4OCIA

Crystal structure of calcium binding protein-5 from entamoeba histolytica and its involvement in initiation of phagocytosis of human erythrocytes
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
139
structure length
139
Chain Sequence
LKESFLLFDGDGDGYLTLNEFESLVRVLGVVMETSAIASTYNSNSKVRGMSYELFTSCFSQLKTKSFNKDEIKTAINVLDKDKKGFIPAIELRRILSTIGDNMEQKEITDLFTFMGIDEQGVVKVDDFINQDNHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin, putative
publication title Crystal Structure of Calcium Binding Protein-5 from Entamoeba histolytica and Its Involvement in Initiation of Phagocytosis of Human Erythrocytes.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
total genus 46
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ociA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ociA01
2NXQA 4NQGA 1K95A 3DVEA 1DF0A 3DVKA 4MVFA 3I5GB 1MWNA 3TZ1A 1MHOA 3I5IB 1W7JB 3NSLA 2K7OA 3OB1B 3AAKA 1S1EA 1RWYA 1B7TZ 2M9GA 3EVRA 1R2UA 3OP0A 4OKHA 1IJ5A 3NSIA 1GGZA 1PSRA 2P6BB 1L7ZA 2KI6C 4TNCA 4A4CA 1ALWA 1KWOC 5DKRA 5HYDA 1OOJA 5KSZA 2AUCA 1M45A 2COLB 1AP4A 3FWBA 4PHJA 4DRWA 1IG5A 1QX5B 3PLFB 4I5LB 1K90D 2OTGC 2QACA 1NPQA 4N5XA 1BLQA 1DJWA 1M46A 1J7QA 1SKTA 3OX6A 1SK6D 1WRZA 2JXLA 1G8IA 1K9UA 2I94A 3LK0A 3DF0A 4C0JA 2JNFA 1SR6C 2F8PA 4GAOA 4OVNF 2MAZA 4XYNA 2JNXA 2NCOA 3NXAA 2HPSA 1NCXA 1YVHA 2F2OA 2M0RA 1BU3A 1YUTA 1BMOA 4MRYA 3TS5B 4R1EA 3JTDB 1F55A 4AOMA 4HRGA 2KAXA 5K89A 1FPWA 3K21A 1RTP1 1LXFC 4IL1A 1QV1A 1HQVA 4ICBA 2BCXA 1DGUA 2LMTA 4ZCUA 1CTRA 3I5GC 1TNPA 3EKJA 2PVBA 1QIVA 4PHMA 2ZNDA 3I5IC 1MQ1A 1WLMA 1R6PA 2CTNA 2M29A 3O2PA 2LM5A 3HCMA 5JOLA 2JOJA 2OS8B 1N2DA 2FCEA 2JT3A 3HX4A 2FJUB 1N65A 4QJ4B 5B8IB 5J3XA 4A4BA 3TDIA 2M7LA 5TNCA 1S6IA 1BT6A 2SASA 2KI6D 4DIRA 2JWWA 2KNEA 1PULA 1YUSA 1KQMB 1KSOA 4BY4A 1XO5A 2GGZA 2LAPA 5CSJA 1CKKA 1TCFA 1PSBA 4PE1A 5IBWA 2BCBA 2LMUA 2E30A 4GBAA 1RROA 1QXPA 1SBJA 1IRJA 4NDDA 1SW8A 4L9MA 1UURA 1S26D 4P5OE 5HKWA 1YURA 3PALA 1OZOA 1WRLA 3RLZA 3BYAA 2BKIB 3TS5C 5AXIA 3TDUA 2ZN8A 1IKUA 3JTDC 4I5KA 1CNPA 2BBMA 4JPZB 2M7NA 1CFCA 1NCYA 1S3PA 5AEQA 1SNLA 1IQ5A 1SCVA 3F45A 3VRQA 4BY5A 2ZRSA 2LUCA 1TNQA 1OSAA 4DUQA 2G2BA 2JZIA 3PFVA 1F71A 2MHHA 3H4SE 5JJGA 3DVJA 3SG4A 1JFKA 4I5JA 4CLNA 1EG3A 2A4JA 2F3YA 1S6CA 4MLWA 2G9BA 2OS8C 5I2QA 1A03A 4AQIA 4WQ2A 2JXCA 1NCZA 1CFPA 4GGFA 1J55A 2CNPA 2L50A 2SCPA 1J7PA 2ZKMX 4NDBA 2JTZA 1UHIA 3SIBA 1KQMC 2BCAA 3A4UB 4PE4A 1TRFA 3GOFA 3LK1A 1IWQA 4Q04A 3WNXB 2CBLA 3FS7A 1NX0A 1XFXO 4P2YB 2RGIA 1S6JA 1A2XA 5CSNA 2LP3A 2K2AA 1Y6WA 4ORCB 4ZCVA 1XK4A 5HLOA 3NSKA 1MXEA 1CDLA 4FQOA 2NZ0A 5ER4X 1XK4C 1CFDA 1FF1A 1QIWA 3EK7A 1RECA 1RK9A 1SYMA 2EC6B 3QRXA 1DJIA 1SY9A 1OMVA 1UWOA 1EJ3A 2L4HA 2JPTA 3VROA 1L2OB 5HLVA 2MRDA 1JWDA 1A75B 1F70A 3OHMB 3GK2A 2L5XB 2LHLA 2MLEC 4MBEA 1QTXA 2HF5A 2L2EA 3KO0A 2KAVA 3WHTB 2KAYA 1AHRA 2V53A 1SPYA 2KBMA 2TN4A 1JF2A 5CPVA 1CFFA 2FOTA 1QX2A 1YR5A 1B1GA 2K7CA 1QS7A 3PN7B 1DJGA 1K9PA 2BBNA 1PK0D 2LANA 4USLA 4YBHB 1IH0A 4ORAB 1AJ5A 3BQ3A 1LINA 3CR4X 1E8AA 1J7OA 4CIDA 2M8UA 1QLKA 1QJTA 1GJYA 1XFWO 1G33A 1NSHA 2K8MB 3DVMA 5G08A 1YVLA 3CR2A 1NUBA 3SG5A 1GQMA 1K94A 2BKHB 3GK1A 1K8UA 1DMOA 1UHJA 2PRUA 1K96A 1IQ3A 3SG2A 5AFPA 1NX1A 4C0KA 1KFUL 1XVJA 2KGBC 1J1EA 1SCMB 2EC6C 2LHIA 2LVKA 5HKZA 3KPXA 4HRHA 1DVIA 1GGWA 2LUXA 1A75A 5DKQA 1J1DA 1L2OC 5AANA 5PALA 2F3ZA 3MSEB 3WXAA 1LVCD 1RFJA 2JT0A 1MXLC 1NP8A 1ZMZA 2KFFA 1CLLA 2LV7A 4MZLA 1JUOA 2NLNA 2BE6A 1YTZC 2HQWA 3AKBA 1KK7Y 4XJKB 4PHNA 4CFRA 1OZSA 1QX7A 3PN7C 1K2HA 1F4OA 3CGAA 1PALA 5F6TA 1AK8A 2KFHA 5DKNA 1IGVA 1LKJA 1WY9A 2JC2A 2MBXA 1X02A 1EL4A 4YGBB 1OE9B 1BG1A 1MUXA 1TTXA 4GFTA 1DJZA 2WCEA 1UHKA 1Y1XA 2KYFA 1DGVA 1LA3A 1J7RA 3BUMB 2MA2A 1NWDA 2OPOA 4MRXA 3BOWB 3I5HB 4PDZA 2JULA 1HT9A 2BE4A 4M2QA 2KGRA 4FTGA 1CLMA 2I18A 1F54A 3O6BA 1SCMC 5I2OA 4M2OA 2EGDA 5I2LA 3C1VA 5D7FA 3LCPC 1D1OA 1YX8A 2K61A 1NYAA 4E68A 2L98A 3TUYB 1FW4A 4PE7A 2BL0B 1KFXL 4GUKA 3CWGA 1FI6A 2CCMA 5D69A 2K7BA 4XJKA 5I8NA 2WCFA 1EG4A 1QLSA 1ZOTB 2Y1NA 5CSIA 2KSPA 5KTYA 2KYCA 1KK8B 2FCDA 4QJ5B 3KHEA 4WRIA 3BUNB 1NX2A 1UUSA 1M31A 1Y1AA 4F0ZB 1BODA 4PHKA 1EH2A 1QV0A 2LNKA 2ZN9A 2HQ8A 2EHBA 2H61A 4JQ0D 2Y1MA 1SL8A 3KEVA 2JRFA 1K9KA 1QASA 2H61C 1YX7A 1F4QA 1S36A 2PASA 5KU1A 1IJ6A 3SG6A 5CSFA 4AQJA 1QVIZ 3VRPA 2KBIA 4N1GA 1XFVO 3BOWA 2Q4UA 3WHUB 3GK4X 2LLUA 3I5HC 1M39A 3NSOA 1JFJA 2LMVA 4OR9B 1KFUS 4D1EA 3LLEA 1KK7Z 4NDCA 1CDMA 1Q80A 2LVVA 1XFYO 1DT7B 2F2PA 3SIAA 2KFGA 3FWCA 1CM4A 4MSPA 2CXJA 1H8BA 2WORA 5ER5A 1CM1A 3TDZA 1AJ4A 1TNWA 1Y0VH 2M97A 4YRUA 1BF5A 3TUYC 1XYDA 2BL0C 2I7AA 3I5FB 4CFQA 1H4BA 2NCPA 2KOTA 1CLBA 4GNKB 2H2KA 4YGEB 3IF7A 1KK8C 4DCKA 2M1UA 5GQQC 1UHHA 2LLTA 3EK4A 1ODBA 2KI4B 2L51A 2O60A 1TN4A 3PM8A 1NIWA 1JSAA 2KDHA 3E3RA 3OX5A 2VRGA 2K2FA 1XFUO 1C7VA 1MR8A 4CPVA 1YUUA 2K0JA 4MEWA 1B8CA 4ORBB 2DOQA 3CS1A 3CTNA 2BECA 1SL7A 1JC2A 2JT8A 4GPLB 2HETA 3AAJA 3SG3A 2CT9A 1V1FA 2LVIA 1ZUZA 3A8RA 2Y5IA 2QPTA 1U5IB 1RJVA 1DJHA 3IQQA 1QVIY 3O78A 1EXRA 1S5GY 3BUXB 1CMGA 3EVVA 2LP2A 4YI8A 1KCYA 5FYXA 1BR1B 3EVUA 4DS7A 1FI5A 1FBVA 1CMFA 1KQVA 1Y1UA 4MZKA 3D10A 1CB1A 1AUIB 1KFXS 2JU0A 1C07A 2PMYA 1BJFA 2KQYA 3I5FC 2JQ6A 2L0PA 1ZFSA 4YI9A 1W7IB 3JVTB 1QATA 2M3WA 1WRKA 1SRAA 1YRTB 2AAOA 3KF9A 1BOCA 2Y4QA 2M49B 1N0YA 3CZTX 4PALA 1CDNA 1MF8B 1TIZA 2LVJA 2KI4C 4YGDB 2WOSA 1LA0A 2F33A 1B8RA 2LC5A 4PCWA 2Q91A 1DTLA 1C7WA 1UHNA 3AKAA 1TCOB 1B7TY 1SL9A 2ZFDA 2LCPA 2O5GA 1V1GA 4YGCB 3VRNA 1G4YR 2B1UA 1U5IA 3O4YA 1B4CA 1OMRA 2I2RE 2M1KB 2D8NA 3D0YB 3LL8B 4GGNA 1WDCB 4HSZA 1KSMA 1YRUB 5HKYA 3CR5X 1A4PA 3VRRA 2ZRTA 3BUOB 1F8HA 3OB2B 4C0LA 2WC8A 1DF0B 5BPJA 3VGOA 3ICBA 1PVBA 1CDPA 2KQ6A 3DD4A 2AMIA 1DJXA 3PSRA 1B9AA 1OMDA 2K7DA 3EK8A 2L4IA 2E6WA 1B47A 3JVTC 4ETOA 4MN0A 2GGMA 4OCIA 1KWOB 3IQOA 2PSRA 4I5NB 4QJ3B 3SG7A 1JF0A 4OV2A 1M63B 1PRWA 1OQPA 1XFZO 4M2PA 1JBAA 1A29A 1WLZA 1BR4B 2KHNA 2GV5A 2OTGB 4JWQA 2JTTA 2LE9B 4N1FA 1S5GZ 3CLNA 3EKHA 4GGFC 2LLSA 2MLFC 2MJWB 1PVAA 4U8DA 4WQ3A 3ZNIA 3SJSA 2IS9A 3ZWHA 1NX3A 3FIAA 1SMGA 1SR6B 1ALVA 1B8LA 3PATA 1K93D 3DF0B 1UP5A 2ZNEA 2ISDA 4PE0A 1AVSA 5AERA 3M0WA 4YGAA 2PALA 1XA5A 2WNDA 3BUWB 3D0YA 4MZJA 3RM1A 1TNXA 4UPGA 3BXKA 1VRKA 2WCBA 1DJYA 2R2IA 4HREE 1TOPA 1ZACA 1WDCC
chains in the Genus database with same CATH superfamily
2NXQA 3BFBA 3FE8A 1K95A 4INWA 3DVEA 4NQGA 1DF0A 3DVKA 3D76A 4MVFA 3I5GB 1MWNA 3TZ1A 1MHOA 3I5IB 1W7JB 3NSLA 2K7OA 3OB1B 3AAKA 1S1EA 1RWYA 1B7TZ 2M9GA 3EVRA 1R2UA 3OP0A 4OKHA 1IJ5A 3NSIA 3D75A 1GGZA 1PSRA 2P6BB 1L7ZA 2KI6C 4TNCA 4A4CA 1ALWA 1KWOC 5DKRA 5HYDA 1OOJA 5KSZA 2AUCA 1M45A 2COLB 1AP4A 3FWBA 4PHJA 4DRWA 1IG5A 2WCMA 3S0FA 1QX5B 3PLFB 4I5LB 1K90D 2OTGC 2QACA 1NPQA 3FE9A 4N5XA 3IVTA 1BLQA 1DJWA 1M46A 1J7QA 1SKTA 3OX6A 1SK6D 1WRZA 2JXLA 1G8IA 1K9UA 2I94A 3L4AA 3LK0A 3DF0A 4C0JA 2JNFA 1SR6C 2F8PA 1OOHA 4GAOA 4OVNF 2MAZA 4XYNA 2JNXA 2NCOA 3NXAA 2HPSA 1NCXA 1YVHA 1IIOA 2F2OA 2M0RA 1BU3A 1YUTA 1DELA 1BMOA 4MRYA 3TS5B 4R1EA 3JTDB 1F55A 4AOMA 4HRGA 2KAXA 3VB1A 5K89A 1FPWA 3K21A 1RTP1 1LXFC 4IL1A 1QV1A 1HQVA 4ICBA 3S0DA 2BCXA 1DGUA 2LMTA 4ZCUA 1CTRA 3I5GC 1TNPA 3EKJA 2PVBA 1QIVA 4PHMA 2ZNDA 3I5IC 1MQ1A 1WLMA 1R6PA 2CTNA 2M29A 3O2PA 2LM5A 3HCMA 5JOLA 2JOJA 2OS8B 1N2DA 3O4XA 2FCEA 2JT3A 3HX4A 2FJUB 1N65A 4QJ4B 5B8IB 5J3XA 4A4BA 3TDIA 2M7LA 5TNCA 1S6IA 1BT6A 2SASA 2KI6D 4DIRA 1OW4A 2JWWA 2KNEA 1PULA 1YUSA 1KQMB 1KSOA 4BY4A 1XO5A 2GGZA 2LAPA 5CSJA 3V2LA 1CKKA 1TCFA 1PSBA 4PE1A 5IBWA 2BCBA 2LMUA 1OOGA 2E30A 4GBAA 5EL2A 1P28A 4INXA 1RROA 3DZTA 1QXPA 5I94A 1SBJA 1IRJA 4NDDA 1SW8A 4L9MA 1UURA 1S26D 4P5OE 5HKWA 1YURA 3PALA 1OZOA 1WRLA 3RLZA 3BYAA 2BKIB 3SS3A 5AXIA 3TS5C 3TDUA 2ZN8A 1IKUA 3JTDC 4I5KA 3S0AA 1CNPA 2WCKA 2BBMA 4JPZB 2M7NA 1CFCA 1NCYA 1S3PA 5AEQA 1SNLA 1IQ5A 1SCVA 3F45A 3VRQA 4BY5A 2WCLA 2ZRSA 2LUCA 1TNQA 1OSAA 4DUQA 2G2BA 3QMEA 2JZIA 3PFVA 1F71A 2MHHA 3H4SE 5JJGA 3DVJA 3SG4A 1JFKA 4I5JA 4CLNA 5FI6A 1EG3A 2A4JA 2F3YA 1S6CA 4MLWA 2G9BA 2OS8C 5G08A 5I2QA 1A03A 4AQIA 4WQ2A 2JXCA 1NCZA 1CFPA 4GGFA 1J55A 2CNPA 2L50A 2SCPA 1J7PA 2ZKMX 4NDBA 3UO9A 3R1OA 2JTZA 2FJYA 1UHIA 3SIBA 1KQMC 2BCAA 3A4UB 4PE4A 1TRFA 3GOFA 3LK1A 1IWQA 4Q04A 3WNXB 2CBLA 3FS7A 3R1PA 1NX0A 1XFXO 4P2YB 2RGIA 1S6JA 5HL1A 1A2XA 5CSNA 2LP3A 2K2AA 1Y6WA 4ORCB 4ZCVA 1XK4A 5HLOA 5D3OA 3NSKA 3R1VA 1MXEA 1CDLA 2WC5A 4FQOA 2NZ0A 5ER4X 1XK4C 1CFDA 1FF1A 1QIWA 3EK7A 1RECA 1RK9A 1SYMA 2EC6B 3QRXA 1DJIA 1SY9A 5FI2A 1OMVA 3Q8IA 1UWOA 1EJ3A 2L4HA 2JPTA 3VROA 3S0GA 1L2OB 5HLVA 2MRDA 1JWDA 1A75B 1ORGA 1F70A 3BJHA 3OHMB 3GK2A 2L5XB 2LHLA 2MLEC 3PM2A 4MBEA 1QTXA 2HF5A 2L2EA 3KO0A 2KAVA 3L47A 3WHTB 2KAYA 3NHTA 1AHRA 1Z2CB 2V53A 1C3ZA 1SPYA 2KBMA 2TN4A 3S0BA 1JF2A 5CPVA 1CFFA 3RZSA 1TUZA 2FOTA 1QX2A 1YR5A 1B1GA 2K7CA 1QS7A 3PN7B 1DJGA 1K9PA 2BBNA 1PK0D 3D73A 3BFHA 2LANA 4USLA 4YBHB 1IH0A 4ORAB 1AJ5A 3B88A 3BQ3A 1LINA 3CR4X 1E8AA 1J7OA 4CIDA 1Z4HA 3D74A 1QWVA 2M8UA 1QLKA 1QJTA 1GJYA 1XFWO 1G33A 1NSHA 2K8MB 3DVMA 3EG5B 1YVLA 3CR2A 1NUBA 3SG5A 1GQMA 1K94A 2BKHB 3CABA 3GK1A 1K8UA 1DMOA 1UHJA 2PRUA 1K96A 1IQ3A 3SG2A 5AFPA 1NX1A 2PQLA 3SS5A 4C0KA 1KFUL 1XVJA 2KGBC 1J1EA 1SCMB 2EC6C 2LHIA 2LVKA 5HKZA 3KPXA 4HRHA 1DVIA 1GGWA 2LUXA 1A75A 5DKQA 3R72A 1J1DA 1L2OC 5AANA 5PALA 2F3ZA 3MSEB 5FI7A 1DEKA 4KYNA 3WXAA 1LVCD 1RFJA 2JT0A 1MXLC 1NP8A 1ZMZA 2KFFA 1CLLA 2LV7A 4MZLA 1JUOA 2NLNA 2BE6A 1YTZC 2HQWA 3AKBA 1KK7Y 4XJKB 1TUJA 1LS8A 4PHNA 4CFRA 1OZSA 1W9ZA 1QX7A 3PN7C 1K2HA 1F4OA 3CGAA 1PALA 2WC6A 5F6TA 1AK8A 2KFHA 5DKNA 1IGVA 1LKJA 1WY9A 2JC2A 2MBXA 1X02A 1EL4A 4YGBB 1OE9B 1BG1A 1MUXA 1TTXA 4GFTA 1DJZA 2WCEA 3OBVA 1UHKA 1Y1XA 2KYFA 3UNWA 1DGVA 3B7AA 1LA3A 2JPOA 1J7RA 3BUMB 2MA2A 1NWDA 2OPOA 4MRXA 3BOWB 3I5HB 4PDZA 2JULA 1HT9A 2BE4A 4M2QA 2KGRA 4FTGA 1CLMA 2I18A 1F54A 3O6BA 1SCMC 5I2OA 2KLEA 4M2OA 2EGDA 5I2LA 2YGUA 3C1VA 3DXLA 5D7FA 3LCPC 5DICA 1D1OA 1YX8A 2K61A 1NYAA 4E68A 3SS4A 2L98A 3TUYB 3K1EA 1FW4A 3B87A 4PE7A 2BL0B 1KFXL 4GUKA 3CWGA 1FI6A 2CCMA 5D69A 2K7BA 4XJKA 5I8NA 2WCFA 1EG4A 1QLSA 1ZOTB 2Y1NA 5CSIA 2KSPA 5KTYA 2KYCA 1KK8B 2FCDA 4QJ5B 3KHEA 4WRIA 3BUNB 1NX2A 1UUSA 1M31A 1Y1AA 4F0ZB 1BODA 2WCJA 4PHKA 1EH2A 1QV0A 2LNKA 2ZN9A 2HQ8A 2EHBA 2H61A 4JQ0D 2Y1MA 1SL8A 3KEVA 2JRFA 1K9KA 1QASA 2H61C 1YX7A 1F4QA 1S36A 2PASA 5KU1A 4FQTA 1IJ6A 3SG6A 5CSFA 4AQJA 1QVIZ 3VRPA 3S0EA 2KBIA 4N1GA 1XFVO 3BOWA 2Q4UA 3WHUB 3GK4X 2LLUA 1T14A 3I5HC 1M39A 3NSOA 4IJ7A 1JFJA 2LMVA 4OR9B 1KFUS 4D1EA 3LLEA 1KK7Z 4NDCA 1CDMA 1Q80A 2LVVA 1XFYO 1DT7B 2F2PA 3SIAA 2KFGA 3FWCA 1CM4A 3FE6A 4MSPA 2P70A 2GTEA 2CXJA 1H8BA 2QDIA 2WORA 5ER5A 3CDNA 1CM1A 3TDZA 1AJ4A 1TNWA 1Y0VH 2M97A 4YRUA 1BF5A 2QEOA 3TUYC 1XYDA 2BL0C 2I7AA 3I5FB 4CFQA 1H4BA 2NCPA 2KOTA 1CLBA 4GNKB 2H2KA 4YGEB 3IF7A 1KK8C 4DCKA 2M1UA 5GQQC 1UHHA 2LLTA 3EK4A 1ODBA 2KI4B 2L51A 2O60A 1TN4A 3PM8A 1NIWA 1JSAA 2KDHA 3E3RA 3OX5A 2VRGA 2K2FA 1XFUO 1C7VA 1MR8A 4CPVA 1YUUA 2K0JA 4MEWA 1B8CA 4ORBB 2DOQA 3CS1A 3CTNA 2BECA 1SL7A 1JC2A 1XFRA 3CZ0A 2JT8A 4JKTA 3CYZA 4GPLB 1SSEB 2HETA 3AAJA 3SG3A 2CT9A 2QEHA 1V1FA 2LVIA 1ZUZA 2BAPA 2Y5IA 3A8RA 2QPTA 1OOFA 1U5IB 1RJVA 1DJHA 3D77A 3IQQA 1QVIY 2QEBA 3O78A 1C3YA 3DYEA 1EXRA 1S5GY 1OOIX 3BUXB 1CMGA 4F7FA 3EVVA 2LP2A 4YI8A 1KCYA 3CZ2A 5FYXA 1BR1B 3EVUA 4DS7A 1FI5A 1FBVA 1CMFA 1KQVA 1Y1UA 4MZKA 3D10A 1CB1A 1AUIB 1KFXS 2JU0A 2KLDA 1C07A 2PMYA 2BNXA 3B6XA 1BJFA 2KQYA 3I5FC 2JQ6A 2L0PA 1ZFSA 4YI9A 3PJIA 1W7IB 3JVTB 1QATA 2M3WA 1WRKA 1DC1A 1SRAA 1YRTB 2AAOA 3KF9A 1BOCA 2Y4QA 2M49B 2H8VA 1N0YA 3CZTX 4PALA 4OZDA 1CDNA 1MF8B 2PYQA 1TIZA 2LVJA 2KI4C 4PT1A 4YGDB 2WOSA 1DQEA 1LA0A 2F33A 1B8RA 2LC5A 4PCWA 2Q91A 1DTLA 1C7WA 1UHNA 3AKAA 2WCHA 1TCOB 1B7TY 1SL9A 1TWOA 2ZFDA 2LCPA 2O5GA 3NHIA 1V1GA 4YGCB 3VRNA 1G4YR 2B1UA 3NGVA 1U5IA 3O4YA 4JD9A 1B4CA 1OMRA 2I2RE 2L5YA 3BFAA 2M1KB 2D8NA 3D0YB 3LL8B 2P71A 4GGNA 1WDCB 4HSZA 1KSMA 1YRUB 3N7HA 2L2CA 5HKYA 3CR5X 1A4PA 2K60A 3VRRA 3OGNA 2ZRTA 3BUOB 1F8HA 3OB2B 4C0LA 2WC8A 1GM0A 1DF0B 5BPJA 3VGOA 3ICBA 1PVBA 2QEVA 1CDPA 2KQ6A 3DD4A 1DJXA 2AMIA 3PSRA 1B9AA 1OMDA 2K7DA 3CZ1A 3EK8A 2L4IA 2E6WA 1B47A 3JVTC 4ETOA 4MN0A 2GGMA 4OCIA 1KWOB 3IQOA 2PSRA 4I5NB 4QJ3B 3SG7A 1JF0A 4OV2A 1M63B 1PRWA 1OQPA 1XFZO 4M2PA 3DY9A 1JBAA 1A29A 1WLZA 1BR4B 2KHNA 2GV5A 2OTGB 4JWQA 2JTTA 2LE9B 3B86A 4N1FA 1S5GZ 3CLNA 3EKHA 4GGFC 2LLSA 2MLFC 2MJWB 1PVAA 4U8DA 4WQ3A 2ERBA 3ZNIA 3SJSA 2IS9A 3ZWHA 1NX3A 3FIAA 1SMGA 1SR6B 1ALVA 1B8LA 2KPHA 3PATA 1K93D 3D78A 3DF0B 1UP5A 2ZNEA 2ISDA 4PE0A 1AVSA 5AERA 3M0WA 4YGAA 2PALA 1XA5A 2WNDA 3BUWB 3D0YA 4MZJA 3RM1A 1TNXA 4UPGA 3BXKA 1VRKA 2WCBA 1DJYA 2R2IA 4HREE 1TOPA 1ZACA 1WDCC 3L4LA
chains in the Genus database with same CATH topology
2NXQA 4NQGA 1K95A 3DVEA 1DF0A 3DVKA 4MVFA 3I5GB 1MWNA 3TZ1A 1MHOA 3I5IB 1W7JB 3NSLA 2K7OA 3OB1B 3AAKA 1S1EA 1RWYA 1B7TZ 2M9GA 3EVRA 1R2UA 3OP0A 4OKHA 1IJ5A 3NSIA 1GGZA 1PSRA 2P6BB 1L7ZA 2KI6C 4TNCA 4A4CA 1ALWA 1KWOC 5DKRA 5HYDA 1OOJA 5KSZA 2AUCA 1M45A 2COLB 1AP4A 3FWBA 4PHJA 4DRWA 1IG5A 1QX5B 3PLFB 4I5LB 1K90D 2OTGC 2QACA 1NPQA 4N5XA 1BLQA 1DJWA 1M46A 1J7QA 1SKTA 3OX6A 1SK6D 1WRZA 2JXLA 1G8IA 1K9UA 2I94A 3LK0A 3DF0A 4C0JA 2JNFA 1SR6C 2F8PA 4GAOA 4OVNF 2MAZA 4XYNA 2JNXA 2NCOA 3NXAA 2HPSA 1NCXA 1YVHA 2F2OA 2M0RA 1BU3A 1YUTA 1BMOA 4MRYA 3TS5B 4R1EA 3JTDB 1F55A 4AOMA 4HRGA 2KAXA 5K89A 1FPWA 3K21A 1RTP1 1LXFC 4IL1A 1QV1A 1HQVA 4ICBA 2BCXA 1DGUA 2LMTA 4ZCUA 1CTRA 3I5GC 1TNPA 3EKJA 2PVBA 1QIVA 4PHMA 2ZNDA 3I5IC 1MQ1A 1WLMA 1R6PA 2CTNA 2M29A 3O2PA 2LM5A 3HCMA 5JOLA 2JOJA 2OS8B 1N2DA 2FCEA 2JT3A 3HX4A 2FJUB 1N65A 4QJ4B 5B8IB 5J3XA 4A4BA 3TDIA 2M7LA 5TNCA 1S6IA 1BT6A 2SASA 2KI6D 4DIRA 2JWWA 2KNEA 1PULA 1YUSA 1KQMB 1KSOA 4BY4A 1XO5A 2GGZA 2LAPA 5CSJA 1CKKA 1TCFA 1PSBA 4PE1A 5IBWA 2BCBA 2LMUA 2E30A 4GBAA 1RROA 1QXPA 1SBJA 1IRJA 4NDDA 1SW8A 4L9MA 1UURA 1S26D 4P5OE 5HKWA 1YURA 3PALA 1OZOA 1WRLA 3RLZA 3BYAA 2BKIB 3TS5C 5AXIA 3TDUA 2ZN8A 1IKUA 3JTDC 4I5KA 1CNPA 2BBMA 4JPZB 2M7NA 1CFCA 1NCYA 1S3PA 5AEQA 1SNLA 1IQ5A 1SCVA 3F45A 3VRQA 4BY5A 2ZRSA 2LUCA 1TNQA 1OSAA 4DUQA 2G2BA 2JZIA 3PFVA 1F71A 2MHHA 3H4SE 5JJGA 3DVJA 3SG4A 1JFKA 4I5JA 4CLNA 1EG3A 2A4JA 2F3YA 1S6CA 4MLWA 2G9BA 2OS8C 5I2QA 1A03A 4AQIA 4WQ2A 2JXCA 1NCZA 1CFPA 4GGFA 1J55A 2CNPA 2L50A 2SCPA 1J7PA 2ZKMX 4NDBA 2JTZA 1UHIA 3SIBA 1KQMC 2BCAA 3A4UB 4PE4A 1TRFA 3GOFA 3LK1A 1IWQA 4Q04A 3WNXB 2CBLA 3FS7A 1NX0A 1XFXO 4P2YB 2RGIA 1S6JA 1A2XA 5CSNA 2LP3A 2K2AA 1Y6WA 4ORCB 4ZCVA 1XK4A 5HLOA 3NSKA 1MXEA 1CDLA 4FQOA 2NZ0A 5ER4X 1XK4C 1CFDA 1FF1A 1QIWA 3EK7A 1RECA 1RK9A 1SYMA 2EC6B 3QRXA 1DJIA 1SY9A 1OMVA 1UWOA 1EJ3A 2L4HA 2JPTA 3VROA 1L2OB 5HLVA 2MRDA 1JWDA 1A75B 1F70A 3OHMB 3GK2A 2L5XB 2LHLA 2MLEC 4MBEA 1QTXA 2HF5A 2L2EA 3KO0A 2KAVA 3WHTB 2KAYA 1AHRA 2V53A 1SPYA 2KBMA 2TN4A 1JF2A 5CPVA 1CFFA 2FOTA 1QX2A 1YR5A 1B1GA 2K7CA 1QS7A 3PN7B 1DJGA 1K9PA 2BBNA 1PK0D 2LANA 4USLA 4YBHB 1IH0A 4ORAB 1AJ5A 3BQ3A 1LINA 3CR4X 1E8AA 1J7OA 4CIDA 2M8UA 1QLKA 1QJTA 1GJYA 1XFWO 1G33A 1NSHA 2K8MB 3DVMA 5G08A 1YVLA 3CR2A 1NUBA 3SG5A 1GQMA 1K94A 2BKHB 3GK1A 1K8UA 1DMOA 1UHJA 2PRUA 1K96A 1IQ3A 3SG2A 5AFPA 1NX1A 4C0KA 1KFUL 1XVJA 2KGBC 1J1EA 1SCMB 2EC6C 2LHIA 2LVKA 5HKZA 3KPXA 4HRHA 1DVIA 1GGWA 2LUXA 1A75A 5DKQA 1J1DA 1L2OC 5AANA 5PALA 2F3ZA 3MSEB 3WXAA 1LVCD 1RFJA 2JT0A 1MXLC 1NP8A 1ZMZA 2KFFA 1CLLA 2LV7A 4MZLA 1JUOA 2NLNA 2BE6A 1YTZC 2HQWA 3AKBA 1KK7Y 4XJKB 4PHNA 4CFRA 1OZSA 1QX7A 3PN7C 1K2HA 1F4OA 3CGAA 1PALA 5F6TA 1AK8A 2KFHA 5DKNA 1IGVA 1LKJA 1WY9A 2JC2A 2MBXA 1X02A 1EL4A 4YGBB 1OE9B 1BG1A 1MUXA 1TTXA 4GFTA 1DJZA 2WCEA 1UHKA 1Y1XA 2KYFA 1DGVA 1LA3A 1J7RA 3BUMB 2MA2A 1NWDA 2OPOA 4MRXA 3BOWB 3I5HB 4PDZA 2JULA 1HT9A 2BE4A 4M2QA 2KGRA 4FTGA 1CLMA 2I18A 1F54A 3O6BA 1SCMC 5I2OA 4M2OA 2EGDA 5I2LA 3C1VA 5D7FA 3LCPC 1D1OA 1YX8A 2K61A 1NYAA 4E68A 2L98A 3TUYB 1FW4A 4PE7A 2BL0B 1KFXL 4GUKA 3CWGA 1FI6A 2CCMA 5D69A 2K7BA 4XJKA 5I8NA 2WCFA 1EG4A 1QLSA 1ZOTB 2Y1NA 5CSIA 2KSPA 5KTYA 2KYCA 1KK8B 2FCDA 4QJ5B 3KHEA 4WRIA 3BUNB 1NX2A 1UUSA 1M31A 1Y1AA 4F0ZB 1BODA 4PHKA 1EH2A 1QV0A 2LNKA 2ZN9A 2HQ8A 2EHBA 2H61A 4JQ0D 2Y1MA 1SL8A 3KEVA 2JRFA 1K9KA 1QASA 2H61C 1YX7A 1F4QA 1S36A 2PASA 5KU1A 1IJ6A 3SG6A 5CSFA 4AQJA 1QVIZ 3VRPA 2KBIA 4N1GA 1XFVO 3BOWA 2Q4UA 3WHUB 3GK4X 2LLUA 3I5HC 1M39A 3NSOA 1JFJA 2LMVA 4OR9B 1KFUS 4D1EA 3LLEA 1KK7Z 4NDCA 1CDMA 1Q80A 2LVVA 1XFYO 1DT7B 2F2PA 3SIAA 2KFGA 3FWCA 1CM4A 4MSPA 2CXJA 1H8BA 2WORA 5ER5A 1CM1A 3TDZA 1AJ4A 1TNWA 1Y0VH 2M97A 4YRUA 1BF5A 3TUYC 1XYDA 2BL0C 2I7AA 3I5FB 4CFQA 1H4BA 2NCPA 2KOTA 1CLBA 4GNKB 2H2KA 4YGEB 3IF7A 1KK8C 4DCKA 2M1UA 5GQQC 1UHHA 2LLTA 3EK4A 1ODBA 2KI4B 2L51A 2O60A 1TN4A 3PM8A 1NIWA 1JSAA 2KDHA 3E3RA 3OX5A 2VRGA 2K2FA 1XFUO 1C7VA 1MR8A 4CPVA 1YUUA 2K0JA 4MEWA 1B8CA 4ORBB 2DOQA 3CS1A 3CTNA 2BECA 1SL7A 1JC2A 2JT8A 4GPLB 2HETA 3AAJA 3SG3A 2CT9A 1V1FA 2LVIA 1ZUZA 3A8RA 2Y5IA 2QPTA 1U5IB 1RJVA 1DJHA 3IQQA 1QVIY 3O78A 1EXRA 1S5GY 3BUXB 1CMGA 3EVVA 2LP2A 4YI8A 1KCYA 5FYXA 1BR1B 3EVUA 4DS7A 1FI5A 1FBVA 1CMFA 1KQVA 1Y1UA 4MZKA 3D10A 1CB1A 1AUIB 1KFXS 2JU0A 1C07A 2PMYA 1BJFA 2KQYA 3I5FC 2JQ6A 2L0PA 1ZFSA 4YI9A 1W7IB 3JVTB 1QATA 2M3WA 1WRKA 1SRAA 1YRTB 2AAOA 3KF9A 1BOCA 2Y4QA 2M49B 1N0YA 3CZTX 4PALA 1CDNA 1MF8B 1TIZA 2LVJA 2KI4C 4YGDB 2WOSA 1LA0A 2F33A 1B8RA 2LC5A 4PCWA 2Q91A 1DTLA 1C7WA 1UHNA 3AKAA 1TCOB 1B7TY 1SL9A 2ZFDA 2LCPA 2O5GA 1V1GA 4YGCB 3VRNA 1G4YR 2B1UA 1U5IA 3O4YA 1B4CA 1OMRA 2I2RE 2M1KB 2D8NA 3D0YB 3LL8B 4GGNA 1WDCB 4HSZA 1KSMA 1YRUB 5HKYA 3CR5X 1A4PA 3VRRA 2ZRTA 3BUOB 1F8HA 3OB2B 4C0LA 2WC8A 1DF0B 5BPJA 3VGOA 3ICBA 1PVBA 1CDPA 2KQ6A 3DD4A 2AMIA 1DJXA 3PSRA 1B9AA 1OMDA 2K7DA 3EK8A 2L4IA 2E6WA 1B47A 3JVTC 4ETOA 4MN0A 2GGMA 4OCIA 1KWOB 3IQOA 2PSRA 4I5NB 4QJ3B 3SG7A 1JF0A 4OV2A 1M63B 1PRWA 1OQPA 1XFZO 4M2PA 1JBAA 1A29A 1WLZA 1BR4B 2KHNA 2GV5A 2OTGB 4JWQA 2JTTA 2LE9B 4N1FA 1S5GZ 3CLNA 3EKHA 4GGFC 2LLSA 2MLFC 2MJWB 1PVAA 4U8DA 4WQ3A 3ZNIA 3SJSA 2IS9A 3ZWHA 1NX3A 3FIAA 1SMGA 1SR6B 1ALVA 1B8LA 3PATA 1K93D 3DF0B 1UP5A 2ZNEA 2ISDA 4PE0A 1AVSA 5AERA 3M0WA 4YGAA 2PALA 1XA5A 2WNDA 3BUWB 3D0YA 4MZJA 3RM1A 1TNXA 4UPGA 3BXKA 1VRKA 2WCBA 1DJYA 2R2IA 4HREE 1TOPA 1ZACA 1WDCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXQ A;  4NQG A;  1K95 A;  3DVE A;  1DF0 A;  3DVK A;  4MVF A;  3I5G B;  1MWN A;  3TZ1 A;  1MHO A;  3I5I B;  1W7J B;  3NSL A;  2K7O A;  3OB1 B;  3AAK A;  1S1E A;  1RWY A;  1B7T Z;  2M9G A;  3EVR A;  1R2U A;  3OP0 A;  4OKH A;  1IJ5 A;  3NSI A;  1GGZ A;  1PSR A;  2P6B B;  1L7Z A;  2KI6 C;  4TNC A;  4A4C A;  1ALW A;  1KWO C;  5DKR A;  5HYD A;  1OOJ A;  5KSZ A;  2AUC A;  1M45 A;  2COL B;  1AP4 A;  3FWB A;  4PHJ A;  4DRW A;  1IG5 A;  1QX5 B;  3PLF B;  4I5L B;  1K90 D;  2OTG C;  2QAC A;  1NPQ A;  4N5X A;  1BLQ A;  1DJW A;  1M46 A;  1J7Q A;  1SKT A;  3OX6 A;  1SK6 D;  1WRZ A;  2JXL A;  1G8I A;  1K9U A;  2I94 A;  3LK0 A;  3DF0 A;  4C0J A;  2JNF A;  1SR6 C;  2F8P A;  4GAO A;  4OVN F;  2MAZ A;  4XYN A;  2JNX A;  2NCO A;  3NXA A;  2HPS A;  1NCX A;  1YVH A;  2F2O A;  2M0R A;  1BU3 A;  1YUT A;  1BMO A;  4MRY A;  3TS5 B;  4R1E A;  3JTD B;  1F55 A;  4AOM A;  4HRG A;  2KAX A;  5K89 A;  1FPW A;  3K21 A;  1RTP 1;  1LXF C;  4IL1 A;  1QV1 A;  1HQV A;  4ICB A;  2BCX A;  1DGU A;  2LMT A;  4ZCU A;  1CTR A;  3I5G C;  1TNP A;  3EKJ A;  2PVB A;  1QIV A;  4PHM A;  2ZND A;  3I5I C;  1MQ1 A;  1WLM A;  1R6P A;  2CTN A;  2M29 A;  3O2P A;  2LM5 A;  3HCM A;  5JOL A;  2JOJ A;  2OS8 B;  1N2D A;  2FCE A;  2JT3 A;  3HX4 A;  2FJU B;  1N65 A;  4QJ4 B;  5B8I B;  5J3X A;  4A4B A;  3TDI A;  2M7L A;  5TNC A;  1S6I A;  1BT6 A;  2SAS A;  2KI6 D;  4DIR A;  2JWW A;  2KNE A;  1PUL A;  1YUS A;  1KQM B;  1KSO A;  4BY4 A;  1XO5 A;  2GGZ A;  2LAP A;  5CSJ A;  1CKK A;  1TCF A;  1PSB A;  4PE1 A;  5IBW A;  2BCB A;  2LMU A;  2E30 A;  4GBA A;  1RRO A;  1QXP A;  1SBJ A;  1IRJ A;  4NDD A;  1SW8 A;  4L9M A;  1UUR A;  1S26 D;  4P5O E;  5HKW A;  1YUR A;  3PAL A;  1OZO A;  1WRL A;  3RLZ A;  3BYA A;  2BKI B;  3TS5 C;  5AXI A;  3TDU A;  2ZN8 A;  1IKU A;  3JTD C;  4I5K A;  1CNP A;  2BBM A;  4JPZ B;  2M7N A;  1CFC A;  1NCY A;  1S3P A;  5AEQ A;  1SNL A;  1IQ5 A;  1SCV A;  3F45 A;  3VRQ A;  4BY5 A;  2ZRS A;  2LUC A;  1TNQ A;  1OSA A;  4DUQ A;  2G2B A;  2JZI A;  3PFV A;  1F71 A;  2MHH A;  3H4S E;  5JJG A;  3DVJ A;  3SG4 A;  1JFK A;  4I5J A;  4CLN A;  1EG3 A;  2A4J A;  2F3Y A;  1S6C A;  4MLW A;  2G9B A;  2OS8 C;  5I2Q A;  1A03 A;  4AQI A;  4WQ2 A;  2JXC A;  1NCZ A;  1CFP A;  4GGF A;  1J55 A;  2CNP A;  2L50 A;  2SCP A;  1J7P A;  2ZKM X;  4NDB A;  2JTZ A;  1UHI A;  3SIB A;  1KQM C;  2BCA A;  3A4U B;  4PE4 A;  1TRF A;  3GOF A;  3LK1 A;  1IWQ A;  4Q04 A;  3WNX B;  2CBL A;  3FS7 A;  1NX0 A;  1XFX O;  4P2Y B;  2RGI A;  1S6J A;  1A2X A;  5CSN A;  2LP3 A;  2K2A A;  1Y6W A;  4ORC B;  4ZCV A;  1XK4 A;  5HLO A;  3NSK A;  1MXE A;  1CDL A;  4FQO A;  2NZ0 A;  5ER4 X;  1XK4 C;  1CFD A;  1FF1 A;  1QIW A;  3EK7 A;  1REC A;  1RK9 A;  1SYM A;  2EC6 B;  3QRX A;  1DJI A;  1SY9 A;  1OMV A;  1UWO A;  1EJ3 A;  2L4H A;  2JPT A;  3VRO A;  1L2O B;  5HLV A;  2MRD A;  1JWD A;  1A75 B;  1F70 A;  3OHM B;  3GK2 A;  2L5X B;  2LHL A;  2MLE C;  4MBE A;  1QTX A;  2HF5 A;  2L2E A;  3KO0 A;  2KAV A;  3WHT B;  2KAY A;  1AHR A;  2V53 A;  1SPY A;  2KBM A;  2TN4 A;  1JF2 A;  5CPV A;  1CFF A;  2FOT A;  1QX2 A;  1YR5 A;  1B1G A;  2K7C A;  1QS7 A;  3PN7 B;  1DJG A;  1K9P A;  2BBN A;  1PK0 D;  2LAN A;  4USL A;  4YBH B;  1IH0 A;  4ORA B;  1AJ5 A;  3BQ3 A;  1LIN A;  3CR4 X;  1E8A A;  1J7O A;  4CID A;  2M8U A;  1QLK A;  1QJT A;  1GJY A;  1XFW O;  1G33 A;  1NSH A;  2K8M B;  3DVM A;  5G08 A;  1YVL A;  3CR2 A;  1NUB A;  3SG5 A;  1GQM A;  1K94 A;  2BKH B;  3GK1 A;  1K8U A;  1DMO A;  1UHJ A;  2PRU A;  1K96 A;  1IQ3 A;  3SG2 A;  5AFP A;  1NX1 A;  4C0K A;  1KFU L;  1XVJ A;  2KGB C;  1J1E A;  1SCM B;  2EC6 C;  2LHI A;  2LVK A;  5HKZ A;  3KPX A;  4HRH A;  1DVI A;  1GGW A;  2LUX A;  1A75 A;  5DKQ A;  1J1D A;  1L2O C;  5AAN A;  5PAL A;  2F3Z A;  3MSE B;  3WXA A;  1LVC D;  1RFJ A;  2JT0 A;  1MXL C;  1NP8 A;  1ZMZ A;  2KFF A;  1CLL A;  2LV7 A;  4MZL A;  1JUO A;  2NLN A;  2BE6 A;  1YTZ C;  2HQW A;  3AKB A;  1KK7 Y;  4XJK B;  4PHN A;  4CFR A;  1OZS A;  1QX7 A;  3PN7 C;  1K2H A;  1F4O A;  3CGA A;  1PAL A;  5F6T A;  1AK8 A;  2KFH A;  5DKN A;  1IGV A;  1LKJ A;  1WY9 A;  2JC2 A;  2MBX A;  1X02 A;  1EL4 A;  4YGB B;  1OE9 B;  1BG1 A;  1MUX A;  1TTX A;  4GFT A;  1DJZ A;  2WCE A;  1UHK A;  1Y1X A;  2KYF A;  1DGV A;  1LA3 A;  1J7R A;  3BUM B;  2MA2 A;  1NWD A;  2OPO A;  4MRX A;  3BOW B;  3I5H B;  4PDZ A;  2JUL A;  1HT9 A;  2BE4 A;  4M2Q A;  2KGR A;  4FTG A;  1CLM A;  2I18 A;  1F54 A;  3O6B A;  1SCM C;  5I2O A;  4M2O A;  2EGD A;  5I2L A;  3C1V A;  5D7F A;  3LCP C;  1D1O A;  1YX8 A;  2K61 A;  1NYA A;  4E68 A;  2L98 A;  3TUY B;  1FW4 A;  4PE7 A;  2BL0 B;  1KFX L;  4GUK A;  3CWG A;  1FI6 A;  2CCM A;  5D69 A;  2K7B A;  4XJK A;  5I8N A;  2WCF A;  1EG4 A;  1QLS A;  1ZOT B;  2Y1N A;  5CSI A;  2KSP A;  5KTY A;  2KYC A;  1KK8 B;  2FCD A;  4QJ5 B;  3KHE A;  4WRI A;  3BUN B;  1NX2 A;  1UUS A;  1M31 A;  1Y1A A;  4F0Z B;  1BOD A;  4PHK A;  1EH2 A;  1QV0 A;  2LNK A;  2ZN9 A;  2HQ8 A;  2EHB A;  2H61 A;  4JQ0 D;  2Y1M A;  1SL8 A;  3KEV A;  2JRF A;  1K9K A;  1QAS A;  2H61 C;  1YX7 A;  1F4Q A;  1S36 A;  2PAS A;  5KU1 A;  1IJ6 A;  3SG6 A;  5CSF A;  4AQJ A;  1QVI Z;  3VRP A;  2KBI A;  4N1G A;  1XFV O;  3BOW A;  2Q4U A;  3WHU B;  3GK4 X;  2LLU A;  3I5H C;  1M39 A;  3NSO A;  1JFJ A;  2LMV A;  4OR9 B;  1KFU S;  4D1E A;  3LLE A;  1KK7 Z;  4NDC A;  1CDM A;  1Q80 A;  2LVV A;  1XFY O;  1DT7 B;  2F2P A;  3SIA A;  2KFG A;  3FWC A;  1CM4 A;  4MSP A;  2CXJ A;  1H8B A;  2WOR A;  5ER5 A;  1CM1 A;  3TDZ A;  1AJ4 A;  1TNW A;  1Y0V H;  2M97 A;  4YRU A;  1BF5 A;  3TUY C;  1XYD A;  2BL0 C;  2I7A A;  3I5F B;  4CFQ A;  1H4B A;  2NCP A;  2KOT A;  1CLB A;  4GNK B;  2H2K A;  4YGE B;  3IF7 A;  1KK8 C;  4DCK A;  2M1U A;  5GQQ C;  1UHH A;  2LLT A;  3EK4 A;  1ODB A;  2KI4 B;  2L51 A;  2O60 A;  1TN4 A;  3PM8 A;  1NIW A;  1JSA A;  2KDH A;  3E3R A;  3OX5 A;  2VRG A;  2K2F A;  1XFU O;  1C7V A;  1MR8 A;  4CPV A;  1YUU A;  2K0J A;  4MEW A;  1B8C A;  4ORB B;  2DOQ A;  3CS1 A;  3CTN A;  2BEC A;  1SL7 A;  1JC2 A;  2JT8 A;  4GPL B;  2HET A;  3AAJ A;  3SG3 A;  2CT9 A;  1V1F A;  2LVI A;  1ZUZ A;  3A8R A;  2Y5I A;  2QPT A;  1U5I B;  1RJV A;  1DJH A;  3IQQ A;  1QVI Y;  3O78 A;  1EXR A;  1S5G Y;  3BUX B;  1CMG A;  3EVV A;  2LP2 A;  4YI8 A;  1KCY A;  5FYX A;  1BR1 B;  3EVU A;  4DS7 A;  1FI5 A;  1FBV A;  1CMF A;  1KQV A;  1Y1U A;  4MZK A;  3D10 A;  1CB1 A;  1AUI B;  1KFX S;  2JU0 A;  1C07 A;  2PMY A;  1BJF A;  2KQY A;  3I5F C;  2JQ6 A;  2L0P A;  1ZFS A;  4YI9 A;  1W7I B;  3JVT B;  1QAT A;  2M3W A;  1WRK A;  1SRA A;  1YRT B;  2AAO A;  3KF9 A;  1BOC A;  2Y4Q A;  2M49 B;  1N0Y A;  3CZT X;  4PAL A;  1CDN A;  1MF8 B;  1TIZ A;  2LVJ A;  2KI4 C;  4YGD B;  2WOS A;  1LA0 A;  2F33 A;  1B8R A;  2LC5 A;  4PCW A;  2Q91 A;  1DTL A;  1C7W A;  1UHN A;  3AKA A;  1TCO B;  1B7T Y;  1SL9 A;  2ZFD A;  2LCP A;  2O5G A;  1V1G A;  4YGC B;  3VRN A;  1G4Y R;  2B1U A;  1U5I A;  3O4Y A;  1B4C A;  1OMR A;  2I2R E;  2M1K B;  2D8N A;  3D0Y B;  3LL8 B;  4GGN A;  1WDC B;  4HSZ A;  1KSM A;  1YRU B;  5HKY A;  3CR5 X;  1A4P A;  3VRR A;  2ZRT A;  3BUO B;  1F8H A;  3OB2 B;  4C0L A;  2WC8 A;  1DF0 B;  5BPJ A;  3VGO A;  3ICB A;  1PVB A;  1CDP A;  2KQ6 A;  3DD4 A;  2AMI A;  1DJX A;  3PSR A;  1B9A A;  1OMD A;  2K7D A;  3EK8 A;  2L4I A;  2E6W A;  1B47 A;  3JVT C;  4ETO A;  4MN0 A;  2GGM A;  4OCI A;  1KWO B;  3IQO A;  2PSR A;  4I5N B;  4QJ3 B;  3SG7 A;  1JF0 A;  4OV2 A;  1M63 B;  1PRW A;  1OQP A;  1XFZ O;  4M2P A;  1JBA A;  1A29 A;  1WLZ A;  1BR4 B;  2KHN A;  2GV5 A;  2OTG B;  4JWQ A;  2JTT A;  2LE9 B;  4N1F A;  1S5G Z;  3CLN A;  3EKH A;  4GGF C;  2LLS A;  2MLF C;  2MJW B;  1PVA A;  4U8D A;  4WQ3 A;  3ZNI A;  3SJS A;  2IS9 A;  3ZWH A;  1NX3 A;  3FIA A;  1SMG A;  1SR6 B;  1ALV A;  1B8L A;  3PAT A;  1K93 D;  3DF0 B;  1UP5 A;  2ZNE A;  2ISD A;  4PE0 A;  1AVS A;  5AER A;  3M0W A;  4YGA A;  2PAL A;  1XA5 A;  2WND A;  3BUW B;  3D0Y A;  4MZJ A;  3RM1 A;  1TNX A;  4UPG A;  3BXK A;  1VRK A;  2WCB A;  1DJY A;  2R2I A;  4HRE E;  1TOP A;  1ZAC A;  1WDC C; 
#chains in the Genus database with same CATH topology
 2NXQ A;  3BFB A;  3FE8 A;  1K95 A;  4INW A;  3DVE A;  4NQG A;  1DF0 A;  3DVK A;  3D76 A;  4MVF A;  3I5G B;  1MWN A;  3TZ1 A;  1MHO A;  3I5I B;  1W7J B;  3NSL A;  2K7O A;  3OB1 B;  3AAK A;  1S1E A;  1RWY A;  1B7T Z;  2M9G A;  3EVR A;  1R2U A;  3OP0 A;  4OKH A;  1IJ5 A;  3NSI A;  3D75 A;  1GGZ A;  1PSR A;  2P6B B;  1L7Z A;  2KI6 C;  4TNC A;  4A4C A;  1ALW A;  1KWO C;  5DKR A;  5HYD A;  1OOJ A;  5KSZ A;  2AUC A;  1M45 A;  2COL B;  1AP4 A;  3FWB A;  4PHJ A;  4DRW A;  1IG5 A;  2WCM A;  3S0F A;  1QX5 B;  3PLF B;  4I5L B;  1K90 D;  2OTG C;  2QAC A;  1NPQ A;  3FE9 A;  4N5X A;  3IVT A;  1BLQ A;  1DJW A;  1M46 A;  1J7Q A;  1SKT A;  3OX6 A;  1SK6 D;  1WRZ A;  2JXL A;  1G8I A;  1K9U A;  2I94 A;  3L4A A;  3LK0 A;  3DF0 A;  4C0J A;  2JNF A;  1SR6 C;  2F8P A;  1OOH A;  4GAO A;  4OVN F;  2MAZ A;  4XYN A;  2JNX A;  2NCO A;  3NXA A;  2HPS A;  1NCX A;  1YVH A;  1IIO A;  2F2O A;  2M0R A;  1BU3 A;  1YUT A;  1DEL A;  1BMO A;  4MRY A;  3TS5 B;  4R1E A;  3JTD B;  1F55 A;  4AOM A;  4HRG A;  2KAX A;  3VB1 A;  5K89 A;  1FPW A;  3K21 A;  1RTP 1;  1LXF C;  4IL1 A;  1QV1 A;  1HQV A;  4ICB A;  3S0D A;  2BCX A;  1DGU A;  2LMT A;  4ZCU A;  1CTR A;  3I5G C;  1TNP A;  3EKJ A;  2PVB A;  1QIV A;  4PHM A;  2ZND A;  3I5I C;  1MQ1 A;  1WLM A;  1R6P A;  2CTN A;  2M29 A;  3O2P A;  2LM5 A;  3HCM A;  5JOL A;  2JOJ A;  2OS8 B;  1N2D A;  3O4X A;  2FCE A;  2JT3 A;  3HX4 A;  2FJU B;  1N65 A;  4QJ4 B;  5B8I B;  5J3X A;  4A4B A;  3TDI A;  2M7L A;  5TNC A;  1S6I A;  1BT6 A;  2SAS A;  2KI6 D;  4DIR A;  1OW4 A;  2JWW A;  2KNE A;  1PUL A;  1YUS A;  1KQM B;  1KSO A;  4BY4 A;  1XO5 A;  2GGZ A;  2LAP A;  5CSJ A;  3V2L A;  1CKK A;  1TCF A;  1PSB A;  4PE1 A;  5IBW A;  2BCB A;  2LMU A;  1OOG A;  2E30 A;  4GBA A;  5EL2 A;  1P28 A;  4INX A;  1RRO A;  3DZT A;  1QXP A;  5I94 A;  1SBJ A;  1IRJ A;  4NDD A;  1SW8 A;  4L9M A;  1UUR A;  1S26 D;  4P5O E;  5HKW A;  1YUR A;  3PAL A;  1OZO A;  1WRL A;  3RLZ A;  3BYA A;  2BKI B;  3SS3 A;  5AXI A;  3TS5 C;  3TDU A;  2ZN8 A;  1IKU A;  3JTD C;  4I5K A;  3S0A A;  1CNP A;  2WCK A;  2BBM A;  4JPZ B;  2M7N A;  1CFC A;  1NCY A;  1S3P A;  5AEQ A;  1SNL A;  1IQ5 A;  1SCV A;  3F45 A;  3VRQ A;  4BY5 A;  2WCL A;  2ZRS A;  2LUC A;  1TNQ A;  1OSA A;  4DUQ A;  2G2B A;  3QME A;  2JZI A;  3PFV A;  1F71 A;  2MHH A;  3H4S E;  5JJG A;  3DVJ A;  3SG4 A;  1JFK A;  4I5J A;  4CLN A;  5FI6 A;  1EG3 A;  2A4J A;  2F3Y A;  1S6C A;  4MLW A;  2G9B A;  2OS8 C;  5G08 A;  5I2Q A;  1A03 A;  4AQI A;  4WQ2 A;  2JXC A;  1NCZ A;  1CFP A;  4GGF A;  1J55 A;  2CNP A;  2L50 A;  2SCP A;  1J7P A;  2ZKM X;  4NDB A;  3UO9 A;  3R1O A;  2JTZ A;  2FJY A;  1UHI A;  3SIB A;  1KQM C;  2BCA A;  3A4U B;  4PE4 A;  1TRF A;  3GOF A;  3LK1 A;  1IWQ A;  4Q04 A;  3WNX B;  2CBL A;  3FS7 A;  3R1P A;  1NX0 A;  1XFX O;  4P2Y B;  2RGI A;  1S6J A;  5HL1 A;  1A2X A;  5CSN A;  2LP3 A;  2K2A A;  1Y6W A;  4ORC B;  4ZCV A;  1XK4 A;  5HLO A;  5D3O A;  3NSK A;  3R1V A;  1MXE A;  1CDL A;  2WC5 A;  4FQO A;  2NZ0 A;  5ER4 X;  1XK4 C;  1CFD A;  1FF1 A;  1QIW A;  3EK7 A;  1REC A;  1RK9 A;  1SYM A;  2EC6 B;  3QRX A;  1DJI A;  1SY9 A;  5FI2 A;  1OMV A;  3Q8I A;  1UWO A;  1EJ3 A;  2L4H A;  2JPT A;  3VRO A;  3S0G A;  1L2O B;  5HLV A;  2MRD A;  1JWD A;  1A75 B;  1ORG A;  1F70 A;  3BJH A;  3OHM B;  3GK2 A;  2L5X B;  2LHL A;  2MLE C;  3PM2 A;  4MBE A;  1QTX A;  2HF5 A;  2L2E A;  3KO0 A;  2KAV A;  3L47 A;  3WHT B;  2KAY A;  3NHT A;  1AHR A;  1Z2C B;  2V53 A;  1C3Z A;  1SPY A;  2KBM A;  2TN4 A;  3S0B A;  1JF2 A;  5CPV A;  1CFF A;  3RZS A;  1TUZ A;  2FOT A;  1QX2 A;  1YR5 A;  1B1G A;  2K7C A;  1QS7 A;  3PN7 B;  1DJG A;  1K9P A;  2BBN A;  1PK0 D;  3D73 A;  3BFH A;  2LAN A;  4USL A;  4YBH B;  1IH0 A;  4ORA B;  1AJ5 A;  3B88 A;  3BQ3 A;  1LIN A;  3CR4 X;  1E8A A;  1J7O A;  4CID A;  1Z4H A;  3D74 A;  1QWV A;  2M8U A;  1QLK A;  1QJT A;  1GJY A;  1XFW O;  1G33 A;  1NSH A;  2K8M B;  3DVM A;  3EG5 B;  1YVL A;  3CR2 A;  1NUB A;  3SG5 A;  1GQM A;  1K94 A;  2BKH B;  3CAB A;  3GK1 A;  1K8U A;  1DMO A;  1UHJ A;  2PRU A;  1K96 A;  1IQ3 A;  3SG2 A;  5AFP A;  1NX1 A;  2PQL A;  3SS5 A;  4C0K A;  1KFU L;  1XVJ A;  2KGB C;  1J1E A;  1SCM B;  2EC6 C;  2LHI A;  2LVK A;  5HKZ A;  3KPX A;  4HRH A;  1DVI A;  1GGW A;  2LUX A;  1A75 A;  5DKQ A;  3R72 A;  1J1D A;  1L2O C;  5AAN A;  5PAL A;  2F3Z A;  3MSE B;  5FI7 A;  1DEK A;  4KYN A;  3WXA A;  1LVC D;  1RFJ A;  2JT0 A;  1MXL C;  1NP8 A;  1ZMZ A;  2KFF A;  1CLL A;  2LV7 A;  4MZL A;  1JUO A;  2NLN A;  2BE6 A;  1YTZ C;  2HQW A;  3AKB A;  1KK7 Y;  4XJK B;  1TUJ A;  1LS8 A;  4PHN A;  4CFR A;  1OZS A;  1W9Z A;  1QX7 A;  3PN7 C;  1K2H A;  1F4O A;  3CGA A;  1PAL A;  2WC6 A;  5F6T A;  1AK8 A;  2KFH A;  5DKN A;  1IGV A;  1LKJ A;  1WY9 A;  2JC2 A;  2MBX A;  1X02 A;  1EL4 A;  4YGB B;  1OE9 B;  1BG1 A;  1MUX A;  1TTX A;  4GFT A;  1DJZ A;  2WCE A;  3OBV A;  1UHK A;  1Y1X A;  2KYF A;  3UNW A;  1DGV A;  3B7A A;  1LA3 A;  2JPO A;  1J7R A;  3BUM B;  2MA2 A;  1NWD A;  2OPO A;  4MRX A;  3BOW B;  3I5H B;  4PDZ A;  2JUL A;  1HT9 A;  2BE4 A;  4M2Q A;  2KGR A;  4FTG A;  1CLM A;  2I18 A;  1F54 A;  3O6B A;  1SCM C;  5I2O A;  2KLE A;  4M2O A;  2EGD A;  5I2L A;  2YGU A;  3C1V A;  3DXL A;  5D7F A;  3LCP C;  5DIC A;  1D1O A;  1YX8 A;  2K61 A;  1NYA A;  4E68 A;  3SS4 A;  2L98 A;  3TUY B;  3K1E A;  1FW4 A;  3B87 A;  4PE7 A;  2BL0 B;  1KFX L;  4GUK A;  3CWG A;  1FI6 A;  2CCM A;  5D69 A;  2K7B A;  4XJK A;  5I8N A;  2WCF A;  1EG4 A;  1QLS A;  1ZOT B;  2Y1N A;  5CSI A;  2KSP A;  5KTY A;  2KYC A;  1KK8 B;  2FCD A;  4QJ5 B;  3KHE A;  4WRI A;  3BUN B;  1NX2 A;  1UUS A;  1M31 A;  1Y1A A;  4F0Z B;  1BOD A;  2WCJ A;  4PHK A;  1EH2 A;  1QV0 A;  2LNK A;  2ZN9 A;  2HQ8 A;  2EHB A;  2H61 A;  4JQ0 D;  2Y1M A;  1SL8 A;  3KEV A;  2JRF A;  1K9K A;  1QAS A;  2H61 C;  1YX7 A;  1F4Q A;  1S36 A;  2PAS A;  5KU1 A;  4FQT A;  1IJ6 A;  3SG6 A;  5CSF A;  4AQJ A;  1QVI Z;  3VRP A;  3S0E A;  2KBI A;  4N1G A;  1XFV O;  3BOW A;  2Q4U A;  3WHU B;  3GK4 X;  2LLU A;  1T14 A;  3I5H C;  1M39 A;  3NSO A;  4IJ7 A;  1JFJ A;  2LMV A;  4OR9 B;  1KFU S;  4D1E A;  3LLE A;  1KK7 Z;  4NDC A;  1CDM A;  1Q80 A;  2LVV A;  1XFY O;  1DT7 B;  2F2P A;  3SIA A;  2KFG A;  3FWC A;  1CM4 A;  3FE6 A;  4MSP A;  2P70 A;  2GTE A;  2CXJ A;  1H8B A;  2QDI A;  2WOR A;  5ER5 A;  3CDN A;  1CM1 A;  3TDZ A;  1AJ4 A;  1TNW A;  1Y0V H;  2M97 A;  4YRU A;  1BF5 A;  2QEO A;  3TUY C;  1XYD A;  2BL0 C;  2I7A A;  3I5F B;  4CFQ A;  1H4B A;  2NCP A;  2KOT A;  1CLB A;  4GNK B;  2H2K A;  4YGE B;  3IF7 A;  1KK8 C;  4DCK A;  2M1U A;  5GQQ C;  1UHH A;  2LLT A;  3EK4 A;  1ODB A;  2KI4 B;  2L51 A;  2O60 A;  1TN4 A;  3PM8 A;  1NIW A;  1JSA A;  2KDH A;  3E3R A;  3OX5 A;  2VRG A;  2K2F A;  1XFU O;  1C7V A;  1MR8 A;  4CPV A;  1YUU A;  2K0J A;  4MEW A;  1B8C A;  4ORB B;  2DOQ A;  3CS1 A;  3CTN A;  2BEC A;  1SL7 A;  1JC2 A;  1XFR A;  3CZ0 A;  2JT8 A;  4JKT A;  3CYZ A;  4GPL B;  1SSE B;  2HET A;  3AAJ A;  3SG3 A;  2CT9 A;  2QEH A;  1V1F A;  2LVI A;  1ZUZ A;  2BAP A;  2Y5I A;  3A8R A;  2QPT A;  1OOF A;  1U5I B;  1RJV A;  1DJH A;  3D77 A;  3IQQ A;  1QVI Y;  2QEB A;  3O78 A;  1C3Y A;  3DYE A;  1EXR A;  1S5G Y;  1OOI X;  3BUX B;  1CMG A;  4F7F A;  3EVV A;  2LP2 A;  4YI8 A;  1KCY A;  3CZ2 A;  5FYX A;  1BR1 B;  3EVU A;  4DS7 A;  1FI5 A;  1FBV A;  1CMF A;  1KQV A;  1Y1U A;  4MZK A;  3D10 A;  1CB1 A;  1AUI B;  1KFX S;  2JU0 A;  2KLD A;  1C07 A;  2PMY A;  2BNX A;  3B6X A;  1BJF A;  2KQY A;  3I5F C;  2JQ6 A;  2L0P A;  1ZFS A;  4YI9 A;  3PJI A;  1W7I B;  3JVT B;  1QAT A;  2M3W A;  1WRK A;  1DC1 A;  1SRA A;  1YRT B;  2AAO A;  3KF9 A;  1BOC A;  2Y4Q A;  2M49 B;  2H8V A;  1N0Y A;  3CZT X;  4PAL A;  4OZD A;  1CDN A;  1MF8 B;  2PYQ A;  1TIZ A;  2LVJ A;  2KI4 C;  4PT1 A;  4YGD B;  2WOS A;  1DQE A;  1LA0 A;  2F33 A;  1B8R A;  2LC5 A;  4PCW A;  2Q91 A;  1DTL A;  1C7W A;  1UHN A;  3AKA A;  2WCH A;  1TCO B;  1B7T Y;  1SL9 A;  1TWO A;  2ZFD A;  2LCP A;  2O5G A;  3NHI A;  1V1G A;  4YGC B;  3VRN A;  1G4Y R;  2B1U A;  3NGV A;  1U5I A;  3O4Y A;  4JD9 A;  1B4C A;  1OMR A;  2I2R E;  2L5Y A;  3BFA A;  2M1K B;  2D8N A;  3D0Y B;  3LL8 B;  2P71 A;  4GGN A;  1WDC B;  4HSZ A;  1KSM A;  1YRU B;  3N7H A;  2L2C A;  5HKY A;  3CR5 X;  1A4P A;  2K60 A;  3VRR A;  3OGN A;  2ZRT A;  3BUO B;  1F8H A;  3OB2 B;  4C0L A;  2WC8 A;  1GM0 A;  1DF0 B;  5BPJ A;  3VGO A;  3ICB A;  1PVB A;  2QEV A;  1CDP A;  2KQ6 A;  3DD4 A;  1DJX A;  2AMI A;  3PSR A;  1B9A A;  1OMD A;  2K7D A;  3CZ1 A;  3EK8 A;  2L4I A;  2E6W A;  1B47 A;  3JVT C;  4ETO A;  4MN0 A;  2GGM A;  4OCI A;  1KWO B;  3IQO A;  2PSR A;  4I5N B;  4QJ3 B;  3SG7 A;  1JF0 A;  4OV2 A;  1M63 B;  1PRW A;  1OQP A;  1XFZ O;  4M2P A;  3DY9 A;  1JBA A;  1A29 A;  1WLZ A;  1BR4 B;  2KHN A;  2GV5 A;  2OTG B;  4JWQ A;  2JTT A;  2LE9 B;  3B86 A;  4N1F A;  1S5G Z;  3CLN A;  3EKH A;  4GGF C;  2LLS A;  2MLF C;  2MJW B;  1PVA A;  4U8D A;  4WQ3 A;  2ERB A;  3ZNI A;  3SJS A;  2IS9 A;  3ZWH A;  1NX3 A;  3FIA A;  1SMG A;  1SR6 B;  1ALV A;  1B8L A;  2KPH A;  3PAT A;  1K93 D;  3D78 A;  3DF0 B;  1UP5 A;  2ZNE A;  2ISD A;  4PE0 A;  1AVS A;  5AER A;  3M0W A;  4YGA A;  2PAL A;  1XA5 A;  2WND A;  3BUW B;  3D0Y A;  4MZJ A;  3RM1 A;  1TNX A;  4UPG A;  3BXK A;  1VRK A;  2WCB A;  1DJY A;  2R2I A;  4HRE E;  1TOP A;  1ZAC A;  1WDC C;  3L4L A; 
#chains in the Genus database with same CATH homology
 2NXQ A;  4NQG A;  1K95 A;  3DVE A;  1DF0 A;  3DVK A;  4MVF A;  3I5G B;  1MWN A;  3TZ1 A;  1MHO A;  3I5I B;  1W7J B;  3NSL A;  2K7O A;  3OB1 B;  3AAK A;  1S1E A;  1RWY A;  1B7T Z;  2M9G A;  3EVR A;  1R2U A;  3OP0 A;  4OKH A;  1IJ5 A;  3NSI A;  1GGZ A;  1PSR A;  2P6B B;  1L7Z A;  2KI6 C;  4TNC A;  4A4C A;  1ALW A;  1KWO C;  5DKR A;  5HYD A;  1OOJ A;  5KSZ A;  2AUC A;  1M45 A;  2COL B;  1AP4 A;  3FWB A;  4PHJ A;  4DRW A;  1IG5 A;  1QX5 B;  3PLF B;  4I5L B;  1K90 D;  2OTG C;  2QAC A;  1NPQ A;  4N5X A;  1BLQ A;  1DJW A;  1M46 A;  1J7Q A;  1SKT A;  3OX6 A;  1SK6 D;  1WRZ A;  2JXL A;  1G8I A;  1K9U A;  2I94 A;  3LK0 A;  3DF0 A;  4C0J A;  2JNF A;  1SR6 C;  2F8P A;  4GAO A;  4OVN F;  2MAZ A;  4XYN A;  2JNX A;  2NCO A;  3NXA A;  2HPS A;  1NCX A;  1YVH A;  2F2O A;  2M0R A;  1BU3 A;  1YUT A;  1BMO A;  4MRY A;  3TS5 B;  4R1E A;  3JTD B;  1F55 A;  4AOM A;  4HRG A;  2KAX A;  5K89 A;  1FPW A;  3K21 A;  1RTP 1;  1LXF C;  4IL1 A;  1QV1 A;  1HQV A;  4ICB A;  2BCX A;  1DGU A;  2LMT A;  4ZCU A;  1CTR A;  3I5G C;  1TNP A;  3EKJ A;  2PVB A;  1QIV A;  4PHM A;  2ZND A;  3I5I C;  1MQ1 A;  1WLM A;  1R6P A;  2CTN A;  2M29 A;  3O2P A;  2LM5 A;  3HCM A;  5JOL A;  2JOJ A;  2OS8 B;  1N2D A;  2FCE A;  2JT3 A;  3HX4 A;  2FJU B;  1N65 A;  4QJ4 B;  5B8I B;  5J3X A;  4A4B A;  3TDI A;  2M7L A;  5TNC A;  1S6I A;  1BT6 A;  2SAS A;  2KI6 D;  4DIR A;  2JWW A;  2KNE A;  1PUL A;  1YUS A;  1KQM B;  1KSO A;  4BY4 A;  1XO5 A;  2GGZ A;  2LAP A;  5CSJ A;  1CKK A;  1TCF A;  1PSB A;  4PE1 A;  5IBW A;  2BCB A;  2LMU A;  2E30 A;  4GBA A;  1RRO A;  1QXP A;  1SBJ A;  1IRJ A;  4NDD A;  1SW8 A;  4L9M A;  1UUR A;  1S26 D;  4P5O E;  5HKW A;  1YUR A;  3PAL A;  1OZO A;  1WRL A;  3RLZ A;  3BYA A;  2BKI B;  3TS5 C;  5AXI A;  3TDU A;  2ZN8 A;  1IKU A;  3JTD C;  4I5K A;  1CNP A;  2BBM A;  4JPZ B;  2M7N A;  1CFC A;  1NCY A;  1S3P A;  5AEQ A;  1SNL A;  1IQ5 A;  1SCV A;  3F45 A;  3VRQ A;  4BY5 A;  2ZRS A;  2LUC A;  1TNQ A;  1OSA A;  4DUQ A;  2G2B A;  2JZI A;  3PFV A;  1F71 A;  2MHH A;  3H4S E;  5JJG A;  3DVJ A;  3SG4 A;  1JFK A;  4I5J A;  4CLN A;  1EG3 A;  2A4J A;  2F3Y A;  1S6C A;  4MLW A;  2G9B A;  2OS8 C;  5I2Q A;  1A03 A;  4AQI A;  4WQ2 A;  2JXC A;  1NCZ A;  1CFP A;  4GGF A;  1J55 A;  2CNP A;  2L50 A;  2SCP A;  1J7P A;  2ZKM X;  4NDB A;  2JTZ A;  1UHI A;  3SIB A;  1KQM C;  2BCA A;  3A4U B;  4PE4 A;  1TRF A;  3GOF A;  3LK1 A;  1IWQ A;  4Q04 A;  3WNX B;  2CBL A;  3FS7 A;  1NX0 A;  1XFX O;  4P2Y B;  2RGI A;  1S6J A;  1A2X A;  5CSN A;  2LP3 A;  2K2A A;  1Y6W A;  4ORC B;  4ZCV A;  1XK4 A;  5HLO A;  3NSK A;  1MXE A;  1CDL A;  4FQO A;  2NZ0 A;  5ER4 X;  1XK4 C;  1CFD A;  1FF1 A;  1QIW A;  3EK7 A;  1REC A;  1RK9 A;  1SYM A;  2EC6 B;  3QRX A;  1DJI A;  1SY9 A;  1OMV A;  1UWO A;  1EJ3 A;  2L4H A;  2JPT A;  3VRO A;  1L2O B;  5HLV A;  2MRD A;  1JWD A;  1A75 B;  1F70 A;  3OHM B;  3GK2 A;  2L5X B;  2LHL A;  2MLE C;  4MBE A;  1QTX A;  2HF5 A;  2L2E A;  3KO0 A;  2KAV A;  3WHT B;  2KAY A;  1AHR A;  2V53 A;  1SPY A;  2KBM A;  2TN4 A;  1JF2 A;  5CPV A;  1CFF A;  2FOT A;  1QX2 A;  1YR5 A;  1B1G A;  2K7C A;  1QS7 A;  3PN7 B;  1DJG A;  1K9P A;  2BBN A;  1PK0 D;  2LAN A;  4USL A;  4YBH B;  1IH0 A;  4ORA B;  1AJ5 A;  3BQ3 A;  1LIN A;  3CR4 X;  1E8A A;  1J7O A;  4CID A;  2M8U A;  1QLK A;  1QJT A;  1GJY A;  1XFW O;  1G33 A;  1NSH A;  2K8M B;  3DVM A;  5G08 A;  1YVL A;  3CR2 A;  1NUB A;  3SG5 A;  1GQM A;  1K94 A;  2BKH B;  3GK1 A;  1K8U A;  1DMO A;  1UHJ A;  2PRU A;  1K96 A;  1IQ3 A;  3SG2 A;  5AFP A;  1NX1 A;  4C0K A;  1KFU L;  1XVJ A;  2KGB C;  1J1E A;  1SCM B;  2EC6 C;  2LHI A;  2LVK A;  5HKZ A;  3KPX A;  4HRH A;  1DVI A;  1GGW A;  2LUX A;  1A75 A;  5DKQ A;  1J1D A;  1L2O C;  5AAN A;  5PAL A;  2F3Z A;  3MSE B;  3WXA A;  1LVC D;  1RFJ A;  2JT0 A;  1MXL C;  1NP8 A;  1ZMZ A;  2KFF A;  1CLL A;  2LV7 A;  4MZL A;  1JUO A;  2NLN A;  2BE6 A;  1YTZ C;  2HQW A;  3AKB A;  1KK7 Y;  4XJK B;  4PHN A;  4CFR A;  1OZS A;  1QX7 A;  3PN7 C;  1K2H A;  1F4O A;  3CGA A;  1PAL A;  5F6T A;  1AK8 A;  2KFH A;  5DKN A;  1IGV A;  1LKJ A;  1WY9 A;  2JC2 A;  2MBX A;  1X02 A;  1EL4 A;  4YGB B;  1OE9 B;  1BG1 A;  1MUX A;  1TTX A;  4GFT A;  1DJZ A;  2WCE A;  1UHK A;  1Y1X A;  2KYF A;  1DGV A;  1LA3 A;  1J7R A;  3BUM B;  2MA2 A;  1NWD A;  2OPO A;  4MRX A;  3BOW B;  3I5H B;  4PDZ A;  2JUL A;  1HT9 A;  2BE4 A;  4M2Q A;  2KGR A;  4FTG A;  1CLM A;  2I18 A;  1F54 A;  3O6B A;  1SCM C;  5I2O A;  4M2O A;  2EGD A;  5I2L A;  3C1V A;  5D7F A;  3LCP C;  1D1O A;  1YX8 A;  2K61 A;  1NYA A;  4E68 A;  2L98 A;  3TUY B;  1FW4 A;  4PE7 A;  2BL0 B;  1KFX L;  4GUK A;  3CWG A;  1FI6 A;  2CCM A;  5D69 A;  2K7B A;  4XJK A;  5I8N A;  2WCF A;  1EG4 A;  1QLS A;  1ZOT B;  2Y1N A;  5CSI A;  2KSP A;  5KTY A;  2KYC A;  1KK8 B;  2FCD A;  4QJ5 B;  3KHE A;  4WRI A;  3BUN B;  1NX2 A;  1UUS A;  1M31 A;  1Y1A A;  4F0Z B;  1BOD A;  4PHK A;  1EH2 A;  1QV0 A;  2LNK A;  2ZN9 A;  2HQ8 A;  2EHB A;  2H61 A;  4JQ0 D;  2Y1M A;  1SL8 A;  3KEV A;  2JRF A;  1K9K A;  1QAS A;  2H61 C;  1YX7 A;  1F4Q A;  1S36 A;  2PAS A;  5KU1 A;  1IJ6 A;  3SG6 A;  5CSF A;  4AQJ A;  1QVI Z;  3VRP A;  2KBI A;  4N1G A;  1XFV O;  3BOW A;  2Q4U A;  3WHU B;  3GK4 X;  2LLU A;  3I5H C;  1M39 A;  3NSO A;  1JFJ A;  2LMV A;  4OR9 B;  1KFU S;  4D1E A;  3LLE A;  1KK7 Z;  4NDC A;  1CDM A;  1Q80 A;  2LVV A;  1XFY O;  1DT7 B;  2F2P A;  3SIA A;  2KFG A;  3FWC A;  1CM4 A;  4MSP A;  2CXJ A;  1H8B A;  2WOR A;  5ER5 A;  1CM1 A;  3TDZ A;  1AJ4 A;  1TNW A;  1Y0V H;  2M97 A;  4YRU A;  1BF5 A;  3TUY C;  1XYD A;  2BL0 C;  2I7A A;  3I5F B;  4CFQ A;  1H4B A;  2NCP A;  2KOT A;  1CLB A;  4GNK B;  2H2K A;  4YGE B;  3IF7 A;  1KK8 C;  4DCK A;  2M1U A;  5GQQ C;  1UHH A;  2LLT A;  3EK4 A;  1ODB A;  2KI4 B;  2L51 A;  2O60 A;  1TN4 A;  3PM8 A;  1NIW A;  1JSA A;  2KDH A;  3E3R A;  3OX5 A;  2VRG A;  2K2F A;  1XFU O;  1C7V A;  1MR8 A;  4CPV A;  1YUU A;  2K0J A;  4MEW A;  1B8C A;  4ORB B;  2DOQ A;  3CS1 A;  3CTN A;  2BEC A;  1SL7 A;  1JC2 A;  2JT8 A;  4GPL B;  2HET A;  3AAJ A;  3SG3 A;  2CT9 A;  1V1F A;  2LVI A;  1ZUZ A;  3A8R A;  2Y5I A;  2QPT A;  1U5I B;  1RJV A;  1DJH A;  3IQQ A;  1QVI Y;  3O78 A;  1EXR A;  1S5G Y;  3BUX B;  1CMG A;  3EVV A;  2LP2 A;  4YI8 A;  1KCY A;  5FYX A;  1BR1 B;  3EVU A;  4DS7 A;  1FI5 A;  1FBV A;  1CMF A;  1KQV A;  1Y1U A;  4MZK A;  3D10 A;  1CB1 A;  1AUI B;  1KFX S;  2JU0 A;  1C07 A;  2PMY A;  1BJF A;  2KQY A;  3I5F C;  2JQ6 A;  2L0P A;  1ZFS A;  4YI9 A;  1W7I B;  3JVT B;  1QAT A;  2M3W A;  1WRK A;  1SRA A;  1YRT B;  2AAO A;  3KF9 A;  1BOC A;  2Y4Q A;  2M49 B;  1N0Y A;  3CZT X;  4PAL A;  1CDN A;  1MF8 B;  1TIZ A;  2LVJ A;  2KI4 C;  4YGD B;  2WOS A;  1LA0 A;  2F33 A;  1B8R A;  2LC5 A;  4PCW A;  2Q91 A;  1DTL A;  1C7W A;  1UHN A;  3AKA A;  1TCO B;  1B7T Y;  1SL9 A;  2ZFD A;  2LCP A;  2O5G A;  1V1G A;  4YGC B;  3VRN A;  1G4Y R;  2B1U A;  1U5I A;  3O4Y A;  1B4C A;  1OMR A;  2I2R E;  2M1K B;  2D8N A;  3D0Y B;  3LL8 B;  4GGN A;  1WDC B;  4HSZ A;  1KSM A;  1YRU B;  5HKY A;  3CR5 X;  1A4P A;  3VRR A;  2ZRT A;  3BUO B;  1F8H A;  3OB2 B;  4C0L A;  2WC8 A;  1DF0 B;  5BPJ A;  3VGO A;  3ICB A;  1PVB A;  1CDP A;  2KQ6 A;  3DD4 A;  2AMI A;  1DJX A;  3PSR A;  1B9A A;  1OMD A;  2K7D A;  3EK8 A;  2L4I A;  2E6W A;  1B47 A;  3JVT C;  4ETO A;  4MN0 A;  2GGM A;  4OCI A;  1KWO B;  3IQO A;  2PSR A;  4I5N B;  4QJ3 B;  3SG7 A;  1JF0 A;  4OV2 A;  1M63 B;  1PRW A;  1OQP A;  1XFZ O;  4M2P A;  1JBA A;  1A29 A;  1WLZ A;  1BR4 B;  2KHN A;  2GV5 A;  2OTG B;  4JWQ A;  2JTT A;  2LE9 B;  4N1F A;  1S5G Z;  3CLN A;  3EKH A;  4GGF C;  2LLS A;  2MLF C;  2MJW B;  1PVA A;  4U8D A;  4WQ3 A;  3ZNI A;  3SJS A;  2IS9 A;  3ZWH A;  1NX3 A;  3FIA A;  1SMG A;  1SR6 B;  1ALV A;  1B8L A;  3PAT A;  1K93 D;  3DF0 B;  1UP5 A;  2ZNE A;  2ISD A;  4PE0 A;  1AVS A;  5AER A;  3M0W A;  4YGA A;  2PAL A;  1XA5 A;  2WND A;  3BUW B;  3D0Y A;  4MZJ A;  3RM1 A;  1TNX A;  4UPG A;  3BXK A;  1VRK A;  2WCB A;  1DJY A;  2R2I A;  4HRE E;  1TOP A;  1ZAC A;  1WDC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...