2L98A

Structure of trans-resveratrol in complex with the cardiac regulatory protein troponin c
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Structure of trans-Resveratrol in Complex with the Cardiac Regulatory Protein Troponin C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2l98A00
4P5OE 1B8RA 1NWDA 3SG7A 3LK1A 2MRDA 4C0JA 1IKUA 2OTGB 3DF0B 5KU1A 4PE1A 1JSAA 1S3PA 1R2UA 2LHIA 2LUCA 1NCXA 2BE4A 4DRWA 1OSAA 1DJZA 4GUKA 1DVIA 4N1FA 2MBXA 1DJHA 4OVNF 5G08A 2CNPA 1FF1A 3TDZA 1S6IA 1U5IA 2G2BA 1OZSA 4CPVA 2KGBC 2KOTA 1NIWA 1A4PA 1QIWA 3PALA 1ALVA 2LP3A 1JFKA 1C7WA 3DVJA 1IRJA 2NZ0A 4A4BA 1NUBA 3DD4A 4FQOA 1S1EA 2LP2A 1EG3A 1YVHA 3TUYB 1PSBA 1QVIZ 2KNEA 1K2HA 1AJ4A 1YRTB 4DCKA 5K89A 3QRXA 3VRQA 2I94A 2KFFA 1ODBA 5AANA 2MLFC 1CDPA 1S5GY 2K7DA 2QACA 1B9AA 3SG6A 5AFPA 1XFYO 3LK0A 3OB2B 4NDDA 1PVAA 2VRGA 1QX5B 2Q4UA 4PE4A 1QV1A 1XO5A 1QV0A 2L4HA 1ZOTB 1XK4C 1S6CA 1YX8A 2LAPA 2M0RA 1Y1XA 1YVLA 2OTGC 1H8BA 5HKYA 5HLOA 4L9MA 4C0KA 1G8IA 4XJKA 1SKTA 5CSNA 1QTXA 1SW8A 1V1GA 2JTTA 1JF0A 2KI4B 3BUNB 3M0WA 3CGAA 1KFXS 1XA5A 5KSZA 2M3WA 1BODA 1CLMA 2PSRA 1Y0VH 3D10A 4U8DA 5HLVA 1EXRA 2BE6A 2M49B 1IJ5A 1CDMA 3GK2A 2FCEA 2KFGA 3OP0A 4DIRA 1A75A 1KWOB 1WRLA 2ZNEA 1F70A 1HQVA 1IH0A 3HX4A 2FOTA 5TNCA 1SPYA 1CFDA 3TUYC 2BKIB 1AHRA 3O2PA 1QLKA 4CLNA 3CTNA 2CT9A 1ZFSA 1B47A 1FI5A 2HQ8A 2AAOA 2K8MB 4OCIA 1CFPA 3BOWA 1DF0B 2L4IA 4GBAA 2JPTA 3DVMA 2COLB 5DKQA 3RM1A 2KAXA 1UURA 2M7NA 1SL8A 3SG2A 1BR1B 1PALA 1SK6D 1HT9A 3TS5C 1EJ3A 1XFZO 2L50A 3OX5A 5JJGA 1FBVA 1XFVO 1QVIY 1B8LA 3SJSA 4GPLB 4M2PA 2JULA 3EK4A 2BCBA 1BT6A 1YX7A 1VRKA 1K90D 3KHEA 4PALA 4MLWA 1K9UA 2HPSA 1CMGA 3EKJA 1GJYA 1IJ6A 1BF5A 5JOLA 2KI4C 2K2AA 2MJWB 3I5HB 4QJ5B 1ZMZA 3FWCA 1EL4A 4MZLA 1S26D 2Y4QA 1YR5A 2EC6B 2JXCA 3TDUA 1GGWA 2OPOA 1C7VA 4PE0A 1KWOC 2IS9A 3SIBA 1TNPA 1QXPA 2SCPA 2JC2A 1RROA 2KAYA 3CR4X 4HREE 1MUXA 2LLUA 3IF7A 1DT7B 4PDZA 5AEQA 1IG5A 2JWWA 3VROA 1JC2A 1ALWA 3AKBA 2D8NA 1G33A 4GGFA 4WQ3A 2PASA 4C0LA 1UP5A 3VGOA 2SASA 1N2DA 1NX2A 1UHHA 2WC8A 3EKHA 2PALA 5IBWA 2K7BA 4MSPA 3BUXB 1K96A 1BR4B 1SYMA 2JNFA 2F2PA 2WCBA 2BCXA 1SNLA 1V1FA 1M46A 1PVBA 2LUXA 1XVJA 2K0JA 2M97A 1MXLC 1F8HA 2KDHA 2LLTA 4IL1A 1DGUA 1IWQA 4D1EA 5CPVA 3H4SE 2GV5A 3AKAA 1K94A 1GGZA 4MVFA 2LHLA 4N1GA 3EK7A 4MEWA 4CFRA 2H2KA 4A4CA 2BL0B 3PFVA 1YTZC 1MWNA 3I5GB 1SCVA 1WRZA 1U5IB 3ZNIA 3PATA 3O6BA 2WORA 1WRKA 4CFQA 2BBMA 2DOQA 1AK8A 1DJXA 2LMUA 2PMYA 3IQQA 2L5XB 5I2LA 3I5HC 1JWDA 1FW4A 1MHOA 1UHIA 2ZN9A 4PHMA 2O5GA 2EC6C 4PHKA 1UHNA 1TCOB 3AAJA 4ZCUA 4PHJA 4I5NB 4M2OA 3TS5B 1S36A 1W7IB 3GOFA 1IQ5A 1J7QA 3PN7B 4NDBA 2LVJA 2BCAA 5BPJA 1KFUS 2NXQA 1QATA 2QPTA 1LVCD 2K61A 3ICBA 1DJIA 1K93D 5GQQC 2ZN8A 4MRYA 1KK7Y 4JWQA 3KO0A 5B8IB 2MAZA 1TIZA 2L0PA 1RECA 4XYNA 1KSMA 1B4CA 2JTZA 3IQOA 4OR9B 1F4QA 3SG4A 3CWGA 1TNQA 2F2OA 4WQ2A 2JZIA 4XJKB 1CFFA 1D1OA 4GGNA 2K7CA 2LM5A 2R2IA 2WOSA 5D69A 1IQ3A 1J7RA 1EG4A 1NX1A 1LA3A 3FS7A 2JOJA 2V53A 2BL0C 1PSRA 1JF2A 2NCOA 3CR5X 2HQWA 5I2OA 3F45A 1NP8A 1ZACA 3I5GC 3O78A 2AMIA 2LLSA 2Y5IA 5CSIA 1LINA 1E8AA 3A4UB 2F8PA 1A75B 1FI6A 1ZUZA 1SY9A 2KSPA 2KQYA 1S6JA 2KBMA 2BKHB 2KYFA 2I2RE 4OV2A 1BJFA 2B1UA 4ICBA 1N0YA 4YI9A 1DJYA 3HCMA 1DJGA 1TN4A 1WLMA 5D7FA 1LKJA 2JT8A 3OHMB 1AJ5A 1NSHA 1SBJA 4MZJA 2L98A 2K2FA 4ETOA 1QASA 1QIVA 3EVRA 2K7OA 1UHJA 2WNDA 3VRPA 3PN7C 3BOWB 5HKZA 1OQPA 4M2QA 4PHNA 5F6TA 1NCZA 2BECA 2LVKA 2FJUB 5FYXA 1JUOA 2OS8B 1CTRA 4FTGA 2EGDA 1F71A 2WCFA 1J7PA 4F0ZB 4MRXA 1OMVA 1J1DA 2Y1MA 3BUOB 5ER4X 3EVUA 2ZKMX 4MBEA 3EK8A 3VRNA 2JU0A 3GK4X 1B1GA 1KK7Z 2LVVA 1F4OA 1LA0A 1GQMA 3BUWB 3VRRA 3WHTB 1QS7A 1IGVA 3RLZA 2Q91A 1SL7A 4P2YB 3NSLA 2LV7A 1A03A 1F54A 1B7TZ 4QJ4B 1J1EA 1NX3A 1F55A 1KFXL 1TOPA 1W7JB 1JBAA 1XFXO 1TNWA 3DVEA 4ORCB 4AOMA 1L2OB 1EH2A 3I5FB 1BMOA 2JT3A 1NX0A 3KPXA 2AUCA 1CFCA 1TTXA 5DKRA 5DKNA 2F3YA 1SMGA 1RTP1 5CSFA 1SCMB 4DUQA 1RJVA 2NCPA 2M7LA 1FPWA 1M63B 1QX2A 4USLA 1KCYA 1QJTA 5AERA 3I5IB 2A4JA 1NPQA 3DF0A 4GFTA 1A29A 2M1UA 1XFWO 3LL8B 1TCFA 1YURA 3BQ3A 1K9PA 1Y1UA 1OMDA 3K21A 5I8NA 4HRGA 1NCYA 1CLLA 2M29A 4PCWA 1Y1AA 4YGBB 3SG5A 1RWYA 1KQMB 1R6PA 2OS8C 2MLEC 2EHBA 1M45A 3JTDB 2O60A 2ZNDA 2KI6C 1KQVA 2ZRSA 4NQGA 2JNXA 4YGAA 2FCDA 1AVSA 3C1VA 4YGEB 3BXKA 1K8UA 1C07A 4UPGA 2CTNA 1TRFA 2KAVA 1LXFC 2GGMA 1X02A 5J3XA 3LCPC 2LC5A 3FIAA 2KI6D 1J55A 4JQ0D 1G4YR 2JQ6A 1J7OA 2HETA 2LMVA 2E6WA 4YI8A 4AQIA 1BLQA 1NYAA 1DGVA 2P6BB 1RFJA 5CSJA 3KEVA 1DMOA 4R1EA 3WXAA 4PE7A 3EVVA 1L2OC 1N65A 3ZWHA 3I5FC 1JFJA 3D0YA 4I5KA 4I5LB 2ZFDA 2PRUA 5ER5A 1DJWA 1SCMC 3OB1B 1MR8A 2KGRA 3BUMB 2HF5A 4NDCA 4TNCA 1PK0D 2JT0A 1K95A 1YRUB 4GGFC 1Y6WA 1CB1A 3I5IC 1SR6B 1A2XA 3D0YB 5HKWA 4QJ3B 3PM8A 1WDCB 2ISDA 1AP4A 2KHNA 1PRWA 1B7TY 3KF9A 4HSZA 3PSRA 4BY4A 1RK9A 4DS7A 2H61A 1KQMC 2LANA 1DTLA 1KK8B 2LE9B 3LLEA 3A8RA 4MN0A 1MQ1A 4N5XA 1CDLA 3WHUB 3JTDC 1BG1A 2CXJA 3SG3A 1CMFA 4ZCVA 1M39A 2LMTA 1CKKA 5PALA 1WY9A 4I5JA 3SIAA 4AQJA 5I2QA 1CNPA 3E3RA 1XFUO 3FWBA 3MSEB 3AAKA 1BOCA 3CR2A 1QX7A 2LCPA 4MZKA 3NSIA 1SL9A 4ORAB 3TZ1A 1H4BA 1OZOA 2RGIA 4JPZB 2WCEA 1OMRA 4OKHA 3NXAA 1BU3A 4ORBB 1MXEA 2F33A 1DF0A 3JVTB 1CM1A 3PLFB 3WNXB 2M8UA 4WRIA 4YGDB 4YBHB 1UWOA 2JRFA 1YUTA 1QLSA 4Q04A 3NSKA 1CDNA 1CLBA 4YRUA 2PVBA 4YGCB 3CZTX 3CS1A 1Q80A 1B8CA 2G9BA 2F3ZA 1SR6C 2KFHA 1KFUL 1UUSA 1MF8B 1PULA 1YUSA 2L51A 2MA2A 3DVKA 1S5GZ 2GGZA 1TNXA 1OOJA 1WDCC 3TDIA 1WLZA 2TN4A 2I18A 2M9GA 3GK1A 2Y1NA 1KK8C 4GAOA 2JXLA 4BY5A 4HRHA 2LVIA 3OX6A 1YUUA 1M31A 2KQ6A 2I7AA 1OE9B 1CM4A 2LNKA 5AXIA 2ZRTA 4CIDA 4E68A 2NLNA 1AUIB 2E30A 2L2EA 2H61C 2CCMA 3NSOA 2KYCA 2CBLA 1XK4A 1SRAA 4GNKB 1L7ZA 1XYDA 2BBNA 5KTYA 2M1KB 3CLNA 5HYDA 3O4YA 1KSOA 1UHKA 2MHHA 2KBIA 3BYAA 1K9KA 3JVTC
chains in the Genus database with same CATH superfamily
4P5OE 1B8RA 3EG5B 1NWDA 3S0GA 3SG7A 3LK1A 2MRDA 4C0JA 1IKUA 2OTGB 3DF0B 5KU1A 4PE1A 1JSAA 1S3PA 3OGNA 1R2UA 2LHIA 2LUCA 1NCXA 2BE4A 4DRWA 1OSAA 1DJZA 4GUKA 1DVIA 3L47A 3R1OA 4INWA 4N1FA 2MBXA 1DJHA 3BJHA 4OVNF 5G08A 2PQLA 2CNPA 1FF1A 3TDZA 1S6IA 1U5IA 2G2BA 1OZSA 4CPVA 1ORGA 2KGBC 2KOTA 1NIWA 3SS4A 1A4PA 1QIWA 3NHIA 2BNXA 1ALVA 3PALA 2LP3A 1JFKA 1C7WA 3DVJA 1IRJA 1TUZA 2NZ0A 1NUBA 4A4BA 3DD4A 4FQOA 1S1EA 2LP2A 1EG3A 1YVHA 3TUYB 1PSBA 1QVIZ 2KNEA 3V2LA 1K2HA 1AJ4A 1YRTB 4DCKA 5K89A 3QRXA 3VRQA 2I94A 2KFFA 1ODBA 5AANA 3SS3A 2MLFC 1CDPA 1S5GY 2K7DA 2QACA 1B9AA 3SG6A 5AFPA 1XFYO 3LK0A 3OB2B 4NDDA 1PVAA 2VRGA 1QX5B 1C3ZA 2Q4UA 4PE4A 1QV1A 2WCMA 3B88A 1XO5A 1QV0A 2L4HA 2WC6A 1ZOTB 1XK4C 1S6CA 3R1PA 1YX8A 2LAPA 2M0RA 1Y1XA 1YVLA 2OTGC 1H8BA 5HKYA 5FI2A 4L9MA 5HLOA 1G8IA 4C0KA 1Z4HA 4XJKA 1SKTA 3D74A 5CSNA 1QTXA 1SW8A 1V1GA 3DXLA 2JTTA 1JF0A 2KI4B 3BUNB 1DQEA 3M0WA 3CGAA 1KFXS 1XA5A 5KSZA 2M3WA 3BFAA 1BODA 1CLMA 2PSRA 1Y0VH 3D10A 2YGUA 4U8DA 1EXRA 2BE6A 5HLVA 3UNWA 2M49B 1GM0A 1IJ5A 1CDMA 3GK2A 2FCEA 2KFGA 3OP0A 4DIRA 1A75A 1KWOB 1WRLA 2ZNEA 1F70A 1HQVA 1IH0A 1DELA 3HX4A 2FOTA 3BFBA 5TNCA 1SPYA 1CFDA 3TUYC 2BKIB 1AHRA 3O2PA 2KPHA 1QLKA 3L4LA 4CLNA 3CTNA 2CT9A 3OBVA 1ZFSA 1B47A 3CZ2A 1FI5A 3D76A 2HQ8A 2AAOA 2K8MB 1IIOA 2QDIA 4OCIA 1CFPA 3BOWA 1DF0B 2L4IA 4GBAA 2JPTA 3DVMA 2COLB 4INXA 5DKQA 3RM1A 2KAXA 1UURA 2M7NA 1SL8A 3B87A 3NHTA 3SG2A 1BR1B 1PALA 1SK6D 1HT9A 3TS5C 1EJ3A 1XFZO 2L50A 3OX5A 5JJGA 1FBVA 1XFVO 1QVIY 1B8LA 3SJSA 4GPLB 4M2PA 5EL2A 2JULA 3EK4A 2BCBA 3FE9A 2QEVA 1BT6A 1YX7A 1VRKA 1K90D 3KHEA 1OOGA 4PALA 4MLWA 1K9UA 2HPSA 1CMGA 3EKJA 1GJYA 1IJ6A 1BF5A 5JOLA 2KI4C 5I94A 2K60A 1C3YA 2K2AA 2MJWB 3CZ0A 3I5HB 4QJ5B 1ZMZA 3FWCA 1EL4A 4MZLA 1S26D 2Y4QA 4KYNA 1DC1A 1YR5A 2EC6B 2JXCA 3TDUA 1GGWA 2OPOA 1C7VA 4PE0A 1KWOC 2IS9A 3SIBA 1TNPA 1QXPA 2KLEA 2JC2A 1RROA 2KAYA 2SCPA 3CR4X 4HREE 1MUXA 2LLUA 3IF7A 1DT7B 1AP4A 4PDZA 5AEQA 1IG5A 2JWWA 3VROA 1JC2A 1ALWA 3AKBA 2D8NA 1G33A 4GGFA 4WQ3A 2PASA 4C0LA 1UP5A 3VB1A 2SASA 3VGOA 1N2DA 1NX2A 3QMEA 1QWVA 1UHHA 2WC8A 3EKHA 2PALA 5IBWA 2K7BA 4MSPA 3BUXB 1K96A 2WCKA 1BR4B 1SYMA 2JNFA 2F2PA 2WCBA 2BCXA 2QEBA 1SNLA 1V1FA 1M46A 1PVBA 2LUXA 1XVJA 2K0JA 2M97A 1MXLC 1F8HA 2KDHA 2LLTA 4IL1A 1DGUA 1IWQA 3D78A 4D1EA 5CPVA 3H4SE 2GV5A 3Q8IA 3AKAA 1K94A 1GGZA 4MVFA 2LHLA 4N1GA 5D3OA 3EK7A 4MEWA 4CFRA 2H2KA 2WC5A 4A4CA 2BL0B 3PFVA 1YTZC 1MWNA 3I5GB 1SCVA 1WRZA 1U5IB 3D77A 3PATA 3ZNIA 3O6BA 2WORA 1WRKA 4CFQA 2BBMA 2DOQA 1AK8A 1DJXA 2LMUA 2PMYA 3IQQA 2L5XB 5I2LA 3I5HC 1JWDA 1FW4A 1MHOA 1UHIA 1OW4A 2ZN9A 4PHMA 2O5GA 2EC6C 4PHKA 1UHNA 1TCOB 3AAJA 4ZCUA 2QEOA 4PHJA 4I5NB 4M2OA 3TS5B 3B6XA 1S36A 2GTEA 3PM2A 1W7IB 3GOFA 1IQ5A 1J7QA 3PN7B 4NDBA 2LVJA 2BCAA 5BPJA 1KFUS 2NXQA 1QATA 2QPTA 1LVCD 2K61A 3ICBA 1DJIA 4IJ7A 1K93D 5GQQC 2ZN8A 4MRYA 1KK7Y 4JWQA 3KO0A 5B8IB 2MAZA 1TIZA 2L0PA 2WCLA 1RECA 4XYNA 1KSMA 1B4CA 2JTZA 3IQOA 4OR9B 1F4QA 1OOFA 3SG4A 3CWGA 1TNQA 2F2OA 4WQ2A 2JZIA 1Z2CB 2L2CA 4XJKB 1CFFA 1D1OA 4GGNA 2WCJA 2K7CA 2LM5A 2R2IA 2WOSA 5D69A 1IQ3A 1J7RA 1EG4A 1NX1A 1LA3A 1LS8A 3FS7A 2JOJA 2V53A 2BL0C 1PSRA 1JF2A 2NCOA 3CR5X 2HQWA 5I2OA 1DEKA 3F45A 1NP8A 1ZACA 3I5GC 3O78A 2AMIA 2LLSA 2Y5IA 3DY9A 5CSIA 1LINA 1E8AA 3A4UB 3IVTA 2F8PA 1A75B 1FI6A 1ZUZA 1SY9A 3L4AA 2KSPA 2KQYA 5FI6A 1S6JA 2KBMA 2BKHB 2KYFA 2I2RE 2JPOA 4OV2A 1BJFA 2B1UA 4ICBA 1N0YA 4YI9A 2WCHA 1DJYA 3HCMA 1DJGA 1TN4A 1WLMA 5D7FA 1LKJA 2JT8A 1P28A 1AJ5A 1NSHA 3NGVA 3OHMB 1SBJA 4MZJA 2L98A 2K2FA 4ETOA 1QASA 1QIVA 3EVRA 2K7OA 1UHJA 2WNDA 3VRPA 3PN7C 3BOWB 5HKZA 1OQPA 4M2QA 4PHNA 5F6TA 1NCZA 2BECA 2LVKA 2FJUB 5FYXA 1JUOA 2OS8B 1CTRA 4FTGA 2EGDA 1F71A 2WCFA 1J7PA 4F0ZB 4MRXA 1OMVA 1J1DA 2Y1MA 3BUOB 5ER4X 3EVUA 1OOIX 2ZKMX 4MBEA 3EK8A 3VRNA 2JU0A 3GK4X 1B1GA 1KK7Z 4F7FA 2LVVA 1F4OA 3SS5A 1LA0A 1GQMA 3BUWB 2BAPA 3VRRA 3WHTB 4JKTA 1QS7A 1IGVA 3RLZA 2Q91A 1SL7A 1TUJA 4P2YB 4PT1A 3NSLA 2LV7A 1A03A 1F54A 1B7TZ 4QJ4B 1J1EA 1NX3A 1F55A 1KFXL 1TOPA 1W7JB 1JBAA 1XFXO 1TNWA 3DVEA 4ORCB 4AOMA 2KLDA 1L2OB 1EH2A 3I5FB 1BMOA 2JT3A 1NX0A 3KPXA 2AUCA 1CFCA 1TTXA 5DKRA 5DKNA 2F3YA 1SMGA 1RTP1 5CSFA 1SCMB 4DUQA 1RJVA 2NCPA 2M7LA 3S0FA 1FPWA 1M63B 1QX2A 4USLA 1KCYA 1QJTA 3CZ1A 5AERA 3I5IB 2A4JA 1NPQA 3DF0A 4GFTA 1A29A 2M1UA 3B7AA 1XFWO 3LL8B 1TCFA 1YURA 3BQ3A 1K9PA 1Y1UA 1OMDA 3K21A 3PJIA 5I8NA 4HRGA 1NCYA 1CLLA 2M29A 4PCWA 1Y1AA 3N7HA 4YGBB 3SG5A 1RWYA 1KQMB 1R6PA 1XFRA 2OS8C 3S0AA 2MLEC 3R1VA 2EHBA 1M45A 3JTDB 2P70A 2O60A 2ZNDA 2KI6C 1KQVA 2ZRSA 4NQGA 2JNXA 4YGAA 2FCDA 1AVSA 3C1VA 4YGEB 3BXKA 1K8UA 1C07A 5FI7A 4UPGA 2CTNA 1TRFA 2KAVA 1LXFC 2GGMA 2PYQA 1OOHA 1X02A 3CABA 5J3XA 3LCPC 2LC5A 5DICA 3FIAA 2KI6D 1J55A 4JQ0D 1G4YR 2JQ6A 1J7OA 2HETA 2LMVA 2E6WA 3DZTA 4YI8A 4AQIA 1BLQA 1NYAA 1DGVA 2P6BB 1RFJA 5CSJA 3R72A 3KEVA 1SSEB 4R1EA 1DMOA 3WXAA 4PE7A 3EVVA 1L2OC 1N65A 3ZWHA 3I5FC 1JFJA 3D0YA 3S0BA 4I5KA 3D73A 4I5LB 2ZFDA 2PRUA 3K1EA 5ER5A 1DJWA 1SCMC 3OB1B 1MR8A 2KGRA 3BUMB 2HF5A 4NDCA 4TNCA 1PK0D 2JT0A 1K95A 1YRUB 4GGFC 1Y6WA 1CB1A 3I5IC 1SR6B 1A2XA 3D0YB 5HKWA 3B86A 4QJ3B 3BFHA 3UO9A 3PM8A 1WDCB 3DYEA 2ISDA 2KHNA 1PRWA 1B7TY 1T14A 3KF9A 3PSRA 2L5YA 1RK9A 4HSZA 2H61A 1KQMC 4BY4A 2LANA 1DTLA 1KK8B 2LE9B 3LLEA 3A8RA 4MN0A 1MQ1A 4N5XA 1CDLA 3WHUB 3JTDC 4OZDA 1BG1A 2CXJA 3SG3A 1CMFA 4ZCVA 1M39A 2LMTA 1CKKA 5PALA 1WY9A 4I5JA 3SIAA 1W9ZA 4AQJA 5I2QA 1CNPA 3E3RA 1XFUO 3FWBA 3MSEB 3AAKA 1BOCA 3CR2A 1QX7A 2LCPA 4MZKA 3NSIA 3CYZA 3CDNA 1SL9A 3O4XA 2P71A 2FJYA 4ORAB 3TZ1A 1H4BA 1OZOA 2RGIA 4JPZB 2WCEA 1OMRA 4OKHA 3NXAA 1BU3A 4ORBB 1MXEA 2ERBA 2F33A 1DF0A 3JVTB 1CM1A 3PLFB 3WNXB 3S0EA 2M8UA 4WRIA 5HL1A 4YGDB 4YBHB 1UWOA 2JRFA 1YUTA 2QEHA 1QLSA 4Q04A 3NSKA 1CDNA 1CLBA 4YRUA 2PVBA 4YGCB 3CZTX 3CS1A 3FE8A 1Q80A 1B8CA 2G9BA 2F3ZA 1SR6C 2KFHA 4FQTA 1KFUL 3RZSA 1UUSA 1MF8B 1PULA 1YUSA 2L51A 2MA2A 3DVKA 1S5GZ 2GGZA 1TNXA 1OOJA 1WDCC 3TDIA 1WLZA 2TN4A 2I18A 2M9GA 3GK1A 4JD9A 2Y1NA 1KK8C 4GAOA 2JXLA 4BY5A 4HRHA 2LVIA 3OX6A 1YUUA 1M31A 2KQ6A 3S0DA 3D75A 2I7AA 1OE9B 1CM4A 2LNKA 5AXIA 2ZRTA 4CIDA 4E68A 2NLNA 1AUIB 2E30A 2L2EA 2H61C 2CCMA 2H8VA 3NSOA 2KYCA 2CBLA 1XK4A 1SRAA 4GNKB 1TWOA 1L7ZA 1XYDA 2BBNA 4DS7A 5KTYA 2M1KB 3CLNA 5HYDA 3O4YA 1KSOA 1UHKA 2MHHA 2KBIA 3BYAA 1K9KA 3JVTC 3FE6A
chains in the Genus database with same CATH topology
4P5OE 1B8RA 1NWDA 3SG7A 3LK1A 2MRDA 4C0JA 1IKUA 2OTGB 3DF0B 5KU1A 4PE1A 1JSAA 1S3PA 1R2UA 2LHIA 2LUCA 1NCXA 2BE4A 4DRWA 1OSAA 1DJZA 4GUKA 1DVIA 4N1FA 2MBXA 1DJHA 4OVNF 5G08A 2CNPA 1FF1A 3TDZA 1S6IA 1U5IA 2G2BA 1OZSA 4CPVA 2KGBC 2KOTA 1NIWA 1A4PA 1QIWA 3PALA 1ALVA 2LP3A 1JFKA 1C7WA 3DVJA 1IRJA 2NZ0A 4A4BA 1NUBA 3DD4A 4FQOA 1S1EA 2LP2A 1EG3A 1YVHA 3TUYB 1PSBA 1QVIZ 2KNEA 1K2HA 1AJ4A 1YRTB 4DCKA 5K89A 3QRXA 3VRQA 2I94A 2KFFA 1ODBA 5AANA 2MLFC 1CDPA 1S5GY 2K7DA 2QACA 1B9AA 3SG6A 5AFPA 1XFYO 3LK0A 3OB2B 4NDDA 1PVAA 2VRGA 1QX5B 2Q4UA 4PE4A 1QV1A 1XO5A 1QV0A 2L4HA 1ZOTB 1XK4C 1S6CA 1YX8A 2LAPA 2M0RA 1Y1XA 1YVLA 2OTGC 1H8BA 5HKYA 5HLOA 4L9MA 4C0KA 1G8IA 4XJKA 1SKTA 5CSNA 1QTXA 1SW8A 1V1GA 2JTTA 1JF0A 2KI4B 3BUNB 3M0WA 3CGAA 1KFXS 1XA5A 5KSZA 2M3WA 1BODA 1CLMA 2PSRA 1Y0VH 3D10A 4U8DA 5HLVA 1EXRA 2BE6A 2M49B 1IJ5A 1CDMA 3GK2A 2FCEA 2KFGA 3OP0A 4DIRA 1A75A 1KWOB 1WRLA 2ZNEA 1F70A 1HQVA 1IH0A 3HX4A 2FOTA 5TNCA 1SPYA 1CFDA 3TUYC 2BKIB 1AHRA 3O2PA 1QLKA 4CLNA 3CTNA 2CT9A 1ZFSA 1B47A 1FI5A 2HQ8A 2AAOA 2K8MB 4OCIA 1CFPA 3BOWA 1DF0B 2L4IA 4GBAA 2JPTA 3DVMA 2COLB 5DKQA 3RM1A 2KAXA 1UURA 2M7NA 1SL8A 3SG2A 1BR1B 1PALA 1SK6D 1HT9A 3TS5C 1EJ3A 1XFZO 2L50A 3OX5A 5JJGA 1FBVA 1XFVO 1QVIY 1B8LA 3SJSA 4GPLB 4M2PA 2JULA 3EK4A 2BCBA 1BT6A 1YX7A 1VRKA 1K90D 3KHEA 4PALA 4MLWA 1K9UA 2HPSA 1CMGA 3EKJA 1GJYA 1IJ6A 1BF5A 5JOLA 2KI4C 2K2AA 2MJWB 3I5HB 4QJ5B 1ZMZA 3FWCA 1EL4A 4MZLA 1S26D 2Y4QA 1YR5A 2EC6B 2JXCA 3TDUA 1GGWA 2OPOA 1C7VA 4PE0A 1KWOC 2IS9A 3SIBA 1TNPA 1QXPA 2SCPA 2JC2A 1RROA 2KAYA 3CR4X 4HREE 1MUXA 2LLUA 3IF7A 1DT7B 4PDZA 5AEQA 1IG5A 2JWWA 3VROA 1JC2A 1ALWA 3AKBA 2D8NA 1G33A 4GGFA 4WQ3A 2PASA 4C0LA 1UP5A 3VGOA 2SASA 1N2DA 1NX2A 1UHHA 2WC8A 3EKHA 2PALA 5IBWA 2K7BA 4MSPA 3BUXB 1K96A 1BR4B 1SYMA 2JNFA 2F2PA 2WCBA 2BCXA 1SNLA 1V1FA 1M46A 1PVBA 2LUXA 1XVJA 2K0JA 2M97A 1MXLC 1F8HA 2KDHA 2LLTA 4IL1A 1DGUA 1IWQA 4D1EA 5CPVA 3H4SE 2GV5A 3AKAA 1K94A 1GGZA 4MVFA 2LHLA 4N1GA 3EK7A 4MEWA 4CFRA 2H2KA 4A4CA 2BL0B 3PFVA 1YTZC 1MWNA 3I5GB 1SCVA 1WRZA 1U5IB 3ZNIA 3PATA 3O6BA 2WORA 1WRKA 4CFQA 2BBMA 2DOQA 1AK8A 1DJXA 2LMUA 2PMYA 3IQQA 2L5XB 5I2LA 3I5HC 1JWDA 1FW4A 1MHOA 1UHIA 2ZN9A 4PHMA 2O5GA 2EC6C 4PHKA 1UHNA 1TCOB 3AAJA 4ZCUA 4PHJA 4I5NB 4M2OA 3TS5B 1S36A 1W7IB 3GOFA 1IQ5A 1J7QA 3PN7B 4NDBA 2LVJA 2BCAA 5BPJA 1KFUS 2NXQA 1QATA 2QPTA 1LVCD 2K61A 3ICBA 1DJIA 1K93D 5GQQC 2ZN8A 4MRYA 1KK7Y 4JWQA 3KO0A 5B8IB 2MAZA 1TIZA 2L0PA 1RECA 4XYNA 1KSMA 1B4CA 2JTZA 3IQOA 4OR9B 1F4QA 3SG4A 3CWGA 1TNQA 2F2OA 4WQ2A 2JZIA 4XJKB 1CFFA 1D1OA 4GGNA 2K7CA 2LM5A 2R2IA 2WOSA 5D69A 1IQ3A 1J7RA 1EG4A 1NX1A 1LA3A 3FS7A 2JOJA 2V53A 2BL0C 1PSRA 1JF2A 2NCOA 3CR5X 2HQWA 5I2OA 3F45A 1NP8A 1ZACA 3I5GC 3O78A 2AMIA 2LLSA 2Y5IA 5CSIA 1LINA 1E8AA 3A4UB 2F8PA 1A75B 1FI6A 1ZUZA 1SY9A 2KSPA 2KQYA 1S6JA 2KBMA 2BKHB 2KYFA 2I2RE 4OV2A 1BJFA 2B1UA 4ICBA 1N0YA 4YI9A 1DJYA 3HCMA 1DJGA 1TN4A 1WLMA 5D7FA 1LKJA 2JT8A 3OHMB 1AJ5A 1NSHA 1SBJA 4MZJA 2L98A 2K2FA 4ETOA 1QASA 1QIVA 3EVRA 2K7OA 1UHJA 2WNDA 3VRPA 3PN7C 3BOWB 5HKZA 1OQPA 4M2QA 4PHNA 5F6TA 1NCZA 2BECA 2LVKA 2FJUB 5FYXA 1JUOA 2OS8B 1CTRA 4FTGA 2EGDA 1F71A 2WCFA 1J7PA 4F0ZB 4MRXA 1OMVA 1J1DA 2Y1MA 3BUOB 5ER4X 3EVUA 2ZKMX 4MBEA 3EK8A 3VRNA 2JU0A 3GK4X 1B1GA 1KK7Z 2LVVA 1F4OA 1LA0A 1GQMA 3BUWB 3VRRA 3WHTB 1QS7A 1IGVA 3RLZA 2Q91A 1SL7A 4P2YB 3NSLA 2LV7A 1A03A 1F54A 1B7TZ 4QJ4B 1J1EA 1NX3A 1F55A 1KFXL 1TOPA 1W7JB 1JBAA 1XFXO 1TNWA 3DVEA 4ORCB 4AOMA 1L2OB 1EH2A 3I5FB 1BMOA 2JT3A 1NX0A 3KPXA 2AUCA 1CFCA 1TTXA 5DKRA 5DKNA 2F3YA 1SMGA 1RTP1 5CSFA 1SCMB 4DUQA 1RJVA 2NCPA 2M7LA 1FPWA 1M63B 1QX2A 4USLA 1KCYA 1QJTA 5AERA 3I5IB 2A4JA 1NPQA 3DF0A 4GFTA 1A29A 2M1UA 1XFWO 3LL8B 1TCFA 1YURA 3BQ3A 1K9PA 1Y1UA 1OMDA 3K21A 5I8NA 4HRGA 1NCYA 1CLLA 2M29A 4PCWA 1Y1AA 4YGBB 3SG5A 1RWYA 1KQMB 1R6PA 2OS8C 2MLEC 2EHBA 1M45A 3JTDB 2O60A 2ZNDA 2KI6C 1KQVA 2ZRSA 4NQGA 2JNXA 4YGAA 2FCDA 1AVSA 3C1VA 4YGEB 3BXKA 1K8UA 1C07A 4UPGA 2CTNA 1TRFA 2KAVA 1LXFC 2GGMA 1X02A 5J3XA 3LCPC 2LC5A 3FIAA 2KI6D 1J55A 4JQ0D 1G4YR 2JQ6A 1J7OA 2HETA 2LMVA 2E6WA 4YI8A 4AQIA 1BLQA 1NYAA 1DGVA 2P6BB 1RFJA 5CSJA 3KEVA 1DMOA 4R1EA 3WXAA 4PE7A 3EVVA 1L2OC 1N65A 3ZWHA 3I5FC 1JFJA 3D0YA 4I5KA 4I5LB 2ZFDA 2PRUA 5ER5A 1DJWA 1SCMC 3OB1B 1MR8A 2KGRA 3BUMB 2HF5A 4NDCA 4TNCA 1PK0D 2JT0A 1K95A 1YRUB 4GGFC 1Y6WA 1CB1A 3I5IC 1SR6B 1A2XA 3D0YB 5HKWA 4QJ3B 3PM8A 1WDCB 2ISDA 1AP4A 2KHNA 1PRWA 1B7TY 3KF9A 4HSZA 3PSRA 4BY4A 1RK9A 4DS7A 2H61A 1KQMC 2LANA 1DTLA 1KK8B 2LE9B 3LLEA 3A8RA 4MN0A 1MQ1A 4N5XA 1CDLA 3WHUB 3JTDC 1BG1A 2CXJA 3SG3A 1CMFA 4ZCVA 1M39A 2LMTA 1CKKA 5PALA 1WY9A 4I5JA 3SIAA 4AQJA 5I2QA 1CNPA 3E3RA 1XFUO 3FWBA 3MSEB 3AAKA 1BOCA 3CR2A 1QX7A 2LCPA 4MZKA 3NSIA 1SL9A 4ORAB 3TZ1A 1H4BA 1OZOA 2RGIA 4JPZB 2WCEA 1OMRA 4OKHA 3NXAA 1BU3A 4ORBB 1MXEA 2F33A 1DF0A 3JVTB 1CM1A 3PLFB 3WNXB 2M8UA 4WRIA 4YGDB 4YBHB 1UWOA 2JRFA 1YUTA 1QLSA 4Q04A 3NSKA 1CDNA 1CLBA 4YRUA 2PVBA 4YGCB 3CZTX 3CS1A 1Q80A 1B8CA 2G9BA 2F3ZA 1SR6C 2KFHA 1KFUL 1UUSA 1MF8B 1PULA 1YUSA 2L51A 2MA2A 3DVKA 1S5GZ 2GGZA 1TNXA 1OOJA 1WDCC 3TDIA 1WLZA 2TN4A 2I18A 2M9GA 3GK1A 2Y1NA 1KK8C 4GAOA 2JXLA 4BY5A 4HRHA 2LVIA 3OX6A 1YUUA 1M31A 2KQ6A 2I7AA 1OE9B 1CM4A 2LNKA 5AXIA 2ZRTA 4CIDA 4E68A 2NLNA 1AUIB 2E30A 2L2EA 2H61C 2CCMA 3NSOA 2KYCA 2CBLA 1XK4A 1SRAA 4GNKB 1L7ZA 1XYDA 2BBNA 5KTYA 2M1KB 3CLNA 5HYDA 3O4YA 1KSOA 1UHKA 2MHHA 2KBIA 3BYAA 1K9KA 3JVTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O E;  1B8R A;  1NWD A;  3SG7 A;  3LK1 A;  2MRD A;  4C0J A;  1IKU A;  2OTG B;  3DF0 B;  5KU1 A;  4PE1 A;  1JSA A;  1S3P A;  1R2U A;  2LHI A;  2LUC A;  1NCX A;  2BE4 A;  4DRW A;  1OSA A;  1DJZ A;  4GUK A;  1DVI A;  4N1F A;  2MBX A;  1DJH A;  4OVN F;  5G08 A;  2CNP A;  1FF1 A;  3TDZ A;  1S6I A;  1U5I A;  2G2B A;  1OZS A;  4CPV A;  2KGB C;  2KOT A;  1NIW A;  1A4P A;  1QIW A;  3PAL A;  1ALV A;  2LP3 A;  1JFK A;  1C7W A;  3DVJ A;  1IRJ A;  2NZ0 A;  4A4B A;  1NUB A;  3DD4 A;  4FQO A;  1S1E A;  2LP2 A;  1EG3 A;  1YVH A;  3TUY B;  1PSB A;  1QVI Z;  2KNE A;  1K2H A;  1AJ4 A;  1YRT B;  4DCK A;  5K89 A;  3QRX A;  3VRQ A;  2I94 A;  2KFF A;  1ODB A;  5AAN A;  2MLF C;  1CDP A;  1S5G Y;  2K7D A;  2QAC A;  1B9A A;  3SG6 A;  5AFP A;  1XFY O;  3LK0 A;  3OB2 B;  4NDD A;  1PVA A;  2VRG A;  1QX5 B;  2Q4U A;  4PE4 A;  1QV1 A;  1XO5 A;  1QV0 A;  2L4H A;  1ZOT B;  1XK4 C;  1S6C A;  1YX8 A;  2LAP A;  2M0R A;  1Y1X A;  1YVL A;  2OTG C;  1H8B A;  5HKY A;  5HLO A;  4L9M A;  4C0K A;  1G8I A;  4XJK A;  1SKT A;  5CSN A;  1QTX A;  1SW8 A;  1V1G A;  2JTT A;  1JF0 A;  2KI4 B;  3BUN B;  3M0W A;  3CGA A;  1KFX S;  1XA5 A;  5KSZ A;  2M3W A;  1BOD A;  1CLM A;  2PSR A;  1Y0V H;  3D10 A;  4U8D A;  5HLV A;  1EXR A;  2BE6 A;  2M49 B;  1IJ5 A;  1CDM A;  3GK2 A;  2FCE A;  2KFG A;  3OP0 A;  4DIR A;  1A75 A;  1KWO B;  1WRL A;  2ZNE A;  1F70 A;  1HQV A;  1IH0 A;  3HX4 A;  2FOT A;  5TNC A;  1SPY A;  1CFD A;  3TUY C;  2BKI B;  1AHR A;  3O2P A;  1QLK A;  4CLN A;  3CTN A;  2CT9 A;  1ZFS A;  1B47 A;  1FI5 A;  2HQ8 A;  2AAO A;  2K8M B;  4OCI A;  1CFP A;  3BOW A;  1DF0 B;  2L4I A;  4GBA A;  2JPT A;  3DVM A;  2COL B;  5DKQ A;  3RM1 A;  2KAX A;  1UUR A;  2M7N A;  1SL8 A;  3SG2 A;  1BR1 B;  1PAL A;  1SK6 D;  1HT9 A;  3TS5 C;  1EJ3 A;  1XFZ O;  2L50 A;  3OX5 A;  5JJG A;  1FBV A;  1XFV O;  1QVI Y;  1B8L A;  3SJS A;  4GPL B;  4M2P A;  2JUL A;  3EK4 A;  2BCB A;  1BT6 A;  1YX7 A;  1VRK A;  1K90 D;  3KHE A;  4PAL A;  4MLW A;  1K9U A;  2HPS A;  1CMG A;  3EKJ A;  1GJY A;  1IJ6 A;  1BF5 A;  5JOL A;  2KI4 C;  2K2A A;  2MJW B;  3I5H B;  4QJ5 B;  1ZMZ A;  3FWC A;  1EL4 A;  4MZL A;  1S26 D;  2Y4Q A;  1YR5 A;  2EC6 B;  2JXC A;  3TDU A;  1GGW A;  2OPO A;  1C7V A;  4PE0 A;  1KWO C;  2IS9 A;  3SIB A;  1TNP A;  1QXP A;  2SCP A;  2JC2 A;  1RRO A;  2KAY A;  3CR4 X;  4HRE E;  1MUX A;  2LLU A;  3IF7 A;  1DT7 B;  4PDZ A;  5AEQ A;  1IG5 A;  2JWW A;  3VRO A;  1JC2 A;  1ALW A;  3AKB A;  2D8N A;  1G33 A;  4GGF A;  4WQ3 A;  2PAS A;  4C0L A;  1UP5 A;  3VGO A;  2SAS A;  1N2D A;  1NX2 A;  1UHH A;  2WC8 A;  3EKH A;  2PAL A;  5IBW A;  2K7B A;  4MSP A;  3BUX B;  1K96 A;  1BR4 B;  1SYM A;  2JNF A;  2F2P A;  2WCB A;  2BCX A;  1SNL A;  1V1F A;  1M46 A;  1PVB A;  2LUX A;  1XVJ A;  2K0J A;  2M97 A;  1MXL C;  1F8H A;  2KDH A;  2LLT A;  4IL1 A;  1DGU A;  1IWQ A;  4D1E A;  5CPV A;  3H4S E;  2GV5 A;  3AKA A;  1K94 A;  1GGZ A;  4MVF A;  2LHL A;  4N1G A;  3EK7 A;  4MEW A;  4CFR A;  2H2K A;  4A4C A;  2BL0 B;  3PFV A;  1YTZ C;  1MWN A;  3I5G B;  1SCV A;  1WRZ A;  1U5I B;  3ZNI A;  3PAT A;  3O6B A;  2WOR A;  1WRK A;  4CFQ A;  2BBM A;  2DOQ A;  1AK8 A;  1DJX A;  2LMU A;  2PMY A;  3IQQ A;  2L5X B;  5I2L A;  3I5H C;  1JWD A;  1FW4 A;  1MHO A;  1UHI A;  2ZN9 A;  4PHM A;  2O5G A;  2EC6 C;  4PHK A;  1UHN A;  1TCO B;  3AAJ A;  4ZCU A;  4PHJ A;  4I5N B;  4M2O A;  3TS5 B;  1S36 A;  1W7I B;  3GOF A;  1IQ5 A;  1J7Q A;  3PN7 B;  4NDB A;  2LVJ A;  2BCA A;  5BPJ A;  1KFU S;  2NXQ A;  1QAT A;  2QPT A;  1LVC D;  2K61 A;  3ICB A;  1DJI A;  1K93 D;  5GQQ C;  2ZN8 A;  4MRY A;  1KK7 Y;  4JWQ A;  3KO0 A;  5B8I B;  2MAZ A;  1TIZ A;  2L0P A;  1REC A;  4XYN A;  1KSM A;  1B4C A;  2JTZ A;  3IQO A;  4OR9 B;  1F4Q A;  3SG4 A;  3CWG A;  1TNQ A;  2F2O A;  4WQ2 A;  2JZI A;  4XJK B;  1CFF A;  1D1O A;  4GGN A;  2K7C A;  2LM5 A;  2R2I A;  2WOS A;  5D69 A;  1IQ3 A;  1J7R A;  1EG4 A;  1NX1 A;  1LA3 A;  3FS7 A;  2JOJ A;  2V53 A;  2BL0 C;  1PSR A;  1JF2 A;  2NCO A;  3CR5 X;  2HQW A;  5I2O A;  3F45 A;  1NP8 A;  1ZAC A;  3I5G C;  3O78 A;  2AMI A;  2LLS A;  2Y5I A;  5CSI A;  1LIN A;  1E8A A;  3A4U B;  2F8P A;  1A75 B;  1FI6 A;  1ZUZ A;  1SY9 A;  2KSP A;  2KQY A;  1S6J A;  2KBM A;  2BKH B;  2KYF A;  2I2R E;  4OV2 A;  1BJF A;  2B1U A;  4ICB A;  1N0Y A;  4YI9 A;  1DJY A;  3HCM A;  1DJG A;  1TN4 A;  1WLM A;  5D7F A;  1LKJ A;  2JT8 A;  3OHM B;  1AJ5 A;  1NSH A;  1SBJ A;  4MZJ A;  2L98 A;  2K2F A;  4ETO A;  1QAS A;  1QIV A;  3EVR A;  2K7O A;  1UHJ A;  2WND A;  3VRP A;  3PN7 C;  3BOW B;  5HKZ A;  1OQP A;  4M2Q A;  4PHN A;  5F6T A;  1NCZ A;  2BEC A;  2LVK A;  2FJU B;  5FYX A;  1JUO A;  2OS8 B;  1CTR A;  4FTG A;  2EGD A;  1F71 A;  2WCF A;  1J7P A;  4F0Z B;  4MRX A;  1OMV A;  1J1D A;  2Y1M A;  3BUO B;  5ER4 X;  3EVU A;  2ZKM X;  4MBE A;  3EK8 A;  3VRN A;  2JU0 A;  3GK4 X;  1B1G A;  1KK7 Z;  2LVV A;  1F4O A;  1LA0 A;  1GQM A;  3BUW B;  3VRR A;  3WHT B;  1QS7 A;  1IGV A;  3RLZ A;  2Q91 A;  1SL7 A;  4P2Y B;  3NSL A;  2LV7 A;  1A03 A;  1F54 A;  1B7T Z;  4QJ4 B;  1J1E A;  1NX3 A;  1F55 A;  1KFX L;  1TOP A;  1W7J B;  1JBA A;  1XFX O;  1TNW A;  3DVE A;  4ORC B;  4AOM A;  1L2O B;  1EH2 A;  3I5F B;  1BMO A;  2JT3 A;  1NX0 A;  3KPX A;  2AUC A;  1CFC A;  1TTX A;  5DKR A;  5DKN A;  2F3Y A;  1SMG A;  1RTP 1;  5CSF A;  1SCM B;  4DUQ A;  1RJV A;  2NCP A;  2M7L A;  1FPW A;  1M63 B;  1QX2 A;  4USL A;  1KCY A;  1QJT A;  5AER A;  3I5I B;  2A4J A;  1NPQ A;  3DF0 A;  4GFT A;  1A29 A;  2M1U A;  1XFW O;  3LL8 B;  1TCF A;  1YUR A;  3BQ3 A;  1K9P A;  1Y1U A;  1OMD A;  3K21 A;  5I8N A;  4HRG A;  1NCY A;  1CLL A;  2M29 A;  4PCW A;  1Y1A A;  4YGB B;  3SG5 A;  1RWY A;  1KQM B;  1R6P A;  2OS8 C;  2MLE C;  2EHB A;  1M45 A;  3JTD B;  2O60 A;  2ZND A;  2KI6 C;  1KQV A;  2ZRS A;  4NQG A;  2JNX A;  4YGA A;  2FCD A;  1AVS A;  3C1V A;  4YGE B;  3BXK A;  1K8U A;  1C07 A;  4UPG A;  2CTN A;  1TRF A;  2KAV A;  1LXF C;  2GGM A;  1X02 A;  5J3X A;  3LCP C;  2LC5 A;  3FIA A;  2KI6 D;  1J55 A;  4JQ0 D;  1G4Y R;  2JQ6 A;  1J7O A;  2HET A;  2LMV A;  2E6W A;  4YI8 A;  4AQI A;  1BLQ A;  1NYA A;  1DGV A;  2P6B B;  1RFJ A;  5CSJ A;  3KEV A;  1DMO A;  4R1E A;  3WXA A;  4PE7 A;  3EVV A;  1L2O C;  1N65 A;  3ZWH A;  3I5F C;  1JFJ A;  3D0Y A;  4I5K A;  4I5L B;  2ZFD A;  2PRU A;  5ER5 A;  1DJW A;  1SCM C;  3OB1 B;  1MR8 A;  2KGR A;  3BUM B;  2HF5 A;  4NDC A;  4TNC A;  1PK0 D;  2JT0 A;  1K95 A;  1YRU B;  4GGF C;  1Y6W A;  1CB1 A;  3I5I C;  1SR6 B;  1A2X A;  3D0Y B;  5HKW A;  4QJ3 B;  3PM8 A;  1WDC B;  2ISD A;  1AP4 A;  2KHN A;  1PRW A;  1B7T Y;  3KF9 A;  4HSZ A;  3PSR A;  4BY4 A;  1RK9 A;  4DS7 A;  2H61 A;  1KQM C;  2LAN A;  1DTL A;  1KK8 B;  2LE9 B;  3LLE A;  3A8R A;  4MN0 A;  1MQ1 A;  4N5X A;  1CDL A;  3WHU B;  3JTD C;  1BG1 A;  2CXJ A;  3SG3 A;  1CMF A;  4ZCV A;  1M39 A;  2LMT A;  1CKK A;  5PAL A;  1WY9 A;  4I5J A;  3SIA A;  4AQJ A;  5I2Q A;  1CNP A;  3E3R A;  1XFU O;  3FWB A;  3MSE B;  3AAK A;  1BOC A;  3CR2 A;  1QX7 A;  2LCP A;  4MZK A;  3NSI A;  1SL9 A;  4ORA B;  3TZ1 A;  1H4B A;  1OZO A;  2RGI A;  4JPZ B;  2WCE A;  1OMR A;  4OKH A;  3NXA A;  1BU3 A;  4ORB B;  1MXE A;  2F33 A;  1DF0 A;  3JVT B;  1CM1 A;  3PLF B;  3WNX B;  2M8U A;  4WRI A;  4YGD B;  4YBH B;  1UWO A;  2JRF A;  1YUT A;  1QLS A;  4Q04 A;  3NSK A;  1CDN A;  1CLB A;  4YRU A;  2PVB A;  4YGC B;  3CZT X;  3CS1 A;  1Q80 A;  1B8C A;  2G9B A;  2F3Z A;  1SR6 C;  2KFH A;  1KFU L;  1UUS A;  1MF8 B;  1PUL A;  1YUS A;  2L51 A;  2MA2 A;  3DVK A;  1S5G Z;  2GGZ A;  1TNX A;  1OOJ A;  1WDC C;  3TDI A;  1WLZ A;  2TN4 A;  2I18 A;  2M9G A;  3GK1 A;  2Y1N A;  1KK8 C;  4GAO A;  2JXL A;  4BY5 A;  4HRH A;  2LVI A;  3OX6 A;  1YUU A;  1M31 A;  2KQ6 A;  2I7A A;  1OE9 B;  1CM4 A;  2LNK A;  5AXI A;  2ZRT A;  4CID A;  4E68 A;  2NLN A;  1AUI B;  2E30 A;  2L2E A;  2H61 C;  2CCM A;  3NSO A;  2KYC A;  2CBL A;  1XK4 A;  1SRA A;  4GNK B;  1L7Z A;  1XYD A;  2BBN A;  5KTY A;  2M1K B;  3CLN A;  5HYD A;  3O4Y A;  1KSO A;  1UHK A;  2MHH A;  2KBI A;  3BYA A;  1K9K A;  3JVT C; 
#chains in the Genus database with same CATH topology
 4P5O E;  1B8R A;  3EG5 B;  1NWD A;  3S0G A;  3SG7 A;  3LK1 A;  2MRD A;  4C0J A;  1IKU A;  2OTG B;  3DF0 B;  5KU1 A;  4PE1 A;  1JSA A;  1S3P A;  3OGN A;  1R2U A;  2LHI A;  2LUC A;  1NCX A;  2BE4 A;  4DRW A;  1OSA A;  1DJZ A;  4GUK A;  1DVI A;  3L47 A;  3R1O A;  4INW A;  4N1F A;  2MBX A;  1DJH A;  3BJH A;  4OVN F;  5G08 A;  2PQL A;  2CNP A;  1FF1 A;  3TDZ A;  1S6I A;  1U5I A;  2G2B A;  1OZS A;  4CPV A;  1ORG A;  2KGB C;  2KOT A;  1NIW A;  3SS4 A;  1A4P A;  1QIW A;  3NHI A;  2BNX A;  1ALV A;  3PAL A;  2LP3 A;  1JFK A;  1C7W A;  3DVJ A;  1IRJ A;  1TUZ A;  2NZ0 A;  1NUB A;  4A4B A;  3DD4 A;  4FQO A;  1S1E A;  2LP2 A;  1EG3 A;  1YVH A;  3TUY B;  1PSB A;  1QVI Z;  2KNE A;  3V2L A;  1K2H A;  1AJ4 A;  1YRT B;  4DCK A;  5K89 A;  3QRX A;  3VRQ A;  2I94 A;  2KFF A;  1ODB A;  5AAN A;  3SS3 A;  2MLF C;  1CDP A;  1S5G Y;  2K7D A;  2QAC A;  1B9A A;  3SG6 A;  5AFP A;  1XFY O;  3LK0 A;  3OB2 B;  4NDD A;  1PVA A;  2VRG A;  1QX5 B;  1C3Z A;  2Q4U A;  4PE4 A;  1QV1 A;  2WCM A;  3B88 A;  1XO5 A;  1QV0 A;  2L4H A;  2WC6 A;  1ZOT B;  1XK4 C;  1S6C A;  3R1P A;  1YX8 A;  2LAP A;  2M0R A;  1Y1X A;  1YVL A;  2OTG C;  1H8B A;  5HKY A;  5FI2 A;  4L9M A;  5HLO A;  1G8I A;  4C0K A;  1Z4H A;  4XJK A;  1SKT A;  3D74 A;  5CSN A;  1QTX A;  1SW8 A;  1V1G A;  3DXL A;  2JTT A;  1JF0 A;  2KI4 B;  3BUN B;  1DQE A;  3M0W A;  3CGA A;  1KFX S;  1XA5 A;  5KSZ A;  2M3W A;  3BFA A;  1BOD A;  1CLM A;  2PSR A;  1Y0V H;  3D10 A;  2YGU A;  4U8D A;  1EXR A;  2BE6 A;  5HLV A;  3UNW A;  2M49 B;  1GM0 A;  1IJ5 A;  1CDM A;  3GK2 A;  2FCE A;  2KFG A;  3OP0 A;  4DIR A;  1A75 A;  1KWO B;  1WRL A;  2ZNE A;  1F70 A;  1HQV A;  1IH0 A;  1DEL A;  3HX4 A;  2FOT A;  3BFB A;  5TNC A;  1SPY A;  1CFD A;  3TUY C;  2BKI B;  1AHR A;  3O2P A;  2KPH A;  1QLK A;  3L4L A;  4CLN A;  3CTN A;  2CT9 A;  3OBV A;  1ZFS A;  1B47 A;  3CZ2 A;  1FI5 A;  3D76 A;  2HQ8 A;  2AAO A;  2K8M B;  1IIO A;  2QDI A;  4OCI A;  1CFP A;  3BOW A;  1DF0 B;  2L4I A;  4GBA A;  2JPT A;  3DVM A;  2COL B;  4INX A;  5DKQ A;  3RM1 A;  2KAX A;  1UUR A;  2M7N A;  1SL8 A;  3B87 A;  3NHT A;  3SG2 A;  1BR1 B;  1PAL A;  1SK6 D;  1HT9 A;  3TS5 C;  1EJ3 A;  1XFZ O;  2L50 A;  3OX5 A;  5JJG A;  1FBV A;  1XFV O;  1QVI Y;  1B8L A;  3SJS A;  4GPL B;  4M2P A;  5EL2 A;  2JUL A;  3EK4 A;  2BCB A;  3FE9 A;  2QEV A;  1BT6 A;  1YX7 A;  1VRK A;  1K90 D;  3KHE A;  1OOG A;  4PAL A;  4MLW A;  1K9U A;  2HPS A;  1CMG A;  3EKJ A;  1GJY A;  1IJ6 A;  1BF5 A;  5JOL A;  2KI4 C;  5I94 A;  2K60 A;  1C3Y A;  2K2A A;  2MJW B;  3CZ0 A;  3I5H B;  4QJ5 B;  1ZMZ A;  3FWC A;  1EL4 A;  4MZL A;  1S26 D;  2Y4Q A;  4KYN A;  1DC1 A;  1YR5 A;  2EC6 B;  2JXC A;  3TDU A;  1GGW A;  2OPO A;  1C7V A;  4PE0 A;  1KWO C;  2IS9 A;  3SIB A;  1TNP A;  1QXP A;  2KLE A;  2JC2 A;  1RRO A;  2KAY A;  2SCP A;  3CR4 X;  4HRE E;  1MUX A;  2LLU A;  3IF7 A;  1DT7 B;  1AP4 A;  4PDZ A;  5AEQ A;  1IG5 A;  2JWW A;  3VRO A;  1JC2 A;  1ALW A;  3AKB A;  2D8N A;  1G33 A;  4GGF A;  4WQ3 A;  2PAS A;  4C0L A;  1UP5 A;  3VB1 A;  2SAS A;  3VGO A;  1N2D A;  1NX2 A;  3QME A;  1QWV A;  1UHH A;  2WC8 A;  3EKH A;  2PAL A;  5IBW A;  2K7B A;  4MSP A;  3BUX B;  1K96 A;  2WCK A;  1BR4 B;  1SYM A;  2JNF A;  2F2P A;  2WCB A;  2BCX A;  2QEB A;  1SNL A;  1V1F A;  1M46 A;  1PVB A;  2LUX A;  1XVJ A;  2K0J A;  2M97 A;  1MXL C;  1F8H A;  2KDH A;  2LLT A;  4IL1 A;  1DGU A;  1IWQ A;  3D78 A;  4D1E A;  5CPV A;  3H4S E;  2GV5 A;  3Q8I A;  3AKA A;  1K94 A;  1GGZ A;  4MVF A;  2LHL A;  4N1G A;  5D3O A;  3EK7 A;  4MEW A;  4CFR A;  2H2K A;  2WC5 A;  4A4C A;  2BL0 B;  3PFV A;  1YTZ C;  1MWN A;  3I5G B;  1SCV A;  1WRZ A;  1U5I B;  3D77 A;  3PAT A;  3ZNI A;  3O6B A;  2WOR A;  1WRK A;  4CFQ A;  2BBM A;  2DOQ A;  1AK8 A;  1DJX A;  2LMU A;  2PMY A;  3IQQ A;  2L5X B;  5I2L A;  3I5H C;  1JWD A;  1FW4 A;  1MHO A;  1UHI A;  1OW4 A;  2ZN9 A;  4PHM A;  2O5G A;  2EC6 C;  4PHK A;  1UHN A;  1TCO B;  3AAJ A;  4ZCU A;  2QEO A;  4PHJ A;  4I5N B;  4M2O A;  3TS5 B;  3B6X A;  1S36 A;  2GTE A;  3PM2 A;  1W7I B;  3GOF A;  1IQ5 A;  1J7Q A;  3PN7 B;  4NDB A;  2LVJ A;  2BCA A;  5BPJ A;  1KFU S;  2NXQ A;  1QAT A;  2QPT A;  1LVC D;  2K61 A;  3ICB A;  1DJI A;  4IJ7 A;  1K93 D;  5GQQ C;  2ZN8 A;  4MRY A;  1KK7 Y;  4JWQ A;  3KO0 A;  5B8I B;  2MAZ A;  1TIZ A;  2L0P A;  2WCL A;  1REC A;  4XYN A;  1KSM A;  1B4C A;  2JTZ A;  3IQO A;  4OR9 B;  1F4Q A;  1OOF A;  3SG4 A;  3CWG A;  1TNQ A;  2F2O A;  4WQ2 A;  2JZI A;  1Z2C B;  2L2C A;  4XJK B;  1CFF A;  1D1O A;  4GGN A;  2WCJ A;  2K7C A;  2LM5 A;  2R2I A;  2WOS A;  5D69 A;  1IQ3 A;  1J7R A;  1EG4 A;  1NX1 A;  1LA3 A;  1LS8 A;  3FS7 A;  2JOJ A;  2V53 A;  2BL0 C;  1PSR A;  1JF2 A;  2NCO A;  3CR5 X;  2HQW A;  5I2O A;  1DEK A;  3F45 A;  1NP8 A;  1ZAC A;  3I5G C;  3O78 A;  2AMI A;  2LLS A;  2Y5I A;  3DY9 A;  5CSI A;  1LIN A;  1E8A A;  3A4U B;  3IVT A;  2F8P A;  1A75 B;  1FI6 A;  1ZUZ A;  1SY9 A;  3L4A A;  2KSP A;  2KQY A;  5FI6 A;  1S6J A;  2KBM A;  2BKH B;  2KYF A;  2I2R E;  2JPO A;  4OV2 A;  1BJF A;  2B1U A;  4ICB A;  1N0Y A;  4YI9 A;  2WCH A;  1DJY A;  3HCM A;  1DJG A;  1TN4 A;  1WLM A;  5D7F A;  1LKJ A;  2JT8 A;  1P28 A;  1AJ5 A;  1NSH A;  3NGV A;  3OHM B;  1SBJ A;  4MZJ A;  2L98 A;  2K2F A;  4ETO A;  1QAS A;  1QIV A;  3EVR A;  2K7O A;  1UHJ A;  2WND A;  3VRP A;  3PN7 C;  3BOW B;  5HKZ A;  1OQP A;  4M2Q A;  4PHN A;  5F6T A;  1NCZ A;  2BEC A;  2LVK A;  2FJU B;  5FYX A;  1JUO A;  2OS8 B;  1CTR A;  4FTG A;  2EGD A;  1F71 A;  2WCF A;  1J7P A;  4F0Z B;  4MRX A;  1OMV A;  1J1D A;  2Y1M A;  3BUO B;  5ER4 X;  3EVU A;  1OOI X;  2ZKM X;  4MBE A;  3EK8 A;  3VRN A;  2JU0 A;  3GK4 X;  1B1G A;  1KK7 Z;  4F7F A;  2LVV A;  1F4O A;  3SS5 A;  1LA0 A;  1GQM A;  3BUW B;  2BAP A;  3VRR A;  3WHT B;  4JKT A;  1QS7 A;  1IGV A;  3RLZ A;  2Q91 A;  1SL7 A;  1TUJ A;  4P2Y B;  4PT1 A;  3NSL A;  2LV7 A;  1A03 A;  1F54 A;  1B7T Z;  4QJ4 B;  1J1E A;  1NX3 A;  1F55 A;  1KFX L;  1TOP A;  1W7J B;  1JBA A;  1XFX O;  1TNW A;  3DVE A;  4ORC B;  4AOM A;  2KLD A;  1L2O B;  1EH2 A;  3I5F B;  1BMO A;  2JT3 A;  1NX0 A;  3KPX A;  2AUC A;  1CFC A;  1TTX A;  5DKR A;  5DKN A;  2F3Y A;  1SMG A;  1RTP 1;  5CSF A;  1SCM B;  4DUQ A;  1RJV A;  2NCP A;  2M7L A;  3S0F A;  1FPW A;  1M63 B;  1QX2 A;  4USL A;  1KCY A;  1QJT A;  3CZ1 A;  5AER A;  3I5I B;  2A4J A;  1NPQ A;  3DF0 A;  4GFT A;  1A29 A;  2M1U A;  3B7A A;  1XFW O;  3LL8 B;  1TCF A;  1YUR A;  3BQ3 A;  1K9P A;  1Y1U A;  1OMD A;  3K21 A;  3PJI A;  5I8N A;  4HRG A;  1NCY A;  1CLL A;  2M29 A;  4PCW A;  1Y1A A;  3N7H A;  4YGB B;  3SG5 A;  1RWY A;  1KQM B;  1R6P A;  1XFR A;  2OS8 C;  3S0A A;  2MLE C;  3R1V A;  2EHB A;  1M45 A;  3JTD B;  2P70 A;  2O60 A;  2ZND A;  2KI6 C;  1KQV A;  2ZRS A;  4NQG A;  2JNX A;  4YGA A;  2FCD A;  1AVS A;  3C1V A;  4YGE B;  3BXK A;  1K8U A;  1C07 A;  5FI7 A;  4UPG A;  2CTN A;  1TRF A;  2KAV A;  1LXF C;  2GGM A;  2PYQ A;  1OOH A;  1X02 A;  3CAB A;  5J3X A;  3LCP C;  2LC5 A;  5DIC A;  3FIA A;  2KI6 D;  1J55 A;  4JQ0 D;  1G4Y R;  2JQ6 A;  1J7O A;  2HET A;  2LMV A;  2E6W A;  3DZT A;  4YI8 A;  4AQI A;  1BLQ A;  1NYA A;  1DGV A;  2P6B B;  1RFJ A;  5CSJ A;  3R72 A;  3KEV A;  1SSE B;  4R1E A;  1DMO A;  3WXA A;  4PE7 A;  3EVV A;  1L2O C;  1N65 A;  3ZWH A;  3I5F C;  1JFJ A;  3D0Y A;  3S0B A;  4I5K A;  3D73 A;  4I5L B;  2ZFD A;  2PRU A;  3K1E A;  5ER5 A;  1DJW A;  1SCM C;  3OB1 B;  1MR8 A;  2KGR A;  3BUM B;  2HF5 A;  4NDC A;  4TNC A;  1PK0 D;  2JT0 A;  1K95 A;  1YRU B;  4GGF C;  1Y6W A;  1CB1 A;  3I5I C;  1SR6 B;  1A2X A;  3D0Y B;  5HKW A;  3B86 A;  4QJ3 B;  3BFH A;  3UO9 A;  3PM8 A;  1WDC B;  3DYE A;  2ISD A;  2KHN A;  1PRW A;  1B7T Y;  1T14 A;  3KF9 A;  3PSR A;  2L5Y A;  1RK9 A;  4HSZ A;  2H61 A;  1KQM C;  4BY4 A;  2LAN A;  1DTL A;  1KK8 B;  2LE9 B;  3LLE A;  3A8R A;  4MN0 A;  1MQ1 A;  4N5X A;  1CDL A;  3WHU B;  3JTD C;  4OZD A;  1BG1 A;  2CXJ A;  3SG3 A;  1CMF A;  4ZCV A;  1M39 A;  2LMT A;  1CKK A;  5PAL A;  1WY9 A;  4I5J A;  3SIA A;  1W9Z A;  4AQJ A;  5I2Q A;  1CNP A;  3E3R A;  1XFU O;  3FWB A;  3MSE B;  3AAK A;  1BOC A;  3CR2 A;  1QX7 A;  2LCP A;  4MZK A;  3NSI A;  3CYZ A;  3CDN A;  1SL9 A;  3O4X A;  2P71 A;  2FJY A;  4ORA B;  3TZ1 A;  1H4B A;  1OZO A;  2RGI A;  4JPZ B;  2WCE A;  1OMR A;  4OKH A;  3NXA A;  1BU3 A;  4ORB B;  1MXE A;  2ERB A;  2F33 A;  1DF0 A;  3JVT B;  1CM1 A;  3PLF B;  3WNX B;  3S0E A;  2M8U A;  4WRI A;  5HL1 A;  4YGD B;  4YBH B;  1UWO A;  2JRF A;  1YUT A;  2QEH A;  1QLS A;  4Q04 A;  3NSK A;  1CDN A;  1CLB A;  4YRU A;  2PVB A;  4YGC B;  3CZT X;  3CS1 A;  3FE8 A;  1Q80 A;  1B8C A;  2G9B A;  2F3Z A;  1SR6 C;  2KFH A;  4FQT A;  1KFU L;  3RZS A;  1UUS A;  1MF8 B;  1PUL A;  1YUS A;  2L51 A;  2MA2 A;  3DVK A;  1S5G Z;  2GGZ A;  1TNX A;  1OOJ A;  1WDC C;  3TDI A;  1WLZ A;  2TN4 A;  2I18 A;  2M9G A;  3GK1 A;  4JD9 A;  2Y1N A;  1KK8 C;  4GAO A;  2JXL A;  4BY5 A;  4HRH A;  2LVI A;  3OX6 A;  1YUU A;  1M31 A;  2KQ6 A;  3S0D A;  3D75 A;  2I7A A;  1OE9 B;  1CM4 A;  2LNK A;  5AXI A;  2ZRT A;  4CID A;  4E68 A;  2NLN A;  1AUI B;  2E30 A;  2L2E A;  2H61 C;  2CCM A;  2H8V A;  3NSO A;  2KYC A;  2CBL A;  1XK4 A;  1SRA A;  4GNK B;  1TWO A;  1L7Z A;  1XYD A;  2BBN A;  4DS7 A;  5KTY A;  2M1K B;  3CLN A;  5HYD A;  3O4Y A;  1KSO A;  1UHK A;  2MHH A;  2KBI A;  3BYA A;  1K9K A;  3JVT C;  3FE6 A; 
#chains in the Genus database with same CATH homology
 4P5O E;  1B8R A;  1NWD A;  3SG7 A;  3LK1 A;  2MRD A;  4C0J A;  1IKU A;  2OTG B;  3DF0 B;  5KU1 A;  4PE1 A;  1JSA A;  1S3P A;  1R2U A;  2LHI A;  2LUC A;  1NCX A;  2BE4 A;  4DRW A;  1OSA A;  1DJZ A;  4GUK A;  1DVI A;  4N1F A;  2MBX A;  1DJH A;  4OVN F;  5G08 A;  2CNP A;  1FF1 A;  3TDZ A;  1S6I A;  1U5I A;  2G2B A;  1OZS A;  4CPV A;  2KGB C;  2KOT A;  1NIW A;  1A4P A;  1QIW A;  3PAL A;  1ALV A;  2LP3 A;  1JFK A;  1C7W A;  3DVJ A;  1IRJ A;  2NZ0 A;  4A4B A;  1NUB A;  3DD4 A;  4FQO A;  1S1E A;  2LP2 A;  1EG3 A;  1YVH A;  3TUY B;  1PSB A;  1QVI Z;  2KNE A;  1K2H A;  1AJ4 A;  1YRT B;  4DCK A;  5K89 A;  3QRX A;  3VRQ A;  2I94 A;  2KFF A;  1ODB A;  5AAN A;  2MLF C;  1CDP A;  1S5G Y;  2K7D A;  2QAC A;  1B9A A;  3SG6 A;  5AFP A;  1XFY O;  3LK0 A;  3OB2 B;  4NDD A;  1PVA A;  2VRG A;  1QX5 B;  2Q4U A;  4PE4 A;  1QV1 A;  1XO5 A;  1QV0 A;  2L4H A;  1ZOT B;  1XK4 C;  1S6C A;  1YX8 A;  2LAP A;  2M0R A;  1Y1X A;  1YVL A;  2OTG C;  1H8B A;  5HKY A;  5HLO A;  4L9M A;  4C0K A;  1G8I A;  4XJK A;  1SKT A;  5CSN A;  1QTX A;  1SW8 A;  1V1G A;  2JTT A;  1JF0 A;  2KI4 B;  3BUN B;  3M0W A;  3CGA A;  1KFX S;  1XA5 A;  5KSZ A;  2M3W A;  1BOD A;  1CLM A;  2PSR A;  1Y0V H;  3D10 A;  4U8D A;  5HLV A;  1EXR A;  2BE6 A;  2M49 B;  1IJ5 A;  1CDM A;  3GK2 A;  2FCE A;  2KFG A;  3OP0 A;  4DIR A;  1A75 A;  1KWO B;  1WRL A;  2ZNE A;  1F70 A;  1HQV A;  1IH0 A;  3HX4 A;  2FOT A;  5TNC A;  1SPY A;  1CFD A;  3TUY C;  2BKI B;  1AHR A;  3O2P A;  1QLK A;  4CLN A;  3CTN A;  2CT9 A;  1ZFS A;  1B47 A;  1FI5 A;  2HQ8 A;  2AAO A;  2K8M B;  4OCI A;  1CFP A;  3BOW A;  1DF0 B;  2L4I A;  4GBA A;  2JPT A;  3DVM A;  2COL B;  5DKQ A;  3RM1 A;  2KAX A;  1UUR A;  2M7N A;  1SL8 A;  3SG2 A;  1BR1 B;  1PAL A;  1SK6 D;  1HT9 A;  3TS5 C;  1EJ3 A;  1XFZ O;  2L50 A;  3OX5 A;  5JJG A;  1FBV A;  1XFV O;  1QVI Y;  1B8L A;  3SJS A;  4GPL B;  4M2P A;  2JUL A;  3EK4 A;  2BCB A;  1BT6 A;  1YX7 A;  1VRK A;  1K90 D;  3KHE A;  4PAL A;  4MLW A;  1K9U A;  2HPS A;  1CMG A;  3EKJ A;  1GJY A;  1IJ6 A;  1BF5 A;  5JOL A;  2KI4 C;  2K2A A;  2MJW B;  3I5H B;  4QJ5 B;  1ZMZ A;  3FWC A;  1EL4 A;  4MZL A;  1S26 D;  2Y4Q A;  1YR5 A;  2EC6 B;  2JXC A;  3TDU A;  1GGW A;  2OPO A;  1C7V A;  4PE0 A;  1KWO C;  2IS9 A;  3SIB A;  1TNP A;  1QXP A;  2SCP A;  2JC2 A;  1RRO A;  2KAY A;  3CR4 X;  4HRE E;  1MUX A;  2LLU A;  3IF7 A;  1DT7 B;  4PDZ A;  5AEQ A;  1IG5 A;  2JWW A;  3VRO A;  1JC2 A;  1ALW A;  3AKB A;  2D8N A;  1G33 A;  4GGF A;  4WQ3 A;  2PAS A;  4C0L A;  1UP5 A;  3VGO A;  2SAS A;  1N2D A;  1NX2 A;  1UHH A;  2WC8 A;  3EKH A;  2PAL A;  5IBW A;  2K7B A;  4MSP A;  3BUX B;  1K96 A;  1BR4 B;  1SYM A;  2JNF A;  2F2P A;  2WCB A;  2BCX A;  1SNL A;  1V1F A;  1M46 A;  1PVB A;  2LUX A;  1XVJ A;  2K0J A;  2M97 A;  1MXL C;  1F8H A;  2KDH A;  2LLT A;  4IL1 A;  1DGU A;  1IWQ A;  4D1E A;  5CPV A;  3H4S E;  2GV5 A;  3AKA A;  1K94 A;  1GGZ A;  4MVF A;  2LHL A;  4N1G A;  3EK7 A;  4MEW A;  4CFR A;  2H2K A;  4A4C A;  2BL0 B;  3PFV A;  1YTZ C;  1MWN A;  3I5G B;  1SCV A;  1WRZ A;  1U5I B;  3ZNI A;  3PAT A;  3O6B A;  2WOR A;  1WRK A;  4CFQ A;  2BBM A;  2DOQ A;  1AK8 A;  1DJX A;  2LMU A;  2PMY A;  3IQQ A;  2L5X B;  5I2L A;  3I5H C;  1JWD A;  1FW4 A;  1MHO A;  1UHI A;  2ZN9 A;  4PHM A;  2O5G A;  2EC6 C;  4PHK A;  1UHN A;  1TCO B;  3AAJ A;  4ZCU A;  4PHJ A;  4I5N B;  4M2O A;  3TS5 B;  1S36 A;  1W7I B;  3GOF A;  1IQ5 A;  1J7Q A;  3PN7 B;  4NDB A;  2LVJ A;  2BCA A;  5BPJ A;  1KFU S;  2NXQ A;  1QAT A;  2QPT A;  1LVC D;  2K61 A;  3ICB A;  1DJI A;  1K93 D;  5GQQ C;  2ZN8 A;  4MRY A;  1KK7 Y;  4JWQ A;  3KO0 A;  5B8I B;  2MAZ A;  1TIZ A;  2L0P A;  1REC A;  4XYN A;  1KSM A;  1B4C A;  2JTZ A;  3IQO A;  4OR9 B;  1F4Q A;  3SG4 A;  3CWG A;  1TNQ A;  2F2O A;  4WQ2 A;  2JZI A;  4XJK B;  1CFF A;  1D1O A;  4GGN A;  2K7C A;  2LM5 A;  2R2I A;  2WOS A;  5D69 A;  1IQ3 A;  1J7R A;  1EG4 A;  1NX1 A;  1LA3 A;  3FS7 A;  2JOJ A;  2V53 A;  2BL0 C;  1PSR A;  1JF2 A;  2NCO A;  3CR5 X;  2HQW A;  5I2O A;  3F45 A;  1NP8 A;  1ZAC A;  3I5G C;  3O78 A;  2AMI A;  2LLS A;  2Y5I A;  5CSI A;  1LIN A;  1E8A A;  3A4U B;  2F8P A;  1A75 B;  1FI6 A;  1ZUZ A;  1SY9 A;  2KSP A;  2KQY A;  1S6J A;  2KBM A;  2BKH B;  2KYF A;  2I2R E;  4OV2 A;  1BJF A;  2B1U A;  4ICB A;  1N0Y A;  4YI9 A;  1DJY A;  3HCM A;  1DJG A;  1TN4 A;  1WLM A;  5D7F A;  1LKJ A;  2JT8 A;  3OHM B;  1AJ5 A;  1NSH A;  1SBJ A;  4MZJ A;  2L98 A;  2K2F A;  4ETO A;  1QAS A;  1QIV A;  3EVR A;  2K7O A;  1UHJ A;  2WND A;  3VRP A;  3PN7 C;  3BOW B;  5HKZ A;  1OQP A;  4M2Q A;  4PHN A;  5F6T A;  1NCZ A;  2BEC A;  2LVK A;  2FJU B;  5FYX A;  1JUO A;  2OS8 B;  1CTR A;  4FTG A;  2EGD A;  1F71 A;  2WCF A;  1J7P A;  4F0Z B;  4MRX A;  1OMV A;  1J1D A;  2Y1M A;  3BUO B;  5ER4 X;  3EVU A;  2ZKM X;  4MBE A;  3EK8 A;  3VRN A;  2JU0 A;  3GK4 X;  1B1G A;  1KK7 Z;  2LVV A;  1F4O A;  1LA0 A;  1GQM A;  3BUW B;  3VRR A;  3WHT B;  1QS7 A;  1IGV A;  3RLZ A;  2Q91 A;  1SL7 A;  4P2Y B;  3NSL A;  2LV7 A;  1A03 A;  1F54 A;  1B7T Z;  4QJ4 B;  1J1E A;  1NX3 A;  1F55 A;  1KFX L;  1TOP A;  1W7J B;  1JBA A;  1XFX O;  1TNW A;  3DVE A;  4ORC B;  4AOM A;  1L2O B;  1EH2 A;  3I5F B;  1BMO A;  2JT3 A;  1NX0 A;  3KPX A;  2AUC A;  1CFC A;  1TTX A;  5DKR A;  5DKN A;  2F3Y A;  1SMG A;  1RTP 1;  5CSF A;  1SCM B;  4DUQ A;  1RJV A;  2NCP A;  2M7L A;  1FPW A;  1M63 B;  1QX2 A;  4USL A;  1KCY A;  1QJT A;  5AER A;  3I5I B;  2A4J A;  1NPQ A;  3DF0 A;  4GFT A;  1A29 A;  2M1U A;  1XFW O;  3LL8 B;  1TCF A;  1YUR A;  3BQ3 A;  1K9P A;  1Y1U A;  1OMD A;  3K21 A;  5I8N A;  4HRG A;  1NCY A;  1CLL A;  2M29 A;  4PCW A;  1Y1A A;  4YGB B;  3SG5 A;  1RWY A;  1KQM B;  1R6P A;  2OS8 C;  2MLE C;  2EHB A;  1M45 A;  3JTD B;  2O60 A;  2ZND A;  2KI6 C;  1KQV A;  2ZRS A;  4NQG A;  2JNX A;  4YGA A;  2FCD A;  1AVS A;  3C1V A;  4YGE B;  3BXK A;  1K8U A;  1C07 A;  4UPG A;  2CTN A;  1TRF A;  2KAV A;  1LXF C;  2GGM A;  1X02 A;  5J3X A;  3LCP C;  2LC5 A;  3FIA A;  2KI6 D;  1J55 A;  4JQ0 D;  1G4Y R;  2JQ6 A;  1J7O A;  2HET A;  2LMV A;  2E6W A;  4YI8 A;  4AQI A;  1BLQ A;  1NYA A;  1DGV A;  2P6B B;  1RFJ A;  5CSJ A;  3KEV A;  1DMO A;  4R1E A;  3WXA A;  4PE7 A;  3EVV A;  1L2O C;  1N65 A;  3ZWH A;  3I5F C;  1JFJ A;  3D0Y A;  4I5K A;  4I5L B;  2ZFD A;  2PRU A;  5ER5 A;  1DJW A;  1SCM C;  3OB1 B;  1MR8 A;  2KGR A;  3BUM B;  2HF5 A;  4NDC A;  4TNC A;  1PK0 D;  2JT0 A;  1K95 A;  1YRU B;  4GGF C;  1Y6W A;  1CB1 A;  3I5I C;  1SR6 B;  1A2X A;  3D0Y B;  5HKW A;  4QJ3 B;  3PM8 A;  1WDC B;  2ISD A;  1AP4 A;  2KHN A;  1PRW A;  1B7T Y;  3KF9 A;  4HSZ A;  3PSR A;  4BY4 A;  1RK9 A;  4DS7 A;  2H61 A;  1KQM C;  2LAN A;  1DTL A;  1KK8 B;  2LE9 B;  3LLE A;  3A8R A;  4MN0 A;  1MQ1 A;  4N5X A;  1CDL A;  3WHU B;  3JTD C;  1BG1 A;  2CXJ A;  3SG3 A;  1CMF A;  4ZCV A;  1M39 A;  2LMT A;  1CKK A;  5PAL A;  1WY9 A;  4I5J A;  3SIA A;  4AQJ A;  5I2Q A;  1CNP A;  3E3R A;  1XFU O;  3FWB A;  3MSE B;  3AAK A;  1BOC A;  3CR2 A;  1QX7 A;  2LCP A;  4MZK A;  3NSI A;  1SL9 A;  4ORA B;  3TZ1 A;  1H4B A;  1OZO A;  2RGI A;  4JPZ B;  2WCE A;  1OMR A;  4OKH A;  3NXA A;  1BU3 A;  4ORB B;  1MXE A;  2F33 A;  1DF0 A;  3JVT B;  1CM1 A;  3PLF B;  3WNX B;  2M8U A;  4WRI A;  4YGD B;  4YBH B;  1UWO A;  2JRF A;  1YUT A;  1QLS A;  4Q04 A;  3NSK A;  1CDN A;  1CLB A;  4YRU A;  2PVB A;  4YGC B;  3CZT X;  3CS1 A;  1Q80 A;  1B8C A;  2G9B A;  2F3Z A;  1SR6 C;  2KFH A;  1KFU L;  1UUS A;  1MF8 B;  1PUL A;  1YUS A;  2L51 A;  2MA2 A;  3DVK A;  1S5G Z;  2GGZ A;  1TNX A;  1OOJ A;  1WDC C;  3TDI A;  1WLZ A;  2TN4 A;  2I18 A;  2M9G A;  3GK1 A;  2Y1N A;  1KK8 C;  4GAO A;  2JXL A;  4BY5 A;  4HRH A;  2LVI A;  3OX6 A;  1YUU A;  1M31 A;  2KQ6 A;  2I7A A;  1OE9 B;  1CM4 A;  2LNK A;  5AXI A;  2ZRT A;  4CID A;  4E68 A;  2NLN A;  1AUI B;  2E30 A;  2L2E A;  2H61 C;  2CCM A;  3NSO A;  2KYC A;  2CBL A;  1XK4 A;  1SRA A;  4GNK B;  1L7Z A;  1XYD A;  2BBN A;  5KTY A;  2M1K B;  3CLN A;  5HYD A;  3O4Y A;  1KSO A;  1UHK A;  2MHH A;  2KBI A;  3BYA A;  1K9K A;  3JVT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...