1K95A

Crystal structure of des(1-52)grancalcin with bound calcium
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
161
Chain Sequence
b'SVYTYFSAVAEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRANCALCIN
publication title Structure of Ca(2+)-loaded human grancalcin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 54
structure length 161
sequence length 165
ec nomenclature
pdb deposition date 2001-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k95A00
1IJ5A 4PHKA 5JOLA 3CS1A 2F33A 4XYNA 2LP3A 1BF5A 1F4QA 3FS7A 1CFDA 2LE9B 2EC6B 2JZIA 4PE1A 4FQOA 4DUQA 1MWNA 3CLNA 2MJWB 3TZ1A 1J7RA 4GGFC 1S1EA 4L9MA 1LXFC 1OSAA 1K96A 3FIAA 3LCPC 1UHHA 4ORCB 3BOWA 1CFCA 1XFUO 3TS5B 1CLMA 3BQ3A 2BE6A 3O4YA 1RK9A 4ZCVA 1IRJA 1UP5A 1C7WA 2JXCA 2M7NA 3D0YB 1SBJA 2M29A 3SIAA 1AP4A 1Q80A 4MEWA 1NWDA 1F54A 1K2HA 4YGBB 1F55A 2PASA 1WRKA 4GGFA 2Y4QA 3TUYC 1D1OA 4I5JA 5IBWA 1CDMA 1N65A 1RWYA 3I5GB 2LHLA 3WXAA 1RFJA 2G2BA 1E8AA 2LMTA 2ZFDA 4U8DA 5HKZA 3BXKA 1DJZA 4WQ3A 2RGIA 4MZKA 2HQWA 2JXLA 2LNKA 3BUWB 1JC2A 3NXAA 2ZN9A 1SKTA 2F2OA 1J7QA 2BECA 2K7BA 3SG3A 2M7LA 1DVIA 2TN4A 3I5FC 4YI8A 1M39A 1UHKA 1A75B 1K9PA 4GPLB 1BODA 1GGWA 2HF5A 3WHTB 2KBIA 5TNCA 3D10A 4MZLA 1JFJA 1VRKA 2JT0A 2EGDA 3AKAA 3KF9A 3WNXB 1TN4A 2GGZA 1JUOA 2B1UA 2PVBA 1IJ6A 3M0WA 3O6BA 1YRUB 1TNXA 2JPTA 3RM1A 5I2QA 1CFPA 2KYCA 1EH2A 1YRTB 2OTGB 1K95A 1KK8C 3TDUA 1SR6C 2L0PA 3JVTB 4MBEA 1QASA 1PSRA 1EG4A 3KEVA 2LUXA 1EG3A 4ETOA 2VRGA 2F2PA 2M49B 3E3RA 2WC8A 3DVKA 4CFRA 2BBNA 2H2KA 4GNKB 1JF0A 1QJTA 4MSPA 3HX4A 4YGEB 5PALA 1YVHA 2KHNA 4N5XA 1A4PA 1SY9A 3VRQA 4AQJA 1S6IA 2PSRA 2L4HA 1AJ5A 2SASA 3DVMA 2MBXA 4AQIA 2FJUB 1Y0VH 2KSPA 1SMGA 1S26D 1W7IB 2AAOA 1JBAA 1TOPA 3BOWB 2KGRA 4DRWA 1J1EA 1BJFA 2LANA 3LL8B 2NXQA 1BLQA 1IKUA 2LP2A 3OP0A 2K0JA 1NP8A 2I2RE 5KU1A 4M2PA 4I5KA 4N1FA 1RTP1 5G08A 1QX7A 4AOMA 3PSRA 1QS7A 1K90D 1ODBA 3EVVA 4PE0A 1L2OB 3CR2A 4WQ2A 4MVFA 3FWCA 1B4CA 1DTLA 1PVBA 4P2YB 5AXIA 2NZ0A 3GK2A 5I2LA 2EHBA 2JQ6A 2WOSA 2LVJA 3IF7A 1KSMA 1S36A 1ZMZA 3JTDC 2K7DA 3OX5A 4OKHA 1NX3A 3VRRA 1DJXA 1J7PA 1XA5A 1PULA 2BKIB 1JSAA 2LVIA 1G4YR 4Q04A 1R2UA 1BT6A 4JQ0D 4CPVA 1TNWA 1FW4A 1XFXO 1YTZC 2M1UA 3SG7A 1BG1A 1UUSA 4NDDA 1M46A 3H4SE 2JWWA 3AKBA 1CKKA 1WRZA 1Y1UA 1YURA 3CWGA 3EK7A 2ZRTA 2PALA 1G8IA 3I5FB 3QRXA 3VROA 3PN7B 5HKWA 3AAJA 5F6TA 2E6WA 2MLEC 1FPWA 2KNEA 2LCPA 1OE9B 4MLWA 1CM1A 1GQMA 1YVLA 2LLTA 1RROA 2FCEA 2MLFC 3OB1B 1KCYA 5HLOA 3ICBA 2KQ6A 1F4OA 1SYMA 1IQ3A 4PE7A 3VRPA 1KSOA 1MR8A 3DVEA 1QIVA 1OZSA 2JOJA 1PVAA 2L50A 5CSFA 5AEQA 1KFUS 1SCVA 4BY5A 3GK4X 2WCBA 4D1EA 2LMUA 1DGVA 1GJYA 4NDBA 1YR5A 4MRYA 4UPGA 1AHRA 1DF0A 1SL9A 3GK1A 2COLB 2JTTA 2MAZA 2DOQA 1A2XA 3OHMB 4TNCA 4DCKA 4I5NB 2L4IA 1CNPA 1NX2A 2M0RA 1OZOA 3NSLA 3I5HC 2FCDA 2KI6D 1SNLA 2JT3A 3KO0A 4I5LB 1OMVA 1DJWA 2LM5A 1AK8A 1F8HA 4NQGA 1CMFA 1SL7A 3DD4A 1TCFA 1NX1A 2CXJA 3AAKA 3LLEA 5CSNA 3BUNB 3GOFA 1V1GA 2BL0C 3EVRA 1NYAA 1XK4C 1KFUL 1B7TY 1IWQA 4GUKA 1SCMC 1F70A 2L98A 2K61A 4YGCB 3PATA 1N2DA 4M2OA 1PK0D 4NDCA 1JF2A 5HYDA 1DJIA 1JFKA 1M31A 1B9AA 5J3XA 2SCPA 2KYFA 4GGNA 2KOTA 1J1DA 1N0YA 1QLSA 2I94A 5ER4X 3SG5A 1A03A 2LHIA 2K7OA 1ZUZA 3JTDB 1W7JB 1UHNA 2PMYA 2Y1MA 1R6PA 1KWOC 2ZNEA 3ZWHA 1DMOA 2M1KB 1KQMC 1LA3A 1SPYA 2BCBA 2LAPA 1BU3A 2Y5IA 3I5GC 3A4UB 3C1VA 1B8RA 3EVUA 1FF1A 1B7TZ 1XFWO 3EK8A 2LLUA 4DS7A 1CLLA 1JWDA 2L2EA 1L7ZA 2FOTA 2LUCA 1S3PA 3OX6A 2JT8A 2PRUA 1KQVA 1YUUA 1QV1A 1TNPA 4JPZB 1CDLA 1B8LA 4WRIA 4ZCUA 4HRGA 1MQ1A 2M3WA 3WHUB 3EK4A 1QLKA 1QXPA 1ALVA 3BUXB 3F45A 1QX2A 3K21A 4BY4A 5HKYA 1YX8A 1CTRA 1DT7B 4HRHA 3LK0A 2KAXA 5AFPA 3NSKA 1MF8B 2O60A 1KK7Y 1U5IA 1DF0B 1XFVO 4N1GA 1A29A 1UHIA 3TUYB 1V1FA 2A4JA 1RECA 4IL1A 2WORA 1LA0A 2MRDA 2LVVA 1FI5A 1EL4A 1UHJA 2IS9A 1QTXA 4ORAB 1MHOA 1B1GA 1S6JA 1WLZA 1ZACA 2M97A 3BYAA 1PSBA 2KI4C 1NCZA 1XYDA 2F8PA 1EJ3A 1XFYO 1TIZA 1XVJA 5ER5A 4PHNA 1C7VA 4PE4A 2HPSA 4C0KA 4C0JA 1SRAA 3CTNA 2K8MB 1KK7Z 2KGBC 5BPJA 1H8BA 5JJGA 5CPVA 2WNDA 4XJKA 3EKHA 2OS8C 1FBVA 1QIWA 3EKJA 2JULA 1Y6WA 2OPOA 2KQYA 1BR1B 5DKNA 1Y1XA 4M2QA 3I5HB 3I5IC 1MUXA 2CBLA 2LVKA 4CLNA 1C07A 5AERA 4A4BA 1WLMA 3PALA 5FYXA 4DIRA 2L5XB 1Y1AA 4PHMA 2KDHA 3PLFB 1PALA 2BL0B 2CCMA 1WDCC 1AVSA 4GFTA 5K89A 1KK8B 1M63B 1SR6B 3CZTX 3DF0A 1XFZO 1SCMB 1PRWA 2GGMA 3BUOB 4USLA 1LINA 1L2OC 2G9BA 2JRFA 4OCIA 4PCWA 1NPQA 1ZFSA 5D69A 3SIBA 1K94A 1BMOA 4YGDB 1FI6A 4YI9A 1NCXA 1DGUA 1NUBA 4OR9B 2LV7A 3KHEA 1AUIB 2LMVA 3A8RA 1B8CA 1KFXS 1MXLC 3O78A 2KAYA 2QPTA 4QJ5B 1IQ5A 2D8NA 3FWBA 1KWOB 4R1EA 5HLVA 2KAVA 1KQMB 1CDPA 2JTZA 4YGAA 1AJ4A 4JWQA 2MA2A 4QJ3B 3IQOA 1CMGA 3TDZA 2BE4A 3SG2A 1S5GY 2JU0A 4OV2A 3HCMA 5CSIA 2NCOA 2I7AA 3PFVA 2EC6C 1TCOB 2HETA 2L51A 2LLSA 5CSJA 5DKQA 2BBMA 2KFFA 1U5IB 3BUMB 2CNPA 1SW8A 1K8UA 2M9GA 1F71A 1NCYA 3PN7C 1LKJA 3NSOA 1UWOA 1RJVA 2ZRSA 3TS5C 5I2OA 4MZJA 1NIWA 3SJSA 3LK1A 1CFFA 1DJGA 3CR4X 3NSIA 2P6BB 3OB2B 4F0ZB 1CB1A 2GV5A 5DKRA 2MHHA 5KSZA 1K9UA 1S5GZ 1KFXL 5AANA 1TNQA 1CM4A 2ZNDA 5I8NA 1IH0A 1QV0A 1SL8A 2O5GA 3ZNIA 4PDZA 4QJ4B 1B47A 2QACA 1NSHA 3MSEB 1M45A 1XK4A 1YUTA 2KFGA 1TTXA 4PHJA 1NX0A 1CLBA 5GQQC 3CR5X 3RLZA 2Q4UA 2WCFA 4MN0A 4XJKB 1MXEA 2LC5A 2JC2A 4YRUA 4E68A 4C0LA 3VRNA 2KI4B 1CDNA 1OQPA 5KTYA 2CT9A 2ZKMX 1HT9A 2NLNA 3D0YA 4FTGA 2KBMA 4ICBA 1BOCA 2M8UA 1HQVA 2Y1NA 3VGOA 2H61C 2BCAA 2K2AA 2KI6C 4HSZA 2NCPA 1H4BA 1ZOTB 2BKHB 4P5OE 1J55A 4CIDA 3DF0B 3O2PA 4ORBB 2AMIA 2OS8B 4HREE 1QX5B 1OMDA 1DJYA 4CFQA 1OOJA 1BR4B 3TDIA 2WCEA 3I5IB 1X02A 2CTNA 2I18A 1SK6D 5B8IB 4MRXA 2ZN8A 1EXRA 3CGAA 1QVIY 1J7OA 5D7FA 2JNXA 1K93D 3KPXA 2H61A 1GGZA 4YBHB 2OTGC 1WDCB 2R2IA 1A75A 1YUSA 1LVCD 2F3ZA 3JVTC 2HQ8A 4GBAA 1IGVA 1G33A 2K2FA 1IG5A 1OMRA 1DJHA 2BCXA 1TRFA 2AUCA 2E30A 1K9KA 3SG4A 3DVJA 4PALA 4A4CA 2V53A 4GAOA 1YX7A 3IQQA 2JNFA 1XO5A 1WRLA 1WY9A 2Q91A 3SG6A 1QVIZ 1UURA 1QATA 1S6CA 2KFHA 1ALWA 4OVNF 2ISDA 3PM8A 2F3YA 2K7CA
chains in the Genus database with same CATH superfamily
1IJ5A 4PHKA 5JOLA 3CS1A 2F33A 2WC5A 4XYNA 2LP3A 1BF5A 3SS5A 1F4QA 2KLEA 3FS7A 1CFDA 2LE9B 2EC6B 2JZIA 2WCHA 4PE1A 1Z4HA 4FQOA 3S0EA 3SS4A 4DUQA 1MWNA 3CLNA 2MJWB 3TZ1A 1J7RA 4GGFC 1S1EA 4L9MA 1LXFC 1OSAA 1K96A 3FIAA 3LCPC 4INWA 1UHHA 4ORCB 3BOWA 1CFCA 1XFUO 3TS5B 1CLMA 3BQ3A 2BE6A 3O4YA 1RK9A 4ZCVA 1IRJA 1UP5A 1C7WA 2JXCA 5FI6A 2M7NA 3D0YB 1SBJA 2M29A 3SIAA 1AP4A 1Q80A 4MEWA 1NWDA 1F54A 3R1PA 4YGBB 1F55A 1K2HA 2PASA 1C3ZA 1WRKA 4GGFA 2Y4QA 3S0FA 3TUYC 1D1OA 4I5JA 5IBWA 3D75A 1CDMA 1N65A 1RWYA 3I5GB 4INXA 2LHLA 3WXAA 1RFJA 2G2BA 1E8AA 2LMTA 2ZFDA 4U8DA 5HKZA 3BXKA 1DJZA 4WQ3A 2RGIA 4MZKA 2HQWA 2JXLA 2LNKA 3BUWB 1JC2A 3NXAA 2QEVA 2ZN9A 4KYNA 1SKTA 2F2OA 1J7QA 2BECA 2K7BA 3SG3A 2M7LA 1DVIA 2TN4A 3I5FC 4YI8A 1M39A 1UHKA 1A75B 1K9PA 4GPLB 1BODA 1GGWA 2HF5A 3WHTB 2KBIA 5TNCA 3L4LA 3D10A 3NGVA 4MZLA 1JFJA 3BFBA 1VRKA 2JT0A 2EGDA 3AKAA 3KF9A 3WNXB 1TN4A 1TWOA 2GGZA 1JUOA 2B1UA 2PVBA 1IJ6A 3M0WA 3O6BA 1YRUB 1TNXA 2JPTA 3RM1A 5I2QA 1CFPA 2KYCA 1EH2A 1YRTB 2OTGB 1K95A 1KK8C 3TDUA 1SR6C 2L0PA 3JVTB 4MBEA 1QASA 1PSRA 1EG4A 3KEVA 2LUXA 1EG3A 4ETOA 2VRGA 2F2PA 3DZTA 2M49B 3E3RA 2WC8A 3DVKA 3N7HA 3SS3A 4CFRA 2BBNA 2H2KA 4GNKB 1JF0A 1QJTA 4MSPA 3HX4A 4YGEB 5PALA 1YVHA 2KHNA 4N5XA 1A4PA 1SY9A 3VRQA 4AQJA 1S6IA 2PSRA 2L4HA 1AJ5A 1OOIX 3Q8IA 2SASA 3DVMA 2MBXA 4AQIA 2FJUB 1Y0VH 2KSPA 1SMGA 1S26D 1W7IB 2AAOA 2QEHA 1JBAA 1TOPA 3BOWB 2KGRA 4DRWA 1J1EA 1BJFA 2LANA 3LL8B 2NXQA 1BLQA 1IKUA 2LP2A 3D77A 2GTEA 3OP0A 2K0JA 1NP8A 2I2RE 1TUZA 3NHTA 5KU1A 4M2PA 1W9ZA 4I5KA 4N1FA 1RTP1 5G08A 3B87A 1QX7A 5EL2A 4AOMA 3PSRA 1QS7A 1K90D 1ODBA 3EVVA 1DC1A 4PE0A 1L2OB 3CR2A 3K1EA 4WQ2A 4MVFA 2H8VA 3FWCA 1B4CA 1DTLA 1PVBA 4P2YB 3QMEA 5AXIA 2NZ0A 3GK2A 5I2LA 2EHBA 1T14A 2JQ6A 2WC6A 2WOSA 2LVJA 3PM2A 3IF7A 1KSMA 1S36A 1ZMZA 3JTDC 2K7DA 3OX5A 4OKHA 1NX3A 3VRRA 1DJXA 1J7PA 1XA5A 1PULA 1LS8A 1OOFA 2BKIB 1JSAA 2LVIA 1G4YR 4Q04A 1R2UA 1BT6A 3S0AA 4JQ0D 4CPVA 1TNWA 1FW4A 1XFXO 1YTZC 2M1UA 3SG7A 1BG1A 1UUSA 4NDDA 1M46A 3H4SE 2PYQA 2WCMA 2JWWA 3OGNA 3BFAA 3AKBA 2JPOA 1WRZA 1Y1UA 1CKKA 1YURA 2ERBA 2QDIA 2ZRTA 2PALA 1G8IA 3CWGA 3EK7A 3I5FB 3QRXA 3PN7B 5FI7A 5HKWA 3VROA 3AAJA 5F6TA 2E6WA 2MLEC 1FPWA 2KNEA 2LCPA 1OE9B 2P70A 4MLWA 1CM1A 3CZ2A 1GQMA 1YVLA 2LLTA 1DQEA 1RROA 2FCEA 2MLFC 3OB1B 3B7AA 1KCYA 1IIOA 5HLOA 3ICBA 2KQ6A 1F4OA 1SYMA 1IQ3A 4PE7A 3VRPA 1KSOA 1MR8A 3DVEA 1QIVA 1OZSA 2JOJA 1PVAA 2L50A 3B6XA 5CSFA 5AEQA 1KFUS 1SCVA 4BY5A 3GK4X 2WCBA 4D1EA 2LMUA 3O4XA 1DGVA 1GJYA 4NDBA 1YR5A 4MRYA 4UPGA 1AHRA 1DELA 3CABA 3S0BA 1DF0A 2WCKA 1SL9A 2BAPA 3GK1A 2COLB 2JTTA 2MAZA 2DOQA 1A2XA 3OHMB 4TNCA 4DCKA 4I5NB 2L4IA 1CNPA 1NX2A 2M0RA 1OZOA 3NSLA 3I5HC 2FCDA 2KI6D 1SNLA 2JT3A 3KO0A 4I5LB 1OMVA 1DJWA 2LM5A 1AK8A 1F8HA 4NQGA 1CMFA 1SL7A 3DD4A 1TCFA 1NX1A 2CXJA 3AAKA 3LLEA 5CSNA 3BUNB 3GOFA 1V1GA 2BL0C 3EVRA 1NYAA 1GM0A 3DXLA 1XK4C 1KFUL 1B7TY 1IWQA 4GUKA 1SCMC 1F70A 2L98A 2K61A 4YGCB 3FE6A 2BNXA 3PATA 1N2DA 4M2OA 1PK0D 4NDCA 1JF2A 5HYDA 1DJIA 3BJHA 1JFKA 1M31A 1B9AA 5J3XA 2QEOA 2SCPA 2KYFA 4GGNA 3S0DA 2KOTA 1J1DA 1N0YA 1QLSA 2I94A 5ER4X 3SG5A 1A03A 2LHIA 2K7OA 1ZUZA 3JTDB 1W7JB 2L5YA 1UHNA 2PMYA 2Y1MA 1R6PA 1KWOC 2ZNEA 3ZWHA 1DMOA 2M1KB 1KQMC 1LA3A 1SPYA 2BCBA 2LAPA 1BU3A 2Y5IA 3CYZA 3I5GC 3A4UB 3UO9A 3C1VA 1B8RA 3EVUA 1FF1A 1B7TZ 1XFWO 3EK8A 2LLUA 4DS7A 1CLLA 3BFHA 1JWDA 2L2EA 1L7ZA 2FOTA 2LUCA 1S3PA 3OX6A 2JT8A 1QWVA 2PRUA 1KQVA 1YUUA 1QV1A 1OOGA 1TNPA 4JPZB 1CDLA 1B8LA 4WRIA 3R1OA 4ZCUA 4HRGA 1MQ1A 2M3WA 3WHUB 3EG5B 3EK4A 4FQTA 1QLKA 1XFRA 1QXPA 1ALVA 3BUXB 3F45A 1QX2A 3K21A 4BY4A 5HKYA 1YX8A 1CTRA 1DT7B 4HRHA 3LK0A 3CZ0A 2KAXA 3B88A 5FI2A 3NSKA 1MF8B 5AFPA 2O60A 1KK7Y 1U5IA 1DF0B 3R72A 1XFVO 4N1GA 1A29A 1UHIA 3TUYB 1V1FA 3V2LA 2A4JA 1RECA 3IVTA 4IL1A 2WORA 1LA0A 2MRDA 2LVVA 2WCLA 1EL4A 3R1VA 1FI5A 1UHJA 2IS9A 1QTXA 2K60A 3PJIA 1MHOA 4ORAB 1B1GA 1S6JA 4JD9A 1WLZA 1ZACA 2M97A 3BYAA 1PSBA 2KI4C 1NCZA 1XYDA 2F8PA 1EJ3A 1XFYO 1TIZA 1XVJA 5ER5A 4PHNA 1C7VA 4PE4A 5I94A 2HPSA 4C0KA 4C0JA 1SRAA 3CTNA 2K8MB 1KK7Z 1ORGA 2KGBC 5BPJA 1H8BA 3OBVA 5JJGA 1TUJA 5CPVA 2WNDA 4XJKA 1C3YA 3EKHA 2OS8C 3DYEA 1FBVA 1QIWA 3EKJA 2JULA 1Y6WA 2OPOA 2KQYA 1BR1B 3NHIA 5DKNA 1Y1XA 4M2QA 3I5HB 3I5IC 1MUXA 2CBLA 2LVKA 4CLNA 1C07A 5AERA 4A4BA 4JKTA 1WLMA 3PALA 5FYXA 4DIRA 2L5XB 3CDNA 1Y1AA 4PHMA 2KDHA 3PLFB 1PALA 2BL0B 1WDCC 2CCMA 1AVSA 4GFTA 4IJ7A 1KK8B 5K89A 1M63B 1SR6B 3CZTX 3DF0A 1XFZO 1SCMB 3D73A 1PRWA 3D76A 2GGMA 3S0GA 3BUOB 4USLA 1LINA 1L2OC 2G9BA 2JRFA 4OCIA 4PCWA 1NPQA 1ZFSA 5D69A 3SIBA 1K94A 1BMOA 4YGDB 1FI6A 4YI9A 1NCXA 1DGUA 1NUBA 4OR9B 2LV7A 3KHEA 1AUIB 2LMVA 3A8RA 1B8CA 1KFXS 1DEKA 1MXLC 2KAYA 3O78A 2QPTA 2PQLA 4QJ5B 1IQ5A 2D8NA 2KPHA 3FWBA 2KLDA 1KWOB 2P71A 4R1EA 5HLVA 2KAVA 1KQMB 1CDPA 2JTZA 4YGAA 1AJ4A 4JWQA 2MA2A 4QJ3B 3IQOA 1CMGA 3TDZA 2BE4A 2WCJA 3FE9A 5HL1A 3SG2A 1S5GY 2JU0A 4OV2A 3HCMA 3RZSA 5CSIA 2NCOA 2I7AA 2L2CA 3PFVA 2EC6C 1TCOB 2HETA 2L51A 2LLSA 5CSJA 5DKQA 2BBMA 2KFFA 1U5IB 3BUMB 4F7FA 2CNPA 1SW8A 1Z2CB 1K8UA 2M9GA 1F71A 1NCYA 3PN7C 1LKJA 3NSOA 1UWOA 1RJVA 2ZRSA 3TS5C 5I2OA 4MZJA 1NIWA 3SJSA 3LK1A 3CZ1A 1CFFA 1DJGA 3CR4X 2FJYA 3NSIA 2P6BB 3B86A 3OB2B 4F0ZB 1CB1A 2GV5A 5DKRA 2MHHA 5KSZA 1K9UA 1S5GZ 1KFXL 3FE8A 5AANA 1TNQA 1CM4A 2ZNDA 5I8NA 1IH0A 1QV0A 1SL8A 2O5GA 1P28A 4PDZA 3ZNIA 1B47A 2QACA 1NSHA 4QJ4B 1SSEB 3MSEB 1M45A 1XK4A 1YUTA 2KFGA 1TTXA 4OZDA 4PHJA 1NX0A 1CLBA 5GQQC 3CR5X 3RLZA 2Q4UA 2WCFA 4MN0A 4XJKB 4PT1A 1MXEA 2LC5A 2JC2A 4YRUA 4E68A 4C0LA 3VRNA 2KI4B 1CDNA 1OQPA 5KTYA 2CT9A 2ZKMX 1HT9A 2NLNA 3D0YA 4FTGA 2KBMA 4ICBA 1BOCA 2M8UA 1HQVA 2Y1NA 3VGOA 1OW4A 2H61C 2BCAA 2K2AA 2KI6C 4HSZA 2NCPA 1H4BA 3DY9A 1ZOTB 2BKHB 4P5OE 1J55A 4CIDA 3DF0B 3O2PA 2YGUA 2AMIA 4ORBB 3VB1A 2OS8B 4HREE 1QX5B 1OMDA 1DJYA 4CFQA 1OOJA 1BR4B 3TDIA 5D3OA 2WCEA 3I5IB 1X02A 2CTNA 2I18A 1SK6D 5B8IB 4MRXA 2ZN8A 1EXRA 3CGAA 1QVIY 1J7OA 5D7FA 2JNXA 1K93D 3KPXA 2H61A 1GGZA 4YBHB 2OTGC 1WDCB 5DICA 2R2IA 1A75A 1YUSA 1LVCD 2F3ZA 3JVTC 2HQ8A 4GBAA 1IGVA 1G33A 2K2FA 1IG5A 1OMRA 1DJHA 2BCXA 3D74A 1TRFA 2AUCA 2E30A 1K9KA 3SG4A 3DVJA 4PALA 1OOHA 4A4CA 2V53A 4GAOA 3D78A 1YX7A 3IQQA 2JNFA 3L4AA 1XO5A 1WRLA 1WY9A 2Q91A 3SG6A 1QVIZ 1UURA 1QATA 1S6CA 2KFHA 1ALWA 3L47A 4OVNF 2QEBA 3UNWA 2ISDA 3PM8A 2F3YA 2K7CA
chains in the Genus database with same CATH topology
1IJ5A 4PHKA 5JOLA 3CS1A 2F33A 4XYNA 2LP3A 1BF5A 1F4QA 3FS7A 1CFDA 2LE9B 2EC6B 2JZIA 4PE1A 4FQOA 4DUQA 1MWNA 3CLNA 2MJWB 3TZ1A 1J7RA 4GGFC 1S1EA 4L9MA 1LXFC 1OSAA 1K96A 3FIAA 3LCPC 1UHHA 4ORCB 3BOWA 1CFCA 1XFUO 3TS5B 1CLMA 3BQ3A 2BE6A 3O4YA 1RK9A 4ZCVA 1IRJA 1UP5A 1C7WA 2JXCA 2M7NA 3D0YB 1SBJA 2M29A 3SIAA 1AP4A 1Q80A 4MEWA 1NWDA 1F54A 1K2HA 4YGBB 1F55A 2PASA 1WRKA 4GGFA 2Y4QA 3TUYC 1D1OA 4I5JA 5IBWA 1CDMA 1N65A 1RWYA 3I5GB 2LHLA 3WXAA 1RFJA 2G2BA 1E8AA 2LMTA 2ZFDA 4U8DA 5HKZA 3BXKA 1DJZA 4WQ3A 2RGIA 4MZKA 2HQWA 2JXLA 2LNKA 3BUWB 1JC2A 3NXAA 2ZN9A 1SKTA 2F2OA 1J7QA 2BECA 2K7BA 3SG3A 2M7LA 1DVIA 2TN4A 3I5FC 4YI8A 1M39A 1UHKA 1A75B 1K9PA 4GPLB 1BODA 1GGWA 2HF5A 3WHTB 2KBIA 5TNCA 3D10A 4MZLA 1JFJA 1VRKA 2JT0A 2EGDA 3AKAA 3KF9A 3WNXB 1TN4A 2GGZA 1JUOA 2B1UA 2PVBA 1IJ6A 3M0WA 3O6BA 1YRUB 1TNXA 2JPTA 3RM1A 5I2QA 1CFPA 2KYCA 1EH2A 1YRTB 2OTGB 1K95A 1KK8C 3TDUA 1SR6C 2L0PA 3JVTB 4MBEA 1QASA 1PSRA 1EG4A 3KEVA 2LUXA 1EG3A 4ETOA 2VRGA 2F2PA 2M49B 3E3RA 2WC8A 3DVKA 4CFRA 2BBNA 2H2KA 4GNKB 1JF0A 1QJTA 4MSPA 3HX4A 4YGEB 5PALA 1YVHA 2KHNA 4N5XA 1A4PA 1SY9A 3VRQA 4AQJA 1S6IA 2PSRA 2L4HA 1AJ5A 2SASA 3DVMA 2MBXA 4AQIA 2FJUB 1Y0VH 2KSPA 1SMGA 1S26D 1W7IB 2AAOA 1JBAA 1TOPA 3BOWB 2KGRA 4DRWA 1J1EA 1BJFA 2LANA 3LL8B 2NXQA 1BLQA 1IKUA 2LP2A 3OP0A 2K0JA 1NP8A 2I2RE 5KU1A 4M2PA 4I5KA 4N1FA 1RTP1 5G08A 1QX7A 4AOMA 3PSRA 1QS7A 1K90D 1ODBA 3EVVA 4PE0A 1L2OB 3CR2A 4WQ2A 4MVFA 3FWCA 1B4CA 1DTLA 1PVBA 4P2YB 5AXIA 2NZ0A 3GK2A 5I2LA 2EHBA 2JQ6A 2WOSA 2LVJA 3IF7A 1KSMA 1S36A 1ZMZA 3JTDC 2K7DA 3OX5A 4OKHA 1NX3A 3VRRA 1DJXA 1J7PA 1XA5A 1PULA 2BKIB 1JSAA 2LVIA 1G4YR 4Q04A 1R2UA 1BT6A 4JQ0D 4CPVA 1TNWA 1FW4A 1XFXO 1YTZC 2M1UA 3SG7A 1BG1A 1UUSA 4NDDA 1M46A 3H4SE 2JWWA 3AKBA 1CKKA 1WRZA 1Y1UA 1YURA 3CWGA 3EK7A 2ZRTA 2PALA 1G8IA 3I5FB 3QRXA 3VROA 3PN7B 5HKWA 3AAJA 5F6TA 2E6WA 2MLEC 1FPWA 2KNEA 2LCPA 1OE9B 4MLWA 1CM1A 1GQMA 1YVLA 2LLTA 1RROA 2FCEA 2MLFC 3OB1B 1KCYA 5HLOA 3ICBA 2KQ6A 1F4OA 1SYMA 1IQ3A 4PE7A 3VRPA 1KSOA 1MR8A 3DVEA 1QIVA 1OZSA 2JOJA 1PVAA 2L50A 5CSFA 5AEQA 1KFUS 1SCVA 4BY5A 3GK4X 2WCBA 4D1EA 2LMUA 1DGVA 1GJYA 4NDBA 1YR5A 4MRYA 4UPGA 1AHRA 1DF0A 1SL9A 3GK1A 2COLB 2JTTA 2MAZA 2DOQA 1A2XA 3OHMB 4TNCA 4DCKA 4I5NB 2L4IA 1CNPA 1NX2A 2M0RA 1OZOA 3NSLA 3I5HC 2FCDA 2KI6D 1SNLA 2JT3A 3KO0A 4I5LB 1OMVA 1DJWA 2LM5A 1AK8A 1F8HA 4NQGA 1CMFA 1SL7A 3DD4A 1TCFA 1NX1A 2CXJA 3AAKA 3LLEA 5CSNA 3BUNB 3GOFA 1V1GA 2BL0C 3EVRA 1NYAA 1XK4C 1KFUL 1B7TY 1IWQA 4GUKA 1SCMC 1F70A 2L98A 2K61A 4YGCB 3PATA 1N2DA 4M2OA 1PK0D 4NDCA 1JF2A 5HYDA 1DJIA 1JFKA 1M31A 1B9AA 5J3XA 2SCPA 2KYFA 4GGNA 2KOTA 1J1DA 1N0YA 1QLSA 2I94A 5ER4X 3SG5A 1A03A 2LHIA 2K7OA 1ZUZA 3JTDB 1W7JB 1UHNA 2PMYA 2Y1MA 1R6PA 1KWOC 2ZNEA 3ZWHA 1DMOA 2M1KB 1KQMC 1LA3A 1SPYA 2BCBA 2LAPA 1BU3A 2Y5IA 3I5GC 3A4UB 3C1VA 1B8RA 3EVUA 1FF1A 1B7TZ 1XFWO 3EK8A 2LLUA 4DS7A 1CLLA 1JWDA 2L2EA 1L7ZA 2FOTA 2LUCA 1S3PA 3OX6A 2JT8A 2PRUA 1KQVA 1YUUA 1QV1A 1TNPA 4JPZB 1CDLA 1B8LA 4WRIA 4ZCUA 4HRGA 1MQ1A 2M3WA 3WHUB 3EK4A 1QLKA 1QXPA 1ALVA 3BUXB 3F45A 1QX2A 3K21A 4BY4A 5HKYA 1YX8A 1CTRA 1DT7B 4HRHA 3LK0A 2KAXA 5AFPA 3NSKA 1MF8B 2O60A 1KK7Y 1U5IA 1DF0B 1XFVO 4N1GA 1A29A 1UHIA 3TUYB 1V1FA 2A4JA 1RECA 4IL1A 2WORA 1LA0A 2MRDA 2LVVA 1FI5A 1EL4A 1UHJA 2IS9A 1QTXA 4ORAB 1MHOA 1B1GA 1S6JA 1WLZA 1ZACA 2M97A 3BYAA 1PSBA 2KI4C 1NCZA 1XYDA 2F8PA 1EJ3A 1XFYO 1TIZA 1XVJA 5ER5A 4PHNA 1C7VA 4PE4A 2HPSA 4C0KA 4C0JA 1SRAA 3CTNA 2K8MB 1KK7Z 2KGBC 5BPJA 1H8BA 5JJGA 5CPVA 2WNDA 4XJKA 3EKHA 2OS8C 1FBVA 1QIWA 3EKJA 2JULA 1Y6WA 2OPOA 2KQYA 1BR1B 5DKNA 1Y1XA 4M2QA 3I5HB 3I5IC 1MUXA 2CBLA 2LVKA 4CLNA 1C07A 5AERA 4A4BA 1WLMA 3PALA 5FYXA 4DIRA 2L5XB 1Y1AA 4PHMA 2KDHA 3PLFB 1PALA 2BL0B 2CCMA 1WDCC 1AVSA 4GFTA 5K89A 1KK8B 1M63B 1SR6B 3CZTX 3DF0A 1XFZO 1SCMB 1PRWA 2GGMA 3BUOB 4USLA 1LINA 1L2OC 2G9BA 2JRFA 4OCIA 4PCWA 1NPQA 1ZFSA 5D69A 3SIBA 1K94A 1BMOA 4YGDB 1FI6A 4YI9A 1NCXA 1DGUA 1NUBA 4OR9B 2LV7A 3KHEA 1AUIB 2LMVA 3A8RA 1B8CA 1KFXS 1MXLC 3O78A 2KAYA 2QPTA 4QJ5B 1IQ5A 2D8NA 3FWBA 1KWOB 4R1EA 5HLVA 2KAVA 1KQMB 1CDPA 2JTZA 4YGAA 1AJ4A 4JWQA 2MA2A 4QJ3B 3IQOA 1CMGA 3TDZA 2BE4A 3SG2A 1S5GY 2JU0A 4OV2A 3HCMA 5CSIA 2NCOA 2I7AA 3PFVA 2EC6C 1TCOB 2HETA 2L51A 2LLSA 5CSJA 5DKQA 2BBMA 2KFFA 1U5IB 3BUMB 2CNPA 1SW8A 1K8UA 2M9GA 1F71A 1NCYA 3PN7C 1LKJA 3NSOA 1UWOA 1RJVA 2ZRSA 3TS5C 5I2OA 4MZJA 1NIWA 3SJSA 3LK1A 1CFFA 1DJGA 3CR4X 3NSIA 2P6BB 3OB2B 4F0ZB 1CB1A 2GV5A 5DKRA 2MHHA 5KSZA 1K9UA 1S5GZ 1KFXL 5AANA 1TNQA 1CM4A 2ZNDA 5I8NA 1IH0A 1QV0A 1SL8A 2O5GA 3ZNIA 4PDZA 4QJ4B 1B47A 2QACA 1NSHA 3MSEB 1M45A 1XK4A 1YUTA 2KFGA 1TTXA 4PHJA 1NX0A 1CLBA 5GQQC 3CR5X 3RLZA 2Q4UA 2WCFA 4MN0A 4XJKB 1MXEA 2LC5A 2JC2A 4YRUA 4E68A 4C0LA 3VRNA 2KI4B 1CDNA 1OQPA 5KTYA 2CT9A 2ZKMX 1HT9A 2NLNA 3D0YA 4FTGA 2KBMA 4ICBA 1BOCA 2M8UA 1HQVA 2Y1NA 3VGOA 2H61C 2BCAA 2K2AA 2KI6C 4HSZA 2NCPA 1H4BA 1ZOTB 2BKHB 4P5OE 1J55A 4CIDA 3DF0B 3O2PA 4ORBB 2AMIA 2OS8B 4HREE 1QX5B 1OMDA 1DJYA 4CFQA 1OOJA 1BR4B 3TDIA 2WCEA 3I5IB 1X02A 2CTNA 2I18A 1SK6D 5B8IB 4MRXA 2ZN8A 1EXRA 3CGAA 1QVIY 1J7OA 5D7FA 2JNXA 1K93D 3KPXA 2H61A 1GGZA 4YBHB 2OTGC 1WDCB 2R2IA 1A75A 1YUSA 1LVCD 2F3ZA 3JVTC 2HQ8A 4GBAA 1IGVA 1G33A 2K2FA 1IG5A 1OMRA 1DJHA 2BCXA 1TRFA 2AUCA 2E30A 1K9KA 3SG4A 3DVJA 4PALA 4A4CA 2V53A 4GAOA 1YX7A 3IQQA 2JNFA 1XO5A 1WRLA 1WY9A 2Q91A 3SG6A 1QVIZ 1UURA 1QATA 1S6CA 2KFHA 1ALWA 4OVNF 2ISDA 3PM8A 2F3YA 2K7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ5 A;  4PHK A;  5JOL A;  3CS1 A;  2F33 A;  4XYN A;  2LP3 A;  1BF5 A;  1F4Q A;  3FS7 A;  1CFD A;  2LE9 B;  2EC6 B;  2JZI A;  4PE1 A;  4FQO A;  4DUQ A;  1MWN A;  3CLN A;  2MJW B;  3TZ1 A;  1J7R A;  4GGF C;  1S1E A;  4L9M A;  1LXF C;  1OSA A;  1K96 A;  3FIA A;  3LCP C;  1UHH A;  4ORC B;  3BOW A;  1CFC A;  1XFU O;  3TS5 B;  1CLM A;  3BQ3 A;  2BE6 A;  3O4Y A;  1RK9 A;  4ZCV A;  1IRJ A;  1UP5 A;  1C7W A;  2JXC A;  2M7N A;  3D0Y B;  1SBJ A;  2M29 A;  3SIA A;  1AP4 A;  1Q80 A;  4MEW A;  1NWD A;  1F54 A;  1K2H A;  4YGB B;  1F55 A;  2PAS A;  1WRK A;  4GGF A;  2Y4Q A;  3TUY C;  1D1O A;  4I5J A;  5IBW A;  1CDM A;  1N65 A;  1RWY A;  3I5G B;  2LHL A;  3WXA A;  1RFJ A;  2G2B A;  1E8A A;  2LMT A;  2ZFD A;  4U8D A;  5HKZ A;  3BXK A;  1DJZ A;  4WQ3 A;  2RGI A;  4MZK A;  2HQW A;  2JXL A;  2LNK A;  3BUW B;  1JC2 A;  3NXA A;  2ZN9 A;  1SKT A;  2F2O A;  1J7Q A;  2BEC A;  2K7B A;  3SG3 A;  2M7L A;  1DVI A;  2TN4 A;  3I5F C;  4YI8 A;  1M39 A;  1UHK A;  1A75 B;  1K9P A;  4GPL B;  1BOD A;  1GGW A;  2HF5 A;  3WHT B;  2KBI A;  5TNC A;  3D10 A;  4MZL A;  1JFJ A;  1VRK A;  2JT0 A;  2EGD A;  3AKA A;  3KF9 A;  3WNX B;  1TN4 A;  2GGZ A;  1JUO A;  2B1U A;  2PVB A;  1IJ6 A;  3M0W A;  3O6B A;  1YRU B;  1TNX A;  2JPT A;  3RM1 A;  5I2Q A;  1CFP A;  2KYC A;  1EH2 A;  1YRT B;  2OTG B;  1K95 A;  1KK8 C;  3TDU A;  1SR6 C;  2L0P A;  3JVT B;  4MBE A;  1QAS A;  1PSR A;  1EG4 A;  3KEV A;  2LUX A;  1EG3 A;  4ETO A;  2VRG A;  2F2P A;  2M49 B;  3E3R A;  2WC8 A;  3DVK A;  4CFR A;  2BBN A;  2H2K A;  4GNK B;  1JF0 A;  1QJT A;  4MSP A;  3HX4 A;  4YGE B;  5PAL A;  1YVH A;  2KHN A;  4N5X A;  1A4P A;  1SY9 A;  3VRQ A;  4AQJ A;  1S6I A;  2PSR A;  2L4H A;  1AJ5 A;  2SAS A;  3DVM A;  2MBX A;  4AQI A;  2FJU B;  1Y0V H;  2KSP A;  1SMG A;  1S26 D;  1W7I B;  2AAO A;  1JBA A;  1TOP A;  3BOW B;  2KGR A;  4DRW A;  1J1E A;  1BJF A;  2LAN A;  3LL8 B;  2NXQ A;  1BLQ A;  1IKU A;  2LP2 A;  3OP0 A;  2K0J A;  1NP8 A;  2I2R E;  5KU1 A;  4M2P A;  4I5K A;  4N1F A;  1RTP 1;  5G08 A;  1QX7 A;  4AOM A;  3PSR A;  1QS7 A;  1K90 D;  1ODB A;  3EVV A;  4PE0 A;  1L2O B;  3CR2 A;  4WQ2 A;  4MVF A;  3FWC A;  1B4C A;  1DTL A;  1PVB A;  4P2Y B;  5AXI A;  2NZ0 A;  3GK2 A;  5I2L A;  2EHB A;  2JQ6 A;  2WOS A;  2LVJ A;  3IF7 A;  1KSM A;  1S36 A;  1ZMZ A;  3JTD C;  2K7D A;  3OX5 A;  4OKH A;  1NX3 A;  3VRR A;  1DJX A;  1J7P A;  1XA5 A;  1PUL A;  2BKI B;  1JSA A;  2LVI A;  1G4Y R;  4Q04 A;  1R2U A;  1BT6 A;  4JQ0 D;  4CPV A;  1TNW A;  1FW4 A;  1XFX O;  1YTZ C;  2M1U A;  3SG7 A;  1BG1 A;  1UUS A;  4NDD A;  1M46 A;  3H4S E;  2JWW A;  3AKB A;  1CKK A;  1WRZ A;  1Y1U A;  1YUR A;  3CWG A;  3EK7 A;  2ZRT A;  2PAL A;  1G8I A;  3I5F B;  3QRX A;  3VRO A;  3PN7 B;  5HKW A;  3AAJ A;  5F6T A;  2E6W A;  2MLE C;  1FPW A;  2KNE A;  2LCP A;  1OE9 B;  4MLW A;  1CM1 A;  1GQM A;  1YVL A;  2LLT A;  1RRO A;  2FCE A;  2MLF C;  3OB1 B;  1KCY A;  5HLO A;  3ICB A;  2KQ6 A;  1F4O A;  1SYM A;  1IQ3 A;  4PE7 A;  3VRP A;  1KSO A;  1MR8 A;  3DVE A;  1QIV A;  1OZS A;  2JOJ A;  1PVA A;  2L50 A;  5CSF A;  5AEQ A;  1KFU S;  1SCV A;  4BY5 A;  3GK4 X;  2WCB A;  4D1E A;  2LMU A;  1DGV A;  1GJY A;  4NDB A;  1YR5 A;  4MRY A;  4UPG A;  1AHR A;  1DF0 A;  1SL9 A;  3GK1 A;  2COL B;  2JTT A;  2MAZ A;  2DOQ A;  1A2X A;  3OHM B;  4TNC A;  4DCK A;  4I5N B;  2L4I A;  1CNP A;  1NX2 A;  2M0R A;  1OZO A;  3NSL A;  3I5H C;  2FCD A;  2KI6 D;  1SNL A;  2JT3 A;  3KO0 A;  4I5L B;  1OMV A;  1DJW A;  2LM5 A;  1AK8 A;  1F8H A;  4NQG A;  1CMF A;  1SL7 A;  3DD4 A;  1TCF A;  1NX1 A;  2CXJ A;  3AAK A;  3LLE A;  5CSN A;  3BUN B;  3GOF A;  1V1G A;  2BL0 C;  3EVR A;  1NYA A;  1XK4 C;  1KFU L;  1B7T Y;  1IWQ A;  4GUK A;  1SCM C;  1F70 A;  2L98 A;  2K61 A;  4YGC B;  3PAT A;  1N2D A;  4M2O A;  1PK0 D;  4NDC A;  1JF2 A;  5HYD A;  1DJI A;  1JFK A;  1M31 A;  1B9A A;  5J3X A;  2SCP A;  2KYF A;  4GGN A;  2KOT A;  1J1D A;  1N0Y A;  1QLS A;  2I94 A;  5ER4 X;  3SG5 A;  1A03 A;  2LHI A;  2K7O A;  1ZUZ A;  3JTD B;  1W7J B;  1UHN A;  2PMY A;  2Y1M A;  1R6P A;  1KWO C;  2ZNE A;  3ZWH A;  1DMO A;  2M1K B;  1KQM C;  1LA3 A;  1SPY A;  2BCB A;  2LAP A;  1BU3 A;  2Y5I A;  3I5G C;  3A4U B;  3C1V A;  1B8R A;  3EVU A;  1FF1 A;  1B7T Z;  1XFW O;  3EK8 A;  2LLU A;  4DS7 A;  1CLL A;  1JWD A;  2L2E A;  1L7Z A;  2FOT A;  2LUC A;  1S3P A;  3OX6 A;  2JT8 A;  2PRU A;  1KQV A;  1YUU A;  1QV1 A;  1TNP A;  4JPZ B;  1CDL A;  1B8L A;  4WRI A;  4ZCU A;  4HRG A;  1MQ1 A;  2M3W A;  3WHU B;  3EK4 A;  1QLK A;  1QXP A;  1ALV A;  3BUX B;  3F45 A;  1QX2 A;  3K21 A;  4BY4 A;  5HKY A;  1YX8 A;  1CTR A;  1DT7 B;  4HRH A;  3LK0 A;  2KAX A;  5AFP A;  3NSK A;  1MF8 B;  2O60 A;  1KK7 Y;  1U5I A;  1DF0 B;  1XFV O;  4N1G A;  1A29 A;  1UHI A;  3TUY B;  1V1F A;  2A4J A;  1REC A;  4IL1 A;  2WOR A;  1LA0 A;  2MRD A;  2LVV A;  1FI5 A;  1EL4 A;  1UHJ A;  2IS9 A;  1QTX A;  4ORA B;  1MHO A;  1B1G A;  1S6J A;  1WLZ A;  1ZAC A;  2M97 A;  3BYA A;  1PSB A;  2KI4 C;  1NCZ A;  1XYD A;  2F8P A;  1EJ3 A;  1XFY O;  1TIZ A;  1XVJ A;  5ER5 A;  4PHN A;  1C7V A;  4PE4 A;  2HPS A;  4C0K A;  4C0J A;  1SRA A;  3CTN A;  2K8M B;  1KK7 Z;  2KGB C;  5BPJ A;  1H8B A;  5JJG A;  5CPV A;  2WND A;  4XJK A;  3EKH A;  2OS8 C;  1FBV A;  1QIW A;  3EKJ A;  2JUL A;  1Y6W A;  2OPO A;  2KQY A;  1BR1 B;  5DKN A;  1Y1X A;  4M2Q A;  3I5H B;  3I5I C;  1MUX A;  2CBL A;  2LVK A;  4CLN A;  1C07 A;  5AER A;  4A4B A;  1WLM A;  3PAL A;  5FYX A;  4DIR A;  2L5X B;  1Y1A A;  4PHM A;  2KDH A;  3PLF B;  1PAL A;  2BL0 B;  2CCM A;  1WDC C;  1AVS A;  4GFT A;  5K89 A;  1KK8 B;  1M63 B;  1SR6 B;  3CZT X;  3DF0 A;  1XFZ O;  1SCM B;  1PRW A;  2GGM A;  3BUO B;  4USL A;  1LIN A;  1L2O C;  2G9B A;  2JRF A;  4OCI A;  4PCW A;  1NPQ A;  1ZFS A;  5D69 A;  3SIB A;  1K94 A;  1BMO A;  4YGD B;  1FI6 A;  4YI9 A;  1NCX A;  1DGU A;  1NUB A;  4OR9 B;  2LV7 A;  3KHE A;  1AUI B;  2LMV A;  3A8R A;  1B8C A;  1KFX S;  1MXL C;  3O78 A;  2KAY A;  2QPT A;  4QJ5 B;  1IQ5 A;  2D8N A;  3FWB A;  1KWO B;  4R1E A;  5HLV A;  2KAV A;  1KQM B;  1CDP A;  2JTZ A;  4YGA A;  1AJ4 A;  4JWQ A;  2MA2 A;  4QJ3 B;  3IQO A;  1CMG A;  3TDZ A;  2BE4 A;  3SG2 A;  1S5G Y;  2JU0 A;  4OV2 A;  3HCM A;  5CSI A;  2NCO A;  2I7A A;  3PFV A;  2EC6 C;  1TCO B;  2HET A;  2L51 A;  2LLS A;  5CSJ A;  5DKQ A;  2BBM A;  2KFF A;  1U5I B;  3BUM B;  2CNP A;  1SW8 A;  1K8U A;  2M9G A;  1F71 A;  1NCY A;  3PN7 C;  1LKJ A;  3NSO A;  1UWO A;  1RJV A;  2ZRS A;  3TS5 C;  5I2O A;  4MZJ A;  1NIW A;  3SJS A;  3LK1 A;  1CFF A;  1DJG A;  3CR4 X;  3NSI A;  2P6B B;  3OB2 B;  4F0Z B;  1CB1 A;  2GV5 A;  5DKR A;  2MHH A;  5KSZ A;  1K9U A;  1S5G Z;  1KFX L;  5AAN A;  1TNQ A;  1CM4 A;  2ZND A;  5I8N A;  1IH0 A;  1QV0 A;  1SL8 A;  2O5G A;  3ZNI A;  4PDZ A;  4QJ4 B;  1B47 A;  2QAC A;  1NSH A;  3MSE B;  1M45 A;  1XK4 A;  1YUT A;  2KFG A;  1TTX A;  4PHJ A;  1NX0 A;  1CLB A;  5GQQ C;  3CR5 X;  3RLZ A;  2Q4U A;  2WCF A;  4MN0 A;  4XJK B;  1MXE A;  2LC5 A;  2JC2 A;  4YRU A;  4E68 A;  4C0L A;  3VRN A;  2KI4 B;  1CDN A;  1OQP A;  5KTY A;  2CT9 A;  2ZKM X;  1HT9 A;  2NLN A;  3D0Y A;  4FTG A;  2KBM A;  4ICB A;  1BOC A;  2M8U A;  1HQV A;  2Y1N A;  3VGO A;  2H61 C;  2BCA A;  2K2A A;  2KI6 C;  4HSZ A;  2NCP A;  1H4B A;  1ZOT B;  2BKH B;  4P5O E;  1J55 A;  4CID A;  3DF0 B;  3O2P A;  4ORB B;  2AMI A;  2OS8 B;  4HRE E;  1QX5 B;  1OMD A;  1DJY A;  4CFQ A;  1OOJ A;  1BR4 B;  3TDI A;  2WCE A;  3I5I B;  1X02 A;  2CTN A;  2I18 A;  1SK6 D;  5B8I B;  4MRX A;  2ZN8 A;  1EXR A;  3CGA A;  1QVI Y;  1J7O A;  5D7F A;  2JNX A;  1K93 D;  3KPX A;  2H61 A;  1GGZ A;  4YBH B;  2OTG C;  1WDC B;  2R2I A;  1A75 A;  1YUS A;  1LVC D;  2F3Z A;  3JVT C;  2HQ8 A;  4GBA A;  1IGV A;  1G33 A;  2K2F A;  1IG5 A;  1OMR A;  1DJH A;  2BCX A;  1TRF A;  2AUC A;  2E30 A;  1K9K A;  3SG4 A;  3DVJ A;  4PAL A;  4A4C A;  2V53 A;  4GAO A;  1YX7 A;  3IQQ A;  2JNF A;  1XO5 A;  1WRL A;  1WY9 A;  2Q91 A;  3SG6 A;  1QVI Z;  1UUR A;  1QAT A;  1S6C A;  2KFH A;  1ALW A;  4OVN F;  2ISD A;  3PM8 A;  2F3Y A;  2K7C A; 
#chains in the Genus database with same CATH topology
 1IJ5 A;  4PHK A;  5JOL A;  3CS1 A;  2F33 A;  2WC5 A;  4XYN A;  2LP3 A;  1BF5 A;  3SS5 A;  1F4Q A;  2KLE A;  3FS7 A;  1CFD A;  2LE9 B;  2EC6 B;  2JZI A;  2WCH A;  4PE1 A;  1Z4H A;  4FQO A;  3S0E A;  3SS4 A;  4DUQ A;  1MWN A;  3CLN A;  2MJW B;  3TZ1 A;  1J7R A;  4GGF C;  1S1E A;  4L9M A;  1LXF C;  1OSA A;  1K96 A;  3FIA A;  3LCP C;  4INW A;  1UHH A;  4ORC B;  3BOW A;  1CFC A;  1XFU O;  3TS5 B;  1CLM A;  3BQ3 A;  2BE6 A;  3O4Y A;  1RK9 A;  4ZCV A;  1IRJ A;  1UP5 A;  1C7W A;  2JXC A;  5FI6 A;  2M7N A;  3D0Y B;  1SBJ A;  2M29 A;  3SIA A;  1AP4 A;  1Q80 A;  4MEW A;  1NWD A;  1F54 A;  3R1P A;  4YGB B;  1F55 A;  1K2H A;  2PAS A;  1C3Z A;  1WRK A;  4GGF A;  2Y4Q A;  3S0F A;  3TUY C;  1D1O A;  4I5J A;  5IBW A;  3D75 A;  1CDM A;  1N65 A;  1RWY A;  3I5G B;  4INX A;  2LHL A;  3WXA A;  1RFJ A;  2G2B A;  1E8A A;  2LMT A;  2ZFD A;  4U8D A;  5HKZ A;  3BXK A;  1DJZ A;  4WQ3 A;  2RGI A;  4MZK A;  2HQW A;  2JXL A;  2LNK A;  3BUW B;  1JC2 A;  3NXA A;  2QEV A;  2ZN9 A;  4KYN A;  1SKT A;  2F2O A;  1J7Q A;  2BEC A;  2K7B A;  3SG3 A;  2M7L A;  1DVI A;  2TN4 A;  3I5F C;  4YI8 A;  1M39 A;  1UHK A;  1A75 B;  1K9P A;  4GPL B;  1BOD A;  1GGW A;  2HF5 A;  3WHT B;  2KBI A;  5TNC A;  3L4L A;  3D10 A;  3NGV A;  4MZL A;  1JFJ A;  3BFB A;  1VRK A;  2JT0 A;  2EGD A;  3AKA A;  3KF9 A;  3WNX B;  1TN4 A;  1TWO A;  2GGZ A;  1JUO A;  2B1U A;  2PVB A;  1IJ6 A;  3M0W A;  3O6B A;  1YRU B;  1TNX A;  2JPT A;  3RM1 A;  5I2Q A;  1CFP A;  2KYC A;  1EH2 A;  1YRT B;  2OTG B;  1K95 A;  1KK8 C;  3TDU A;  1SR6 C;  2L0P A;  3JVT B;  4MBE A;  1QAS A;  1PSR A;  1EG4 A;  3KEV A;  2LUX A;  1EG3 A;  4ETO A;  2VRG A;  2F2P A;  3DZT A;  2M49 B;  3E3R A;  2WC8 A;  3DVK A;  3N7H A;  3SS3 A;  4CFR A;  2BBN A;  2H2K A;  4GNK B;  1JF0 A;  1QJT A;  4MSP A;  3HX4 A;  4YGE B;  5PAL A;  1YVH A;  2KHN A;  4N5X A;  1A4P A;  1SY9 A;  3VRQ A;  4AQJ A;  1S6I A;  2PSR A;  2L4H A;  1AJ5 A;  1OOI X;  3Q8I A;  2SAS A;  3DVM A;  2MBX A;  4AQI A;  2FJU B;  1Y0V H;  2KSP A;  1SMG A;  1S26 D;  1W7I B;  2AAO A;  2QEH A;  1JBA A;  1TOP A;  3BOW B;  2KGR A;  4DRW A;  1J1E A;  1BJF A;  2LAN A;  3LL8 B;  2NXQ A;  1BLQ A;  1IKU A;  2LP2 A;  3D77 A;  2GTE A;  3OP0 A;  2K0J A;  1NP8 A;  2I2R E;  1TUZ A;  3NHT A;  5KU1 A;  4M2P A;  1W9Z A;  4I5K A;  4N1F A;  1RTP 1;  5G08 A;  3B87 A;  1QX7 A;  5EL2 A;  4AOM A;  3PSR A;  1QS7 A;  1K90 D;  1ODB A;  3EVV A;  1DC1 A;  4PE0 A;  1L2O B;  3CR2 A;  3K1E A;  4WQ2 A;  4MVF A;  2H8V A;  3FWC A;  1B4C A;  1DTL A;  1PVB A;  4P2Y B;  3QME A;  5AXI A;  2NZ0 A;  3GK2 A;  5I2L A;  2EHB A;  1T14 A;  2JQ6 A;  2WC6 A;  2WOS A;  2LVJ A;  3PM2 A;  3IF7 A;  1KSM A;  1S36 A;  1ZMZ A;  3JTD C;  2K7D A;  3OX5 A;  4OKH A;  1NX3 A;  3VRR A;  1DJX A;  1J7P A;  1XA5 A;  1PUL A;  1LS8 A;  1OOF A;  2BKI B;  1JSA A;  2LVI A;  1G4Y R;  4Q04 A;  1R2U A;  1BT6 A;  3S0A A;  4JQ0 D;  4CPV A;  1TNW A;  1FW4 A;  1XFX O;  1YTZ C;  2M1U A;  3SG7 A;  1BG1 A;  1UUS A;  4NDD A;  1M46 A;  3H4S E;  2PYQ A;  2WCM A;  2JWW A;  3OGN A;  3BFA A;  3AKB A;  2JPO A;  1WRZ A;  1Y1U A;  1CKK A;  1YUR A;  2ERB A;  2QDI A;  2ZRT A;  2PAL A;  1G8I A;  3CWG A;  3EK7 A;  3I5F B;  3QRX A;  3PN7 B;  5FI7 A;  5HKW A;  3VRO A;  3AAJ A;  5F6T A;  2E6W A;  2MLE C;  1FPW A;  2KNE A;  2LCP A;  1OE9 B;  2P70 A;  4MLW A;  1CM1 A;  3CZ2 A;  1GQM A;  1YVL A;  2LLT A;  1DQE A;  1RRO A;  2FCE A;  2MLF C;  3OB1 B;  3B7A A;  1KCY A;  1IIO A;  5HLO A;  3ICB A;  2KQ6 A;  1F4O A;  1SYM A;  1IQ3 A;  4PE7 A;  3VRP A;  1KSO A;  1MR8 A;  3DVE A;  1QIV A;  1OZS A;  2JOJ A;  1PVA A;  2L50 A;  3B6X A;  5CSF A;  5AEQ A;  1KFU S;  1SCV A;  4BY5 A;  3GK4 X;  2WCB A;  4D1E A;  2LMU A;  3O4X A;  1DGV A;  1GJY A;  4NDB A;  1YR5 A;  4MRY A;  4UPG A;  1AHR A;  1DEL A;  3CAB A;  3S0B A;  1DF0 A;  2WCK A;  1SL9 A;  2BAP A;  3GK1 A;  2COL B;  2JTT A;  2MAZ A;  2DOQ A;  1A2X A;  3OHM B;  4TNC A;  4DCK A;  4I5N B;  2L4I A;  1CNP A;  1NX2 A;  2M0R A;  1OZO A;  3NSL A;  3I5H C;  2FCD A;  2KI6 D;  1SNL A;  2JT3 A;  3KO0 A;  4I5L B;  1OMV A;  1DJW A;  2LM5 A;  1AK8 A;  1F8H A;  4NQG A;  1CMF A;  1SL7 A;  3DD4 A;  1TCF A;  1NX1 A;  2CXJ A;  3AAK A;  3LLE A;  5CSN A;  3BUN B;  3GOF A;  1V1G A;  2BL0 C;  3EVR A;  1NYA A;  1GM0 A;  3DXL A;  1XK4 C;  1KFU L;  1B7T Y;  1IWQ A;  4GUK A;  1SCM C;  1F70 A;  2L98 A;  2K61 A;  4YGC B;  3FE6 A;  2BNX A;  3PAT A;  1N2D A;  4M2O A;  1PK0 D;  4NDC A;  1JF2 A;  5HYD A;  1DJI A;  3BJH A;  1JFK A;  1M31 A;  1B9A A;  5J3X A;  2QEO A;  2SCP A;  2KYF A;  4GGN A;  3S0D A;  2KOT A;  1J1D A;  1N0Y A;  1QLS A;  2I94 A;  5ER4 X;  3SG5 A;  1A03 A;  2LHI A;  2K7O A;  1ZUZ A;  3JTD B;  1W7J B;  2L5Y A;  1UHN A;  2PMY A;  2Y1M A;  1R6P A;  1KWO C;  2ZNE A;  3ZWH A;  1DMO A;  2M1K B;  1KQM C;  1LA3 A;  1SPY A;  2BCB A;  2LAP A;  1BU3 A;  2Y5I A;  3CYZ A;  3I5G C;  3A4U B;  3UO9 A;  3C1V A;  1B8R A;  3EVU A;  1FF1 A;  1B7T Z;  1XFW O;  3EK8 A;  2LLU A;  4DS7 A;  1CLL A;  3BFH A;  1JWD A;  2L2E A;  1L7Z A;  2FOT A;  2LUC A;  1S3P A;  3OX6 A;  2JT8 A;  1QWV A;  2PRU A;  1KQV A;  1YUU A;  1QV1 A;  1OOG A;  1TNP A;  4JPZ B;  1CDL A;  1B8L A;  4WRI A;  3R1O A;  4ZCU A;  4HRG A;  1MQ1 A;  2M3W A;  3WHU B;  3EG5 B;  3EK4 A;  4FQT A;  1QLK A;  1XFR A;  1QXP A;  1ALV A;  3BUX B;  3F45 A;  1QX2 A;  3K21 A;  4BY4 A;  5HKY A;  1YX8 A;  1CTR A;  1DT7 B;  4HRH A;  3LK0 A;  3CZ0 A;  2KAX A;  3B88 A;  5FI2 A;  3NSK A;  1MF8 B;  5AFP A;  2O60 A;  1KK7 Y;  1U5I A;  1DF0 B;  3R72 A;  1XFV O;  4N1G A;  1A29 A;  1UHI A;  3TUY B;  1V1F A;  3V2L A;  2A4J A;  1REC A;  3IVT A;  4IL1 A;  2WOR A;  1LA0 A;  2MRD A;  2LVV A;  2WCL A;  1EL4 A;  3R1V A;  1FI5 A;  1UHJ A;  2IS9 A;  1QTX A;  2K60 A;  3PJI A;  1MHO A;  4ORA B;  1B1G A;  1S6J A;  4JD9 A;  1WLZ A;  1ZAC A;  2M97 A;  3BYA A;  1PSB A;  2KI4 C;  1NCZ A;  1XYD A;  2F8P A;  1EJ3 A;  1XFY O;  1TIZ A;  1XVJ A;  5ER5 A;  4PHN A;  1C7V A;  4PE4 A;  5I94 A;  2HPS A;  4C0K A;  4C0J A;  1SRA A;  3CTN A;  2K8M B;  1KK7 Z;  1ORG A;  2KGB C;  5BPJ A;  1H8B A;  3OBV A;  5JJG A;  1TUJ A;  5CPV A;  2WND A;  4XJK A;  1C3Y A;  3EKH A;  2OS8 C;  3DYE A;  1FBV A;  1QIW A;  3EKJ A;  2JUL A;  1Y6W A;  2OPO A;  2KQY A;  1BR1 B;  3NHI A;  5DKN A;  1Y1X A;  4M2Q A;  3I5H B;  3I5I C;  1MUX A;  2CBL A;  2LVK A;  4CLN A;  1C07 A;  5AER A;  4A4B A;  4JKT A;  1WLM A;  3PAL A;  5FYX A;  4DIR A;  2L5X B;  3CDN A;  1Y1A A;  4PHM A;  2KDH A;  3PLF B;  1PAL A;  2BL0 B;  1WDC C;  2CCM A;  1AVS A;  4GFT A;  4IJ7 A;  1KK8 B;  5K89 A;  1M63 B;  1SR6 B;  3CZT X;  3DF0 A;  1XFZ O;  1SCM B;  3D73 A;  1PRW A;  3D76 A;  2GGM A;  3S0G A;  3BUO B;  4USL A;  1LIN A;  1L2O C;  2G9B A;  2JRF A;  4OCI A;  4PCW A;  1NPQ A;  1ZFS A;  5D69 A;  3SIB A;  1K94 A;  1BMO A;  4YGD B;  1FI6 A;  4YI9 A;  1NCX A;  1DGU A;  1NUB A;  4OR9 B;  2LV7 A;  3KHE A;  1AUI B;  2LMV A;  3A8R A;  1B8C A;  1KFX S;  1DEK A;  1MXL C;  2KAY A;  3O78 A;  2QPT A;  2PQL A;  4QJ5 B;  1IQ5 A;  2D8N A;  2KPH A;  3FWB A;  2KLD A;  1KWO B;  2P71 A;  4R1E A;  5HLV A;  2KAV A;  1KQM B;  1CDP A;  2JTZ A;  4YGA A;  1AJ4 A;  4JWQ A;  2MA2 A;  4QJ3 B;  3IQO A;  1CMG A;  3TDZ A;  2BE4 A;  2WCJ A;  3FE9 A;  5HL1 A;  3SG2 A;  1S5G Y;  2JU0 A;  4OV2 A;  3HCM A;  3RZS A;  5CSI A;  2NCO A;  2I7A A;  2L2C A;  3PFV A;  2EC6 C;  1TCO B;  2HET A;  2L51 A;  2LLS A;  5CSJ A;  5DKQ A;  2BBM A;  2KFF A;  1U5I B;  3BUM B;  4F7F A;  2CNP A;  1SW8 A;  1Z2C B;  1K8U A;  2M9G A;  1F71 A;  1NCY A;  3PN7 C;  1LKJ A;  3NSO A;  1UWO A;  1RJV A;  2ZRS A;  3TS5 C;  5I2O A;  4MZJ A;  1NIW A;  3SJS A;  3LK1 A;  3CZ1 A;  1CFF A;  1DJG A;  3CR4 X;  2FJY A;  3NSI A;  2P6B B;  3B86 A;  3OB2 B;  4F0Z B;  1CB1 A;  2GV5 A;  5DKR A;  2MHH A;  5KSZ A;  1K9U A;  1S5G Z;  1KFX L;  3FE8 A;  5AAN A;  1TNQ A;  1CM4 A;  2ZND A;  5I8N A;  1IH0 A;  1QV0 A;  1SL8 A;  2O5G A;  1P28 A;  4PDZ A;  3ZNI A;  1B47 A;  2QAC A;  1NSH A;  4QJ4 B;  1SSE B;  3MSE B;  1M45 A;  1XK4 A;  1YUT A;  2KFG A;  1TTX A;  4OZD A;  4PHJ A;  1NX0 A;  1CLB A;  5GQQ C;  3CR5 X;  3RLZ A;  2Q4U A;  2WCF A;  4MN0 A;  4XJK B;  4PT1 A;  1MXE A;  2LC5 A;  2JC2 A;  4YRU A;  4E68 A;  4C0L A;  3VRN A;  2KI4 B;  1CDN A;  1OQP A;  5KTY A;  2CT9 A;  2ZKM X;  1HT9 A;  2NLN A;  3D0Y A;  4FTG A;  2KBM A;  4ICB A;  1BOC A;  2M8U A;  1HQV A;  2Y1N A;  3VGO A;  1OW4 A;  2H61 C;  2BCA A;  2K2A A;  2KI6 C;  4HSZ A;  2NCP A;  1H4B A;  3DY9 A;  1ZOT B;  2BKH B;  4P5O E;  1J55 A;  4CID A;  3DF0 B;  3O2P A;  2YGU A;  2AMI A;  4ORB B;  3VB1 A;  2OS8 B;  4HRE E;  1QX5 B;  1OMD A;  1DJY A;  4CFQ A;  1OOJ A;  1BR4 B;  3TDI A;  5D3O A;  2WCE A;  3I5I B;  1X02 A;  2CTN A;  2I18 A;  1SK6 D;  5B8I B;  4MRX A;  2ZN8 A;  1EXR A;  3CGA A;  1QVI Y;  1J7O A;  5D7F A;  2JNX A;  1K93 D;  3KPX A;  2H61 A;  1GGZ A;  4YBH B;  2OTG C;  1WDC B;  5DIC A;  2R2I A;  1A75 A;  1YUS A;  1LVC D;  2F3Z A;  3JVT C;  2HQ8 A;  4GBA A;  1IGV A;  1G33 A;  2K2F A;  1IG5 A;  1OMR A;  1DJH A;  2BCX A;  3D74 A;  1TRF A;  2AUC A;  2E30 A;  1K9K A;  3SG4 A;  3DVJ A;  4PAL A;  1OOH A;  4A4C A;  2V53 A;  4GAO A;  3D78 A;  1YX7 A;  3IQQ A;  2JNF A;  3L4A A;  1XO5 A;  1WRL A;  1WY9 A;  2Q91 A;  3SG6 A;  1QVI Z;  1UUR A;  1QAT A;  1S6C A;  2KFH A;  1ALW A;  3L47 A;  4OVN F;  2QEB A;  3UNW A;  2ISD A;  3PM8 A;  2F3Y A;  2K7C A; 
#chains in the Genus database with same CATH homology
 1IJ5 A;  4PHK A;  5JOL A;  3CS1 A;  2F33 A;  4XYN A;  2LP3 A;  1BF5 A;  1F4Q A;  3FS7 A;  1CFD A;  2LE9 B;  2EC6 B;  2JZI A;  4PE1 A;  4FQO A;  4DUQ A;  1MWN A;  3CLN A;  2MJW B;  3TZ1 A;  1J7R A;  4GGF C;  1S1E A;  4L9M A;  1LXF C;  1OSA A;  1K96 A;  3FIA A;  3LCP C;  1UHH A;  4ORC B;  3BOW A;  1CFC A;  1XFU O;  3TS5 B;  1CLM A;  3BQ3 A;  2BE6 A;  3O4Y A;  1RK9 A;  4ZCV A;  1IRJ A;  1UP5 A;  1C7W A;  2JXC A;  2M7N A;  3D0Y B;  1SBJ A;  2M29 A;  3SIA A;  1AP4 A;  1Q80 A;  4MEW A;  1NWD A;  1F54 A;  1K2H A;  4YGB B;  1F55 A;  2PAS A;  1WRK A;  4GGF A;  2Y4Q A;  3TUY C;  1D1O A;  4I5J A;  5IBW A;  1CDM A;  1N65 A;  1RWY A;  3I5G B;  2LHL A;  3WXA A;  1RFJ A;  2G2B A;  1E8A A;  2LMT A;  2ZFD A;  4U8D A;  5HKZ A;  3BXK A;  1DJZ A;  4WQ3 A;  2RGI A;  4MZK A;  2HQW A;  2JXL A;  2LNK A;  3BUW B;  1JC2 A;  3NXA A;  2ZN9 A;  1SKT A;  2F2O A;  1J7Q A;  2BEC A;  2K7B A;  3SG3 A;  2M7L A;  1DVI A;  2TN4 A;  3I5F C;  4YI8 A;  1M39 A;  1UHK A;  1A75 B;  1K9P A;  4GPL B;  1BOD A;  1GGW A;  2HF5 A;  3WHT B;  2KBI A;  5TNC A;  3D10 A;  4MZL A;  1JFJ A;  1VRK A;  2JT0 A;  2EGD A;  3AKA A;  3KF9 A;  3WNX B;  1TN4 A;  2GGZ A;  1JUO A;  2B1U A;  2PVB A;  1IJ6 A;  3M0W A;  3O6B A;  1YRU B;  1TNX A;  2JPT A;  3RM1 A;  5I2Q A;  1CFP A;  2KYC A;  1EH2 A;  1YRT B;  2OTG B;  1K95 A;  1KK8 C;  3TDU A;  1SR6 C;  2L0P A;  3JVT B;  4MBE A;  1QAS A;  1PSR A;  1EG4 A;  3KEV A;  2LUX A;  1EG3 A;  4ETO A;  2VRG A;  2F2P A;  2M49 B;  3E3R A;  2WC8 A;  3DVK A;  4CFR A;  2BBN A;  2H2K A;  4GNK B;  1JF0 A;  1QJT A;  4MSP A;  3HX4 A;  4YGE B;  5PAL A;  1YVH A;  2KHN A;  4N5X A;  1A4P A;  1SY9 A;  3VRQ A;  4AQJ A;  1S6I A;  2PSR A;  2L4H A;  1AJ5 A;  2SAS A;  3DVM A;  2MBX A;  4AQI A;  2FJU B;  1Y0V H;  2KSP A;  1SMG A;  1S26 D;  1W7I B;  2AAO A;  1JBA A;  1TOP A;  3BOW B;  2KGR A;  4DRW A;  1J1E A;  1BJF A;  2LAN A;  3LL8 B;  2NXQ A;  1BLQ A;  1IKU A;  2LP2 A;  3OP0 A;  2K0J A;  1NP8 A;  2I2R E;  5KU1 A;  4M2P A;  4I5K A;  4N1F A;  1RTP 1;  5G08 A;  1QX7 A;  4AOM A;  3PSR A;  1QS7 A;  1K90 D;  1ODB A;  3EVV A;  4PE0 A;  1L2O B;  3CR2 A;  4WQ2 A;  4MVF A;  3FWC A;  1B4C A;  1DTL A;  1PVB A;  4P2Y B;  5AXI A;  2NZ0 A;  3GK2 A;  5I2L A;  2EHB A;  2JQ6 A;  2WOS A;  2LVJ A;  3IF7 A;  1KSM A;  1S36 A;  1ZMZ A;  3JTD C;  2K7D A;  3OX5 A;  4OKH A;  1NX3 A;  3VRR A;  1DJX A;  1J7P A;  1XA5 A;  1PUL A;  2BKI B;  1JSA A;  2LVI A;  1G4Y R;  4Q04 A;  1R2U A;  1BT6 A;  4JQ0 D;  4CPV A;  1TNW A;  1FW4 A;  1XFX O;  1YTZ C;  2M1U A;  3SG7 A;  1BG1 A;  1UUS A;  4NDD A;  1M46 A;  3H4S E;  2JWW A;  3AKB A;  1CKK A;  1WRZ A;  1Y1U A;  1YUR A;  3CWG A;  3EK7 A;  2ZRT A;  2PAL A;  1G8I A;  3I5F B;  3QRX A;  3VRO A;  3PN7 B;  5HKW A;  3AAJ A;  5F6T A;  2E6W A;  2MLE C;  1FPW A;  2KNE A;  2LCP A;  1OE9 B;  4MLW A;  1CM1 A;  1GQM A;  1YVL A;  2LLT A;  1RRO A;  2FCE A;  2MLF C;  3OB1 B;  1KCY A;  5HLO A;  3ICB A;  2KQ6 A;  1F4O A;  1SYM A;  1IQ3 A;  4PE7 A;  3VRP A;  1KSO A;  1MR8 A;  3DVE A;  1QIV A;  1OZS A;  2JOJ A;  1PVA A;  2L50 A;  5CSF A;  5AEQ A;  1KFU S;  1SCV A;  4BY5 A;  3GK4 X;  2WCB A;  4D1E A;  2LMU A;  1DGV A;  1GJY A;  4NDB A;  1YR5 A;  4MRY A;  4UPG A;  1AHR A;  1DF0 A;  1SL9 A;  3GK1 A;  2COL B;  2JTT A;  2MAZ A;  2DOQ A;  1A2X A;  3OHM B;  4TNC A;  4DCK A;  4I5N B;  2L4I A;  1CNP A;  1NX2 A;  2M0R A;  1OZO A;  3NSL A;  3I5H C;  2FCD A;  2KI6 D;  1SNL A;  2JT3 A;  3KO0 A;  4I5L B;  1OMV A;  1DJW A;  2LM5 A;  1AK8 A;  1F8H A;  4NQG A;  1CMF A;  1SL7 A;  3DD4 A;  1TCF A;  1NX1 A;  2CXJ A;  3AAK A;  3LLE A;  5CSN A;  3BUN B;  3GOF A;  1V1G A;  2BL0 C;  3EVR A;  1NYA A;  1XK4 C;  1KFU L;  1B7T Y;  1IWQ A;  4GUK A;  1SCM C;  1F70 A;  2L98 A;  2K61 A;  4YGC B;  3PAT A;  1N2D A;  4M2O A;  1PK0 D;  4NDC A;  1JF2 A;  5HYD A;  1DJI A;  1JFK A;  1M31 A;  1B9A A;  5J3X A;  2SCP A;  2KYF A;  4GGN A;  2KOT A;  1J1D A;  1N0Y A;  1QLS A;  2I94 A;  5ER4 X;  3SG5 A;  1A03 A;  2LHI A;  2K7O A;  1ZUZ A;  3JTD B;  1W7J B;  1UHN A;  2PMY A;  2Y1M A;  1R6P A;  1KWO C;  2ZNE A;  3ZWH A;  1DMO A;  2M1K B;  1KQM C;  1LA3 A;  1SPY A;  2BCB A;  2LAP A;  1BU3 A;  2Y5I A;  3I5G C;  3A4U B;  3C1V A;  1B8R A;  3EVU A;  1FF1 A;  1B7T Z;  1XFW O;  3EK8 A;  2LLU A;  4DS7 A;  1CLL A;  1JWD A;  2L2E A;  1L7Z A;  2FOT A;  2LUC A;  1S3P A;  3OX6 A;  2JT8 A;  2PRU A;  1KQV A;  1YUU A;  1QV1 A;  1TNP A;  4JPZ B;  1CDL A;  1B8L A;  4WRI A;  4ZCU A;  4HRG A;  1MQ1 A;  2M3W A;  3WHU B;  3EK4 A;  1QLK A;  1QXP A;  1ALV A;  3BUX B;  3F45 A;  1QX2 A;  3K21 A;  4BY4 A;  5HKY A;  1YX8 A;  1CTR A;  1DT7 B;  4HRH A;  3LK0 A;  2KAX A;  5AFP A;  3NSK A;  1MF8 B;  2O60 A;  1KK7 Y;  1U5I A;  1DF0 B;  1XFV O;  4N1G A;  1A29 A;  1UHI A;  3TUY B;  1V1F A;  2A4J A;  1REC A;  4IL1 A;  2WOR A;  1LA0 A;  2MRD A;  2LVV A;  1FI5 A;  1EL4 A;  1UHJ A;  2IS9 A;  1QTX A;  4ORA B;  1MHO A;  1B1G A;  1S6J A;  1WLZ A;  1ZAC A;  2M97 A;  3BYA A;  1PSB A;  2KI4 C;  1NCZ A;  1XYD A;  2F8P A;  1EJ3 A;  1XFY O;  1TIZ A;  1XVJ A;  5ER5 A;  4PHN A;  1C7V A;  4PE4 A;  2HPS A;  4C0K A;  4C0J A;  1SRA A;  3CTN A;  2K8M B;  1KK7 Z;  2KGB C;  5BPJ A;  1H8B A;  5JJG A;  5CPV A;  2WND A;  4XJK A;  3EKH A;  2OS8 C;  1FBV A;  1QIW A;  3EKJ A;  2JUL A;  1Y6W A;  2OPO A;  2KQY A;  1BR1 B;  5DKN A;  1Y1X A;  4M2Q A;  3I5H B;  3I5I C;  1MUX A;  2CBL A;  2LVK A;  4CLN A;  1C07 A;  5AER A;  4A4B A;  1WLM A;  3PAL A;  5FYX A;  4DIR A;  2L5X B;  1Y1A A;  4PHM A;  2KDH A;  3PLF B;  1PAL A;  2BL0 B;  2CCM A;  1WDC C;  1AVS A;  4GFT A;  5K89 A;  1KK8 B;  1M63 B;  1SR6 B;  3CZT X;  3DF0 A;  1XFZ O;  1SCM B;  1PRW A;  2GGM A;  3BUO B;  4USL A;  1LIN A;  1L2O C;  2G9B A;  2JRF A;  4OCI A;  4PCW A;  1NPQ A;  1ZFS A;  5D69 A;  3SIB A;  1K94 A;  1BMO A;  4YGD B;  1FI6 A;  4YI9 A;  1NCX A;  1DGU A;  1NUB A;  4OR9 B;  2LV7 A;  3KHE A;  1AUI B;  2LMV A;  3A8R A;  1B8C A;  1KFX S;  1MXL C;  3O78 A;  2KAY A;  2QPT A;  4QJ5 B;  1IQ5 A;  2D8N A;  3FWB A;  1KWO B;  4R1E A;  5HLV A;  2KAV A;  1KQM B;  1CDP A;  2JTZ A;  4YGA A;  1AJ4 A;  4JWQ A;  2MA2 A;  4QJ3 B;  3IQO A;  1CMG A;  3TDZ A;  2BE4 A;  3SG2 A;  1S5G Y;  2JU0 A;  4OV2 A;  3HCM A;  5CSI A;  2NCO A;  2I7A A;  3PFV A;  2EC6 C;  1TCO B;  2HET A;  2L51 A;  2LLS A;  5CSJ A;  5DKQ A;  2BBM A;  2KFF A;  1U5I B;  3BUM B;  2CNP A;  1SW8 A;  1K8U A;  2M9G A;  1F71 A;  1NCY A;  3PN7 C;  1LKJ A;  3NSO A;  1UWO A;  1RJV A;  2ZRS A;  3TS5 C;  5I2O A;  4MZJ A;  1NIW A;  3SJS A;  3LK1 A;  1CFF A;  1DJG A;  3CR4 X;  3NSI A;  2P6B B;  3OB2 B;  4F0Z B;  1CB1 A;  2GV5 A;  5DKR A;  2MHH A;  5KSZ A;  1K9U A;  1S5G Z;  1KFX L;  5AAN A;  1TNQ A;  1CM4 A;  2ZND A;  5I8N A;  1IH0 A;  1QV0 A;  1SL8 A;  2O5G A;  3ZNI A;  4PDZ A;  4QJ4 B;  1B47 A;  2QAC A;  1NSH A;  3MSE B;  1M45 A;  1XK4 A;  1YUT A;  2KFG A;  1TTX A;  4PHJ A;  1NX0 A;  1CLB A;  5GQQ C;  3CR5 X;  3RLZ A;  2Q4U A;  2WCF A;  4MN0 A;  4XJK B;  1MXE A;  2LC5 A;  2JC2 A;  4YRU A;  4E68 A;  4C0L A;  3VRN A;  2KI4 B;  1CDN A;  1OQP A;  5KTY A;  2CT9 A;  2ZKM X;  1HT9 A;  2NLN A;  3D0Y A;  4FTG A;  2KBM A;  4ICB A;  1BOC A;  2M8U A;  1HQV A;  2Y1N A;  3VGO A;  2H61 C;  2BCA A;  2K2A A;  2KI6 C;  4HSZ A;  2NCP A;  1H4B A;  1ZOT B;  2BKH B;  4P5O E;  1J55 A;  4CID A;  3DF0 B;  3O2P A;  4ORB B;  2AMI A;  2OS8 B;  4HRE E;  1QX5 B;  1OMD A;  1DJY A;  4CFQ A;  1OOJ A;  1BR4 B;  3TDI A;  2WCE A;  3I5I B;  1X02 A;  2CTN A;  2I18 A;  1SK6 D;  5B8I B;  4MRX A;  2ZN8 A;  1EXR A;  3CGA A;  1QVI Y;  1J7O A;  5D7F A;  2JNX A;  1K93 D;  3KPX A;  2H61 A;  1GGZ A;  4YBH B;  2OTG C;  1WDC B;  2R2I A;  1A75 A;  1YUS A;  1LVC D;  2F3Z A;  3JVT C;  2HQ8 A;  4GBA A;  1IGV A;  1G33 A;  2K2F A;  1IG5 A;  1OMR A;  1DJH A;  2BCX A;  1TRF A;  2AUC A;  2E30 A;  1K9K A;  3SG4 A;  3DVJ A;  4PAL A;  4A4C A;  2V53 A;  4GAO A;  1YX7 A;  3IQQ A;  2JNF A;  1XO5 A;  1WRL A;  1WY9 A;  2Q91 A;  3SG6 A;  1QVI Z;  1UUR A;  1QAT A;  1S6C A;  2KFH A;  1ALW A;  4OVN F;  2ISD A;  3PM8 A;  2F3Y A;  2K7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...