1K95A

Crystal structure of des(1-52)grancalcin with bound calcium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
161
Chain Sequence
SVYTYFSAVAEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords GRANCALCIN
publication title Structure of Ca(2+)-loaded human grancalcin.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 161
sequence length 165
ec nomenclature
pdb deposition date 2001-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k95A00
4XYNA 1FI6A 1QJTA 5AERA 2OTGC 1XFVO 4GGNA 3DVKA 1KQVA 3GK2A 3LL8B 5HLOA 4AQJA 1EH2A 4YBHB 2D8NA 2Y1MA 1FPWA 2BKHB 2F3ZA 1WDCB 1FF1A 2I7AA 3BUOB 1TIZA 1SBJA 2KFGA 5J3XA 2CT9A 2CNPA 2CXJA 1IRJA 2M49B 3FIAA 4MRXA 5JJGA 1QXPA 1EJ3A 3EK8A 2WNDA 1QVIZ 1YX8A 5ER4X 3DVEA 1J7OA 5K89A 1MHOA 1EXRA 2NXQA 2KI4C 1KK7Z 2G2BA 4MZJA 1YTZC 3TUYB 1KFXS 5HYDA 3O4YA 5DKRA 1SW8A 1AJ5A 1UHHA 2LMTA 3BOWA 3EKHA 4MRYA 4AOMA 1BR4B 1PULA 2BCXA 1Q80A 3EK4A 1K9KA 3IQQA 1L2OB 1SL9A 3AKBA 1QV0A 2ZN8A 3D0YA 4C0LA 4GFTA 1NUBA 1N65A 4MN0A 1BF5A 3VROA 5CSIA 2OTGB 3TS5C 2JNFA 1CDLA 1TNQA 1BOCA 1BMOA 3I5FC 1IH0A 3LLEA 1QTXA 4ORAB 3WHUB 4HRGA 2NLNA 2LANA 3CR5X 1CDMA 1S26D 2SCPA 2F33A 2PVBA 1TCOB 1IG5A 1TCFA 2JRFA 3CR4X 1UHIA 1TNPA 2Y4QA 1RROA 2JU0A 1UHJA 2O60A 4XJKA 3GK1A 1JUOA 1MXLC 4GAOA 1IGVA 1A4PA 1XK4A 3VRQA 3SIAA 2KI6C 4MZKA 3DVMA 5HKWA 2M1KB 4YGBB 1AP4A 2LAPA 1S3PA 2WCEA 1OE9B 2K2FA 3CS1A 1QX2A 3DF0A 1SCMC 2ISDA 2LUCA 3KPXA 1CNPA 1R2UA 1YUUA 2P6BB 4YI8A 3MSEB 5KTYA 1ZFSA 1DGUA 1Y0VH 1YR5A 4BY5A 3K21A 3TS5B 2BE4A 2LVKA 1LINA 2KGRA 2PALA 3F45A 1RECA 5AFPA 3AKAA 1PVAA 2JC2A 4P2YB 4M2QA 3SG6A 1KK8B 1OMDA 1A29A 1TNXA 1KFXL 2MJWB 1MUXA 2QACA 4PE1A 3IQOA 4PALA 3WXAA 4MVFA 4FQOA 4PE7A 1NYAA 2K7CA 3NSIA 2K7BA 1NIWA 1A75A 1S5GZ 4P5OE 5I8NA 1MF8B 2F8PA 1B7TZ 2L50A 1KWOB 3BOWB 1M45A 2HQWA 3SG5A 2KAYA 4MZLA 5CPVA 1DJXA 3GOFA 4D1EA 3ICBA 3CR2A 3OX6A 1WLMA 3TDIA 2LV7A 4ICBA 1LXFC 1CFPA 2M3WA 4OKHA 1WLZA 4UPGA 4OV2A 2EGDA 2K61A 2NCPA 1PALA 1ZUZA 3LCPC 1F4OA 1DGVA 2WORA 1XFUO 4YGCB 4E68A 1XFXO 4XJKB 1IWQA 1RK9A 1XFYO 2CTNA 3HX4A 5HKYA 1SPYA 1YVLA 2H2KA 2PRUA 1L2OC 5BPJA 1CLBA 2LVVA 1K2HA 1CDPA 3CWGA 1IJ5A 1GJYA 1BG1A 4CIDA 2KFFA 3EK7A 1OOJA 1WY9A 3O6BA 1F70A 3JTDB 3FWCA 2AUCA 2HETA 1YVHA 2WC8A 1TN4A 4Q04A 1J1EA 1SCVA 1UP5A 2HPSA 3ZWHA 1RJVA 2FCDA 2JZIA 2PASA 1UWOA 4GGFA 1SR6B 2LHLA 4QJ4B 1K9UA 1Y1UA 4CPVA 3PLFB 2JQ6A 2BCBA 3SIBA 4NDCA 3NSLA 3PATA 3CLNA 3LK0A 4YRUA 4I5JA 1QIVA 4PHJA 1S6JA 1AK8A 1W7JB 3SJSA 1N0YA 1HQVA 2GGMA 1K90D 2AAOA 5AANA 3BXKA 4PCWA 2B1UA 3PFVA 1J55A 2FOTA 2CCMA 1PVBA 1KSOA 1QX5B 1A75B 4DIRA 2KDHA 1NPQA 2V53A 1MQ1A 3DD4A 2Y1NA 4USLA 4WQ2A 4F0ZB 3I5HB 1C07A 2H61A 3KO0A 3C1VA 1U5IB 2KBIA 2Q4UA 1NP8A 1YRTB 3M0WA 5D69A 2R2IA 2ZNEA 3FWBA 3PM8A 4OCIA 1QV1A 1CDNA 1MR8A 1YUTA 1CFFA 1XVJA 3BUXB 2L5XB 1KK8C 1K8UA 2SASA 3BUMB 1UHNA 1WRLA 2ZRTA 1IQ3A 1FI5A 2KGBC 4YGDB 1CFDA 1BR1B 1M63B 2BBNA 2LP3A 2VRGA 1B7TY 5KU1A 2MHHA 1GQMA 1SK6D 5I2QA 1CFCA 1TRFA 4MSPA 3TDUA 3WHTB 1JF2A 2KHNA 1KWOC 1WRZA 2LC5A 3O2PA 5GQQC 1J7RA 4PDZA 2L4HA 5D7FA 4I5LB 4PHMA 1CTRA 1SYMA 2H61C 1QVIY 1F8HA 1UHKA 4ZCVA 3TDZA 1PSRA 2JWWA 1KK7Y 3CGAA 1JFJA 2I2RE 1LA3A 1CM1A 1SY9A 2JOJA 4NDDA 1GGZA 2TN4A 3QRXA 3SG7A 4IL1A 1MXEA 1MWNA 2WCFA 3GK4X 4HSZA 3DVJA 2GGZA 1BLQA 4WQ3A 5DKQA 4MEWA 1H8BA 3A8RA 2NCOA 3FS7A 1FW4A 1NCZA 1K9PA 1OMRA 1UURA 1OZOA 2LM5A 2MLEC 1S36A 4QJ5B 5TNCA 1XK4C 4FTGA 1DT7B 2BECA 2KBMA 1A03A 1A2XA 1DF0A 1CM4A 1YURA 1V1GA 3IF7A 3PALA 2CBLA 1DJIA 3JTDC 1Y1XA 1CKKA 1NX2A 2KFHA 2ZRSA 1F55A 3A4UB 2JNXA 3PN7C 3D0YB 1K96A 2LLSA 3KF9A 1JC2A 2HF5A 1BJFA 1QS7A 1SR6C 3TZ1A 1JF0A 4PHKA 1TOPA 1NX1A 3VRNA 3VRRA 2M7NA 1XYDA 3I5GB 1KSMA 2LVIA 2WCBA 2LE9B 1YRUB 3OX5A 5FYXA 2GV5A 1IKUA 2OPOA 2JTZA 1F71A 2EC6C 2L0PA 5F6TA 2KYFA 4DUQA 4ORBB 1SKTA 5ER5A 2E30A 3JVTB 2Y5IA 4CLNA 1KQMB 1AJ4A 4JWQA 1UUSA 1RWYA 3EVVA 3AAKA 2DOQA 3H4SE 1R6PA 2KNEA 3ZNIA 3I5HC 5I2OA 2L98A 4HRHA 2L51A 4M2PA 2K7OA 2M0RA 1X02A 1HT9A 1JFKA 2I94A 1K95A 2QPTA 2EHBA 4YGEB 1DJZA 4NQGA 1JBAA 3RLZA 2JT0A 4CFRA 5CSFA 2JXLA 1NCYA 3DF0B 4GBAA 3CTNA 5CSJA 1KFUS 5G08A 3PN7B 2JULA 1S1EA 1XFWO 1OMVA 1GGWA 1NX3A 1S5GY 4YI9A 1C7WA 2HQ8A 1F4QA 2LMVA 2Q91A 4I5NB 1K94A 3OHMB 1SMGA 2M9GA 4OR9B 1M46A 2LVJA 2JT8A 4A4CA 4GNKB 1NSHA 4DS7A 1QLSA 2BL0C 2LNKA 1H4BA 1EG3A 1M39A 4TNCA 5AEQA 1DJWA 1CMGA 1OZSA 1RTP1 1JWDA 2EC6B 1EG4A 4PE4A 2L2EA 4DCKA 1C7VA 1LA0A 2LHIA 1V1FA 5HKZA 4MBEA 2K8MB 1L7ZA 2JXCA 2LUXA 1DF0B 3CZTX 1LVCD 4JQ0D 1QATA 1TNWA 1M31A 2NZ0A 3OB1B 2KQYA 2F3YA 1YX7A 2BCAA 1PK0D 4A4BA 1B8LA 2AMIA 3E3RA 4U8DA 1WRKA 4GGFC 1ZOTB 2JT3A 4OVNF 4M2OA 4PE0A 4YGAA 1OSAA 1E8AA 3KEVA 1QASA 1F54A 2BKIB 2K7DA 1RFJA 2KSPA 2KI6D 1BT6A 1Y6WA 2OS8C 3I5IB 1QIWA 4L9MA 3VGOA 1FBVA 2KAVA 1XO5A 3NXAA 2BL0B 2F2OA 5KSZA 4MLWA 4NDBA 2E6WA 1S6CA 5HLVA 2COLB 5JOLA 1ODBA 3BUWB 2KQ6A 2M29A 2WOSA 4QJ3B 1DMOA 2FCEA 5DKNA 1K93D 2I18A 2LLTA 2A4JA 4GPLB 3WNXB 1N2DA 2O5GA 2F2PA 2LP2A 1KFUL 4JPZB 4HREE 1XFZO 4I5KA 2MA2A 4AQIA 1PRWA 3VRPA 2KYCA 2BBMA 1CB1A 3I5GC 1J1DA 1DJGA 1B1GA 5PALA 1LKJA 1AHRA 3BQ3A 4GUKA 4CFQA 3BYAA 2KI4B 1ZMZA 4BY4A 1J7PA 3JVTC 4ETOA 1AVSA 1KQMC 2M8UA 1SRAA 2OS8B 1DJYA 2PSRA 3HCMA 3SG3A 4C0KA 3BUNB 1AUIB 1B8CA 2LMUA 1SL8A 1DTLA 3D10A 2KOTA 1DJHA 3EVUA 5B8IB 1SL7A 2PMYA 4ZCUA 1BODA 4WRIA 3I5FB 2JTTA 4N1FA 1Y1AA 3SG2A 1CLMA 3EKJA 3EVRA 1TTXA 2L4IA 1QX7A 1B9AA 4ORCB 1SNLA 2ZKMX 1IJ6A 5AXIA 1D1OA 1BU3A 2FJUB 4PHNA 3KHEA 1CMFA 1XA5A 4N1GA 1VRKA 2LLUA 1EL4A 5I2LA 2ZNDA 1QLKA 1JSAA 1OQPA 1DVIA 1W7IB 1B4CA 1KCYA 1IQ5A 2MAZA 2G9BA 2M97A 1G4YR 3SG4A 1YUSA 1U5IA 2RGIA 1B47A 3LK1A 2JPTA 3PSRA 2K0JA 1G33A 1WDCC 1NWDA 5CSNA 1SCMB 3NSKA 1NX0A 1PSBA 5IBWA 1NCXA 2BE6A 1ZACA 3OB2B 2MRDA 4R1EA 4C0JA 2ZN9A 2LCPA 4DRWA 2ZFDA 3RM1A 3O78A 1B8RA 3NSOA 3TUYC 4N5XA 2IS9A 1ALVA 3OP0A 1CLLA 2KAXA 1S6IA 2MLFC 3I5IC 1ALWA 2MBXA 2K2AA 2M1UA 2M7LA 3AAJA 1G8IA 1J7QA
chains in the Genus database with same CATH superfamily
3NHTA 4XYNA 1FI6A 3D73A 1QJTA 5EL2A 5AERA 2OTGC 1XFVO 4GGNA 3DVKA 1KQVA 3GK2A 3LL8B 3Q8IA 5HLOA 4AQJA 1EH2A 2QEVA 4YBHB 1C3YA 2D8NA 2Y1MA 3O4XA 1FPWA 2BKHB 2F3ZA 1WDCB 1FF1A 2I7AA 2PYQA 3BUOB 1TIZA 1SBJA 2KFGA 2WC6A 3B88A 5J3XA 1DQEA 1TUJA 2CT9A 2CNPA 2CXJA 1IRJA 1C3ZA 2M49B 3FIAA 4INXA 1QXPA 4MRXA 1EJ3A 5JJGA 3EK8A 2WNDA 1QVIZ 1YX8A 5ER4X 3DVEA 1J7OA 5K89A 1MHOA 1EXRA 2NXQA 2KI4C 1KK7Z 2G2BA 4MZJA 1YTZC 3TUYB 1KFXS 5HYDA 3O4YA 5DKRA 1SW8A 1AJ5A 1UHHA 2LMTA 3BOWA 3EKHA 4MRYA 4AOMA 1BR4B 1PULA 2BCXA 1Q80A 3EK4A 1K9KA 3IQQA 1L2OB 1LS8A 1SL9A 3AKBA 1QV0A 2ZN8A 3D0YA 4C0LA 4GFTA 3DXLA 1NUBA 1N65A 4MN0A 1BF5A 3VROA 5CSIA 2OTGB 3TS5C 2JNFA 1CDLA 1TNQA 1BOCA 1BMOA 3I5FC 1IH0A 3LLEA 1QTXA 4ORAB 3WHUB 4HRGA 2NLNA 2LANA 3CR5X 1CDMA 1S26D 2KLDA 2SCPA 1T14A 2F33A 2PVBA 1TCOB 3PM2A 1IG5A 1TCFA 2JRFA 3CR4X 1UHIA 1TNPA 2Y4QA 1RROA 2JU0A 1UHJA 2O60A 4XJKA 5HL1A 3GK1A 1JUOA 3CZ1A 1MXLC 4GAOA 1IGVA 1A4PA 1XK4A 3VRQA 3SIAA 2KI6C 4MZKA 3DVMA 5HKWA 2M1KB 4YGBB 1AP4A 2LAPA 3RZSA 1S3PA 2WCEA 1OE9B 2K2FA 3CS1A 1QX2A 3D78A 3DF0A 3SS5A 1SCMC 2ISDA 2LUCA 3KPXA 1CNPA 1R2UA 1YUUA 2P6BB 3BFBA 3MSEB 4YI8A 5KTYA 1ZFSA 1DGUA 1Y0VH 1YR5A 4BY5A 3K21A 3TS5B 2BE4A 2LVKA 1LINA 2KGRA 2PALA 3F45A 1RECA 5AFPA 3AKAA 1PVAA 2JC2A 4P2YB 4M2QA 3SG6A 2WCHA 1KK8B 1OMDA 3L47A 1QWVA 1A29A 3B6XA 1TNXA 1KFXL 2MJWB 3NGVA 1MUXA 2QACA 4IJ7A 3IQOA 4PALA 4PE1A 4MVFA 4FQOA 4PE7A 3N7HA 3WXAA 1NYAA 2K7CA 3NSIA 2K7BA 1NIWA 1A75A 1S5GZ 4P5OE 5I8NA 3S0BA 1MF8B 2F8PA 1B7TZ 3B87A 2L50A 1KWOB 3BOWB 1M45A 2HQWA 3IVTA 2KAYA 3SG5A 1TWOA 4JKTA 4MZLA 3B7AA 5CPVA 1DJXA 3GOFA 4D1EA 3ICBA 3CR2A 3R72A 3OX6A 5FI6A 1WLMA 3TDIA 2LV7A 4ICBA 1LXFC 1CFPA 2M3WA 4OKHA 1WLZA 4UPGA 4OV2A 2EGDA 2K61A 2NCPA 1PALA 1ZUZA 3LCPC 1F4OA 3FE8A 1DGVA 2WCLA 2KPHA 2WORA 5DICA 3L4LA 1XFUO 4YGCB 2JPOA 3D77A 4E68A 1XFXO 3CYZA 1IWQA 1RK9A 1XFYO 2CTNA 4XJKB 3HX4A 5HKYA 1SPYA 1YVLA 2H2KA 2PRUA 1L2OC 5BPJA 1CLBA 2LVVA 1K2HA 3R1PA 1CDPA 3CWGA 1IJ5A 1GJYA 1BG1A 4CIDA 2KFFA 3S0GA 3EK7A 1OOJA 1WY9A 3O6BA 1GM0A 1F70A 3JTDB 3FWCA 2AUCA 2HETA 1YVHA 2PQLA 2WC8A 1TN4A 4Q04A 3NHIA 1J1EA 1SCVA 1UP5A 2HPSA 3DYEA 1RJVA 2FCDA 3ZWHA 2JZIA 2PASA 1UWOA 4GGFA 1SR6B 2LHLA 1SSEB 4QJ4B 1K9UA 1Y1UA 3EG5B 4CPVA 3PLFB 2JQ6A 2BCBA 3SIBA 4NDCA 3NSLA 3PATA 3CLNA 3LK0A 4YRUA 4I5JA 2BAPA 1IIOA 1QIVA 4PHJA 1S6JA 1AK8A 1W7JB 3SJSA 5FI7A 1N0YA 1HQVA 2GGMA 1K90D 2AAOA 5AANA 3BXKA 4PCWA 2B1UA 3PFVA 1J55A 2FOTA 2CCMA 1PVBA 1KSOA 1QX5B 1A75B 4DIRA 2KDHA 1NPQA 2P70A 1MQ1A 2V53A 3DD4A 2Y1NA 4USLA 4WQ2A 4F0ZB 3I5HB 1C07A 2H61A 3KO0A 3C1VA 1U5IB 2KBIA 2Q4UA 4JD9A 1NP8A 1YRTB 3M0WA 5D69A 3CDNA 2H8VA 2R2IA 2ZNEA 3FWBA 3PM8A 1QV1A 4OCIA 1MR8A 1CDNA 1YUTA 1CFFA 1XVJA 3BUXB 2L5XB 1KK8C 1K8UA 2SASA 3BUMB 1UHNA 1WRLA 2ZRTA 1IQ3A 1FI5A 2KGBC 4YGDB 1CFDA 1BR1B 1M63B 2BBNA 2LP3A 2VRGA 1B7TY 5KU1A 2MHHA 1ORGA 1GQMA 1SK6D 5I2QA 3R1VA 1CFCA 1TRFA 4MSPA 3TDUA 3WHTB 1JF2A 2KHNA 1KWOC 1WRZA 2LC5A 2L5YA 3O2PA 5GQQC 1J7RA 4PDZA 2L4HA 5D7FA 3DY9A 4I5LB 2ERBA 4FQTA 4PHMA 1CTRA 1SYMA 2H61C 3R1OA 1QVIY 1W9ZA 1F8HA 1UHKA 4ZCVA 3TDZA 1PSRA 2QDIA 2WC5A 2JWWA 1KK7Y 3CGAA 1JFJA 2I2RE 1LA3A 3DZTA 1CM1A 1SY9A 2JOJA 4NDDA 1GGZA 2TN4A 3QRXA 3SG7A 4IL1A 1MXEA 1MWNA 2WCFA 3GK4X 4HSZA 3DVJA 2GGZA 1BLQA 1OOHA 4WQ3A 5DKQA 4MEWA 1H8BA 3A8RA 2NCOA 3FS7A 1DC1A 1FW4A 3UO9A 1NCZA 1K9PA 1OMRA 1UURA 1OZOA 2LM5A 2MLEC 1S36A 4QJ5B 5TNCA 1XK4C 4FTGA 1DT7B 2BECA 2KBMA 1A03A 1A2XA 1DF0A 1CM4A 1YURA 1V1GA 3IF7A 3PALA 2CBLA 1DJIA 3FE9A 3JTDC 1Y1XA 1CKKA 1NX2A 2KFHA 2ZRSA 1F55A 2KLEA 3A4UB 2JNXA 3PN7C 3D0YB 1K96A 2LLSA 3KF9A 1JC2A 2HF5A 1BJFA 1QS7A 1SR6C 2QEBA 1JF0A 3TZ1A 4PHKA 1TOPA 1NX1A 3S0DA 3VRNA 3VRRA 2M7NA 1OOGA 4KYNA 5I94A 1XYDA 3I5GB 1KSMA 2LVIA 2WCBA 2LE9B 1YRUB 3OX5A 5FYXA 2GV5A 1IKUA 2OPOA 3V2LA 2JTZA 1F71A 2EC6C 2L0PA 2BNXA 5F6TA 2KYFA 4DUQA 4ORBB 3B86A 1SKTA 5ER5A 2E30A 3JVTB 2Y5IA 4CLNA 1KQMB 1AJ4A 4JWQA 1UUSA 1RWYA 3EVVA 3AAKA 3S0AA 2DOQA 2WCJA 3H4SE 1R6PA 2KNEA 3ZNIA 3I5HC 5I2OA 2L98A 4HRHA 2L51A 4M2PA 4PT1A 2K7OA 2M0RA 1X02A 1HT9A 1JFKA 2I94A 1K95A 2QPTA 2EHBA 3PJIA 4YGEB 1DJZA 4NQGA 1JBAA 3RLZA 2JT0A 3BFHA 5CSFA 2JXLA 4CFRA 1NCYA 3DF0B 4GBAA 3CTNA 5CSJA 1KFUS 5G08A 3BJHA 3PN7B 2JULA 1S1EA 1XFWO 1OMVA 1GGWA 1NX3A 1S5GY 4YI9A 1C7WA 2HQ8A 1F4QA 2LMVA 2Q91A 4I5NB 1K94A 3OHMB 1SMGA 2M9GA 4OR9B 1M46A 2LVJA 2JT8A 4A4CA 4GNKB 1NSHA 4DS7A 2P71A 1QLSA 2BL0C 2LNKA 1H4BA 1EG3A 1M39A 4TNCA 5AEQA 3SS4A 1DJWA 1CMGA 1OZSA 1RTP1 1JWDA 2EC6B 1EG4A 3CZ2A 4PE4A 2L2EA 4DCKA 1C7VA 1LA0A 2LHIA 1V1FA 2QEOA 4MBEA 5HKZA 2K8MB 1L7ZA 2JXCA 2LUXA 1DF0B 3CZTX 1LVCD 4JQ0D 1QATA 1TNWA 1M31A 2NZ0A 3OB1B 1P28A 2KQYA 2F3YA 1DELA 1YX7A 2BCAA 1PK0D 4A4BA 1B8LA 2AMIA 3E3RA 4U8DA 1WRKA 4GGFC 1ZOTB 2JT3A 4OVNF 4M2OA 4PE0A 4YGAA 1OSAA 1E8AA 3KEVA 1QASA 1F54A 2BKIB 2K7DA 2GTEA 1RFJA 2KSPA 2KI6D 1BT6A 1Y6WA 2OS8C 3I5IB 1QIWA 4L9MA 3VGOA 1FBVA 2KAVA 1XO5A 3NXAA 2BL0B 2F2OA 5KSZA 1Z2CB 3D76A 4MLWA 4NDBA 2E6WA 1S6CA 5HLVA 2COLB 5JOLA 1ODBA 3BUWB 2KQ6A 2M29A 2WOSA 4QJ3B 1DMOA 2FCEA 5DKNA 1K93D 2I18A 2LLTA 2A4JA 4GPLB 3S0FA 3WNXB 1N2DA 2O5GA 2F2PA 2LP2A 1KFUL 1XFRA 4JPZB 4HREE 1XFZO 3OGNA 4I5KA 2MA2A 2WCKA 4AQIA 1PRWA 3VRPA 1OOIX 2KYCA 2BBMA 3FE6A 1CB1A 3I5GC 1J1DA 1DJGA 3CABA 1B1GA 5PALA 1LKJA 1AHRA 3BQ3A 1DEKA 4GUKA 1TUZA 3BYAA 2KI4B 4CFQA 1ZMZA 4BY4A 1J7PA 3JVTC 4ETOA 1AVSA 1KQMC 2M8UA 3SS3A 1SRAA 3D74A 5FI2A 2YGUA 2OS8B 1DJYA 2PSRA 2WCMA 3HCMA 3SG3A 2QEHA 4C0KA 3BUNB 1AUIB 1B8CA 2LMUA 4OZDA 1SL8A 1DTLA 4INWA 3D10A 2KOTA 3D75A 1DJHA 3QMEA 3EVUA 5B8IB 1SL7A 2PMYA 4ZCUA 2K60A 1BODA 4WRIA 3I5FB 2JTTA 4N1FA 1Y1AA 3SG2A 1CLMA 3EKJA 3EVRA 1TTXA 2L4IA 1QX7A 1B9AA 4ORCB 1SNLA 2ZKMX 1IJ6A 5AXIA 1D1OA 1BU3A 2FJUB 4PHNA 3KHEA 1CMFA 1XA5A 4N1GA 1VRKA 2LLUA 1EL4A 5I2LA 2ZNDA 1QLKA 1JSAA 1OQPA 1DVIA 1W7IB 1B4CA 1KCYA 1IQ5A 2MAZA 2G9BA 1OOFA 4F7FA 2L2CA 1G4YR 2M97A 1Z4HA 3SG4A 1YUSA 2FJYA 1U5IA 2RGIA 1B47A 3LK1A 2JPTA 3PSRA 5D3OA 2K0JA 1G33A 1WDCC 1NWDA 3K1EA 5CSNA 1SCMB 3NSKA 1NX0A 1PSBA 5IBWA 3OBVA 1NCXA 2BE6A 1ZACA 3OB2B 2MRDA 4R1EA 4C0JA 2ZN9A 2LCPA 3UNWA 2ZFDA 3RM1A 3VB1A 4DRWA 3O78A 3BFAA 1OW4A 3CZ0A 1B8RA 3NSOA 3TUYC 4N5XA 2IS9A 1ALVA 3OP0A 3L4AA 1CLLA 2KAXA 3S0EA 1S6IA 2MLFC 3I5IC 1ALWA 2MBXA 2K2AA 2M1UA 2M7LA 3AAJA 1G8IA 1J7QA
chains in the Genus database with same CATH topology
4XYNA 1FI6A 1QJTA 5AERA 2OTGC 1XFVO 4GGNA 3DVKA 1KQVA 3GK2A 3LL8B 5HLOA 4AQJA 1EH2A 4YBHB 2D8NA 2Y1MA 1FPWA 2BKHB 2F3ZA 1WDCB 1FF1A 2I7AA 3BUOB 1TIZA 1SBJA 2KFGA 5J3XA 2CT9A 2CNPA 2CXJA 1IRJA 2M49B 3FIAA 4MRXA 5JJGA 1QXPA 1EJ3A 3EK8A 2WNDA 1QVIZ 1YX8A 5ER4X 3DVEA 1J7OA 5K89A 1MHOA 1EXRA 2NXQA 2KI4C 1KK7Z 2G2BA 4MZJA 1YTZC 3TUYB 1KFXS 5HYDA 3O4YA 5DKRA 1SW8A 1AJ5A 1UHHA 2LMTA 3BOWA 3EKHA 4MRYA 4AOMA 1BR4B 1PULA 2BCXA 1Q80A 3EK4A 1K9KA 3IQQA 1L2OB 1SL9A 3AKBA 1QV0A 2ZN8A 3D0YA 4C0LA 4GFTA 1NUBA 1N65A 4MN0A 1BF5A 3VROA 5CSIA 2OTGB 3TS5C 2JNFA 1CDLA 1TNQA 1BOCA 1BMOA 3I5FC 1IH0A 3LLEA 1QTXA 4ORAB 3WHUB 4HRGA 2NLNA 2LANA 3CR5X 1CDMA 1S26D 2SCPA 2F33A 2PVBA 1TCOB 1IG5A 1TCFA 2JRFA 3CR4X 1UHIA 1TNPA 2Y4QA 1RROA 2JU0A 1UHJA 2O60A 4XJKA 3GK1A 1JUOA 1MXLC 4GAOA 1IGVA 1A4PA 1XK4A 3VRQA 3SIAA 2KI6C 4MZKA 3DVMA 5HKWA 2M1KB 4YGBB 1AP4A 2LAPA 1S3PA 2WCEA 1OE9B 2K2FA 3CS1A 1QX2A 3DF0A 1SCMC 2ISDA 2LUCA 3KPXA 1CNPA 1R2UA 1YUUA 2P6BB 4YI8A 3MSEB 5KTYA 1ZFSA 1DGUA 1Y0VH 1YR5A 4BY5A 3K21A 3TS5B 2BE4A 2LVKA 1LINA 2KGRA 2PALA 3F45A 1RECA 5AFPA 3AKAA 1PVAA 2JC2A 4P2YB 4M2QA 3SG6A 1KK8B 1OMDA 1A29A 1TNXA 1KFXL 2MJWB 1MUXA 2QACA 4PE1A 3IQOA 4PALA 3WXAA 4MVFA 4FQOA 4PE7A 1NYAA 2K7CA 3NSIA 2K7BA 1NIWA 1A75A 1S5GZ 4P5OE 5I8NA 1MF8B 2F8PA 1B7TZ 2L50A 1KWOB 3BOWB 1M45A 2HQWA 3SG5A 2KAYA 4MZLA 5CPVA 1DJXA 3GOFA 4D1EA 3ICBA 3CR2A 3OX6A 1WLMA 3TDIA 2LV7A 4ICBA 1LXFC 1CFPA 2M3WA 4OKHA 1WLZA 4UPGA 4OV2A 2EGDA 2K61A 2NCPA 1PALA 1ZUZA 3LCPC 1F4OA 1DGVA 2WORA 1XFUO 4YGCB 4E68A 1XFXO 4XJKB 1IWQA 1RK9A 1XFYO 2CTNA 3HX4A 5HKYA 1SPYA 1YVLA 2H2KA 2PRUA 1L2OC 5BPJA 1CLBA 2LVVA 1K2HA 1CDPA 3CWGA 1IJ5A 1GJYA 1BG1A 4CIDA 2KFFA 3EK7A 1OOJA 1WY9A 3O6BA 1F70A 3JTDB 3FWCA 2AUCA 2HETA 1YVHA 2WC8A 1TN4A 4Q04A 1J1EA 1SCVA 1UP5A 2HPSA 3ZWHA 1RJVA 2FCDA 2JZIA 2PASA 1UWOA 4GGFA 1SR6B 2LHLA 4QJ4B 1K9UA 1Y1UA 4CPVA 3PLFB 2JQ6A 2BCBA 3SIBA 4NDCA 3NSLA 3PATA 3CLNA 3LK0A 4YRUA 4I5JA 1QIVA 4PHJA 1S6JA 1AK8A 1W7JB 3SJSA 1N0YA 1HQVA 2GGMA 1K90D 2AAOA 5AANA 3BXKA 4PCWA 2B1UA 3PFVA 1J55A 2FOTA 2CCMA 1PVBA 1KSOA 1QX5B 1A75B 4DIRA 2KDHA 1NPQA 2V53A 1MQ1A 3DD4A 2Y1NA 4USLA 4WQ2A 4F0ZB 3I5HB 1C07A 2H61A 3KO0A 3C1VA 1U5IB 2KBIA 2Q4UA 1NP8A 1YRTB 3M0WA 5D69A 2R2IA 2ZNEA 3FWBA 3PM8A 4OCIA 1QV1A 1CDNA 1MR8A 1YUTA 1CFFA 1XVJA 3BUXB 2L5XB 1KK8C 1K8UA 2SASA 3BUMB 1UHNA 1WRLA 2ZRTA 1IQ3A 1FI5A 2KGBC 4YGDB 1CFDA 1BR1B 1M63B 2BBNA 2LP3A 2VRGA 1B7TY 5KU1A 2MHHA 1GQMA 1SK6D 5I2QA 1CFCA 1TRFA 4MSPA 3TDUA 3WHTB 1JF2A 2KHNA 1KWOC 1WRZA 2LC5A 3O2PA 5GQQC 1J7RA 4PDZA 2L4HA 5D7FA 4I5LB 4PHMA 1CTRA 1SYMA 2H61C 1QVIY 1F8HA 1UHKA 4ZCVA 3TDZA 1PSRA 2JWWA 1KK7Y 3CGAA 1JFJA 2I2RE 1LA3A 1CM1A 1SY9A 2JOJA 4NDDA 1GGZA 2TN4A 3QRXA 3SG7A 4IL1A 1MXEA 1MWNA 2WCFA 3GK4X 4HSZA 3DVJA 2GGZA 1BLQA 4WQ3A 5DKQA 4MEWA 1H8BA 3A8RA 2NCOA 3FS7A 1FW4A 1NCZA 1K9PA 1OMRA 1UURA 1OZOA 2LM5A 2MLEC 1S36A 4QJ5B 5TNCA 1XK4C 4FTGA 1DT7B 2BECA 2KBMA 1A03A 1A2XA 1DF0A 1CM4A 1YURA 1V1GA 3IF7A 3PALA 2CBLA 1DJIA 3JTDC 1Y1XA 1CKKA 1NX2A 2KFHA 2ZRSA 1F55A 3A4UB 2JNXA 3PN7C 3D0YB 1K96A 2LLSA 3KF9A 1JC2A 2HF5A 1BJFA 1QS7A 1SR6C 3TZ1A 1JF0A 4PHKA 1TOPA 1NX1A 3VRNA 3VRRA 2M7NA 1XYDA 3I5GB 1KSMA 2LVIA 2WCBA 2LE9B 1YRUB 3OX5A 5FYXA 2GV5A 1IKUA 2OPOA 2JTZA 1F71A 2EC6C 2L0PA 5F6TA 2KYFA 4DUQA 4ORBB 1SKTA 5ER5A 2E30A 3JVTB 2Y5IA 4CLNA 1KQMB 1AJ4A 4JWQA 1UUSA 1RWYA 3EVVA 3AAKA 2DOQA 3H4SE 1R6PA 2KNEA 3ZNIA 3I5HC 5I2OA 2L98A 4HRHA 2L51A 4M2PA 2K7OA 2M0RA 1X02A 1HT9A 1JFKA 2I94A 1K95A 2QPTA 2EHBA 4YGEB 1DJZA 4NQGA 1JBAA 3RLZA 2JT0A 4CFRA 5CSFA 2JXLA 1NCYA 3DF0B 4GBAA 3CTNA 5CSJA 1KFUS 5G08A 3PN7B 2JULA 1S1EA 1XFWO 1OMVA 1GGWA 1NX3A 1S5GY 4YI9A 1C7WA 2HQ8A 1F4QA 2LMVA 2Q91A 4I5NB 1K94A 3OHMB 1SMGA 2M9GA 4OR9B 1M46A 2LVJA 2JT8A 4A4CA 4GNKB 1NSHA 4DS7A 1QLSA 2BL0C 2LNKA 1H4BA 1EG3A 1M39A 4TNCA 5AEQA 1DJWA 1CMGA 1OZSA 1RTP1 1JWDA 2EC6B 1EG4A 4PE4A 2L2EA 4DCKA 1C7VA 1LA0A 2LHIA 1V1FA 5HKZA 4MBEA 2K8MB 1L7ZA 2JXCA 2LUXA 1DF0B 3CZTX 1LVCD 4JQ0D 1QATA 1TNWA 1M31A 2NZ0A 3OB1B 2KQYA 2F3YA 1YX7A 2BCAA 1PK0D 4A4BA 1B8LA 2AMIA 3E3RA 4U8DA 1WRKA 4GGFC 1ZOTB 2JT3A 4OVNF 4M2OA 4PE0A 4YGAA 1OSAA 1E8AA 3KEVA 1QASA 1F54A 2BKIB 2K7DA 1RFJA 2KSPA 2KI6D 1BT6A 1Y6WA 2OS8C 3I5IB 1QIWA 4L9MA 3VGOA 1FBVA 2KAVA 1XO5A 3NXAA 2BL0B 2F2OA 5KSZA 4MLWA 4NDBA 2E6WA 1S6CA 5HLVA 2COLB 5JOLA 1ODBA 3BUWB 2KQ6A 2M29A 2WOSA 4QJ3B 1DMOA 2FCEA 5DKNA 1K93D 2I18A 2LLTA 2A4JA 4GPLB 3WNXB 1N2DA 2O5GA 2F2PA 2LP2A 1KFUL 4JPZB 4HREE 1XFZO 4I5KA 2MA2A 4AQIA 1PRWA 3VRPA 2KYCA 2BBMA 1CB1A 3I5GC 1J1DA 1DJGA 1B1GA 5PALA 1LKJA 1AHRA 3BQ3A 4GUKA 4CFQA 3BYAA 2KI4B 1ZMZA 4BY4A 1J7PA 3JVTC 4ETOA 1AVSA 1KQMC 2M8UA 1SRAA 2OS8B 1DJYA 2PSRA 3HCMA 3SG3A 4C0KA 3BUNB 1AUIB 1B8CA 2LMUA 1SL8A 1DTLA 3D10A 2KOTA 1DJHA 3EVUA 5B8IB 1SL7A 2PMYA 4ZCUA 1BODA 4WRIA 3I5FB 2JTTA 4N1FA 1Y1AA 3SG2A 1CLMA 3EKJA 3EVRA 1TTXA 2L4IA 1QX7A 1B9AA 4ORCB 1SNLA 2ZKMX 1IJ6A 5AXIA 1D1OA 1BU3A 2FJUB 4PHNA 3KHEA 1CMFA 1XA5A 4N1GA 1VRKA 2LLUA 1EL4A 5I2LA 2ZNDA 1QLKA 1JSAA 1OQPA 1DVIA 1W7IB 1B4CA 1KCYA 1IQ5A 2MAZA 2G9BA 2M97A 1G4YR 3SG4A 1YUSA 1U5IA 2RGIA 1B47A 3LK1A 2JPTA 3PSRA 2K0JA 1G33A 1WDCC 1NWDA 5CSNA 1SCMB 3NSKA 1NX0A 1PSBA 5IBWA 1NCXA 2BE6A 1ZACA 3OB2B 2MRDA 4R1EA 4C0JA 2ZN9A 2LCPA 4DRWA 2ZFDA 3RM1A 3O78A 1B8RA 3NSOA 3TUYC 4N5XA 2IS9A 1ALVA 3OP0A 1CLLA 2KAXA 1S6IA 2MLFC 3I5IC 1ALWA 2MBXA 2K2AA 2M1UA 2M7LA 3AAJA 1G8IA 1J7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYN A;  1FI6 A;  1QJT A;  5AER A;  2OTG C;  1XFV O;  4GGN A;  3DVK A;  1KQV A;  3GK2 A;  3LL8 B;  5HLO A;  4AQJ A;  1EH2 A;  4YBH B;  2D8N A;  2Y1M A;  1FPW A;  2BKH B;  2F3Z A;  1WDC B;  1FF1 A;  2I7A A;  3BUO B;  1TIZ A;  1SBJ A;  2KFG A;  5J3X A;  2CT9 A;  2CNP A;  2CXJ A;  1IRJ A;  2M49 B;  3FIA A;  4MRX A;  5JJG A;  1QXP A;  1EJ3 A;  3EK8 A;  2WND A;  1QVI Z;  1YX8 A;  5ER4 X;  3DVE A;  1J7O A;  5K89 A;  1MHO A;  1EXR A;  2NXQ A;  2KI4 C;  1KK7 Z;  2G2B A;  4MZJ A;  1YTZ C;  3TUY B;  1KFX S;  5HYD A;  3O4Y A;  5DKR A;  1SW8 A;  1AJ5 A;  1UHH A;  2LMT A;  3BOW A;  3EKH A;  4MRY A;  4AOM A;  1BR4 B;  1PUL A;  2BCX A;  1Q80 A;  3EK4 A;  1K9K A;  3IQQ A;  1L2O B;  1SL9 A;  3AKB A;  1QV0 A;  2ZN8 A;  3D0Y A;  4C0L A;  4GFT A;  1NUB A;  1N65 A;  4MN0 A;  1BF5 A;  3VRO A;  5CSI A;  2OTG B;  3TS5 C;  2JNF A;  1CDL A;  1TNQ A;  1BOC A;  1BMO A;  3I5F C;  1IH0 A;  3LLE A;  1QTX A;  4ORA B;  3WHU B;  4HRG A;  2NLN A;  2LAN A;  3CR5 X;  1CDM A;  1S26 D;  2SCP A;  2F33 A;  2PVB A;  1TCO B;  1IG5 A;  1TCF A;  2JRF A;  3CR4 X;  1UHI A;  1TNP A;  2Y4Q A;  1RRO A;  2JU0 A;  1UHJ A;  2O60 A;  4XJK A;  3GK1 A;  1JUO A;  1MXL C;  4GAO A;  1IGV A;  1A4P A;  1XK4 A;  3VRQ A;  3SIA A;  2KI6 C;  4MZK A;  3DVM A;  5HKW A;  2M1K B;  4YGB B;  1AP4 A;  2LAP A;  1S3P A;  2WCE A;  1OE9 B;  2K2F A;  3CS1 A;  1QX2 A;  3DF0 A;  1SCM C;  2ISD A;  2LUC A;  3KPX A;  1CNP A;  1R2U A;  1YUU A;  2P6B B;  4YI8 A;  3MSE B;  5KTY A;  1ZFS A;  1DGU A;  1Y0V H;  1YR5 A;  4BY5 A;  3K21 A;  3TS5 B;  2BE4 A;  2LVK A;  1LIN A;  2KGR A;  2PAL A;  3F45 A;  1REC A;  5AFP A;  3AKA A;  1PVA A;  2JC2 A;  4P2Y B;  4M2Q A;  3SG6 A;  1KK8 B;  1OMD A;  1A29 A;  1TNX A;  1KFX L;  2MJW B;  1MUX A;  2QAC A;  4PE1 A;  3IQO A;  4PAL A;  3WXA A;  4MVF A;  4FQO A;  4PE7 A;  1NYA A;  2K7C A;  3NSI A;  2K7B A;  1NIW A;  1A75 A;  1S5G Z;  4P5O E;  5I8N A;  1MF8 B;  2F8P A;  1B7T Z;  2L50 A;  1KWO B;  3BOW B;  1M45 A;  2HQW A;  3SG5 A;  2KAY A;  4MZL A;  5CPV A;  1DJX A;  3GOF A;  4D1E A;  3ICB A;  3CR2 A;  3OX6 A;  1WLM A;  3TDI A;  2LV7 A;  4ICB A;  1LXF C;  1CFP A;  2M3W A;  4OKH A;  1WLZ A;  4UPG A;  4OV2 A;  2EGD A;  2K61 A;  2NCP A;  1PAL A;  1ZUZ A;  3LCP C;  1F4O A;  1DGV A;  2WOR A;  1XFU O;  4YGC B;  4E68 A;  1XFX O;  4XJK B;  1IWQ A;  1RK9 A;  1XFY O;  2CTN A;  3HX4 A;  5HKY A;  1SPY A;  1YVL A;  2H2K A;  2PRU A;  1L2O C;  5BPJ A;  1CLB A;  2LVV A;  1K2H A;  1CDP A;  3CWG A;  1IJ5 A;  1GJY A;  1BG1 A;  4CID A;  2KFF A;  3EK7 A;  1OOJ A;  1WY9 A;  3O6B A;  1F70 A;  3JTD B;  3FWC A;  2AUC A;  2HET A;  1YVH A;  2WC8 A;  1TN4 A;  4Q04 A;  1J1E A;  1SCV A;  1UP5 A;  2HPS A;  3ZWH A;  1RJV A;  2FCD A;  2JZI A;  2PAS A;  1UWO A;  4GGF A;  1SR6 B;  2LHL A;  4QJ4 B;  1K9U A;  1Y1U A;  4CPV A;  3PLF B;  2JQ6 A;  2BCB A;  3SIB A;  4NDC A;  3NSL A;  3PAT A;  3CLN A;  3LK0 A;  4YRU A;  4I5J A;  1QIV A;  4PHJ A;  1S6J A;  1AK8 A;  1W7J B;  3SJS A;  1N0Y A;  1HQV A;  2GGM A;  1K90 D;  2AAO A;  5AAN A;  3BXK A;  4PCW A;  2B1U A;  3PFV A;  1J55 A;  2FOT A;  2CCM A;  1PVB A;  1KSO A;  1QX5 B;  1A75 B;  4DIR A;  2KDH A;  1NPQ A;  2V53 A;  1MQ1 A;  3DD4 A;  2Y1N A;  4USL A;  4WQ2 A;  4F0Z B;  3I5H B;  1C07 A;  2H61 A;  3KO0 A;  3C1V A;  1U5I B;  2KBI A;  2Q4U A;  1NP8 A;  1YRT B;  3M0W A;  5D69 A;  2R2I A;  2ZNE A;  3FWB A;  3PM8 A;  4OCI A;  1QV1 A;  1CDN A;  1MR8 A;  1YUT A;  1CFF A;  1XVJ A;  3BUX B;  2L5X B;  1KK8 C;  1K8U A;  2SAS A;  3BUM B;  1UHN A;  1WRL A;  2ZRT A;  1IQ3 A;  1FI5 A;  2KGB C;  4YGD B;  1CFD A;  1BR1 B;  1M63 B;  2BBN A;  2LP3 A;  2VRG A;  1B7T Y;  5KU1 A;  2MHH A;  1GQM A;  1SK6 D;  5I2Q A;  1CFC A;  1TRF A;  4MSP A;  3TDU A;  3WHT B;  1JF2 A;  2KHN A;  1KWO C;  1WRZ A;  2LC5 A;  3O2P A;  5GQQ C;  1J7R A;  4PDZ A;  2L4H A;  5D7F A;  4I5L B;  4PHM A;  1CTR A;  1SYM A;  2H61 C;  1QVI Y;  1F8H A;  1UHK A;  4ZCV A;  3TDZ A;  1PSR A;  2JWW A;  1KK7 Y;  3CGA A;  1JFJ A;  2I2R E;  1LA3 A;  1CM1 A;  1SY9 A;  2JOJ A;  4NDD A;  1GGZ A;  2TN4 A;  3QRX A;  3SG7 A;  4IL1 A;  1MXE A;  1MWN A;  2WCF A;  3GK4 X;  4HSZ A;  3DVJ A;  2GGZ A;  1BLQ A;  4WQ3 A;  5DKQ A;  4MEW A;  1H8B A;  3A8R A;  2NCO A;  3FS7 A;  1FW4 A;  1NCZ A;  1K9P A;  1OMR A;  1UUR A;  1OZO A;  2LM5 A;  2MLE C;  1S36 A;  4QJ5 B;  5TNC A;  1XK4 C;  4FTG A;  1DT7 B;  2BEC A;  2KBM A;  1A03 A;  1A2X A;  1DF0 A;  1CM4 A;  1YUR A;  1V1G A;  3IF7 A;  3PAL A;  2CBL A;  1DJI A;  3JTD C;  1Y1X A;  1CKK A;  1NX2 A;  2KFH A;  2ZRS A;  1F55 A;  3A4U B;  2JNX A;  3PN7 C;  3D0Y B;  1K96 A;  2LLS A;  3KF9 A;  1JC2 A;  2HF5 A;  1BJF A;  1QS7 A;  1SR6 C;  3TZ1 A;  1JF0 A;  4PHK A;  1TOP A;  1NX1 A;  3VRN A;  3VRR A;  2M7N A;  1XYD A;  3I5G B;  1KSM A;  2LVI A;  2WCB A;  2LE9 B;  1YRU B;  3OX5 A;  5FYX A;  2GV5 A;  1IKU A;  2OPO A;  2JTZ A;  1F71 A;  2EC6 C;  2L0P A;  5F6T A;  2KYF A;  4DUQ A;  4ORB B;  1SKT A;  5ER5 A;  2E30 A;  3JVT B;  2Y5I A;  4CLN A;  1KQM B;  1AJ4 A;  4JWQ A;  1UUS A;  1RWY A;  3EVV A;  3AAK A;  2DOQ A;  3H4S E;  1R6P A;  2KNE A;  3ZNI A;  3I5H C;  5I2O A;  2L98 A;  4HRH A;  2L51 A;  4M2P A;  2K7O A;  2M0R A;  1X02 A;  1HT9 A;  1JFK A;  2I94 A;  1K95 A;  2QPT A;  2EHB A;  4YGE B;  1DJZ A;  4NQG A;  1JBA A;  3RLZ A;  2JT0 A;  4CFR A;  5CSF A;  2JXL A;  1NCY A;  3DF0 B;  4GBA A;  3CTN A;  5CSJ A;  1KFU S;  5G08 A;  3PN7 B;  2JUL A;  1S1E A;  1XFW O;  1OMV A;  1GGW A;  1NX3 A;  1S5G Y;  4YI9 A;  1C7W A;  2HQ8 A;  1F4Q A;  2LMV A;  2Q91 A;  4I5N B;  1K94 A;  3OHM B;  1SMG A;  2M9G A;  4OR9 B;  1M46 A;  2LVJ A;  2JT8 A;  4A4C A;  4GNK B;  1NSH A;  4DS7 A;  1QLS A;  2BL0 C;  2LNK A;  1H4B A;  1EG3 A;  1M39 A;  4TNC A;  5AEQ A;  1DJW A;  1CMG A;  1OZS A;  1RTP 1;  1JWD A;  2EC6 B;  1EG4 A;  4PE4 A;  2L2E A;  4DCK A;  1C7V A;  1LA0 A;  2LHI A;  1V1F A;  5HKZ A;  4MBE A;  2K8M B;  1L7Z A;  2JXC A;  2LUX A;  1DF0 B;  3CZT X;  1LVC D;  4JQ0 D;  1QAT A;  1TNW A;  1M31 A;  2NZ0 A;  3OB1 B;  2KQY A;  2F3Y A;  1YX7 A;  2BCA A;  1PK0 D;  4A4B A;  1B8L A;  2AMI A;  3E3R A;  4U8D A;  1WRK A;  4GGF C;  1ZOT B;  2JT3 A;  4OVN F;  4M2O A;  4PE0 A;  4YGA A;  1OSA A;  1E8A A;  3KEV A;  1QAS A;  1F54 A;  2BKI B;  2K7D A;  1RFJ A;  2KSP A;  2KI6 D;  1BT6 A;  1Y6W A;  2OS8 C;  3I5I B;  1QIW A;  4L9M A;  3VGO A;  1FBV A;  2KAV A;  1XO5 A;  3NXA A;  2BL0 B;  2F2O A;  5KSZ A;  4MLW A;  4NDB A;  2E6W A;  1S6C A;  5HLV A;  2COL B;  5JOL A;  1ODB A;  3BUW B;  2KQ6 A;  2M29 A;  2WOS A;  4QJ3 B;  1DMO A;  2FCE A;  5DKN A;  1K93 D;  2I18 A;  2LLT A;  2A4J A;  4GPL B;  3WNX B;  1N2D A;  2O5G A;  2F2P A;  2LP2 A;  1KFU L;  4JPZ B;  4HRE E;  1XFZ O;  4I5K A;  2MA2 A;  4AQI A;  1PRW A;  3VRP A;  2KYC A;  2BBM A;  1CB1 A;  3I5G C;  1J1D A;  1DJG A;  1B1G A;  5PAL A;  1LKJ A;  1AHR A;  3BQ3 A;  4GUK A;  4CFQ A;  3BYA A;  2KI4 B;  1ZMZ A;  4BY4 A;  1J7P A;  3JVT C;  4ETO A;  1AVS A;  1KQM C;  2M8U A;  1SRA A;  2OS8 B;  1DJY A;  2PSR A;  3HCM A;  3SG3 A;  4C0K A;  3BUN B;  1AUI B;  1B8C A;  2LMU A;  1SL8 A;  1DTL A;  3D10 A;  2KOT A;  1DJH A;  3EVU A;  5B8I B;  1SL7 A;  2PMY A;  4ZCU A;  1BOD A;  4WRI A;  3I5F B;  2JTT A;  4N1F A;  1Y1A A;  3SG2 A;  1CLM A;  3EKJ A;  3EVR A;  1TTX A;  2L4I A;  1QX7 A;  1B9A A;  4ORC B;  1SNL A;  2ZKM X;  1IJ6 A;  5AXI A;  1D1O A;  1BU3 A;  2FJU B;  4PHN A;  3KHE A;  1CMF A;  1XA5 A;  4N1G A;  1VRK A;  2LLU A;  1EL4 A;  5I2L A;  2ZND A;  1QLK A;  1JSA A;  1OQP A;  1DVI A;  1W7I B;  1B4C A;  1KCY A;  1IQ5 A;  2MAZ A;  2G9B A;  2M97 A;  1G4Y R;  3SG4 A;  1YUS A;  1U5I A;  2RGI A;  1B47 A;  3LK1 A;  2JPT A;  3PSR A;  2K0J A;  1G33 A;  1WDC C;  1NWD A;  5CSN A;  1SCM B;  3NSK A;  1NX0 A;  1PSB A;  5IBW A;  1NCX A;  2BE6 A;  1ZAC A;  3OB2 B;  2MRD A;  4R1E A;  4C0J A;  2ZN9 A;  2LCP A;  4DRW A;  2ZFD A;  3RM1 A;  3O78 A;  1B8R A;  3NSO A;  3TUY C;  4N5X A;  2IS9 A;  1ALV A;  3OP0 A;  1CLL A;  2KAX A;  1S6I A;  2MLF C;  3I5I C;  1ALW A;  2MBX A;  2K2A A;  2M1U A;  2M7L A;  3AAJ A;  1G8I A;  1J7Q A; 
#chains in the Genus database with same CATH topology
 3NHT A;  4XYN A;  1FI6 A;  3D73 A;  1QJT A;  5EL2 A;  5AER A;  2OTG C;  1XFV O;  4GGN A;  3DVK A;  1KQV A;  3GK2 A;  3LL8 B;  3Q8I A;  5HLO A;  4AQJ A;  1EH2 A;  2QEV A;  4YBH B;  1C3Y A;  2D8N A;  2Y1M A;  3O4X A;  1FPW A;  2BKH B;  2F3Z A;  1WDC B;  1FF1 A;  2I7A A;  2PYQ A;  3BUO B;  1TIZ A;  1SBJ A;  2KFG A;  2WC6 A;  3B88 A;  5J3X A;  1DQE A;  1TUJ A;  2CT9 A;  2CNP A;  2CXJ A;  1IRJ A;  1C3Z A;  2M49 B;  3FIA A;  4INX A;  1QXP A;  4MRX A;  1EJ3 A;  5JJG A;  3EK8 A;  2WND A;  1QVI Z;  1YX8 A;  5ER4 X;  3DVE A;  1J7O A;  5K89 A;  1MHO A;  1EXR A;  2NXQ A;  2KI4 C;  1KK7 Z;  2G2B A;  4MZJ A;  1YTZ C;  3TUY B;  1KFX S;  5HYD A;  3O4Y A;  5DKR A;  1SW8 A;  1AJ5 A;  1UHH A;  2LMT A;  3BOW A;  3EKH A;  4MRY A;  4AOM A;  1BR4 B;  1PUL A;  2BCX A;  1Q80 A;  3EK4 A;  1K9K A;  3IQQ A;  1L2O B;  1LS8 A;  1SL9 A;  3AKB A;  1QV0 A;  2ZN8 A;  3D0Y A;  4C0L A;  4GFT A;  3DXL A;  1NUB A;  1N65 A;  4MN0 A;  1BF5 A;  3VRO A;  5CSI A;  2OTG B;  3TS5 C;  2JNF A;  1CDL A;  1TNQ A;  1BOC A;  1BMO A;  3I5F C;  1IH0 A;  3LLE A;  1QTX A;  4ORA B;  3WHU B;  4HRG A;  2NLN A;  2LAN A;  3CR5 X;  1CDM A;  1S26 D;  2KLD A;  2SCP A;  1T14 A;  2F33 A;  2PVB A;  1TCO B;  3PM2 A;  1IG5 A;  1TCF A;  2JRF A;  3CR4 X;  1UHI A;  1TNP A;  2Y4Q A;  1RRO A;  2JU0 A;  1UHJ A;  2O60 A;  4XJK A;  5HL1 A;  3GK1 A;  1JUO A;  3CZ1 A;  1MXL C;  4GAO A;  1IGV A;  1A4P A;  1XK4 A;  3VRQ A;  3SIA A;  2KI6 C;  4MZK A;  3DVM A;  5HKW A;  2M1K B;  4YGB B;  1AP4 A;  2LAP A;  3RZS A;  1S3P A;  2WCE A;  1OE9 B;  2K2F A;  3CS1 A;  1QX2 A;  3D78 A;  3DF0 A;  3SS5 A;  1SCM C;  2ISD A;  2LUC A;  3KPX A;  1CNP A;  1R2U A;  1YUU A;  2P6B B;  3BFB A;  3MSE B;  4YI8 A;  5KTY A;  1ZFS A;  1DGU A;  1Y0V H;  1YR5 A;  4BY5 A;  3K21 A;  3TS5 B;  2BE4 A;  2LVK A;  1LIN A;  2KGR A;  2PAL A;  3F45 A;  1REC A;  5AFP A;  3AKA A;  1PVA A;  2JC2 A;  4P2Y B;  4M2Q A;  3SG6 A;  2WCH A;  1KK8 B;  1OMD A;  3L47 A;  1QWV A;  1A29 A;  3B6X A;  1TNX A;  1KFX L;  2MJW B;  3NGV A;  1MUX A;  2QAC A;  4IJ7 A;  3IQO A;  4PAL A;  4PE1 A;  4MVF A;  4FQO A;  4PE7 A;  3N7H A;  3WXA A;  1NYA A;  2K7C A;  3NSI A;  2K7B A;  1NIW A;  1A75 A;  1S5G Z;  4P5O E;  5I8N A;  3S0B A;  1MF8 B;  2F8P A;  1B7T Z;  3B87 A;  2L50 A;  1KWO B;  3BOW B;  1M45 A;  2HQW A;  3IVT A;  2KAY A;  3SG5 A;  1TWO A;  4JKT A;  4MZL A;  3B7A A;  5CPV A;  1DJX A;  3GOF A;  4D1E A;  3ICB A;  3CR2 A;  3R72 A;  3OX6 A;  5FI6 A;  1WLM A;  3TDI A;  2LV7 A;  4ICB A;  1LXF C;  1CFP A;  2M3W A;  4OKH A;  1WLZ A;  4UPG A;  4OV2 A;  2EGD A;  2K61 A;  2NCP A;  1PAL A;  1ZUZ A;  3LCP C;  1F4O A;  3FE8 A;  1DGV A;  2WCL A;  2KPH A;  2WOR A;  5DIC A;  3L4L A;  1XFU O;  4YGC B;  2JPO A;  3D77 A;  4E68 A;  1XFX O;  3CYZ A;  1IWQ A;  1RK9 A;  1XFY O;  2CTN A;  4XJK B;  3HX4 A;  5HKY A;  1SPY A;  1YVL A;  2H2K A;  2PRU A;  1L2O C;  5BPJ A;  1CLB A;  2LVV A;  1K2H A;  3R1P A;  1CDP A;  3CWG A;  1IJ5 A;  1GJY A;  1BG1 A;  4CID A;  2KFF A;  3S0G A;  3EK7 A;  1OOJ A;  1WY9 A;  3O6B A;  1GM0 A;  1F70 A;  3JTD B;  3FWC A;  2AUC A;  2HET A;  1YVH A;  2PQL A;  2WC8 A;  1TN4 A;  4Q04 A;  3NHI A;  1J1E A;  1SCV A;  1UP5 A;  2HPS A;  3DYE A;  1RJV A;  2FCD A;  3ZWH A;  2JZI A;  2PAS A;  1UWO A;  4GGF A;  1SR6 B;  2LHL A;  1SSE B;  4QJ4 B;  1K9U A;  1Y1U A;  3EG5 B;  4CPV A;  3PLF B;  2JQ6 A;  2BCB A;  3SIB A;  4NDC A;  3NSL A;  3PAT A;  3CLN A;  3LK0 A;  4YRU A;  4I5J A;  2BAP A;  1IIO A;  1QIV A;  4PHJ A;  1S6J A;  1AK8 A;  1W7J B;  3SJS A;  5FI7 A;  1N0Y A;  1HQV A;  2GGM A;  1K90 D;  2AAO A;  5AAN A;  3BXK A;  4PCW A;  2B1U A;  3PFV A;  1J55 A;  2FOT A;  2CCM A;  1PVB A;  1KSO A;  1QX5 B;  1A75 B;  4DIR A;  2KDH A;  1NPQ A;  2P70 A;  1MQ1 A;  2V53 A;  3DD4 A;  2Y1N A;  4USL A;  4WQ2 A;  4F0Z B;  3I5H B;  1C07 A;  2H61 A;  3KO0 A;  3C1V A;  1U5I B;  2KBI A;  2Q4U A;  4JD9 A;  1NP8 A;  1YRT B;  3M0W A;  5D69 A;  3CDN A;  2H8V A;  2R2I A;  2ZNE A;  3FWB A;  3PM8 A;  1QV1 A;  4OCI A;  1MR8 A;  1CDN A;  1YUT A;  1CFF A;  1XVJ A;  3BUX B;  2L5X B;  1KK8 C;  1K8U A;  2SAS A;  3BUM B;  1UHN A;  1WRL A;  2ZRT A;  1IQ3 A;  1FI5 A;  2KGB C;  4YGD B;  1CFD A;  1BR1 B;  1M63 B;  2BBN A;  2LP3 A;  2VRG A;  1B7T Y;  5KU1 A;  2MHH A;  1ORG A;  1GQM A;  1SK6 D;  5I2Q A;  3R1V A;  1CFC A;  1TRF A;  4MSP A;  3TDU A;  3WHT B;  1JF2 A;  2KHN A;  1KWO C;  1WRZ A;  2LC5 A;  2L5Y A;  3O2P A;  5GQQ C;  1J7R A;  4PDZ A;  2L4H A;  5D7F A;  3DY9 A;  4I5L B;  2ERB A;  4FQT A;  4PHM A;  1CTR A;  1SYM A;  2H61 C;  3R1O A;  1QVI Y;  1W9Z A;  1F8H A;  1UHK A;  4ZCV A;  3TDZ A;  1PSR A;  2QDI A;  2WC5 A;  2JWW A;  1KK7 Y;  3CGA A;  1JFJ A;  2I2R E;  1LA3 A;  3DZT A;  1CM1 A;  1SY9 A;  2JOJ A;  4NDD A;  1GGZ A;  2TN4 A;  3QRX A;  3SG7 A;  4IL1 A;  1MXE A;  1MWN A;  2WCF A;  3GK4 X;  4HSZ A;  3DVJ A;  2GGZ A;  1BLQ A;  1OOH A;  4WQ3 A;  5DKQ A;  4MEW A;  1H8B A;  3A8R A;  2NCO A;  3FS7 A;  1DC1 A;  1FW4 A;  3UO9 A;  1NCZ A;  1K9P A;  1OMR A;  1UUR A;  1OZO A;  2LM5 A;  2MLE C;  1S36 A;  4QJ5 B;  5TNC A;  1XK4 C;  4FTG A;  1DT7 B;  2BEC A;  2KBM A;  1A03 A;  1A2X A;  1DF0 A;  1CM4 A;  1YUR A;  1V1G A;  3IF7 A;  3PAL A;  2CBL A;  1DJI A;  3FE9 A;  3JTD C;  1Y1X A;  1CKK A;  1NX2 A;  2KFH A;  2ZRS A;  1F55 A;  2KLE A;  3A4U B;  2JNX A;  3PN7 C;  3D0Y B;  1K96 A;  2LLS A;  3KF9 A;  1JC2 A;  2HF5 A;  1BJF A;  1QS7 A;  1SR6 C;  2QEB A;  1JF0 A;  3TZ1 A;  4PHK A;  1TOP A;  1NX1 A;  3S0D A;  3VRN A;  3VRR A;  2M7N A;  1OOG A;  4KYN A;  5I94 A;  1XYD A;  3I5G B;  1KSM A;  2LVI A;  2WCB A;  2LE9 B;  1YRU B;  3OX5 A;  5FYX A;  2GV5 A;  1IKU A;  2OPO A;  3V2L A;  2JTZ A;  1F71 A;  2EC6 C;  2L0P A;  2BNX A;  5F6T A;  2KYF A;  4DUQ A;  4ORB B;  3B86 A;  1SKT A;  5ER5 A;  2E30 A;  3JVT B;  2Y5I A;  4CLN A;  1KQM B;  1AJ4 A;  4JWQ A;  1UUS A;  1RWY A;  3EVV A;  3AAK A;  3S0A A;  2DOQ A;  2WCJ A;  3H4S E;  1R6P A;  2KNE A;  3ZNI A;  3I5H C;  5I2O A;  2L98 A;  4HRH A;  2L51 A;  4M2P A;  4PT1 A;  2K7O A;  2M0R A;  1X02 A;  1HT9 A;  1JFK A;  2I94 A;  1K95 A;  2QPT A;  2EHB A;  3PJI A;  4YGE B;  1DJZ A;  4NQG A;  1JBA A;  3RLZ A;  2JT0 A;  3BFH A;  5CSF A;  2JXL A;  4CFR A;  1NCY A;  3DF0 B;  4GBA A;  3CTN A;  5CSJ A;  1KFU S;  5G08 A;  3BJH A;  3PN7 B;  2JUL A;  1S1E A;  1XFW O;  1OMV A;  1GGW A;  1NX3 A;  1S5G Y;  4YI9 A;  1C7W A;  2HQ8 A;  1F4Q A;  2LMV A;  2Q91 A;  4I5N B;  1K94 A;  3OHM B;  1SMG A;  2M9G A;  4OR9 B;  1M46 A;  2LVJ A;  2JT8 A;  4A4C A;  4GNK B;  1NSH A;  4DS7 A;  2P71 A;  1QLS A;  2BL0 C;  2LNK A;  1H4B A;  1EG3 A;  1M39 A;  4TNC A;  5AEQ A;  3SS4 A;  1DJW A;  1CMG A;  1OZS A;  1RTP 1;  1JWD A;  2EC6 B;  1EG4 A;  3CZ2 A;  4PE4 A;  2L2E A;  4DCK A;  1C7V A;  1LA0 A;  2LHI A;  1V1F A;  2QEO A;  4MBE A;  5HKZ A;  2K8M B;  1L7Z A;  2JXC A;  2LUX A;  1DF0 B;  3CZT X;  1LVC D;  4JQ0 D;  1QAT A;  1TNW A;  1M31 A;  2NZ0 A;  3OB1 B;  1P28 A;  2KQY A;  2F3Y A;  1DEL A;  1YX7 A;  2BCA A;  1PK0 D;  4A4B A;  1B8L A;  2AMI A;  3E3R A;  4U8D A;  1WRK A;  4GGF C;  1ZOT B;  2JT3 A;  4OVN F;  4M2O A;  4PE0 A;  4YGA A;  1OSA A;  1E8A A;  3KEV A;  1QAS A;  1F54 A;  2BKI B;  2K7D A;  2GTE A;  1RFJ A;  2KSP A;  2KI6 D;  1BT6 A;  1Y6W A;  2OS8 C;  3I5I B;  1QIW A;  4L9M A;  3VGO A;  1FBV A;  2KAV A;  1XO5 A;  3NXA A;  2BL0 B;  2F2O A;  5KSZ A;  1Z2C B;  3D76 A;  4MLW A;  4NDB A;  2E6W A;  1S6C A;  5HLV A;  2COL B;  5JOL A;  1ODB A;  3BUW B;  2KQ6 A;  2M29 A;  2WOS A;  4QJ3 B;  1DMO A;  2FCE A;  5DKN A;  1K93 D;  2I18 A;  2LLT A;  2A4J A;  4GPL B;  3S0F A;  3WNX B;  1N2D A;  2O5G A;  2F2P A;  2LP2 A;  1KFU L;  1XFR A;  4JPZ B;  4HRE E;  1XFZ O;  3OGN A;  4I5K A;  2MA2 A;  2WCK A;  4AQI A;  1PRW A;  3VRP A;  1OOI X;  2KYC A;  2BBM A;  3FE6 A;  1CB1 A;  3I5G C;  1J1D A;  1DJG A;  3CAB A;  1B1G A;  5PAL A;  1LKJ A;  1AHR A;  3BQ3 A;  1DEK A;  4GUK A;  1TUZ A;  3BYA A;  2KI4 B;  4CFQ A;  1ZMZ A;  4BY4 A;  1J7P A;  3JVT C;  4ETO A;  1AVS A;  1KQM C;  2M8U A;  3SS3 A;  1SRA A;  3D74 A;  5FI2 A;  2YGU A;  2OS8 B;  1DJY A;  2PSR A;  2WCM A;  3HCM A;  3SG3 A;  2QEH A;  4C0K A;  3BUN B;  1AUI B;  1B8C A;  2LMU A;  4OZD A;  1SL8 A;  1DTL A;  4INW A;  3D10 A;  2KOT A;  3D75 A;  1DJH A;  3QME A;  3EVU A;  5B8I B;  1SL7 A;  2PMY A;  4ZCU A;  2K60 A;  1BOD A;  4WRI A;  3I5F B;  2JTT A;  4N1F A;  1Y1A A;  3SG2 A;  1CLM A;  3EKJ A;  3EVR A;  1TTX A;  2L4I A;  1QX7 A;  1B9A A;  4ORC B;  1SNL A;  2ZKM X;  1IJ6 A;  5AXI A;  1D1O A;  1BU3 A;  2FJU B;  4PHN A;  3KHE A;  1CMF A;  1XA5 A;  4N1G A;  1VRK A;  2LLU A;  1EL4 A;  5I2L A;  2ZND A;  1QLK A;  1JSA A;  1OQP A;  1DVI A;  1W7I B;  1B4C A;  1KCY A;  1IQ5 A;  2MAZ A;  2G9B A;  1OOF A;  4F7F A;  2L2C A;  1G4Y R;  2M97 A;  1Z4H A;  3SG4 A;  1YUS A;  2FJY A;  1U5I A;  2RGI A;  1B47 A;  3LK1 A;  2JPT A;  3PSR A;  5D3O A;  2K0J A;  1G33 A;  1WDC C;  1NWD A;  3K1E A;  5CSN A;  1SCM B;  3NSK A;  1NX0 A;  1PSB A;  5IBW A;  3OBV A;  1NCX A;  2BE6 A;  1ZAC A;  3OB2 B;  2MRD A;  4R1E A;  4C0J A;  2ZN9 A;  2LCP A;  3UNW A;  2ZFD A;  3RM1 A;  3VB1 A;  4DRW A;  3O78 A;  3BFA A;  1OW4 A;  3CZ0 A;  1B8R A;  3NSO A;  3TUY C;  4N5X A;  2IS9 A;  1ALV A;  3OP0 A;  3L4A A;  1CLL A;  2KAX A;  3S0E A;  1S6I A;  2MLF C;  3I5I C;  1ALW A;  2MBX A;  2K2A A;  2M1U A;  2M7L A;  3AAJ A;  1G8I A;  1J7Q A; 
#chains in the Genus database with same CATH homology
 4XYN A;  1FI6 A;  1QJT A;  5AER A;  2OTG C;  1XFV O;  4GGN A;  3DVK A;  1KQV A;  3GK2 A;  3LL8 B;  5HLO A;  4AQJ A;  1EH2 A;  4YBH B;  2D8N A;  2Y1M A;  1FPW A;  2BKH B;  2F3Z A;  1WDC B;  1FF1 A;  2I7A A;  3BUO B;  1TIZ A;  1SBJ A;  2KFG A;  5J3X A;  2CT9 A;  2CNP A;  2CXJ A;  1IRJ A;  2M49 B;  3FIA A;  4MRX A;  5JJG A;  1QXP A;  1EJ3 A;  3EK8 A;  2WND A;  1QVI Z;  1YX8 A;  5ER4 X;  3DVE A;  1J7O A;  5K89 A;  1MHO A;  1EXR A;  2NXQ A;  2KI4 C;  1KK7 Z;  2G2B A;  4MZJ A;  1YTZ C;  3TUY B;  1KFX S;  5HYD A;  3O4Y A;  5DKR A;  1SW8 A;  1AJ5 A;  1UHH A;  2LMT A;  3BOW A;  3EKH A;  4MRY A;  4AOM A;  1BR4 B;  1PUL A;  2BCX A;  1Q80 A;  3EK4 A;  1K9K A;  3IQQ A;  1L2O B;  1SL9 A;  3AKB A;  1QV0 A;  2ZN8 A;  3D0Y A;  4C0L A;  4GFT A;  1NUB A;  1N65 A;  4MN0 A;  1BF5 A;  3VRO A;  5CSI A;  2OTG B;  3TS5 C;  2JNF A;  1CDL A;  1TNQ A;  1BOC A;  1BMO A;  3I5F C;  1IH0 A;  3LLE A;  1QTX A;  4ORA B;  3WHU B;  4HRG A;  2NLN A;  2LAN A;  3CR5 X;  1CDM A;  1S26 D;  2SCP A;  2F33 A;  2PVB A;  1TCO B;  1IG5 A;  1TCF A;  2JRF A;  3CR4 X;  1UHI A;  1TNP A;  2Y4Q A;  1RRO A;  2JU0 A;  1UHJ A;  2O60 A;  4XJK A;  3GK1 A;  1JUO A;  1MXL C;  4GAO A;  1IGV A;  1A4P A;  1XK4 A;  3VRQ A;  3SIA A;  2KI6 C;  4MZK A;  3DVM A;  5HKW A;  2M1K B;  4YGB B;  1AP4 A;  2LAP A;  1S3P A;  2WCE A;  1OE9 B;  2K2F A;  3CS1 A;  1QX2 A;  3DF0 A;  1SCM C;  2ISD A;  2LUC A;  3KPX A;  1CNP A;  1R2U A;  1YUU A;  2P6B B;  4YI8 A;  3MSE B;  5KTY A;  1ZFS A;  1DGU A;  1Y0V H;  1YR5 A;  4BY5 A;  3K21 A;  3TS5 B;  2BE4 A;  2LVK A;  1LIN A;  2KGR A;  2PAL A;  3F45 A;  1REC A;  5AFP A;  3AKA A;  1PVA A;  2JC2 A;  4P2Y B;  4M2Q A;  3SG6 A;  1KK8 B;  1OMD A;  1A29 A;  1TNX A;  1KFX L;  2MJW B;  1MUX A;  2QAC A;  4PE1 A;  3IQO A;  4PAL A;  3WXA A;  4MVF A;  4FQO A;  4PE7 A;  1NYA A;  2K7C A;  3NSI A;  2K7B A;  1NIW A;  1A75 A;  1S5G Z;  4P5O E;  5I8N A;  1MF8 B;  2F8P A;  1B7T Z;  2L50 A;  1KWO B;  3BOW B;  1M45 A;  2HQW A;  3SG5 A;  2KAY A;  4MZL A;  5CPV A;  1DJX A;  3GOF A;  4D1E A;  3ICB A;  3CR2 A;  3OX6 A;  1WLM A;  3TDI A;  2LV7 A;  4ICB A;  1LXF C;  1CFP A;  2M3W A;  4OKH A;  1WLZ A;  4UPG A;  4OV2 A;  2EGD A;  2K61 A;  2NCP A;  1PAL A;  1ZUZ A;  3LCP C;  1F4O A;  1DGV A;  2WOR A;  1XFU O;  4YGC B;  4E68 A;  1XFX O;  4XJK B;  1IWQ A;  1RK9 A;  1XFY O;  2CTN A;  3HX4 A;  5HKY A;  1SPY A;  1YVL A;  2H2K A;  2PRU A;  1L2O C;  5BPJ A;  1CLB A;  2LVV A;  1K2H A;  1CDP A;  3CWG A;  1IJ5 A;  1GJY A;  1BG1 A;  4CID A;  2KFF A;  3EK7 A;  1OOJ A;  1WY9 A;  3O6B A;  1F70 A;  3JTD B;  3FWC A;  2AUC A;  2HET A;  1YVH A;  2WC8 A;  1TN4 A;  4Q04 A;  1J1E A;  1SCV A;  1UP5 A;  2HPS A;  3ZWH A;  1RJV A;  2FCD A;  2JZI A;  2PAS A;  1UWO A;  4GGF A;  1SR6 B;  2LHL A;  4QJ4 B;  1K9U A;  1Y1U A;  4CPV A;  3PLF B;  2JQ6 A;  2BCB A;  3SIB A;  4NDC A;  3NSL A;  3PAT A;  3CLN A;  3LK0 A;  4YRU A;  4I5J A;  1QIV A;  4PHJ A;  1S6J A;  1AK8 A;  1W7J B;  3SJS A;  1N0Y A;  1HQV A;  2GGM A;  1K90 D;  2AAO A;  5AAN A;  3BXK A;  4PCW A;  2B1U A;  3PFV A;  1J55 A;  2FOT A;  2CCM A;  1PVB A;  1KSO A;  1QX5 B;  1A75 B;  4DIR A;  2KDH A;  1NPQ A;  2V53 A;  1MQ1 A;  3DD4 A;  2Y1N A;  4USL A;  4WQ2 A;  4F0Z B;  3I5H B;  1C07 A;  2H61 A;  3KO0 A;  3C1V A;  1U5I B;  2KBI A;  2Q4U A;  1NP8 A;  1YRT B;  3M0W A;  5D69 A;  2R2I A;  2ZNE A;  3FWB A;  3PM8 A;  4OCI A;  1QV1 A;  1CDN A;  1MR8 A;  1YUT A;  1CFF A;  1XVJ A;  3BUX B;  2L5X B;  1KK8 C;  1K8U A;  2SAS A;  3BUM B;  1UHN A;  1WRL A;  2ZRT A;  1IQ3 A;  1FI5 A;  2KGB C;  4YGD B;  1CFD A;  1BR1 B;  1M63 B;  2BBN A;  2LP3 A;  2VRG A;  1B7T Y;  5KU1 A;  2MHH A;  1GQM A;  1SK6 D;  5I2Q A;  1CFC A;  1TRF A;  4MSP A;  3TDU A;  3WHT B;  1JF2 A;  2KHN A;  1KWO C;  1WRZ A;  2LC5 A;  3O2P A;  5GQQ C;  1J7R A;  4PDZ A;  2L4H A;  5D7F A;  4I5L B;  4PHM A;  1CTR A;  1SYM A;  2H61 C;  1QVI Y;  1F8H A;  1UHK A;  4ZCV A;  3TDZ A;  1PSR A;  2JWW A;  1KK7 Y;  3CGA A;  1JFJ A;  2I2R E;  1LA3 A;  1CM1 A;  1SY9 A;  2JOJ A;  4NDD A;  1GGZ A;  2TN4 A;  3QRX A;  3SG7 A;  4IL1 A;  1MXE A;  1MWN A;  2WCF A;  3GK4 X;  4HSZ A;  3DVJ A;  2GGZ A;  1BLQ A;  4WQ3 A;  5DKQ A;  4MEW A;  1H8B A;  3A8R A;  2NCO A;  3FS7 A;  1FW4 A;  1NCZ A;  1K9P A;  1OMR A;  1UUR A;  1OZO A;  2LM5 A;  2MLE C;  1S36 A;  4QJ5 B;  5TNC A;  1XK4 C;  4FTG A;  1DT7 B;  2BEC A;  2KBM A;  1A03 A;  1A2X A;  1DF0 A;  1CM4 A;  1YUR A;  1V1G A;  3IF7 A;  3PAL A;  2CBL A;  1DJI A;  3JTD C;  1Y1X A;  1CKK A;  1NX2 A;  2KFH A;  2ZRS A;  1F55 A;  3A4U B;  2JNX A;  3PN7 C;  3D0Y B;  1K96 A;  2LLS A;  3KF9 A;  1JC2 A;  2HF5 A;  1BJF A;  1QS7 A;  1SR6 C;  3TZ1 A;  1JF0 A;  4PHK A;  1TOP A;  1NX1 A;  3VRN A;  3VRR A;  2M7N A;  1XYD A;  3I5G B;  1KSM A;  2LVI A;  2WCB A;  2LE9 B;  1YRU B;  3OX5 A;  5FYX A;  2GV5 A;  1IKU A;  2OPO A;  2JTZ A;  1F71 A;  2EC6 C;  2L0P A;  5F6T A;  2KYF A;  4DUQ A;  4ORB B;  1SKT A;  5ER5 A;  2E30 A;  3JVT B;  2Y5I A;  4CLN A;  1KQM B;  1AJ4 A;  4JWQ A;  1UUS A;  1RWY A;  3EVV A;  3AAK A;  2DOQ A;  3H4S E;  1R6P A;  2KNE A;  3ZNI A;  3I5H C;  5I2O A;  2L98 A;  4HRH A;  2L51 A;  4M2P A;  2K7O A;  2M0R A;  1X02 A;  1HT9 A;  1JFK A;  2I94 A;  1K95 A;  2QPT A;  2EHB A;  4YGE B;  1DJZ A;  4NQG A;  1JBA A;  3RLZ A;  2JT0 A;  4CFR A;  5CSF A;  2JXL A;  1NCY A;  3DF0 B;  4GBA A;  3CTN A;  5CSJ A;  1KFU S;  5G08 A;  3PN7 B;  2JUL A;  1S1E A;  1XFW O;  1OMV A;  1GGW A;  1NX3 A;  1S5G Y;  4YI9 A;  1C7W A;  2HQ8 A;  1F4Q A;  2LMV A;  2Q91 A;  4I5N B;  1K94 A;  3OHM B;  1SMG A;  2M9G A;  4OR9 B;  1M46 A;  2LVJ A;  2JT8 A;  4A4C A;  4GNK B;  1NSH A;  4DS7 A;  1QLS A;  2BL0 C;  2LNK A;  1H4B A;  1EG3 A;  1M39 A;  4TNC A;  5AEQ A;  1DJW A;  1CMG A;  1OZS A;  1RTP 1;  1JWD A;  2EC6 B;  1EG4 A;  4PE4 A;  2L2E A;  4DCK A;  1C7V A;  1LA0 A;  2LHI A;  1V1F A;  5HKZ A;  4MBE A;  2K8M B;  1L7Z A;  2JXC A;  2LUX A;  1DF0 B;  3CZT X;  1LVC D;  4JQ0 D;  1QAT A;  1TNW A;  1M31 A;  2NZ0 A;  3OB1 B;  2KQY A;  2F3Y A;  1YX7 A;  2BCA A;  1PK0 D;  4A4B A;  1B8L A;  2AMI A;  3E3R A;  4U8D A;  1WRK A;  4GGF C;  1ZOT B;  2JT3 A;  4OVN F;  4M2O A;  4PE0 A;  4YGA A;  1OSA A;  1E8A A;  3KEV A;  1QAS A;  1F54 A;  2BKI B;  2K7D A;  1RFJ A;  2KSP A;  2KI6 D;  1BT6 A;  1Y6W A;  2OS8 C;  3I5I B;  1QIW A;  4L9M A;  3VGO A;  1FBV A;  2KAV A;  1XO5 A;  3NXA A;  2BL0 B;  2F2O A;  5KSZ A;  4MLW A;  4NDB A;  2E6W A;  1S6C A;  5HLV A;  2COL B;  5JOL A;  1ODB A;  3BUW B;  2KQ6 A;  2M29 A;  2WOS A;  4QJ3 B;  1DMO A;  2FCE A;  5DKN A;  1K93 D;  2I18 A;  2LLT A;  2A4J A;  4GPL B;  3WNX B;  1N2D A;  2O5G A;  2F2P A;  2LP2 A;  1KFU L;  4JPZ B;  4HRE E;  1XFZ O;  4I5K A;  2MA2 A;  4AQI A;  1PRW A;  3VRP A;  2KYC A;  2BBM A;  1CB1 A;  3I5G C;  1J1D A;  1DJG A;  1B1G A;  5PAL A;  1LKJ A;  1AHR A;  3BQ3 A;  4GUK A;  4CFQ A;  3BYA A;  2KI4 B;  1ZMZ A;  4BY4 A;  1J7P A;  3JVT C;  4ETO A;  1AVS A;  1KQM C;  2M8U A;  1SRA A;  2OS8 B;  1DJY A;  2PSR A;  3HCM A;  3SG3 A;  4C0K A;  3BUN B;  1AUI B;  1B8C A;  2LMU A;  1SL8 A;  1DTL A;  3D10 A;  2KOT A;  1DJH A;  3EVU A;  5B8I B;  1SL7 A;  2PMY A;  4ZCU A;  1BOD A;  4WRI A;  3I5F B;  2JTT A;  4N1F A;  1Y1A A;  3SG2 A;  1CLM A;  3EKJ A;  3EVR A;  1TTX A;  2L4I A;  1QX7 A;  1B9A A;  4ORC B;  1SNL A;  2ZKM X;  1IJ6 A;  5AXI A;  1D1O A;  1BU3 A;  2FJU B;  4PHN A;  3KHE A;  1CMF A;  1XA5 A;  4N1G A;  1VRK A;  2LLU A;  1EL4 A;  5I2L A;  2ZND A;  1QLK A;  1JSA A;  1OQP A;  1DVI A;  1W7I B;  1B4C A;  1KCY A;  1IQ5 A;  2MAZ A;  2G9B A;  2M97 A;  1G4Y R;  3SG4 A;  1YUS A;  1U5I A;  2RGI A;  1B47 A;  3LK1 A;  2JPT A;  3PSR A;  2K0J A;  1G33 A;  1WDC C;  1NWD A;  5CSN A;  1SCM B;  3NSK A;  1NX0 A;  1PSB A;  5IBW A;  1NCX A;  2BE6 A;  1ZAC A;  3OB2 B;  2MRD A;  4R1E A;  4C0J A;  2ZN9 A;  2LCP A;  4DRW A;  2ZFD A;  3RM1 A;  3O78 A;  1B8R A;  3NSO A;  3TUY C;  4N5X A;  2IS9 A;  1ALV A;  3OP0 A;  1CLL A;  2KAX A;  1S6I A;  2MLF C;  3I5I C;  1ALW A;  2MBX A;  2K2A A;  2M1U A;  2M7L A;  3AAJ A;  1G8I A;  1J7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...