1K95A

Crystal structure of des(1-52)grancalcin with bound calcium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
161
Chain Sequence
SVYTYFSAVAEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRANCALCIN
publication title Structure of Ca(2+)-loaded human grancalcin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 54
structure length 161
sequence length 165
ec nomenclature
pdb deposition date 2001-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k95A00
2V53A 1K90D 4MRYA 2TN4A 3TUYC 2K0JA 2Y5IA 2DOQA 5AFPA 3D0YB 1TIZA 5I2OA 2KNEA 5D69A 1IG5A 3PFVA 1B7TY 4OVNF 1TNXA 2G2BA 3FIAA 1PVBA 1AP4A 1GGWA 2LUCA 3SG6A 2ZNDA 3FWBA 1QLSA 2EC6B 3DF0A 4YI8A 1DT7B 1DGVA 3I5GB 1TNPA 5HLOA 1AJ5A 1IQ5A 1EG4A 1XYDA 3D0YA 3DD4A 1KQMC 1UP5A 2JXLA 4PE1A 5KSZA 5AANA 2R2IA 1WRLA 2KAVA 1S6CA 2PSRA 2HPSA 4ZCUA 4QJ4B 4GNKB 2M0RA 3LLEA 4GFTA 1JC2A 4L9MA 1TTXA 1J7OA 4YGAA 1J7QA 4PCWA 2MRDA 1SL9A 2F2PA 2K61A 5F6TA 1XFWO 1S6IA 1R6PA 2IS9A 2BCXA 3ICBA 1L2OB 2F3ZA 5HYDA 5CSIA 3LK0A 2HETA 3BUWB 1U5IB 3WHTB 1OSAA 3OX6A 2EGDA 1TN4A 3RM1A 2K7CA 4GUKA 4MN0A 2Y4QA 2CBLA 1DJGA 3AAJA 1CLBA 4GPLB 1XFUO 1IJ5A 1Y0VH 3OHMB 3I5GC 1SBJA 2ZN9A 1FPWA 1EG3A 3EVVA 3BOWB 1U5IA 2RGIA 3WNXB 5HKZA 2K7OA 3O2PA 2M49B 2JQ6A 3EK7A 1K94A 4GGNA 2MAZA 1TRFA 3CLNA 1S5GY 1DJWA 3NXAA 1NX3A 3I5IB 2KFHA 5FYXA 1F8HA 3SIBA 1JF2A 3BYAA 5KTYA 3K21A 2LMTA 1WY9A 1WLZA 1L7ZA 3CS1A 2BECA 3H4SE 4R1EA 2ZRSA 5ER4X 4GBAA 1KFUL 4AQIA 2JNXA 2WNDA 3BOWA 3CR4X 1KSMA 1PSBA 1LXFC 1L2OC 5DKQA 1KFUS 1JSAA 2JPTA 3A4UB 1ODBA 1CFCA 2NCOA 1B4CA 1DMOA 3HX4A 1VRKA 1C7VA 1CDMA 1SRAA 2PMYA 2WCEA 5K89A 1QXPA 1RFJA 4I5JA 4BY4A 3EKHA 1ZFSA 2JTTA 3GK2A 1QS7A 3I5HB 4MZJA 3ZWHA 2LANA 3SG2A 2JT3A 1A75B 1SYMA 1QVIY 1KK8C 1DF0A 5G08A 1UHJA 4P2YB 2WCFA 4OKHA 2NXQA 4AOMA 2F2OA 2LMUA 3BUOB 1CKKA 1N2DA 3ZNIA 1F70A 1FW4A 2L51A 1F54A 3KPXA 2HQ8A 4I5LB 3I5IC 1SK6D 1EL4A 1RWYA 1BR1B 2F3YA 4PALA 3WHUB 4GAOA 3FS7A 4PHKA 4JWQA 1JBAA 1UWOA 4P5OE 2QACA 1G33A 5HKWA 2K7DA 2KBMA 1QTXA 1K9PA 2HF5A 2PALA 4OCIA 1DGUA 2P6BB 4YGCB 1K8UA 3GK4X 1QV0A 4I5NB 2WCBA 2L5XB 2BE6A 3PN7C 1KQMB 1K95A 3TZ1A 1RJVA 2MBXA 3EVUA 2LV7A 3C1VA 1IKUA 1TNWA 3I5HC 4HRHA 2GGZA 3VRQA 3IQOA 1QJTA 1M63B 1KK7Y 1UURA 4UPGA 3EVRA 1BT6A 2ZKMX 1K9KA 3DF0B 1F71A 1G4YR 1QASA 1CM4A 1SPYA 2I18A 3M0WA 1LVCD 1WRZA 1RROA 2OTGB 4ICBA 4HREE 4MBEA 3VRRA 4U8DA 1NPQA 1CM1A 2LUXA 3CGAA 4YRUA 1JWDA 1PULA 4M2OA 1ZOTB 2CT9A 3E3RA 2KYFA 1CDPA 5I8NA 2I7AA 2JRFA 4QJ5B 2KGRA 2K2FA 1SR6B 4XYNA 2KOTA 4ORBB 1EH2A 3CR5X 2EHBA 2KI4B 2AAOA 3I5FC 1Y6WA 4YGDB 1KCYA 3F45A 1YRTB 1KQVA 1CNPA 1DJZA 1UHKA 3CR2A 1CTRA 1RTP1 1B7TZ 1Q80A 1UUSA 5AEQA 3TDUA 1IRJA 1OMVA 1UHHA 2KQ6A 1RECA 4PE4A 1BLQA 1NCZA 1CLLA 1Y1XA 1NX0A 1QLKA 1S1EA 4N1GA 1MXEA 1TCFA 1NYAA 2LVKA 4HRGA 2LVJA 5TNCA 1JFJA 2NZ0A 1PRWA 2JT8A 2JULA 4WQ3A 1GGZA 2LP3A 4C0JA 1D1OA 3JTDC 4YGBB 1A4PA 2GGMA 1OZOA 2OTGC 2SASA 3BUMB 1W7IB 2M97A 2CNPA 1AJ4A 2L50A 5DKRA 3SG3A 3TDIA 2PRUA 1OE9B 1TCOB 1SMGA 3IF7A 4I5KA 3RLZA 5B8IB 2JT0A 1X02A 2KSPA 1SR6C 2BCAA 3IQQA 3SJSA 4M2PA 1KK8B 2JWWA 1GJYA 2KI4C 4QJ3B 2O5GA 4JPZB 1K2HA 1G8IA 1J7RA 2LNKA 2LLUA 1ZMZA 2LMVA 1LINA 1B8RA 1B47A 1K93D 1YX7A 2LCPA 2COLB 2WORA 3AKBA 3NSLA 2QPTA 3PATA 3O4YA 1DF0B 1YUSA 2L4HA 3MSEB 4ZCVA 5CPVA 3JVTB 3OP0A 1YTZC 1NCXA 4XJKA 4JQ0D 2LM5A 2L0PA 3PN7B 1NX1A 4DCKA 2LP2A 5DKNA 2G9BA 3D10A 3LL8B 1B1GA 1ALWA 1F4OA 1OMRA 1YVLA 4DIRA 2SCPA 2K8MB 4IL1A 1CFFA 3GOFA 4NDCA 3WXAA 1FF1A 3SIAA 2ZFDA 2K7BA 2F33A 2M3WA 1DJXA 3BUXB 1QX5B 2LE9B 3BXKA 1C7WA 1MF8B 1MUXA 1NIWA 2BL0C 1AK8A 1SW8A 2ZRTA 1QIWA 2MA2A 1IWQA 1CMGA 2H61A 1F55A 4PHNA 2M9GA 3EK8A 4PHMA 4PDZA 4TNCA 4AQJA 5PALA 1A03A 3CWGA 4PHJA 1BJFA 4CIDA 4N5XA 1DVIA 1H8BA 1B9AA 1Y1AA 2WC8A 4WRIA 1YX8A 4MZKA 2KQYA 1NP8A 2KDHA 1K9UA 1QX2A 3JVTC 2GV5A 4DUQA 1YURA 2M8UA 1YR5A 4A4BA 1NWDA 4GGFA 1BR4B 2BKHB 2BCBA 3I5FB 2E30A 4MEWA 3VROA 2LC5A 4FTGA 2KFGA 2LLSA 1SCVA 4DS7A 2H61C 1CLMA 4CFRA 1WDCB 2VRGA 3KHEA 1OMDA 1WLMA 3TDZA 1PSRA 1Y1UA 1ZACA 1FI5A 2LLTA 3GK1A 5JOLA 2FCDA 2KHNA 3PM8A 1CMFA 1OOJA 3CZTX 1BOCA 3LK1A 4D1EA 4A4CA 1J7PA 1W7JB 1CFPA 3JTDB 4GGFC 3HCMA 5D7FA 4MRXA 3DVJA 3SG7A 1XFYO 1J1DA 5IBWA 4ORAB 3KO0A 4ORCB 1N0YA 1B8LA 1MQ1A 3NSKA 1SL7A 2E6WA 1A2XA 3O6BA 2D8NA 1XO5A 1BG1A 5I2LA 4DRWA 1KK7Z 4C0KA 2LAPA 4CFQA 1E8AA 1TNQA 1WRKA 1NUBA 3VGOA 4BY5A 3EK4A 1MR8A 2I94A 1QIVA 4Q04A 3BUNB 2HQWA 1QX7A 2O60A 1AVSA 4YBHB 1M31A 1BODA 2L4IA 2ISDA 1WDCC 2L2EA 3O78A 1OQPA 4PE0A 1H4BA 5ER5A 4F0ZB 2JNFA 1CDNA 2MJWB 4ETOA 2NCPA 3A8RA 4OV2A 1LA0A 2KFFA 2WOSA 2L98A 4CLNA 1M45A 1LKJA 1MXLC 1SCMC 2MLFC 1CDLA 4NQGA 1S26D 1XFZO 1RK9A 1QATA 1ZUZA 2KAXA 2AUCA 2PASA 3BQ3A 1MHOA 1YUTA 1EXRA 3PLFB 4MSPA 3QRXA 2Q91A 1JFKA 2PVBA 2OS8B 1M46A 2LHIA 3SG5A 5CSJA 2K2AA 4CPVA 3KEVA 5CSFA 1FBVA 1IJ6A 2KYCA 1QV1A 1NCYA 2KI6D 1UHIA 4C0LA 1IH0A 1S6JA 5GQQC 1JUOA 1YVHA 4XJKB 1C07A 2BL0B 2JXCA 4MLWA 4NDDA 1PK0D 1M39A 5CSNA 1S3PA 5BPJA 3NSOA 4HSZA 3OB2B 4YGEB 1K96A 1XFXO 1PVAA 4MZLA 1NSHA 2EC6C 3OB1B 4USLA 1GQMA 5J3XA 3TS5B 1S5GZ 3AAKA 2Q4UA 4YI9A 2M29A 1FI6A 2OS8C 2KI6C 1KFXL 1B8CA 1J1EA 2LHLA 2FJUB 1KWOB 1AHRA 1KFXS 1N65A 2LVVA 5HKYA 1CB1A 3KF9A 5I2QA 2NLNA 1SNLA 5AERA 1BMOA 3AKAA 3EKJA 2M1KB 2M1UA 2KGBC 2MLEC 1JF0A 1LA3A 2MHHA 2M7LA 1J55A 3DVMA 1DJIA 1HT9A 2BBNA 4MVFA 1QVIZ 4PE7A 2CCMA 3SG4A 2Y1NA 3VRNA 1XK4A 2JTZA 1SKTA 1NX2A 1SY9A 1A29A 1KSOA 1DJHA 2JZIA 2LVIA 1HQVA 1IGVA 1R2UA 3TS5C 2BBMA 2Y1MA 3PALA 2CTNA 3CTNA 2KBIA 1YRUB 2M7NA 3LCPC 4M2QA 3TUYB 5HLVA 2F8PA 2A4JA 1DTLA 1A75A 1KWOC 2AMIA 1ALVA 1V1FA 3FWCA 5KU1A 2B1UA 3NSIA 2BE4A 4NDBA 2CXJA 2OPOA 1OZSA 4N1FA 1YUUA 2ZN8A 2I2RE 4OR9B 4E68A 2KAYA 1XK4C 1SL8A 1PALA 4FQOA 5AXIA 1XVJA 1CFDA 2FCEA 3PSRA 1BF5A 1SCMB 1AUIB 2ZNEA 1V1GA 3DVEA 2JC2A 1IQ3A 3VRPA 4WQ2A 1S36A 1UHNA 1DJYA 2H2KA 2BKIB 2JOJA 3DVKA 1XA5A 1F4QA 1EJ3A 3OX5A 1MWNA 1BU3A 2JU0A 1XFVO 5JJGA 2FOTA 1TOPA
chains in the Genus database with same CATH superfamily
2V53A 1K90D 4MRYA 2TN4A 3TUYC 2K0JA 2Y5IA 2DOQA 5AFPA 3D0YB 3BFHA 1TIZA 5I2OA 4OR9B 2H8VA 2KNEA 5D69A 1IG5A 3PFVA 3EG5B 1B7TY 3NHTA 4OVNF 1TNXA 2G2BA 1ORGA 3FIAA 1PVBA 1AP4A 1GGWA 2LUCA 3SG6A 2ZNDA 3FWBA 1QLSA 2EC6B 3DF0A 4YI8A 1DT7B 1DGVA 3NHIA 3I5GB 1TNPA 5HLOA 1AJ5A 1IQ5A 1EG4A 1XYDA 3D0YA 3DD4A 1KQMC 1UP5A 2JXLA 4PE1A 5KSZA 5AANA 2R2IA 1WRLA 2KAVA 1S6CA 2PSRA 2HPSA 3R1PA 4ZCUA 4GNKB 2M0RA 3LLEA 4GFTA 4QJ4B 1JC2A 4L9MA 1TTXA 1DELA 1J7OA 4YGAA 1J7QA 4PCWA 2MRDA 1SL9A 2F2PA 1Z4HA 2K61A 5F6TA 4KYNA 1XFWO 1S6IA 5D3OA 1R6PA 2IS9A 2BCXA 3ICBA 1L2OB 2F3ZA 5HYDA 5CSIA 3LK0A 2HETA 3S0BA 3BUWB 1U5IB 1LS8A 3WHTB 1Z2CB 1OSAA 2P71A 3OX6A 2EGDA 1TN4A 1XFRA 3RM1A 2K7CA 4GUKA 4MN0A 2Y4QA 2CBLA 1DJGA 3AAJA 4INWA 1CLBA 3UO9A 2JPOA 4GPLB 3QMEA 2P70A 1XFUO 1IJ5A 1Y0VH 3OHMB 3I5GC 1SBJA 2ZN9A 1FPWA 1EG3A 1IIOA 3EVVA 3BOWB 1U5IA 2RGIA 3D75A 5HKZA 2K7OA 3WNXB 3R1OA 3O2PA 2M49B 2JQ6A 1C3YA 3EK7A 1K94A 4GGNA 2MAZA 1TRFA 3CLNA 1S5GY 1DJWA 3NXAA 1NX3A 3I5IB 2KFHA 2L2CA 5FYXA 3SIBA 1JF2A 3BYAA 5KTYA 3K21A 2LMTA 1WY9A 1WLZA 1L7ZA 3CS1A 2BECA 3H4SE 4R1EA 2ZRSA 5ER4X 5FI2A 4GBAA 1KFUL 4AQIA 2JNXA 2WNDA 3BOWA 3CR4X 1KSMA 1PSBA 1LXFC 1L2OC 5DKQA 3S0FA 1KFUS 1JSAA 3B86A 2JPTA 3A4UB 1ODBA 1CFCA 2NCOA 1B4CA 1DMOA 3HX4A 1VRKA 1C7VA 1CDMA 1SRAA 2PMYA 2WCEA 1OOGA 1QXPA 3DXLA 5K89A 3B7AA 1RFJA 4I5JA 1DEKA 3EKHA 4BY4A 1ZFSA 2JTTA 2WCJA 1QS7A 3GK2A 3D77A 3I5HB 4MZJA 2LANA 3ZWHA 3SG2A 2JT3A 1A75B 1SYMA 1QVIY 1KK8C 3UNWA 1DF0A 3BFBA 1UHJA 4P2YB 5G08A 2WCFA 4OKHA 2NXQA 4AOMA 2F2OA 2LMUA 3BUOB 1CKKA 1N2DA 4FQTA 3ZNIA 1FW4A 1F70A 2L51A 1F54A 3KPXA 2HQ8A 4I5LB 3I5IC 1SK6D 1EL4A 1RWYA 1BR1B 2F3YA 4PALA 3WHUB 4GAOA 3FS7A 4PHKA 4JWQA 1P28A 1JBAA 1T14A 1UWOA 4P5OE 2FJYA 3R1VA 2QACA 1G33A 4IJ7A 5HKWA 2K7DA 2KBMA 1QTXA 1K9PA 2HF5A 2PALA 3B87A 4OCIA 5FI6A 1DGUA 2KLDA 2P6BB 4YGCB 1K8UA 3GK4X 1QV0A 4I5NB 2WCBA 2L5XB 2BE6A 3PN7C 1KQMB 1K95A 3TZ1A 3S0AA 3S0GA 1RJVA 2GTEA 2MBXA 5EL2A 3EVUA 2LV7A 3C1VA 1IKUA 1TNWA 3I5HC 4HRHA 2GGZA 3VRQA 3IQOA 1QJTA 1M63B 3DZTA 1KK7Y 1UURA 4UPGA 3EVRA 1BT6A 2ZKMX 1K9KA 3DF0B 1F71A 1G4YR 1QASA 1CM4A 1SPYA 2I18A 3M0WA 1LVCD 1WRZA 3VB1A 1RROA 2OTGB 4ICBA 4HREE 4MBEA 3VRRA 4U8DA 1NPQA 1CM1A 2LUXA 3CGAA 4YRUA 1JWDA 1PULA 4M2OA 1ZOTB 2CT9A 2QEVA 3E3RA 2KYFA 1CDPA 5I8NA 2I7AA 2JRFA 4QJ5B 3S0EA 2KGRA 2K2FA 1SR6B 4XYNA 2KOTA 4ORBB 1EH2A 3CR5X 2EHBA 1DQEA 2KI4B 2AAOA 3I5FC 1Y6WA 4YGDB 1KCYA 3F45A 1YRTB 1W9ZA 3CABA 1KQVA 1TWOA 1CNPA 1DJZA 1UHKA 3CR2A 1CTRA 1RTP1 3FE8A 1B7TZ 1Q80A 1UUSA 5AEQA 3TDUA 1IRJA 1OMVA 1UHHA 2KQ6A 1RECA 4PE4A 1BLQA 1NCZA 1CLLA 1Y1XA 1NX0A 1QLKA 1S1EA 4N1GA 1MXEA 1TCFA 1NYAA 2LVKA 4HRGA 2LVJA 5TNCA 1JFJA 2ERBA 2NZ0A 1OOIX 1PRWA 2JT8A 2JULA 4WQ3A 1GGZA 2LP3A 4C0JA 1D1OA 3JTDC 1SSEB 4YGBB 1A4PA 2GGMA 2KLEA 1OZOA 2OTGC 2SASA 3BUMB 3CYZA 1QWVA 1W7IB 2M97A 2CNPA 1AJ4A 2BAPA 2L50A 5DKRA 3SG3A 3TDIA 2PRUA 1OE9B 1TCOB 1SMGA 3IF7A 4I5KA 3V2LA 3RLZA 5B8IB 2JT0A 1X02A 2KSPA 3L4LA 1SR6C 2BCAA 3IQQA 3SJSA 4F7FA 4M2PA 1KK8B 2BNXA 2JWWA 1GJYA 2KI4C 1TUZA 4QJ3B 2O5GA 4JPZB 1K2HA 1G8IA 3BJHA 4JD9A 3PM2A 1J7RA 3FE6A 2LNKA 2LLUA 1ZMZA 2LMVA 1LINA 1B8RA 1B47A 1K93D 1YX7A 2LCPA 2COLB 2WORA 4INXA 3AKBA 3NSLA 2QPTA 3PATA 3O4YA 1DF0B 1YUSA 2L4HA 3MSEB 4ZCVA 5CPVA 3JVTB 3OP0A 1YTZC 1NCXA 4XJKA 4JQ0D 5FI7A 2LM5A 2L0PA 3PN7B 1NX1A 4DCKA 2LP2A 2WCLA 5DKNA 2G9BA 3D10A 3LL8B 1B1GA 3SS5A 1ALWA 5HL1A 1F4OA 1OMRA 1YVLA 4DIRA 3R72A 2SCPA 2K8MB 4IL1A 1CFFA 4JKTA 3GOFA 4NDCA 3WXAA 1FF1A 3SIAA 2ZFDA 2K7BA 2F33A 2M3WA 1DJXA 3BUXB 1QX5B 2LE9B 3BXKA 1C7WA 1MF8B 1MUXA 1NIWA 2BL0C 1GM0A 1AK8A 1SW8A 2ZRTA 1QIWA 2MA2A 1IWQA 1CMGA 2H61A 1TUJA 3DYEA 1F55A 4PHNA 2M9GA 3EK8A 4PHMA 4PDZA 4TNCA 4AQJA 5PALA 1A03A 3FE9A 1C3ZA 3CWGA 4PHJA 1BJFA 4CIDA 4N5XA 1DVIA 1H8BA 1B9AA 1Y1AA 2WC8A 4WRIA 1YX8A 4MZKA 2KQYA 1NP8A 2KDHA 1K9UA 1QX2A 3JVTC 2GV5A 2WC5A 1YURA 2M8UA 3B88A 1YR5A 4A4BA 4DUQA 1NWDA 2QEBA 4GGFA 1BR4B 2BKHB 3K1EA 2BCBA 3I5FB 2E30A 4MEWA 3VROA 2LC5A 4FTGA 3L47A 2KFGA 2LLSA 1SCVA 4DS7A 2H61C 1CLMA 4CFRA 1WDCB 2VRGA 3KHEA 1OMDA 1WLMA 3TDZA 1PSRA 2WCKA 3D78A 1Y1UA 1ZACA 3N7HA 2LLTA 1FI5A 2YGUA 3GK1A 2FCDA 2KHNA 5JOLA 3PM8A 1CMFA 1OOJA 3CZTX 1OOHA 1BOCA 3BFAA 3LK1A 4D1EA 4A4CA 1J7PA 1W7JB 1CFPA 3S0DA 3CZ1A 3JTDB 4GGFC 3HCMA 5D7FA 4MRXA 3DVJA 3SG7A 1XFYO 1J1DA 5IBWA 4ORAB 3KO0A 4ORCB 1N0YA 1B8LA 1MQ1A 3NSKA 2L5YA 2PQLA 1SL7A 2E6WA 1A2XA 2K60A 2D8NA 1XO5A 3O6BA 5I2LA 1BG1A 4DRWA 1KK7Z 4C0KA 2LAPA 4CFQA 2WC6A 1E8AA 1TNQA 1WRKA 1NUBA 3VGOA 4BY5A 3EK4A 1MR8A 2I94A 1QIVA 4Q04A 3BUNB 2HQWA 1QX7A 2O60A 1AVSA 4YBHB 1M31A 1BODA 2L4IA 2ISDA 1WDCC 2L2EA 3O78A 1OQPA 4PE0A 2QEOA 1H4BA 5ER5A 4F0ZB 2JNFA 1CDNA 2MJWB 3NGVA 4ETOA 2NCPA 3A8RA 4OV2A 1LA0A 2KFFA 2WOSA 2L98A 4OZDA 4CLNA 1M45A 1LKJA 1MXLC 1SCMC 2MLFC 1CDLA 3CDNA 3D76A 4NQGA 1S26D 1XFZO 1RK9A 1QATA 1ZUZA 2KAXA 2AUCA 2PASA 3BQ3A 2WCHA 1MHOA 1YUTA 1EXRA 3PLFB 4MSPA 3QRXA 2Q91A 3D73A 1JFKA 2PVBA 2OS8B 1M46A 2LHIA 3SG5A 5CSJA 2K2AA 4CPVA 3KEVA 5CSFA 1FBVA 2PYQA 1IJ6A 1OOFA 2KYCA 1QV1A 1NCYA 3O4XA 2KI6D 1UHIA 4C0LA 1IH0A 1S6JA 5GQQC 1JUOA 1YVHA 4XJKB 1C07A 2BL0B 2JXCA 4MLWA 5DICA 4NDDA 1PK0D 1M39A 5CSNA 1S3PA 5I94A 5BPJA 3NSOA 4HSZA 3OB2B 4YGEB 1K96A 1XFXO 3OGNA 1PVAA 4MZLA 1NSHA 2EC6C 3B6XA 3PJIA 3OB1B 3OBVA 4USLA 1GQMA 5J3XA 3TS5B 1S5GZ 3AAKA 2Q4UA 3D74A 3SS4A 4YI9A 2M29A 1FI6A 2OS8C 2KI6C 1F8HA 1KFXL 1B8CA 1J1EA 2LHLA 2FJUB 1KWOB 1AHRA 1KFXS 1N65A 2QEHA 2LVVA 5HKYA 3IVTA 1CB1A 3KF9A 5I2QA 2NLNA 1SNLA 5AERA 1BMOA 3AKAA 3EKJA 2M1KB 4PT1A 2M1UA 3CZ0A 2KGBC 1DC1A 2MLEC 1JF0A 1LA3A 2MHHA 2M7LA 1J55A 3DVMA 1DJIA 1HT9A 2BBNA 4MVFA 1QVIZ 1OW4A 4PE7A 2CCMA 3SG4A 2Y1NA 3VRNA 3SS3A 1XK4A 2JTZA 1SKTA 1NX2A 3RZSA 1SY9A 1A29A 1KSOA 1DJHA 2JZIA 2LVIA 1HQVA 1IGVA 1R2UA 3TS5C 2BBMA 2Y1MA 3PALA 2CTNA 3CTNA 2KBIA 1YRUB 2M7NA 3LCPC 4M2QA 3TUYB 5HLVA 2F8PA 2A4JA 1DTLA 1A75A 1KWOC 2AMIA 1ALVA 1V1FA 2KPHA 3FWCA 5KU1A 2B1UA 3NSIA 2BE4A 4NDBA 2CXJA 2OPOA 1OZSA 2QDIA 1YUUA 2ZN8A 2I2RE 4N1FA 4E68A 2KAYA 1XK4C 1SL8A 1PALA 4FQOA 5AXIA 1XVJA 1CFDA 2FCEA 3PSRA 1BF5A 1SCMB 1AUIB 2ZNEA 3CZ2A 1V1GA 3DVEA 2JC2A 1IQ3A 3VRPA 4WQ2A 1S36A 1UHNA 1DJYA 2H2KA 2BKIB 2JOJA 3DVKA 1XA5A 1F4QA 3DY9A 1EJ3A 3OX5A 3L4AA 1MWNA 1BU3A 2WCMA 2JU0A 1XFVO 5JJGA 3Q8IA 2FOTA 1TOPA
chains in the Genus database with same CATH topology
2V53A 1K90D 4MRYA 2TN4A 3TUYC 2K0JA 2Y5IA 2DOQA 5AFPA 3D0YB 1TIZA 5I2OA 2KNEA 5D69A 1IG5A 3PFVA 1B7TY 4OVNF 1TNXA 2G2BA 3FIAA 1PVBA 1AP4A 1GGWA 2LUCA 3SG6A 2ZNDA 3FWBA 1QLSA 2EC6B 3DF0A 4YI8A 1DT7B 1DGVA 3I5GB 1TNPA 5HLOA 1AJ5A 1IQ5A 1EG4A 1XYDA 3D0YA 3DD4A 1KQMC 1UP5A 2JXLA 4PE1A 5KSZA 5AANA 2R2IA 1WRLA 2KAVA 1S6CA 2PSRA 2HPSA 4ZCUA 4QJ4B 4GNKB 2M0RA 3LLEA 4GFTA 1JC2A 4L9MA 1TTXA 1J7OA 4YGAA 1J7QA 4PCWA 2MRDA 1SL9A 2F2PA 2K61A 5F6TA 1XFWO 1S6IA 1R6PA 2IS9A 2BCXA 3ICBA 1L2OB 2F3ZA 5HYDA 5CSIA 3LK0A 2HETA 3BUWB 1U5IB 3WHTB 1OSAA 3OX6A 2EGDA 1TN4A 3RM1A 2K7CA 4GUKA 4MN0A 2Y4QA 2CBLA 1DJGA 3AAJA 1CLBA 4GPLB 1XFUO 1IJ5A 1Y0VH 3OHMB 3I5GC 1SBJA 2ZN9A 1FPWA 1EG3A 3EVVA 3BOWB 1U5IA 2RGIA 3WNXB 5HKZA 2K7OA 3O2PA 2M49B 2JQ6A 3EK7A 1K94A 4GGNA 2MAZA 1TRFA 3CLNA 1S5GY 1DJWA 3NXAA 1NX3A 3I5IB 2KFHA 5FYXA 1F8HA 3SIBA 1JF2A 3BYAA 5KTYA 3K21A 2LMTA 1WY9A 1WLZA 1L7ZA 3CS1A 2BECA 3H4SE 4R1EA 2ZRSA 5ER4X 4GBAA 1KFUL 4AQIA 2JNXA 2WNDA 3BOWA 3CR4X 1KSMA 1PSBA 1LXFC 1L2OC 5DKQA 1KFUS 1JSAA 2JPTA 3A4UB 1ODBA 1CFCA 2NCOA 1B4CA 1DMOA 3HX4A 1VRKA 1C7VA 1CDMA 1SRAA 2PMYA 2WCEA 5K89A 1QXPA 1RFJA 4I5JA 4BY4A 3EKHA 1ZFSA 2JTTA 3GK2A 1QS7A 3I5HB 4MZJA 3ZWHA 2LANA 3SG2A 2JT3A 1A75B 1SYMA 1QVIY 1KK8C 1DF0A 5G08A 1UHJA 4P2YB 2WCFA 4OKHA 2NXQA 4AOMA 2F2OA 2LMUA 3BUOB 1CKKA 1N2DA 3ZNIA 1F70A 1FW4A 2L51A 1F54A 3KPXA 2HQ8A 4I5LB 3I5IC 1SK6D 1EL4A 1RWYA 1BR1B 2F3YA 4PALA 3WHUB 4GAOA 3FS7A 4PHKA 4JWQA 1JBAA 1UWOA 4P5OE 2QACA 1G33A 5HKWA 2K7DA 2KBMA 1QTXA 1K9PA 2HF5A 2PALA 4OCIA 1DGUA 2P6BB 4YGCB 1K8UA 3GK4X 1QV0A 4I5NB 2WCBA 2L5XB 2BE6A 3PN7C 1KQMB 1K95A 3TZ1A 1RJVA 2MBXA 3EVUA 2LV7A 3C1VA 1IKUA 1TNWA 3I5HC 4HRHA 2GGZA 3VRQA 3IQOA 1QJTA 1M63B 1KK7Y 1UURA 4UPGA 3EVRA 1BT6A 2ZKMX 1K9KA 3DF0B 1F71A 1G4YR 1QASA 1CM4A 1SPYA 2I18A 3M0WA 1LVCD 1WRZA 1RROA 2OTGB 4ICBA 4HREE 4MBEA 3VRRA 4U8DA 1NPQA 1CM1A 2LUXA 3CGAA 4YRUA 1JWDA 1PULA 4M2OA 1ZOTB 2CT9A 3E3RA 2KYFA 1CDPA 5I8NA 2I7AA 2JRFA 4QJ5B 2KGRA 2K2FA 1SR6B 4XYNA 2KOTA 4ORBB 1EH2A 3CR5X 2EHBA 2KI4B 2AAOA 3I5FC 1Y6WA 4YGDB 1KCYA 3F45A 1YRTB 1KQVA 1CNPA 1DJZA 1UHKA 3CR2A 1CTRA 1RTP1 1B7TZ 1Q80A 1UUSA 5AEQA 3TDUA 1IRJA 1OMVA 1UHHA 2KQ6A 1RECA 4PE4A 1BLQA 1NCZA 1CLLA 1Y1XA 1NX0A 1QLKA 1S1EA 4N1GA 1MXEA 1TCFA 1NYAA 2LVKA 4HRGA 2LVJA 5TNCA 1JFJA 2NZ0A 1PRWA 2JT8A 2JULA 4WQ3A 1GGZA 2LP3A 4C0JA 1D1OA 3JTDC 4YGBB 1A4PA 2GGMA 1OZOA 2OTGC 2SASA 3BUMB 1W7IB 2M97A 2CNPA 1AJ4A 2L50A 5DKRA 3SG3A 3TDIA 2PRUA 1OE9B 1TCOB 1SMGA 3IF7A 4I5KA 3RLZA 5B8IB 2JT0A 1X02A 2KSPA 1SR6C 2BCAA 3IQQA 3SJSA 4M2PA 1KK8B 2JWWA 1GJYA 2KI4C 4QJ3B 2O5GA 4JPZB 1K2HA 1G8IA 1J7RA 2LNKA 2LLUA 1ZMZA 2LMVA 1LINA 1B8RA 1B47A 1K93D 1YX7A 2LCPA 2COLB 2WORA 3AKBA 3NSLA 2QPTA 3PATA 3O4YA 1DF0B 1YUSA 2L4HA 3MSEB 4ZCVA 5CPVA 3JVTB 3OP0A 1YTZC 1NCXA 4XJKA 4JQ0D 2LM5A 2L0PA 3PN7B 1NX1A 4DCKA 2LP2A 5DKNA 2G9BA 3D10A 3LL8B 1B1GA 1ALWA 1F4OA 1OMRA 1YVLA 4DIRA 2SCPA 2K8MB 4IL1A 1CFFA 3GOFA 4NDCA 3WXAA 1FF1A 3SIAA 2ZFDA 2K7BA 2F33A 2M3WA 1DJXA 3BUXB 1QX5B 2LE9B 3BXKA 1C7WA 1MF8B 1MUXA 1NIWA 2BL0C 1AK8A 1SW8A 2ZRTA 1QIWA 2MA2A 1IWQA 1CMGA 2H61A 1F55A 4PHNA 2M9GA 3EK8A 4PHMA 4PDZA 4TNCA 4AQJA 5PALA 1A03A 3CWGA 4PHJA 1BJFA 4CIDA 4N5XA 1DVIA 1H8BA 1B9AA 1Y1AA 2WC8A 4WRIA 1YX8A 4MZKA 2KQYA 1NP8A 2KDHA 1K9UA 1QX2A 3JVTC 2GV5A 4DUQA 1YURA 2M8UA 1YR5A 4A4BA 1NWDA 4GGFA 1BR4B 2BKHB 2BCBA 3I5FB 2E30A 4MEWA 3VROA 2LC5A 4FTGA 2KFGA 2LLSA 1SCVA 4DS7A 2H61C 1CLMA 4CFRA 1WDCB 2VRGA 3KHEA 1OMDA 1WLMA 3TDZA 1PSRA 1Y1UA 1ZACA 1FI5A 2LLTA 3GK1A 5JOLA 2FCDA 2KHNA 3PM8A 1CMFA 1OOJA 3CZTX 1BOCA 3LK1A 4D1EA 4A4CA 1J7PA 1W7JB 1CFPA 3JTDB 4GGFC 3HCMA 5D7FA 4MRXA 3DVJA 3SG7A 1XFYO 1J1DA 5IBWA 4ORAB 3KO0A 4ORCB 1N0YA 1B8LA 1MQ1A 3NSKA 1SL7A 2E6WA 1A2XA 3O6BA 2D8NA 1XO5A 1BG1A 5I2LA 4DRWA 1KK7Z 4C0KA 2LAPA 4CFQA 1E8AA 1TNQA 1WRKA 1NUBA 3VGOA 4BY5A 3EK4A 1MR8A 2I94A 1QIVA 4Q04A 3BUNB 2HQWA 1QX7A 2O60A 1AVSA 4YBHB 1M31A 1BODA 2L4IA 2ISDA 1WDCC 2L2EA 3O78A 1OQPA 4PE0A 1H4BA 5ER5A 4F0ZB 2JNFA 1CDNA 2MJWB 4ETOA 2NCPA 3A8RA 4OV2A 1LA0A 2KFFA 2WOSA 2L98A 4CLNA 1M45A 1LKJA 1MXLC 1SCMC 2MLFC 1CDLA 4NQGA 1S26D 1XFZO 1RK9A 1QATA 1ZUZA 2KAXA 2AUCA 2PASA 3BQ3A 1MHOA 1YUTA 1EXRA 3PLFB 4MSPA 3QRXA 2Q91A 1JFKA 2PVBA 2OS8B 1M46A 2LHIA 3SG5A 5CSJA 2K2AA 4CPVA 3KEVA 5CSFA 1FBVA 1IJ6A 2KYCA 1QV1A 1NCYA 2KI6D 1UHIA 4C0LA 1IH0A 1S6JA 5GQQC 1JUOA 1YVHA 4XJKB 1C07A 2BL0B 2JXCA 4MLWA 4NDDA 1PK0D 1M39A 5CSNA 1S3PA 5BPJA 3NSOA 4HSZA 3OB2B 4YGEB 1K96A 1XFXO 1PVAA 4MZLA 1NSHA 2EC6C 3OB1B 4USLA 1GQMA 5J3XA 3TS5B 1S5GZ 3AAKA 2Q4UA 4YI9A 2M29A 1FI6A 2OS8C 2KI6C 1KFXL 1B8CA 1J1EA 2LHLA 2FJUB 1KWOB 1AHRA 1KFXS 1N65A 2LVVA 5HKYA 1CB1A 3KF9A 5I2QA 2NLNA 1SNLA 5AERA 1BMOA 3AKAA 3EKJA 2M1KB 2M1UA 2KGBC 2MLEC 1JF0A 1LA3A 2MHHA 2M7LA 1J55A 3DVMA 1DJIA 1HT9A 2BBNA 4MVFA 1QVIZ 4PE7A 2CCMA 3SG4A 2Y1NA 3VRNA 1XK4A 2JTZA 1SKTA 1NX2A 1SY9A 1A29A 1KSOA 1DJHA 2JZIA 2LVIA 1HQVA 1IGVA 1R2UA 3TS5C 2BBMA 2Y1MA 3PALA 2CTNA 3CTNA 2KBIA 1YRUB 2M7NA 3LCPC 4M2QA 3TUYB 5HLVA 2F8PA 2A4JA 1DTLA 1A75A 1KWOC 2AMIA 1ALVA 1V1FA 3FWCA 5KU1A 2B1UA 3NSIA 2BE4A 4NDBA 2CXJA 2OPOA 1OZSA 4N1FA 1YUUA 2ZN8A 2I2RE 4OR9B 4E68A 2KAYA 1XK4C 1SL8A 1PALA 4FQOA 5AXIA 1XVJA 1CFDA 2FCEA 3PSRA 1BF5A 1SCMB 1AUIB 2ZNEA 1V1GA 3DVEA 2JC2A 1IQ3A 3VRPA 4WQ2A 1S36A 1UHNA 1DJYA 2H2KA 2BKIB 2JOJA 3DVKA 1XA5A 1F4QA 1EJ3A 3OX5A 1MWNA 1BU3A 2JU0A 1XFVO 5JJGA 2FOTA 1TOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V53 A;  1K90 D;  4MRY A;  2TN4 A;  3TUY C;  2K0J A;  2Y5I A;  2DOQ A;  5AFP A;  3D0Y B;  1TIZ A;  5I2O A;  2KNE A;  5D69 A;  1IG5 A;  3PFV A;  1B7T Y;  4OVN F;  1TNX A;  2G2B A;  3FIA A;  1PVB A;  1AP4 A;  1GGW A;  2LUC A;  3SG6 A;  2ZND A;  3FWB A;  1QLS A;  2EC6 B;  3DF0 A;  4YI8 A;  1DT7 B;  1DGV A;  3I5G B;  1TNP A;  5HLO A;  1AJ5 A;  1IQ5 A;  1EG4 A;  1XYD A;  3D0Y A;  3DD4 A;  1KQM C;  1UP5 A;  2JXL A;  4PE1 A;  5KSZ A;  5AAN A;  2R2I A;  1WRL A;  2KAV A;  1S6C A;  2PSR A;  2HPS A;  4ZCU A;  4QJ4 B;  4GNK B;  2M0R A;  3LLE A;  4GFT A;  1JC2 A;  4L9M A;  1TTX A;  1J7O A;  4YGA A;  1J7Q A;  4PCW A;  2MRD A;  1SL9 A;  2F2P A;  2K61 A;  5F6T A;  1XFW O;  1S6I A;  1R6P A;  2IS9 A;  2BCX A;  3ICB A;  1L2O B;  2F3Z A;  5HYD A;  5CSI A;  3LK0 A;  2HET A;  3BUW B;  1U5I B;  3WHT B;  1OSA A;  3OX6 A;  2EGD A;  1TN4 A;  3RM1 A;  2K7C A;  4GUK A;  4MN0 A;  2Y4Q A;  2CBL A;  1DJG A;  3AAJ A;  1CLB A;  4GPL B;  1XFU O;  1IJ5 A;  1Y0V H;  3OHM B;  3I5G C;  1SBJ A;  2ZN9 A;  1FPW A;  1EG3 A;  3EVV A;  3BOW B;  1U5I A;  2RGI A;  3WNX B;  5HKZ A;  2K7O A;  3O2P A;  2M49 B;  2JQ6 A;  3EK7 A;  1K94 A;  4GGN A;  2MAZ A;  1TRF A;  3CLN A;  1S5G Y;  1DJW A;  3NXA A;  1NX3 A;  3I5I B;  2KFH A;  5FYX A;  1F8H A;  3SIB A;  1JF2 A;  3BYA A;  5KTY A;  3K21 A;  2LMT A;  1WY9 A;  1WLZ A;  1L7Z A;  3CS1 A;  2BEC A;  3H4S E;  4R1E A;  2ZRS A;  5ER4 X;  4GBA A;  1KFU L;  4AQI A;  2JNX A;  2WND A;  3BOW A;  3CR4 X;  1KSM A;  1PSB A;  1LXF C;  1L2O C;  5DKQ A;  1KFU S;  1JSA A;  2JPT A;  3A4U B;  1ODB A;  1CFC A;  2NCO A;  1B4C A;  1DMO A;  3HX4 A;  1VRK A;  1C7V A;  1CDM A;  1SRA A;  2PMY A;  2WCE A;  5K89 A;  1QXP A;  1RFJ A;  4I5J A;  4BY4 A;  3EKH A;  1ZFS A;  2JTT A;  3GK2 A;  1QS7 A;  3I5H B;  4MZJ A;  3ZWH A;  2LAN A;  3SG2 A;  2JT3 A;  1A75 B;  1SYM A;  1QVI Y;  1KK8 C;  1DF0 A;  5G08 A;  1UHJ A;  4P2Y B;  2WCF A;  4OKH A;  2NXQ A;  4AOM A;  2F2O A;  2LMU A;  3BUO B;  1CKK A;  1N2D A;  3ZNI A;  1F70 A;  1FW4 A;  2L51 A;  1F54 A;  3KPX A;  2HQ8 A;  4I5L B;  3I5I C;  1SK6 D;  1EL4 A;  1RWY A;  1BR1 B;  2F3Y A;  4PAL A;  3WHU B;  4GAO A;  3FS7 A;  4PHK A;  4JWQ A;  1JBA A;  1UWO A;  4P5O E;  2QAC A;  1G33 A;  5HKW A;  2K7D A;  2KBM A;  1QTX A;  1K9P A;  2HF5 A;  2PAL A;  4OCI A;  1DGU A;  2P6B B;  4YGC B;  1K8U A;  3GK4 X;  1QV0 A;  4I5N B;  2WCB A;  2L5X B;  2BE6 A;  3PN7 C;  1KQM B;  1K95 A;  3TZ1 A;  1RJV A;  2MBX A;  3EVU A;  2LV7 A;  3C1V A;  1IKU A;  1TNW A;  3I5H C;  4HRH A;  2GGZ A;  3VRQ A;  3IQO A;  1QJT A;  1M63 B;  1KK7 Y;  1UUR A;  4UPG A;  3EVR A;  1BT6 A;  2ZKM X;  1K9K A;  3DF0 B;  1F71 A;  1G4Y R;  1QAS A;  1CM4 A;  1SPY A;  2I18 A;  3M0W A;  1LVC D;  1WRZ A;  1RRO A;  2OTG B;  4ICB A;  4HRE E;  4MBE A;  3VRR A;  4U8D A;  1NPQ A;  1CM1 A;  2LUX A;  3CGA A;  4YRU A;  1JWD A;  1PUL A;  4M2O A;  1ZOT B;  2CT9 A;  3E3R A;  2KYF A;  1CDP A;  5I8N A;  2I7A A;  2JRF A;  4QJ5 B;  2KGR A;  2K2F A;  1SR6 B;  4XYN A;  2KOT A;  4ORB B;  1EH2 A;  3CR5 X;  2EHB A;  2KI4 B;  2AAO A;  3I5F C;  1Y6W A;  4YGD B;  1KCY A;  3F45 A;  1YRT B;  1KQV A;  1CNP A;  1DJZ A;  1UHK A;  3CR2 A;  1CTR A;  1RTP 1;  1B7T Z;  1Q80 A;  1UUS A;  5AEQ A;  3TDU A;  1IRJ A;  1OMV A;  1UHH A;  2KQ6 A;  1REC A;  4PE4 A;  1BLQ A;  1NCZ A;  1CLL A;  1Y1X A;  1NX0 A;  1QLK A;  1S1E A;  4N1G A;  1MXE A;  1TCF A;  1NYA A;  2LVK A;  4HRG A;  2LVJ A;  5TNC A;  1JFJ A;  2NZ0 A;  1PRW A;  2JT8 A;  2JUL A;  4WQ3 A;  1GGZ A;  2LP3 A;  4C0J A;  1D1O A;  3JTD C;  4YGB B;  1A4P A;  2GGM A;  1OZO A;  2OTG C;  2SAS A;  3BUM B;  1W7I B;  2M97 A;  2CNP A;  1AJ4 A;  2L50 A;  5DKR A;  3SG3 A;  3TDI A;  2PRU A;  1OE9 B;  1TCO B;  1SMG A;  3IF7 A;  4I5K A;  3RLZ A;  5B8I B;  2JT0 A;  1X02 A;  2KSP A;  1SR6 C;  2BCA A;  3IQQ A;  3SJS A;  4M2P A;  1KK8 B;  2JWW A;  1GJY A;  2KI4 C;  4QJ3 B;  2O5G A;  4JPZ B;  1K2H A;  1G8I A;  1J7R A;  2LNK A;  2LLU A;  1ZMZ A;  2LMV A;  1LIN A;  1B8R A;  1B47 A;  1K93 D;  1YX7 A;  2LCP A;  2COL B;  2WOR A;  3AKB A;  3NSL A;  2QPT A;  3PAT A;  3O4Y A;  1DF0 B;  1YUS A;  2L4H A;  3MSE B;  4ZCV A;  5CPV A;  3JVT B;  3OP0 A;  1YTZ C;  1NCX A;  4XJK A;  4JQ0 D;  2LM5 A;  2L0P A;  3PN7 B;  1NX1 A;  4DCK A;  2LP2 A;  5DKN A;  2G9B A;  3D10 A;  3LL8 B;  1B1G A;  1ALW A;  1F4O A;  1OMR A;  1YVL A;  4DIR A;  2SCP A;  2K8M B;  4IL1 A;  1CFF A;  3GOF A;  4NDC A;  3WXA A;  1FF1 A;  3SIA A;  2ZFD A;  2K7B A;  2F33 A;  2M3W A;  1DJX A;  3BUX B;  1QX5 B;  2LE9 B;  3BXK A;  1C7W A;  1MF8 B;  1MUX A;  1NIW A;  2BL0 C;  1AK8 A;  1SW8 A;  2ZRT A;  1QIW A;  2MA2 A;  1IWQ A;  1CMG A;  2H61 A;  1F55 A;  4PHN A;  2M9G A;  3EK8 A;  4PHM A;  4PDZ A;  4TNC A;  4AQJ A;  5PAL A;  1A03 A;  3CWG A;  4PHJ A;  1BJF A;  4CID A;  4N5X A;  1DVI A;  1H8B A;  1B9A A;  1Y1A A;  2WC8 A;  4WRI A;  1YX8 A;  4MZK A;  2KQY A;  1NP8 A;  2KDH A;  1K9U A;  1QX2 A;  3JVT C;  2GV5 A;  4DUQ A;  1YUR A;  2M8U A;  1YR5 A;  4A4B A;  1NWD A;  4GGF A;  1BR4 B;  2BKH B;  2BCB A;  3I5F B;  2E30 A;  4MEW A;  3VRO A;  2LC5 A;  4FTG A;  2KFG A;  2LLS A;  1SCV A;  4DS7 A;  2H61 C;  1CLM A;  4CFR A;  1WDC B;  2VRG A;  3KHE A;  1OMD A;  1WLM A;  3TDZ A;  1PSR A;  1Y1U A;  1ZAC A;  1FI5 A;  2LLT A;  3GK1 A;  5JOL A;  2FCD A;  2KHN A;  3PM8 A;  1CMF A;  1OOJ A;  3CZT X;  1BOC A;  3LK1 A;  4D1E A;  4A4C A;  1J7P A;  1W7J B;  1CFP A;  3JTD B;  4GGF C;  3HCM A;  5D7F A;  4MRX A;  3DVJ A;  3SG7 A;  1XFY O;  1J1D A;  5IBW A;  4ORA B;  3KO0 A;  4ORC B;  1N0Y A;  1B8L A;  1MQ1 A;  3NSK A;  1SL7 A;  2E6W A;  1A2X A;  3O6B A;  2D8N A;  1XO5 A;  1BG1 A;  5I2L A;  4DRW A;  1KK7 Z;  4C0K A;  2LAP A;  4CFQ A;  1E8A A;  1TNQ A;  1WRK A;  1NUB A;  3VGO A;  4BY5 A;  3EK4 A;  1MR8 A;  2I94 A;  1QIV A;  4Q04 A;  3BUN B;  2HQW A;  1QX7 A;  2O60 A;  1AVS A;  4YBH B;  1M31 A;  1BOD A;  2L4I A;  2ISD A;  1WDC C;  2L2E A;  3O78 A;  1OQP A;  4PE0 A;  1H4B A;  5ER5 A;  4F0Z B;  2JNF A;  1CDN A;  2MJW B;  4ETO A;  2NCP A;  3A8R A;  4OV2 A;  1LA0 A;  2KFF A;  2WOS A;  2L98 A;  4CLN A;  1M45 A;  1LKJ A;  1MXL C;  1SCM C;  2MLF C;  1CDL A;  4NQG A;  1S26 D;  1XFZ O;  1RK9 A;  1QAT A;  1ZUZ A;  2KAX A;  2AUC A;  2PAS A;  3BQ3 A;  1MHO A;  1YUT A;  1EXR A;  3PLF B;  4MSP A;  3QRX A;  2Q91 A;  1JFK A;  2PVB A;  2OS8 B;  1M46 A;  2LHI A;  3SG5 A;  5CSJ A;  2K2A A;  4CPV A;  3KEV A;  5CSF A;  1FBV A;  1IJ6 A;  2KYC A;  1QV1 A;  1NCY A;  2KI6 D;  1UHI A;  4C0L A;  1IH0 A;  1S6J A;  5GQQ C;  1JUO A;  1YVH A;  4XJK B;  1C07 A;  2BL0 B;  2JXC A;  4MLW A;  4NDD A;  1PK0 D;  1M39 A;  5CSN A;  1S3P A;  5BPJ A;  3NSO A;  4HSZ A;  3OB2 B;  4YGE B;  1K96 A;  1XFX O;  1PVA A;  4MZL A;  1NSH A;  2EC6 C;  3OB1 B;  4USL A;  1GQM A;  5J3X A;  3TS5 B;  1S5G Z;  3AAK A;  2Q4U A;  4YI9 A;  2M29 A;  1FI6 A;  2OS8 C;  2KI6 C;  1KFX L;  1B8C A;  1J1E A;  2LHL A;  2FJU B;  1KWO B;  1AHR A;  1KFX S;  1N65 A;  2LVV A;  5HKY A;  1CB1 A;  3KF9 A;  5I2Q A;  2NLN A;  1SNL A;  5AER A;  1BMO A;  3AKA A;  3EKJ A;  2M1K B;  2M1U A;  2KGB C;  2MLE C;  1JF0 A;  1LA3 A;  2MHH A;  2M7L A;  1J55 A;  3DVM A;  1DJI A;  1HT9 A;  2BBN A;  4MVF A;  1QVI Z;  4PE7 A;  2CCM A;  3SG4 A;  2Y1N A;  3VRN A;  1XK4 A;  2JTZ A;  1SKT A;  1NX2 A;  1SY9 A;  1A29 A;  1KSO A;  1DJH A;  2JZI A;  2LVI A;  1HQV A;  1IGV A;  1R2U A;  3TS5 C;  2BBM A;  2Y1M A;  3PAL A;  2CTN A;  3CTN A;  2KBI A;  1YRU B;  2M7N A;  3LCP C;  4M2Q A;  3TUY B;  5HLV A;  2F8P A;  2A4J A;  1DTL A;  1A75 A;  1KWO C;  2AMI A;  1ALV A;  1V1F A;  3FWC A;  5KU1 A;  2B1U A;  3NSI A;  2BE4 A;  4NDB A;  2CXJ A;  2OPO A;  1OZS A;  4N1F A;  1YUU A;  2ZN8 A;  2I2R E;  4OR9 B;  4E68 A;  2KAY A;  1XK4 C;  1SL8 A;  1PAL A;  4FQO A;  5AXI A;  1XVJ A;  1CFD A;  2FCE A;  3PSR A;  1BF5 A;  1SCM B;  1AUI B;  2ZNE A;  1V1G A;  3DVE A;  2JC2 A;  1IQ3 A;  3VRP A;  4WQ2 A;  1S36 A;  1UHN A;  1DJY A;  2H2K A;  2BKI B;  2JOJ A;  3DVK A;  1XA5 A;  1F4Q A;  1EJ3 A;  3OX5 A;  1MWN A;  1BU3 A;  2JU0 A;  1XFV O;  5JJG A;  2FOT A;  1TOP A; 
#chains in the Genus database with same CATH topology
 2V53 A;  1K90 D;  4MRY A;  2TN4 A;  3TUY C;  2K0J A;  2Y5I A;  2DOQ A;  5AFP A;  3D0Y B;  3BFH A;  1TIZ A;  5I2O A;  4OR9 B;  2H8V A;  2KNE A;  5D69 A;  1IG5 A;  3PFV A;  3EG5 B;  1B7T Y;  3NHT A;  4OVN F;  1TNX A;  2G2B A;  1ORG A;  3FIA A;  1PVB A;  1AP4 A;  1GGW A;  2LUC A;  3SG6 A;  2ZND A;  3FWB A;  1QLS A;  2EC6 B;  3DF0 A;  4YI8 A;  1DT7 B;  1DGV A;  3NHI A;  3I5G B;  1TNP A;  5HLO A;  1AJ5 A;  1IQ5 A;  1EG4 A;  1XYD A;  3D0Y A;  3DD4 A;  1KQM C;  1UP5 A;  2JXL A;  4PE1 A;  5KSZ A;  5AAN A;  2R2I A;  1WRL A;  2KAV A;  1S6C A;  2PSR A;  2HPS A;  3R1P A;  4ZCU A;  4GNK B;  2M0R A;  3LLE A;  4GFT A;  4QJ4 B;  1JC2 A;  4L9M A;  1TTX A;  1DEL A;  1J7O A;  4YGA A;  1J7Q A;  4PCW A;  2MRD A;  1SL9 A;  2F2P A;  1Z4H A;  2K61 A;  5F6T A;  4KYN A;  1XFW O;  1S6I A;  5D3O A;  1R6P A;  2IS9 A;  2BCX A;  3ICB A;  1L2O B;  2F3Z A;  5HYD A;  5CSI A;  3LK0 A;  2HET A;  3S0B A;  3BUW B;  1U5I B;  1LS8 A;  3WHT B;  1Z2C B;  1OSA A;  2P71 A;  3OX6 A;  2EGD A;  1TN4 A;  1XFR A;  3RM1 A;  2K7C A;  4GUK A;  4MN0 A;  2Y4Q A;  2CBL A;  1DJG A;  3AAJ A;  4INW A;  1CLB A;  3UO9 A;  2JPO A;  4GPL B;  3QME A;  2P70 A;  1XFU O;  1IJ5 A;  1Y0V H;  3OHM B;  3I5G C;  1SBJ A;  2ZN9 A;  1FPW A;  1EG3 A;  1IIO A;  3EVV A;  3BOW B;  1U5I A;  2RGI A;  3D75 A;  5HKZ A;  2K7O A;  3WNX B;  3R1O A;  3O2P A;  2M49 B;  2JQ6 A;  1C3Y A;  3EK7 A;  1K94 A;  4GGN A;  2MAZ A;  1TRF A;  3CLN A;  1S5G Y;  1DJW A;  3NXA A;  1NX3 A;  3I5I B;  2KFH A;  2L2C A;  5FYX A;  3SIB A;  1JF2 A;  3BYA A;  5KTY A;  3K21 A;  2LMT A;  1WY9 A;  1WLZ A;  1L7Z A;  3CS1 A;  2BEC A;  3H4S E;  4R1E A;  2ZRS A;  5ER4 X;  5FI2 A;  4GBA A;  1KFU L;  4AQI A;  2JNX A;  2WND A;  3BOW A;  3CR4 X;  1KSM A;  1PSB A;  1LXF C;  1L2O C;  5DKQ A;  3S0F A;  1KFU S;  1JSA A;  3B86 A;  2JPT A;  3A4U B;  1ODB A;  1CFC A;  2NCO A;  1B4C A;  1DMO A;  3HX4 A;  1VRK A;  1C7V A;  1CDM A;  1SRA A;  2PMY A;  2WCE A;  1OOG A;  1QXP A;  3DXL A;  5K89 A;  3B7A A;  1RFJ A;  4I5J A;  1DEK A;  3EKH A;  4BY4 A;  1ZFS A;  2JTT A;  2WCJ A;  1QS7 A;  3GK2 A;  3D77 A;  3I5H B;  4MZJ A;  2LAN A;  3ZWH A;  3SG2 A;  2JT3 A;  1A75 B;  1SYM A;  1QVI Y;  1KK8 C;  3UNW A;  1DF0 A;  3BFB A;  1UHJ A;  4P2Y B;  5G08 A;  2WCF A;  4OKH A;  2NXQ A;  4AOM A;  2F2O A;  2LMU A;  3BUO B;  1CKK A;  1N2D A;  4FQT A;  3ZNI A;  1FW4 A;  1F70 A;  2L51 A;  1F54 A;  3KPX A;  2HQ8 A;  4I5L B;  3I5I C;  1SK6 D;  1EL4 A;  1RWY A;  1BR1 B;  2F3Y A;  4PAL A;  3WHU B;  4GAO A;  3FS7 A;  4PHK A;  4JWQ A;  1P28 A;  1JBA A;  1T14 A;  1UWO A;  4P5O E;  2FJY A;  3R1V A;  2QAC A;  1G33 A;  4IJ7 A;  5HKW A;  2K7D A;  2KBM A;  1QTX A;  1K9P A;  2HF5 A;  2PAL A;  3B87 A;  4OCI A;  5FI6 A;  1DGU A;  2KLD A;  2P6B B;  4YGC B;  1K8U A;  3GK4 X;  1QV0 A;  4I5N B;  2WCB A;  2L5X B;  2BE6 A;  3PN7 C;  1KQM B;  1K95 A;  3TZ1 A;  3S0A A;  3S0G A;  1RJV A;  2GTE A;  2MBX A;  5EL2 A;  3EVU A;  2LV7 A;  3C1V A;  1IKU A;  1TNW A;  3I5H C;  4HRH A;  2GGZ A;  3VRQ A;  3IQO A;  1QJT A;  1M63 B;  3DZT A;  1KK7 Y;  1UUR A;  4UPG A;  3EVR A;  1BT6 A;  2ZKM X;  1K9K A;  3DF0 B;  1F71 A;  1G4Y R;  1QAS A;  1CM4 A;  1SPY A;  2I18 A;  3M0W A;  1LVC D;  1WRZ A;  3VB1 A;  1RRO A;  2OTG B;  4ICB A;  4HRE E;  4MBE A;  3VRR A;  4U8D A;  1NPQ A;  1CM1 A;  2LUX A;  3CGA A;  4YRU A;  1JWD A;  1PUL A;  4M2O A;  1ZOT B;  2CT9 A;  2QEV A;  3E3R A;  2KYF A;  1CDP A;  5I8N A;  2I7A A;  2JRF A;  4QJ5 B;  3S0E A;  2KGR A;  2K2F A;  1SR6 B;  4XYN A;  2KOT A;  4ORB B;  1EH2 A;  3CR5 X;  2EHB A;  1DQE A;  2KI4 B;  2AAO A;  3I5F C;  1Y6W A;  4YGD B;  1KCY A;  3F45 A;  1YRT B;  1W9Z A;  3CAB A;  1KQV A;  1TWO A;  1CNP A;  1DJZ A;  1UHK A;  3CR2 A;  1CTR A;  1RTP 1;  3FE8 A;  1B7T Z;  1Q80 A;  1UUS A;  5AEQ A;  3TDU A;  1IRJ A;  1OMV A;  1UHH A;  2KQ6 A;  1REC A;  4PE4 A;  1BLQ A;  1NCZ A;  1CLL A;  1Y1X A;  1NX0 A;  1QLK A;  1S1E A;  4N1G A;  1MXE A;  1TCF A;  1NYA A;  2LVK A;  4HRG A;  2LVJ A;  5TNC A;  1JFJ A;  2ERB A;  2NZ0 A;  1OOI X;  1PRW A;  2JT8 A;  2JUL A;  4WQ3 A;  1GGZ A;  2LP3 A;  4C0J A;  1D1O A;  3JTD C;  1SSE B;  4YGB B;  1A4P A;  2GGM A;  2KLE A;  1OZO A;  2OTG C;  2SAS A;  3BUM B;  3CYZ A;  1QWV A;  1W7I B;  2M97 A;  2CNP A;  1AJ4 A;  2BAP A;  2L50 A;  5DKR A;  3SG3 A;  3TDI A;  2PRU A;  1OE9 B;  1TCO B;  1SMG A;  3IF7 A;  4I5K A;  3V2L A;  3RLZ A;  5B8I B;  2JT0 A;  1X02 A;  2KSP A;  3L4L A;  1SR6 C;  2BCA A;  3IQQ A;  3SJS A;  4F7F A;  4M2P A;  1KK8 B;  2BNX A;  2JWW A;  1GJY A;  2KI4 C;  1TUZ A;  4QJ3 B;  2O5G A;  4JPZ B;  1K2H A;  1G8I A;  3BJH A;  4JD9 A;  3PM2 A;  1J7R A;  3FE6 A;  2LNK A;  2LLU A;  1ZMZ A;  2LMV A;  1LIN A;  1B8R A;  1B47 A;  1K93 D;  1YX7 A;  2LCP A;  2COL B;  2WOR A;  4INX A;  3AKB A;  3NSL A;  2QPT A;  3PAT A;  3O4Y A;  1DF0 B;  1YUS A;  2L4H A;  3MSE B;  4ZCV A;  5CPV A;  3JVT B;  3OP0 A;  1YTZ C;  1NCX A;  4XJK A;  4JQ0 D;  5FI7 A;  2LM5 A;  2L0P A;  3PN7 B;  1NX1 A;  4DCK A;  2LP2 A;  2WCL A;  5DKN A;  2G9B A;  3D10 A;  3LL8 B;  1B1G A;  3SS5 A;  1ALW A;  5HL1 A;  1F4O A;  1OMR A;  1YVL A;  4DIR A;  3R72 A;  2SCP A;  2K8M B;  4IL1 A;  1CFF A;  4JKT A;  3GOF A;  4NDC A;  3WXA A;  1FF1 A;  3SIA A;  2ZFD A;  2K7B A;  2F33 A;  2M3W A;  1DJX A;  3BUX B;  1QX5 B;  2LE9 B;  3BXK A;  1C7W A;  1MF8 B;  1MUX A;  1NIW A;  2BL0 C;  1GM0 A;  1AK8 A;  1SW8 A;  2ZRT A;  1QIW A;  2MA2 A;  1IWQ A;  1CMG A;  2H61 A;  1TUJ A;  3DYE A;  1F55 A;  4PHN A;  2M9G A;  3EK8 A;  4PHM A;  4PDZ A;  4TNC A;  4AQJ A;  5PAL A;  1A03 A;  3FE9 A;  1C3Z A;  3CWG A;  4PHJ A;  1BJF A;  4CID A;  4N5X A;  1DVI A;  1H8B A;  1B9A A;  1Y1A A;  2WC8 A;  4WRI A;  1YX8 A;  4MZK A;  2KQY A;  1NP8 A;  2KDH A;  1K9U A;  1QX2 A;  3JVT C;  2GV5 A;  2WC5 A;  1YUR A;  2M8U A;  3B88 A;  1YR5 A;  4A4B A;  4DUQ A;  1NWD A;  2QEB A;  4GGF A;  1BR4 B;  2BKH B;  3K1E A;  2BCB A;  3I5F B;  2E30 A;  4MEW A;  3VRO A;  2LC5 A;  4FTG A;  3L47 A;  2KFG A;  2LLS A;  1SCV A;  4DS7 A;  2H61 C;  1CLM A;  4CFR A;  1WDC B;  2VRG A;  3KHE A;  1OMD A;  1WLM A;  3TDZ A;  1PSR A;  2WCK A;  3D78 A;  1Y1U A;  1ZAC A;  3N7H A;  2LLT A;  1FI5 A;  2YGU A;  3GK1 A;  2FCD A;  2KHN A;  5JOL A;  3PM8 A;  1CMF A;  1OOJ A;  3CZT X;  1OOH A;  1BOC A;  3BFA A;  3LK1 A;  4D1E A;  4A4C A;  1J7P A;  1W7J B;  1CFP A;  3S0D A;  3CZ1 A;  3JTD B;  4GGF C;  3HCM A;  5D7F A;  4MRX A;  3DVJ A;  3SG7 A;  1XFY O;  1J1D A;  5IBW A;  4ORA B;  3KO0 A;  4ORC B;  1N0Y A;  1B8L A;  1MQ1 A;  3NSK A;  2L5Y A;  2PQL A;  1SL7 A;  2E6W A;  1A2X A;  2K60 A;  2D8N A;  1XO5 A;  3O6B A;  5I2L A;  1BG1 A;  4DRW A;  1KK7 Z;  4C0K A;  2LAP A;  4CFQ A;  2WC6 A;  1E8A A;  1TNQ A;  1WRK A;  1NUB A;  3VGO A;  4BY5 A;  3EK4 A;  1MR8 A;  2I94 A;  1QIV A;  4Q04 A;  3BUN B;  2HQW A;  1QX7 A;  2O60 A;  1AVS A;  4YBH B;  1M31 A;  1BOD A;  2L4I A;  2ISD A;  1WDC C;  2L2E A;  3O78 A;  1OQP A;  4PE0 A;  2QEO A;  1H4B A;  5ER5 A;  4F0Z B;  2JNF A;  1CDN A;  2MJW B;  3NGV A;  4ETO A;  2NCP A;  3A8R A;  4OV2 A;  1LA0 A;  2KFF A;  2WOS A;  2L98 A;  4OZD A;  4CLN A;  1M45 A;  1LKJ A;  1MXL C;  1SCM C;  2MLF C;  1CDL A;  3CDN A;  3D76 A;  4NQG A;  1S26 D;  1XFZ O;  1RK9 A;  1QAT A;  1ZUZ A;  2KAX A;  2AUC A;  2PAS A;  3BQ3 A;  2WCH A;  1MHO A;  1YUT A;  1EXR A;  3PLF B;  4MSP A;  3QRX A;  2Q91 A;  3D73 A;  1JFK A;  2PVB A;  2OS8 B;  1M46 A;  2LHI A;  3SG5 A;  5CSJ A;  2K2A A;  4CPV A;  3KEV A;  5CSF A;  1FBV A;  2PYQ A;  1IJ6 A;  1OOF A;  2KYC A;  1QV1 A;  1NCY A;  3O4X A;  2KI6 D;  1UHI A;  4C0L A;  1IH0 A;  1S6J A;  5GQQ C;  1JUO A;  1YVH A;  4XJK B;  1C07 A;  2BL0 B;  2JXC A;  4MLW A;  5DIC A;  4NDD A;  1PK0 D;  1M39 A;  5CSN A;  1S3P A;  5I94 A;  5BPJ A;  3NSO A;  4HSZ A;  3OB2 B;  4YGE B;  1K96 A;  1XFX O;  3OGN A;  1PVA A;  4MZL A;  1NSH A;  2EC6 C;  3B6X A;  3PJI A;  3OB1 B;  3OBV A;  4USL A;  1GQM A;  5J3X A;  3TS5 B;  1S5G Z;  3AAK A;  2Q4U A;  3D74 A;  3SS4 A;  4YI9 A;  2M29 A;  1FI6 A;  2OS8 C;  2KI6 C;  1F8H A;  1KFX L;  1B8C A;  1J1E A;  2LHL A;  2FJU B;  1KWO B;  1AHR A;  1KFX S;  1N65 A;  2QEH A;  2LVV A;  5HKY A;  3IVT A;  1CB1 A;  3KF9 A;  5I2Q A;  2NLN A;  1SNL A;  5AER A;  1BMO A;  3AKA A;  3EKJ A;  2M1K B;  4PT1 A;  2M1U A;  3CZ0 A;  2KGB C;  1DC1 A;  2MLE C;  1JF0 A;  1LA3 A;  2MHH A;  2M7L A;  1J55 A;  3DVM A;  1DJI A;  1HT9 A;  2BBN A;  4MVF A;  1QVI Z;  1OW4 A;  4PE7 A;  2CCM A;  3SG4 A;  2Y1N A;  3VRN A;  3SS3 A;  1XK4 A;  2JTZ A;  1SKT A;  1NX2 A;  3RZS A;  1SY9 A;  1A29 A;  1KSO A;  1DJH A;  2JZI A;  2LVI A;  1HQV A;  1IGV A;  1R2U A;  3TS5 C;  2BBM A;  2Y1M A;  3PAL A;  2CTN A;  3CTN A;  2KBI A;  1YRU B;  2M7N A;  3LCP C;  4M2Q A;  3TUY B;  5HLV A;  2F8P A;  2A4J A;  1DTL A;  1A75 A;  1KWO C;  2AMI A;  1ALV A;  1V1F A;  2KPH A;  3FWC A;  5KU1 A;  2B1U A;  3NSI A;  2BE4 A;  4NDB A;  2CXJ A;  2OPO A;  1OZS A;  2QDI A;  1YUU A;  2ZN8 A;  2I2R E;  4N1F A;  4E68 A;  2KAY A;  1XK4 C;  1SL8 A;  1PAL A;  4FQO A;  5AXI A;  1XVJ A;  1CFD A;  2FCE A;  3PSR A;  1BF5 A;  1SCM B;  1AUI B;  2ZNE A;  3CZ2 A;  1V1G A;  3DVE A;  2JC2 A;  1IQ3 A;  3VRP A;  4WQ2 A;  1S36 A;  1UHN A;  1DJY A;  2H2K A;  2BKI B;  2JOJ A;  3DVK A;  1XA5 A;  1F4Q A;  3DY9 A;  1EJ3 A;  3OX5 A;  3L4A A;  1MWN A;  1BU3 A;  2WCM A;  2JU0 A;  1XFV O;  5JJG A;  3Q8I A;  2FOT A;  1TOP A; 
#chains in the Genus database with same CATH homology
 2V53 A;  1K90 D;  4MRY A;  2TN4 A;  3TUY C;  2K0J A;  2Y5I A;  2DOQ A;  5AFP A;  3D0Y B;  1TIZ A;  5I2O A;  2KNE A;  5D69 A;  1IG5 A;  3PFV A;  1B7T Y;  4OVN F;  1TNX A;  2G2B A;  3FIA A;  1PVB A;  1AP4 A;  1GGW A;  2LUC A;  3SG6 A;  2ZND A;  3FWB A;  1QLS A;  2EC6 B;  3DF0 A;  4YI8 A;  1DT7 B;  1DGV A;  3I5G B;  1TNP A;  5HLO A;  1AJ5 A;  1IQ5 A;  1EG4 A;  1XYD A;  3D0Y A;  3DD4 A;  1KQM C;  1UP5 A;  2JXL A;  4PE1 A;  5KSZ A;  5AAN A;  2R2I A;  1WRL A;  2KAV A;  1S6C A;  2PSR A;  2HPS A;  4ZCU A;  4QJ4 B;  4GNK B;  2M0R A;  3LLE A;  4GFT A;  1JC2 A;  4L9M A;  1TTX A;  1J7O A;  4YGA A;  1J7Q A;  4PCW A;  2MRD A;  1SL9 A;  2F2P A;  2K61 A;  5F6T A;  1XFW O;  1S6I A;  1R6P A;  2IS9 A;  2BCX A;  3ICB A;  1L2O B;  2F3Z A;  5HYD A;  5CSI A;  3LK0 A;  2HET A;  3BUW B;  1U5I B;  3WHT B;  1OSA A;  3OX6 A;  2EGD A;  1TN4 A;  3RM1 A;  2K7C A;  4GUK A;  4MN0 A;  2Y4Q A;  2CBL A;  1DJG A;  3AAJ A;  1CLB A;  4GPL B;  1XFU O;  1IJ5 A;  1Y0V H;  3OHM B;  3I5G C;  1SBJ A;  2ZN9 A;  1FPW A;  1EG3 A;  3EVV A;  3BOW B;  1U5I A;  2RGI A;  3WNX B;  5HKZ A;  2K7O A;  3O2P A;  2M49 B;  2JQ6 A;  3EK7 A;  1K94 A;  4GGN A;  2MAZ A;  1TRF A;  3CLN A;  1S5G Y;  1DJW A;  3NXA A;  1NX3 A;  3I5I B;  2KFH A;  5FYX A;  1F8H A;  3SIB A;  1JF2 A;  3BYA A;  5KTY A;  3K21 A;  2LMT A;  1WY9 A;  1WLZ A;  1L7Z A;  3CS1 A;  2BEC A;  3H4S E;  4R1E A;  2ZRS A;  5ER4 X;  4GBA A;  1KFU L;  4AQI A;  2JNX A;  2WND A;  3BOW A;  3CR4 X;  1KSM A;  1PSB A;  1LXF C;  1L2O C;  5DKQ A;  1KFU S;  1JSA A;  2JPT A;  3A4U B;  1ODB A;  1CFC A;  2NCO A;  1B4C A;  1DMO A;  3HX4 A;  1VRK A;  1C7V A;  1CDM A;  1SRA A;  2PMY A;  2WCE A;  5K89 A;  1QXP A;  1RFJ A;  4I5J A;  4BY4 A;  3EKH A;  1ZFS A;  2JTT A;  3GK2 A;  1QS7 A;  3I5H B;  4MZJ A;  3ZWH A;  2LAN A;  3SG2 A;  2JT3 A;  1A75 B;  1SYM A;  1QVI Y;  1KK8 C;  1DF0 A;  5G08 A;  1UHJ A;  4P2Y B;  2WCF A;  4OKH A;  2NXQ A;  4AOM A;  2F2O A;  2LMU A;  3BUO B;  1CKK A;  1N2D A;  3ZNI A;  1F70 A;  1FW4 A;  2L51 A;  1F54 A;  3KPX A;  2HQ8 A;  4I5L B;  3I5I C;  1SK6 D;  1EL4 A;  1RWY A;  1BR1 B;  2F3Y A;  4PAL A;  3WHU B;  4GAO A;  3FS7 A;  4PHK A;  4JWQ A;  1JBA A;  1UWO A;  4P5O E;  2QAC A;  1G33 A;  5HKW A;  2K7D A;  2KBM A;  1QTX A;  1K9P A;  2HF5 A;  2PAL A;  4OCI A;  1DGU A;  2P6B B;  4YGC B;  1K8U A;  3GK4 X;  1QV0 A;  4I5N B;  2WCB A;  2L5X B;  2BE6 A;  3PN7 C;  1KQM B;  1K95 A;  3TZ1 A;  1RJV A;  2MBX A;  3EVU A;  2LV7 A;  3C1V A;  1IKU A;  1TNW A;  3I5H C;  4HRH A;  2GGZ A;  3VRQ A;  3IQO A;  1QJT A;  1M63 B;  1KK7 Y;  1UUR A;  4UPG A;  3EVR A;  1BT6 A;  2ZKM X;  1K9K A;  3DF0 B;  1F71 A;  1G4Y R;  1QAS A;  1CM4 A;  1SPY A;  2I18 A;  3M0W A;  1LVC D;  1WRZ A;  1RRO A;  2OTG B;  4ICB A;  4HRE E;  4MBE A;  3VRR A;  4U8D A;  1NPQ A;  1CM1 A;  2LUX A;  3CGA A;  4YRU A;  1JWD A;  1PUL A;  4M2O A;  1ZOT B;  2CT9 A;  3E3R A;  2KYF A;  1CDP A;  5I8N A;  2I7A A;  2JRF A;  4QJ5 B;  2KGR A;  2K2F A;  1SR6 B;  4XYN A;  2KOT A;  4ORB B;  1EH2 A;  3CR5 X;  2EHB A;  2KI4 B;  2AAO A;  3I5F C;  1Y6W A;  4YGD B;  1KCY A;  3F45 A;  1YRT B;  1KQV A;  1CNP A;  1DJZ A;  1UHK A;  3CR2 A;  1CTR A;  1RTP 1;  1B7T Z;  1Q80 A;  1UUS A;  5AEQ A;  3TDU A;  1IRJ A;  1OMV A;  1UHH A;  2KQ6 A;  1REC A;  4PE4 A;  1BLQ A;  1NCZ A;  1CLL A;  1Y1X A;  1NX0 A;  1QLK A;  1S1E A;  4N1G A;  1MXE A;  1TCF A;  1NYA A;  2LVK A;  4HRG A;  2LVJ A;  5TNC A;  1JFJ A;  2NZ0 A;  1PRW A;  2JT8 A;  2JUL A;  4WQ3 A;  1GGZ A;  2LP3 A;  4C0J A;  1D1O A;  3JTD C;  4YGB B;  1A4P A;  2GGM A;  1OZO A;  2OTG C;  2SAS A;  3BUM B;  1W7I B;  2M97 A;  2CNP A;  1AJ4 A;  2L50 A;  5DKR A;  3SG3 A;  3TDI A;  2PRU A;  1OE9 B;  1TCO B;  1SMG A;  3IF7 A;  4I5K A;  3RLZ A;  5B8I B;  2JT0 A;  1X02 A;  2KSP A;  1SR6 C;  2BCA A;  3IQQ A;  3SJS A;  4M2P A;  1KK8 B;  2JWW A;  1GJY A;  2KI4 C;  4QJ3 B;  2O5G A;  4JPZ B;  1K2H A;  1G8I A;  1J7R A;  2LNK A;  2LLU A;  1ZMZ A;  2LMV A;  1LIN A;  1B8R A;  1B47 A;  1K93 D;  1YX7 A;  2LCP A;  2COL B;  2WOR A;  3AKB A;  3NSL A;  2QPT A;  3PAT A;  3O4Y A;  1DF0 B;  1YUS A;  2L4H A;  3MSE B;  4ZCV A;  5CPV A;  3JVT B;  3OP0 A;  1YTZ C;  1NCX A;  4XJK A;  4JQ0 D;  2LM5 A;  2L0P A;  3PN7 B;  1NX1 A;  4DCK A;  2LP2 A;  5DKN A;  2G9B A;  3D10 A;  3LL8 B;  1B1G A;  1ALW A;  1F4O A;  1OMR A;  1YVL A;  4DIR A;  2SCP A;  2K8M B;  4IL1 A;  1CFF A;  3GOF A;  4NDC A;  3WXA A;  1FF1 A;  3SIA A;  2ZFD A;  2K7B A;  2F33 A;  2M3W A;  1DJX A;  3BUX B;  1QX5 B;  2LE9 B;  3BXK A;  1C7W A;  1MF8 B;  1MUX A;  1NIW A;  2BL0 C;  1AK8 A;  1SW8 A;  2ZRT A;  1QIW A;  2MA2 A;  1IWQ A;  1CMG A;  2H61 A;  1F55 A;  4PHN A;  2M9G A;  3EK8 A;  4PHM A;  4PDZ A;  4TNC A;  4AQJ A;  5PAL A;  1A03 A;  3CWG A;  4PHJ A;  1BJF A;  4CID A;  4N5X A;  1DVI A;  1H8B A;  1B9A A;  1Y1A A;  2WC8 A;  4WRI A;  1YX8 A;  4MZK A;  2KQY A;  1NP8 A;  2KDH A;  1K9U A;  1QX2 A;  3JVT C;  2GV5 A;  4DUQ A;  1YUR A;  2M8U A;  1YR5 A;  4A4B A;  1NWD A;  4GGF A;  1BR4 B;  2BKH B;  2BCB A;  3I5F B;  2E30 A;  4MEW A;  3VRO A;  2LC5 A;  4FTG A;  2KFG A;  2LLS A;  1SCV A;  4DS7 A;  2H61 C;  1CLM A;  4CFR A;  1WDC B;  2VRG A;  3KHE A;  1OMD A;  1WLM A;  3TDZ A;  1PSR A;  1Y1U A;  1ZAC A;  1FI5 A;  2LLT A;  3GK1 A;  5JOL A;  2FCD A;  2KHN A;  3PM8 A;  1CMF A;  1OOJ A;  3CZT X;  1BOC A;  3LK1 A;  4D1E A;  4A4C A;  1J7P A;  1W7J B;  1CFP A;  3JTD B;  4GGF C;  3HCM A;  5D7F A;  4MRX A;  3DVJ A;  3SG7 A;  1XFY O;  1J1D A;  5IBW A;  4ORA B;  3KO0 A;  4ORC B;  1N0Y A;  1B8L A;  1MQ1 A;  3NSK A;  1SL7 A;  2E6W A;  1A2X A;  3O6B A;  2D8N A;  1XO5 A;  1BG1 A;  5I2L A;  4DRW A;  1KK7 Z;  4C0K A;  2LAP A;  4CFQ A;  1E8A A;  1TNQ A;  1WRK A;  1NUB A;  3VGO A;  4BY5 A;  3EK4 A;  1MR8 A;  2I94 A;  1QIV A;  4Q04 A;  3BUN B;  2HQW A;  1QX7 A;  2O60 A;  1AVS A;  4YBH B;  1M31 A;  1BOD A;  2L4I A;  2ISD A;  1WDC C;  2L2E A;  3O78 A;  1OQP A;  4PE0 A;  1H4B A;  5ER5 A;  4F0Z B;  2JNF A;  1CDN A;  2MJW B;  4ETO A;  2NCP A;  3A8R A;  4OV2 A;  1LA0 A;  2KFF A;  2WOS A;  2L98 A;  4CLN A;  1M45 A;  1LKJ A;  1MXL C;  1SCM C;  2MLF C;  1CDL A;  4NQG A;  1S26 D;  1XFZ O;  1RK9 A;  1QAT A;  1ZUZ A;  2KAX A;  2AUC A;  2PAS A;  3BQ3 A;  1MHO A;  1YUT A;  1EXR A;  3PLF B;  4MSP A;  3QRX A;  2Q91 A;  1JFK A;  2PVB A;  2OS8 B;  1M46 A;  2LHI A;  3SG5 A;  5CSJ A;  2K2A A;  4CPV A;  3KEV A;  5CSF A;  1FBV A;  1IJ6 A;  2KYC A;  1QV1 A;  1NCY A;  2KI6 D;  1UHI A;  4C0L A;  1IH0 A;  1S6J A;  5GQQ C;  1JUO A;  1YVH A;  4XJK B;  1C07 A;  2BL0 B;  2JXC A;  4MLW A;  4NDD A;  1PK0 D;  1M39 A;  5CSN A;  1S3P A;  5BPJ A;  3NSO A;  4HSZ A;  3OB2 B;  4YGE B;  1K96 A;  1XFX O;  1PVA A;  4MZL A;  1NSH A;  2EC6 C;  3OB1 B;  4USL A;  1GQM A;  5J3X A;  3TS5 B;  1S5G Z;  3AAK A;  2Q4U A;  4YI9 A;  2M29 A;  1FI6 A;  2OS8 C;  2KI6 C;  1KFX L;  1B8C A;  1J1E A;  2LHL A;  2FJU B;  1KWO B;  1AHR A;  1KFX S;  1N65 A;  2LVV A;  5HKY A;  1CB1 A;  3KF9 A;  5I2Q A;  2NLN A;  1SNL A;  5AER A;  1BMO A;  3AKA A;  3EKJ A;  2M1K B;  2M1U A;  2KGB C;  2MLE C;  1JF0 A;  1LA3 A;  2MHH A;  2M7L A;  1J55 A;  3DVM A;  1DJI A;  1HT9 A;  2BBN A;  4MVF A;  1QVI Z;  4PE7 A;  2CCM A;  3SG4 A;  2Y1N A;  3VRN A;  1XK4 A;  2JTZ A;  1SKT A;  1NX2 A;  1SY9 A;  1A29 A;  1KSO A;  1DJH A;  2JZI A;  2LVI A;  1HQV A;  1IGV A;  1R2U A;  3TS5 C;  2BBM A;  2Y1M A;  3PAL A;  2CTN A;  3CTN A;  2KBI A;  1YRU B;  2M7N A;  3LCP C;  4M2Q A;  3TUY B;  5HLV A;  2F8P A;  2A4J A;  1DTL A;  1A75 A;  1KWO C;  2AMI A;  1ALV A;  1V1F A;  3FWC A;  5KU1 A;  2B1U A;  3NSI A;  2BE4 A;  4NDB A;  2CXJ A;  2OPO A;  1OZS A;  4N1F A;  1YUU A;  2ZN8 A;  2I2R E;  4OR9 B;  4E68 A;  2KAY A;  1XK4 C;  1SL8 A;  1PAL A;  4FQO A;  5AXI A;  1XVJ A;  1CFD A;  2FCE A;  3PSR A;  1BF5 A;  1SCM B;  1AUI B;  2ZNE A;  1V1G A;  3DVE A;  2JC2 A;  1IQ3 A;  3VRP A;  4WQ2 A;  1S36 A;  1UHN A;  1DJY A;  2H2K A;  2BKI B;  2JOJ A;  3DVK A;  1XA5 A;  1F4Q A;  1EJ3 A;  3OX5 A;  1MWN A;  1BU3 A;  2JU0 A;  1XFV O;  5JJG A;  2FOT A;  1TOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...