FQO A;  1BU3 A;  1XA5 A;  1WDC C;  4PHJ A;  3GOF A;  1S5G Y;  1KK8 C;  1CLM A;  2L5X B;  1F4Q A;  3VRO A;  1K90 D;  2I18 A;  4UPG A;  3BUM B;  4ICB A;  1DVI A;  2OPO A;  3R72 A;  1S5G Z;  3WHT B;  3O6B A;  4CLN A;  1LKJ A;  2JZI A;  2WCM A;  4Q04 A;  2PAL A;  1BJF A;  3CR2 A;  2WOR A;  1SSE B;  2LUC A;  2WCH A;  3AAK A;  3GK1 A;  1SCM B;  3CAB A;  3MSE B;  4MRY A;  3SS5 A;  2ZN9 A;  3TZ1 A;  2QAC A;  1U5I B;  1AUI B;  1M46 A;  1REC A;  3D10 A;  2H8V A;  1RWY A;  2L2C A;  3IVT A;  1CLB A;  1Y1U A;  1CTR A;  2M1U A;  2PAS A;  2F2O A;  1OQP A;  1F4O A;  1YRU B;  1DJH A;  3IF7 A;  1A2X A;  1CMF A;  1BR4 B;  1P28 A;  2M7N A;  3SJS A;  1MWN A;  1SR6 C;  2NCO A;  1L2O B;  1OOI X;  2JT0 A;  3FE8 A;  5I8N A;  1A75 B;  3I5G B;  3UO9 A;  1ZMZ A;  2M3W A;  2NXQ A;  4NQG A;  3TUY C;  2JT8 A;  4YGD B;  2BCX A;  3BXK A;  3FIA A;  1PVB A;  3GK4 X;  1QIV A;  1X02 A;  3FE6 A;  1JF2 A;  3PFV A;  3FWB A;  2KI4 B;  5K89 A;  3AKB A;  1DMO A;  1YUU A;  2Y5I A;  4BY5 A;  2VRG A;  1C3Y A;  4JQ0 D;  1SY9 A;  4OZD A;  1B47 A;  3VB1 A;  2KNE A;  3FWC A;  3OB2 B;  2NZ0 A;  3V2L A;  1K9U A;  1NX3 A;  2GGZ A;  1TNX A;  3AKA A;  1XFY O;  4PAL A;  3CS1 A;  1J7Q A;  2BAP A;  3QRX A;  2KOT A;  1KCY A;  1Y1A A;  3IQQ A;  3BFH A;  2L0P A;  1R2U A;  1FW4 A;  1EL4 A;  1ZFS A;  1Q80 A;  2LMV A;  2MJW B;  2Q91 A;  2BKI B;  1NP8 A;  1DGV A;  1Z4H A;  3OX5 A;  3LK1 A;  2JUL A;  2LLS A;  1XK4 C;  1EJ3 A;  2F3Z A;  5D7F A;  3BQ3 A;  5I2Q A;  3DVJ A;  2SCP A;  2QEO A;  1WRK A;  1HT9 A;  3K21 A;  1KFX S;  1OMR A;  2JNX A;  3H4S E;  4I5K A;  3C1V A;  1TIZ A;  4MZJ A;  3I5H C;  5JJG A;  1BLQ A;  1YUT A;  2BCA A;  2KYC A;  3TDU A;  1AHR A;  1G8I A;  2G2B A;  3DVM A;  2KQY A;  4GGF C;  4MZK A;  1DF0 B;  1DC1 A;  1CLL A;  2KFH A;  4OV2 A;  2M1K B;  4HRH A;  2QDI A;  1LA3 A;  2LAP A;  2V53 A;  3HCM A;  4OKH A;  2ISD A;  1S26 D;  1MF8 B;  1OMD A;  1G4Y R;  3OGN A;  1VRK A;  1SL8 A;  4INX A;  3SIA A;  2EGD A;  4YI9 A;  3L4A A;  1F70 A;  1CDM A;  1B1G A;  1OSA A;  4GUK A;  1PK0 D;  5ER4 X;  1TCO B;  4GBA A;  4BY4 A;  1KWO B;  2CT9 A;  2MLE C;  1S6C A;  1JUO A;  3CR4 X;  2WCB A;  3B86 A;  3DVK A;  1BG1 A;  1DQE A;  1UHH A;  3O4Y A;  1S6I A;  3PLF B;  1NPQ A;  2EC6 C;  1K95 A;  5KSZ A;  4M2P A;  2LP2 A;  2JPO A;  3RM1 A;  2KAY A;  2WC6 A;  4AQJ A;  1CDN A;  3WNX B;  3I5F B;  1XO5 A;  1CNP A;  2K7B A;  1AK8 A;  2LNK A;  5AFP A;  1A03 A;  2OTG C;  2E30 A;  1BOD A;  1XFX O;  4DCK A;  3SG6 A;  1ODB A;  3KF9 A;  1HQV A;  2ZRS A;  1XK4 A;  2KBI A;  1SPY A;  1M31 A;  2WCF A;  3S0D A;  3PSR A;  1RK9 A;  3NSK A;  4USL A;  4OVN F;  3B7A A;  4ORB B;  1YVL A;  2BBM A;  1BOC A;  1OZS A;  3CLN A;  1YVH A;  5F6T A;  2BL0 C;  3KEV A;  2BNX A;  1J1E A;  3PN7 C;  1S36 A;  3VRR A;  4XJK A;  4PHM A;  1EG3 A;  2KBM A;  1K8U A;  3GK2 A;  3TS5 C;  4F0Z B;  3CTN A;  3K1E A;  4GGF A;  4P5O E;  5FI2 A;  1K2H A;  2IS9 A;  2EC6 B;  2QEB A;  1WLM A;  2F33 A;  3DF0 A;  1SW8 A;  1C3Z A;  1QLK A;  1XFZ O;  4YGB B;  1B8R A;  2OS8 B;  3R1V A;  1JF0 A;  1IRJ A;  4M2O A;  1UUR A;  4JD9 A;  1NIW A;  3S0G A;  2BEC A;  2LVI A;  3I5I C;  1F54 A;  5CSF A;  1QJT A;  1IH0 A;  1TNQ A;  3N7H A;  4NDB A;  5I94 A;  1XFV O;  1NSH A;  4FQT A;  2QEH A;  2M49 B;  1AJ4 A;  2WND A;  2LLT A;  2LVJ A;  5AXI A;  4NDD A;  4ZCV A;  1K94 A;  3VRN A;  1UHI A;  4ORA B;  3AAJ A;  1DGU A;  1LIN A;  1QAS A;  2HF5 A;  1QAT A;  1KQV A;  4PHK A;  2LUX A;  4MLW A;  1CFC A;  2JOJ A;  1FBV A;  2I7A A;  1RFJ A;  1V1F A;  1RJV A;  3A8R A;  1OOG A;  4HRG A;  1CFP A;  2KSP A;  1UUS A;  5TNC A;  1IQ5 A;  3DXL A;  1KQM C;  1B8L A;  2CCM A;  4FTG A;  1QIW A;  2F3Y A;  1MUX A;  1TN4 A;  5FI6 A;  1W7J B;  1WDC B;  2CTN A;  2WCJ A;  1KK8 B;  4I5L B;  1OZO A;  1JC2 A;  1B7T Z;  1T14 A;  5GQQ C;  3RZS A;  2PYQ A;  2PRU A;  1PAL A;  1TNP A;  2LC5 A;  2P70 A;  2WC8 A;  1W9Z A;  3CR5 X;  4PDZ A;  4PE1 A;  3CWG A;  5BPJ A;  1D1O A;  1LVC D;  1N0Y A;  3R1P A;  4U8D A;  2LP3 A;  3NHT A;  1F71 A;  3EK8 A;  2HQ8 A;  2D8N A;  1TCF A;  3F45 A;  2MHH A;  2WCL A;  2JT3 A;  2ZKM X;  1DEK A;  5DKR A;  3SG4 A;  2BE4 A;  1MXE A;  5KTY A;  1QX2 A;  1B8C A;  1N2D A;  3BUN B;  2MLF C;  2FJY A;  2LE9 B;  1M63 B;  2O5G A;  4AQI A;  1F55 A;  1TRF A;  4YRU A;  2KHN A;  2L2E A;  2JU0 A;  3DD4 A;  1N65 A;  2AMI A;  1DJG A;  4DUQ A;  1CDL A;  1IJ6 A;  1SR6 B;  2L98 A;  2LMU A;  2LAN A;  2LVK A;  1A29 A;  2Y4Q A;  1CKK A;  3SS4 A;  1B4C A;  2YGU A;  4XYN A;  4PHN A;  3TUY B;  4QJ5 B;  3O78 A;  2BKH B;  1KFX L;  1MHO A;  2KFG A;  3NXA A;  5HYD A;  1OE9 B;  2HET A;  1CDP A;  1NUB A;  2JPT A;  2ZRT A;  3PM8 A;  3D76 A;  4AOM A;  4HRE E;  3B87 A;  4GNK B;  2G9B A;  1QXP A;  1DJY A;  1M45 A;  4C0K A;  1MR8 A;  2L4I A;  3VGO A;  1BR1 B;  3EK4 A;  2K7O A;  2ZND A;  2ERB A;  4NDC A;  2AAO A;  2ZNE A;  3JTD C;  4MBE A;  2HQW A;  4CPV A;  4QJ3 B;  2Y1M A;  1QLS A;  5AER A;  3BUW B;  4MEW A;  1QX7 A;  5KU1 A;  2Q4U A;  3EKH A;  2KGB C;  4ORC B;  2PQL A;  3SG2 A;  2WCE A;  4N1G A;  5IBW A;  3L47 A;  1LXF C;  2ZFD A;  5AAN A;  1IIO A;  2JQ6 A;  3O4X A;  1V1G A;  4DIR A;  3IQO A;  3I5H B;  1QX5 B;  4GPL B;  5AEQ A;  2JRF A;  2O60 A;  3DZT A;  2BE6 A;  1PVA A;  1QVI Y;  1NWD A;  4JPZ B;  1M39 A;  1TTX A;  4L9M A;  4XJK B;  1J7O A;  1B9A A;  2ZN8 A;  3BOW B;  2K2F A;  1QVI Z;  2DOQ A;  3L4L A;  4INW A;  5DKN A;  4ZCU A;  1AVS A;  1EG4 A;  2PSR A;  2WC5 A;  1Z2C B;  1YUS A;  1NX1 A;  2WOS A;  5FI7 A;  1CFD A;  1KFU S;  3PAL A;  3BUX B;  1KK7 Y;  4E68 A;  1GM0 A;  3CDN A;  2FCD A;  1WY9 A;  3D77 A;  3S0B A;  1SKT A;  1SYM A;  4HSZ A;  1KK7 Z;  5EL2 A;  1OOH A;  3LLE A;  1NCY A;  3E3R A;  4MRX A;  3CZ2 A;  1WRZ A;  2L5Y A;  3NSI A;  4WQ3 A;  5CSJ A;  5DKQ A;  1TNW A;  2Y1N A;  1W7I B;  4I5J A;  3TDI A;  4CFQ A;  3DVE A;  4WQ2 A;  2LV7 A;  2RGI A;  3D75 A;  2M8U A;  3Q8I A;  3UNW A;  2M0R A;  5JOL A;  1OOJ A;  5ER5 A;  1A4P A;  3EKJ A;  4MZL A;  2JXC A;  5I2L A;  3SG7 A;  1FPW A;  3D73 A;  5CPV A;  1SCM C;  2K8M B;  1G33 A;  2H2K A;  4DRW A;  1S3P A;  3CZ0 A;  2OTG B;  3DY9 A;  1CM1 A;  2LLU A;  5CSI A;  5CSN A;  1CFF A;  2K0J A;  1OOF A;  3S0A A;  1MXL C;  3HX4 A;  3O2P A;  4N5X A;  1DT7 B;  1NCX A;  1E8A A;  3S0E A;  3ICB A;  5HKW A;  1C7W A;  1SMG A;  4I5N B;  4R1E A;  3RLZ A;  2BL0 B;  1R6P A;  5G08 A;  2I2R E;  2KFF A;  3PN7 B;  4M2Q A;  1Y0V H;  5DIC A;  4C0L A;  4PT1 A;  3WXA A;  1ZOT B;  3ZWH A;  1L2O C;  3TS5 B;  1FI6 A;  1XYD A;  2KI6 D;  3D78 A;  3SG3 A;  3I5G C;  1KSM A;  3PM2 A;  1K96 A;  1YR5 A;  2EHB A;  3LL8 B;  1H8B A;  2MAZ A;  1FI5 A;  3OHM B;  4F7F A;  3S0F A;  1B7T Y;  2F8P A;  1CB1 A;  1S1E A;  2KI4 C;  1UWO A;  2FCE A;  4YGA A;  2KPH A;  5HLV A;  1QV0 A;  4DS7 A;  2R2I A;  1UP5 A;  2HPS A;  3D0Y A;  3OP0 A;  3PJI A;  4JWQ A;  4YGC B;  3VRP A;  2TN4 A;  3M0W A;  1TUJ A;  4JKT A;  3I5I B;  4YGE B;  4IJ7 A;  4D1E A;  1UHK A;  4KYN A;  4MSP A;  3D74 A;  2GGM A;  1IGV A;  1FF1 A;  1SBJ A;  3BJH A;  1XFW O;  1SL9 A;  3CZT X;  2JXL A;  4PE0 A;  2K61 A;  1K9P A;  2LMT A;  3VRQ A;  4C0J A;  2M29 A;  3OB1 B;  5I2O A;  1IKU A;  1S6J A;  2KI6 C;  3EVR A;  1WRL A;  2M97 A;  1EXR A;  3BYA A;  1F8H A;  1JWD A;  1U5I A;  2CBL A;  2FOT A;  1NCZ A;  2LCP A;  2KLD A;  2B1U A;  2BCB A;  1KSO A;  2QPT A;  1XVJ A;  2E6W A;  3LK0 A;  1ZAC A;  1JSA A;  1KQM B;  2KGR A;  3OX6 A;  1C07 A;  1K9K A;  4IL1 A;  5B8I B;  1IQ3 A;  2CNP A;  1YX7 A;  4WRI A;  1LS8 A;  4A4C A;  2K7D A;  3DYE A;  2P71 A;  1DEL A;  2P6B B;  1XFR A;  3BUO B;  3A4U B;  3OBV A;  2LHL A;  1GQM A;  1SRA A;  1NX0 A;  1DJX A;  2PVB A;  3TDZ A;  2L51 A;  1ALW A;  1A75 A;  1JFK A;  2AUC A;  3NHI A;  2H61 C;  2FJU B;  2MRD A;  1C7V A;  5PAL A;  1KWO C;  2M7L A;  2JNF A;  5FYX A;  3B88 A;  4CFR A;  3SIB A;  1MQ1 A;  2F2P A;  3WHU B;  3R1O A;  1EH2 A;  3NGV A;  1PUL A;  1NX2 A;  1RTP 1;  4PCW A;  3LCP C;  1UHJ A;  1DTL A;  1TOP A;  1ZUZ A;  3NSL A;  1BF5 A;  3B6X A;  3I5F C;  1IG5 A;  2MBX A;  4P2Y B;  1GGZ A;  1QTX A;  4MN0 A;  2PMY A;  2GV5 A;  1QWV A; 
#chains in the Genus database with same CATH homology
 5HKZ A;  1IJ5 A;  3JVT C;  1UHN A;  2L50 A;  3NSO A;  4ETO A;  1BT6 A;  1QV1 A;  3KO0 A;  4YBH B;  1K93 D;  2KAV A;  2L4H A;  1XFU O;  1J1D A;  1IWQ A;  1YTZ C;  1RRO A;  1JBA A;  2KQ6 A;  2LM5 A;  1DJZ A;  2KDH A;  1JFJ A;  1SNL A;  2JWW A;  4PE4 A;  4GGN A;  2KYF A;  3DF0 B;  4PE7 A;  4TNC A;  1YUR A;  1AP4 A;  2M9G A;  2COL B;  4MVF A;  1J7R A;  1AJ5 A;  1SCV A;  2LHI A;  2CXJ A;  1DF0 A;  2JC2 A;  5J3X A;  1Y1X A;  3CGA A;  3JTD B;  1KFU L;  1PSB A;  1NYA A;  4QJ4 B;  2NCP A;  4CID A;  2OS8 C;  2I94 A;  1YRT B;  3EVU A;  3PAT A;  3ZNI A;  1H4B A;  2JTT A;  1WLZ A;  2H61 A;  3SG5 A;  1DJW A;  2SAS A;  3JVT B;  1ALV A;  2JTZ A;  5HKY A;  4GAO A;  4N1F A;  1OMV A;  3KHE A;  4OCI A;  4GFT A;  1QS7 A;  4A4B A;  3EK7 A;  3KPX A;  1DJI A;  2BBN A;  1PRW A;  2K7C A;  1Y6W A;  4YI8 A;  2LVV A;  2A4J A;  1CM4 A;  1L7Z A;  1PSR A;  1LA0 A;  5D69 A;  1CMG A;  1SK6 D;  1J7P A;  1BMO A;  3BOW A;  4OR9 B;  1YX8 A;  2KAX A;  3D0Y B;  1J55 A;  2NLN A;  3FS7 A;  1GJY A;  2K2A A;  1GGW A;  1SL7 A;  3EVV A;  5HLO A;  2MA2 A;  4FQO A;  1BU3 A;  1XA5 A;  1WDC C;  4PHJ A;  3GOF A;  1S5G Y;  1KK8 C;  1CLM A;  2L5X B;  1F4Q A;  3VRO A;  1K90 D;  2I18 A;  4UPG A;  3BUM B;  4ICB A;  1DVI A;  2OPO A;  1S5G Z;  3WHT B;  3O6B A;  4CLN A;  1LKJ A;  2JZI A;  4Q04 A;  2PAL A;  1BJF A;  3CR2 A;  2WOR A;  3AAK A;  2LUC A;  3GK1 A;  3LLE A;  3TZ1 A;  1SCM B;  3MSE B;  4MRY A;  1B1G A;  2ZN9 A;  2QAC A;  1U5I B;  1AUI B;  1M46 A;  1REC A;  3D10 A;  1CLB A;  1RWY A;  1Y1U A;  1CTR A;  2M1U A;  2PAS A;  2F2O A;  1OQP A;  1F4O A;  1YRU B;  1DJH A;  3IF7 A;  1A2X A;  1CMF A;  1BR4 B;  2M7N A;  3SJS A;  1MWN A;  1SR6 C;  2NCO A;  1L2O B;  2JT0 A;  5I8N A;  1A75 B;  3I5G B;  1ZMZ A;  2M3W A;  2NXQ A;  4NQG A;  3TUY C;  2JT8 A;  4YGD B;  2BCX A;  3BXK A;  3FIA A;  1PVB A;  3GK4 X;  1QIV A;  1X02 A;  1DMO A;  1JF2 A;  3PFV A;  3FWB A;  2KI4 B;  5K89 A;  3AKB A;  1YUU A;  2Y5I A;  4BY5 A;  2VRG A;  4JQ0 D;  1SY9 A;  1B47 A;  2KNE A;  3FWC A;  3OB2 B;  2NZ0 A;  1K9U A;  1NX3 A;  2GGZ A;  1TNX A;  3AKA A;  1XFY O;  4PAL A;  3CS1 A;  1J7Q A;  3QRX A;  2KOT A;  1KCY A;  1Y1A A;  3IQQ A;  2L0P A;  1R2U A;  1FW4 A;  1EL4 A;  1ZFS A;  1Q80 A;  2LMV A;  2MJW B;  2Q91 A;  2BKI B;  1NP8 A;  1DGV A;  3OX5 A;  3LK1 A;  2JUL A;  2LLS A;  1XK4 C;  1EJ3 A;  2F3Z A;  5D7F A;  3BQ3 A;  5I2Q A;  3DVJ A;  2SCP A;  3K21 A;  1WRK A;  1HT9 A;  1KFX S;  1OMR A;  2JNX A;  3H4S E;  4I5K A;  3C1V A;  1TIZ A;  4MZJ A;  3I5H C;  5JJG A;  1BLQ A;  1YUT A;  2BCA A;  2KYC A;  3TDU A;  1AHR A;  1G8I A;  2G2B A;  3DVM A;  2KQY A;  4GGF C;  4MZK A;  1DF0 B;  1CLL A;  2KFH A;  4OV2 A;  2M1K B;  4HRH A;  1LA3 A;  2LAP A;  2V53 A;  3HCM A;  4OKH A;  2ISD A;  1S26 D;  1MF8 B;  1OMD A;  1G4Y R;  1VRK A;  1SL8 A;  3SIA A;  2EGD A;  4YI9 A;  1F70 A;  1CDM A;  1OSA A;  4GUK A;  1PK0 D;  5ER4 X;  1TCO B;  4GBA A;  4BY4 A;  1KWO B;  2CT9 A;  2MLE C;  1S6C A;  1JUO A;  3CR4 X;  2WCB A;  3DVK A;  1BG1 A;  1UHH A;  3O4Y A;  1S6I A;  3PLF B;  1NPQ A;  2EC6 C;  1K95 A;  5KSZ A;  4M2P A;  2LP2 A;  3RM1 A;  2KAY A;  4AQJ A;  1CDN A;  3WNX B;  3I5F B;  1XO5 A;  1CNP A;  2K7B A;  1AK8 A;  2LNK A;  5AFP A;  1A03 A;  2OTG C;  2E30 A;  1BOD A;  1XFX O;  4DCK A;  3SG6 A;  1ODB A;  3KF9 A;  1HQV A;  2ZRS A;  1XK4 A;  2KBI A;  1SPY A;  1M31 A;  2WCF A;  3PSR A;  1RK9 A;  3NSK A;  4USL A;  4OVN F;  4ORB B;  1YVL A;  2BBM A;  1BOC A;  1OZS A;  3CLN A;  1YVH A;  5F6T A;  2BL0 C;  3KEV A;  1J1E A;  3PN7 C;  1S36 A;  3VRR A;  4XJK A;  4PHM A;  1EG3 A;  2KBM A;  1K8U A;  3GK2 A;  3TS5 C;  4F0Z B;  3CTN A;  4GGF A;  4P5O E;  1K2H A;  2IS9 A;  2EC6 B;  1WLM A;  2F33 A;  3DF0 A;  1SW8 A;  1QLK A;  1XFZ O;  4YGB B;  1B8R A;  2OS8 B;  1JF0 A;  1IRJ A;  4M2O A;  1UUR A;  1NIW A;  2BEC A;  2LVI A;  3I5I C;  1F54 A;  5CSF A;  1QJT A;  1IH0 A;  1TNQ A;  4NDB A;  1XFV O;  1NSH A;  2M49 B;  1AJ4 A;  2WND A;  2LLT A;  2LVJ A;  5AXI A;  4NDD A;  4ZCV A;  1K94 A;  3VRN A;  1UHI A;  4ORA B;  3AAJ A;  1DGU A;  1LIN A;  1QAS A;  2HF5 A;  1QAT A;  1KQV A;  4PHK A;  2LUX A;  4MLW A;  1CFC A;  2JOJ A;  1FBV A;  2I7A A;  1RFJ A;  1V1F A;  1RJV A;  3A8R A;  4HRG A;  1CFP A;  2KSP A;  1UUS A;  5TNC A;  1IQ5 A;  1KQM C;  1B8L A;  2CCM A;  4FTG A;  1QIW A;  2F3Y A;  1MUX A;  1TN4 A;  1W7J B;  1WDC B;  2CTN A;  1JC2 A;  1KK8 B;  4I5L B;  1OZO A;  1B7T Z;  5GQQ C;  2PRU A;  1PAL A;  1TNP A;  2LC5 A;  2WC8 A;  3CR5 X;  4PDZ A;  4PE1 A;  3CWG A;  5BPJ A;  1D1O A;  1LVC D;  1N0Y A;  4U8D A;  2LP3 A;  1F71 A;  3EK8 A;  2HQ8 A;  2D8N A;  1TCF A;  3F45 A;  2MHH A;  2ZKM X;  2JT3 A;  5DKR A;  3SG4 A;  5KTY A;  2BE4 A;  1MXE A;  1QX2 A;  1B8C A;  1N2D A;  3BUN B;  2MLF C;  2LE9 B;  1M63 B;  2O5G A;  4AQI A;  1F55 A;  1TRF A;  4YRU A;  2KHN A;  2L2E A;  2JU0 A;  3DD4 A;  1N65 A;  2AMI A;  1DJG A;  4DUQ A;  1CDL A;  1IJ6 A;  1SR6 B;  2L98 A;  2LMU A;  2LAN A;  2LVK A;  1A29 A;  2Y4Q A;  1CKK A;  1B4C A;  4XYN A;  4PHN A;  3TUY B;  4QJ5 B;  3O78 A;  2BKH B;  1KFX L;  1MHO A;  2KFG A;  3NXA A;  5HYD A;  1OE9 B;  2HET A;  1CDP A;  1NUB A;  2JPT A;  2ZRT A;  3PM8 A;  4AOM A;  4HRE E;  4GNK B;  2G9B A;  1QXP A;  1DJY A;  1M45 A;  4C0K A;  1MR8 A;  2L4I A;  3VGO A;  1BR1 B;  3EK4 A;  2K7O A;  2ZND A;  4NDC A;  2AAO A;  2ZNE A;  3JTD C;  4MBE A;  2HQW A;  4CPV A;  4QJ3 B;  2Y1M A;  1QLS A;  5AER A;  3BUW B;  4MEW A;  1QX7 A;  5KU1 A;  2Q4U A;  3EKH A;  2KGB C;  4ORC B;  3SG2 A;  2WCE A;  4N1G A;  5IBW A;  1LXF C;  2ZFD A;  5AAN A;  2JQ6 A;  1V1G A;  4DIR A;  3IQO A;  3I5H B;  1QX5 B;  4GPL B;  5AEQ A;  2JRF A;  2O60 A;  2BE6 A;  1PVA A;  1QVI Y;  1NWD A;  4JPZ B;  1M39 A;  1TTX A;  4L9M A;  4XJK B;  1J7O A;  1B9A A;  2ZN8 A;  3BOW B;  2K2F A;  1QVI Z;  2DOQ A;  5DKN A;  4ZCU A;  1AVS A;  1EG4 A;  2PSR A;  1YUS A;  1NX1 A;  2WOS A;  1CFD A;  1KFU S;  3PAL A;  3BUX B;  1KK7 Y;  4E68 A;  2FCD A;  1WY9 A;  1SKT A;  1SYM A;  4HSZ A;  1KK7 Z;  1NCY A;  3E3R A;  4MRX A;  5DKQ A;  1WRZ A;  5CSJ A;  3NSI A;  4WQ3 A;  1TNW A;  2Y1N A;  1W7I B;  4I5J A;  3TDI A;  4CFQ A;  3DVE A;  4WQ2 A;  2LV7 A;  2RGI A;  2M8U A;  2M0R A;  5JOL A;  1OOJ A;  5ER5 A;  1A4P A;  3EKJ A;  4MZL A;  2JXC A;  5I2L A;  3SG7 A;  1FPW A;  5CPV A;  1SCM C;  2K8M B;  1G33 A;  2H2K A;  4DRW A;  1S3P A;  2OTG B;  1CM1 A;  2LLU A;  5CSI A;  5CSN A;  1CFF A;  2K0J A;  1MXL C;  3HX4 A;  3O2P A;  4N5X A;  1DT7 B;  1NCX A;  1E8A A;  3ICB A;  5HKW A;  1C7W A;  1SMG A;  4I5N B;  4R1E A;  3RLZ A;  2BL0 B;  1R6P A;  5G08 A;  2I2R E;  2KFF A;  3PN7 B;  4M2Q A;  1Y0V H;  4C0L A;  3ZWH A;  3WXA A;  1ZOT B;  1L2O C;  3TS5 B;  1FI6 A;  1XYD A;  2KI6 D;  3SG3 A;  3I5G C;  1KSM A;  1K96 A;  1YR5 A;  2EHB A;  3LL8 B;  1H8B A;  2MAZ A;  1FI5 A;  3OHM B;  1B7T Y;  2F8P A;  1CB1 A;  1S1E A;  2KI4 C;  1UWO A;  2FCE A;  4YGA A;  5HLV A;  4DS7 A;  1QV0 A;  2R2I A;  1UP5 A;  2HPS A;  3D0Y A;  3OP0 A;  4JWQ A;  4YGC B;  3VRP A;  2TN4 A;  3M0W A;  4YGE B;  3I5I B;  4D1E A;  1UHK A;  4MSP A;  2GGM A;  1IGV A;  1FF1 A;  1SBJ A;  1XFW O;  1SL9 A;  3CZT X;  2JXL A;  4PE0 A;  2K61 A;  1K9P A;  2LMT A;  3VRQ A;  4C0J A;  2M29 A;  3OB1 B;  5I2O A;  1IKU A;  1S6J A;  2KI6 C;  3EVR A;  1WRL A;  2M97 A;  1EXR A;  3BYA A;  1F8H A;  1JWD A;  1U5I A;  2CBL A;  2FOT A;  1NCZ A;  2LCP A;  2B1U A;  2BCB A;  1KSO A;  2QPT A;  1XVJ A;  2E6W A;  3LK0 A;  1ZAC A;  1JSA A;  1KQM B;  2KGR A;  3OX6 A;  1C07 A;  1K9K A;  4IL1 A;  5B8I B;  1IQ3 A;  2CNP A;  1YX7 A;  4WRI A;  4A4C A;  2K7D A;  2P6B B;  3BUO B;  3A4U B;  2LHL A;  1GQM A;  1SRA A;  1NX0 A;  1DJX A;  2PVB A;  3TDZ A;  2L51 A;  1ALW A;  1A75 A;  1JFK A;  2AUC A;  2H61 C;  2FJU B;  2MRD A;  1C7V A;  5PAL A;  1KWO C;  2M7L A;  2JNF A;  5FYX A;  4CFR A;  3SIB A;  1MQ1 A;  2F2P A;  3WHU B;  1EH2 A;  4PCW A;  1PUL A;  1NX2 A;  1RTP 1;  3LCP C;  1UHJ A;  1DTL A;  1TOP A;  1ZUZ A;  3NSL A;  1BF5 A;  3I5F C;  1IG5 A;  2MBX A;  4P2Y B;  1GGZ A;  1QTX A;  4MN0 A;  2PMY A;  2GV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...