4OCIA

Crystal structure of calcium binding protein-5 from entamoeba histolytica and its involvement in initiation of phagocytosis of human erythrocytes
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
139
structure length
139
Chain Sequence
LKESFLLFDGDGDGYLTLNEFESLVRVLGVVMETSAIASTYNSNSKVRGMSYELFTSCFSQLKTKSFNKDEIKTAINVLDKDKKGFIPAIELRRILSTIGDNMEQKEITDLFTFMGIDEQGVVKVDDFINQDNHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin, putative
publication title Crystal Structure of Calcium Binding Protein-5 from Entamoeba histolytica and Its Involvement in Initiation of Phagocytosis of Human Erythrocytes.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
total genus 46
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ociA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ociA01
1M63B 3O6BA 2PMYA 3WHUB 1VRKA 2L0PA 1EJ3A 1S3PA 4JPZB 1YUSA 2KYCA 4C0LA 1DF0B 5CSIA 4ETOA 3AAJA 1JF2A 1K9PA 2LUCA 1G33A 1J1EA 3DF0B 3CR5X 1EH2A 2BKIB 3JTDC 5I2LA 1M46A 5TNCA 5HLVA 1KWOC 1A75B 2I2RE 4FTGA 1DGUA 3SIAA 4PE4A 4CFQA 4MRXA 4DRWA 1PALA 2K7CA 1RK9A 3BQ3A 2BL0B 1J7OA 2COLB 2JT3A 3D10A 4HSZA 1KQVA 1SCMC 1S6JA 1CKKA 1TCFA 1D1OA 1B7TZ 2MLFC 1M31A 1OOJA 2KFHA 3D0YB 3ZWHA 1PRWA 4TNCA 2QACA 1BU3A 1NCZA 2EHBA 2JZIA 1K9UA 1EG4A 2K2FA 1B8RA 2HETA 1XO5A 4M2PA 2OS8C 1ALWA 1CFDA 1J7RA 2JQ6A 1NP8A 1YVLA 2BKHB 5J3XA 3VROA 1CMGA 2LVVA 1FI6A 1M39A 2JXCA 1V1GA 2BBMA 4ZCUA 4BY4A 1CDMA 2Y4QA 1MQ1A 1U5IB 3EK8A 4NQGA 2H61C 2LLTA 1AJ4A 2LC5A 1QJTA 3TDUA 1OSAA 2LHLA 4GNKB 1CLMA 2ZNDA 1OMVA 4Q04A 1R6PA 1KWOB 3A8RA 5F6TA 5AANA 1OMRA 1KSOA 1BR4B 2V53A 5HYDA 1IKUA 1XFUO 3I5IB 4WRIA 3DD4A 4DCKA 2F2PA 4OKHA 1RECA 4CIDA 1K94A 1SCMB 1JBAA 1OMDA 1DT7B 1KK7Z 2BE4A 3VRPA 2FCDA 3VGOA 1PK0D 2KI6C 3LK1A 5ER5A 2WCBA 1L7ZA 1EG3A 1N65A 2PRUA 3BUNB 3PFVA 1ZMZA 4FQOA 3PM8A 4NDBA 2OS8B 1ZUZA 2EC6C 1WRKA 3FWBA 4DS7A 3OX5A 2PASA 3DVJA 1LVCD 1SPYA 3GK2A 3AKAA 1YVHA 2MBXA 1TRFA 3CS1A 1QXPA 2KAXA 2F8PA 4YGDB 4MLWA 1UP5A 1PVBA 1XFZO 3NSKA 1BF5A 1AUIB 1S6CA 2Y1MA 3HX4A 1QIWA 3CGAA 1KQMC 1IH0A 2I94A 1NX2A 1QVIY 2ZN9A 3SG4A 3IQOA 1FW4A 5CSNA 4USLA 1F70A 3D0YA 1NYAA 4CPVA 2M1KB 3PALA 4I5LB 4A4CA 1TTXA 4C0JA 1CFFA 1DJXA 2MHHA 4I5JA 3NSIA 3EKJA 3RLZA 3TUYC 1YX7A 1PULA 2L98A 1Y1UA 1OZOA 4UPGA 1CLLA 1DMOA 3E3RA 5KU1A 2Q91A 2KQYA 1EL4A 5HKYA 2EC6B 1NX3A 1UHIA 2WCFA 4PCWA 1G4YR 1CDPA 4MN0A 1QX5B 4M2OA 5ER4X 2LMTA 4PHNA 1JF0A 4AQIA 2ZKMX 1MUXA 4GGFA 5CPVA 1IJ5A 1K96A 1UHKA 1F4OA 1CDNA 1LINA 2G2BA 2BCBA 3O78A 1S6IA 1UUSA 5JJGA 2E30A 1IWQA 1WDCC 1KQMB 3O4YA 1F8HA 2WC8A 1DJIA 4ICBA 1M45A 3H4SE 1CB1A 2LANA 2SASA 2NZ0A 1FBVA 2HF5A 1FI5A 2MRDA 2M97A 2ZFDA 1MHOA 1K93D 3OX6A 2M7LA 4GGFC 1JC2A 1R2UA 3PLFB 3SG3A 2F3YA 3I5IC 5CSFA 2JNXA 5HLOA 1TOPA 3TUYB 2LMUA 2HQ8A 3KF9A 2JTZA 1B47A 4YGCB 3SJSA 3LL8B 4L9MA 1ZACA 5I8NA 2LCPA 1Y0VH 1YRTB 1DJWA 2L5XB 1C7WA 5FYXA 1TNXA 4P5OE 4DIRA 2KNEA 1BT6A 1S36A 1S5GY 2KBMA 4GUKA 2O5GA 2JWWA 5BPJA 3NSLA 5K89A 1AP4A 5DKRA 1KFXS 2F33A 2LP3A 1W7IB 4R1EA 3HCMA 3O2PA 1MXLC 1CTRA 1PSBA 2L50A 1B8CA 1BODA 3I5GC 3VRNA 2M0RA 2CTNA 2Y1NA 1WDCB 1UWOA 1CM1A 2JULA 2LHIA 2KQ6A 2JC2A 3LLEA 1SRAA 3SG6A 1XA5A 3KEVA 1IQ3A 1F55A 3OP0A 2OTGC 1UURA 2K61A 3PSRA 4I5KA 1H4BA 4GAOA 2JTTA 2K2AA 4XJKA 4BY5A 2M8UA 1N0YA 1XFWO 4OV2A 4N5XA 1LA0A 1MR8A 2LVIA 1UHNA 1K95A 1A2XA 2L4IA 1KFXL 3IF7A 1KFUS 1UHHA 4JWQA 2LE9B 3WHTB 4YGBB 1QV0A 4NDCA 4YI9A 1CLBA 1E8AA 3BYAA 1B7TY 2ZRTA 4A4BA 1DJGA 4GGNA 4PHJA 3ZNIA 5I2OA 1K9KA 2OPOA 1SW8A 1SK6D 1F71A 2B1UA 3TS5B 2KAYA 2M1UA 1GJYA 1OQPA 1H8BA 1TNWA 3I5HC 1LA3A 1MXEA 1ZOTB 3I5GB 3MSEB 1NWDA 4QJ5B 4MZKA 3BUWB 2ZNEA 5AEQA 1BLQA 2LP2A 3EVUA 2M9GA 1C7VA 1KFUL 4IL1A 2KDHA 3CR2A 3SIBA 2OTGB 1AHRA 1B8LA 1RJVA 2A4JA 2KGRA 2D8NA 2F2OA 1A29A 1BG1A 4YGAA 2M29A 3AAKA 1A4PA 1K8UA 3BUOB 2CNPA 1SY9A 3FIAA 1SMGA 4DUQA 1KK7Y 4U8DA 2O60A 2KI4B 1DVIA 2K8MB 2LLSA 2LVJA 3EVRA 5PALA 1W7JB 3SG7A 1AK8A 2AMIA 4XJKB 1Y1AA 4HRHA 2FOTA 3I5FB 1BMOA 1XVJA 5HKWA 1CDLA 2R2IA 1N2DA 1LXFC 2LVKA 5D7FA 3PN7C 5D69A 3I5HB 1A03A 1IJ6A 1EXRA 3FS7A 3SG5A 4CFRA 1B4CA 1HT9A 2WNDA 2LLUA 1NSHA 1BR1B 4MVFA 1NUBA 1YURA 2JT8A 1DJHA 2KI6D 4PE0A 4N1GA 4OVNF 2K7BA 1F54A 4MBEA 2IS9A 5AFPA 1BJFA 1IQ5A 1WLZA 5B8IB 2KBIA 4P2YB 2GGMA 3CZTX 1DTLA 1YUUA 1S1EA 2CCMA 2EGDA 2GV5A 1QATA 4PE1A 4ORCB 1CNPA 2NXQA 2JNFA 2MJWB 4MSPA 1J7PA 1K90D 3VRQA 4D1EA 1K2HA 1WRZA 1TNPA 4I5NB 3OB1B 2LNKA 4M2QA 4WQ3A 4CLNA 1PVAA 2HQWA 1RTP1 3DVMA 3EKHA 3QRXA 4GBAA 2TN4A 3GOFA 4MZLA 5DKNA 1CM4A 1G8IA 5G08A 1YX8A 1DJZA 1RFJA 4PALA 1BOCA 4ORBB 1SL8A 4JQ0D 2FJUB 4MRYA 5DKQA 3F45A 4YBHB 1WRLA 1TN4A 2L2EA 1XFXO 3PN7B 2PVBA 3TDIA 4E68A 2LUXA 3TS5C 2CBLA 2I7AA 2CXJA 2LM5A 1JFJA 1IGVA 1NX1A 1QLKA 1Y6WA 1QASA 2F3ZA 2K7DA 4PHMA 2WCEA 2FCEA 4YGEB 2SCPA 1IG5A 3FWCA 1UHJA 1XYDA 1SKTA 2H61A 1RROA 1SR6C 3BUXB 4HREE 2KFFA 1QTXA 3CWGA 4PHKA 2M49B 2I18A 3A4UB 3EK4A 3OB2B 1AJ5A 1SNLA 3JVTC 2JXLA 2JOJA 3GK4X 5GQQC 1SCVA 1Q80A 2DOQA 1QLSA 1GGWA 1WY9A 2M7NA 4PE7A 3EK7A 1ODBA 4F0ZB 2NCPA 2Y5IA 3ICBA 1DGVA 3C1VA 3BUMB 1MWNA 2RGIA 1QX2A 4OR9B 5IBWA 3TDZA 2KI4C 4N1FA 3JTDB 1JFKA 1SL9A 2JPTA 5KTYA 3I5FC 4WQ2A 1NPQA 4QJ3B 1QVIZ 3LK0A 3GK1A 1QV1A 2L51A 1XK4A 2LAPA 1RWYA 1OE9B 3DVEA 3NXAA 2NCOA 1X02A 3BOWA 2HPSA 4YRUA 2E6WA 3KO0A 4GFTA 1AVSA 4NDDA 1SBJA 2MAZA 4PDZA 4OCIA 2ZRSA 1YUTA 3TZ1A 2L4HA 2ZN8A 4YI8A 1JWDA 1J55A 1PSRA 1SR6B 3CLNA 1XK4C 2K0JA 3SG2A 4AQJA 1B1GA 1QS7A 2VRGA 1YTZC 3JVTB 2KAVA 2KFGA 1NX0A 3NSOA 1DF0A 5I2QA 1OZSA 4QJ4B 2CT9A 2MA2A 1V1FA 3BXKA 2BCXA 2KSPA 2QPTA 3DF0A 5AERA 1ALVA 1KK8C 1GGZA 5AXIA 3M0WA 1FPWA 5HKZA 1L2OC 3KPXA 3RM1A 1JSAA 1A75A 3EVVA 1S26D 3WXAA 2K7OA 5KSZA 2JRFA 3DVKA 1ZFSA 2BBNA 1TNQA 4C0KA 1CFPA 2Q4UA 3PATA 2BCAA 3WNXB 1HQVA 2M3WA 3VRRA 2JT0A 2AUCA 4GPLB 1J1DA 2H2KA 3K21A 1GQMA 1NIWA 2KGBC 2P6BB 1FF1A 2G9BA 2JU0A 1F4QA 1TCOB 2ISDA 2WOSA 1XFVO 1Y1XA 4MZJA 1IRJA 3AKBA 4MEWA 1C07A 1KCYA 2BL0C 1B9AA 5CSJA 4ORAB 2KHNA 1DJYA 2NLNA 1J7QA 4HRGA 2BE6A 1QIVA 1NCYA 1XFYO 4AOMA 3KHEA 1SYMA 3BOWB 2KYFA 3CR4X 1YR5A 1JUOA 1LKJA 1NCXA 1U5IA 1WLMA 2LMVA 1S5GZ 3IQQA 1YRUB 1KSMA 1TIZA 2AAOA 2WORA 2KOTA 1CFCA 5JOLA 1CMFA 2BECA 1MF8B 1KK8B 2MLEC 3LCPC 4ZCVA 2PALA 2GGZA 1QX7A 2LV7A 3OHMB 4XYNA 3CTNA 1SL7A 1L2OB 2PSRA
chains in the Genus database with same CATH superfamily
1M63B 3O6BA 2PMYA 3WHUB 1VRKA 3D77A 2L0PA 1EJ3A 1S3PA 4JPZB 5FI7A 1YUSA 2KYCA 3D74A 4C0LA 2FJYA 1DF0B 3BJHA 5CSIA 4ETOA 3AAJA 1OOIX 1TWOA 1JF2A 3DZTA 1K9PA 1TUZA 1G33A 1J1EA 2LUCA 3CR5X 3CDNA 3DF0B 1EH2A 2BKIB 3JTDC 5I2LA 1M46A 5TNCA 5HLVA 1KWOC 1A75B 4PT1A 2I2RE 4FTGA 1DGUA 3SIAA 4PE4A 4CFQA 1T14A 4MRXA 4DRWA 1PALA 2K7CA 1RK9A 3BQ3A 2BL0B 1J7OA 2COLB 1QWVA 2JT3A 3D10A 2P71A 4HSZA 1KQVA 1SCMC 1S6JA 1CKKA 1TCFA 1D1OA 1B7TZ 2WCJA 2MLFC 1M31A 1OOJA 2KFHA 3D0YB 4IJ7A 3ZWHA 1PRWA 4TNCA 2QACA 1BU3A 1NCZA 2EHBA 2JZIA 1K9UA 1EG4A 2K2FA 1B8RA 2HETA 1XO5A 4M2PA 2OS8C 1ALWA 1CFDA 1J7RA 2JQ6A 1NP8A 1YVLA 2BKHB 5J3XA 3VROA 1CMGA 2LVVA 1FI6A 1M39A 2JXCA 2QDIA 1V1GA 3VB1A 2BBMA 4ZCUA 4BY4A 1CDMA 2Y4QA 1MQ1A 1U5IB 3EK8A 4NQGA 3B87A 1OW4A 2H61C 2LLTA 1AJ4A 2LC5A 1QJTA 3TDUA 1DEKA 1OSAA 2LHLA 4GNKB 1CLMA 2ZNDA 1OMVA 4JD9A 4Q04A 1R6PA 1KWOB 3A8RA 5F6TA 5AANA 1OMRA 1KSOA 1BR4B 2V53A 5HYDA 1IKUA 1XFUO 3I5IB 4WRIA 3DD4A 2KLDA 4DCKA 2F2PA 4OKHA 3NGVA 1RECA 1DELA 4CIDA 1K94A 1SCMB 1JBAA 1OMDA 1DT7B 1KK7Z 2BE4A 3VRPA 2FCDA 3VGOA 1PK0D 2KI6C 3LK1A 1DC1A 5ER5A 2WCBA 1L7ZA 1EG3A 1N65A 2PRUA 3BUNB 3PFVA 1ZMZA 4FQOA 3B6XA 3PM8A 4NDBA 2OS8B 1ZUZA 2EC6C 2JPOA 1WRKA 3FWBA 4DS7A 3OX5A 2PASA 3DVJA 1LVCD 1SPYA 3GK2A 3AKAA 1YVHA 2BNXA 2MBXA 1IIOA 3S0DA 1TRFA 3CS1A 3CYZA 1QXPA 2KAXA 2F8PA 4YGDB 3B88A 1UP5A 1PVBA 1XFZO 3NSKA 4MLWA 1BF5A 1AUIB 1S6CA 2Y1MA 3HX4A 1QIWA 3CGAA 1KQMC 1IH0A 2I94A 1NX2A 1QVIY 2ZN9A 3S0BA 3IQOA 3SG4A 1FW4A 5CSNA 4USLA 1F70A 3D0YA 1NYAA 2KLEA 3PJIA 4CPVA 2M1KB 3PALA 1Z2CB 4I5LB 4A4CA 1TTXA 4C0JA 1CFFA 1DJXA 2MHHA 4I5JA 3NSIA 3EKJA 3RLZA 3TUYC 1YX7A 1PULA 2L98A 1Y1UA 1OZOA 4UPGA 1CLLA 1DMOA 3E3RA 5KU1A 2Q91A 2KQYA 1EL4A 5HKYA 2EC6B 1NX3A 5I94A 3BFBA 1UHIA 2WCFA 4PCWA 1G4YR 1CDPA 3CZ1A 1QX5B 4M2OA 4MN0A 5ER4X 2LMTA 4PHNA 3NHTA 1JF0A 4AQIA 2ZKMX 1MUXA 3B86A 4GGFA 5CPVA 1IJ5A 1K96A 1UHKA 1F4OA 1CDNA 1LINA 2G2BA 2BCBA 3O78A 1S6IA 3S0EA 1UUSA 5JJGA 2E30A 1IWQA 1WDCC 1KQMB 3D75A 3O4YA 1F8HA 2WC8A 1DJIA 4ICBA 1M45A 3H4SE 1CB1A 2L5YA 2LANA 2SASA 2YGUA 5FI6A 2NZ0A 1FBVA 2HF5A 3DXLA 1FI5A 2MRDA 2M97A 2ZFDA 1MHOA 1K93D 3OX6A 2M7LA 4GGFC 1JC2A 1R2UA 3PLFB 1C3ZA 2F3YA 3I5IC 5CSFA 2JNXA 5HLOA 3SG3A 1TOPA 3TUYB 3FE9A 2LMUA 2HQ8A 3NHIA 3KF9A 2JTZA 1B47A 4YGCB 3SJSA 5D3OA 3LL8B 4L9MA 1ZACA 5I8NA 2LCPA 1Y0VH 1YRTB 1DJWA 2ERBA 2L5XB 1C7WA 5FYXA 1W9ZA 1TNXA 4P5OE 4DIRA 2KNEA 1BT6A 2QEOA 1S36A 1S5GY 2KBMA 4GUKA 2O5GA 2JWWA 5BPJA 3NSLA 5K89A 1AP4A 5DKRA 1KFXS 2F33A 2LP3A 1W7IB 4R1EA 3HCMA 3O2PA 1MXLC 1CTRA 4KYNA 1PSBA 2L50A 1B8CA 1BODA 3I5GC 3VRNA 2M0RA 2CTNA 2Y1NA 1WDCB 1UWOA 1CM1A 2JULA 2LHIA 3UO9A 2KQ6A 2JC2A 1XFRA 1SRAA 3LLEA 1XA5A 3SG6A 3KEVA 1IQ3A 1F55A 3OP0A 2OTGC 1UURA 2K61A 3PSRA 4I5KA 2P70A 1H4BA 4GAOA 2JTTA 1LS8A 2K2AA 4XJKA 4BY5A 2M8UA 1N0YA 1XFWO 4OV2A 4N5XA 1LA0A 1MR8A 2LVIA 1UHNA 1K95A 1A2XA 2L4IA 1KFXL 3IF7A 1KFUS 1UHHA 4JWQA 2LE9B 3WHTB 4YGBB 1QV0A 4NDCA 4YI9A 1CLBA 1E8AA 3BYAA 3V2LA 1B7TY 3R1PA 3EG5B 2ZRTA 4A4BA 1DJGA 4GGNA 4PHJA 3ZNIA 2L2CA 5I2OA 2GTEA 1K9KA 2OPOA 1OOGA 1P28A 3L4LA 4OZDA 1SW8A 1SK6D 1F71A 2B1UA 3TS5B 2KAYA 2M1UA 1GJYA 1OQPA 1H8BA 1TNWA 3I5HC 1LA3A 1MXEA 1SSEB 1ZOTB 3I5GB 3MSEB 1NWDA 4JKTA 4MZKA 3BUWB 2ZNEA 5AEQA 3SS3A 4F7FA 4QJ5B 1BLQA 2LP2A 3EVUA 2M9GA 1C7VA 1KFUL 4IL1A 2KDHA 3CR2A 3SIBA 2OTGB 1AHRA 3SS5A 3DY9A 3QMEA 1B8LA 2WCLA 1RJVA 2A4JA 2KGRA 2D8NA 2F2OA 1A29A 1BG1A 4YGAA 2M29A 3AAKA 1A4PA 1K8UA 3BUOB 2CNPA 1SY9A 3FIAA 1SMGA 4DUQA 1KK7Y 4U8DA 2O60A 2KI4B 1DVIA 2K8MB 2LLSA 2LVJA 3EVRA 5PALA 1W7JB 3SG7A 1AK8A 2AMIA 4XJKB 1Y1AA 4HRHA 2FOTA 2KPHA 3I5FB 1BMOA 1XVJA 5HKWA 1CDLA 2R2IA 1N2DA 1LXFC 2PQLA 2LVKA 5D7FA 1TUJA 3PN7C 5D69A 3I5HB 1A03A 1IJ6A 1EXRA 3FS7A 3SG5A 4CFRA 1B4CA 1HT9A 4INWA 2WNDA 2LLUA 1NSHA 1BR1B 3FE8A 1NUBA 1YURA 2JT8A 1DJHA 2KI6D 3K1EA 4MVFA 4PE0A 1GM0A 4N1GA 1OOFA 4OVNF 2K7BA 1SL7A 1F54A 4MBEA 2IS9A 5AFPA 1BJFA 1IQ5A 1WLZA 5B8IB 2KBIA 4P2YB 2GGMA 3CZTX 3DYEA 1DTLA 1YUUA 1S1EA 2CCMA 2EGDA 2GV5A 1QATA 4PE1A 4ORCB 1CNPA 2NXQA 2JNFA 2MJWB 4MSPA 3D73A 1J7PA 1K90D 3VRQA 3CZ2A 4D1EA 1WRZA 1TNPA 4I5NB 1K2HA 3OB1B 2LNKA 4M2QA 4WQ3A 4CLNA 1PVAA 2HQWA 1RTP1 3DVMA 3EKHA 3QRXA 5HL1A 4GBAA 2H8VA 2TN4A 3GOFA 4MZLA 5DKNA 1CM4A 1G8IA 5G08A 3CABA 1YX8A 1DJZA 3S0AA 1RFJA 4PALA 4INXA 1BOCA 4ORBB 1SL8A 4JQ0D 2FJUB 4MRYA 5DKQA 2WCHA 3F45A 4YBHB 1WRLA 1TN4A 2L2EA 1XFXO 3PN7B 2PVBA 3TDIA 4E68A 3B7AA 2LUXA 3L4AA 3TS5C 2CBLA 1Z4HA 2I7AA 1OOHA 2CXJA 2LM5A 2WCMA 1JFJA 1IGVA 1ORGA 1NX1A 1QLKA 1Y6WA 1QASA 2F3ZA 2K7DA 4PHMA 2QEVA 2WCEA 2FCEA 4YGEB 2SCPA 1IG5A 3FWCA 1UHJA 1XYDA 1SKTA 3L47A 2H61A 1RROA 1SR6C 3BUXB 4HREE 2KFFA 3RZSA 1QTXA 3CWGA 4PHKA 2M49B 2I18A 3A4UB 3EK4A 3OB2B 1AJ5A 1SNLA 3BFHA 3FE6A 3JVTC 2JXLA 2JOJA 3GK4X 3IVTA 5GQQC 1SCVA 1Q80A 2DOQA 1QLSA 3O4XA 2PYQA 1GGWA 1WY9A 2M7NA 4PE7A 3EK7A 1ODBA 3OGNA 5FI2A 4F0ZB 3N7HA 2NCPA 2Y5IA 3ICBA 1DGVA 3C1VA 3BUMB 1MWNA 2RGIA 1QX2A 4OR9B 5IBWA 3TDZA 2KI4C 4N1FA 3JTDB 3UNWA 2BAPA 1JFKA 1SL9A 2JPTA 3D76A 5KTYA 3I5FC 4WQ2A 1NPQA 4QJ3B 1QVIZ 3LK0A 3GK1A 3BFAA 1QV1A 2L51A 1XK4A 2LAPA 1OE9B 3DVEA 3NXAA 2NCOA 1X02A 3BOWA 2HPSA 2WC6A 2E6WA 2WC5A 3KO0A 4GFTA 1AVSA 4YRUA 4NDDA 1SBJA 2MAZA 4PDZA 3R72A 4OCIA 1DQEA 2K60A 2ZRSA 1YUTA 3TZ1A 2L4HA 2ZN8A 4YI8A 1JWDA 1J55A 1PSRA 1SR6B 5EL2A 3CLNA 1XK4C 2K0JA 3SG2A 4AQJA 1B1GA 1QS7A 2VRGA 1YTZC 3JVTB 2KAVA 2KFGA 5DICA 1NX0A 3NSOA 1DF0A 5I2QA 1OZSA 4QJ4B 3R1VA 2CT9A 2MA2A 1V1FA 3BXKA 2BCXA 2KSPA 2QEHA 2QPTA 3DF0A 3OBVA 1ALVA 1KK8C 5AERA 1GGZA 5AXIA 3M0WA 3S0FA 4FQTA 3Q8IA 1FPWA 5HKZA 1L2OC 3KPXA 3RM1A 1JSAA 1A75A 3EVVA 1S26D 3CZ0A 2K7OA 3WXAA 5KSZA 2JRFA 3DVKA 1ZFSA 2BBNA 1TNQA 4C0KA 1CFPA 2WCKA 2Q4UA 3PATA 2BCAA 3WNXB 1HQVA 2M3WA 3VRRA 2JT0A 2AUCA 4GPLB 1J1DA 2H2KA 3D78A 3K21A 1GQMA 1NIWA 2KGBC 2P6BB 1FF1A 2G9BA 2JU0A 1F4QA 1TCOB 2ISDA 2WOSA 1XFVO 1Y1XA 4MZJA 3PM2A 1IRJA 3AKBA 4MEWA 1C07A 3S0GA 1KCYA 2BL0C 1B9AA 5CSJA 4ORAB 2KHNA 1DJYA 2NLNA 1J7QA 4HRGA 2BE6A 1QIVA 1NCYA 1XFYO 4AOMA 3KHEA 1SYMA 3BOWB 2KYFA 3CR4X 1YR5A 1JUOA 1LKJA 1NCXA 1U5IA 1WLMA 2LMVA 1S5GZ 3SS4A 3IQQA 1YRUB 1KSMA 1TIZA 2AAOA 2WORA 2KOTA 3R1OA 1CFCA 5JOLA 1CMFA 2BECA 1MF8B 1KK8B 2MLEC 3LCPC 4ZCVA 2PALA 2GGZA 1QX7A 2LV7A 3OHMB 1C3YA 2QEBA 4XYNA 3CTNA 1RWYA 1L2OB 2PSRA
chains in the Genus database with same CATH topology
1M63B 3O6BA 2PMYA 3WHUB 1VRKA 2L0PA 1EJ3A 1S3PA 4JPZB 1YUSA 2KYCA 4C0LA 1DF0B 5CSIA 4ETOA 3AAJA 1JF2A 1K9PA 2LUCA 1G33A 1J1EA 3DF0B 3CR5X 1EH2A 2BKIB 3JTDC 5I2LA 1M46A 5TNCA 5HLVA 1KWOC 1A75B 2I2RE 4FTGA 1DGUA 3SIAA 4PE4A 4CFQA 4MRXA 4DRWA 1PALA 2K7CA 1RK9A 3BQ3A 2BL0B 1J7OA 2COLB 2JT3A 3D10A 4HSZA 1KQVA 1SCMC 1S6JA 1CKKA 1TCFA 1D1OA 1B7TZ 2MLFC 1M31A 1OOJA 2KFHA 3D0YB 3ZWHA 1PRWA 4TNCA 2QACA 1BU3A 1NCZA 2EHBA 2JZIA 1K9UA 1EG4A 2K2FA 1B8RA 2HETA 1XO5A 4M2PA 2OS8C 1ALWA 1CFDA 1J7RA 2JQ6A 1NP8A 1YVLA 2BKHB 5J3XA 3VROA 1CMGA 2LVVA 1FI6A 1M39A 2JXCA 1V1GA 2BBMA 4ZCUA 4BY4A 1CDMA 2Y4QA 1MQ1A 1U5IB 3EK8A 4NQGA 2H61C 2LLTA 1AJ4A 2LC5A 1QJTA 3TDUA 1OSAA 2LHLA 4GNKB 1CLMA 2ZNDA 1OMVA 4Q04A 1R6PA 1KWOB 3A8RA 5F6TA 5AANA 1OMRA 1KSOA 1BR4B 2V53A 5HYDA 1IKUA 1XFUO 3I5IB 4WRIA 3DD4A 4DCKA 2F2PA 4OKHA 1RECA 4CIDA 1K94A 1SCMB 1JBAA 1OMDA 1DT7B 1KK7Z 2BE4A 3VRPA 2FCDA 3VGOA 1PK0D 2KI6C 3LK1A 5ER5A 2WCBA 1L7ZA 1EG3A 1N65A 2PRUA 3BUNB 3PFVA 1ZMZA 4FQOA 3PM8A 4NDBA 2OS8B 1ZUZA 2EC6C 1WRKA 3FWBA 4DS7A 3OX5A 2PASA 3DVJA 1LVCD 1SPYA 3GK2A 3AKAA 1YVHA 2MBXA 1TRFA 3CS1A 1QXPA 2KAXA 2F8PA 4YGDB 4MLWA 1UP5A 1PVBA 1XFZO 3NSKA 1BF5A 1AUIB 1S6CA 2Y1MA 3HX4A 1QIWA 3CGAA 1KQMC 1IH0A 2I94A 1NX2A 1QVIY 2ZN9A 3SG4A 3IQOA 1FW4A 5CSNA 4USLA 1F70A 3D0YA 1NYAA 4CPVA 2M1KB 3PALA 4I5LB 4A4CA 1TTXA 4C0JA 1CFFA 1DJXA 2MHHA 4I5JA 3NSIA 3EKJA 3RLZA 3TUYC 1YX7A 1PULA 2L98A 1Y1UA 1OZOA 4UPGA 1CLLA 1DMOA 3E3RA 5KU1A 2Q91A 2KQYA 1EL4A 5HKYA 2EC6B 1NX3A 1UHIA 2WCFA 4PCWA 1G4YR 1CDPA 4MN0A 1QX5B 4M2OA 5ER4X 2LMTA 4PHNA 1JF0A 4AQIA 2ZKMX 1MUXA 4GGFA 5CPVA 1IJ5A 1K96A 1UHKA 1F4OA 1CDNA 1LINA 2G2BA 2BCBA 3O78A 1S6IA 1UUSA 5JJGA 2E30A 1IWQA 1WDCC 1KQMB 3O4YA 1F8HA 2WC8A 1DJIA 4ICBA 1M45A 3H4SE 1CB1A 2LANA 2SASA 2NZ0A 1FBVA 2HF5A 1FI5A 2MRDA 2M97A 2ZFDA 1MHOA 1K93D 3OX6A 2M7LA 4GGFC 1JC2A 1R2UA 3PLFB 3SG3A 2F3YA 3I5IC 5CSFA 2JNXA 5HLOA 1TOPA 3TUYB 2LMUA 2HQ8A 3KF9A 2JTZA 1B47A 4YGCB 3SJSA 3LL8B 4L9MA 1ZACA 5I8NA 2LCPA 1Y0VH 1YRTB 1DJWA 2L5XB 1C7WA 5FYXA 1TNXA 4P5OE 4DIRA 2KNEA 1BT6A 1S36A 1S5GY 2KBMA 4GUKA 2O5GA 2JWWA 5BPJA 3NSLA 5K89A 1AP4A 5DKRA 1KFXS 2F33A 2LP3A 1W7IB 4R1EA 3HCMA 3O2PA 1MXLC 1CTRA 1PSBA 2L50A 1B8CA 1BODA 3I5GC 3VRNA 2M0RA 2CTNA 2Y1NA 1WDCB 1UWOA 1CM1A 2JULA 2LHIA 2KQ6A 2JC2A 3LLEA 1SRAA 3SG6A 1XA5A 3KEVA 1IQ3A 1F55A 3OP0A 2OTGC 1UURA 2K61A 3PSRA 4I5KA 1H4BA 4GAOA 2JTTA 2K2AA 4XJKA 4BY5A 2M8UA 1N0YA 1XFWO 4OV2A 4N5XA 1LA0A 1MR8A 2LVIA 1UHNA 1K95A 1A2XA 2L4IA 1KFXL 3IF7A 1KFUS 1UHHA 4JWQA 2LE9B 3WHTB 4YGBB 1QV0A 4NDCA 4YI9A 1CLBA 1E8AA 3BYAA 1B7TY 2ZRTA 4A4BA 1DJGA 4GGNA 4PHJA 3ZNIA 5I2OA 1K9KA 2OPOA 1SW8A 1SK6D 1F71A 2B1UA 3TS5B 2KAYA 2M1UA 1GJYA 1OQPA 1H8BA 1TNWA 3I5HC 1LA3A 1MXEA 1ZOTB 3I5GB 3MSEB 1NWDA 4QJ5B 4MZKA 3BUWB 2ZNEA 5AEQA 1BLQA 2LP2A 3EVUA 2M9GA 1C7VA 1KFUL 4IL1A 2KDHA 3CR2A 3SIBA 2OTGB 1AHRA 1B8LA 1RJVA 2A4JA 2KGRA 2D8NA 2F2OA 1A29A 1BG1A 4YGAA 2M29A 3AAKA 1A4PA 1K8UA 3BUOB 2CNPA 1SY9A 3FIAA 1SMGA 4DUQA 1KK7Y 4U8DA 2O60A 2KI4B 1DVIA 2K8MB 2LLSA 2LVJA 3EVRA 5PALA 1W7JB 3SG7A 1AK8A 2AMIA 4XJKB 1Y1AA 4HRHA 2FOTA 3I5FB 1BMOA 1XVJA 5HKWA 1CDLA 2R2IA 1N2DA 1LXFC 2LVKA 5D7FA 3PN7C 5D69A 3I5HB 1A03A 1IJ6A 1EXRA 3FS7A 3SG5A 4CFRA 1B4CA 1HT9A 2WNDA 2LLUA 1NSHA 1BR1B 4MVFA 1NUBA 1YURA 2JT8A 1DJHA 2KI6D 4PE0A 4N1GA 4OVNF 2K7BA 1F54A 4MBEA 2IS9A 5AFPA 1BJFA 1IQ5A 1WLZA 5B8IB 2KBIA 4P2YB 2GGMA 3CZTX 1DTLA 1YUUA 1S1EA 2CCMA 2EGDA 2GV5A 1QATA 4PE1A 4ORCB 1CNPA 2NXQA 2JNFA 2MJWB 4MSPA 1J7PA 1K90D 3VRQA 4D1EA 1K2HA 1WRZA 1TNPA 4I5NB 3OB1B 2LNKA 4M2QA 4WQ3A 4CLNA 1PVAA 2HQWA 1RTP1 3DVMA 3EKHA 3QRXA 4GBAA 2TN4A 3GOFA 4MZLA 5DKNA 1CM4A 1G8IA 5G08A 1YX8A 1DJZA 1RFJA 4PALA 1BOCA 4ORBB 1SL8A 4JQ0D 2FJUB 4MRYA 5DKQA 3F45A 4YBHB 1WRLA 1TN4A 2L2EA 1XFXO 3PN7B 2PVBA 3TDIA 4E68A 2LUXA 3TS5C 2CBLA 2I7AA 2CXJA 2LM5A 1JFJA 1IGVA 1NX1A 1QLKA 1Y6WA 1QASA 2F3ZA 2K7DA 4PHMA 2WCEA 2FCEA 4YGEB 2SCPA 1IG5A 3FWCA 1UHJA 1XYDA 1SKTA 2H61A 1RROA 1SR6C 3BUXB 4HREE 2KFFA 1QTXA 3CWGA 4PHKA 2M49B 2I18A 3A4UB 3EK4A 3OB2B 1AJ5A 1SNLA 3JVTC 2JXLA 2JOJA 3GK4X 5GQQC 1SCVA 1Q80A 2DOQA 1QLSA 1GGWA 1WY9A 2M7NA 4PE7A 3EK7A 1ODBA 4F0ZB 2NCPA 2Y5IA 3ICBA 1DGVA 3C1VA 3BUMB 1MWNA 2RGIA 1QX2A 4OR9B 5IBWA 3TDZA 2KI4C 4N1FA 3JTDB 1JFKA 1SL9A 2JPTA 5KTYA 3I5FC 4WQ2A 1NPQA 4QJ3B 1QVIZ 3LK0A 3GK1A 1QV1A 2L51A 1XK4A 2LAPA 1RWYA 1OE9B 3DVEA 3NXAA 2NCOA 1X02A 3BOWA 2HPSA 4YRUA 2E6WA 3KO0A 4GFTA 1AVSA 4NDDA 1SBJA 2MAZA 4PDZA 4OCIA 2ZRSA 1YUTA 3TZ1A 2L4HA 2ZN8A 4YI8A 1JWDA 1J55A 1PSRA 1SR6B 3CLNA 1XK4C 2K0JA 3SG2A 4AQJA 1B1GA 1QS7A 2VRGA 1YTZC 3JVTB 2KAVA 2KFGA 1NX0A 3NSOA 1DF0A 5I2QA 1OZSA 4QJ4B 2CT9A 2MA2A 1V1FA 3BXKA 2BCXA 2KSPA 2QPTA 3DF0A 5AERA 1ALVA 1KK8C 1GGZA 5AXIA 3M0WA 1FPWA 5HKZA 1L2OC 3KPXA 3RM1A 1JSAA 1A75A 3EVVA 1S26D 3WXAA 2K7OA 5KSZA 2JRFA 3DVKA 1ZFSA 2BBNA 1TNQA 4C0KA 1CFPA 2Q4UA 3PATA 2BCAA 3WNXB 1HQVA 2M3WA 3VRRA 2JT0A 2AUCA 4GPLB 1J1DA 2H2KA 3K21A 1GQMA 1NIWA 2KGBC 2P6BB 1FF1A 2G9BA 2JU0A 1F4QA 1TCOB 2ISDA 2WOSA 1XFVO 1Y1XA 4MZJA 1IRJA 3AKBA 4MEWA 1C07A 1KCYA 2BL0C 1B9AA 5CSJA 4ORAB 2KHNA 1DJYA 2NLNA 1J7QA 4HRGA 2BE6A 1QIVA 1NCYA 1XFYO 4AOMA 3KHEA 1SYMA 3BOWB 2KYFA 3CR4X 1YR5A 1JUOA 1LKJA 1NCXA 1U5IA 1WLMA 2LMVA 1S5GZ 3IQQA 1YRUB 1KSMA 1TIZA 2AAOA 2WORA 2KOTA 1CFCA 5JOLA 1CMFA 2BECA 1MF8B 1KK8B 2MLEC 3LCPC 4ZCVA 2PALA 2GGZA 1QX7A 2LV7A 3OHMB 4XYNA 3CTNA 1SL7A 1L2OB 2PSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M63 B;  3O6B A;  2PMY A;  3WHU B;  1VRK A;  2L0P A;  1EJ3 A;  1S3P A;  4JPZ B;  1YUS A;  2KYC A;  4C0L A;  1DF0 B;  5CSI A;  4ETO A;  3AAJ A;  1JF2 A;  1K9P A;  2LUC A;  1G33 A;  1J1E A;  3DF0 B;  3CR5 X;  1EH2 A;  2BKI B;  3JTD C;  5I2L A;  1M46 A;  5TNC A;  5HLV A;  1KWO C;  1A75 B;  2I2R E;  4FTG A;  1DGU A;  3SIA A;  4PE4 A;  4CFQ A;  4MRX A;  4DRW A;  1PAL A;  2K7C A;  1RK9 A;  3BQ3 A;  2BL0 B;  1J7O A;  2COL B;  2JT3 A;  3D10 A;  4HSZ A;  1KQV A;  1SCM C;  1S6J A;  1CKK A;  1TCF A;  1D1O A;  1B7T Z;  2MLF C;  1M31 A;  1OOJ A;  2KFH A;  3D0Y B;  3ZWH A;  1PRW A;  4TNC A;  2QAC A;  1BU3 A;  1NCZ A;  2EHB A;  2JZI A;  1K9U A;  1EG4 A;  2K2F A;  1B8R A;  2HET A;  1XO5 A;  4M2P A;  2OS8 C;  1ALW A;  1CFD A;  1J7R A;  2JQ6 A;  1NP8 A;  1YVL A;  2BKH B;  5J3X A;  3VRO A;  1CMG A;  2LVV A;  1FI6 A;  1M39 A;  2JXC A;  1V1G A;  2BBM A;  4ZCU A;  4BY4 A;  1CDM A;  2Y4Q A;  1MQ1 A;  1U5I B;  3EK8 A;  4NQG A;  2H61 C;  2LLT A;  1AJ4 A;  2LC5 A;  1QJT A;  3TDU A;  1OSA A;  2LHL A;  4GNK B;  1CLM A;  2ZND A;  1OMV A;  4Q04 A;  1R6P A;  1KWO B;  3A8R A;  5F6T A;  5AAN A;  1OMR A;  1KSO A;  1BR4 B;  2V53 A;  5HYD A;  1IKU A;  1XFU O;  3I5I B;  4WRI A;  3DD4 A;  4DCK A;  2F2P A;  4OKH A;  1REC A;  4CID A;  1K94 A;  1SCM B;  1JBA A;  1OMD A;  1DT7 B;  1KK7 Z;  2BE4 A;  3VRP A;  2FCD A;  3VGO A;  1PK0 D;  2KI6 C;  3LK1 A;  5ER5 A;  2WCB A;  1L7Z A;  1EG3 A;  1N65 A;  2PRU A;  3BUN B;  3PFV A;  1ZMZ A;  4FQO A;  3PM8 A;  4NDB A;  2OS8 B;  1ZUZ A;  2EC6 C;  1WRK A;  3FWB A;  4DS7 A;  3OX5 A;  2PAS A;  3DVJ A;  1LVC D;  1SPY A;  3GK2 A;  3AKA A;  1YVH A;  2MBX A;  1TRF A;  3CS1 A;  1QXP A;  2KAX A;  2F8P A;  4YGD B;  4MLW A;  1UP5 A;  1PVB A;  1XFZ O;  3NSK A;  1BF5 A;  1AUI B;  1S6C A;  2Y1M A;  3HX4 A;  1QIW A;  3CGA A;  1KQM C;  1IH0 A;  2I94 A;  1NX2 A;  1QVI Y;  2ZN9 A;  3SG4 A;  3IQO A;  1FW4 A;  5CSN A;  4USL A;  1F70 A;  3D0Y A;  1NYA A;  4CPV A;  2M1K B;  3PAL A;  4I5L B;  4A4C A;  1TTX A;  4C0J A;  1CFF A;  1DJX A;  2MHH A;  4I5J A;  3NSI A;  3EKJ A;  3RLZ A;  3TUY C;  1YX7 A;  1PUL A;  2L98 A;  1Y1U A;  1OZO A;  4UPG A;  1CLL A;  1DMO A;  3E3R A;  5KU1 A;  2Q91 A;  2KQY A;  1EL4 A;  5HKY A;  2EC6 B;  1NX3 A;  1UHI A;  2WCF A;  4PCW A;  1G4Y R;  1CDP A;  4MN0 A;  1QX5 B;  4M2O A;  5ER4 X;  2LMT A;  4PHN A;  1JF0 A;  4AQI A;  2ZKM X;  1MUX A;  4GGF A;  5CPV A;  1IJ5 A;  1K96 A;  1UHK A;  1F4O A;  1CDN A;  1LIN A;  2G2B A;  2BCB A;  3O78 A;  1S6I A;  1UUS A;  5JJG A;  2E30 A;  1IWQ A;  1WDC C;  1KQM B;  3O4Y A;  1F8H A;  2WC8 A;  1DJI A;  4ICB A;  1M45 A;  3H4S E;  1CB1 A;  2LAN A;  2SAS A;  2NZ0 A;  1FBV A;  2HF5 A;  1FI5 A;  2MRD A;  2M97 A;  2ZFD A;  1MHO A;  1K93 D;  3OX6 A;  2M7L A;  4GGF C;  1JC2 A;  1R2U A;  3PLF B;  3SG3 A;  2F3Y A;  3I5I C;  5CSF A;  2JNX A;  5HLO A;  1TOP A;  3TUY B;  2LMU A;  2HQ8 A;  3KF9 A;  2JTZ A;  1B47 A;  4YGC B;  3SJS A;  3LL8 B;  4L9M A;  1ZAC A;  5I8N A;  2LCP A;  1Y0V H;  1YRT B;  1DJW A;  2L5X B;  1C7W A;  5FYX A;  1TNX A;  4P5O E;  4DIR A;  2KNE A;  1BT6 A;  1S36 A;  1S5G Y;  2KBM A;  4GUK A;  2O5G A;  2JWW A;  5BPJ A;  3NSL A;  5K89 A;  1AP4 A;  5DKR A;  1KFX S;  2F33 A;  2LP3 A;  1W7I B;  4R1E A;  3HCM A;  3O2P A;  1MXL C;  1CTR A;  1PSB A;  2L50 A;  1B8C A;  1BOD A;  3I5G C;  3VRN A;  2M0R A;  2CTN A;  2Y1N A;  1WDC B;  1UWO A;  1CM1 A;  2JUL A;  2LHI A;  2KQ6 A;  2JC2 A;  3LLE A;  1SRA A;  3SG6 A;  1XA5 A;  3KEV A;  1IQ3 A;  1F55 A;  3OP0 A;  2OTG C;  1UUR A;  2K61 A;  3PSR A;  4I5K A;  1H4B A;  4GAO A;  2JTT A;  2K2A A;  4XJK A;  4BY5 A;  2M8U A;  1N0Y A;  1XFW O;  4OV2 A;  4N5X A;  1LA0 A;  1MR8 A;  2LVI A;  1UHN A;  1K95 A;  1A2X A;  2L4I A;  1KFX L;  3IF7 A;  1KFU S;  1UHH A;  4JWQ A;  2LE9 B;  3WHT B;  4YGB B;  1QV0 A;  4NDC A;  4YI9 A;  1CLB A;  1E8A A;  3BYA A;  1B7T Y;  2ZRT A;  4A4B A;  1DJG A;  4GGN A;  4PHJ A;  3ZNI A;  5I2O A;  1K9K A;  2OPO A;  1SW8 A;  1SK6 D;  1F71 A;  2B1U A;  3TS5 B;  2KAY A;  2M1U A;  1GJY A;  1OQP A;  1H8B A;  1TNW A;  3I5H C;  1LA3 A;  1MXE A;  1ZOT B;  3I5G B;  3MSE B;  1NWD A;  4QJ5 B;  4MZK A;  3BUW B;  2ZNE A;  5AEQ A;  1BLQ A;  2LP2 A;  3EVU A;  2M9G A;  1C7V A;  1KFU L;  4IL1 A;  2KDH A;  3CR2 A;  3SIB A;  2OTG B;  1AHR A;  1B8L A;  1RJV A;  2A4J A;  2KGR A;  2D8N A;  2F2O A;  1A29 A;  1BG1 A;  4YGA A;  2M29 A;  3AAK A;  1A4P A;  1K8U A;  3BUO B;  2CNP A;  1SY9 A;  3FIA A;  1SMG A;  4DUQ A;  1KK7 Y;  4U8D A;  2O60 A;  2KI4 B;  1DVI A;  2K8M B;  2LLS A;  2LVJ A;  3EVR A;  5PAL A;  1W7J B;  3SG7 A;  1AK8 A;  2AMI A;  4XJK B;  1Y1A A;  4HRH A;  2FOT A;  3I5F B;  1BMO A;  1XVJ A;  5HKW A;  1CDL A;  2R2I A;  1N2D A;  1LXF C;  2LVK A;  5D7F A;  3PN7 C;  5D69 A;  3I5H B;  1A03 A;  1IJ6 A;  1EXR A;  3FS7 A;  3SG5 A;  4CFR A;  1B4C A;  1HT9 A;  2WND A;  2LLU A;  1NSH A;  1BR1 B;  4MVF A;  1NUB A;  1YUR A;  2JT8 A;  1DJH A;  2KI6 D;  4PE0 A;  4N1G A;  4OVN F;  2K7B A;  1F54 A;  4MBE A;  2IS9 A;  5AFP A;  1BJF A;  1IQ5 A;  1WLZ A;  5B8I B;  2KBI A;  4P2Y B;  2GGM A;  3CZT X;  1DTL A;  1YUU A;  1S1E A;  2CCM A;  2EGD A;  2GV5 A;  1QAT A;  4PE1 A;  4ORC B;  1CNP A;  2NXQ A;  2JNF A;  2MJW B;  4MSP A;  1J7P A;  1K90 D;  3VRQ A;  4D1E A;  1K2H A;  1WRZ A;  1TNP A;  4I5N B;  3OB1 B;  2LNK A;  4M2Q A;  4WQ3 A;  4CLN A;  1PVA A;  2HQW A;  1RTP 1;  3DVM A;  3EKH A;  3QRX A;  4GBA A;  2TN4 A;  3GOF A;  4MZL A;  5DKN A;  1CM4 A;  1G8I A;  5G08 A;  1YX8 A;  1DJZ A;  1RFJ A;  4PAL A;  1BOC A;  4ORB B;  1SL8 A;  4JQ0 D;  2FJU B;  4MRY A;  5DKQ A;  3F45 A;  4YBH B;  1WRL A;  1TN4 A;  2L2E A;  1XFX O;  3PN7 B;  2PVB A;  3TDI A;  4E68 A;  2LUX A;  3TS5 C;  2CBL A;  2I7A A;  2CXJ A;  2LM5 A;  1JFJ A;  1IGV A;  1NX1 A;  1QLK A;  1Y6W A;  1QAS A;  2F3Z A;  2K7D A;  4PHM A;  2WCE A;  2FCE A;  4YGE B;  2SCP A;  1IG5 A;  3FWC A;  1UHJ A;  1XYD A;  1SKT A;  2H61 A;  1RRO A;  1SR6 C;  3BUX B;  4HRE E;  2KFF A;  1QTX A;  3CWG A;  4PHK A;  2M49 B;  2I18 A;  3A4U B;  3EK4 A;  3OB2 B;  1AJ5 A;  1SNL A;  3JVT C;  2JXL A;  2JOJ A;  3GK4 X;  5GQQ C;  1SCV A;  1Q80 A;  2DOQ A;  1QLS A;  1GGW A;  1WY9 A;  2M7N A;  4PE7 A;  3EK7 A;  1ODB A;  4F0Z B;  2NCP A;  2Y5I A;  3ICB A;  1DGV A;  3C1V A;  3BUM B;  1MWN A;  2RGI A;  1QX2 A;  4OR9 B;  5IBW A;  3TDZ A;  2KI4 C;  4N1F A;  3JTD B;  1JFK A;  1SL9 A;  2JPT A;  5KTY A;  3I5F C;  4WQ2 A;  1NPQ A;  4QJ3 B;  1QVI Z;  3LK0 A;  3GK1 A;  1QV1 A;  2L51 A;  1XK4 A;  2LAP A;  1RWY A;  1OE9 B;  3DVE A;  3NXA A;  2NCO A;  1X02 A;  3BOW A;  2HPS A;  4YRU A;  2E6W A;  3KO0 A;  4GFT A;  1AVS A;  4NDD A;  1SBJ A;  2MAZ A;  4PDZ A;  4OCI A;  2ZRS A;  1YUT A;  3TZ1 A;  2L4H A;  2ZN8 A;  4YI8 A;  1JWD A;  1J55 A;  1PSR A;  1SR6 B;  3CLN A;  1XK4 C;  2K0J A;  3SG2 A;  4AQJ A;  1B1G A;  1QS7 A;  2VRG A;  1YTZ C;  3JVT B;  2KAV A;  2KFG A;  1NX0 A;  3NSO A;  1DF0 A;  5I2Q A;  1OZS A;  4QJ4 B;  2CT9 A;  2MA2 A;  1V1F A;  3BXK A;  2BCX A;  2KSP A;  2QPT A;  3DF0 A;  5AER A;  1ALV A;  1KK8 C;  1GGZ A;  5AXI A;  3M0W A;  1FPW A;  5HKZ A;  1L2O C;  3KPX A;  3RM1 A;  1JSA A;  1A75 A;  3EVV A;  1S26 D;  3WXA A;  2K7O A;  5KSZ A;  2JRF A;  3DVK A;  1ZFS A;  2BBN A;  1TNQ A;  4C0K A;  1CFP A;  2Q4U A;  3PAT A;  2BCA A;  3WNX B;  1HQV A;  2M3W A;  3VRR A;  2JT0 A;  2AUC A;  4GPL B;  1J1D A;  2H2K A;  3K21 A;  1GQM A;  1NIW A;  2KGB C;  2P6B B;  1FF1 A;  2G9B A;  2JU0 A;  1F4Q A;  1TCO B;  2ISD A;  2WOS A;  1XFV O;  1Y1X A;  4MZJ A;  1IRJ A;  3AKB A;  4MEW A;  1C07 A;  1KCY A;  2BL0 C;  1B9A A;  5CSJ A;  4ORA B;  2KHN A;  1DJY A;  2NLN A;  1J7Q A;  4HRG A;  2BE6 A;  1QIV A;  1NCY A;  1XFY O;  4AOM A;  3KHE A;  1SYM A;  3BOW B;  2KYF A;  3CR4 X;  1YR5 A;  1JUO A;  1LKJ A;  1NCX A;  1U5I A;  1WLM A;  2LMV A;  1S5G Z;  3IQQ A;  1YRU B;  1KSM A;  1TIZ A;  2AAO A;  2WOR A;  2KOT A;  1CFC A;  5JOL A;  1CMF A;  2BEC A;  1MF8 B;  1KK8 B;  2MLE C;  3LCP C;  4ZCV A;  2PAL A;  2GGZ A;  1QX7 A;  2LV7 A;  3OHM B;  4XYN A;  3CTN A;  1SL7 A;  1L2O B;  2PSR A; 
#chains in the Genus database with same CATH topology
 1M63 B;  3O6B A;  2PMY A;  3WHU B;  1VRK A;  3D77 A;  2L0P A;  1EJ3 A;  1S3P A;  4JPZ B;  5FI7 A;  1YUS A;  2KYC A;  3D74 A;  4C0L A;  2FJY A;  1DF0 B;  3BJH A;  5CSI A;  4ETO A;  3AAJ A;  1OOI X;  1TWO A;  1JF2 A;  3DZT A;  1K9P A;  1TUZ A;  1G33 A;  1J1E A;  2LUC A;  3CR5 X;  3CDN A;  3DF0 B;  1EH2 A;  2BKI B;  3JTD C;  5I2L A;  1M46 A;  5TNC A;  5HLV A;  1KWO C;  1A75 B;  4PT1 A;  2I2R E;  4FTG A;  1DGU A;  3SIA A;  4PE4 A;  4CFQ A;  1T14 A;  4MRX A;  4DRW A;  1PAL A;  2K7C A;  1RK9 A;  3BQ3 A;  2BL0 B;  1J7O A;  2COL B;  1QWV A;  2JT3 A;  3D10 A;  2P71 A;  4HSZ A;  1KQV A;  1SCM C;  1S6J A;  1CKK A;  1TCF A;  1D1O A;  1B7T Z;  2WCJ A;  2MLF C;  1M31 A;  1OOJ A;  2KFH A;  3D0Y B;  4IJ7 A;  3ZWH A;  1PRW A;  4TNC A;  2QAC A;  1BU3 A;  1NCZ A;  2EHB A;  2JZI A;  1K9U A;  1EG4 A;  2K2F A;  1B8R A;  2HET A;  1XO5 A;  4M2P A;  2OS8 C;  1ALW A;  1CFD A;  1J7R A;  2JQ6 A;  1NP8 A;  1YVL A;  2BKH B;  5J3X A;  3VRO A;  1CMG A;  2LVV A;  1FI6 A;  1M39 A;  2JXC A;  2QDI A;  1V1G A;  3VB1 A;  2BBM A;  4ZCU A;  4BY4 A;  1CDM A;  2Y4Q A;  1MQ1 A;  1U5I B;  3EK8 A;  4NQG A;  3B87 A;  1OW4 A;  2H61 C;  2LLT A;  1AJ4 A;  2LC5 A;  1QJT A;  3TDU A;  1DEK A;  1OSA A;  2LHL A;  4GNK B;  1CLM A;  2ZND A;  1OMV A;  4JD9 A;  4Q04 A;  1R6P A;  1KWO B;  3A8R A;  5F6T A;  5AAN A;  1OMR A;  1KSO A;  1BR4 B;  2V53 A;  5HYD A;  1IKU A;  1XFU O;  3I5I B;  4WRI A;  3DD4 A;  2KLD A;  4DCK A;  2F2P A;  4OKH A;  3NGV A;  1REC A;  1DEL A;  4CID A;  1K94 A;  1SCM B;  1JBA A;  1OMD A;  1DT7 B;  1KK7 Z;  2BE4 A;  3VRP A;  2FCD A;  3VGO A;  1PK0 D;  2KI6 C;  3LK1 A;  1DC1 A;  5ER5 A;  2WCB A;  1L7Z A;  1EG3 A;  1N65 A;  2PRU A;  3BUN B;  3PFV A;  1ZMZ A;  4FQO A;  3B6X A;  3PM8 A;  4NDB A;  2OS8 B;  1ZUZ A;  2EC6 C;  2JPO A;  1WRK A;  3FWB A;  4DS7 A;  3OX5 A;  2PAS A;  3DVJ A;  1LVC D;  1SPY A;  3GK2 A;  3AKA A;  1YVH A;  2BNX A;  2MBX A;  1IIO A;  3S0D A;  1TRF A;  3CS1 A;  3CYZ A;  1QXP A;  2KAX A;  2F8P A;  4YGD B;  3B88 A;  1UP5 A;  1PVB A;  1XFZ O;  3NSK A;  4MLW A;  1BF5 A;  1AUI B;  1S6C A;  2Y1M A;  3HX4 A;  1QIW A;  3CGA A;  1KQM C;  1IH0 A;  2I94 A;  1NX2 A;  1QVI Y;  2ZN9 A;  3S0B A;  3IQO A;  3SG4 A;  1FW4 A;  5CSN A;  4USL A;  1F70 A;  3D0Y A;  1NYA A;  2KLE A;  3PJI A;  4CPV A;  2M1K B;  3PAL A;  1Z2C B;  4I5L B;  4A4C A;  1TTX A;  4C0J A;  1CFF A;  1DJX A;  2MHH A;  4I5J A;  3NSI A;  3EKJ A;  3RLZ A;  3TUY C;  1YX7 A;  1PUL A;  2L98 A;  1Y1U A;  1OZO A;  4UPG A;  1CLL A;  1DMO A;  3E3R A;  5KU1 A;  2Q91 A;  2KQY A;  1EL4 A;  5HKY A;  2EC6 B;  1NX3 A;  5I94 A;  3BFB A;  1UHI A;  2WCF A;  4PCW A;  1G4Y R;  1CDP A;  3CZ1 A;  1QX5 B;  4M2O A;  4MN0 A;  5ER4 X;  2LMT A;  4PHN A;  3NHT A;  1JF0 A;  4AQI A;  2ZKM X;  1MUX A;  3B86 A;  4GGF A;  5CPV A;  1IJ5 A;  1K96 A;  1UHK A;  1F4O A;  1CDN A;  1LIN A;  2G2B A;  2BCB A;  3O78 A;  1S6I A;  3S0E A;  1UUS A;  5JJG A;  2E30 A;  1IWQ A;  1WDC C;  1KQM B;  3D75 A;  3O4Y A;  1F8H A;  2WC8 A;  1DJI A;  4ICB A;  1M45 A;  3H4S E;  1CB1 A;  2L5Y A;  2LAN A;  2SAS A;  2YGU A;  5FI6 A;  2NZ0 A;  1FBV A;  2HF5 A;  3DXL A;  1FI5 A;  2MRD A;  2M97 A;  2ZFD A;  1MHO A;  1K93 D;  3OX6 A;  2M7L A;  4GGF C;  1JC2 A;  1R2U A;  3PLF B;  1C3Z A;  2F3Y A;  3I5I C;  5CSF A;  2JNX A;  5HLO A;  3SG3 A;  1TOP A;  3TUY B;  3FE9 A;  2LMU A;  2HQ8 A;  3NHI A;  3KF9 A;  2JTZ A;  1B47 A;  4YGC B;  3SJS A;  5D3O A;  3LL8 B;  4L9M A;  1ZAC A;  5I8N A;  2LCP A;  1Y0V H;  1YRT B;  1DJW A;  2ERB A;  2L5X B;  1C7W A;  5FYX A;  1W9Z A;  1TNX A;  4P5O E;  4DIR A;  2KNE A;  1BT6 A;  2QEO A;  1S36 A;  1S5G Y;  2KBM A;  4GUK A;  2O5G A;  2JWW A;  5BPJ A;  3NSL A;  5K89 A;  1AP4 A;  5DKR A;  1KFX S;  2F33 A;  2LP3 A;  1W7I B;  4R1E A;  3HCM A;  3O2P A;  1MXL C;  1CTR A;  4KYN A;  1PSB A;  2L50 A;  1B8C A;  1BOD A;  3I5G C;  3VRN A;  2M0R A;  2CTN A;  2Y1N A;  1WDC B;  1UWO A;  1CM1 A;  2JUL A;  2LHI A;  3UO9 A;  2KQ6 A;  2JC2 A;  1XFR A;  1SRA A;  3LLE A;  1XA5 A;  3SG6 A;  3KEV A;  1IQ3 A;  1F55 A;  3OP0 A;  2OTG C;  1UUR A;  2K61 A;  3PSR A;  4I5K A;  2P70 A;  1H4B A;  4GAO A;  2JTT A;  1LS8 A;  2K2A A;  4XJK A;  4BY5 A;  2M8U A;  1N0Y A;  1XFW O;  4OV2 A;  4N5X A;  1LA0 A;  1MR8 A;  2LVI A;  1UHN A;  1K95 A;  1A2X A;  2L4I A;  1KFX L;  3IF7 A;  1KFU S;  1UHH A;  4JWQ A;  2LE9 B;  3WHT B;  4YGB B;  1QV0 A;  4NDC A;  4YI9 A;  1CLB A;  1E8A A;  3BYA A;  3V2L A;  1B7T Y;  3R1P A;  3EG5 B;  2ZRT A;  4A4B A;  1DJG A;  4GGN A;  4PHJ A;  3ZNI A;  2L2C A;  5I2O A;  2GTE A;  1K9K A;  2OPO A;  1OOG A;  1P28 A;  3L4L A;  4OZD A;  1SW8 A;  1SK6 D;  1F71 A;  2B1U A;  3TS5 B;  2KAY A;  2M1U A;  1GJY A;  1OQP A;  1H8B A;  1TNW A;  3I5H C;  1LA3 A;  1MXE A;  1SSE B;  1ZOT B;  3I5G B;  3MSE B;  1NWD A;  4JKT A;  4MZK A;  3BUW B;  2ZNE A;  5AEQ A;  3SS3 A;  4F7F A;  4QJ5 B;  1BLQ A;  2LP2 A;  3EVU A;  2M9G A;  1C7V A;  1KFU L;  4IL1 A;  2KDH A;  3CR2 A;  3SIB A;  2OTG B;  1AHR A;  3SS5 A;  3DY9 A;  3QME A;  1B8L A;  2WCL A;  1RJV A;  2A4J A;  2KGR A;  2D8N A;  2F2O A;  1A29 A;  1BG1 A;  4YGA A;  2M29 A;  3AAK A;  1A4P A;  1K8U A;  3BUO B;  2CNP A;  1SY9 A;  3FIA A;  1SMG A;  4DUQ A;  1KK7 Y;  4U8D A;  2O60 A;  2KI4 B;  1DVI A;  2K8M B;  2LLS A;  2LVJ A;  3EVR A;  5PAL A;  1W7J B;  3SG7 A;  1AK8 A;  2AMI A;  4XJK B;  1Y1A A;  4HRH A;  2FOT A;  2KPH A;  3I5F B;  1BMO A;  1XVJ A;  5HKW A;  1CDL A;  2R2I A;  1N2D A;  1LXF C;  2PQL A;  2LVK A;  5D7F A;  1TUJ A;  3PN7 C;  5D69 A;  3I5H B;  1A03 A;  1IJ6 A;  1EXR A;  3FS7 A;  3SG5 A;  4CFR A;  1B4C A;  1HT9 A;  4INW A;  2WND A;  2LLU A;  1NSH A;  1BR1 B;  3FE8 A;  1NUB A;  1YUR A;  2JT8 A;  1DJH A;  2KI6 D;  3K1E A;  4MVF A;  4PE0 A;  1GM0 A;  4N1G A;  1OOF A;  4OVN F;  2K7B A;  1SL7 A;  1F54 A;  4MBE A;  2IS9 A;  5AFP A;  1BJF A;  1IQ5 A;  1WLZ A;  5B8I B;  2KBI A;  4P2Y B;  2GGM A;  3CZT X;  3DYE A;  1DTL A;  1YUU A;  1S1E A;  2CCM A;  2EGD A;  2GV5 A;  1QAT A;  4PE1 A;  4ORC B;  1CNP A;  2NXQ A;  2JNF A;  2MJW B;  4MSP A;  3D73 A;  1J7P A;  1K90 D;  3VRQ A;  3CZ2 A;  4D1E A;  1WRZ A;  1TNP A;  4I5N B;  1K2H A;  3OB1 B;  2LNK A;  4M2Q A;  4WQ3 A;  4CLN A;  1PVA A;  2HQW A;  1RTP 1;  3DVM A;  3EKH A;  3QRX A;  5HL1 A;  4GBA A;  2H8V A;  2TN4 A;  3GOF A;  4MZL A;  5DKN A;  1CM4 A;  1G8I A;  5G08 A;  3CAB A;  1YX8 A;  1DJZ A;  3S0A A;  1RFJ A;  4PAL A;  4INX A;  1BOC A;  4ORB B;  1SL8 A;  4JQ0 D;  2FJU B;  4MRY A;  5DKQ A;  2WCH A;  3F45 A;  4YBH B;  1WRL A;  1TN4 A;  2L2E A;  1XFX O;  3PN7 B;  2PVB A;  3TDI A;  4E68 A;  3B7A A;  2LUX A;  3L4A A;  3TS5 C;  2CBL A;  1Z4H A;  2I7A A;  1OOH A;  2CXJ A;  2LM5 A;  2WCM A;  1JFJ A;  1IGV A;  1ORG A;  1NX1 A;  1QLK A;  1Y6W A;  1QAS A;  2F3Z A;  2K7D A;  4PHM A;  2QEV A;  2WCE A;  2FCE A;  4YGE B;  2SCP A;  1IG5 A;  3FWC A;  1UHJ A;  1XYD A;  1SKT A;  3L47 A;  2H61 A;  1RRO A;  1SR6 C;  3BUX B;  4HRE E;  2KFF A;  3RZS A;  1QTX A;  3CWG A;  4PHK A;  2M49 B;  2I18 A;  3A4U B;  3EK4 A;  3OB2 B;  1AJ5 A;  1SNL A;  3BFH A;  3FE6 A;  3JVT C;  2JXL A;  2JOJ A;  3GK4 X;  3IVT A;  5GQQ C;  1SCV A;  1Q80 A;  2DOQ A;  1QLS A;  3O4X A;  2PYQ A;  1GGW A;  1WY9 A;  2M7N A;  4PE7 A;  3EK7 A;  1ODB A;  3OGN A;  5FI2 A;  4F0Z B;  3N7H A;  2NCP A;  2Y5I A;  3ICB A;  1DGV A;  3C1V A;  3BUM B;  1MWN A;  2RGI A;  1QX2 A;  4OR9 B;  5IBW A;  3TDZ A;  2KI4 C;  4N1F A;  3JTD B;  3UNW A;  2BAP A;  1JFK A;  1SL9 A;  2JPT A;  3D76 A;  5KTY A;  3I5F C;  4WQ2 A;  1NPQ A;  4QJ3 B;  1QVI Z;  3LK0 A;  3GK1 A;  3BFA A;  1QV1 A;  2L51 A;  1XK4 A;  2LAP A;  1OE9 B;  3DVE A;  3NXA A;  2NCO A;  1X02 A;  3BOW A;  2HPS A;  2WC6 A;  2E6W A;  2WC5 A;  3KO0 A;  4GFT A;  1AVS A;  4YRU A;  4NDD A;  1SBJ A;  2MAZ A;  4PDZ A;  3R72 A;  4OCI A;  1DQE A;  2K60 A;  2ZRS A;  1YUT A;  3TZ1 A;  2L4H A;  2ZN8 A;  4YI8 A;  1JWD A;  1J55 A;  1PSR A;  1SR6 B;  5EL2 A;  3CLN A;  1XK4 C;  2K0J A;  3SG2 A;  4AQJ A;  1B1G A;  1QS7 A;  2VRG A;  1YTZ C;  3JVT B;  2KAV A;  2KFG A;  5DIC A;  1NX0 A;  3NSO A;  1DF0 A;  5I2Q A;  1OZS A;  4QJ4 B;  3R1V A;  2CT9 A;  2MA2 A;  1V1F A;  3BXK A;  2BCX A;  2KSP A;  2QEH A;  2QPT A;  3DF0 A;  3OBV A;  1ALV A;  1KK8 C;  5AER A;  1GGZ A;  5AXI A;  3M0W A;  3S0F A;  4FQT A;  3Q8I A;  1FPW A;  5HKZ A;  1L2O C;  3KPX A;  3RM1 A;  1JSA A;  1A75 A;  3EVV A;  1S26 D;  3CZ0 A;  2K7O A;  3WXA A;  5KSZ A;  2JRF A;  3DVK A;  1ZFS A;  2BBN A;  1TNQ A;  4C0K A;  1CFP A;  2WCK A;  2Q4U A;  3PAT A;  2BCA A;  3WNX B;  1HQV A;  2M3W A;  3VRR A;  2JT0 A;  2AUC A;  4GPL B;  1J1D A;  2H2K A;  3D78 A;  3K21 A;  1GQM A;  1NIW A;  2KGB C;  2P6B B;  1FF1 A;  2G9B A;  2JU0 A;  1F4Q A;  1TCO B;  2ISD A;  2WOS A;  1XFV O;  1Y1X A;  4MZJ A;  3PM2 A;  1IRJ A;  3AKB A;  4MEW A;  1C07 A;  3S0G A;  1KCY A;  2BL0 C;  1B9A A;  5CSJ A;  4ORA B;  2KHN A;  1DJY A;  2NLN A;  1J7Q A;  4HRG A;  2BE6 A;  1QIV A;  1NCY A;  1XFY O;  4AOM A;  3KHE A;  1SYM A;  3BOW B;  2KYF A;  3CR4 X;  1YR5 A;  1JUO A;  1LKJ A;  1NCX A;  1U5I A;  1WLM A;  2LMV A;  1S5G Z;  3SS4 A;  3IQQ A;  1YRU B;  1KSM A;  1TIZ A;  2AAO A;  2WOR A;  2KOT A;  3R1O A;  1CFC A;  5JOL A;  1CMF A;  2BEC A;  1MF8 B;  1KK8 B;  2MLE C;  3LCP C;  4ZCV A;  2PAL A;  2GGZ A;  1QX7 A;  2LV7 A;  3OHM B;  1C3Y A;  2QEB A;  4XYN A;  3CTN A;  1RWY A;  1L2O B;  2PSR A; 
#chains in the Genus database with same CATH homology
 1M63 B;  3O6B A;  2PMY A;  3WHU B;  1VRK A;  2L0P A;  1EJ3 A;  1S3P A;  4JPZ B;  1YUS A;  2KYC A;  4C0L A;  1DF0 B;  5CSI A;  4ETO A;  3AAJ A;  1JF2 A;  1K9P A;  2LUC A;  1G33 A;  1J1E A;  3DF0 B;  3CR5 X;  1EH2 A;  2BKI B;  3JTD C;  5I2L A;  1M46 A;  5TNC A;  5HLV A;  1KWO C;  1A75 B;  2I2R E;  4FTG A;  1DGU A;  3SIA A;  4PE4 A;  4CFQ A;  4MRX A;  4DRW A;  1PAL A;  2K7C A;  1RK9 A;  3BQ3 A;  2BL0 B;  1J7O A;  2COL B;  2JT3 A;  3D10 A;  4HSZ A;  1KQV A;  1SCM C;  1S6J A;  1CKK A;  1TCF A;  1D1O A;  1B7T Z;  2MLF C;  1M31 A;  1OOJ A;  2KFH A;  3D0Y B;  3ZWH A;  1PRW A;  4TNC A;  2QAC A;  1BU3 A;  1NCZ A;  2EHB A;  2JZI A;  1K9U A;  1EG4 A;  2K2F A;  1B8R A;  2HET A;  1XO5 A;  4M2P A;  2OS8 C;  1ALW A;  1CFD A;  1J7R A;  2JQ6 A;  1NP8 A;  1YVL A;  2BKH B;  5J3X A;  3VRO A;  1CMG A;  2LVV A;  1FI6 A;  1M39 A;  2JXC A;  1V1G A;  2BBM A;  4ZCU A;  4BY4 A;  1CDM A;  2Y4Q A;  1MQ1 A;  1U5I B;  3EK8 A;  4NQG A;  2H61 C;  2LLT A;  1AJ4 A;  2LC5 A;  1QJT A;  3TDU A;  1OSA A;  2LHL A;  4GNK B;  1CLM A;  2ZND A;  1OMV A;  4Q04 A;  1R6P A;  1KWO B;  3A8R A;  5F6T A;  5AAN A;  1OMR A;  1KSO A;  1BR4 B;  2V53 A;  5HYD A;  1IKU A;  1XFU O;  3I5I B;  4WRI A;  3DD4 A;  4DCK A;  2F2P A;  4OKH A;  1REC A;  4CID A;  1K94 A;  1SCM B;  1JBA A;  1OMD A;  1DT7 B;  1KK7 Z;  2BE4 A;  3VRP A;  2FCD A;  3VGO A;  1PK0 D;  2KI6 C;  3LK1 A;  5ER5 A;  2WCB A;  1L7Z A;  1EG3 A;  1N65 A;  2PRU A;  3BUN B;  3PFV A;  1ZMZ A;  4FQO A;  3PM8 A;  4NDB A;  2OS8 B;  1ZUZ A;  2EC6 C;  1WRK A;  3FWB A;  4DS7 A;  3OX5 A;  2PAS A;  3DVJ A;  1LVC D;  1SPY A;  3GK2 A;  3AKA A;  1YVH A;  2MBX A;  1TRF A;  3CS1 A;  1QXP A;  2KAX A;  2F8P A;  4YGD B;  4MLW A;  1UP5 A;  1PVB A;  1XFZ O;  3NSK A;  1BF5 A;  1AUI B;  1S6C A;  2Y1M A;  3HX4 A;  1QIW A;  3CGA A;  1KQM C;  1IH0 A;  2I94 A;  1NX2 A;  1QVI Y;  2ZN9 A;  3SG4 A;  3IQO A;  1FW4 A;  5CSN A;  4USL A;  1F70 A;  3D0Y A;  1NYA A;  4CPV A;  2M1K B;  3PAL A;  4I5L B;  4A4C A;  1TTX A;  4C0J A;  1CFF A;  1DJX A;  2MHH A;  4I5J A;  3NSI A;  3EKJ A;  3RLZ A;  3TUY C;  1YX7 A;  1PUL A;  2L98 A;  1Y1U A;  1OZO A;  4UPG A;  1CLL A;  1DMO A;  3E3R A;  5KU1 A;  2Q91 A;  2KQY A;  1EL4 A;  5HKY A;  2EC6 B;  1NX3 A;  1UHI A;  2WCF A;  4PCW A;  1G4Y R;  1CDP A;  4MN0 A;  1QX5 B;  4M2O A;  5ER4 X;  2LMT A;  4PHN A;  1JF0 A;  4AQI A;  2ZKM X;  1MUX A;  4GGF A;  5CPV A;  1IJ5 A;  1K96 A;  1UHK A;  1F4O A;  1CDN A;  1LIN A;  2G2B A;  2BCB A;  3O78 A;  1S6I A;  1UUS A;  5JJG A;  2E30 A;  1IWQ A;  1WDC C;  1KQM B;  3O4Y A;  1F8H A;  2WC8 A;  1DJI A;  4ICB A;  1M45 A;  3H4S E;  1CB1 A;  2LAN A;  2SAS A;  2NZ0 A;  1FBV A;  2HF5 A;  1FI5 A;  2MRD A;  2M97 A;  2ZFD A;  1MHO A;  1K93 D;  3OX6 A;  2M7L A;  4GGF C;  1JC2 A;  1R2U A;  3PLF B;  3SG3 A;  2F3Y A;  3I5I C;  5CSF A;  2JNX A;  5HLO A;  1TOP A;  3TUY B;  2LMU A;  2HQ8 A;  3KF9 A;  2JTZ A;  1B47 A;  4YGC B;  3SJS A;  3LL8 B;  4L9M A;  1ZAC A;  5I8N A;  2LCP A;  1Y0V H;  1YRT B;  1DJW A;  2L5X B;  1C7W A;  5FYX A;  1TNX A;  4P5O E;  4DIR A;  2KNE A;  1BT6 A;  1S36 A;  1S5G Y;  2KBM A;  4GUK A;  2O5G A;  2JWW A;  5BPJ A;  3NSL A;  5K89 A;  1AP4 A;  5DKR A;  1KFX S;  2F33 A;  2LP3 A;  1W7I B;  4R1E A;  3HCM A;  3O2P A;  1MXL C;  1CTR A;  1PSB A;  2L50 A;  1B8C A;  1BOD A;  3I5G C;  3VRN A;  2M0R A;  2CTN A;  2Y1N A;  1WDC B;  1UWO A;  1CM1 A;  2JUL A;  2LHI A;  2KQ6 A;  2JC2 A;  3LLE A;  1SRA A;  3SG6 A;  1XA5 A;  3KEV A;  1IQ3 A;  1F55 A;  3OP0 A;  2OTG C;  1UUR A;  2K61 A;  3PSR A;  4I5K A;  1H4B A;  4GAO A;  2JTT A;  2K2A A;  4XJK A;  4BY5 A;  2M8U A;  1N0Y A;  1XFW O;  4OV2 A;  4N5X A;  1LA0 A;  1MR8 A;  2LVI A;  1UHN A;  1K95 A;  1A2X A;  2L4I A;  1KFX L;  3IF7 A;  1KFU S;  1UHH A;  4JWQ A;  2LE9 B;  3WHT B;  4YGB B;  1QV0 A;  4NDC A;  4YI9 A;  1CLB A;  1E8A A;  3BYA A;  1B7T Y;  2ZRT A;  4A4B A;  1DJG A;  4GGN A;  4PHJ A;  3ZNI A;  5I2O A;  1K9K A;  2OPO A;  1SW8 A;  1SK6 D;  1F71 A;  2B1U A;  3TS5 B;  2KAY A;  2M1U A;  1GJY A;  1OQP A;  1H8B A;  1TNW A;  3I5H C;  1LA3 A;  1MXE A;  1ZOT B;  3I5G B;  3MSE B;  1NWD A;  4QJ5 B;  4MZK A;  3BUW B;  2ZNE A;  5AEQ A;  1BLQ A;  2LP2 A;  3EVU A;  2M9G A;  1C7V A;  1KFU L;  4IL1 A;  2KDH A;  3CR2 A;  3SIB A;  2OTG B;  1AHR A;  1B8L A;  1RJV A;  2A4J A;  2KGR A;  2D8N A;  2F2O A;  1A29 A;  1BG1 A;  4YGA A;  2M29 A;  3AAK A;  1A4P A;  1K8U A;  3BUO B;  2CNP A;  1SY9 A;  3FIA A;  1SMG A;  4DUQ A;  1KK7 Y;  4U8D A;  2O60 A;  2KI4 B;  1DVI A;  2K8M B;  2LLS A;  2LVJ A;  3EVR A;  5PAL A;  1W7J B;  3SG7 A;  1AK8 A;  2AMI A;  4XJK B;  1Y1A A;  4HRH A;  2FOT A;  3I5F B;  1BMO A;  1XVJ A;  5HKW A;  1CDL A;  2R2I A;  1N2D A;  1LXF C;  2LVK A;  5D7F A;  3PN7 C;  5D69 A;  3I5H B;  1A03 A;  1IJ6 A;  1EXR A;  3FS7 A;  3SG5 A;  4CFR A;  1B4C A;  1HT9 A;  2WND A;  2LLU A;  1NSH A;  1BR1 B;  4MVF A;  1NUB A;  1YUR A;  2JT8 A;  1DJH A;  2KI6 D;  4PE0 A;  4N1G A;  4OVN F;  2K7B A;  1F54 A;  4MBE A;  2IS9 A;  5AFP A;  1BJF A;  1IQ5 A;  1WLZ A;  5B8I B;  2KBI A;  4P2Y B;  2GGM A;  3CZT X;  1DTL A;  1YUU A;  1S1E A;  2CCM A;  2EGD A;  2GV5 A;  1QAT A;  4PE1 A;  4ORC B;  1CNP A;  2NXQ A;  2JNF A;  2MJW B;  4MSP A;  1J7P A;  1K90 D;  3VRQ A;  4D1E A;  1K2H A;  1WRZ A;  1TNP A;  4I5N B;  3OB1 B;  2LNK A;  4M2Q A;  4WQ3 A;  4CLN A;  1PVA A;  2HQW A;  1RTP 1;  3DVM A;  3EKH A;  3QRX A;  4GBA A;  2TN4 A;  3GOF A;  4MZL A;  5DKN A;  1CM4 A;  1G8I A;  5G08 A;  1YX8 A;  1DJZ A;  1RFJ A;  4PAL A;  1BOC A;  4ORB B;  1SL8 A;  4JQ0 D;  2FJU B;  4MRY A;  5DKQ A;  3F45 A;  4YBH B;  1WRL A;  1TN4 A;  2L2E A;  1XFX O;  3PN7 B;  2PVB A;  3TDI A;  4E68 A;  2LUX A;  3TS5 C;  2CBL A;  2I7A A;  2CXJ A;  2LM5 A;  1JFJ A;  1IGV A;  1NX1 A;  1QLK A;  1Y6W A;  1QAS A;  2F3Z A;  2K7D A;  4PHM A;  2WCE A;  2FCE A;  4YGE B;  2SCP A;  1IG5 A;  3FWC A;  1UHJ A;  1XYD A;  1SKT A;  2H61 A;  1RRO A;  1SR6 C;  3BUX B;  4HRE E;  2KFF A;  1QTX A;  3CWG A;  4PHK A;  2M49 B;  2I18 A;  3A4U B;  3EK4 A;  3OB2 B;  1AJ5 A;  1SNL A;  3JVT C;  2JXL A;  2JOJ A;  3GK4 X;  5GQQ C;  1SCV A;  1Q80 A;  2DOQ A;  1QLS A;  1GGW A;  1WY9 A;  2M7N A;  4PE7 A;  3EK7 A;  1ODB A;  4F0Z B;  2NCP A;  2Y5I A;  3ICB A;  1DGV A;  3C1V A;  3BUM B;  1MWN A;  2RGI A;  1QX2 A;  4OR9 B;  5IBW A;  3TDZ A;  2KI4 C;  4N1F A;  3JTD B;  1JFK A;  1SL9 A;  2JPT A;  5KTY A;  3I5F C;  4WQ2 A;  1NPQ A;  4QJ3 B;  1QVI Z;  3LK0 A;  3GK1 A;  1QV1 A;  2L51 A;  1XK4 A;  2LAP A;  1RWY A;  1OE9 B;  3DVE A;  3NXA A;  2NCO A;  1X02 A;  3BOW A;  2HPS A;  4YRU A;  2E6W A;  3KO0 A;  4GFT A;  1AVS A;  4NDD A;  1SBJ A;  2MAZ A;  4PDZ A;  4OCI A;  2ZRS A;  1YUT A;  3TZ1 A;  2L4H A;  2ZN8 A;  4YI8 A;  1JWD A;  1J55 A;  1PSR A;  1SR6 B;  3CLN A;  1XK4 C;  2K0J A;  3SG2 A;  4AQJ A;  1B1G A;  1QS7 A;  2VRG A;  1YTZ C;  3JVT B;  2KAV A;  2KFG A;  1NX0 A;  3NSO A;  1DF0 A;  5I2Q A;  1OZS A;  4QJ4 B;  2CT9 A;  2MA2 A;  1V1F A;  3BXK A;  2BCX A;  2KSP A;  2QPT A;  3DF0 A;  5AER A;  1ALV A;  1KK8 C;  1GGZ A;  5AXI A;  3M0W A;  1FPW A;  5HKZ A;  1L2O C;  3KPX A;  3RM1 A;  1JSA A;  1A75 A;  3EVV A;  1S26 D;  3WXA A;  2K7O A;  5KSZ A;  2JRF A;  3DVK A;  1ZFS A;  2BBN A;  1TNQ A;  4C0K A;  1CFP A;  2Q4U A;  3PAT A;  2BCA A;  3WNX B;  1HQV A;  2M3W A;  3VRR A;  2JT0 A;  2AUC A;  4GPL B;  1J1D A;  2H2K A;  3K21 A;  1GQM A;  1NIW A;  2KGB C;  2P6B B;  1FF1 A;  2G9B A;  2JU0 A;  1F4Q A;  1TCO B;  2ISD A;  2WOS A;  1XFV O;  1Y1X A;  4MZJ A;  1IRJ A;  3AKB A;  4MEW A;  1C07 A;  1KCY A;  2BL0 C;  1B9A A;  5CSJ A;  4ORA B;  2KHN A;  1DJY A;  2NLN A;  1J7Q A;  4HRG A;  2BE6 A;  1QIV A;  1NCY A;  1XFY O;  4AOM A;  3KHE A;  1SYM A;  3BOW B;  2KYF A;  3CR4 X;  1YR5 A;  1JUO A;  1LKJ A;  1NCX A;  1U5I A;  1WLM A;  2LMV A;  1S5G Z;  3IQQ A;  1YRU B;  1KSM A;  1TIZ A;  2AAO A;  2WOR A;  2KOT A;  1CFC A;  5JOL A;  1CMF A;  2BEC A;  1MF8 B;  1KK8 B;  2MLE C;  3LCP C;  4ZCV A;  2PAL A;  2GGZ A;  1QX7 A;  2LV7 A;  3OHM B;  4XYN A;  3CTN A;  1SL7 A;  1L2O B;  2PSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...