4OCIA

Crystal structure of calcium binding protein-5 from entamoeba histolytica and its involvement in initiation of phagocytosis of human erythrocytes
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
139
structure length
139
Chain Sequence
LKESFLLFDGDGDGYLTLNEFESLVRVLGVVMETSAIASTYNSNSKVRGMSYELFTSCFSQLKTKSFNKDEIKTAINVLDKDKKGFIPAIELRRILSTIGDNMEQKEITDLFTFMGIDEQGVVKVDDFINQDNHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Calmodulin, putative
publication title Crystal Structure of Calcium Binding Protein-5 from Entamoeba histolytica and Its Involvement in Initiation of Phagocytosis of Human Erythrocytes.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 46
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ociA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ociA01
4GNKB 1K93D 5AXIA 1QX7A 5B8IB 1PK0D 1MF8B 3D0YB 4ICBA 1J7OA 2ZKMX 1SYMA 2V53A 1QXPA 1YVLA 1CFCA 4OR9B 4YGDB 1EXRA 1NIWA 2KI6C 2M7NA 2M29A 1KQMC 2A4JA 2KBMA 3LK0A 1KQVA 1XA5A 2I7AA 2K2FA 1CDLA 5ER4X 3NSOA 1PSRA 1GJYA 4MRXA 2DOQA 1YURA 1XFXO 1QX2A 1B8CA 4QJ5B 1K94A 4DCKA 4R1EA 1U5IA 4N5XA 3I5FC 4U8DA 1SNLA 4YI8A 5J3XA 1WDCB 4HRHA 2WCEA 2LCPA 1AHRA 2BE4A 2BECA 1E8AA 1QVIY 2WCBA 2Q91A 1PRWA 3BOWA 4ORCB 4CLNA 1YUUA 1K9KA 2OS8C 2PMYA 1DGVA 1DJXA 1MQ1A 4CFQA 1XFZO 1WY9A 4AQJA 1Q80A 1Y6WA 4ETOA 1DJZA 3SG2A 4MZLA 2LLUA 1DT7B 3TDIA 1Y1AA 4ZCUA 1NX0A 5CSIA 3I5HB 5I2OA 1PALA 3RLZA 1SY9A 5I2LA 1CDMA 3SIAA 2LV7A 3O2PA 1TCFA 1YUSA 3I5GB 4QJ4B 4XJKB 1Y0VH 1LKJA 4YI9A 1NCZA 1IJ5A 2JNXA 3CR4X 1F55A 1NX2A 1SCVA 2K7BA 2Y4QA 2MRDA 2AAOA 2JOJA 1DJYA 2ZNDA 2BCAA 1K2HA 3CR5X 2MLFC 1FI6A 5HLVA 1XYDA 1K9PA 1EH2A 1W7JB 2OPOA 1QATA 3C1VA 2WCFA 2BCBA 1RK9A 4YGEB 1NP8A 1UP5A 2QPTA 1S6IA 4FTGA 1K8UA 1CFFA 1K95A 1NSHA 2LVIA 1AJ5A 1TIZA 3BUOB 3GOFA 1JSAA 1NYAA 1QS7A 2JZIA 2KSPA 1N65A 1UHNA 2KAXA 2LMVA 1OZSA 1IGVA 3BXKA 3DVJA 3OP0A 1CFPA 1RWYA 3SG3A 3KPXA 2LVKA 4ORAB 2EGDA 4MRYA 3BUNB 1RROA 2CBLA 4PHJA 2F2PA 2WORA 1OZOA 5HKYA 3GK4X 3OX6A 3A8RA 1MUXA 5D7FA 2E30A 3SIBA 1AK8A 1B4CA 1N2DA 1JFKA 4I5LB 4PE7A 1DGUA 1OOJA 4PE4A 5HYDA 1BOCA 1YX8A 3D10A 3ICBA 3LL8B 4C0JA 4NQGA 2FOTA 1LINA 4IL1A 2ZRTA 3ZWHA 5I2QA 3I5IC 5HLOA 1TNPA 3F45A 1DJHA 4MBEA 1CKKA 2LLTA 3DD4A 1FW4A 4TNCA 1EJ3A 1TNQA 2K7DA 3BUMB 1UWOA 2F2OA 2L50A 1B47A 5CSNA 1SW8A 2L4HA 1BF5A 2QACA 4GGNA 2KGRA 1TNXA 1ALWA 2JT3A 1S36A 2KI6D 2LMUA 3EK7A 3HCMA 1BODA 2KNEA 4MLWA 1LA0A 1F8HA 1TN4A 2M9GA 1FF1A 1AUIB 3AKAA 2ZFDA 3DF0A 2LNKA 1A75B 2OTGB 5JJGA 1IRJA 1LVCD 5F6TA 2JWWA 4C0KA 1K96A 5HKWA 1OMDA 1QVIZ 3I5HC 4GGFC 4M2OA 2KGBC 3CS1A 5KU1A 5GQQC 4UPGA 1BG1A 1VRKA 2L98A 4NDDA 4YGCB 3PFVA 2CNPA 4FQOA 3IQQA 1G8IA 2KQ6A 3I5GC 1JFJA 1J1EA 1OMVA 4A4BA 1AP4A 3KEVA 3TZ1A 2NLNA 1KFUS 2SCPA 3I5IB 4MN0A 4GFTA 2FCDA 3IF7A 1G33A 1KSMA 4JWQA 4YGBB 1Y1XA 2PASA 1ODBA 1M63B 4MEWA 1QJTA 1PVAA 1XFYO 2GGMA 4PALA 1YRUB 5BPJA 2KDHA 1JUOA 4GBAA 2H61C 1R6PA 1IWQA 2JTTA 3VRRA 2F3YA 3O78A 1ZMZA 1XO5A 3CGAA 1GGWA 1JWDA 5DKRA 1A03A 2L0PA 2LLSA 4HREE 2PSRA 3ZNIA 2K0JA 1CLMA 2WNDA 3PALA 1QV1A 2NXQA 1KWOB 1CMGA 1FPWA 2M0RA 4MVFA 1UURA 2IS9A 4I5KA 3BUWB 4HSZA 4PHKA 4PE1A 1CMFA 1B8RA 1MXEA 1WLMA 2VRGA 2O60A 1SCMB 1R2UA 1ZUZA 1NX1A 2FJUB 2JRFA 4NDBA 2KAVA 4C0LA 4I5JA 1S6CA 1F4QA 3GK1A 3EVUA 3MSEB 1N0YA 3FIAA 2M7LA 4WRIA 1M31A 3QRXA 1GGZA 1QLSA 2HPSA 1F70A 2LHLA 1YVHA 2KI4C 4AOMA 1B8LA 1SBJA 1V1GA 2JXCA 1OMRA 1H4BA 3BUXB 1U5IB 4F0ZB 1CLBA 1SKTA 2LP2A 1JF2A 2AUCA 2G9BA 1CDNA 1BLQA 1MWNA 5ER5A 1KK7Y 2EC6B 1XK4C 2Q4UA 1JF0A 3BOWB 2Y1MA 1SL7A 4CPVA 2F8PA 1B7TY 1HQVA 1CM4A 5K89A 1J7PA 2BE6A 1X02A 5AERA 1J1DA 1L2OB 2OTGC 1C7VA 4GAOA 1NPQA 1CFDA 2CCMA 4PDZA 1S5GZ 1YUTA 2R2IA 3WHTB 2LP3A 4PHMA 2M1KB 1AJ4A 5JOLA 2I18A 1DF0A 2L51A 3CR2A 4DIRA 5AANA 2AMIA 4YRUA 2P6BB 1WRZA 4MSPA 1M39A 1XFWO 3VRNA 3AAKA 4M2PA 3PSRA 3DVEA 4WQ2A 4AQIA 2K7OA 2ZNEA 2PVBA 3CLNA 3NSLA 4OVNF 5DKNA 1QTXA 2KI4B 1C07A 1GQMA 3OHMB 2JNFA 1DJWA 1KSOA 2Y1NA 3D0YA 1OQPA 3O6BA 1S5GY 1L7ZA 4BY5A 2CTNA 2Y5IA 2ZRSA 1TTXA 1A2XA 3PM8A 1SL8A 1UHHA 4OKHA 2LE9B 2G2BA 1QX5B 1KWOC 1KFUL 3H4SE 1XVJA 4USLA 1DJGA 4YBHB 4HRGA 1CM1A 3OX5A 2KYFA 1NCXA 1HT9A 3TDUA 3NSKA 1SCMC 1YR5A 3TUYB 2KHNA 4I5NB 1UHKA 4E68A 1IQ3A 3M0WA 1F71A 3SJSA 1FI5A 2M1UA 2JQ6A 3EVRA 1TNWA 2JU0A 1SR6B 2I2RE 3SG7A 2KBIA 4DRWA 1BJFA 5G08A 3TS5B 1ZACA 1S6JA 2F33A 2HETA 1DMOA 3WXAA 1C7WA 1W7IB 5KSZA 2L2EA 4GGFA 1QV0A 1YTZC 1RFJA 3OB1B 3JVTC 2LC5A 2LUCA 2LVVA 3HX4A 4XJKA 2L5XB 2EC6C 3NXAA 1NCYA 1K90D 1SL9A 3A4UB 3DVMA 3K21A 2GGZA 3FWBA 1CLLA 3DF0B 4DS7A 4JPZB 2BL0C 1PVBA 2ZN8A 4MZKA 1L2OC 4P2YB 3CWGA 1ZOTB 1KK7Z 3PN7C 1B1GA 3LK1A 2ZN9A 2MHHA 2LVJA 1B9AA 4M2QA 2WOSA 2K7CA 1B7TZ 2HQ8A 4GUKA 4N1GA 1J7QA 5AEQA 1CB1A 2H61A 2KYCA 2M3WA 1JC2A 3LLEA 1TCOB 5PALA 2NZ0A 3CTNA 2LHIA 1RECA 1WLZA 2JT8A 1XFVO 3E3RA 2CT9A 2ISDA 3RM1A 2I94A 3OB2B 4Q04A 2HF5A 1KK8C 1DJIA 1H8BA 3WNXB 3TDZA 1A4PA 1LXFC 5CSJA 1UHJA 2BBMA 2KQYA 1J7RA 1ZFSA 3JVTB 5TNCA 1IQ5A 3WHUB 2HQWA 4PE0A 1DTLA 2KFFA 3EK4A 1JBAA 4OV2A 1KFXL 4XYNA 4P5OE 1AVSA 1G4YR 2M49B 3PATA 2JULA 1M46A 4ORBB 5FYXA 4L9MA 3KO0A 1MXLC 2BL0B 3DVKA 3LCPC 1KQMB 2M8UA 2KAYA 2EHBA 3PN7B 2F3ZA 3VRPA 1KFXS 1RJVA 1S26D 4QJ3B 2MAZA 1PSBA 1YX7A 1SPYA 1XFUO 1J55A 3VRQA 4D1EA 3SG5A 1BU3A 3I5FB 4NDCA 2LANA 1QLKA 2GV5A 4CIDA 3VGOA 2MJWB 1XK4A 3EKJA 5D69A 4DUQA 2FCEA 3SG4A 2JT0A 1TRFA 1BMOA 2BBNA 4MZJA 2BKIB 3TUYC 1DVIA 1EG4A 2MA2A 4CFRA 2OS8B 3KF9A 2MLEC 2PALA 1IKUA 3FS7A 1A75A 1V1FA 3KHEA 1A29A 1SR6C 1TOPA 1RTP1 1KK8B 3JTDC 2MBXA 1KCYA 1LA3A 2LAPA 3BQ3A 2CXJA 3TS5C 1QIWA 1CNPA 1WRKA 2KOTA 4JQ0D 5IBWA 1D1OA 5KTYA 1UHIA 3O4YA 4A4CA 3EK8A 2NCPA 4N1FA 2K8MB 1PULA 1BR4B 4PCWA 1SMGA 4GPLB 2BKHB 1SK6D 2KFGA 1QASA 2BCXA 2PRUA 3AAJA 2LM5A 3EVVA 3GK2A 4OCIA 2O5GA 5HKZA 2JTZA 1CDPA 1NWDA 1ALVA 5AFPA 1NUBA 2K2AA 3NSIA 5DKQA 3VROA 2LMTA 1YRTB 1OSAA 3PLFB 1CTRA 1WRLA 1F54A 1QIVA 4ZCVA 4BY4A 2WC8A 1S1EA 1BT6A 5I8NA 1BR1B 2NCOA 2H2KA 4YGAA 2JC2A 5CSFA 2JXLA 1DF0B 3CZTX 2B1UA 1NX3A 1K9UA 3EKHA 3FWCA 1OE9B 2D8NA 4PHNA 2M97A 1IH0A 2SASA 1WDCC 2L4IA 2TN4A 2LUXA 3SG6A 1IJ6A 2COLB 3BYAA 3IQOA 3JTDB 4WQ3A 1Y1UA 1MR8A 1EL4A 1F4OA 2KFHA 1EG3A 1MHOA 5CPVA 2E6WA 1M45A 2JPTA 1SRAA 1FBVA 2K61A 1IG5A 1UUSA 2RGIA 3AKBA 1S3PA
chains in the Genus database with same CATH superfamily
4GNKB 1K93D 5AXIA 1QX7A 3CYZA 5B8IB 2ERBA 1PK0D 1MF8B 3D0YB 4ICBA 1C3ZA 5DICA 4JD9A 1J7OA 2ZKMX 1SYMA 2V53A 1QXPA 1YVLA 1CFCA 3L4LA 4OR9B 4YGDB 1EXRA 1NIWA 2KI6C 2M7NA 3NHTA 5I94A 2M29A 1KQMC 2A4JA 2KBMA 3OBVA 3LK0A 1DEKA 1XA5A 1KQVA 2I7AA 3O4XA 2K2FA 1CDLA 3QMEA 5ER4X 3NSOA 1PSRA 1GJYA 4MRXA 2DOQA 1YURA 1XFXO 1QX2A 1B8CA 4QJ5B 1K94A 4DCKA 4R1EA 1U5IA 4N5XA 3I5FC 4U8DA 3CABA 1SNLA 4YI8A 2FJYA 5J3XA 1WDCB 4HRHA 2WCEA 2LCPA 1AHRA 2BE4A 2BECA 1E8AA 1QVIY 2P70A 2Q91A 1PRWA 3BOWA 4ORCB 4CLNA 1YUUA 1K9KA 2OS8C 2PMYA 1DGVA 1DJXA 1MQ1A 3V2LA 3CZ1A 4CFQA 1XFZO 1WY9A 4AQJA 1Q80A 1Y6WA 4ETOA 1DJZA 3SG2A 4MZLA 2LLUA 4F7FA 3TDIA 1Y1AA 1DT7B 4ZCUA 1NX0A 5CSIA 3I5HB 5I2OA 1PALA 3RLZA 1SY9A 1XFRA 5I2LA 1QWVA 1CDMA 3SIAA 1OW4A 2LV7A 3O2PA 1TCFA 1YUSA 5FI6A 3I5GB 4QJ4B 4XJKB 1Y0VH 1LKJA 4YI9A 1TUZA 1NCZA 1IJ5A 2JNXA 3CR4X 1F55A 1NX2A 1SCVA 3R1VA 2K7BA 2Y4QA 2MRDA 3B88A 2AAOA 3S0DA 2JOJA 3CZ0A 1DJYA 2ZNDA 2BCAA 2KLEA 3CR5X 1K2HA 2MLFC 1FI6A 5HLVA 1XYDA 1K9PA 1EH2A 3B6XA 1W7JB 1Z2CB 2OPOA 1QATA 3C1VA 2WCFA 2BCBA 1RK9A 3R1PA 4YGEB 1NP8A 1UP5A 2QPTA 1S6IA 1ORGA 4FTGA 1K8UA 1CFFA 1K95A 1NSHA 2LVIA 1AJ5A 1TIZA 3BUOB 3GOFA 1JSAA 1NYAA 1QS7A 2JZIA 2KSPA 1N65A 1UHNA 2KAXA 2LMVA 1OZSA 1IGVA 3BXKA 3DVJA 2QEHA 3OP0A 1CFPA 1RWYA 3SG3A 3KPXA 2LVKA 4ORAB 2EGDA 4MRYA 3BUNB 1RROA 3DXLA 2CBLA 4PHJA 3BFBA 2F2PA 2WORA 3S0BA 1OZOA 5HKYA 3GK4X 3OX6A 3A8RA 1DC1A 1MUXA 5D7FA 2E30A 3SIBA 1AK8A 1B4CA 1N2DA 1JFKA 4I5LB 4PE7A 1DGUA 1OOJA 1P28A 4PE4A 5HYDA 1BOCA 1YX8A 3D10A 3ICBA 3LL8B 4C0JA 4NQGA 2FOTA 1LINA 4IL1A 2ZRTA 3ZWHA 5I2QA 3I5IC 5HLOA 1TNPA 3FE9A 3F45A 1DJHA 4MBEA 1CKKA 2LLTA 3DD4A 1FW4A 4TNCA 1EJ3A 1TNQA 2K7DA 3BUMB 1UWOA 2F2OA 1W9ZA 2L50A 3S0AA 1B47A 5CSNA 3DZTA 1SW8A 3SS4A 2L4HA 1BF5A 2QACA 4GGNA 2KGRA 1TNXA 1ALWA 2JT3A 1S36A 2KI6D 2LMUA 3EK7A 3HCMA 1BODA 2KNEA 4MLWA 1LA0A 1F8HA 3CDNA 1TN4A 2M9GA 1FF1A 1AUIB 3AKAA 2ZFDA 3DF0A 2LNKA 1A75B 2OTGB 2H8VA 1SSEB 5JJGA 1IRJA 1LVCD 5F6TA 2JWWA 2WCLA 3D78A 4C0KA 1K96A 5HKWA 1OMDA 2QEBA 1QVIZ 3I5HC 4GGFC 4M2OA 2KGBC 3CS1A 5KU1A 5GQQC 4UPGA 1BG1A 1VRKA 2L98A 4NDDA 4YGCB 3PFVA 2CNPA 4FQOA 3IQQA 1G8IA 2KQ6A 3I5GC 1JFJA 1J1EA 1OMVA 4A4BA 1AP4A 3KEVA 3TZ1A 2JPOA 2KLDA 2NLNA 1KFUS 2SCPA 3I5IB 4MN0A 4GFTA 2FCDA 3IF7A 1G33A 1KSMA 4JWQA 4YGBB 1Y1XA 2PASA 1ODBA 1M63B 4MEWA 1QJTA 1PVAA 1XFYO 2GGMA 4PALA 1YRUB 5BPJA 2KDHA 1JUOA 4GBAA 2H61C 3CZ2A 1R6PA 1IWQA 2JTTA 3VRRA 2F3YA 3O78A 1ZMZA 1XO5A 3CGAA 1GGWA 1JWDA 5DKRA 1A03A 2L0PA 2LLSA 4HREE 2PSRA 3ZNIA 2K0JA 1CLMA 2WNDA 3PALA 1QV1A 3D77A 3D74A 2NXQA 1KWOB 1CMGA 1FPWA 2M0RA 4MVFA 1UURA 2IS9A 4I5KA 3BUWB 4HSZA 4PHKA 4PE1A 1CMFA 1B8RA 1MXEA 1WLMA 2GTEA 2VRGA 2P71A 2O60A 3DY9A 1SCMB 1R2UA 1ZUZA 1NX1A 2FJUB 3NGVA 2JRFA 4NDBA 2KAVA 4JKTA 4I5JA 4C0LA 1OOGA 1S6CA 1F4QA 3GK1A 3EVUA 3MSEB 1N0YA 3PM2A 2WC5A 3FIAA 4KYNA 4WRIA 2M7LA 1M31A 3B7AA 1GGZA 1QLSA 3QRXA 2HPSA 1F70A 2LHLA 1YVHA 2KI4C 4AOMA 1B8LA 1SBJA 1V1GA 2JXCA 1OMRA 1H4BA 3BUXB 1U5IB 4F0ZB 1CLBA 1SKTA 2LP2A 1JF2A 2AUCA 2G9BA 1CDNA 1BLQA 1MWNA 5ER5A 1KK7Y 2EC6B 1XK4C 2Q4UA 1JF0A 3BOWB 2Y1MA 1SL7A 4CPVA 2F8PA 5EL2A 1B7TY 1HQVA 1CM4A 1OOIX 5K89A 2BE6A 1J7PA 1X02A 2WCMA 5AERA 1J1DA 1L2OB 2OTGC 1C7VA 4GAOA 2BNXA 5HL1A 1NPQA 1CFDA 2CCMA 4PDZA 1S5GZ 1YUTA 2R2IA 3WHTB 2LP3A 4PHMA 2M1KB 1AJ4A 5JOLA 2I18A 1DF0A 2L51A 3CR2A 4DIRA 5AANA 2AMIA 4YRUA 2P6BB 1WRZA 4MSPA 3S0EA 3SS3A 1M39A 1IIOA 1XFWO 3VRNA 3AAKA 4M2PA 3PSRA 3DVEA 2KPHA 4WQ2A 4AQIA 2K7OA 2ZNEA 2PVBA 3CLNA 3NSLA 4OVNF 5DKNA 1QTXA 5FI7A 2KI4B 1C07A 1GQMA 3OHMB 2JNFA 3NHIA 1DJWA 3S0FA 3D73A 1KSOA 2WCHA 2Y1NA 3D0YA 2K60A 1OQPA 3O6BA 1S5GY 1L7ZA 4BY5A 3D76A 2CTNA 2Y5IA 2ZRSA 1TTXA 1A2XA 3PM8A 1SL8A 1UHHA 4OKHA 3RZSA 2LE9B 2G2BA 3D75A 1QX5B 3SS5A 1KWOC 1KFUL 3H4SE 1XVJA 3L4AA 4USLA 1DJGA 4YBHB 4HRGA 1CM1A 4OZDA 3OX5A 1Z4HA 1NCXA 1HT9A 2KYFA 3NSKA 3TDUA 1SCMC 1YR5A 2WCJA 3TUYB 2KHNA 4I5NB 1UHKA 4E68A 1IQ3A 3M0WA 1F71A 3SJSA 1FI5A 2M1UA 2JQ6A 3EVRA 1TNWA 2JU0A 1SR6B 2I2RE 5D3OA 3SG7A 2KBIA 3DYEA 4DRWA 4IJ7A 1BJFA 5G08A 3TS5B 1ZACA 1S6JA 2F33A 2HETA 1DMOA 3WXAA 1C7WA 1W7IB 5KSZA 2L2EA 4GGFA 1QV0A 1YTZC 3UO9A 1RFJA 3OB1B 3EG5B 3JVTC 2LC5A 3B87A 2LUCA 2LVVA 3HX4A 3N7HA 4XJKA 2L5XB 2EC6C 3NXAA 3B86A 1LS8A 1K90D 1NCYA 1SL9A 3A4UB 3DVMA 1TWOA 3K21A 2GGZA 3FWBA 1CLLA 3DF0B 4DS7A 4JPZB 2BL0C 1PVBA 3L47A 2ZN8A 4MZKA 1L2OC 4P2YB 3CWGA 1ZOTB 1KK7Z 3PN7C 1B1GA 2L2CA 3LK1A 2ZN9A 2MHHA 2LVJA 1B9AA 3VB1A 4M2QA 2WOSA 2K7CA 1B7TZ 2HQ8A 1OOHA 4GUKA 4N1GA 1J7QA 5AEQA 1CB1A 2H61A 2KYCA 2M3WA 1JC2A 3LLEA 1T14A 1TCOB 5PALA 2NZ0A 3CTNA 2LHIA 1RECA 1WLZA 2JT8A 1XFVO 3E3RA 2CT9A 2ISDA 3RM1A 2I94A 3OB2B 4Q04A 2HF5A 1KK8C 1DJIA 2PQLA 1H8BA 3WNXB 3S0GA 3TDZA 1A4PA 1LXFC 5CSJA 1UHJA 2BBMA 2KQYA 1J7RA 1ZFSA 4INWA 3JVTB 5TNCA 1IQ5A 3WHUB 2HQWA 3BFAA 3Q8IA 4PE0A 1DTLA 2KFFA 3EK4A 3OGNA 4OV2A 1JBAA 1KFXL 1DQEA 4XYNA 4P5OE 1AVSA 1G4YR 2M49B 3PATA 2JULA 1M46A 3FE8A 4ORBB 5FYXA 4L9MA 3KO0A 1MXLC 4PT1A 2BL0B 1OOFA 2WCBA 3DVKA 3LCPC 1KQMB 2M8UA 3BFHA 2KAYA 2EHBA 3PN7B 2F3ZA 3VRPA 1KFXS 1RJVA 1S26D 4QJ3B 4FQTA 2QEVA 2MAZA 1PSBA 1YX7A 1SPYA 1XFUO 1J55A 3VRQA 4D1EA 3SG5A 1BU3A 1GM0A 3I5FB 1C3YA 4NDCA 2LANA 1QLKA 2GV5A 4CIDA 3VGOA 2L5YA 1XK4A 2MJWB 3EKJA 5D69A 2FCEA 2QEOA 3SG4A 4DUQA 2JT0A 1TRFA 1BMOA 2BBNA 4MZJA 2BKIB 3TUYC 1DVIA 1EG4A 2MA2A 4CFRA 2OS8B 3KF9A 2MLEC 2PALA 1IKUA 3FS7A 1A75A 1V1FA 3KHEA 1A29A 1SR6C 1TOPA 1RTP1 1KK8B 3BJHA 3JTDC 5FI2A 2MBXA 1KCYA 3K1EA 1LA3A 2LAPA 3BQ3A 2CXJA 3TS5C 1QIWA 1CNPA 1WRKA 2KOTA 4JQ0D 5IBWA 1D1OA 5KTYA 1DELA 1UHIA 3O4YA 4A4CA 3EK8A 2NCPA 1TUJA 2PYQA 4N1FA 2K8MB 1PULA 1BR4B 2QDIA 4PCWA 3UNWA 1SMGA 3PJIA 4GPLB 2BKHB 4INXA 1SK6D 2KFGA 1QASA 2BCXA 2PRUA 3AAJA 2LM5A 3EVVA 3GK2A 4OCIA 2O5GA 5HKZA 2JTZA 1CDPA 1NWDA 1ALVA 5AFPA 1NUBA 2K2AA 3IVTA 3NSIA 5DKQA 3VROA 2LMTA 1YRTB 1OSAA 3PLFB 1CTRA 1WRLA 1F54A 1QIVA 2BAPA 4ZCVA 4BY4A 2WC8A 1S1EA 1BT6A 5I8NA 1BR1B 2NCOA 2H2KA 4YGAA 2JC2A 5CSFA 2JXLA 1DF0B 3CZTX 2B1UA 3R72A 1NX3A 3R1OA 2YGUA 1K9UA 3EKHA 3FWCA 1OE9B 2D8NA 2WCKA 2M97A 4PHNA 1IH0A 2SASA 1WDCC 2L4IA 2TN4A 2LUXA 3SG6A 1IJ6A 2COLB 3BYAA 3IQOA 3JTDB 4WQ3A 1Y1UA 1MR8A 1EL4A 1F4OA 2KFHA 1EG3A 1MHOA 5CPVA 2E6WA 1M45A 2JPTA 2WC6A 1SRAA 1FBVA 2K61A 1IG5A 1UUSA 2RGIA 3AKBA 3FE6A 1S3PA
chains in the Genus database with same CATH topology
4GNKB 1K93D 5AXIA 1QX7A 5B8IB 1PK0D 1MF8B 3D0YB 4ICBA 1J7OA 2ZKMX 1SYMA 2V53A 1QXPA 1YVLA 1CFCA 4OR9B 4YGDB 1EXRA 1NIWA 2KI6C 2M7NA 2M29A 1KQMC 2A4JA 2KBMA 3LK0A 1KQVA 1XA5A 2I7AA 2K2FA 1CDLA 5ER4X 3NSOA 1PSRA 1GJYA 4MRXA 2DOQA 1YURA 1XFXO 1QX2A 1B8CA 4QJ5B 1K94A 4DCKA 4R1EA 1U5IA 4N5XA 3I5FC 4U8DA 1SNLA 4YI8A 5J3XA 1WDCB 4HRHA 2WCEA 2LCPA 1AHRA 2BE4A 2BECA 1E8AA 1QVIY 2WCBA 2Q91A 1PRWA 3BOWA 4ORCB 4CLNA 1YUUA 1K9KA 2OS8C 2PMYA 1DGVA 1DJXA 1MQ1A 4CFQA 1XFZO 1WY9A 4AQJA 1Q80A 1Y6WA 4ETOA 1DJZA 3SG2A 4MZLA 2LLUA 1DT7B 3TDIA 1Y1AA 4ZCUA 1NX0A 5CSIA 3I5HB 5I2OA 1PALA 3RLZA 1SY9A 5I2LA 1CDMA 3SIAA 2LV7A 3O2PA 1TCFA 1YUSA 3I5GB 4QJ4B 4XJKB 1Y0VH 1LKJA 4YI9A 1NCZA 1IJ5A 2JNXA 3CR4X 1F55A 1NX2A 1SCVA 2K7BA 2Y4QA 2MRDA 2AAOA 2JOJA 1DJYA 2ZNDA 2BCAA 1K2HA 3CR5X 2MLFC 1FI6A 5HLVA 1XYDA 1K9PA 1EH2A 1W7JB 2OPOA 1QATA 3C1VA 2WCFA 2BCBA 1RK9A 4YGEB 1NP8A 1UP5A 2QPTA 1S6IA 4FTGA 1K8UA 1CFFA 1K95A 1NSHA 2LVIA 1AJ5A 1TIZA 3BUOB 3GOFA 1JSAA 1NYAA 1QS7A 2JZIA 2KSPA 1N65A 1UHNA 2KAXA 2LMVA 1OZSA 1IGVA 3BXKA 3DVJA 3OP0A 1CFPA 1RWYA 3SG3A 3KPXA 2LVKA 4ORAB 2EGDA 4MRYA 3BUNB 1RROA 2CBLA 4PHJA 2F2PA 2WORA 1OZOA 5HKYA 3GK4X 3OX6A 3A8RA 1MUXA 5D7FA 2E30A 3SIBA 1AK8A 1B4CA 1N2DA 1JFKA 4I5LB 4PE7A 1DGUA 1OOJA 4PE4A 5HYDA 1BOCA 1YX8A 3D10A 3ICBA 3LL8B 4C0JA 4NQGA 2FOTA 1LINA 4IL1A 2ZRTA 3ZWHA 5I2QA 3I5IC 5HLOA 1TNPA 3F45A 1DJHA 4MBEA 1CKKA 2LLTA 3DD4A 1FW4A 4TNCA 1EJ3A 1TNQA 2K7DA 3BUMB 1UWOA 2F2OA 2L50A 1B47A 5CSNA 1SW8A 2L4HA 1BF5A 2QACA 4GGNA 2KGRA 1TNXA 1ALWA 2JT3A 1S36A 2KI6D 2LMUA 3EK7A 3HCMA 1BODA 2KNEA 4MLWA 1LA0A 1F8HA 1TN4A 2M9GA 1FF1A 1AUIB 3AKAA 2ZFDA 3DF0A 2LNKA 1A75B 2OTGB 5JJGA 1IRJA 1LVCD 5F6TA 2JWWA 4C0KA 1K96A 5HKWA 1OMDA 1QVIZ 3I5HC 4GGFC 4M2OA 2KGBC 3CS1A 5KU1A 5GQQC 4UPGA 1BG1A 1VRKA 2L98A 4NDDA 4YGCB 3PFVA 2CNPA 4FQOA 3IQQA 1G8IA 2KQ6A 3I5GC 1JFJA 1J1EA 1OMVA 4A4BA 1AP4A 3KEVA 3TZ1A 2NLNA 1KFUS 2SCPA 3I5IB 4MN0A 4GFTA 2FCDA 3IF7A 1G33A 1KSMA 4JWQA 4YGBB 1Y1XA 2PASA 1ODBA 1M63B 4MEWA 1QJTA 1PVAA 1XFYO 2GGMA 4PALA 1YRUB 5BPJA 2KDHA 1JUOA 4GBAA 2H61C 1R6PA 1IWQA 2JTTA 3VRRA 2F3YA 3O78A 1ZMZA 1XO5A 3CGAA 1GGWA 1JWDA 5DKRA 1A03A 2L0PA 2LLSA 4HREE 2PSRA 3ZNIA 2K0JA 1CLMA 2WNDA 3PALA 1QV1A 2NXQA 1KWOB 1CMGA 1FPWA 2M0RA 4MVFA 1UURA 2IS9A 4I5KA 3BUWB 4HSZA 4PHKA 4PE1A 1CMFA 1B8RA 1MXEA 1WLMA 2VRGA 2O60A 1SCMB 1R2UA 1ZUZA 1NX1A 2FJUB 2JRFA 4NDBA 2KAVA 4C0LA 4I5JA 1S6CA 1F4QA 3GK1A 3EVUA 3MSEB 1N0YA 3FIAA 2M7LA 4WRIA 1M31A 3QRXA 1GGZA 1QLSA 2HPSA 1F70A 2LHLA 1YVHA 2KI4C 4AOMA 1B8LA 1SBJA 1V1GA 2JXCA 1OMRA 1H4BA 3BUXB 1U5IB 4F0ZB 1CLBA 1SKTA 2LP2A 1JF2A 2AUCA 2G9BA 1CDNA 1BLQA 1MWNA 5ER5A 1KK7Y 2EC6B 1XK4C 2Q4UA 1JF0A 3BOWB 2Y1MA 1SL7A 4CPVA 2F8PA 1B7TY 1HQVA 1CM4A 5K89A 1J7PA 2BE6A 1X02A 5AERA 1J1DA 1L2OB 2OTGC 1C7VA 4GAOA 1NPQA 1CFDA 2CCMA 4PDZA 1S5GZ 1YUTA 2R2IA 3WHTB 2LP3A 4PHMA 2M1KB 1AJ4A 5JOLA 2I18A 1DF0A 2L51A 3CR2A 4DIRA 5AANA 2AMIA 4YRUA 2P6BB 1WRZA 4MSPA 1M39A 1XFWO 3VRNA 3AAKA 4M2PA 3PSRA 3DVEA 4WQ2A 4AQIA 2K7OA 2ZNEA 2PVBA 3CLNA 3NSLA 4OVNF 5DKNA 1QTXA 2KI4B 1C07A 1GQMA 3OHMB 2JNFA 1DJWA 1KSOA 2Y1NA 3D0YA 1OQPA 3O6BA 1S5GY 1L7ZA 4BY5A 2CTNA 2Y5IA 2ZRSA 1TTXA 1A2XA 3PM8A 1SL8A 1UHHA 4OKHA 2LE9B 2G2BA 1QX5B 1KWOC 1KFUL 3H4SE 1XVJA 4USLA 1DJGA 4YBHB 4HRGA 1CM1A 3OX5A 2KYFA 1NCXA 1HT9A 3TDUA 3NSKA 1SCMC 1YR5A 3TUYB 2KHNA 4I5NB 1UHKA 4E68A 1IQ3A 3M0WA 1F71A 3SJSA 1FI5A 2M1UA 2JQ6A 3EVRA 1TNWA 2JU0A 1SR6B 2I2RE 3SG7A 2KBIA 4DRWA 1BJFA 5G08A 3TS5B 1ZACA 1S6JA 2F33A 2HETA 1DMOA 3WXAA 1C7WA 1W7IB 5KSZA 2L2EA 4GGFA 1QV0A 1YTZC 1RFJA 3OB1B 3JVTC 2LC5A 2LUCA 2LVVA 3HX4A 4XJKA 2L5XB 2EC6C 3NXAA 1NCYA 1K90D 1SL9A 3A4UB 3DVMA 3K21A 2GGZA 3FWBA 1CLLA 3DF0B 4DS7A 4JPZB 2BL0C 1PVBA 2ZN8A 4MZKA 1L2OC 4P2YB 3CWGA 1ZOTB 1KK7Z 3PN7C 1B1GA 3LK1A 2ZN9A 2MHHA 2LVJA 1B9AA 4M2QA 2WOSA 2K7CA 1B7TZ 2HQ8A 4GUKA 4N1GA 1J7QA 5AEQA 1CB1A 2H61A 2KYCA 2M3WA 1JC2A 3LLEA 1TCOB 5PALA 2NZ0A 3CTNA 2LHIA 1RECA 1WLZA 2JT8A 1XFVO 3E3RA 2CT9A 2ISDA 3RM1A 2I94A 3OB2B 4Q04A 2HF5A 1KK8C 1DJIA 1H8BA 3WNXB 3TDZA 1A4PA 1LXFC 5CSJA 1UHJA 2BBMA 2KQYA 1J7RA 1ZFSA 3JVTB 5TNCA 1IQ5A 3WHUB 2HQWA 4PE0A 1DTLA 2KFFA 3EK4A 1JBAA 4OV2A 1KFXL 4XYNA 4P5OE 1AVSA 1G4YR 2M49B 3PATA 2JULA 1M46A 4ORBB 5FYXA 4L9MA 3KO0A 1MXLC 2BL0B 3DVKA 3LCPC 1KQMB 2M8UA 2KAYA 2EHBA 3PN7B 2F3ZA 3VRPA 1KFXS 1RJVA 1S26D 4QJ3B 2MAZA 1PSBA 1YX7A 1SPYA 1XFUO 1J55A 3VRQA 4D1EA 3SG5A 1BU3A 3I5FB 4NDCA 2LANA 1QLKA 2GV5A 4CIDA 3VGOA 2MJWB 1XK4A 3EKJA 5D69A 4DUQA 2FCEA 3SG4A 2JT0A 1TRFA 1BMOA 2BBNA 4MZJA 2BKIB 3TUYC 1DVIA 1EG4A 2MA2A 4CFRA 2OS8B 3KF9A 2MLEC 2PALA 1IKUA 3FS7A 1A75A 1V1FA 3KHEA 1A29A 1SR6C 1TOPA 1RTP1 1KK8B 3JTDC 2MBXA 1KCYA 1LA3A 2LAPA 3BQ3A 2CXJA 3TS5C 1QIWA 1CNPA 1WRKA 2KOTA 4JQ0D 5IBWA 1D1OA 5KTYA 1UHIA 3O4YA 4A4CA 3EK8A 2NCPA 4N1FA 2K8MB 1PULA 1BR4B 4PCWA 1SMGA 4GPLB 2BKHB 1SK6D 2KFGA 1QASA 2BCXA 2PRUA 3AAJA 2LM5A 3EVVA 3GK2A 4OCIA 2O5GA 5HKZA 2JTZA 1CDPA 1NWDA 1ALVA 5AFPA 1NUBA 2K2AA 3NSIA 5DKQA 3VROA 2LMTA 1YRTB 1OSAA 3PLFB 1CTRA 1WRLA 1F54A 1QIVA 4ZCVA 4BY4A 2WC8A 1S1EA 1BT6A 5I8NA 1BR1B 2NCOA 2H2KA 4YGAA 2JC2A 5CSFA 2JXLA 1DF0B 3CZTX 2B1UA 1NX3A 1K9UA 3EKHA 3FWCA 1OE9B 2D8NA 4PHNA 2M97A 1IH0A 2SASA 1WDCC 2L4IA 2TN4A 2LUXA 3SG6A 1IJ6A 2COLB 3BYAA 3IQOA 3JTDB 4WQ3A 1Y1UA 1MR8A 1EL4A 1F4OA 2KFHA 1EG3A 1MHOA 5CPVA 2E6WA 1M45A 2JPTA 1SRAA 1FBVA 2K61A 1IG5A 1UUSA 2RGIA 3AKBA 1S3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNK B;  1K93 D;  5AXI A;  1QX7 A;  5B8I B;  1PK0 D;  1MF8 B;  3D0Y B;  4ICB A;  1J7O A;  2ZKM X;  1SYM A;  2V53 A;  1QXP A;  1YVL A;  1CFC A;  4OR9 B;  4YGD B;  1EXR A;  1NIW A;  2KI6 C;  2M7N A;  2M29 A;  1KQM C;  2A4J A;  2KBM A;  3LK0 A;  1KQV A;  1XA5 A;  2I7A A;  2K2F A;  1CDL A;  5ER4 X;  3NSO A;  1PSR A;  1GJY A;  4MRX A;  2DOQ A;  1YUR A;  1XFX O;  1QX2 A;  1B8C A;  4QJ5 B;  1K94 A;  4DCK A;  4R1E A;  1U5I A;  4N5X A;  3I5F C;  4U8D A;  1SNL A;  4YI8 A;  5J3X A;  1WDC B;  4HRH A;  2WCE A;  2LCP A;  1AHR A;  2BE4 A;  2BEC A;  1E8A A;  1QVI Y;  2WCB A;  2Q91 A;  1PRW A;  3BOW A;  4ORC B;  4CLN A;  1YUU A;  1K9K A;  2OS8 C;  2PMY A;  1DGV A;  1DJX A;  1MQ1 A;  4CFQ A;  1XFZ O;  1WY9 A;  4AQJ A;  1Q80 A;  1Y6W A;  4ETO A;  1DJZ A;  3SG2 A;  4MZL A;  2LLU A;  1DT7 B;  3TDI A;  1Y1A A;  4ZCU A;  1NX0 A;  5CSI A;  3I5H B;  5I2O A;  1PAL A;  3RLZ A;  1SY9 A;  5I2L A;  1CDM A;  3SIA A;  2LV7 A;  3O2P A;  1TCF A;  1YUS A;  3I5G B;  4QJ4 B;  4XJK B;  1Y0V H;  1LKJ A;  4YI9 A;  1NCZ A;  1IJ5 A;  2JNX A;  3CR4 X;  1F55 A;  1NX2 A;  1SCV A;  2K7B A;  2Y4Q A;  2MRD A;  2AAO A;  2JOJ A;  1DJY A;  2ZND A;  2BCA A;  1K2H A;  3CR5 X;  2MLF C;  1FI6 A;  5HLV A;  1XYD A;  1K9P A;  1EH2 A;  1W7J B;  2OPO A;  1QAT A;  3C1V A;  2WCF A;  2BCB A;  1RK9 A;  4YGE B;  1NP8 A;  1UP5 A;  2QPT A;  1S6I A;  4FTG A;  1K8U A;  1CFF A;  1K95 A;  1NSH A;  2LVI A;  1AJ5 A;  1TIZ A;  3BUO B;  3GOF A;  1JSA A;  1NYA A;  1QS7 A;  2JZI A;  2KSP A;  1N65 A;  1UHN A;  2KAX A;  2LMV A;  1OZS A;  1IGV A;  3BXK A;  3DVJ A;  3OP0 A;  1CFP A;  1RWY A;  3SG3 A;  3KPX A;  2LVK A;  4ORA B;  2EGD A;  4MRY A;  3BUN B;  1RRO A;  2CBL A;  4PHJ A;  2F2P A;  2WOR A;  1OZO A;  5HKY A;  3GK4 X;  3OX6 A;  3A8R A;  1MUX A;  5D7F A;  2E30 A;  3SIB A;  1AK8 A;  1B4C A;  1N2D A;  1JFK A;  4I5L B;  4PE7 A;  1DGU A;  1OOJ A;  4PE4 A;  5HYD A;  1BOC A;  1YX8 A;  3D10 A;  3ICB A;  3LL8 B;  4C0J A;  4NQG A;  2FOT A;  1LIN A;  4IL1 A;  2ZRT A;  3ZWH A;  5I2Q A;  3I5I C;  5HLO A;  1TNP A;  3F45 A;  1DJH A;  4MBE A;  1CKK A;  2LLT A;  3DD4 A;  1FW4 A;  4TNC A;  1EJ3 A;  1TNQ A;  2K7D A;  3BUM B;  1UWO A;  2F2O A;  2L50 A;  1B47 A;  5CSN A;  1SW8 A;  2L4H A;  1BF5 A;  2QAC A;  4GGN A;  2KGR A;  1TNX A;  1ALW A;  2JT3 A;  1S36 A;  2KI6 D;  2LMU A;  3EK7 A;  3HCM A;  1BOD A;  2KNE A;  4MLW A;  1LA0 A;  1F8H A;  1TN4 A;  2M9G A;  1FF1 A;  1AUI B;  3AKA A;  2ZFD A;  3DF0 A;  2LNK A;  1A75 B;  2OTG B;  5JJG A;  1IRJ A;  1LVC D;  5F6T A;  2JWW A;  4C0K A;  1K96 A;  5HKW A;  1OMD A;  1QVI Z;  3I5H C;  4GGF C;  4M2O A;  2KGB C;  3CS1 A;  5KU1 A;  5GQQ C;  4UPG A;  1BG1 A;  1VRK A;  2L98 A;  4NDD A;  4YGC B;  3PFV A;  2CNP A;  4FQO A;  3IQQ A;  1G8I A;  2KQ6 A;  3I5G C;  1JFJ A;  1J1E A;  1OMV A;  4A4B A;  1AP4 A;  3KEV A;  3TZ1 A;  2NLN A;  1KFU S;  2SCP A;  3I5I B;  4MN0 A;  4GFT A;  2FCD A;  3IF7 A;  1G33 A;  1KSM A;  4JWQ A;  4YGB B;  1Y1X A;  2PAS A;  1ODB A;  1M63 B;  4MEW A;  1QJT A;  1PVA A;  1XFY O;  2GGM A;  4PAL A;  1YRU B;  5BPJ A;  2KDH A;  1JUO A;  4GBA A;  2H61 C;  1R6P A;  1IWQ A;  2JTT A;  3VRR A;  2F3Y A;  3O78 A;  1ZMZ A;  1XO5 A;  3CGA A;  1GGW A;  1JWD A;  5DKR A;  1A03 A;  2L0P A;  2LLS A;  4HRE E;  2PSR A;  3ZNI A;  2K0J A;  1CLM A;  2WND A;  3PAL A;  1QV1 A;  2NXQ A;  1KWO B;  1CMG A;  1FPW A;  2M0R A;  4MVF A;  1UUR A;  2IS9 A;  4I5K A;  3BUW B;  4HSZ A;  4PHK A;  4PE1 A;  1CMF A;  1B8R A;  1MXE A;  1WLM A;  2VRG A;  2O60 A;  1SCM B;  1R2U A;  1ZUZ A;  1NX1 A;  2FJU B;  2JRF A;  4NDB A;  2KAV A;  4C0L A;  4I5J A;  1S6C A;  1F4Q A;  3GK1 A;  3EVU A;  3MSE B;  1N0Y A;  3FIA A;  2M7L A;  4WRI A;  1M31 A;  3QRX A;  1GGZ A;  1QLS A;  2HPS A;  1F70 A;  2LHL A;  1YVH A;  2KI4 C;  4AOM A;  1B8L A;  1SBJ A;  1V1G A;  2JXC A;  1OMR A;  1H4B A;  3BUX B;  1U5I B;  4F0Z B;  1CLB A;  1SKT A;  2LP2 A;  1JF2 A;  2AUC A;  2G9B A;  1CDN A;  1BLQ A;  1MWN A;  5ER5 A;  1KK7 Y;  2EC6 B;  1XK4 C;  2Q4U A;  1JF0 A;  3BOW B;  2Y1M A;  1SL7 A;  4CPV A;  2F8P A;  1B7T Y;  1HQV A;  1CM4 A;  5K89 A;  1J7P A;  2BE6 A;  1X02 A;  5AER A;  1J1D A;  1L2O B;  2OTG C;  1C7V A;  4GAO A;  1NPQ A;  1CFD A;  2CCM A;  4PDZ A;  1S5G Z;  1YUT A;  2R2I A;  3WHT B;  2LP3 A;  4PHM A;  2M1K B;  1AJ4 A;  5JOL A;  2I18 A;  1DF0 A;  2L51 A;  3CR2 A;  4DIR A;  5AAN A;  2AMI A;  4YRU A;  2P6B B;  1WRZ A;  4MSP A;  1M39 A;  1XFW O;  3VRN A;  3AAK A;  4M2P A;  3PSR A;  3DVE A;  4WQ2 A;  4AQI A;  2K7O A;  2ZNE A;  2PVB A;  3CLN A;  3NSL A;  4OVN F;  5DKN A;  1QTX A;  2KI4 B;  1C07 A;  1GQM A;  3OHM B;  2JNF A;  1DJW A;  1KSO A;  2Y1N A;  3D0Y A;  1OQP A;  3O6B A;  1S5G Y;  1L7Z A;  4BY5 A;  2CTN A;  2Y5I A;  2ZRS A;  1TTX A;  1A2X A;  3PM8 A;  1SL8 A;  1UHH A;  4OKH A;  2LE9 B;  2G2B A;  1QX5 B;  1KWO C;  1KFU L;  3H4S E;  1XVJ A;  4USL A;  1DJG A;  4YBH B;  4HRG A;  1CM1 A;  3OX5 A;  2KYF A;  1NCX A;  1HT9 A;  3TDU A;  3NSK A;  1SCM C;  1YR5 A;  3TUY B;  2KHN A;  4I5N B;  1UHK A;  4E68 A;  1IQ3 A;  3M0W A;  1F71 A;  3SJS A;  1FI5 A;  2M1U A;  2JQ6 A;  3EVR A;  1TNW A;  2JU0 A;  1SR6 B;  2I2R E;  3SG7 A;  2KBI A;  4DRW A;  1BJF A;  5G08 A;  3TS5 B;  1ZAC A;  1S6J A;  2F33 A;  2HET A;  1DMO A;  3WXA A;  1C7W A;  1W7I B;  5KSZ A;  2L2E A;  4GGF A;  1QV0 A;  1YTZ C;  1RFJ A;  3OB1 B;  3JVT C;  2LC5 A;  2LUC A;  2LVV A;  3HX4 A;  4XJK A;  2L5X B;  2EC6 C;  3NXA A;  1NCY A;  1K90 D;  1SL9 A;  3A4U B;  3DVM A;  3K21 A;  2GGZ A;  3FWB A;  1CLL A;  3DF0 B;  4DS7 A;  4JPZ B;  2BL0 C;  1PVB A;  2ZN8 A;  4MZK A;  1L2O C;  4P2Y B;  3CWG A;  1ZOT B;  1KK7 Z;  3PN7 C;  1B1G A;  3LK1 A;  2ZN9 A;  2MHH A;  2LVJ A;  1B9A A;  4M2Q A;  2WOS A;  2K7C A;  1B7T Z;  2HQ8 A;  4GUK A;  4N1G A;  1J7Q A;  5AEQ A;  1CB1 A;  2H61 A;  2KYC A;  2M3W A;  1JC2 A;  3LLE A;  1TCO B;  5PAL A;  2NZ0 A;  3CTN A;  2LHI A;  1REC A;  1WLZ A;  2JT8 A;  1XFV O;  3E3R A;  2CT9 A;  2ISD A;  3RM1 A;  2I94 A;  3OB2 B;  4Q04 A;  2HF5 A;  1KK8 C;  1DJI A;  1H8B A;  3WNX B;  3TDZ A;  1A4P A;  1LXF C;  5CSJ A;  1UHJ A;  2BBM A;  2KQY A;  1J7R A;  1ZFS A;  3JVT B;  5TNC A;  1IQ5 A;  3WHU B;  2HQW A;  4PE0 A;  1DTL A;  2KFF A;  3EK4 A;  1JBA A;  4OV2 A;  1KFX L;  4XYN A;  4P5O E;  1AVS A;  1G4Y R;  2M49 B;  3PAT A;  2JUL A;  1M46 A;  4ORB B;  5FYX A;  4L9M A;  3KO0 A;  1MXL C;  2BL0 B;  3DVK A;  3LCP C;  1KQM B;  2M8U A;  2KAY A;  2EHB A;  3PN7 B;  2F3Z A;  3VRP A;  1KFX S;  1RJV A;  1S26 D;  4QJ3 B;  2MAZ A;  1PSB A;  1YX7 A;  1SPY A;  1XFU O;  1J55 A;  3VRQ A;  4D1E A;  3SG5 A;  1BU3 A;  3I5F B;  4NDC A;  2LAN A;  1QLK A;  2GV5 A;  4CID A;  3VGO A;  2MJW B;  1XK4 A;  3EKJ A;  5D69 A;  4DUQ A;  2FCE A;  3SG4 A;  2JT0 A;  1TRF A;  1BMO A;  2BBN A;  4MZJ A;  2BKI B;  3TUY C;  1DVI A;  1EG4 A;  2MA2 A;  4CFR A;  2OS8 B;  3KF9 A;  2MLE C;  2PAL A;  1IKU A;  3FS7 A;  1A75 A;  1V1F A;  3KHE A;  1A29 A;  1SR6 C;  1TOP A;  1RTP 1;  1KK8 B;  3JTD C;  2MBX A;  1KCY A;  1LA3 A;  2LAP A;  3BQ3 A;  2CXJ A;  3TS5 C;  1QIW A;  1CNP A;  1WRK A;  2KOT A;  4JQ0 D;  5IBW A;  1D1O A;  5KTY A;  1UHI A;  3O4Y A;  4A4C A;  3EK8 A;  2NCP A;  4N1F A;  2K8M B;  1PUL A;  1BR4 B;  4PCW A;  1SMG A;  4GPL B;  2BKH B;  1SK6 D;  2KFG A;  1QAS A;  2BCX A;  2PRU A;  3AAJ A;  2LM5 A;  3EVV A;  3GK2 A;  4OCI A;  2O5G A;  5HKZ A;  2JTZ A;  1CDP A;  1NWD A;  1ALV A;  5AFP A;  1NUB A;  2K2A A;  3NSI A;  5DKQ A;  3VRO A;  2LMT A;  1YRT B;  1OSA A;  3PLF B;  1CTR A;  1WRL A;  1F54 A;  1QIV A;  4ZCV A;  4BY4 A;  2WC8 A;  1S1E A;  1BT6 A;  5I8N A;  1BR1 B;  2NCO A;  2H2K A;  4YGA A;  2JC2 A;  5CSF A;  2JXL A;  1DF0 B;  3CZT X;  2B1U A;  1NX3 A;  1K9U A;  3EKH A;  3FWC A;  1OE9 B;  2D8N A;  4PHN A;  2M97 A;  1IH0 A;  2SAS A;  1WDC C;  2L4I A;  2TN4 A;  2LUX A;  3SG6 A;  1IJ6 A;  2COL B;  3BYA A;  3IQO A;  3JTD B;  4WQ3 A;  1Y1U A;  1MR8 A;  1EL4 A;  1F4O A;  2KFH A;  1EG3 A;  1MHO A;  5CPV A;  2E6W A;  1M45 A;  2JPT A;  1SRA A;  1FBV A;  2K61 A;  1IG5 A;  1UUS A;  2RGI A;  3AKB A;  1S3P A; 
#chains in the Genus database with same CATH topology
 4GNK B;  1K93 D;  5AXI A;  1QX7 A;  3CYZ A;  5B8I B;  2ERB A;  1PK0 D;  1MF8 B;  3D0Y B;  4ICB A;  1C3Z A;  5DIC A;  4JD9 A;  1J7O A;  2ZKM X;  1SYM A;  2V53 A;  1QXP A;  1YVL A;  1CFC A;  3L4L A;  4OR9 B;  4YGD B;  1EXR A;  1NIW A;  2KI6 C;  2M7N A;  3NHT A;  5I94 A;  2M29 A;  1KQM C;  2A4J A;  2KBM A;  3OBV A;  3LK0 A;  1DEK A;  1XA5 A;  1KQV A;  2I7A A;  3O4X A;  2K2F A;  1CDL A;  3QME A;  5ER4 X;  3NSO A;  1PSR A;  1GJY A;  4MRX A;  2DOQ A;  1YUR A;  1XFX O;  1QX2 A;  1B8C A;  4QJ5 B;  1K94 A;  4DCK A;  4R1E A;  1U5I A;  4N5X A;  3I5F C;  4U8D A;  3CAB A;  1SNL A;  4YI8 A;  2FJY A;  5J3X A;  1WDC B;  4HRH A;  2WCE A;  2LCP A;  1AHR A;  2BE4 A;  2BEC A;  1E8A A;  1QVI Y;  2P70 A;  2Q91 A;  1PRW A;  3BOW A;  4ORC B;  4CLN A;  1YUU A;  1K9K A;  2OS8 C;  2PMY A;  1DGV A;  1DJX A;  1MQ1 A;  3V2L A;  3CZ1 A;  4CFQ A;  1XFZ O;  1WY9 A;  4AQJ A;  1Q80 A;  1Y6W A;  4ETO A;  1DJZ A;  3SG2 A;  4MZL A;  2LLU A;  4F7F A;  3TDI A;  1Y1A A;  1DT7 B;  4ZCU A;  1NX0 A;  5CSI A;  3I5H B;  5I2O A;  1PAL A;  3RLZ A;  1SY9 A;  1XFR A;  5I2L A;  1QWV A;  1CDM A;  3SIA A;  1OW4 A;  2LV7 A;  3O2P A;  1TCF A;  1YUS A;  5FI6 A;  3I5G B;  4QJ4 B;  4XJK B;  1Y0V H;  1LKJ A;  4YI9 A;  1TUZ A;  1NCZ A;  1IJ5 A;  2JNX A;  3CR4 X;  1F55 A;  1NX2 A;  1SCV A;  3R1V A;  2K7B A;  2Y4Q A;  2MRD A;  3B88 A;  2AAO A;  3S0D A;  2JOJ A;  3CZ0 A;  1DJY A;  2ZND A;  2BCA A;  2KLE A;  3CR5 X;  1K2H A;  2MLF C;  1FI6 A;  5HLV A;  1XYD A;  1K9P A;  1EH2 A;  3B6X A;  1W7J B;  1Z2C B;  2OPO A;  1QAT A;  3C1V A;  2WCF A;  2BCB A;  1RK9 A;  3R1P A;  4YGE B;  1NP8 A;  1UP5 A;  2QPT A;  1S6I A;  1ORG A;  4FTG A;  1K8U A;  1CFF A;  1K95 A;  1NSH A;  2LVI A;  1AJ5 A;  1TIZ A;  3BUO B;  3GOF A;  1JSA A;  1NYA A;  1QS7 A;  2JZI A;  2KSP A;  1N65 A;  1UHN A;  2KAX A;  2LMV A;  1OZS A;  1IGV A;  3BXK A;  3DVJ A;  2QEH A;  3OP0 A;  1CFP A;  1RWY A;  3SG3 A;  3KPX A;  2LVK A;  4ORA B;  2EGD A;  4MRY A;  3BUN B;  1RRO A;  3DXL A;  2CBL A;  4PHJ A;  3BFB A;  2F2P A;  2WOR A;  3S0B A;  1OZO A;  5HKY A;  3GK4 X;  3OX6 A;  3A8R A;  1DC1 A;  1MUX A;  5D7F A;  2E30 A;  3SIB A;  1AK8 A;  1B4C A;  1N2D A;  1JFK A;  4I5L B;  4PE7 A;  1DGU A;  1OOJ A;  1P28 A;  4PE4 A;  5HYD A;  1BOC A;  1YX8 A;  3D10 A;  3ICB A;  3LL8 B;  4C0J A;  4NQG A;  2FOT A;  1LIN A;  4IL1 A;  2ZRT A;  3ZWH A;  5I2Q A;  3I5I C;  5HLO A;  1TNP A;  3FE9 A;  3F45 A;  1DJH A;  4MBE A;  1CKK A;  2LLT A;  3DD4 A;  1FW4 A;  4TNC A;  1EJ3 A;  1TNQ A;  2K7D A;  3BUM B;  1UWO A;  2F2O A;  1W9Z A;  2L50 A;  3S0A A;  1B47 A;  5CSN A;  3DZT A;  1SW8 A;  3SS4 A;  2L4H A;  1BF5 A;  2QAC A;  4GGN A;  2KGR A;  1TNX A;  1ALW A;  2JT3 A;  1S36 A;  2KI6 D;  2LMU A;  3EK7 A;  3HCM A;  1BOD A;  2KNE A;  4MLW A;  1LA0 A;  1F8H A;  3CDN A;  1TN4 A;  2M9G A;  1FF1 A;  1AUI B;  3AKA A;  2ZFD A;  3DF0 A;  2LNK A;  1A75 B;  2OTG B;  2H8V A;  1SSE B;  5JJG A;  1IRJ A;  1LVC D;  5F6T A;  2JWW A;  2WCL A;  3D78 A;  4C0K A;  1K96 A;  5HKW A;  1OMD A;  2QEB A;  1QVI Z;  3I5H C;  4GGF C;  4M2O A;  2KGB C;  3CS1 A;  5KU1 A;  5GQQ C;  4UPG A;  1BG1 A;  1VRK A;  2L98 A;  4NDD A;  4YGC B;  3PFV A;  2CNP A;  4FQO A;  3IQQ A;  1G8I A;  2KQ6 A;  3I5G C;  1JFJ A;  1J1E A;  1OMV A;  4A4B A;  1AP4 A;  3KEV A;  3TZ1 A;  2JPO A;  2KLD A;  2NLN A;  1KFU S;  2SCP A;  3I5I B;  4MN0 A;  4GFT A;  2FCD A;  3IF7 A;  1G33 A;  1KSM A;  4JWQ A;  4YGB B;  1Y1X A;  2PAS A;  1ODB A;  1M63 B;  4MEW A;  1QJT A;  1PVA A;  1XFY O;  2GGM A;  4PAL A;  1YRU B;  5BPJ A;  2KDH A;  1JUO A;  4GBA A;  2H61 C;  3CZ2 A;  1R6P A;  1IWQ A;  2JTT A;  3VRR A;  2F3Y A;  3O78 A;  1ZMZ A;  1XO5 A;  3CGA A;  1GGW A;  1JWD A;  5DKR A;  1A03 A;  2L0P A;  2LLS A;  4HRE E;  2PSR A;  3ZNI A;  2K0J A;  1CLM A;  2WND A;  3PAL A;  1QV1 A;  3D77 A;  3D74 A;  2NXQ A;  1KWO B;  1CMG A;  1FPW A;  2M0R A;  4MVF A;  1UUR A;  2IS9 A;  4I5K A;  3BUW B;  4HSZ A;  4PHK A;  4PE1 A;  1CMF A;  1B8R A;  1MXE A;  1WLM A;  2GTE A;  2VRG A;  2P71 A;  2O60 A;  3DY9 A;  1SCM B;  1R2U A;  1ZUZ A;  1NX1 A;  2FJU B;  3NGV A;  2JRF A;  4NDB A;  2KAV A;  4JKT A;  4I5J A;  4C0L A;  1OOG A;  1S6C A;  1F4Q A;  3GK1 A;  3EVU A;  3MSE B;  1N0Y A;  3PM2 A;  2WC5 A;  3FIA A;  4KYN A;  4WRI A;  2M7L A;  1M31 A;  3B7A A;  1GGZ A;  1QLS A;  3QRX A;  2HPS A;  1F70 A;  2LHL A;  1YVH A;  2KI4 C;  4AOM A;  1B8L A;  1SBJ A;  1V1G A;  2JXC A;  1OMR A;  1H4B A;  3BUX B;  1U5I B;  4F0Z B;  1CLB A;  1SKT A;  2LP2 A;  1JF2 A;  2AUC A;  2G9B A;  1CDN A;  1BLQ A;  1MWN A;  5ER5 A;  1KK7 Y;  2EC6 B;  1XK4 C;  2Q4U A;  1JF0 A;  3BOW B;  2Y1M A;  1SL7 A;  4CPV A;  2F8P A;  5EL2 A;  1B7T Y;  1HQV A;  1CM4 A;  1OOI X;  5K89 A;  2BE6 A;  1J7P A;  1X02 A;  2WCM A;  5AER A;  1J1D A;  1L2O B;  2OTG C;  1C7V A;  4GAO A;  2BNX A;  5HL1 A;  1NPQ A;  1CFD A;  2CCM A;  4PDZ A;  1S5G Z;  1YUT A;  2R2I A;  3WHT B;  2LP3 A;  4PHM A;  2M1K B;  1AJ4 A;  5JOL A;  2I18 A;  1DF0 A;  2L51 A;  3CR2 A;  4DIR A;  5AAN A;  2AMI A;  4YRU A;  2P6B B;  1WRZ A;  4MSP A;  3S0E A;  3SS3 A;  1M39 A;  1IIO A;  1XFW O;  3VRN A;  3AAK A;  4M2P A;  3PSR A;  3DVE A;  2KPH A;  4WQ2 A;  4AQI A;  2K7O A;  2ZNE A;  2PVB A;  3CLN A;  3NSL A;  4OVN F;  5DKN A;  1QTX A;  5FI7 A;  2KI4 B;  1C07 A;  1GQM A;  3OHM B;  2JNF A;  3NHI A;  1DJW A;  3S0F A;  3D73 A;  1KSO A;  2WCH A;  2Y1N A;  3D0Y A;  2K60 A;  1OQP A;  3O6B A;  1S5G Y;  1L7Z A;  4BY5 A;  3D76 A;  2CTN A;  2Y5I A;  2ZRS A;  1TTX A;  1A2X A;  3PM8 A;  1SL8 A;  1UHH A;  4OKH A;  3RZS A;  2LE9 B;  2G2B A;  3D75 A;  1QX5 B;  3SS5 A;  1KWO C;  1KFU L;  3H4S E;  1XVJ A;  3L4A A;  4USL A;  1DJG A;  4YBH B;  4HRG A;  1CM1 A;  4OZD A;  3OX5 A;  1Z4H A;  1NCX A;  1HT9 A;  2KYF A;  3NSK A;  3TDU A;  1SCM C;  1YR5 A;  2WCJ A;  3TUY B;  2KHN A;  4I5N B;  1UHK A;  4E68 A;  1IQ3 A;  3M0W A;  1F71 A;  3SJS A;  1FI5 A;  2M1U A;  2JQ6 A;  3EVR A;  1TNW A;  2JU0 A;  1SR6 B;  2I2R E;  5D3O A;  3SG7 A;  2KBI A;  3DYE A;  4DRW A;  4IJ7 A;  1BJF A;  5G08 A;  3TS5 B;  1ZAC A;  1S6J A;  2F33 A;  2HET A;  1DMO A;  3WXA A;  1C7W A;  1W7I B;  5KSZ A;  2L2E A;  4GGF A;  1QV0 A;  1YTZ C;  3UO9 A;  1RFJ A;  3OB1 B;  3EG5 B;  3JVT C;  2LC5 A;  3B87 A;  2LUC A;  2LVV A;  3HX4 A;  3N7H A;  4XJK A;  2L5X B;  2EC6 C;  3NXA A;  3B86 A;  1LS8 A;  1K90 D;  1NCY A;  1SL9 A;  3A4U B;  3DVM A;  1TWO A;  3K21 A;  2GGZ A;  3FWB A;  1CLL A;  3DF0 B;  4DS7 A;  4JPZ B;  2BL0 C;  1PVB A;  3L47 A;  2ZN8 A;  4MZK A;  1L2O C;  4P2Y B;  3CWG A;  1ZOT B;  1KK7 Z;  3PN7 C;  1B1G A;  2L2C A;  3LK1 A;  2ZN9 A;  2MHH A;  2LVJ A;  1B9A A;  3VB1 A;  4M2Q A;  2WOS A;  2K7C A;  1B7T Z;  2HQ8 A;  1OOH A;  4GUK A;  4N1G A;  1J7Q A;  5AEQ A;  1CB1 A;  2H61 A;  2KYC A;  2M3W A;  1JC2 A;  3LLE A;  1T14 A;  1TCO B;  5PAL A;  2NZ0 A;  3CTN A;  2LHI A;  1REC A;  1WLZ A;  2JT8 A;  1XFV O;  3E3R A;  2CT9 A;  2ISD A;  3RM1 A;  2I94 A;  3OB2 B;  4Q04 A;  2HF5 A;  1KK8 C;  1DJI A;  2PQL A;  1H8B A;  3WNX B;  3S0G A;  3TDZ A;  1A4P A;  1LXF C;  5CSJ A;  1UHJ A;  2BBM A;  2KQY A;  1J7R A;  1ZFS A;  4INW A;  3JVT B;  5TNC A;  1IQ5 A;  3WHU B;  2HQW A;  3BFA A;  3Q8I A;  4PE0 A;  1DTL A;  2KFF A;  3EK4 A;  3OGN A;  4OV2 A;  1JBA A;  1KFX L;  1DQE A;  4XYN A;  4P5O E;  1AVS A;  1G4Y R;  2M49 B;  3PAT A;  2JUL A;  1M46 A;  3FE8 A;  4ORB B;  5FYX A;  4L9M A;  3KO0 A;  1MXL C;  4PT1 A;  2BL0 B;  1OOF A;  2WCB A;  3DVK A;  3LCP C;  1KQM B;  2M8U A;  3BFH A;  2KAY A;  2EHB A;  3PN7 B;  2F3Z A;  3VRP A;  1KFX S;  1RJV A;  1S26 D;  4QJ3 B;  4FQT A;  2QEV A;  2MAZ A;  1PSB A;  1YX7 A;  1SPY A;  1XFU O;  1J55 A;  3VRQ A;  4D1E A;  3SG5 A;  1BU3 A;  1GM0 A;  3I5F B;  1C3Y A;  4NDC A;  2LAN A;  1QLK A;  2GV5 A;  4CID A;  3VGO A;  2L5Y A;  1XK4 A;  2MJW B;  3EKJ A;  5D69 A;  2FCE A;  2QEO A;  3SG4 A;  4DUQ A;  2JT0 A;  1TRF A;  1BMO A;  2BBN A;  4MZJ A;  2BKI B;  3TUY C;  1DVI A;  1EG4 A;  2MA2 A;  4CFR A;  2OS8 B;  3KF9 A;  2MLE C;  2PAL A;  1IKU A;  3FS7 A;  1A75 A;  1V1F A;  3KHE A;  1A29 A;  1SR6 C;  1TOP A;  1RTP 1;  1KK8 B;  3BJH A;  3JTD C;  5FI2 A;  2MBX A;  1KCY A;  3K1E A;  1LA3 A;  2LAP A;  3BQ3 A;  2CXJ A;  3TS5 C;  1QIW A;  1CNP A;  1WRK A;  2KOT A;  4JQ0 D;  5IBW A;  1D1O A;  5KTY A;  1DEL A;  1UHI A;  3O4Y A;  4A4C A;  3EK8 A;  2NCP A;  1TUJ A;  2PYQ A;  4N1F A;  2K8M B;  1PUL A;  1BR4 B;  2QDI A;  4PCW A;  3UNW A;  1SMG A;  3PJI A;  4GPL B;  2BKH B;  4INX A;  1SK6 D;  2KFG A;  1QAS A;  2BCX A;  2PRU A;  3AAJ A;  2LM5 A;  3EVV A;  3GK2 A;  4OCI A;  2O5G A;  5HKZ A;  2JTZ A;  1CDP A;  1NWD A;  1ALV A;  5AFP A;  1NUB A;  2K2A A;  3IVT A;  3NSI A;  5DKQ A;  3VRO A;  2LMT A;  1YRT B;  1OSA A;  3PLF B;  1CTR A;  1WRL A;  1F54 A;  1QIV A;  2BAP A;  4ZCV A;  4BY4 A;  2WC8 A;  1S1E A;  1BT6 A;  5I8N A;  1BR1 B;  2NCO A;  2H2K A;  4YGA A;  2JC2 A;  5CSF A;  2JXL A;  1DF0 B;  3CZT X;  2B1U A;  3R72 A;  1NX3 A;  3R1O A;  2YGU A;  1K9U A;  3EKH A;  3FWC A;  1OE9 B;  2D8N A;  2WCK A;  2M97 A;  4PHN A;  1IH0 A;  2SAS A;  1WDC C;  2L4I A;  2TN4 A;  2LUX A;  3SG6 A;  1IJ6 A;  2COL B;  3BYA A;  3IQO A;  3JTD B;  4WQ3 A;  1Y1U A;  1MR8 A;  1EL4 A;  1F4O A;  2KFH A;  1EG3 A;  1MHO A;  5CPV A;  2E6W A;  1M45 A;  2JPT A;  2WC6 A;  1SRA A;  1FBV A;  2K61 A;  1IG5 A;  1UUS A;  2RGI A;  3AKB A;  3FE6 A;  1S3P A; 
#chains in the Genus database with same CATH homology
 4GNK B;  1K93 D;  5AXI A;  1QX7 A;  5B8I B;  1PK0 D;  1MF8 B;  3D0Y B;  4ICB A;  1J7O A;  2ZKM X;  1SYM A;  2V53 A;  1QXP A;  1YVL A;  1CFC A;  4OR9 B;  4YGD B;  1EXR A;  1NIW A;  2KI6 C;  2M7N A;  2M29 A;  1KQM C;  2A4J A;  2KBM A;  3LK0 A;  1KQV A;  1XA5 A;  2I7A A;  2K2F A;  1CDL A;  5ER4 X;  3NSO A;  1PSR A;  1GJY A;  4MRX A;  2DOQ A;  1YUR A;  1XFX O;  1QX2 A;  1B8C A;  4QJ5 B;  1K94 A;  4DCK A;  4R1E A;  1U5I A;  4N5X A;  3I5F C;  4U8D A;  1SNL A;  4YI8 A;  5J3X A;  1WDC B;  4HRH A;  2WCE A;  2LCP A;  1AHR A;  2BE4 A;  2BEC A;  1E8A A;  1QVI Y;  2WCB A;  2Q91 A;  1PRW A;  3BOW A;  4ORC B;  4CLN A;  1YUU A;  1K9K A;  2OS8 C;  2PMY A;  1DGV A;  1DJX A;  1MQ1 A;  4CFQ A;  1XFZ O;  1WY9 A;  4AQJ A;  1Q80 A;  1Y6W A;  4ETO A;  1DJZ A;  3SG2 A;  4MZL A;  2LLU A;  1DT7 B;  3TDI A;  1Y1A A;  4ZCU A;  1NX0 A;  5CSI A;  3I5H B;  5I2O A;  1PAL A;  3RLZ A;  1SY9 A;  5I2L A;  1CDM A;  3SIA A;  2LV7 A;  3O2P A;  1TCF A;  1YUS A;  3I5G B;  4QJ4 B;  4XJK B;  1Y0V H;  1LKJ A;  4YI9 A;  1NCZ A;  1IJ5 A;  2JNX A;  3CR4 X;  1F55 A;  1NX2 A;  1SCV A;  2K7B A;  2Y4Q A;  2MRD A;  2AAO A;  2JOJ A;  1DJY A;  2ZND A;  2BCA A;  1K2H A;  3CR5 X;  2MLF C;  1FI6 A;  5HLV A;  1XYD A;  1K9P A;  1EH2 A;  1W7J B;  2OPO A;  1QAT A;  3C1V A;  2WCF A;  2BCB A;  1RK9 A;  4YGE B;  1NP8 A;  1UP5 A;  2QPT A;  1S6I A;  4FTG A;  1K8U A;  1CFF A;  1K95 A;  1NSH A;  2LVI A;  1AJ5 A;  1TIZ A;  3BUO B;  3GOF A;  1JSA A;  1NYA A;  1QS7 A;  2JZI A;  2KSP A;  1N65 A;  1UHN A;  2KAX A;  2LMV A;  1OZS A;  1IGV A;  3BXK A;  3DVJ A;  3OP0 A;  1CFP A;  1RWY A;  3SG3 A;  3KPX A;  2LVK A;  4ORA B;  2EGD A;  4MRY A;  3BUN B;  1RRO A;  2CBL A;  4PHJ A;  2F2P A;  2WOR A;  1OZO A;  5HKY A;  3GK4 X;  3OX6 A;  3A8R A;  1MUX A;  5D7F A;  2E30 A;  3SIB A;  1AK8 A;  1B4C A;  1N2D A;  1JFK A;  4I5L B;  4PE7 A;  1DGU A;  1OOJ A;  4PE4 A;  5HYD A;  1BOC A;  1YX8 A;  3D10 A;  3ICB A;  3LL8 B;  4C0J A;  4NQG A;  2FOT A;  1LIN A;  4IL1 A;  2ZRT A;  3ZWH A;  5I2Q A;  3I5I C;  5HLO A;  1TNP A;  3F45 A;  1DJH A;  4MBE A;  1CKK A;  2LLT A;  3DD4 A;  1FW4 A;  4TNC A;  1EJ3 A;  1TNQ A;  2K7D A;  3BUM B;  1UWO A;  2F2O A;  2L50 A;  1B47 A;  5CSN A;  1SW8 A;  2L4H A;  1BF5 A;  2QAC A;  4GGN A;  2KGR A;  1TNX A;  1ALW A;  2JT3 A;  1S36 A;  2KI6 D;  2LMU A;  3EK7 A;  3HCM A;  1BOD A;  2KNE A;  4MLW A;  1LA0 A;  1F8H A;  1TN4 A;  2M9G A;  1FF1 A;  1AUI B;  3AKA A;  2ZFD A;  3DF0 A;  2LNK A;  1A75 B;  2OTG B;  5JJG A;  1IRJ A;  1LVC D;  5F6T A;  2JWW A;  4C0K A;  1K96 A;  5HKW A;  1OMD A;  1QVI Z;  3I5H C;  4GGF C;  4M2O A;  2KGB C;  3CS1 A;  5KU1 A;  5GQQ C;  4UPG A;  1BG1 A;  1VRK A;  2L98 A;  4NDD A;  4YGC B;  3PFV A;  2CNP A;  4FQO A;  3IQQ A;  1G8I A;  2KQ6 A;  3I5G C;  1JFJ A;  1J1E A;  1OMV A;  4A4B A;  1AP4 A;  3KEV A;  3TZ1 A;  2NLN A;  1KFU S;  2SCP A;  3I5I B;  4MN0 A;  4GFT A;  2FCD A;  3IF7 A;  1G33 A;  1KSM A;  4JWQ A;  4YGB B;  1Y1X A;  2PAS A;  1ODB A;  1M63 B;  4MEW A;  1QJT A;  1PVA A;  1XFY O;  2GGM A;  4PAL A;  1YRU B;  5BPJ A;  2KDH A;  1JUO A;  4GBA A;  2H61 C;  1R6P A;  1IWQ A;  2JTT A;  3VRR A;  2F3Y A;  3O78 A;  1ZMZ A;  1XO5 A;  3CGA A;  1GGW A;  1JWD A;  5DKR A;  1A03 A;  2L0P A;  2LLS A;  4HRE E;  2PSR A;  3ZNI A;  2K0J A;  1CLM A;  2WND A;  3PAL A;  1QV1 A;  2NXQ A;  1KWO B;  1CMG A;  1FPW A;  2M0R A;  4MVF A;  1UUR A;  2IS9 A;  4I5K A;  3BUW B;  4HSZ A;  4PHK A;  4PE1 A;  1CMF A;  1B8R A;  1MXE A;  1WLM A;  2VRG A;  2O60 A;  1SCM B;  1R2U A;  1ZUZ A;  1NX1 A;  2FJU B;  2JRF A;  4NDB A;  2KAV A;  4C0L A;  4I5J A;  1S6C A;  1F4Q A;  3GK1 A;  3EVU A;  3MSE B;  1N0Y A;  3FIA A;  2M7L A;  4WRI A;  1M31 A;  3QRX A;  1GGZ A;  1QLS A;  2HPS A;  1F70 A;  2LHL A;  1YVH A;  2KI4 C;  4AOM A;  1B8L A;  1SBJ A;  1V1G A;  2JXC A;  1OMR A;  1H4B A;  3BUX B;  1U5I B;  4F0Z B;  1CLB A;  1SKT A;  2LP2 A;  1JF2 A;  2AUC A;  2G9B A;  1CDN A;  1BLQ A;  1MWN A;  5ER5 A;  1KK7 Y;  2EC6 B;  1XK4 C;  2Q4U A;  1JF0 A;  3BOW B;  2Y1M A;  1SL7 A;  4CPV A;  2F8P A;  1B7T Y;  1HQV A;  1CM4 A;  5K89 A;  1J7P A;  2BE6 A;  1X02 A;  5AER A;  1J1D A;  1L2O B;  2OTG C;  1C7V A;  4GAO A;  1NPQ A;  1CFD A;  2CCM A;  4PDZ A;  1S5G Z;  1YUT A;  2R2I A;  3WHT B;  2LP3 A;  4PHM A;  2M1K B;  1AJ4 A;  5JOL A;  2I18 A;  1DF0 A;  2L51 A;  3CR2 A;  4DIR A;  5AAN A;  2AMI A;  4YRU A;  2P6B B;  1WRZ A;  4MSP A;  1M39 A;  1XFW O;  3VRN A;  3AAK A;  4M2P A;  3PSR A;  3DVE A;  4WQ2 A;  4AQI A;  2K7O A;  2ZNE A;  2PVB A;  3CLN A;  3NSL A;  4OVN F;  5DKN A;  1QTX A;  2KI4 B;  1C07 A;  1GQM A;  3OHM B;  2JNF A;  1DJW A;  1KSO A;  2Y1N A;  3D0Y A;  1OQP A;  3O6B A;  1S5G Y;  1L7Z A;  4BY5 A;  2CTN A;  2Y5I A;  2ZRS A;  1TTX A;  1A2X A;  3PM8 A;  1SL8 A;  1UHH A;  4OKH A;  2LE9 B;  2G2B A;  1QX5 B;  1KWO C;  1KFU L;  3H4S E;  1XVJ A;  4USL A;  1DJG A;  4YBH B;  4HRG A;  1CM1 A;  3OX5 A;  2KYF A;  1NCX A;  1HT9 A;  3TDU A;  3NSK A;  1SCM C;  1YR5 A;  3TUY B;  2KHN A;  4I5N B;  1UHK A;  4E68 A;  1IQ3 A;  3M0W A;  1F71 A;  3SJS A;  1FI5 A;  2M1U A;  2JQ6 A;  3EVR A;  1TNW A;  2JU0 A;  1SR6 B;  2I2R E;  3SG7 A;  2KBI A;  4DRW A;  1BJF A;  5G08 A;  3TS5 B;  1ZAC A;  1S6J A;  2F33 A;  2HET A;  1DMO A;  3WXA A;  1C7W A;  1W7I B;  5KSZ A;  2L2E A;  4GGF A;  1QV0 A;  1YTZ C;  1RFJ A;  3OB1 B;  3JVT C;  2LC5 A;  2LUC A;  2LVV A;  3HX4 A;  4XJK A;  2L5X B;  2EC6 C;  3NXA A;  1NCY A;  1K90 D;  1SL9 A;  3A4U B;  3DVM A;  3K21 A;  2GGZ A;  3FWB A;  1CLL A;  3DF0 B;  4DS7 A;  4JPZ B;  2BL0 C;  1PVB A;  2ZN8 A;  4MZK A;  1L2O C;  4P2Y B;  3CWG A;  1ZOT B;  1KK7 Z;  3PN7 C;  1B1G A;  3LK1 A;  2ZN9 A;  2MHH A;  2LVJ A;  1B9A A;  4M2Q A;  2WOS A;  2K7C A;  1B7T Z;  2HQ8 A;  4GUK A;  4N1G A;  1J7Q A;  5AEQ A;  1CB1 A;  2H61 A;  2KYC A;  2M3W A;  1JC2 A;  3LLE A;  1TCO B;  5PAL A;  2NZ0 A;  3CTN A;  2LHI A;  1REC A;  1WLZ A;  2JT8 A;  1XFV O;  3E3R A;  2CT9 A;  2ISD A;  3RM1 A;  2I94 A;  3OB2 B;  4Q04 A;  2HF5 A;  1KK8 C;  1DJI A;  1H8B A;  3WNX B;  3TDZ A;  1A4P A;  1LXF C;  5CSJ A;  1UHJ A;  2BBM A;  2KQY A;  1J7R A;  1ZFS A;  3JVT B;  5TNC A;  1IQ5 A;  3WHU B;  2HQW A;  4PE0 A;  1DTL A;  2KFF A;  3EK4 A;  1JBA A;  4OV2 A;  1KFX L;  4XYN A;  4P5O E;  1AVS A;  1G4Y R;  2M49 B;  3PAT A;  2JUL A;  1M46 A;  4ORB B;  5FYX A;  4L9M A;  3KO0 A;  1MXL C;  2BL0 B;  3DVK A;  3LCP C;  1KQM B;  2M8U A;  2KAY A;  2EHB A;  3PN7 B;  2F3Z A;  3VRP A;  1KFX S;  1RJV A;  1S26 D;  4QJ3 B;  2MAZ A;  1PSB A;  1YX7 A;  1SPY A;  1XFU O;  1J55 A;  3VRQ A;  4D1E A;  3SG5 A;  1BU3 A;  3I5F B;  4NDC A;  2LAN A;  1QLK A;  2GV5 A;  4CID A;  3VGO A;  2MJW B;  1XK4 A;  3EKJ A;  5D69 A;  4DUQ A;  2FCE A;  3SG4 A;  2JT0 A;  1TRF A;  1BMO A;  2BBN A;  4MZJ A;  2BKI B;  3TUY C;  1DVI A;  1EG4 A;  2MA2 A;  4CFR A;  2OS8 B;  3KF9 A;  2MLE C;  2PAL A;  1IKU A;  3FS7 A;  1A75 A;  1V1F A;  3KHE A;  1A29 A;  1SR6 C;  1TOP A;  1RTP 1;  1KK8 B;  3JTD C;  2MBX A;  1KCY A;  1LA3 A;  2LAP A;  3BQ3 A;  2CXJ A;  3TS5 C;  1QIW A;  1CNP A;  1WRK A;  2KOT A;  4JQ0 D;  5IBW A;  1D1O A;  5KTY A;  1UHI A;  3O4Y A;  4A4C A;  3EK8 A;  2NCP A;  4N1F A;  2K8M B;  1PUL A;  1BR4 B;  4PCW A;  1SMG A;  4GPL B;  2BKH B;  1SK6 D;  2KFG A;  1QAS A;  2BCX A;  2PRU A;  3AAJ A;  2LM5 A;  3EVV A;  3GK2 A;  4OCI A;  2O5G A;  5HKZ A;  2JTZ A;  1CDP A;  1NWD A;  1ALV A;  5AFP A;  1NUB A;  2K2A A;  3NSI A;  5DKQ A;  3VRO A;  2LMT A;  1YRT B;  1OSA A;  3PLF B;  1CTR A;  1WRL A;  1F54 A;  1QIV A;  4ZCV A;  4BY4 A;  2WC8 A;  1S1E A;  1BT6 A;  5I8N A;  1BR1 B;  2NCO A;  2H2K A;  4YGA A;  2JC2 A;  5CSF A;  2JXL A;  1DF0 B;  3CZT X;  2B1U A;  1NX3 A;  1K9U A;  3EKH A;  3FWC A;  1OE9 B;  2D8N A;  4PHN A;  2M97 A;  1IH0 A;  2SAS A;  1WDC C;  2L4I A;  2TN4 A;  2LUX A;  3SG6 A;  1IJ6 A;  2COL B;  3BYA A;  3IQO A;  3JTD B;  4WQ3 A;  1Y1U A;  1MR8 A;  1EL4 A;  1F4O A;  2KFH A;  1EG3 A;  1MHO A;  5CPV A;  2E6W A;  1M45 A;  2JPT A;  1SRA A;  1FBV A;  2K61 A;  1IG5 A;  1UUS A;  2RGI A;  3AKB A;  1S3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...