1QVIY

Crystal structure of scallop myosin s1 in the pre-power stroke state to 2.6 angstrom resolution: flexibility and function in the head
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
141
structure length
141
Chain Sequence
LPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated muscle
publication title Crystal structure of scallop Myosin s1 in the pre-power stroke state to 2.6 a resolution: flexibility and function in the head.
pubmed doi rcsb
molecule tags Contractile protein
total genus 41
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qviY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qviY02
2AUCA 4C0LA 1CFDA 3WXAA 4DCKA 1YUTA 1UHIA 2Q91A 4QJ5B 2BCXA 3EK8A 5DKNA 1KK7Z 3KEVA 1PULA 1L2OC 1KK8C 1IKUA 2R2IA 4HRHA 3RLZA 1S6IA 1J1DA 3BUNB 1F55A 2F33A 3BUOB 5D69A 1W7JB 1WY9A 1K9PA 2L0PA 2BECA 4A4CA 2OS8B 2FJUB 4DS7A 2KI6D 3NSLA 4BY5A 2K8MB 4ICBA 1IH0A 3SG2A 3I5GB 1SL7A 3LL8B 4YRUA 2HQWA 2JULA 2ZNDA 3PN7B 2BBNA 4PHKA 5CSJA 2ZNEA 2LANA 1U5IA 3EKHA 1SCMC 1VRKA 1PALA 1RWYA 1TCFA 2L50A 1AUIB 1Q80A 1ZFSA 2AMIA 1UP5A 3M0WA 4IL1A 1IJ5A 2MBXA 4P5OE 5J3XA 3LCPC 2EC6C 1ZMZA 2BKHB 1FI6A 3ZWHA 4JPZB 2L4HA 1NX2A 1XO5A 1UURA 1RECA 2MRDA 5JOLA 2LVJA 3NSKA 4N1FA 1Y1UA 3OX6A 1OZOA 1CLLA 3K21A 1XFWO 4OKHA 5BPJA 1KFUL 3CGAA 2H61A 1BF5A 2EHBA 2JXCA 4PE7A 2B1UA 1QLKA 4NDBA 2JTTA 2KGBC 3TDIA 2KFHA 1XFUO 2F3ZA 1RK9A 1TCOB 4A4BA 3AKBA 2SASA 1QVIZ 4YGEB 4UPGA 1XVJA 2M9GA 4P2YB 1MWNA 1AJ5A 2CTNA 2LLUA 4L9MA 3C1VA 1YUSA 2CNPA 3HCMA 1XFVO 1J7QA 2KNEA 2MJWB 2JTZA 3OHMB 1CB1A 3O2PA 1MR8A 2LVIA 3BQ3A 2JXLA 2JT8A 2WORA 3TUYC 1JFKA 1S1EA 3OP0A 4GNKB 2NXQA 3GK2A 2Y5IA 1EJ3A 1X02A 1JF2A 3CS1A 4ORAB 1LINA 1YURA 1XFXO 1C7WA 1MUXA 1QXPA 2L98A 3VGOA 4GFTA 1UHKA 4MZKA 1CDPA 1NX1A 4YGDB 1SMGA 2KYFA 2ZKMX 3PALA 4XJKA 2WCBA 1EXRA 1DF0A 1NWDA 1PVBA 4NQGA 5HLVA 5IBWA 1AVSA 3A4UB 3SJSA 2GGZA 1NUBA 3BUMB 2OTGC 3I5HC 5TNCA 1H4BA 2ZRTA 1W7IB 2JU0A 1JUOA 1WRKA 1YX7A 3WHUB 1V1GA 1SRAA 2H61C 3GK1A 3LK1A 1B8LA 3FWBA 1PSBA 1TOPA 1QX5B 4WQ3A 1Y1XA 1CDLA 2OPOA 1FBVA 1TNQA 1F70A 5I2OA 3LK0A 1K9KA 1SL8A 1QASA 1V1FA 2KBIA 2JRFA 1MF8B 3DVMA 2HPSA 1IGVA 1SK6D 1CMFA 1CDNA 1PSRA 2KYCA 1SL9A 3OB2B 1SY9A 2E6WA 1YR5A 1F71A 4WRIA 4MZJA 1XFZO 2L5XB 2BBMA 2MLFC 1BOCA 1PK0D 2KOTA 1S26D 3JTDC 1Y1AA 1FPWA 2WNDA 1WDCC 2JT3A 5F6TA 1DJXA 5PALA 1XA5A 2KFFA 1TTXA 4DUQA 3AKAA 1FI5A 2K7CA 2KSPA 2LMVA 3BOWB 4FTGA 1A75B 1B47A 4JWQA 5AANA 1KQMB 1K90D 4F0ZB 1BG1A 1F8HA 1QLSA 1UWOA 4USLA 3SIBA 1JSAA 2JPTA 1IQ3A 2L51A 4OR9B 3TS5C 3SG3A 1F4OA 2K2FA 4CLNA 2IS9A 2K0JA 1RFJA 4AOMA 1YVLA 2ZN8A 2KAXA 1JWDA 4GUKA 2K61A 3CR4X 2Y4QA 1GGZA 2NCOA 1EG3A 1KWOC 4MSPA 4HRGA 4AQJA 1M39A 2KI4B 2SCPA 2KBMA 2LM5A 1BR4B 3DVEA 1JC2A 3DF0B 3SG7A 1YTZC 4ORCB 2WC8A 4I5JA 4PE1A 4BY4A 2K2AA 3D0YB 4HSZA 1DJHA 1XK4A 2JOJA 1J7RA 2QPTA 1DGUA 2ZFDA 1DT7B 2LMUA 4Q04A 1NSHA 5CSNA 3I5IB 3JVTB 1YVHA 2BL0B 1AK8A 1YRTB 2NCPA 1DJYA 1KSMA 1LXFC 1UUSA 2PVBA 3TUYB 1S5GY 1IWQA 3KF9A 4ZCVA 2WCFA 2LVKA 3FIAA 2LLSA 3GOFA 3DVJA 5D7FA 1XYDA 3EVUA 3NSIA 2LV7A 3PLFB 1B7TY 1A03A 1U5IB 1NCYA 5CSFA 1TRFA 2K7DA 1KQVA 2ISDA 1J55A 3KO0A 3KHEA 1WLZA 3I5FB 3PFVA 4PCWA 3SIAA 1CMGA 4AQIA 2OS8C 1A2XA 2TN4A 4YGCB 4DRWA 2L2EA 2RGIA 4MLWA 1QX7A 1CM4A 4ORBB 5ER4X 5HKZA 3I5GC 1B9AA 1M31A 3PN7C 2BE4A 1K8UA 1QJTA 5KU1A 2OTGB 2MLEC 2NZ0A 4FQOA 2F2OA 1IQ5A 3NSOA 2KFGA 3BUWB 1BJFA 1YUUA 1SR6B 1BMOA 2LHLA 2L4IA 2LNKA 4OCIA 1QX2A 2K7BA 1LKJA 1ODBA 1B8CA 1G4YR 5AEQA 1M46A 5AFPA 1EL4A 4MRXA 1B4CA 2H2KA 3CTNA 4MEWA 4ETOA 1CNPA 1DJGA 2F2PA 4PALA 5I2QA 2LMTA 3SG4A 1OSAA 2KAVA 4PE4A 2O5GA 1XK4C 3ZNIA 5HKYA 1K2HA 1QV1A 1KCYA 3TDZA 1MXLC 2MAZA 4PDZA 2O60A 2A4JA 3EK7A 5KTYA 1PVAA 1DMOA 1L7ZA 3LLEA 3AAKA 3RM1A 4MBEA 2LP3A 2PRUA 1SCVA 5K89A 2CBLA 1ALVA 1L2OB 1KK8B 1KFUS 1B1GA 4NDCA 1ALWA 4QJ3B 1TNWA 3ICBA 1CDMA 2LUXA 4OV2A 1S3PA 4GGFA 1SKTA 4M2PA 1KK7Y 1RROA 1ZOTB 3TZ1A 1RJVA 5DKQA 1DJIA 2BCAA 2M8UA 2KQYA 3O4YA 2I94A 4QJ4B 4XYNA 4YGAA 4TNCA 5HYDA 4DIRA 3VRQA 1SCMB 1G33A 3CR5X 1OQPA 1CKKA 3BXKA 1RTP1 3PM8A 5ER5A 2FOTA 4YGBB 3H4SE 1J1EA 3CWGA 1AP4A 1N0YA 3O6BA 1JFJA 1BU3A 2EC6B 4I5LB 1DGVA 1G8IA 3EK4A 1CFCA 2PASA 2CT9A 1YX8A 1QTXA 1SPYA 2Q4UA 2LE9B 1PRWA 1DJZA 3CZTX 3VRRA 1CLMA 2HF5A 2BE6A 2NLNA 1KSOA 2Y1MA 3DF0A 1KFXL 3D0YA 1QV0A 3KPXA 3PSRA 5DKRA 1WRZA 2MA2A 3OX5A 1FW4A 4YI8A 1HT9A 2CXJA 1SBJA 1F54A 2JC2A 1NX3A 1K93D 1OZSA 3FS7A 2PMYA 5AERA 1BLQA 2FCEA 2WOSA 3BUXB 1ZACA 1A4PA 1CFFA 2LCPA 4CIDA 1WLMA 1QVIY 1IG5A 4GGFC 1K94A 1NYAA 1C7VA 4N1GA 3VRPA 2GV5A 1SYMA 4GAOA 1QS7A 2M97A 5I2LA 5GQQC 3QRXA 3SG5A 3WNXB 2E30A 3D10A 1EH2A 2LUCA 1AJ4A 1Y6WA 1TNXA 1EG4A 2ZRSA 1KQMC 1LA0A 1UHHA 1XFYO 3NXAA 2EGDA 2GGMA 2LHIA 3BYAA 1GGWA 3CR2A 1E8AA 1GQMA 2HETA 1K9UA 2KGRA 2LAPA 2VRGA 5KSZA 1S6CA 1JBAA 3F45A 2WCEA 2DOQA 1TNPA 3EVRA 4PHJA 2PSRA 4U8DA 3O78A 4MN0A 1K96A 3DD4A 3I5HB 1H8BA 4PHMA 2KI4C 4CPVA 2AAOA 2M49B 1SW8A 3VRNA 1CM1A 2KI6C 4GBAA 1B8RA 1KFXS 2M1UA 2ZN9A 1WRLA 3OB1B 1BR1B 5CPVA 2KDHA 1S5GZ 2LLTA 4WQ2A 4CFRA 2CCMA 1N2DA 1NPQA 1UHNA 2I2RE 3EVVA 4YI9A 1BODA 4GPLB 2JWWA 4JQ0D 4HREE 3IF7A 1QATA 3I5IC 1B7TZ 3IQQA 3JVTC 4YBHB 1GJYA 2BL0C 2M0RA 1YRUB 3AAJA 1M63B 3SG6A 4M2OA 1OOJA 5HLOA 1IRJA 3IQOA 1NCXA 2F8PA 2LP2A 1LA3A 1M45A 1NIWA 3MSEB 1CFPA 1QIVA 1CLBA 2JNXA 1NP8A 3JTDB 1R6PA 1HQVA 2P6BB 5FYXA 5HKWA 1WDCB 1F4QA 3VROA 4CFQA 4I5KA 2G2BA 2KQ6A 1BT6A 4N5XA 2PALA 3I5FC 5AXIA 1CTRA 4PE0A 3DVKA 1C07A 2JZIA 3PATA 2BKIB 4GGNA 2FCDA 4MZLA 1Y0VH 2I7AA 3TS5B 2JNFA 5I8NA 3CLNA 1MXEA 1OMRA 4MVFA 1AHRA 4R1EA 1D1OA 2LC5A 2M1KB 4XJKB 1MHOA 2V53A 3A8RA 3EKJA 4C0KA 3GK4X 1IJ6A 2D8NA 1DF0B 1SR6C 2HQ8A 4E68A 1FF1A 5G08A 3BOWA 1KWOB 1A75A 4M2QA 1OMDA 1JF0A 4NDDA 1ZUZA 2COLB 4PHNA 1TIZA 2M3WA 3HX4A 1S36A 1QIWA 1LVCD 1TN4A 2MHHA 3FWCA 2JQ6A 3WHTB 2G9BA 5CSIA 5JJGA 2M7NA 4I5NB 1S6JA 1OMVA 4OVNF 1UHJA 2I18A 2M7LA 2Y1NA 1SNLA 3TDUA 1OE9B 4ZCUA 4D1EA 1DTLA 1NX0A 1A29A 2F3YA 2QACA 2LVVA 4MRYA 2KAYA 1NCZA 2K7OA 2JT0A 3E3RA 2M29A 5B8IB 1N65A 1R2UA 2BCBA 2KHNA 1K95A 1J7PA 1DJWA 1DVIA 1MQ1A 4C0JA 1J7OA
chains in the Genus database with same CATH superfamily
2AUCA 4C0LA 1CFDA 3BFAA 3WXAA 1YUTA 1UHIA 2Q91A 4DCKA 2BCXA 2P70A 3EK8A 5DKNA 1KK7Z 4QJ5B 3KEVA 1PULA 1L2OC 1KK8C 3CABA 1IKUA 2R2IA 4HRHA 3RLZA 1S6IA 1J1DA 3BUNB 1F55A 2F33A 3BUOB 5D69A 1W7JB 1WY9A 1Z2CB 1K9PA 2L0PA 2BECA 3FE6A 4A4CA 2OS8B 2FJUB 1OOFA 2KI6D 3NSLA 4BY5A 2K8MB 4ICBA 4DS7A 3SG2A 1IH0A 3I5GB 1SL7A 1TWOA 3LL8B 4YRUA 2HQWA 2JULA 2ZNDA 3PN7B 2BBNA 4PHKA 5CSJA 3S0AA 3CZ2A 2ZNEA 2LANA 1U5IA 3EKHA 3VB1A 1SCMC 1DELA 1VRKA 1PALA 1RWYA 1T14A 1TCFA 2L50A 1AUIB 1Q80A 1ZFSA 2AMIA 1UP5A 3M0WA 4IL1A 1IJ5A 5FI2A 4P5OE 5J3XA 2MBXA 3LCPC 2EC6C 1ZMZA 2JPOA 2BKHB 1FI6A 3ZWHA 4JPZB 2L4HA 1NX2A 1XO5A 1UURA 1RECA 2MRDA 5JOLA 2LVJA 3NSKA 4N1FA 1Y1UA 3OX6A 1OZOA 1CLLA 3K21A 1XFWO 4OKHA 3UO9A 5BPJA 1IIOA 2QDIA 1KFUL 3L4AA 3CGAA 2H61A 1BF5A 2EHBA 2JXCA 3NHTA 4PE7A 4JKTA 2B1UA 2PYQA 1QLKA 4NDBA 2JTTA 2KGBC 3TDIA 2KFHA 1XFUO 3S0DA 2L5YA 2F3ZA 1RK9A 1TCOB 4A4BA 1Z4HA 3AKBA 1D1OA 2SASA 1OOGA 1QVIZ 4YGEB 4UPGA 1XVJA 2M9GA 4P2YB 1MWNA 1AJ5A 2QEHA 1W9ZA 2CTNA 2LLUA 4L9MA 3C1VA 1YUSA 2CNPA 1C3YA 3HCMA 1XFVO 1J7QA 2KNEA 2MJWB 2JTZA 3OHMB 1CB1A 3O2PA 1MR8A 2LVIA 3BQ3A 2JXLA 2JT8A 2WORA 3TUYC 1GM0A 5EL2A 1JFKA 2WC5A 1S1EA 3OP0A 4GNKB 2NXQA 3GK2A 2Y5IA 1EJ3A 3SS4A 1X02A 1JF2A 3CS1A 4ORAB 2WC6A 1LINA 1YURA 1XFXO 1C7WA 1MUXA 1QXPA 3S0BA 2L98A 3VGOA 4GFTA 1UHKA 4MZKA 1CDPA 3QMEA 1NX1A 4YGDB 1SMGA 2KYFA 2ZKMX 3PALA 4XJKA 2WCBA 1EXRA 1DF0A 1NWDA 1PVBA 2P71A 4NQGA 5HLVA 5IBWA 1AVSA 3A4UB 3SJSA 2GGZA 3B7AA 1NUBA 3BUMB 2QEVA 2OTGC 3I5HC 5TNCA 1H4BA 2ZRTA 1W7IB 2JU0A 1JUOA 1WRKA 1YX7A 3WHUB 1V1GA 1SRAA 2H61C 3GK1A 3LK1A 1B8LA 3FWBA 1PSBA 1TOPA 1QX5B 3L47A 1Y1XA 4WQ3A 3S0EA 1CDLA 2OPOA 1FBVA 1TNQA 1F70A 5I2OA 3LK0A 1K9KA 1SL8A 1QASA 3Q8IA 1V1FA 2KBIA 2JRFA 1MF8B 3DVMA 2HPSA 1IGVA 1SK6D 1XFRA 1CMFA 1CDNA 1PSRA 2KYCA 1SL9A 3OB2B 1SY9A 2E6WA 1YR5A 4INXA 1F71A 4WRIA 3BFHA 4MZJA 1XFZO 2L5XB 2BBMA 2MLFC 3DXLA 1BOCA 1PK0D 3FE8A 2ERBA 1S26D 2KOTA 1Y1AA 3JTDC 1FPWA 2WNDA 3FE9A 1WDCC 2JT3A 5F6TA 1DJXA 5PALA 3DZTA 1XA5A 2KFFA 3RZSA 1TTXA 4DUQA 3AKAA 1FI5A 2K7CA 2KSPA 2LMVA 3BOWB 4FTGA 1A75B 1B47A 4JWQA 5AANA 4F7FA 1KQMB 1K90D 4F0ZB 2L2CA 1BG1A 1QLSA 1UWOA 4USLA 3SIBA 1F8HA 1JSAA 2JPTA 1IQ3A 2L51A 4OR9B 1DEKA 3TS5C 4PT1A 3SG3A 1F4OA 2K2FA 4CLNA 2IS9A 2K0JA 1RFJA 4AOMA 1YVLA 2ZN8A 2KAXA 1JWDA 5HL1A 4GUKA 2K61A 3CR4X 2Y4QA 1GGZA 2NCOA 1EG3A 1KWOC 4MSPA 4HRGA 4AQJA 1M39A 2KI4B 2SCPA 2KBMA 2LM5A 1BR4B 3B88A 3DVEA 1JC2A 3DF0B 3SG7A 1YTZC 4ORCB 2WC8A 4I5JA 4PE1A 4BY4A 2K2AA 3D0YB 2QEBA 4HSZA 3BFBA 1DC1A 1DJHA 1XK4A 1OW4A 3DY9A 3K1EA 2JOJA 1J7RA 2QPTA 1DGUA 2ZFDA 1DT7B 2LMUA 4Q04A 1NSHA 5CSNA 3I5IB 3JVTB 1YVHA 2BL0B 1AK8A 1YRTB 2NCPA 3CZ1A 2KLDA 1DJYA 1KSMA 1LXFC 1UUSA 2PVBA 3TUYB 1S5GY 1IWQA 3CDNA 3KF9A 4ZCVA 2WCFA 2LVKA 3FIAA 2LLSA 3GOFA 3DVJA 5D7FA 1XYDA 3EVUA 3NSIA 1P28A 2LV7A 3PLFB 1B7TY 3R1VA 1A03A 5I94A 1U5IB 1NCYA 5CSFA 1TRFA 2K7DA 1KQVA 2ISDA 1J55A 3KO0A 3KHEA 1WLZA 3I5FB 3PFVA 4PCWA 3SIAA 1CMGA 2WCKA 4AQIA 2OS8C 1A2XA 2TN4A 4YGCB 4DRWA 2L2EA 2RGIA 4MLWA 1QX7A 1CM4A 4ORBB 5ER4X 4KYNA 5HKZA 3I5GC 1B9AA 1M31A 3PN7C 2BE4A 1K8UA 1QJTA 5KU1A 2OTGB 2MLEC 2NZ0A 4FQOA 2F2OA 1IQ5A 3NSOA 3D75A 1TUJA 2KFGA 3BUWB 1BJFA 1YUUA 1SR6B 1BMOA 2LHLA 2L4IA 2LNKA 4OCIA 4OZDA 5FI6A 1QX2A 2K7BA 1LKJA 1ODBA 2PQLA 1B8CA 1G4YR 5AEQA 1M46A 5AFPA 1EL4A 3OBVA 4MRXA 1B4CA 2H2KA 3CTNA 3N7HA 4MEWA 4ETOA 1CNPA 1DJGA 2F2PA 4PALA 5I2QA 2LMTA 3SG4A 1OSAA 2KAVA 4PE4A 2O5GA 1XK4C 1QWVA 3ZNIA 5HKYA 1K2HA 1QV1A 3R1OA 2KLEA 1KCYA 3TDZA 1MXLC 2MAZA 4PDZA 2O60A 2A4JA 3EK7A 5KTYA 1PVAA 1DMOA 1L7ZA 3LLEA 3AAKA 3RM1A 4MBEA 2LP3A 2PRUA 1SCVA 5K89A 2CBLA 1ALVA 1L2OB 1KK8B 1KFUS 1B1GA 4NDCA 1ALWA 4QJ3B 1TNWA 3D78A 3NGVA 3ICBA 1CDMA 2LUXA 4OV2A 1S3PA 4GGFA 2H8VA 1SKTA 4M2PA 1KK7Y 3DYEA 1RROA 1ZOTB 3TZ1A 1RJVA 3OGNA 5DKQA 1DJIA 2BCAA 2M8UA 5FI7A 2KQYA 3D74A 3O4YA 2I94A 4QJ4B 3D77A 4XYNA 4YGAA 4TNCA 2GTEA 5HYDA 4DIRA 3VRQA 1SCMB 1G33A 2KPHA 3CR5X 1OQPA 1CKKA 3BXKA 1RTP1 3B87A 3PM8A 2FOTA 5ER5A 4YGBB 3H4SE 1J1EA 3CWGA 1AP4A 1N0YA 3O6BA 1JFJA 1BU3A 2EC6B 4I5LB 1DGVA 1G8IA 3EK4A 1CFCA 5I8NA 1SSEB 2PASA 2CT9A 1YX8A 1QTXA 3O4XA 1SPYA 2Q4UA 2LE9B 1PRWA 1DJZA 3CZTX 3VRRA 1CLMA 2HF5A 2BE6A 2NLNA 1KSOA 3SS5A 2Y1MA 3DF0A 1KFXL 3CYZA 4FQTA 3D73A 3D0YA 2QEOA 1QV0A 3KPXA 3PSRA 5DKRA 3S0GA 1C3ZA 1WRZA 2MA2A 3OX5A 1FW4A 5DICA 1TUZA 4YI8A 1HT9A 2CXJA 1SBJA 2YGUA 3IVTA 1F54A 2JC2A 1NX3A 1K93D 1OZSA 3FS7A 2PMYA 5AERA 1BLQA 2FCEA 2WOSA 3SS3A 3BUXB 1ZACA 1A4PA 1CFFA 1OOHA 2LCPA 4CIDA 1WLMA 1QVIY 1IG5A 2WCJA 4GGFC 1K94A 1NYAA 1C7VA 4N1GA 3VRPA 2GV5A 1SYMA 4GAOA 1QS7A 2M97A 5I2LA 4JD9A 5GQQC 3QRXA 3SG5A 3B86A 3WNXB 2E30A 3D10A 1EH2A 2LUCA 1AJ4A 5D3OA 1Y6WA 1TNXA 3R72A 1EG4A 2ZRSA 1KQMC 1LA0A 1UHHA 1XFYO 3NXAA 2EGDA 2GGMA 2WCMA 2LHIA 3BYAA 1GGWA 3CR2A 1E8AA 1GQMA 2HETA 1K9UA 2KGRA 2LAPA 2VRGA 3B6XA 1OOIX 1S6CA 5KSZA 1JBAA 3F45A 2WCEA 2DOQA 1TNPA 3EVRA 4PHJA 2PSRA 4U8DA 3O78A 1ORGA 4MN0A 1K96A 3DD4A 3I5HB 3PJIA 1H8BA 4PHMA 1DQEA 2KI4C 4CPVA 2AAOA 2M49B 1SW8A 3VRNA 1CM1A 1LS8A 2KI6C 4GBAA 1B8RA 2WCHA 1KFXS 2M1UA 2ZN9A 1WRLA 3OB1B 1BR1B 5CPVA 2KDHA 1S5GZ 2LLTA 4WQ2A 4CFRA 2CCMA 1N2DA 1NPQA 1UHNA 2I2RE 3EG5B 3EVVA 4YI9A 1BODA 4GPLB 2JWWA 4JQ0D 4HREE 3IF7A 1QATA 3I5IC 1B7TZ 3IQQA 3JVTC 4YBHB 1GJYA 2BL0C 2M0RA 2BAPA 1YRUB 3AAJA 1M63B 3D76A 3SG6A 4M2OA 1OOJA 5HLOA 1IRJA 4IJ7A 3IQOA 1NCXA 2F8PA 2LP2A 1LA3A 1M45A 1NIWA 3MSEB 3NHIA 1QIVA 3PM2A 2JNXA 1CFPA 1CLBA 1NP8A 3JTDB 1R6PA 1HQVA 2P6BB 5FYXA 5HKWA 3R1PA 1WDCB 1F4QA 3VROA 4CFQA 4I5KA 2G2BA 2KQ6A 1BT6A 2WCLA 4N5XA 2PALA 3I5FC 3CZ0A 1CTRA 4PE0A 3DVKA 5AXIA 1C07A 2JZIA 3PATA 2BKIB 4GGNA 2FCDA 4MZLA 1Y0VH 2I7AA 3TS5B 2JNFA 2BNXA 3CLNA 1MXEA 1OMRA 2K60A 1AHRA 4INWA 4MVFA 4R1EA 2LC5A 2M1KB 3BJHA 1MHOA 2V53A 3A8RA 3EKJA 4XJKB 4C0KA 3S0FA 3GK4X 1IJ6A 2D8NA 1DF0B 1SR6C 2HQ8A 4E68A 1FF1A 5G08A 3BOWA 1KWOB 1A75A 4M2QA 3L4LA 1OMDA 1JF0A 4NDDA 1ZUZA 3V2LA 2COLB 4PHNA 1TIZA 2M3WA 3HX4A 1S36A 1QIWA 1LVCD 1TN4A 2MHHA 3FWCA 2JQ6A 3WHTB 2G9BA 5CSIA 3UNWA 2M7NA 4I5NB 5JJGA 1S6JA 1OMVA 4OVNF 2FJYA 1UHJA 2I18A 2M7LA 2Y1NA 1SNLA 3TDUA 1OE9B 4ZCUA 4D1EA 1DTLA 1NX0A 1A29A 2F3YA 2QACA 2LVVA 4MRYA 2KAYA 1NCZA 2K7OA 2JT0A 3E3RA 2M29A 5B8IB 1N65A 1R2UA 2BCBA 2KHNA 1K95A 1J7PA 1DJWA 1DVIA 1MQ1A 4C0JA 1J7OA
chains in the Genus database with same CATH topology
2AUCA 4C0LA 1CFDA 3WXAA 4DCKA 1YUTA 1UHIA 2Q91A 4QJ5B 2BCXA 3EK8A 5DKNA 1KK7Z 3KEVA 1PULA 1L2OC 1KK8C 1IKUA 2R2IA 4HRHA 3RLZA 1S6IA 1J1DA 3BUNB 1F55A 2F33A 3BUOB 5D69A 1W7JB 1WY9A 1K9PA 2L0PA 2BECA 4A4CA 2OS8B 2FJUB 4DS7A 2KI6D 3NSLA 4BY5A 2K8MB 4ICBA 1IH0A 3SG2A 3I5GB 1SL7A 3LL8B 4YRUA 2HQWA 2JULA 2ZNDA 3PN7B 2BBNA 4PHKA 5CSJA 2ZNEA 2LANA 1U5IA 3EKHA 1SCMC 1VRKA 1PALA 1RWYA 1TCFA 2L50A 1AUIB 1Q80A 1ZFSA 2AMIA 1UP5A 3M0WA 4IL1A 1IJ5A 2MBXA 4P5OE 5J3XA 3LCPC 2EC6C 1ZMZA 2BKHB 1FI6A 3ZWHA 4JPZB 2L4HA 1NX2A 1XO5A 1UURA 1RECA 2MRDA 5JOLA 2LVJA 3NSKA 4N1FA 1Y1UA 3OX6A 1OZOA 1CLLA 3K21A 1XFWO 4OKHA 5BPJA 1KFUL 3CGAA 2H61A 1BF5A 2EHBA 2JXCA 4PE7A 2B1UA 1QLKA 4NDBA 2JTTA 2KGBC 3TDIA 2KFHA 1XFUO 2F3ZA 1RK9A 1TCOB 4A4BA 3AKBA 2SASA 1QVIZ 4YGEB 4UPGA 1XVJA 2M9GA 4P2YB 1MWNA 1AJ5A 2CTNA 2LLUA 4L9MA 3C1VA 1YUSA 2CNPA 3HCMA 1XFVO 1J7QA 2KNEA 2MJWB 2JTZA 3OHMB 1CB1A 3O2PA 1MR8A 2LVIA 3BQ3A 2JXLA 2JT8A 2WORA 3TUYC 1JFKA 1S1EA 3OP0A 4GNKB 2NXQA 3GK2A 2Y5IA 1EJ3A 1X02A 1JF2A 3CS1A 4ORAB 1LINA 1YURA 1XFXO 1C7WA 1MUXA 1QXPA 2L98A 3VGOA 4GFTA 1UHKA 4MZKA 1CDPA 1NX1A 4YGDB 1SMGA 2KYFA 2ZKMX 3PALA 4XJKA 2WCBA 1EXRA 1DF0A 1NWDA 1PVBA 4NQGA 5HLVA 5IBWA 1AVSA 3A4UB 3SJSA 2GGZA 1NUBA 3BUMB 2OTGC 3I5HC 5TNCA 1H4BA 2ZRTA 1W7IB 2JU0A 1JUOA 1WRKA 1YX7A 3WHUB 1V1GA 1SRAA 2H61C 3GK1A 3LK1A 1B8LA 3FWBA 1PSBA 1TOPA 1QX5B 4WQ3A 1Y1XA 1CDLA 2OPOA 1FBVA 1TNQA 1F70A 5I2OA 3LK0A 1K9KA 1SL8A 1QASA 1V1FA 2KBIA 2JRFA 1MF8B 3DVMA 2HPSA 1IGVA 1SK6D 1CMFA 1CDNA 1PSRA 2KYCA 1SL9A 3OB2B 1SY9A 2E6WA 1YR5A 1F71A 4WRIA 4MZJA 1XFZO 2L5XB 2BBMA 2MLFC 1BOCA 1PK0D 2KOTA 1S26D 3JTDC 1Y1AA 1FPWA 2WNDA 1WDCC 2JT3A 5F6TA 1DJXA 5PALA 1XA5A 2KFFA 1TTXA 4DUQA 3AKAA 1FI5A 2K7CA 2KSPA 2LMVA 3BOWB 4FTGA 1A75B 1B47A 4JWQA 5AANA 1KQMB 1K90D 4F0ZB 1BG1A 1F8HA 1QLSA 1UWOA 4USLA 3SIBA 1JSAA 2JPTA 1IQ3A 2L51A 4OR9B 3TS5C 3SG3A 1F4OA 2K2FA 4CLNA 2IS9A 2K0JA 1RFJA 4AOMA 1YVLA 2ZN8A 2KAXA 1JWDA 4GUKA 2K61A 3CR4X 2Y4QA 1GGZA 2NCOA 1EG3A 1KWOC 4MSPA 4HRGA 4AQJA 1M39A 2KI4B 2SCPA 2KBMA 2LM5A 1BR4B 3DVEA 1JC2A 3DF0B 3SG7A 1YTZC 4ORCB 2WC8A 4I5JA 4PE1A 4BY4A 2K2AA 3D0YB 4HSZA 1DJHA 1XK4A 2JOJA 1J7RA 2QPTA 1DGUA 2ZFDA 1DT7B 2LMUA 4Q04A 1NSHA 5CSNA 3I5IB 3JVTB 1YVHA 2BL0B 1AK8A 1YRTB 2NCPA 1DJYA 1KSMA 1LXFC 1UUSA 2PVBA 3TUYB 1S5GY 1IWQA 3KF9A 4ZCVA 2WCFA 2LVKA 3FIAA 2LLSA 3GOFA 3DVJA 5D7FA 1XYDA 3EVUA 3NSIA 2LV7A 3PLFB 1B7TY 1A03A 1U5IB 1NCYA 5CSFA 1TRFA 2K7DA 1KQVA 2ISDA 1J55A 3KO0A 3KHEA 1WLZA 3I5FB 3PFVA 4PCWA 3SIAA 1CMGA 4AQIA 2OS8C 1A2XA 2TN4A 4YGCB 4DRWA 2L2EA 2RGIA 4MLWA 1QX7A 1CM4A 4ORBB 5ER4X 5HKZA 3I5GC 1B9AA 1M31A 3PN7C 2BE4A 1K8UA 1QJTA 5KU1A 2OTGB 2MLEC 2NZ0A 4FQOA 2F2OA 1IQ5A 3NSOA 2KFGA 3BUWB 1BJFA 1YUUA 1SR6B 1BMOA 2LHLA 2L4IA 2LNKA 4OCIA 1QX2A 2K7BA 1LKJA 1ODBA 1B8CA 1G4YR 5AEQA 1M46A 5AFPA 1EL4A 4MRXA 1B4CA 2H2KA 3CTNA 4MEWA 4ETOA 1CNPA 1DJGA 2F2PA 4PALA 5I2QA 2LMTA 3SG4A 1OSAA 2KAVA 4PE4A 2O5GA 1XK4C 3ZNIA 5HKYA 1K2HA 1QV1A 1KCYA 3TDZA 1MXLC 2MAZA 4PDZA 2O60A 2A4JA 3EK7A 5KTYA 1PVAA 1DMOA 1L7ZA 3LLEA 3AAKA 3RM1A 4MBEA 2LP3A 2PRUA 1SCVA 5K89A 2CBLA 1ALVA 1L2OB 1KK8B 1KFUS 1B1GA 4NDCA 1ALWA 4QJ3B 1TNWA 3ICBA 1CDMA 2LUXA 4OV2A 1S3PA 4GGFA 1SKTA 4M2PA 1KK7Y 1RROA 1ZOTB 3TZ1A 1RJVA 5DKQA 1DJIA 2BCAA 2M8UA 2KQYA 3O4YA 2I94A 4QJ4B 4XYNA 4YGAA 4TNCA 5HYDA 4DIRA 3VRQA 1SCMB 1G33A 3CR5X 1OQPA 1CKKA 3BXKA 1RTP1 3PM8A 5ER5A 2FOTA 4YGBB 3H4SE 1J1EA 3CWGA 1AP4A 1N0YA 3O6BA 1JFJA 1BU3A 2EC6B 4I5LB 1DGVA 1G8IA 3EK4A 1CFCA 2PASA 2CT9A 1YX8A 1QTXA 1SPYA 2Q4UA 2LE9B 1PRWA 1DJZA 3CZTX 3VRRA 1CLMA 2HF5A 2BE6A 2NLNA 1KSOA 2Y1MA 3DF0A 1KFXL 3D0YA 1QV0A 3KPXA 3PSRA 5DKRA 1WRZA 2MA2A 3OX5A 1FW4A 4YI8A 1HT9A 2CXJA 1SBJA 1F54A 2JC2A 1NX3A 1K93D 1OZSA 3FS7A 2PMYA 5AERA 1BLQA 2FCEA 2WOSA 3BUXB 1ZACA 1A4PA 1CFFA 2LCPA 4CIDA 1WLMA 1QVIY 1IG5A 4GGFC 1K94A 1NYAA 1C7VA 4N1GA 3VRPA 2GV5A 1SYMA 4GAOA 1QS7A 2M97A 5I2LA 5GQQC 3QRXA 3SG5A 3WNXB 2E30A 3D10A 1EH2A 2LUCA 1AJ4A 1Y6WA 1TNXA 1EG4A 2ZRSA 1KQMC 1LA0A 1UHHA 1XFYO 3NXAA 2EGDA 2GGMA 2LHIA 3BYAA 1GGWA 3CR2A 1E8AA 1GQMA 2HETA 1K9UA 2KGRA 2LAPA 2VRGA 5KSZA 1S6CA 1JBAA 3F45A 2WCEA 2DOQA 1TNPA 3EVRA 4PHJA 2PSRA 4U8DA 3O78A 4MN0A 1K96A 3DD4A 3I5HB 1H8BA 4PHMA 2KI4C 4CPVA 2AAOA 2M49B 1SW8A 3VRNA 1CM1A 2KI6C 4GBAA 1B8RA 1KFXS 2M1UA 2ZN9A 1WRLA 3OB1B 1BR1B 5CPVA 2KDHA 1S5GZ 2LLTA 4WQ2A 4CFRA 2CCMA 1N2DA 1NPQA 1UHNA 2I2RE 3EVVA 4YI9A 1BODA 4GPLB 2JWWA 4JQ0D 4HREE 3IF7A 1QATA 3I5IC 1B7TZ 3IQQA 3JVTC 4YBHB 1GJYA 2BL0C 2M0RA 1YRUB 3AAJA 1M63B 3SG6A 4M2OA 1OOJA 5HLOA 1IRJA 3IQOA 1NCXA 2F8PA 2LP2A 1LA3A 1M45A 1NIWA 3MSEB 1CFPA 1QIVA 1CLBA 2JNXA 1NP8A 3JTDB 1R6PA 1HQVA 2P6BB 5FYXA 5HKWA 1WDCB 1F4QA 3VROA 4CFQA 4I5KA 2G2BA 2KQ6A 1BT6A 4N5XA 2PALA 3I5FC 5AXIA 1CTRA 4PE0A 3DVKA 1C07A 2JZIA 3PATA 2BKIB 4GGNA 2FCDA 4MZLA 1Y0VH 2I7AA 3TS5B 2JNFA 5I8NA 3CLNA 1MXEA 1OMRA 4MVFA 1AHRA 4R1EA 1D1OA 2LC5A 2M1KB 4XJKB 1MHOA 2V53A 3A8RA 3EKJA 4C0KA 3GK4X 1IJ6A 2D8NA 1DF0B 1SR6C 2HQ8A 4E68A 1FF1A 5G08A 3BOWA 1KWOB 1A75A 4M2QA 1OMDA 1JF0A 4NDDA 1ZUZA 2COLB 4PHNA 1TIZA 2M3WA 3HX4A 1S36A 1QIWA 1LVCD 1TN4A 2MHHA 3FWCA 2JQ6A 3WHTB 2G9BA 5CSIA 5JJGA 2M7NA 4I5NB 1S6JA 1OMVA 4OVNF 1UHJA 2I18A 2M7LA 2Y1NA 1SNLA 3TDUA 1OE9B 4ZCUA 4D1EA 1DTLA 1NX0A 1A29A 2F3YA 2QACA 2LVVA 4MRYA 2KAYA 1NCZA 2K7OA 2JT0A 3E3RA 2M29A 5B8IB 1N65A 1R2UA 2BCBA 2KHNA 1K95A 1J7PA 1DJWA 1DVIA 1MQ1A 4C0JA 1J7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUC A;  4C0L A;  1CFD A;  3WXA A;  4DCK A;  1YUT A;  1UHI A;  2Q91 A;  4QJ5 B;  2BCX A;  3EK8 A;  5DKN A;  1KK7 Z;  3KEV A;  1PUL A;  1L2O C;  1KK8 C;  1IKU A;  2R2I A;  4HRH A;  3RLZ A;  1S6I A;  1J1D A;  3BUN B;  1F55 A;  2F33 A;  3BUO B;  5D69 A;  1W7J B;  1WY9 A;  1K9P A;  2L0P A;  2BEC A;  4A4C A;  2OS8 B;  2FJU B;  4DS7 A;  2KI6 D;  3NSL A;  4BY5 A;  2K8M B;  4ICB A;  1IH0 A;  3SG2 A;  3I5G B;  1SL7 A;  3LL8 B;  4YRU A;  2HQW A;  2JUL A;  2ZND A;  3PN7 B;  2BBN A;  4PHK A;  5CSJ A;  2ZNE A;  2LAN A;  1U5I A;  3EKH A;  1SCM C;  1VRK A;  1PAL A;  1RWY A;  1TCF A;  2L50 A;  1AUI B;  1Q80 A;  1ZFS A;  2AMI A;  1UP5 A;  3M0W A;  4IL1 A;  1IJ5 A;  2MBX A;  4P5O E;  5J3X A;  3LCP C;  2EC6 C;  1ZMZ A;  2BKH B;  1FI6 A;  3ZWH A;  4JPZ B;  2L4H A;  1NX2 A;  1XO5 A;  1UUR A;  1REC A;  2MRD A;  5JOL A;  2LVJ A;  3NSK A;  4N1F A;  1Y1U A;  3OX6 A;  1OZO A;  1CLL A;  3K21 A;  1XFW O;  4OKH A;  5BPJ A;  1KFU L;  3CGA A;  2H61 A;  1BF5 A;  2EHB A;  2JXC A;  4PE7 A;  2B1U A;  1QLK A;  4NDB A;  2JTT A;  2KGB C;  3TDI A;  2KFH A;  1XFU O;  2F3Z A;  1RK9 A;  1TCO B;  4A4B A;  3AKB A;  2SAS A;  1QVI Z;  4YGE B;  4UPG A;  1XVJ A;  2M9G A;  4P2Y B;  1MWN A;  1AJ5 A;  2CTN A;  2LLU A;  4L9M A;  3C1V A;  1YUS A;  2CNP A;  3HCM A;  1XFV O;  1J7Q A;  2KNE A;  2MJW B;  2JTZ A;  3OHM B;  1CB1 A;  3O2P A;  1MR8 A;  2LVI A;  3BQ3 A;  2JXL A;  2JT8 A;  2WOR A;  3TUY C;  1JFK A;  1S1E A;  3OP0 A;  4GNK B;  2NXQ A;  3GK2 A;  2Y5I A;  1EJ3 A;  1X02 A;  1JF2 A;  3CS1 A;  4ORA B;  1LIN A;  1YUR A;  1XFX O;  1C7W A;  1MUX A;  1QXP A;  2L98 A;  3VGO A;  4GFT A;  1UHK A;  4MZK A;  1CDP A;  1NX1 A;  4YGD B;  1SMG A;  2KYF A;  2ZKM X;  3PAL A;  4XJK A;  2WCB A;  1EXR A;  1DF0 A;  1NWD A;  1PVB A;  4NQG A;  5HLV A;  5IBW A;  1AVS A;  3A4U B;  3SJS A;  2GGZ A;  1NUB A;  3BUM B;  2OTG C;  3I5H C;  5TNC A;  1H4B A;  2ZRT A;  1W7I B;  2JU0 A;  1JUO A;  1WRK A;  1YX7 A;  3WHU B;  1V1G A;  1SRA A;  2H61 C;  3GK1 A;  3LK1 A;  1B8L A;  3FWB A;  1PSB A;  1TOP A;  1QX5 B;  4WQ3 A;  1Y1X A;  1CDL A;  2OPO A;  1FBV A;  1TNQ A;  1F70 A;  5I2O A;  3LK0 A;  1K9K A;  1SL8 A;  1QAS A;  1V1F A;  2KBI A;  2JRF A;  1MF8 B;  3DVM A;  2HPS A;  1IGV A;  1SK6 D;  1CMF A;  1CDN A;  1PSR A;  2KYC A;  1SL9 A;  3OB2 B;  1SY9 A;  2E6W A;  1YR5 A;  1F71 A;  4WRI A;  4MZJ A;  1XFZ O;  2L5X B;  2BBM A;  2MLF C;  1BOC A;  1PK0 D;  2KOT A;  1S26 D;  3JTD C;  1Y1A A;  1FPW A;  2WND A;  1WDC C;  2JT3 A;  5F6T A;  1DJX A;  5PAL A;  1XA5 A;  2KFF A;  1TTX A;  4DUQ A;  3AKA A;  1FI5 A;  2K7C A;  2KSP A;  2LMV A;  3BOW B;  4FTG A;  1A75 B;  1B47 A;  4JWQ A;  5AAN A;  1KQM B;  1K90 D;  4F0Z B;  1BG1 A;  1F8H A;  1QLS A;  1UWO A;  4USL A;  3SIB A;  1JSA A;  2JPT A;  1IQ3 A;  2L51 A;  4OR9 B;  3TS5 C;  3SG3 A;  1F4O A;  2K2F A;  4CLN A;  2IS9 A;  2K0J A;  1RFJ A;  4AOM A;  1YVL A;  2ZN8 A;  2KAX A;  1JWD A;  4GUK A;  2K61 A;  3CR4 X;  2Y4Q A;  1GGZ A;  2NCO A;  1EG3 A;  1KWO C;  4MSP A;  4HRG A;  4AQJ A;  1M39 A;  2KI4 B;  2SCP A;  2KBM A;  2LM5 A;  1BR4 B;  3DVE A;  1JC2 A;  3DF0 B;  3SG7 A;  1YTZ C;  4ORC B;  2WC8 A;  4I5J A;  4PE1 A;  4BY4 A;  2K2A A;  3D0Y B;  4HSZ A;  1DJH A;  1XK4 A;  2JOJ A;  1J7R A;  2QPT A;  1DGU A;  2ZFD A;  1DT7 B;  2LMU A;  4Q04 A;  1NSH A;  5CSN A;  3I5I B;  3JVT B;  1YVH A;  2BL0 B;  1AK8 A;  1YRT B;  2NCP A;  1DJY A;  1KSM A;  1LXF C;  1UUS A;  2PVB A;  3TUY B;  1S5G Y;  1IWQ A;  3KF9 A;  4ZCV A;  2WCF A;  2LVK A;  3FIA A;  2LLS A;  3GOF A;  3DVJ A;  5D7F A;  1XYD A;  3EVU A;  3NSI A;  2LV7 A;  3PLF B;  1B7T Y;  1A03 A;  1U5I B;  1NCY A;  5CSF A;  1TRF A;  2K7D A;  1KQV A;  2ISD A;  1J55 A;  3KO0 A;  3KHE A;  1WLZ A;  3I5F B;  3PFV A;  4PCW A;  3SIA A;  1CMG A;  4AQI A;  2OS8 C;  1A2X A;  2TN4 A;  4YGC B;  4DRW A;  2L2E A;  2RGI A;  4MLW A;  1QX7 A;  1CM4 A;  4ORB B;  5ER4 X;  5HKZ A;  3I5G C;  1B9A A;  1M31 A;  3PN7 C;  2BE4 A;  1K8U A;  1QJT A;  5KU1 A;  2OTG B;  2MLE C;  2NZ0 A;  4FQO A;  2F2O A;  1IQ5 A;  3NSO A;  2KFG A;  3BUW B;  1BJF A;  1YUU A;  1SR6 B;  1BMO A;  2LHL A;  2L4I A;  2LNK A;  4OCI A;  1QX2 A;  2K7B A;  1LKJ A;  1ODB A;  1B8C A;  1G4Y R;  5AEQ A;  1M46 A;  5AFP A;  1EL4 A;  4MRX A;  1B4C A;  2H2K A;  3CTN A;  4MEW A;  4ETO A;  1CNP A;  1DJG A;  2F2P A;  4PAL A;  5I2Q A;  2LMT A;  3SG4 A;  1OSA A;  2KAV A;  4PE4 A;  2O5G A;  1XK4 C;  3ZNI A;  5HKY A;  1K2H A;  1QV1 A;  1KCY A;  3TDZ A;  1MXL C;  2MAZ A;  4PDZ A;  2O60 A;  2A4J A;  3EK7 A;  5KTY A;  1PVA A;  1DMO A;  1L7Z A;  3LLE A;  3AAK A;  3RM1 A;  4MBE A;  2LP3 A;  2PRU A;  1SCV A;  5K89 A;  2CBL A;  1ALV A;  1L2O B;  1KK8 B;  1KFU S;  1B1G A;  4NDC A;  1ALW A;  4QJ3 B;  1TNW A;  3ICB A;  1CDM A;  2LUX A;  4OV2 A;  1S3P A;  4GGF A;  1SKT A;  4M2P A;  1KK7 Y;  1RRO A;  1ZOT B;  3TZ1 A;  1RJV A;  5DKQ A;  1DJI A;  2BCA A;  2M8U A;  2KQY A;  3O4Y A;  2I94 A;  4QJ4 B;  4XYN A;  4YGA A;  4TNC A;  5HYD A;  4DIR A;  3VRQ A;  1SCM B;  1G33 A;  3CR5 X;  1OQP A;  1CKK A;  3BXK A;  1RTP 1;  3PM8 A;  5ER5 A;  2FOT A;  4YGB B;  3H4S E;  1J1E A;  3CWG A;  1AP4 A;  1N0Y A;  3O6B A;  1JFJ A;  1BU3 A;  2EC6 B;  4I5L B;  1DGV A;  1G8I A;  3EK4 A;  1CFC A;  2PAS A;  2CT9 A;  1YX8 A;  1QTX A;  1SPY A;  2Q4U A;  2LE9 B;  1PRW A;  1DJZ A;  3CZT X;  3VRR A;  1CLM A;  2HF5 A;  2BE6 A;  2NLN A;  1KSO A;  2Y1M A;  3DF0 A;  1KFX L;  3D0Y A;  1QV0 A;  3KPX A;  3PSR A;  5DKR A;  1WRZ A;  2MA2 A;  3OX5 A;  1FW4 A;  4YI8 A;  1HT9 A;  2CXJ A;  1SBJ A;  1F54 A;  2JC2 A;  1NX3 A;  1K93 D;  1OZS A;  3FS7 A;  2PMY A;  5AER A;  1BLQ A;  2FCE A;  2WOS A;  3BUX B;  1ZAC A;  1A4P A;  1CFF A;  2LCP A;  4CID A;  1WLM A;  1QVI Y;  1IG5 A;  4GGF C;  1K94 A;  1NYA A;  1C7V A;  4N1G A;  3VRP A;  2GV5 A;  1SYM A;  4GAO A;  1QS7 A;  2M97 A;  5I2L A;  5GQQ C;  3QRX A;  3SG5 A;  3WNX B;  2E30 A;  3D10 A;  1EH2 A;  2LUC A;  1AJ4 A;  1Y6W A;  1TNX A;  1EG4 A;  2ZRS A;  1KQM C;  1LA0 A;  1UHH A;  1XFY O;  3NXA A;  2EGD A;  2GGM A;  2LHI A;  3BYA A;  1GGW A;  3CR2 A;  1E8A A;  1GQM A;  2HET A;  1K9U A;  2KGR A;  2LAP A;  2VRG A;  5KSZ A;  1S6C A;  1JBA A;  3F45 A;  2WCE A;  2DOQ A;  1TNP A;  3EVR A;  4PHJ A;  2PSR A;  4U8D A;  3O78 A;  4MN0 A;  1K96 A;  3DD4 A;  3I5H B;  1H8B A;  4PHM A;  2KI4 C;  4CPV A;  2AAO A;  2M49 B;  1SW8 A;  3VRN A;  1CM1 A;  2KI6 C;  4GBA A;  1B8R A;  1KFX S;  2M1U A;  2ZN9 A;  1WRL A;  3OB1 B;  1BR1 B;  5CPV A;  2KDH A;  1S5G Z;  2LLT A;  4WQ2 A;  4CFR A;  2CCM A;  1N2D A;  1NPQ A;  1UHN A;  2I2R E;  3EVV A;  4YI9 A;  1BOD A;  4GPL B;  2JWW A;  4JQ0 D;  4HRE E;  3IF7 A;  1QAT A;  3I5I C;  1B7T Z;  3IQQ A;  3JVT C;  4YBH B;  1GJY A;  2BL0 C;  2M0R A;  1YRU B;  3AAJ A;  1M63 B;  3SG6 A;  4M2O A;  1OOJ A;  5HLO A;  1IRJ A;  3IQO A;  1NCX A;  2F8P A;  2LP2 A;  1LA3 A;  1M45 A;  1NIW A;  3MSE B;  1CFP A;  1QIV A;  1CLB A;  2JNX A;  1NP8 A;  3JTD B;  1R6P A;  1HQV A;  2P6B B;  5FYX A;  5HKW A;  1WDC B;  1F4Q A;  3VRO A;  4CFQ A;  4I5K A;  2G2B A;  2KQ6 A;  1BT6 A;  4N5X A;  2PAL A;  3I5F C;  5AXI A;  1CTR A;  4PE0 A;  3DVK A;  1C07 A;  2JZI A;  3PAT A;  2BKI B;  4GGN A;  2FCD A;  4MZL A;  1Y0V H;  2I7A A;  3TS5 B;  2JNF A;  5I8N A;  3CLN A;  1MXE A;  1OMR A;  4MVF A;  1AHR A;  4R1E A;  1D1O A;  2LC5 A;  2M1K B;  4XJK B;  1MHO A;  2V53 A;  3A8R A;  3EKJ A;  4C0K A;  3GK4 X;  1IJ6 A;  2D8N A;  1DF0 B;  1SR6 C;  2HQ8 A;  4E68 A;  1FF1 A;  5G08 A;  3BOW A;  1KWO B;  1A75 A;  4M2Q A;  1OMD A;  1JF0 A;  4NDD A;  1ZUZ A;  2COL B;  4PHN A;  1TIZ A;  2M3W A;  3HX4 A;  1S36 A;  1QIW A;  1LVC D;  1TN4 A;  2MHH A;  3FWC A;  2JQ6 A;  3WHT B;  2G9B A;  5CSI A;  5JJG A;  2M7N A;  4I5N B;  1S6J A;  1OMV A;  4OVN F;  1UHJ A;  2I18 A;  2M7L A;  2Y1N A;  1SNL A;  3TDU A;  1OE9 B;  4ZCU A;  4D1E A;  1DTL A;  1NX0 A;  1A29 A;  2F3Y A;  2QAC A;  2LVV A;  4MRY A;  2KAY A;  1NCZ A;  2K7O A;  2JT0 A;  3E3R A;  2M29 A;  5B8I B;  1N65 A;  1R2U A;  2BCB A;  2KHN A;  1K95 A;  1J7P A;  1DJW A;  1DVI A;  1MQ1 A;  4C0J A;  1J7O A; 
#chains in the Genus database with same CATH topology
 2AUC A;  4C0L A;  1CFD A;  3BFA A;  3WXA A;  1YUT A;  1UHI A;  2Q91 A;  4DCK A;  2BCX A;  2P70 A;  3EK8 A;  5DKN A;  1KK7 Z;  4QJ5 B;  3KEV A;  1PUL A;  1L2O C;  1KK8 C;  3CAB A;  1IKU A;  2R2I A;  4HRH A;  3RLZ A;  1S6I A;  1J1D A;  3BUN B;  1F55 A;  2F33 A;  3BUO B;  5D69 A;  1W7J B;  1WY9 A;  1Z2C B;  1K9P A;  2L0P A;  2BEC A;  3FE6 A;  4A4C A;  2OS8 B;  2FJU B;  1OOF A;  2KI6 D;  3NSL A;  4BY5 A;  2K8M B;  4ICB A;  4DS7 A;  3SG2 A;  1IH0 A;  3I5G B;  1SL7 A;  1TWO A;  3LL8 B;  4YRU A;  2HQW A;  2JUL A;  2ZND A;  3PN7 B;  2BBN A;  4PHK A;  5CSJ A;  3S0A A;  3CZ2 A;  2ZNE A;  2LAN A;  1U5I A;  3EKH A;  3VB1 A;  1SCM C;  1DEL A;  1VRK A;  1PAL A;  1RWY A;  1T14 A;  1TCF A;  2L50 A;  1AUI B;  1Q80 A;  1ZFS A;  2AMI A;  1UP5 A;  3M0W A;  4IL1 A;  1IJ5 A;  5FI2 A;  4P5O E;  5J3X A;  2MBX A;  3LCP C;  2EC6 C;  1ZMZ A;  2JPO A;  2BKH B;  1FI6 A;  3ZWH A;  4JPZ B;  2L4H A;  1NX2 A;  1XO5 A;  1UUR A;  1REC A;  2MRD A;  5JOL A;  2LVJ A;  3NSK A;  4N1F A;  1Y1U A;  3OX6 A;  1OZO A;  1CLL A;  3K21 A;  1XFW O;  4OKH A;  3UO9 A;  5BPJ A;  1IIO A;  2QDI A;  1KFU L;  3L4A A;  3CGA A;  2H61 A;  1BF5 A;  2EHB A;  2JXC A;  3NHT A;  4PE7 A;  4JKT A;  2B1U A;  2PYQ A;  1QLK A;  4NDB A;  2JTT A;  2KGB C;  3TDI A;  2KFH A;  1XFU O;  3S0D A;  2L5Y A;  2F3Z A;  1RK9 A;  1TCO B;  4A4B A;  1Z4H A;  3AKB A;  1D1O A;  2SAS A;  1OOG A;  1QVI Z;  4YGE B;  4UPG A;  1XVJ A;  2M9G A;  4P2Y B;  1MWN A;  1AJ5 A;  2QEH A;  1W9Z A;  2CTN A;  2LLU A;  4L9M A;  3C1V A;  1YUS A;  2CNP A;  1C3Y A;  3HCM A;  1XFV O;  1J7Q A;  2KNE A;  2MJW B;  2JTZ A;  3OHM B;  1CB1 A;  3O2P A;  1MR8 A;  2LVI A;  3BQ3 A;  2JXL A;  2JT8 A;  2WOR A;  3TUY C;  1GM0 A;  5EL2 A;  1JFK A;  2WC5 A;  1S1E A;  3OP0 A;  4GNK B;  2NXQ A;  3GK2 A;  2Y5I A;  1EJ3 A;  3SS4 A;  1X02 A;  1JF2 A;  3CS1 A;  4ORA B;  2WC6 A;  1LIN A;  1YUR A;  1XFX O;  1C7W A;  1MUX A;  1QXP A;  3S0B A;  2L98 A;  3VGO A;  4GFT A;  1UHK A;  4MZK A;  1CDP A;  3QME A;  1NX1 A;  4YGD B;  1SMG A;  2KYF A;  2ZKM X;  3PAL A;  4XJK A;  2WCB A;  1EXR A;  1DF0 A;  1NWD A;  1PVB A;  2P71 A;  4NQG A;  5HLV A;  5IBW A;  1AVS A;  3A4U B;  3SJS A;  2GGZ A;  3B7A A;  1NUB A;  3BUM B;  2QEV A;  2OTG C;  3I5H C;  5TNC A;  1H4B A;  2ZRT A;  1W7I B;  2JU0 A;  1JUO A;  1WRK A;  1YX7 A;  3WHU B;  1V1G A;  1SRA A;  2H61 C;  3GK1 A;  3LK1 A;  1B8L A;  3FWB A;  1PSB A;  1TOP A;  1QX5 B;  3L47 A;  1Y1X A;  4WQ3 A;  3S0E A;  1CDL A;  2OPO A;  1FBV A;  1TNQ A;  1F70 A;  5I2O A;  3LK0 A;  1K9K A;  1SL8 A;  1QAS A;  3Q8I A;  1V1F A;  2KBI A;  2JRF A;  1MF8 B;  3DVM A;  2HPS A;  1IGV A;  1SK6 D;  1XFR A;  1CMF A;  1CDN A;  1PSR A;  2KYC A;  1SL9 A;  3OB2 B;  1SY9 A;  2E6W A;  1YR5 A;  4INX A;  1F71 A;  4WRI A;  3BFH A;  4MZJ A;  1XFZ O;  2L5X B;  2BBM A;  2MLF C;  3DXL A;  1BOC A;  1PK0 D;  3FE8 A;  2ERB A;  1S26 D;  2KOT A;  1Y1A A;  3JTD C;  1FPW A;  2WND A;  3FE9 A;  1WDC C;  2JT3 A;  5F6T A;  1DJX A;  5PAL A;  3DZT A;  1XA5 A;  2KFF A;  3RZS A;  1TTX A;  4DUQ A;  3AKA A;  1FI5 A;  2K7C A;  2KSP A;  2LMV A;  3BOW B;  4FTG A;  1A75 B;  1B47 A;  4JWQ A;  5AAN A;  4F7F A;  1KQM B;  1K90 D;  4F0Z B;  2L2C A;  1BG1 A;  1QLS A;  1UWO A;  4USL A;  3SIB A;  1F8H A;  1JSA A;  2JPT A;  1IQ3 A;  2L51 A;  4OR9 B;  1DEK A;  3TS5 C;  4PT1 A;  3SG3 A;  1F4O A;  2K2F A;  4CLN A;  2IS9 A;  2K0J A;  1RFJ A;  4AOM A;  1YVL A;  2ZN8 A;  2KAX A;  1JWD A;  5HL1 A;  4GUK A;  2K61 A;  3CR4 X;  2Y4Q A;  1GGZ A;  2NCO A;  1EG3 A;  1KWO C;  4MSP A;  4HRG A;  4AQJ A;  1M39 A;  2KI4 B;  2SCP A;  2KBM A;  2LM5 A;  1BR4 B;  3B88 A;  3DVE A;  1JC2 A;  3DF0 B;  3SG7 A;  1YTZ C;  4ORC B;  2WC8 A;  4I5J A;  4PE1 A;  4BY4 A;  2K2A A;  3D0Y B;  2QEB A;  4HSZ A;  3BFB A;  1DC1 A;  1DJH A;  1XK4 A;  1OW4 A;  3DY9 A;  3K1E A;  2JOJ A;  1J7R A;  2QPT A;  1DGU A;  2ZFD A;  1DT7 B;  2LMU A;  4Q04 A;  1NSH A;  5CSN A;  3I5I B;  3JVT B;  1YVH A;  2BL0 B;  1AK8 A;  1YRT B;  2NCP A;  3CZ1 A;  2KLD A;  1DJY A;  1KSM A;  1LXF C;  1UUS A;  2PVB A;  3TUY B;  1S5G Y;  1IWQ A;  3CDN A;  3KF9 A;  4ZCV A;  2WCF A;  2LVK A;  3FIA A;  2LLS A;  3GOF A;  3DVJ A;  5D7F A;  1XYD A;  3EVU A;  3NSI A;  1P28 A;  2LV7 A;  3PLF B;  1B7T Y;  3R1V A;  1A03 A;  5I94 A;  1U5I B;  1NCY A;  5CSF A;  1TRF A;  2K7D A;  1KQV A;  2ISD A;  1J55 A;  3KO0 A;  3KHE A;  1WLZ A;  3I5F B;  3PFV A;  4PCW A;  3SIA A;  1CMG A;  2WCK A;  4AQI A;  2OS8 C;  1A2X A;  2TN4 A;  4YGC B;  4DRW A;  2L2E A;  2RGI A;  4MLW A;  1QX7 A;  1CM4 A;  4ORB B;  5ER4 X;  4KYN A;  5HKZ A;  3I5G C;  1B9A A;  1M31 A;  3PN7 C;  2BE4 A;  1K8U A;  1QJT A;  5KU1 A;  2OTG B;  2MLE C;  2NZ0 A;  4FQO A;  2F2O A;  1IQ5 A;  3NSO A;  3D75 A;  1TUJ A;  2KFG A;  3BUW B;  1BJF A;  1YUU A;  1SR6 B;  1BMO A;  2LHL A;  2L4I A;  2LNK A;  4OCI A;  4OZD A;  5FI6 A;  1QX2 A;  2K7B A;  1LKJ A;  1ODB A;  2PQL A;  1B8C A;  1G4Y R;  5AEQ A;  1M46 A;  5AFP A;  1EL4 A;  3OBV A;  4MRX A;  1B4C A;  2H2K A;  3CTN A;  3N7H A;  4MEW A;  4ETO A;  1CNP A;  1DJG A;  2F2P A;  4PAL A;  5I2Q A;  2LMT A;  3SG4 A;  1OSA A;  2KAV A;  4PE4 A;  2O5G A;  1XK4 C;  1QWV A;  3ZNI A;  5HKY A;  1K2H A;  1QV1 A;  3R1O A;  2KLE A;  1KCY A;  3TDZ A;  1MXL C;  2MAZ A;  4PDZ A;  2O60 A;  2A4J A;  3EK7 A;  5KTY A;  1PVA A;  1DMO A;  1L7Z A;  3LLE A;  3AAK A;  3RM1 A;  4MBE A;  2LP3 A;  2PRU A;  1SCV A;  5K89 A;  2CBL A;  1ALV A;  1L2O B;  1KK8 B;  1KFU S;  1B1G A;  4NDC A;  1ALW A;  4QJ3 B;  1TNW A;  3D78 A;  3NGV A;  3ICB A;  1CDM A;  2LUX A;  4OV2 A;  1S3P A;  4GGF A;  2H8V A;  1SKT A;  4M2P A;  1KK7 Y;  3DYE A;  1RRO A;  1ZOT B;  3TZ1 A;  1RJV A;  3OGN A;  5DKQ A;  1DJI A;  2BCA A;  2M8U A;  5FI7 A;  2KQY A;  3D74 A;  3O4Y A;  2I94 A;  4QJ4 B;  3D77 A;  4XYN A;  4YGA A;  4TNC A;  2GTE A;  5HYD A;  4DIR A;  3VRQ A;  1SCM B;  1G33 A;  2KPH A;  3CR5 X;  1OQP A;  1CKK A;  3BXK A;  1RTP 1;  3B87 A;  3PM8 A;  2FOT A;  5ER5 A;  4YGB B;  3H4S E;  1J1E A;  3CWG A;  1AP4 A;  1N0Y A;  3O6B A;  1JFJ A;  1BU3 A;  2EC6 B;  4I5L B;  1DGV A;  1G8I A;  3EK4 A;  1CFC A;  5I8N A;  1SSE B;  2PAS A;  2CT9 A;  1YX8 A;  1QTX A;  3O4X A;  1SPY A;  2Q4U A;  2LE9 B;  1PRW A;  1DJZ A;  3CZT X;  3VRR A;  1CLM A;  2HF5 A;  2BE6 A;  2NLN A;  1KSO A;  3SS5 A;  2Y1M A;  3DF0 A;  1KFX L;  3CYZ A;  4FQT A;  3D73 A;  3D0Y A;  2QEO A;  1QV0 A;  3KPX A;  3PSR A;  5DKR A;  3S0G A;  1C3Z A;  1WRZ A;  2MA2 A;  3OX5 A;  1FW4 A;  5DIC A;  1TUZ A;  4YI8 A;  1HT9 A;  2CXJ A;  1SBJ A;  2YGU A;  3IVT A;  1F54 A;  2JC2 A;  1NX3 A;  1K93 D;  1OZS A;  3FS7 A;  2PMY A;  5AER A;  1BLQ A;  2FCE A;  2WOS A;  3SS3 A;  3BUX B;  1ZAC A;  1A4P A;  1CFF A;  1OOH A;  2LCP A;  4CID A;  1WLM A;  1QVI Y;  1IG5 A;  2WCJ A;  4GGF C;  1K94 A;  1NYA A;  1C7V A;  4N1G A;  3VRP A;  2GV5 A;  1SYM A;  4GAO A;  1QS7 A;  2M97 A;  5I2L A;  4JD9 A;  5GQQ C;  3QRX A;  3SG5 A;  3B86 A;  3WNX B;  2E30 A;  3D10 A;  1EH2 A;  2LUC A;  1AJ4 A;  5D3O A;  1Y6W A;  1TNX A;  3R72 A;  1EG4 A;  2ZRS A;  1KQM C;  1LA0 A;  1UHH A;  1XFY O;  3NXA A;  2EGD A;  2GGM A;  2WCM A;  2LHI A;  3BYA A;  1GGW A;  3CR2 A;  1E8A A;  1GQM A;  2HET A;  1K9U A;  2KGR A;  2LAP A;  2VRG A;  3B6X A;  1OOI X;  1S6C A;  5KSZ A;  1JBA A;  3F45 A;  2WCE A;  2DOQ A;  1TNP A;  3EVR A;  4PHJ A;  2PSR A;  4U8D A;  3O78 A;  1ORG A;  4MN0 A;  1K96 A;  3DD4 A;  3I5H B;  3PJI A;  1H8B A;  4PHM A;  1DQE A;  2KI4 C;  4CPV A;  2AAO A;  2M49 B;  1SW8 A;  3VRN A;  1CM1 A;  1LS8 A;  2KI6 C;  4GBA A;  1B8R A;  2WCH A;  1KFX S;  2M1U A;  2ZN9 A;  1WRL A;  3OB1 B;  1BR1 B;  5CPV A;  2KDH A;  1S5G Z;  2LLT A;  4WQ2 A;  4CFR A;  2CCM A;  1N2D A;  1NPQ A;  1UHN A;  2I2R E;  3EG5 B;  3EVV A;  4YI9 A;  1BOD A;  4GPL B;  2JWW A;  4JQ0 D;  4HRE E;  3IF7 A;  1QAT A;  3I5I C;  1B7T Z;  3IQQ A;  3JVT C;  4YBH B;  1GJY A;  2BL0 C;  2M0R A;  2BAP A;  1YRU B;  3AAJ A;  1M63 B;  3D76 A;  3SG6 A;  4M2O A;  1OOJ A;  5HLO A;  1IRJ A;  4IJ7 A;  3IQO A;  1NCX A;  2F8P A;  2LP2 A;  1LA3 A;  1M45 A;  1NIW A;  3MSE B;  3NHI A;  1QIV A;  3PM2 A;  2JNX A;  1CFP A;  1CLB A;  1NP8 A;  3JTD B;  1R6P A;  1HQV A;  2P6B B;  5FYX A;  5HKW A;  3R1P A;  1WDC B;  1F4Q A;  3VRO A;  4CFQ A;  4I5K A;  2G2B A;  2KQ6 A;  1BT6 A;  2WCL A;  4N5X A;  2PAL A;  3I5F C;  3CZ0 A;  1CTR A;  4PE0 A;  3DVK A;  5AXI A;  1C07 A;  2JZI A;  3PAT A;  2BKI B;  4GGN A;  2FCD A;  4MZL A;  1Y0V H;  2I7A A;  3TS5 B;  2JNF A;  2BNX A;  3CLN A;  1MXE A;  1OMR A;  2K60 A;  1AHR A;  4INW A;  4MVF A;  4R1E A;  2LC5 A;  2M1K B;  3BJH A;  1MHO A;  2V53 A;  3A8R A;  3EKJ A;  4XJK B;  4C0K A;  3S0F A;  3GK4 X;  1IJ6 A;  2D8N A;  1DF0 B;  1SR6 C;  2HQ8 A;  4E68 A;  1FF1 A;  5G08 A;  3BOW A;  1KWO B;  1A75 A;  4M2Q A;  3L4L A;  1OMD A;  1JF0 A;  4NDD A;  1ZUZ A;  3V2L A;  2COL B;  4PHN A;  1TIZ A;  2M3W A;  3HX4 A;  1S36 A;  1QIW A;  1LVC D;  1TN4 A;  2MHH A;  3FWC A;  2JQ6 A;  3WHT B;  2G9B A;  5CSI A;  3UNW A;  2M7N A;  4I5N B;  5JJG A;  1S6J A;  1OMV A;  4OVN F;  2FJY A;  1UHJ A;  2I18 A;  2M7L A;  2Y1N A;  1SNL A;  3TDU A;  1OE9 B;  4ZCU A;  4D1E A;  1DTL A;  1NX0 A;  1A29 A;  2F3Y A;  2QAC A;  2LVV A;  4MRY A;  2KAY A;  1NCZ A;  2K7O A;  2JT0 A;  3E3R A;  2M29 A;  5B8I B;  1N65 A;  1R2U A;  2BCB A;  2KHN A;  1K95 A;  1J7P A;  1DJW A;  1DVI A;  1MQ1 A;  4C0J A;  1J7O A; 
#chains in the Genus database with same CATH homology
 2AUC A;  4C0L A;  1CFD A;  3WXA A;  4DCK A;  1YUT A;  1UHI A;  2Q91 A;  4QJ5 B;  2BCX A;  3EK8 A;  5DKN A;  1KK7 Z;  3KEV A;  1PUL A;  1L2O C;  1KK8 C;  1IKU A;  2R2I A;  4HRH A;  3RLZ A;  1S6I A;  1J1D A;  3BUN B;  1F55 A;  2F33 A;  3BUO B;  5D69 A;  1W7J B;  1WY9 A;  1K9P A;  2L0P A;  2BEC A;  4A4C A;  2OS8 B;  2FJU B;  4DS7 A;  2KI6 D;  3NSL A;  4BY5 A;  2K8M B;  4ICB A;  1IH0 A;  3SG2 A;  3I5G B;  1SL7 A;  3LL8 B;  4YRU A;  2HQW A;  2JUL A;  2ZND A;  3PN7 B;  2BBN A;  4PHK A;  5CSJ A;  2ZNE A;  2LAN A;  1U5I A;  3EKH A;  1SCM C;  1VRK A;  1PAL A;  1RWY A;  1TCF A;  2L50 A;  1AUI B;  1Q80 A;  1ZFS A;  2AMI A;  1UP5 A;  3M0W A;  4IL1 A;  1IJ5 A;  2MBX A;  4P5O E;  5J3X A;  3LCP C;  2EC6 C;  1ZMZ A;  2BKH B;  1FI6 A;  3ZWH A;  4JPZ B;  2L4H A;  1NX2 A;  1XO5 A;  1UUR A;  1REC A;  2MRD A;  5JOL A;  2LVJ A;  3NSK A;  4N1F A;  1Y1U A;  3OX6 A;  1OZO A;  1CLL A;  3K21 A;  1XFW O;  4OKH A;  5BPJ A;  1KFU L;  3CGA A;  2H61 A;  1BF5 A;  2EHB A;  2JXC A;  4PE7 A;  2B1U A;  1QLK A;  4NDB A;  2JTT A;  2KGB C;  3TDI A;  2KFH A;  1XFU O;  2F3Z A;  1RK9 A;  1TCO B;  4A4B A;  3AKB A;  2SAS A;  1QVI Z;  4YGE B;  4UPG A;  1XVJ A;  2M9G A;  4P2Y B;  1MWN A;  1AJ5 A;  2CTN A;  2LLU A;  4L9M A;  3C1V A;  1YUS A;  2CNP A;  3HCM A;  1XFV O;  1J7Q A;  2KNE A;  2MJW B;  2JTZ A;  3OHM B;  1CB1 A;  3O2P A;  1MR8 A;  2LVI A;  3BQ3 A;  2JXL A;  2JT8 A;  2WOR A;  3TUY C;  1JFK A;  1S1E A;  3OP0 A;  4GNK B;  2NXQ A;  3GK2 A;  2Y5I A;  1EJ3 A;  1X02 A;  1JF2 A;  3CS1 A;  4ORA B;  1LIN A;  1YUR A;  1XFX O;  1C7W A;  1MUX A;  1QXP A;  2L98 A;  3VGO A;  4GFT A;  1UHK A;  4MZK A;  1CDP A;  1NX1 A;  4YGD B;  1SMG A;  2KYF A;  2ZKM X;  3PAL A;  4XJK A;  2WCB A;  1EXR A;  1DF0 A;  1NWD A;  1PVB A;  4NQG A;  5HLV A;  5IBW A;  1AVS A;  3A4U B;  3SJS A;  2GGZ A;  1NUB A;  3BUM B;  2OTG C;  3I5H C;  5TNC A;  1H4B A;  2ZRT A;  1W7I B;  2JU0 A;  1JUO A;  1WRK A;  1YX7 A;  3WHU B;  1V1G A;  1SRA A;  2H61 C;  3GK1 A;  3LK1 A;  1B8L A;  3FWB A;  1PSB A;  1TOP A;  1QX5 B;  4WQ3 A;  1Y1X A;  1CDL A;  2OPO A;  1FBV A;  1TNQ A;  1F70 A;  5I2O A;  3LK0 A;  1K9K A;  1SL8 A;  1QAS A;  1V1F A;  2KBI A;  2JRF A;  1MF8 B;  3DVM A;  2HPS A;  1IGV A;  1SK6 D;  1CMF A;  1CDN A;  1PSR A;  2KYC A;  1SL9 A;  3OB2 B;  1SY9 A;  2E6W A;  1YR5 A;  1F71 A;  4WRI A;  4MZJ A;  1XFZ O;  2L5X B;  2BBM A;  2MLF C;  1BOC A;  1PK0 D;  2KOT A;  1S26 D;  3JTD C;  1Y1A A;  1FPW A;  2WND A;  1WDC C;  2JT3 A;  5F6T A;  1DJX A;  5PAL A;  1XA5 A;  2KFF A;  1TTX A;  4DUQ A;  3AKA A;  1FI5 A;  2K7C A;  2KSP A;  2LMV A;  3BOW B;  4FTG A;  1A75 B;  1B47 A;  4JWQ A;  5AAN A;  1KQM B;  1K90 D;  4F0Z B;  1BG1 A;  1F8H A;  1QLS A;  1UWO A;  4USL A;  3SIB A;  1JSA A;  2JPT A;  1IQ3 A;  2L51 A;  4OR9 B;  3TS5 C;  3SG3 A;  1F4O A;  2K2F A;  4CLN A;  2IS9 A;  2K0J A;  1RFJ A;  4AOM A;  1YVL A;  2ZN8 A;  2KAX A;  1JWD A;  4GUK A;  2K61 A;  3CR4 X;  2Y4Q A;  1GGZ A;  2NCO A;  1EG3 A;  1KWO C;  4MSP A;  4HRG A;  4AQJ A;  1M39 A;  2KI4 B;  2SCP A;  2KBM A;  2LM5 A;  1BR4 B;  3DVE A;  1JC2 A;  3DF0 B;  3SG7 A;  1YTZ C;  4ORC B;  2WC8 A;  4I5J A;  4PE1 A;  4BY4 A;  2K2A A;  3D0Y B;  4HSZ A;  1DJH A;  1XK4 A;  2JOJ A;  1J7R A;  2QPT A;  1DGU A;  2ZFD A;  1DT7 B;  2LMU A;  4Q04 A;  1NSH A;  5CSN A;  3I5I B;  3JVT B;  1YVH A;  2BL0 B;  1AK8 A;  1YRT B;  2NCP A;  1DJY A;  1KSM A;  1LXF C;  1UUS A;  2PVB A;  3TUY B;  1S5G Y;  1IWQ A;  3KF9 A;  4ZCV A;  2WCF A;  2LVK A;  3FIA A;  2LLS A;  3GOF A;  3DVJ A;  5D7F A;  1XYD A;  3EVU A;  3NSI A;  2LV7 A;  3PLF B;  1B7T Y;  1A03 A;  1U5I B;  1NCY A;  5CSF A;  1TRF A;  2K7D A;  1KQV A;  2ISD A;  1J55 A;  3KO0 A;  3KHE A;  1WLZ A;  3I5F B;  3PFV A;  4PCW A;  3SIA A;  1CMG A;  4AQI A;  2OS8 C;  1A2X A;  2TN4 A;  4YGC B;  4DRW A;  2L2E A;  2RGI A;  4MLW A;  1QX7 A;  1CM4 A;  4ORB B;  5ER4 X;  5HKZ A;  3I5G C;  1B9A A;  1M31 A;  3PN7 C;  2BE4 A;  1K8U A;  1QJT A;  5KU1 A;  2OTG B;  2MLE C;  2NZ0 A;  4FQO A;  2F2O A;  1IQ5 A;  3NSO A;  2KFG A;  3BUW B;  1BJF A;  1YUU A;  1SR6 B;  1BMO A;  2LHL A;  2L4I A;  2LNK A;  4OCI A;  1QX2 A;  2K7B A;  1LKJ A;  1ODB A;  1B8C A;  1G4Y R;  5AEQ A;  1M46 A;  5AFP A;  1EL4 A;  4MRX A;  1B4C A;  2H2K A;  3CTN A;  4MEW A;  4ETO A;  1CNP A;  1DJG A;  2F2P A;  4PAL A;  5I2Q A;  2LMT A;  3SG4 A;  1OSA A;  2KAV A;  4PE4 A;  2O5G A;  1XK4 C;  3ZNI A;  5HKY A;  1K2H A;  1QV1 A;  1KCY A;  3TDZ A;  1MXL C;  2MAZ A;  4PDZ A;  2O60 A;  2A4J A;  3EK7 A;  5KTY A;  1PVA A;  1DMO A;  1L7Z A;  3LLE A;  3AAK A;  3RM1 A;  4MBE A;  2LP3 A;  2PRU A;  1SCV A;  5K89 A;  2CBL A;  1ALV A;  1L2O B;  1KK8 B;  1KFU S;  1B1G A;  4NDC A;  1ALW A;  4QJ3 B;  1TNW A;  3ICB A;  1CDM A;  2LUX A;  4OV2 A;  1S3P A;  4GGF A;  1SKT A;  4M2P A;  1KK7 Y;  1RRO A;  1ZOT B;  3TZ1 A;  1RJV A;  5DKQ A;  1DJI A;  2BCA A;  2M8U A;  2KQY A;  3O4Y A;  2I94 A;  4QJ4 B;  4XYN A;  4YGA A;  4TNC A;  5HYD A;  4DIR A;  3VRQ A;  1SCM B;  1G33 A;  3CR5 X;  1OQP A;  1CKK A;  3BXK A;  1RTP 1;  3PM8 A;  5ER5 A;  2FOT A;  4YGB B;  3H4S E;  1J1E A;  3CWG A;  1AP4 A;  1N0Y A;  3O6B A;  1JFJ A;  1BU3 A;  2EC6 B;  4I5L B;  1DGV A;  1G8I A;  3EK4 A;  1CFC A;  2PAS A;  2CT9 A;  1YX8 A;  1QTX A;  1SPY A;  2Q4U A;  2LE9 B;  1PRW A;  1DJZ A;  3CZT X;  3VRR A;  1CLM A;  2HF5 A;  2BE6 A;  2NLN A;  1KSO A;  2Y1M A;  3DF0 A;  1KFX L;  3D0Y A;  1QV0 A;  3KPX A;  3PSR A;  5DKR A;  1WRZ A;  2MA2 A;  3OX5 A;  1FW4 A;  4YI8 A;  1HT9 A;  2CXJ A;  1SBJ A;  1F54 A;  2JC2 A;  1NX3 A;  1K93 D;  1OZS A;  3FS7 A;  2PMY A;  5AER A;  1BLQ A;  2FCE A;  2WOS A;  3BUX B;  1ZAC A;  1A4P A;  1CFF A;  2LCP A;  4CID A;  1WLM A;  1QVI Y;  1IG5 A;  4GGF C;  1K94 A;  1NYA A;  1C7V A;  4N1G A;  3VRP A;  2GV5 A;  1SYM A;  4GAO A;  1QS7 A;  2M97 A;  5I2L A;  5GQQ C;  3QRX A;  3SG5 A;  3WNX B;  2E30 A;  3D10 A;  1EH2 A;  2LUC A;  1AJ4 A;  1Y6W A;  1TNX A;  1EG4 A;  2ZRS A;  1KQM C;  1LA0 A;  1UHH A;  1XFY O;  3NXA A;  2EGD A;  2GGM A;  2LHI A;  3BYA A;  1GGW A;  3CR2 A;  1E8A A;  1GQM A;  2HET A;  1K9U A;  2KGR A;  2LAP A;  2VRG A;  5KSZ A;  1S6C A;  1JBA A;  3F45 A;  2WCE A;  2DOQ A;  1TNP A;  3EVR A;  4PHJ A;  2PSR A;  4U8D A;  3O78 A;  4MN0 A;  1K96 A;  3DD4 A;  3I5H B;  1H8B A;  4PHM A;  2KI4 C;  4CPV A;  2AAO A;  2M49 B;  1SW8 A;  3VRN A;  1CM1 A;  2KI6 C;  4GBA A;  1B8R A;  1KFX S;  2M1U A;  2ZN9 A;  1WRL A;  3OB1 B;  1BR1 B;  5CPV A;  2KDH A;  1S5G Z;  2LLT A;  4WQ2 A;  4CFR A;  2CCM A;  1N2D A;  1NPQ A;  1UHN A;  2I2R E;  3EVV A;  4YI9 A;  1BOD A;  4GPL B;  2JWW A;  4JQ0 D;  4HRE E;  3IF7 A;  1QAT A;  3I5I C;  1B7T Z;  3IQQ A;  3JVT C;  4YBH B;  1GJY A;  2BL0 C;  2M0R A;  1YRU B;  3AAJ A;  1M63 B;  3SG6 A;  4M2O A;  1OOJ A;  5HLO A;  1IRJ A;  3IQO A;  1NCX A;  2F8P A;  2LP2 A;  1LA3 A;  1M45 A;  1NIW A;  3MSE B;  1CFP A;  1QIV A;  1CLB A;  2JNX A;  1NP8 A;  3JTD B;  1R6P A;  1HQV A;  2P6B B;  5FYX A;  5HKW A;  1WDC B;  1F4Q A;  3VRO A;  4CFQ A;  4I5K A;  2G2B A;  2KQ6 A;  1BT6 A;  4N5X A;  2PAL A;  3I5F C;  5AXI A;  1CTR A;  4PE0 A;  3DVK A;  1C07 A;  2JZI A;  3PAT A;  2BKI B;  4GGN A;  2FCD A;  4MZL A;  1Y0V H;  2I7A A;  3TS5 B;  2JNF A;  5I8N A;  3CLN A;  1MXE A;  1OMR A;  4MVF A;  1AHR A;  4R1E A;  1D1O A;  2LC5 A;  2M1K B;  4XJK B;  1MHO A;  2V53 A;  3A8R A;  3EKJ A;  4C0K A;  3GK4 X;  1IJ6 A;  2D8N A;  1DF0 B;  1SR6 C;  2HQ8 A;  4E68 A;  1FF1 A;  5G08 A;  3BOW A;  1KWO B;  1A75 A;  4M2Q A;  1OMD A;  1JF0 A;  4NDD A;  1ZUZ A;  2COL B;  4PHN A;  1TIZ A;  2M3W A;  3HX4 A;  1S36 A;  1QIW A;  1LVC D;  1TN4 A;  2MHH A;  3FWC A;  2JQ6 A;  3WHT B;  2G9B A;  5CSI A;  5JJG A;  2M7N A;  4I5N B;  1S6J A;  1OMV A;  4OVN F;  1UHJ A;  2I18 A;  2M7L A;  2Y1N A;  1SNL A;  3TDU A;  1OE9 B;  4ZCU A;  4D1E A;  1DTL A;  1NX0 A;  1A29 A;  2F3Y A;  2QAC A;  2LVV A;  4MRY A;  2KAY A;  1NCZ A;  2K7O A;  2JT0 A;  3E3R A;  2M29 A;  5B8I B;  1N65 A;  1R2U A;  2BCB A;  2KHN A;  1K95 A;  1J7P A;  1DJW A;  1DVI A;  1MQ1 A;  4C0J A;  1J7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...