1QVIY

Crystal structure of scallop myosin s1 in the pre-power stroke state to 2.6 angstrom resolution: flexibility and function in the head
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
141
structure length
141
Chain Sequence
b'LPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated muscle
publication title Crystal structure of scallop Myosin s1 in the pre-power stroke state to 2.6 a resolution: flexibility and function in the head.
pubmed doi rcsb
molecule tags Contractile protein
total genus 41
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qviY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qviY02
2H2KA 1K94A 1C07A 2KQYA 3SG5A 4WQ2A 3TDIA 1NSHA 1YTZC 5JJGA 1E8AA 1WRZA 2MHHA 3KPXA 3TS5B 3TDUA 4YGCB 2LP2A 4PHKA 2HPSA 4JQ0D 2KFHA 5DKNA 2KYFA 5I2OA 1UHJA 2PMYA 2PASA 1GGZA 3WXAA 2LMVA 1LA3A 1XO5A 4OV2A 1MUXA 1PSBA 3PN7C 2LM5A 5ER5A 3GK2A 1MQ1A 1Q80A 1QIWA 2M97A 5KTYA 1AK8A 3BUXB 3CGAA 1OMDA 2O5GA 4PALA 4AQJA 1FF1A 1RTP1 4GGNA 1A75B 2ZKMX 1F4QA 4C0LA 1JSAA 3VRRA 1JC2A 1F54A 2MBXA 1DVIA 2FCEA 2M3WA 1IJ6A 1U5IB 2NLNA 4ICBA 5KSZA 4PHMA 2KOTA 1F71A 4WQ3A 1F55A 3CZTX 2AMIA 2I18A 5KU1A 1H8BA 2WC8A 1XFUO 1XK4A 3O2PA 1BLQA 1JUOA 3KO0A 1BR1B 5CSNA 3NSIA 1DJGA 2LVJA 4YGBB 1X02A 2GV5A 1BJFA 1CFPA 4P2YB 5B8IB 1QVIZ 5GQQC 1BMOA 1MXLC 3LCPC 2L2EA 2LCPA 3MSEB 2M7NA 3RLZA 4CLNA 1EH2A 1RWYA 2OPOA 1IWQA 4TNCA 4DIRA 1YVLA 4N1GA 1QX2A 1SR6C 2KSPA 4MVFA 1S6JA 2AUCA 5K89A 2MLEC 2K2FA 4YI8A 1QS7A 3OX5A 1G33A 2K7DA 2I2RE 1XVJA 2E6WA 2KAXA 4GBAA 1TCFA 1OE9B 2K7BA 4PE1A 3FWBA 2EC6B 1OQPA 2Y4QA 4JWQA 5CSJA 2BL0B 3JTDB 3NSKA 1B9AA 3CTNA 3EVVA 1CM1A 1NYAA 2A4JA 4QJ5B 3CR2A 2HQWA 3BOWB 1OMVA 1S1EA 1LINA 1XK4C 2SASA 1K96A 1KSOA 2PALA 3LL8B 1TOPA 1H4BA 3QRXA 4NDBA 4NDCA 4PE7A 2TN4A 2PSRA 3EK4A 1WRKA 2JPTA 2ZNDA 3BUWB 1EG3A 2I7AA 2OTGB 1KK8C 3EK7A 3LLEA 1C7VA 3NSLA 1N2DA 2G9BA 1NX1A 2BBNA 5G08A 1B7TY 2F3YA 2OS8B 3D0YB 1TIZA 1RECA 1BG1A 2M9GA 2ZN8A 3I5FC 2JOJA 2K0JA 2LHIA 1J7PA 2F2OA 4ZCVA 1PALA 4PCWA 4PDZA 1LXFC 2M1UA 3AKAA 2IS9A 1IQ5A 1AVSA 2LMTA 1J55A 1SRAA 2BCBA 3SIAA 1Y1XA 4YRUA 1SYMA 4YGAA 2Y1MA 1QX5B 5I2QA 1KCYA 2ZFDA 1S5GZ 5AEQA 1CFDA 1TRFA 2LANA 3PN7B 4JPZB 1DGUA 3RM1A 2CT9A 1ZACA 1QLSA 2KDHA 2JRFA 3IQOA 1B4CA 1PSRA 2O60A 4CFQA 5TNCA 3I5IC 1DF0A 2NCOA 1S26D 3CR5X 2LVVA 4FQOA 1KWOC 1UHIA 1DJXA 1CTRA 4PE0A 2GGMA 1PULA 2K7OA 2LUCA 1FI6A 1YR5A 1SW8A 1XYDA 2K8MB 1KFXL 1CMFA 1HQVA 3VRPA 2KGBC 1W7IB 1IJ5A 3LK1A 3DVEA 4BY4A 3OHMB 1Y0VH 1IQ3A 5DKQA 2F33A 3PATA 2HQ8A 1EG4A 1PK0D 3GOFA 3KF9A 3SG3A 1DTLA 1M31A 1ALVA 1SR6B 1YUSA 4MRYA 4XJKA 2EGDA 5J3XA 1CFFA 2Y1NA 5AANA 4BY5A 1QXPA 2H61C 2KI6D 1KK7Y 3KHEA 4YI9A 4WRIA 1RROA 4ORBB 2LUXA 1ZOTB 3M0WA 3HX4A 1CDLA 3KEVA 2KBIA 1AHRA 1BU3A 1QX7A 1CMGA 2KFGA 2L50A 3DF0A 2LVIA 1XFVO 1DJHA 1KQMC 3PM8A 1B47A 5PALA 1A75A 2Y5IA 1KQVA 3ZNIA 2JNFA 1PVBA 3OX6A 1NCXA 1W7JB 4DUQA 5IBWA 1DT7B 4I5NB 1L2OC 2MA2A 4MSPA 5BPJA 1J1EA 2Q91A 1K8UA 3O4YA 5CSIA 4R1EA 1S6CA 1DMOA 2HETA 1Y1AA 2Q4UA 3CR4X 1CKKA 3LK0A 3PLFB 1KK8B 1MHOA 1UURA 2JTZA 1QATA 2F2PA 1PVAA 1IGVA 3HCMA 3PALA 4F0ZB 1YURA 3VROA 1BOCA 5HLVA 2KNEA 4NDDA 1G8IA 1WLZA 1M46A 2K7CA 1YX7A 2LE9B 1K95A 3I5FB 2KI4C 2BE4A 1WRLA 2PVBA 2LLTA 1EL4A 2BCAA 4M2QA 1NPQA 4E68A 4HREE 5AFPA 3DD4A 3I5GC 2P6BB 3K21A 2KGRA 1RJVA 1OZOA 2CCMA 3BQ3A 1BF5A 1RK9A 1AJ4A 1K90D 2CXJA 3SG2A 2WORA 2R2IA 2F8PA 3OB1B 1CDPA 3BUNB 5CPVA 1NX0A 2VRGA 1J7QA 2WNDA 1SCVA 1BODA 2LLUA 1NIWA 2JU0A 5HLOA 1HT9A 5I2LA 1CLMA 1N65A 4YGDB 3I5IB 2JXCA 3I5HC 3TUYB 3BOWA 1UWOA 3NSOA 1KWOB 2LNKA 4ZCUA 5DKRA 1ZUZA 2L98A 2MRDA 1A4PA 3OB2B 1SBJA 1TNXA 1YRUB 3ICBA 5HKWA 1SKTA 2ZNEA 4OKHA 2LVKA 4MBEA 1ZFSA 3SG7A 4PE4A 4L9MA 1QLKA 2F3ZA 2ZRTA 1CDNA 1TNPA 3A4UB 3D0YA 3E3RA 3H4SE 2KHNA 3EVRA 2LLSA 1ZMZA 3OP0A 1KFUS 1XFYO 1K9PA 2JWWA 2V53A 5ER4X 4N1FA 1TNQA 2L0PA 3CWGA 1M45A 1SMGA 2BECA 1SPYA 2ISDA 4IL1A 4NQGA 3VGOA 4C0JA 1YUUA 1QIVA 1JFKA 2LC5A 2M1KB 2JZIA 2K61A 3DVMA 4M2OA 1AJ5A 2HF5A 1JF0A 3VRQA 3SJSA 1K9UA 3EK8A 1XFXO 1N0YA 4N5XA 1A2XA 1S6IA 3SIBA 1BT6A 1B7TZ 1DF0B 2KBMA 1IKUA 1IG5A 1ODBA 1SCMC 1YX8A 3GK4X 1KFXS 1CLLA 3WHUB 3WNXB 1CM4A 1CDMA 1R6PA 1SL7A 2JXLA 1YVHA 1VRKA 4Q04A 3TDZA 2QPTA 2M7LA 1UUSA 4MEWA 1Y6WA 1L2OB 2I94A 1AUIB 5CSFA 4CIDA 3VRNA 1D1OA 2NZ0A 1QV1A 2CBLA 2DOQA 2M8UA 3JVTC 3SG4A 4D1EA 2KI6C 1K2HA 1J7OA 2WCBA 4DRWA 5F6TA 4C0KA 1YUTA 3PFVA 1V1GA 4ETOA 3O6BA 1FBVA 1EXRA 1C7WA 1OSAA 1OZSA 1WLMA 2L5XB 2LAPA 5JOLA 1QVIY 1TNWA 2QACA 4XJKB 5HKYA 2L4HA 4DS7A 2KI4B 1K9KA 1EJ3A 5AERA 1NCYA 3EKJA 1NX3A 1QASA 4MZKA 2NXQA 2D8NA 4GGFA 2SCPA 1L7ZA 3I5GB 3BUOB 1FPWA 4I5JA 1WDCC 4DCKA 4GFTA 1M63B 1MXEA 2GGZA 2COLB 2BE6A 1JF2A 3DF0B 1U5IA 3EKHA 4CPVA 2CTNA 1JWDA 1SNLA 1DJWA 1GQMA 5D7FA 3FIAA 3ZWHA 2M49B 1XA5A 4PHJA 1WY9A 2LV7A 2WCEA 3C1VA 2BKIB 3I5HB 3DVJA 2JT8A 2L51A 1UHNA 3D10A 2E30A 4OR9B 1J1DA 1DJYA 1TN4A 3PSRA 3O78A 3TS5C 2KYCA 1SK6D 4QJ3B 4A4CA 4YBHB 1UP5A 2CNPA 1CNPA 1FI5A 4GUKA 4HSZA 1KK7Z 1F4OA 2RGIA 3FS7A 2KQ6A 1QV0A 1Y1UA 2JTTA 1CB1A 2L4IA 1CLBA 2KFFA 2JULA 4GGFC 4MLWA 3TZ1A 1OOJA 4QJ4B 4USLA 2G2BA 2MLFC 3WHTB 4AOMA 1JBAA 3F45A 1B8CA 2FJUB 4A4BA 4OVNF 3AKBA 1DJIA 2ZRSA 4M2PA 1SL9A 1LKJA 2BBMA 1CFCA 4FTGA 2AAOA 2JQ6A 1PRWA 1GGWA 1MR8A 3CLNA 1NUBA 5D69A 1RFJA 1DJZA 2LP3A 1S5GY 2BCXA 1SL8A 4MN0A 2NCPA 4CFRA 2FCDA 1ALWA 3EVUA 1A03A 2MAZA 4I5KA 1XFWO 1SCMB 2LHLA 3IF7A 2BKHB 4GPLB 1S36A 2B1UA 1TCOB 1XFZO 1UHKA 2LMUA 4I5LB 1B8RA 1J7RA 1M39A 3NXAA 4HRGA 2JT0A 1IRJA 1F8HA 4U8DA 3JVTB 4AQIA 4PHNA 2EHBA 3BUMB 5FYXA 1R2UA 1G4YR 1IH0A 2ZN9A 1AP4A 1A29A 1OMRA 2WCFA 4GAOA 4HRHA 1V1FA 1LVCD 5AXIA 2KAVA 2WOSA 3DVKA 3GK1A 3SG6A 1UHHA 1YRTB 2EC6C 4MRXA 1GJYA 1S3PA 1QTXA 2BL0C 1LA0A 1NP8A 3JTDC 1MF8B 2MJWB 1DGVA 3BYAA 1NCZA 4OCIA 4XYNA 1FW4A 2K2AA 1BR4B 3A8RA 4YGEB 4GNKB 1B8LA 1WDCB 2JNXA 1KFUL 1TTXA 1KQMB 2PRUA 3CS1A 1SY9A 2KAYA 4MZLA 1K93D 2H61A 4ORCB 2JC2A 2OTGC 1KSMA 3FWCA 3IQQA 1QJTA 3BXKA 4ORAB 2JT3A 1B1GA 1NWDA 2M0RA 3TUYC 3AAJA 2OS8C 5HKZA 4P5OE 5HYDA 2FOTA 1JFJA 4UPGA 3AAKA 5I8NA 2M29A 1NX2A 1MWNA 1F70A 4MZJA
chains in the Genus database with same CATH superfamily
2H2KA 1K94A 1C07A 2KQYA 3SG5A 4WQ2A 3TDIA 1NSHA 1YTZC 5JJGA 1E8AA 1WRZA 2MHHA 3R72A 3KPXA 3TS5B 3TDUA 4YGCB 2LP2A 4PHKA 2HPSA 4JQ0D 2KFHA 5DKNA 2KYFA 5I2OA 1UHJA 2PMYA 2ERBA 2PASA 1GGZA 5FI7A 3WXAA 2LMVA 1LA3A 1XO5A 3CZ1A 4OV2A 2QEHA 3SS3A 1MUXA 3R1OA 3CDNA 1PSBA 3PN7C 2LM5A 5ER5A 3GK2A 1MQ1A 1Q80A 1QIWA 2M97A 5KTYA 3UNWA 1AK8A 3BUXB 3CGAA 1OMDA 2O5GA 4PALA 4D1EA 4AQJA 1FF1A 1RTP1 4GGNA 1A75B 2ZKMX 1F4QA 4C0LA 1JSAA 3BFAA 3VRRA 1JC2A 1F54A 2MBXA 1DVIA 2FCEA 2M3WA 1IJ6A 1U5IB 2NLNA 4ICBA 3VB1A 5KSZA 4PHMA 2KOTA 1F71A 4WQ3A 1F55A 3CZTX 2AMIA 2I18A 5KU1A 1H8BA 3L4AA 2WC8A 1XFUO 1XK4A 3O2PA 1BLQA 1JUOA 3KO0A 1BR1B 2YGUA 3D78A 5CSNA 1C3YA 1Z2CB 3NSIA 1DJGA 2LVJA 1XFRA 4YGBB 1X02A 2GV5A 1BJFA 1CFPA 4P2YB 5B8IB 1QVIZ 5GQQC 1BMOA 1MXLC 4JD9A 3LCPC 2L2EA 2LCPA 3MSEB 2M7NA 3RLZA 4CLNA 1EH2A 1RWYA 2OPOA 1IWQA 2PQLA 3CZ0A 1YVLA 4N1GA 4TNCA 1QX2A 1SR6C 2KSPA 4MVFA 1S6JA 2AUCA 5K89A 3L4LA 2MLEC 2K2FA 4YI8A 1QS7A 3OX5A 1G33A 2K7DA 4OZDA 2I2RE 1XVJA 2E6WA 2KAXA 4GBAA 1TCFA 3L47A 1OE9B 5HL1A 2K7BA 4PE1A 3FWBA 2EC6B 1OQPA 2Y4QA 4JWQA 5CSJA 2BL0B 3NHIA 3JTDB 3NSKA 1B9AA 3CTNA 3EVVA 1CM1A 1NYAA 3B6XA 2A4JA 4QJ5B 3CR2A 2HQWA 3BOWB 1OMVA 1S1EA 1LINA 1XK4C 2SASA 1K96A 1KSOA 1OW4A 2PALA 3LL8B 5I94A 1TOPA 1H4BA 3QRXA 4NDBA 4NDCA 4PE7A 2TN4A 2PSRA 3EK4A 1WRKA 2JPTA 3B7AA 2ZNDA 3BUWB 1EG3A 2I7AA 2OTGB 1KK8C 3EK7A 3IVTA 3DYEA 3FE8A 3LLEA 1C7VA 3NSLA 1N2DA 2G9BA 1NX1A 1DEKA 2BBNA 5G08A 1B7TY 2F3YA 2OS8B 3V2LA 3D0YB 1TIZA 1RECA 1BG1A 2M9GA 2K60A 2ZN8A 3I5FC 2JOJA 2K0JA 2LHIA 1J7PA 2F2OA 4ZCVA 1PALA 4PCWA 4PDZA 1LXFC 4INWA 2M1UA 3AKAA 2IS9A 1IQ5A 1AVSA 2LMTA 1J55A 1SRAA 2BCBA 3SIAA 1Y1XA 2BNXA 3BFBA 4YRUA 1SYMA 4YGAA 2Y1MA 1QX5B 5I2QA 1TWOA 2ZFDA 1KCYA 1S5GZ 5AEQA 1CFDA 1TRFA 2LANA 3PN7B 4JPZB 1DGUA 3RM1A 2CT9A 1ZACA 1QLSA 2KDHA 3PM2A 3OGNA 2JRFA 3IQOA 1B4CA 1PSRA 2O60A 4CFQA 5TNCA 3I5IC 2L5YA 1DF0A 2NCOA 1S26D 3CR5X 2LVVA 4FQOA 1KWOC 1UHIA 1DJXA 1CTRA 4PE0A 2KPHA 2GGMA 1PULA 2K7OA 2LUCA 1FI6A 1YR5A 1SW8A 1XYDA 2K8MB 1KFXL 1CMFA 3N7HA 1HQVA 3D77A 3VRPA 2KGBC 1W7IB 1IJ5A 3LK1A 3DVEA 3OBVA 3RZSA 4BY4A 3OHMB 1Y0VH 1IQ3A 5DKQA 2F33A 3PATA 2HQ8A 1EG4A 1PK0D 3GOFA 3KF9A 3SG3A 2WCHA 1DTLA 1M31A 1ALVA 3D76A 1SR6B 1YUSA 2WC5A 4MRYA 4XJKA 2EGDA 3NGVA 3B86A 5J3XA 1CFFA 2KLEA 2Y1NA 3PJIA 5AANA 4BY5A 1QXPA 2H61C 2QEVA 2KI6D 1KK7Y 3KHEA 4YI9A 4WRIA 1RROA 4ORBB 2LUXA 3NHTA 1ZOTB 3M0WA 3HX4A 2QDIA 1CDLA 3KEVA 2KBIA 1AHRA 1BU3A 1QX7A 1CMGA 2KFGA 2L50A 3DF0A 3S0DA 2LVIA 1XFVO 1DJHA 1P28A 1KQMC 3PM8A 1B47A 5PALA 1A75A 2Y5IA 1KQVA 4JKTA 3ZNIA 2JNFA 1PVBA 3OX6A 1NCXA 1W7JB 2WCMA 4DUQA 5IBWA 1DT7B 4I5NB 1L2OC 2MA2A 4MSPA 5BPJA 1J1EA 2Q91A 1K8UA 3O4YA 5CSIA 4R1EA 1S6CA 4KYNA 1DMOA 2HETA 1Y1AA 2Q4UA 3CR4X 1CKKA 3LK0A 3PLFB 1KK8B 1MHOA 1UURA 2JTZA 1QATA 2F2PA 1PVAA 1IGVA 2WCKA 3HCMA 3PALA 1YURA 3VROA 4F0ZB 1BOCA 5HLVA 2KNEA 4NDDA 1G8IA 1QWVA 1WLZA 1M46A 2K7CA 3BJHA 1GM0A 5D3OA 1YX7A 2LE9B 1K95A 2JPOA 2P71A 3I5FB 2KI4C 3R1PA 2BE4A 1WRLA 2PVBA 2LLTA 1EL4A 2BCAA 4M2QA 1NPQA 4E68A 4HREE 5AFPA 3DD4A 3I5GC 2P6BB 3K21A 4INXA 2KGRA 1RJVA 3S0AA 1OZOA 2CCMA 3BQ3A 1BF5A 1RK9A 1AJ4A 1K90D 2CXJA 3SG2A 2WORA 2R2IA 2F8PA 3OB1B 1CDPA 3BUNB 5CPVA 1NX0A 2VRGA 3SS4A 1J7QA 2WNDA 1SCVA 2L2CA 1BODA 2LLUA 1NIWA 3S0FA 2JU0A 5HLOA 1HT9A 5I2LA 1CLMA 1N65A 4YGDB 3I5IB 2JXCA 3I5HC 3TUYB 3BOWA 1UWOA 3NSOA 1KWOB 2LNKA 4ZCUA 5DKRA 1ZUZA 2L98A 2MRDA 1A4PA 2WC6A 3OB2B 1SBJA 1TNXA 1YRUB 3ICBA 5HKWA 1SKTA 2QEOA 2ZNEA 4OKHA 2LVKA 4MBEA 1ZFSA 3SG7A 4PE4A 4L9MA 1QLKA 2F3ZA 2ZRTA 2FJYA 1CDNA 1TNPA 3A4UB 3D0YA 3E3RA 3H4SE 2KHNA 3D73A 3EVRA 2LLSA 1ZMZA 3OP0A 1KFUS 1C3ZA 1K9PA 1XFYO 2JWWA 2V53A 5ER4X 2WCJA 1TNQA 2L0PA 3CWGA 1M45A 4N1FA 1SMGA 2BECA 1SPYA 2ISDA 4DIRA 4IL1A 4NQGA 3VGOA 4C0JA 1YUUA 1QIVA 1JFKA 2LC5A 2M1KB 2JZIA 2K61A 3DVMA 4M2OA 1AJ5A 2HF5A 1JF0A 3VRQA 3SJSA 1K9UA 3EK8A 1XFXO 1N0YA 4N5XA 1A2XA 1S6IA 3SIBA 1BT6A 1B7TZ 1DF0B 2KBMA 1IKUA 1IG5A 3B87A 1ODBA 1SCMC 1YX8A 3GK4X 1KFXS 1CLLA 3O4XA 3WHUB 3WNXB 1CM4A 1CDMA 1R6PA 1SL7A 2JXLA 1YVHA 1VRKA 4Q04A 3TDZA 2QPTA 2M7LA 1UUSA 3B88A 4MEWA 1Y6WA 1L2OB 2I94A 1AUIB 5CSFA 3UO9A 4CIDA 3VRNA 1D1OA 2NZ0A 1QV1A 2CBLA 2DOQA 2M8UA 3JVTC 3SG4A 4FQTA 1DQEA 2KI6C 1J7OA 2WCBA 1K2HA 4DRWA 5F6TA 4C0KA 1YUTA 3PFVA 1V1GA 4ETOA 3O6BA 1FBVA 1DC1A 1EXRA 1C7WA 1OSAA 1OZSA 1WLMA 2L5XB 2LAPA 3CABA 2BAPA 5JOLA 1IIOA 1QVIY 1TNWA 2H8VA 2QACA 4XJKB 5HKYA 2L4HA 4DS7A 2KI4B 1K9KA 5EL2A 1EJ3A 5AERA 1NCYA 3DY9A 3EKJA 1NX3A 1QASA 5FI6A 4MZKA 2NXQA 2D8NA 4GGFA 2SCPA 1L7ZA 1OOHA 3I5GB 3BUOB 1FPWA 4I5JA 1WDCC 3CYZA 4DCKA 4GFTA 1M63B 1MXEA 2GGZA 2QEBA 2COLB 2BE6A 1T14A 1JF2A 3DF0B 1OOFA 1U5IA 3EKHA 4CPVA 2CTNA 1W9ZA 1OOIX 3CZ2A 1JWDA 1SNLA 1DJWA 1GQMA 5D7FA 3FIAA 3ZWHA 2M49B 1XA5A 3QMEA 1WY9A 2LV7A 2WCEA 4PHJA 3S0GA 2GTEA 2BKIB 3C1VA 1ORGA 3DVJA 2JT8A 3I5HB 2L51A 4PT1A 1UHNA 3D10A 2E30A 4IJ7A 1J1DA 1DJYA 3BFHA 4OR9B 1TN4A 3PSRA 3O78A 3TS5C 2KYCA 1SK6D 4QJ3B 4A4CA 4YBHB 1UP5A 2CNPA 1CNPA 1FI5A 4GUKA 4HSZA 1KK7Z 1F4OA 2RGIA 3FS7A 3R1VA 2KQ6A 1QV0A 1Y1UA 2JTTA 1CB1A 2L4IA 3D74A 1CLBA 1SSEB 2KFFA 2JULA 4GGFC 4MLWA 3TZ1A 1OOJA 4QJ4B 2P70A 4USLA 2G2BA 2MLFC 3WHTB 4AOMA 1JBAA 3F45A 1B8CA 2FJUB 4A4BA 4OVNF 3AKBA 1DJIA 2ZRSA 4M2PA 1SL9A 1LKJA 2BBMA 1CFCA 4FTGA 1OOGA 2AAOA 2JQ6A 1PRWA 1GGWA 1MR8A 1Z4HA 3CLNA 1NUBA 5D69A 1RFJA 1DJZA 2LP3A 2KLDA 1S5GY 2BCXA 1SL8A 3S0EA 4MN0A 2NCPA 4CFRA 2FCDA 1ALWA 1TUZA 3EVUA 1A03A 2MAZA 4I5KA 1XFWO 1SCMB 2LHLA 3IF7A 2BKHB 4GPLB 2PYQA 1S36A 2B1UA 1TCOB 1XFZO 1UHKA 3K1EA 2LMUA 4I5LB 1B8RA 1J7RA 1M39A 3NXAA 4HRGA 2JT0A 1IRJA 1F8HA 4U8DA 3JVTB 3EG5B 4AQIA 3DZTA 4PHNA 2EHBA 3BUMB 5FYXA 1R2UA 1G4YR 1IH0A 2ZN9A 1AP4A 1A29A 1OMRA 2WCFA 1DELA 4GAOA 4HRHA 1V1FA 1LVCD 5AXIA 2KAVA 2WOSA 3DVKA 3GK1A 3SG6A 1UHHA 4F7FA 1YRTB 2EC6C 2WCLA 4MRXA 5DICA 1GJYA 1S3PA 1QTXA 2BL0C 3S0BA 1LA0A 1NP8A 3JTDC 1MF8B 2MJWB 1DGVA 3SS5A 3BYAA 1NCZA 3D75A 4OCIA 4XYNA 1FW4A 2K2AA 3FE6A 1BR4B 3A8RA 4YGEB 4GNKB 1B8LA 1WDCB 2JNXA 1KFUL 1TTXA 1KQMB 2PRUA 3CS1A 1SY9A 2KAYA 4MZLA 1K93D 2H61A 4ORCB 5FI2A 2JC2A 3DXLA 3Q8IA 2OTGC 1KSMA 3FWCA 3IQQA 1QJTA 3BXKA 4ORAB 2JT3A 1B1GA 1NWDA 2M0RA 3TUYC 1TUJA 3AAJA 2OS8C 5HKZA 4P5OE 1LS8A 5HYDA 2FOTA 1JFJA 3FE9A 4UPGA 3AAKA 5I8NA 2M29A 1NX2A 1MWNA 1F70A 4MZJA
chains in the Genus database with same CATH topology
2H2KA 1K94A 1C07A 2KQYA 3SG5A 4WQ2A 3TDIA 1NSHA 1YTZC 5JJGA 1E8AA 1WRZA 2MHHA 3KPXA 3TS5B 3TDUA 4YGCB 2LP2A 4PHKA 2HPSA 4JQ0D 2KFHA 5DKNA 2KYFA 5I2OA 1UHJA 2PMYA 2PASA 1GGZA 3WXAA 2LMVA 1LA3A 1XO5A 4OV2A 1MUXA 1PSBA 3PN7C 2LM5A 5ER5A 3GK2A 1MQ1A 1Q80A 1QIWA 2M97A 5KTYA 1AK8A 3BUXB 3CGAA 1OMDA 2O5GA 4PALA 4AQJA 1FF1A 1RTP1 4GGNA 1A75B 2ZKMX 1F4QA 4C0LA 1JSAA 3VRRA 1JC2A 1F54A 2MBXA 1DVIA 2FCEA 2M3WA 1IJ6A 1U5IB 2NLNA 4ICBA 5KSZA 4PHMA 2KOTA 1F71A 4WQ3A 1F55A 3CZTX 2AMIA 2I18A 5KU1A 1H8BA 2WC8A 1XFUO 1XK4A 3O2PA 1BLQA 1JUOA 3KO0A 1BR1B 5CSNA 3NSIA 1DJGA 2LVJA 4YGBB 1X02A 2GV5A 1BJFA 1CFPA 4P2YB 5B8IB 1QVIZ 5GQQC 1BMOA 1MXLC 3LCPC 2L2EA 2LCPA 3MSEB 2M7NA 3RLZA 4CLNA 1EH2A 1RWYA 2OPOA 1IWQA 4TNCA 4DIRA 1YVLA 4N1GA 1QX2A 1SR6C 2KSPA 4MVFA 1S6JA 2AUCA 5K89A 2MLEC 2K2FA 4YI8A 1QS7A 3OX5A 1G33A 2K7DA 2I2RE 1XVJA 2E6WA 2KAXA 4GBAA 1TCFA 1OE9B 2K7BA 4PE1A 3FWBA 2EC6B 1OQPA 2Y4QA 4JWQA 5CSJA 2BL0B 3JTDB 3NSKA 1B9AA 3CTNA 3EVVA 1CM1A 1NYAA 2A4JA 4QJ5B 3CR2A 2HQWA 3BOWB 1OMVA 1S1EA 1LINA 1XK4C 2SASA 1K96A 1KSOA 2PALA 3LL8B 1TOPA 1H4BA 3QRXA 4NDBA 4NDCA 4PE7A 2TN4A 2PSRA 3EK4A 1WRKA 2JPTA 2ZNDA 3BUWB 1EG3A 2I7AA 2OTGB 1KK8C 3EK7A 3LLEA 1C7VA 3NSLA 1N2DA 2G9BA 1NX1A 2BBNA 5G08A 1B7TY 2F3YA 2OS8B 3D0YB 1TIZA 1RECA 1BG1A 2M9GA 2ZN8A 3I5FC 2JOJA 2K0JA 2LHIA 1J7PA 2F2OA 4ZCVA 1PALA 4PCWA 4PDZA 1LXFC 2M1UA 3AKAA 2IS9A 1IQ5A 1AVSA 2LMTA 1J55A 1SRAA 2BCBA 3SIAA 1Y1XA 4YRUA 1SYMA 4YGAA 2Y1MA 1QX5B 5I2QA 1KCYA 2ZFDA 1S5GZ 5AEQA 1CFDA 1TRFA 2LANA 3PN7B 4JPZB 1DGUA 3RM1A 2CT9A 1ZACA 1QLSA 2KDHA 2JRFA 3IQOA 1B4CA 1PSRA 2O60A 4CFQA 5TNCA 3I5IC 1DF0A 2NCOA 1S26D 3CR5X 2LVVA 4FQOA 1KWOC 1UHIA 1DJXA 1CTRA 4PE0A 2GGMA 1PULA 2K7OA 2LUCA 1FI6A 1YR5A 1SW8A 1XYDA 2K8MB 1KFXL 1CMFA 1HQVA 3VRPA 2KGBC 1W7IB 1IJ5A 3LK1A 3DVEA 4BY4A 3OHMB 1Y0VH 1IQ3A 5DKQA 2F33A 3PATA 2HQ8A 1EG4A 1PK0D 3GOFA 3KF9A 3SG3A 1DTLA 1M31A 1ALVA 1SR6B 1YUSA 4MRYA 4XJKA 2EGDA 5J3XA 1CFFA 2Y1NA 5AANA 4BY5A 1QXPA 2H61C 2KI6D 1KK7Y 3KHEA 4YI9A 4WRIA 1RROA 4ORBB 2LUXA 1ZOTB 3M0WA 3HX4A 1CDLA 3KEVA 2KBIA 1AHRA 1BU3A 1QX7A 1CMGA 2KFGA 2L50A 3DF0A 2LVIA 1XFVO 1DJHA 1KQMC 3PM8A 1B47A 5PALA 1A75A 2Y5IA 1KQVA 3ZNIA 2JNFA 1PVBA 3OX6A 1NCXA 1W7JB 4DUQA 5IBWA 1DT7B 4I5NB 1L2OC 2MA2A 4MSPA 5BPJA 1J1EA 2Q91A 1K8UA 3O4YA 5CSIA 4R1EA 1S6CA 1DMOA 2HETA 1Y1AA 2Q4UA 3CR4X 1CKKA 3LK0A 3PLFB 1KK8B 1MHOA 1UURA 2JTZA 1QATA 2F2PA 1PVAA 1IGVA 3HCMA 3PALA 4F0ZB 1YURA 3VROA 1BOCA 5HLVA 2KNEA 4NDDA 1G8IA 1WLZA 1M46A 2K7CA 1YX7A 2LE9B 1K95A 3I5FB 2KI4C 2BE4A 1WRLA 2PVBA 2LLTA 1EL4A 2BCAA 4M2QA 1NPQA 4E68A 4HREE 5AFPA 3DD4A 3I5GC 2P6BB 3K21A 2KGRA 1RJVA 1OZOA 2CCMA 3BQ3A 1BF5A 1RK9A 1AJ4A 1K90D 2CXJA 3SG2A 2WORA 2R2IA 2F8PA 3OB1B 1CDPA 3BUNB 5CPVA 1NX0A 2VRGA 1J7QA 2WNDA 1SCVA 1BODA 2LLUA 1NIWA 2JU0A 5HLOA 1HT9A 5I2LA 1CLMA 1N65A 4YGDB 3I5IB 2JXCA 3I5HC 3TUYB 3BOWA 1UWOA 3NSOA 1KWOB 2LNKA 4ZCUA 5DKRA 1ZUZA 2L98A 2MRDA 1A4PA 3OB2B 1SBJA 1TNXA 1YRUB 3ICBA 5HKWA 1SKTA 2ZNEA 4OKHA 2LVKA 4MBEA 1ZFSA 3SG7A 4PE4A 4L9MA 1QLKA 2F3ZA 2ZRTA 1CDNA 1TNPA 3A4UB 3D0YA 3E3RA 3H4SE 2KHNA 3EVRA 2LLSA 1ZMZA 3OP0A 1KFUS 1XFYO 1K9PA 2JWWA 2V53A 5ER4X 4N1FA 1TNQA 2L0PA 3CWGA 1M45A 1SMGA 2BECA 1SPYA 2ISDA 4IL1A 4NQGA 3VGOA 4C0JA 1YUUA 1QIVA 1JFKA 2LC5A 2M1KB 2JZIA 2K61A 3DVMA 4M2OA 1AJ5A 2HF5A 1JF0A 3VRQA 3SJSA 1K9UA 3EK8A 1XFXO 1N0YA 4N5XA 1A2XA 1S6IA 3SIBA 1BT6A 1B7TZ 1DF0B 2KBMA 1IKUA 1IG5A 1ODBA 1SCMC 1YX8A 3GK4X 1KFXS 1CLLA 3WHUB 3WNXB 1CM4A 1CDMA 1R6PA 1SL7A 2JXLA 1YVHA 1VRKA 4Q04A 3TDZA 2QPTA 2M7LA 1UUSA 4MEWA 1Y6WA 1L2OB 2I94A 1AUIB 5CSFA 4CIDA 3VRNA 1D1OA 2NZ0A 1QV1A 2CBLA 2DOQA 2M8UA 3JVTC 3SG4A 4D1EA 2KI6C 1K2HA 1J7OA 2WCBA 4DRWA 5F6TA 4C0KA 1YUTA 3PFVA 1V1GA 4ETOA 3O6BA 1FBVA 1EXRA 1C7WA 1OSAA 1OZSA 1WLMA 2L5XB 2LAPA 5JOLA 1QVIY 1TNWA 2QACA 4XJKB 5HKYA 2L4HA 4DS7A 2KI4B 1K9KA 1EJ3A 5AERA 1NCYA 3EKJA 1NX3A 1QASA 4MZKA 2NXQA 2D8NA 4GGFA 2SCPA 1L7ZA 3I5GB 3BUOB 1FPWA 4I5JA 1WDCC 4DCKA 4GFTA 1M63B 1MXEA 2GGZA 2COLB 2BE6A 1JF2A 3DF0B 1U5IA 3EKHA 4CPVA 2CTNA 1JWDA 1SNLA 1DJWA 1GQMA 5D7FA 3FIAA 3ZWHA 2M49B 1XA5A 4PHJA 1WY9A 2LV7A 2WCEA 3C1VA 2BKIB 3I5HB 3DVJA 2JT8A 2L51A 1UHNA 3D10A 2E30A 4OR9B 1J1DA 1DJYA 1TN4A 3PSRA 3O78A 3TS5C 2KYCA 1SK6D 4QJ3B 4A4CA 4YBHB 1UP5A 2CNPA 1CNPA 1FI5A 4GUKA 4HSZA 1KK7Z 1F4OA 2RGIA 3FS7A 2KQ6A 1QV0A 1Y1UA 2JTTA 1CB1A 2L4IA 1CLBA 2KFFA 2JULA 4GGFC 4MLWA 3TZ1A 1OOJA 4QJ4B 4USLA 2G2BA 2MLFC 3WHTB 4AOMA 1JBAA 3F45A 1B8CA 2FJUB 4A4BA 4OVNF 3AKBA 1DJIA 2ZRSA 4M2PA 1SL9A 1LKJA 2BBMA 1CFCA 4FTGA 2AAOA 2JQ6A 1PRWA 1GGWA 1MR8A 3CLNA 1NUBA 5D69A 1RFJA 1DJZA 2LP3A 1S5GY 2BCXA 1SL8A 4MN0A 2NCPA 4CFRA 2FCDA 1ALWA 3EVUA 1A03A 2MAZA 4I5KA 1XFWO 1SCMB 2LHLA 3IF7A 2BKHB 4GPLB 1S36A 2B1UA 1TCOB 1XFZO 1UHKA 2LMUA 4I5LB 1B8RA 1J7RA 1M39A 3NXAA 4HRGA 2JT0A 1IRJA 1F8HA 4U8DA 3JVTB 4AQIA 4PHNA 2EHBA 3BUMB 5FYXA 1R2UA 1G4YR 1IH0A 2ZN9A 1AP4A 1A29A 1OMRA 2WCFA 4GAOA 4HRHA 1V1FA 1LVCD 5AXIA 2KAVA 2WOSA 3DVKA 3GK1A 3SG6A 1UHHA 1YRTB 2EC6C 4MRXA 1GJYA 1S3PA 1QTXA 2BL0C 1LA0A 1NP8A 3JTDC 1MF8B 2MJWB 1DGVA 3BYAA 1NCZA 4OCIA 4XYNA 1FW4A 2K2AA 1BR4B 3A8RA 4YGEB 4GNKB 1B8LA 1WDCB 2JNXA 1KFUL 1TTXA 1KQMB 2PRUA 3CS1A 1SY9A 2KAYA 4MZLA 1K93D 2H61A 4ORCB 2JC2A 2OTGC 1KSMA 3FWCA 3IQQA 1QJTA 3BXKA 4ORAB 2JT3A 1B1GA 1NWDA 2M0RA 3TUYC 3AAJA 2OS8C 5HKZA 4P5OE 5HYDA 2FOTA 1JFJA 4UPGA 3AAKA 5I8NA 2M29A 1NX2A 1MWNA 1F70A 4MZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H2K A;  1K94 A;  1C07 A;  2KQY A;  3SG5 A;  4WQ2 A;  3TDI A;  1NSH A;  1YTZ C;  5JJG A;  1E8A A;  1WRZ A;  2MHH A;  3KPX A;  3TS5 B;  3TDU A;  4YGC B;  2LP2 A;  4PHK A;  2HPS A;  4JQ0 D;  2KFH A;  5DKN A;  2KYF A;  5I2O A;  1UHJ A;  2PMY A;  2PAS A;  1GGZ A;  3WXA A;  2LMV A;  1LA3 A;  1XO5 A;  4OV2 A;  1MUX A;  1PSB A;  3PN7 C;  2LM5 A;  5ER5 A;  3GK2 A;  1MQ1 A;  1Q80 A;  1QIW A;  2M97 A;  5KTY A;  1AK8 A;  3BUX B;  3CGA A;  1OMD A;  2O5G A;  4PAL A;  4AQJ A;  1FF1 A;  1RTP 1;  4GGN A;  1A75 B;  2ZKM X;  1F4Q A;  4C0L A;  1JSA A;  3VRR A;  1JC2 A;  1F54 A;  2MBX A;  1DVI A;  2FCE A;  2M3W A;  1IJ6 A;  1U5I B;  2NLN A;  4ICB A;  5KSZ A;  4PHM A;  2KOT A;  1F71 A;  4WQ3 A;  1F55 A;  3CZT X;  2AMI A;  2I18 A;  5KU1 A;  1H8B A;  2WC8 A;  1XFU O;  1XK4 A;  3O2P A;  1BLQ A;  1JUO A;  3KO0 A;  1BR1 B;  5CSN A;  3NSI A;  1DJG A;  2LVJ A;  4YGB B;  1X02 A;  2GV5 A;  1BJF A;  1CFP A;  4P2Y B;  5B8I B;  1QVI Z;  5GQQ C;  1BMO A;  1MXL C;  3LCP C;  2L2E A;  2LCP A;  3MSE B;  2M7N A;  3RLZ A;  4CLN A;  1EH2 A;  1RWY A;  2OPO A;  1IWQ A;  4TNC A;  4DIR A;  1YVL A;  4N1G A;  1QX2 A;  1SR6 C;  2KSP A;  4MVF A;  1S6J A;  2AUC A;  5K89 A;  2MLE C;  2K2F A;  4YI8 A;  1QS7 A;  3OX5 A;  1G33 A;  2K7D A;  2I2R E;  1XVJ A;  2E6W A;  2KAX A;  4GBA A;  1TCF A;  1OE9 B;  2K7B A;  4PE1 A;  3FWB A;  2EC6 B;  1OQP A;  2Y4Q A;  4JWQ A;  5CSJ A;  2BL0 B;  3JTD B;  3NSK A;  1B9A A;  3CTN A;  3EVV A;  1CM1 A;  1NYA A;  2A4J A;  4QJ5 B;  3CR2 A;  2HQW A;  3BOW B;  1OMV A;  1S1E A;  1LIN A;  1XK4 C;  2SAS A;  1K96 A;  1KSO A;  2PAL A;  3LL8 B;  1TOP A;  1H4B A;  3QRX A;  4NDB A;  4NDC A;  4PE7 A;  2TN4 A;  2PSR A;  3EK4 A;  1WRK A;  2JPT A;  2ZND A;  3BUW B;  1EG3 A;  2I7A A;  2OTG B;  1KK8 C;  3EK7 A;  3LLE A;  1C7V A;  3NSL A;  1N2D A;  2G9B A;  1NX1 A;  2BBN A;  5G08 A;  1B7T Y;  2F3Y A;  2OS8 B;  3D0Y B;  1TIZ A;  1REC A;  1BG1 A;  2M9G A;  2ZN8 A;  3I5F C;  2JOJ A;  2K0J A;  2LHI A;  1J7P A;  2F2O A;  4ZCV A;  1PAL A;  4PCW A;  4PDZ A;  1LXF C;  2M1U A;  3AKA A;  2IS9 A;  1IQ5 A;  1AVS A;  2LMT A;  1J55 A;  1SRA A;  2BCB A;  3SIA A;  1Y1X A;  4YRU A;  1SYM A;  4YGA A;  2Y1M A;  1QX5 B;  5I2Q A;  1KCY A;  2ZFD A;  1S5G Z;  5AEQ A;  1CFD A;  1TRF A;  2LAN A;  3PN7 B;  4JPZ B;  1DGU A;  3RM1 A;  2CT9 A;  1ZAC A;  1QLS A;  2KDH A;  2JRF A;  3IQO A;  1B4C A;  1PSR A;  2O60 A;  4CFQ A;  5TNC A;  3I5I C;  1DF0 A;  2NCO A;  1S26 D;  3CR5 X;  2LVV A;  4FQO A;  1KWO C;  1UHI A;  1DJX A;  1CTR A;  4PE0 A;  2GGM A;  1PUL A;  2K7O A;  2LUC A;  1FI6 A;  1YR5 A;  1SW8 A;  1XYD A;  2K8M B;  1KFX L;  1CMF A;  1HQV A;  3VRP A;  2KGB C;  1W7I B;  1IJ5 A;  3LK1 A;  3DVE A;  4BY4 A;  3OHM B;  1Y0V H;  1IQ3 A;  5DKQ A;  2F33 A;  3PAT A;  2HQ8 A;  1EG4 A;  1PK0 D;  3GOF A;  3KF9 A;  3SG3 A;  1DTL A;  1M31 A;  1ALV A;  1SR6 B;  1YUS A;  4MRY A;  4XJK A;  2EGD A;  5J3X A;  1CFF A;  2Y1N A;  5AAN A;  4BY5 A;  1QXP A;  2H61 C;  2KI6 D;  1KK7 Y;  3KHE A;  4YI9 A;  4WRI A;  1RRO A;  4ORB B;  2LUX A;  1ZOT B;  3M0W A;  3HX4 A;  1CDL A;  3KEV A;  2KBI A;  1AHR A;  1BU3 A;  1QX7 A;  1CMG A;  2KFG A;  2L50 A;  3DF0 A;  2LVI A;  1XFV O;  1DJH A;  1KQM C;  3PM8 A;  1B47 A;  5PAL A;  1A75 A;  2Y5I A;  1KQV A;  3ZNI A;  2JNF A;  1PVB A;  3OX6 A;  1NCX A;  1W7J B;  4DUQ A;  5IBW A;  1DT7 B;  4I5N B;  1L2O C;  2MA2 A;  4MSP A;  5BPJ A;  1J1E A;  2Q91 A;  1K8U A;  3O4Y A;  5CSI A;  4R1E A;  1S6C A;  1DMO A;  2HET A;  1Y1A A;  2Q4U A;  3CR4 X;  1CKK A;  3LK0 A;  3PLF B;  1KK8 B;  1MHO A;  1UUR A;  2JTZ A;  1QAT A;  2F2P A;  1PVA A;  1IGV A;  3HCM A;  3PAL A;  4F0Z B;  1YUR A;  3VRO A;  1BOC A;  5HLV A;  2KNE A;  4NDD A;  1G8I A;  1WLZ A;  1M46 A;  2K7C A;  1YX7 A;  2LE9 B;  1K95 A;  3I5F B;  2KI4 C;  2BE4 A;  1WRL A;  2PVB A;  2LLT A;  1EL4 A;  2BCA A;  4M2Q A;  1NPQ A;  4E68 A;  4HRE E;  5AFP A;  3DD4 A;  3I5G C;  2P6B B;  3K21 A;  2KGR A;  1RJV A;  1OZO A;  2CCM A;  3BQ3 A;  1BF5 A;  1RK9 A;  1AJ4 A;  1K90 D;  2CXJ A;  3SG2 A;  2WOR A;  2R2I A;  2F8P A;  3OB1 B;  1CDP A;  3BUN B;  5CPV A;  1NX0 A;  2VRG A;  1J7Q A;  2WND A;  1SCV A;  1BOD A;  2LLU A;  1NIW A;  2JU0 A;  5HLO A;  1HT9 A;  5I2L A;  1CLM A;  1N65 A;  4YGD B;  3I5I B;  2JXC A;  3I5H C;  3TUY B;  3BOW A;  1UWO A;  3NSO A;  1KWO B;  2LNK A;  4ZCU A;  5DKR A;  1ZUZ A;  2L98 A;  2MRD A;  1A4P A;  3OB2 B;  1SBJ A;  1TNX A;  1YRU B;  3ICB A;  5HKW A;  1SKT A;  2ZNE A;  4OKH A;  2LVK A;  4MBE A;  1ZFS A;  3SG7 A;  4PE4 A;  4L9M A;  1QLK A;  2F3Z A;  2ZRT A;  1CDN A;  1TNP A;  3A4U B;  3D0Y A;  3E3R A;  3H4S E;  2KHN A;  3EVR A;  2LLS A;  1ZMZ A;  3OP0 A;  1KFU S;  1XFY O;  1K9P A;  2JWW A;  2V53 A;  5ER4 X;  4N1F A;  1TNQ A;  2L0P A;  3CWG A;  1M45 A;  1SMG A;  2BEC A;  1SPY A;  2ISD A;  4IL1 A;  4NQG A;  3VGO A;  4C0J A;  1YUU A;  1QIV A;  1JFK A;  2LC5 A;  2M1K B;  2JZI A;  2K61 A;  3DVM A;  4M2O A;  1AJ5 A;  2HF5 A;  1JF0 A;  3VRQ A;  3SJS A;  1K9U A;  3EK8 A;  1XFX O;  1N0Y A;  4N5X A;  1A2X A;  1S6I A;  3SIB A;  1BT6 A;  1B7T Z;  1DF0 B;  2KBM A;  1IKU A;  1IG5 A;  1ODB A;  1SCM C;  1YX8 A;  3GK4 X;  1KFX S;  1CLL A;  3WHU B;  3WNX B;  1CM4 A;  1CDM A;  1R6P A;  1SL7 A;  2JXL A;  1YVH A;  1VRK A;  4Q04 A;  3TDZ A;  2QPT A;  2M7L A;  1UUS A;  4MEW A;  1Y6W A;  1L2O B;  2I94 A;  1AUI B;  5CSF A;  4CID A;  3VRN A;  1D1O A;  2NZ0 A;  1QV1 A;  2CBL A;  2DOQ A;  2M8U A;  3JVT C;  3SG4 A;  4D1E A;  2KI6 C;  1K2H A;  1J7O A;  2WCB A;  4DRW A;  5F6T A;  4C0K A;  1YUT A;  3PFV A;  1V1G A;  4ETO A;  3O6B A;  1FBV A;  1EXR A;  1C7W A;  1OSA A;  1OZS A;  1WLM A;  2L5X B;  2LAP A;  5JOL A;  1QVI Y;  1TNW A;  2QAC A;  4XJK B;  5HKY A;  2L4H A;  4DS7 A;  2KI4 B;  1K9K A;  1EJ3 A;  5AER A;  1NCY A;  3EKJ A;  1NX3 A;  1QAS A;  4MZK A;  2NXQ A;  2D8N A;  4GGF A;  2SCP A;  1L7Z A;  3I5G B;  3BUO B;  1FPW A;  4I5J A;  1WDC C;  4DCK A;  4GFT A;  1M63 B;  1MXE A;  2GGZ A;  2COL B;  2BE6 A;  1JF2 A;  3DF0 B;  1U5I A;  3EKH A;  4CPV A;  2CTN A;  1JWD A;  1SNL A;  1DJW A;  1GQM A;  5D7F A;  3FIA A;  3ZWH A;  2M49 B;  1XA5 A;  4PHJ A;  1WY9 A;  2LV7 A;  2WCE A;  3C1V A;  2BKI B;  3I5H B;  3DVJ A;  2JT8 A;  2L51 A;  1UHN A;  3D10 A;  2E30 A;  4OR9 B;  1J1D A;  1DJY A;  1TN4 A;  3PSR A;  3O78 A;  3TS5 C;  2KYC A;  1SK6 D;  4QJ3 B;  4A4C A;  4YBH B;  1UP5 A;  2CNP A;  1CNP A;  1FI5 A;  4GUK A;  4HSZ A;  1KK7 Z;  1F4O A;  2RGI A;  3FS7 A;  2KQ6 A;  1QV0 A;  1Y1U A;  2JTT A;  1CB1 A;  2L4I A;  1CLB A;  2KFF A;  2JUL A;  4GGF C;  4MLW A;  3TZ1 A;  1OOJ A;  4QJ4 B;  4USL A;  2G2B A;  2MLF C;  3WHT B;  4AOM A;  1JBA A;  3F45 A;  1B8C A;  2FJU B;  4A4B A;  4OVN F;  3AKB A;  1DJI A;  2ZRS A;  4M2P A;  1SL9 A;  1LKJ A;  2BBM A;  1CFC A;  4FTG A;  2AAO A;  2JQ6 A;  1PRW A;  1GGW A;  1MR8 A;  3CLN A;  1NUB A;  5D69 A;  1RFJ A;  1DJZ A;  2LP3 A;  1S5G Y;  2BCX A;  1SL8 A;  4MN0 A;  2NCP A;  4CFR A;  2FCD A;  1ALW A;  3EVU A;  1A03 A;  2MAZ A;  4I5K A;  1XFW O;  1SCM B;  2LHL A;  3IF7 A;  2BKH B;  4GPL B;  1S36 A;  2B1U A;  1TCO B;  1XFZ O;  1UHK A;  2LMU A;  4I5L B;  1B8R A;  1J7R A;  1M39 A;  3NXA A;  4HRG A;  2JT0 A;  1IRJ A;  1F8H A;  4U8D A;  3JVT B;  4AQI A;  4PHN A;  2EHB A;  3BUM B;  5FYX A;  1R2U A;  1G4Y R;  1IH0 A;  2ZN9 A;  1AP4 A;  1A29 A;  1OMR A;  2WCF A;  4GAO A;  4HRH A;  1V1F A;  1LVC D;  5AXI A;  2KAV A;  2WOS A;  3DVK A;  3GK1 A;  3SG6 A;  1UHH A;  1YRT B;  2EC6 C;  4MRX A;  1GJY A;  1S3P A;  1QTX A;  2BL0 C;  1LA0 A;  1NP8 A;  3JTD C;  1MF8 B;  2MJW B;  1DGV A;  3BYA A;  1NCZ A;  4OCI A;  4XYN A;  1FW4 A;  2K2A A;  1BR4 B;  3A8R A;  4YGE B;  4GNK B;  1B8L A;  1WDC B;  2JNX A;  1KFU L;  1TTX A;  1KQM B;  2PRU A;  3CS1 A;  1SY9 A;  2KAY A;  4MZL A;  1K93 D;  2H61 A;  4ORC B;  2JC2 A;  2OTG C;  1KSM A;  3FWC A;  3IQQ A;  1QJT A;  3BXK A;  4ORA B;  2JT3 A;  1B1G A;  1NWD A;  2M0R A;  3TUY C;  3AAJ A;  2OS8 C;  5HKZ A;  4P5O E;  5HYD A;  2FOT A;  1JFJ A;  4UPG A;  3AAK A;  5I8N A;  2M29 A;  1NX2 A;  1MWN A;  1F70 A;  4MZJ A; 
#chains in the Genus database with same CATH topology
 2H2K A;  1K94 A;  1C07 A;  2KQY A;  3SG5 A;  4WQ2 A;  3TDI A;  1NSH A;  1YTZ C;  5JJG A;  1E8A A;  1WRZ A;  2MHH A;  3R72 A;  3KPX A;  3TS5 B;  3TDU A;  4YGC B;  2LP2 A;  4PHK A;  2HPS A;  4JQ0 D;  2KFH A;  5DKN A;  2KYF A;  5I2O A;  1UHJ A;  2PMY A;  2ERB A;  2PAS A;  1GGZ A;  5FI7 A;  3WXA A;  2LMV A;  1LA3 A;  1XO5 A;  3CZ1 A;  4OV2 A;  2QEH A;  3SS3 A;  1MUX A;  3R1O A;  3CDN A;  1PSB A;  3PN7 C;  2LM5 A;  5ER5 A;  3GK2 A;  1MQ1 A;  1Q80 A;  1QIW A;  2M97 A;  5KTY A;  3UNW A;  1AK8 A;  3BUX B;  3CGA A;  1OMD A;  2O5G A;  4PAL A;  4D1E A;  4AQJ A;  1FF1 A;  1RTP 1;  4GGN A;  1A75 B;  2ZKM X;  1F4Q A;  4C0L A;  1JSA A;  3BFA A;  3VRR A;  1JC2 A;  1F54 A;  2MBX A;  1DVI A;  2FCE A;  2M3W A;  1IJ6 A;  1U5I B;  2NLN A;  4ICB A;  3VB1 A;  5KSZ A;  4PHM A;  2KOT A;  1F71 A;  4WQ3 A;  1F55 A;  3CZT X;  2AMI A;  2I18 A;  5KU1 A;  1H8B A;  3L4A A;  2WC8 A;  1XFU O;  1XK4 A;  3O2P A;  1BLQ A;  1JUO A;  3KO0 A;  1BR1 B;  2YGU A;  3D78 A;  5CSN A;  1C3Y A;  1Z2C B;  3NSI A;  1DJG A;  2LVJ A;  1XFR A;  4YGB B;  1X02 A;  2GV5 A;  1BJF A;  1CFP A;  4P2Y B;  5B8I B;  1QVI Z;  5GQQ C;  1BMO A;  1MXL C;  4JD9 A;  3LCP C;  2L2E A;  2LCP A;  3MSE B;  2M7N A;  3RLZ A;  4CLN A;  1EH2 A;  1RWY A;  2OPO A;  1IWQ A;  2PQL A;  3CZ0 A;  1YVL A;  4N1G A;  4TNC A;  1QX2 A;  1SR6 C;  2KSP A;  4MVF A;  1S6J A;  2AUC A;  5K89 A;  3L4L A;  2MLE C;  2K2F A;  4YI8 A;  1QS7 A;  3OX5 A;  1G33 A;  2K7D A;  4OZD A;  2I2R E;  1XVJ A;  2E6W A;  2KAX A;  4GBA A;  1TCF A;  3L47 A;  1OE9 B;  5HL1 A;  2K7B A;  4PE1 A;  3FWB A;  2EC6 B;  1OQP A;  2Y4Q A;  4JWQ A;  5CSJ A;  2BL0 B;  3NHI A;  3JTD B;  3NSK A;  1B9A A;  3CTN A;  3EVV A;  1CM1 A;  1NYA A;  3B6X A;  2A4J A;  4QJ5 B;  3CR2 A;  2HQW A;  3BOW B;  1OMV A;  1S1E A;  1LIN A;  1XK4 C;  2SAS A;  1K96 A;  1KSO A;  1OW4 A;  2PAL A;  3LL8 B;  5I94 A;  1TOP A;  1H4B A;  3QRX A;  4NDB A;  4NDC A;  4PE7 A;  2TN4 A;  2PSR A;  3EK4 A;  1WRK A;  2JPT A;  3B7A A;  2ZND A;  3BUW B;  1EG3 A;  2I7A A;  2OTG B;  1KK8 C;  3EK7 A;  3IVT A;  3DYE A;  3FE8 A;  3LLE A;  1C7V A;  3NSL A;  1N2D A;  2G9B A;  1NX1 A;  1DEK A;  2BBN A;  5G08 A;  1B7T Y;  2F3Y A;  2OS8 B;  3V2L A;  3D0Y B;  1TIZ A;  1REC A;  1BG1 A;  2M9G A;  2K60 A;  2ZN8 A;  3I5F C;  2JOJ A;  2K0J A;  2LHI A;  1J7P A;  2F2O A;  4ZCV A;  1PAL A;  4PCW A;  4PDZ A;  1LXF C;  4INW A;  2M1U A;  3AKA A;  2IS9 A;  1IQ5 A;  1AVS A;  2LMT A;  1J55 A;  1SRA A;  2BCB A;  3SIA A;  1Y1X A;  2BNX A;  3BFB A;  4YRU A;  1SYM A;  4YGA A;  2Y1M A;  1QX5 B;  5I2Q A;  1TWO A;  2ZFD A;  1KCY A;  1S5G Z;  5AEQ A;  1CFD A;  1TRF A;  2LAN A;  3PN7 B;  4JPZ B;  1DGU A;  3RM1 A;  2CT9 A;  1ZAC A;  1QLS A;  2KDH A;  3PM2 A;  3OGN A;  2JRF A;  3IQO A;  1B4C A;  1PSR A;  2O60 A;  4CFQ A;  5TNC A;  3I5I C;  2L5Y A;  1DF0 A;  2NCO A;  1S26 D;  3CR5 X;  2LVV A;  4FQO A;  1KWO C;  1UHI A;  1DJX A;  1CTR A;  4PE0 A;  2KPH A;  2GGM A;  1PUL A;  2K7O A;  2LUC A;  1FI6 A;  1YR5 A;  1SW8 A;  1XYD A;  2K8M B;  1KFX L;  1CMF A;  3N7H A;  1HQV A;  3D77 A;  3VRP A;  2KGB C;  1W7I B;  1IJ5 A;  3LK1 A;  3DVE A;  3OBV A;  3RZS A;  4BY4 A;  3OHM B;  1Y0V H;  1IQ3 A;  5DKQ A;  2F33 A;  3PAT A;  2HQ8 A;  1EG4 A;  1PK0 D;  3GOF A;  3KF9 A;  3SG3 A;  2WCH A;  1DTL A;  1M31 A;  1ALV A;  3D76 A;  1SR6 B;  1YUS A;  2WC5 A;  4MRY A;  4XJK A;  2EGD A;  3NGV A;  3B86 A;  5J3X A;  1CFF A;  2KLE A;  2Y1N A;  3PJI A;  5AAN A;  4BY5 A;  1QXP A;  2H61 C;  2QEV A;  2KI6 D;  1KK7 Y;  3KHE A;  4YI9 A;  4WRI A;  1RRO A;  4ORB B;  2LUX A;  3NHT A;  1ZOT B;  3M0W A;  3HX4 A;  2QDI A;  1CDL A;  3KEV A;  2KBI A;  1AHR A;  1BU3 A;  1QX7 A;  1CMG A;  2KFG A;  2L50 A;  3DF0 A;  3S0D A;  2LVI A;  1XFV O;  1DJH A;  1P28 A;  1KQM C;  3PM8 A;  1B47 A;  5PAL A;  1A75 A;  2Y5I A;  1KQV A;  4JKT A;  3ZNI A;  2JNF A;  1PVB A;  3OX6 A;  1NCX A;  1W7J B;  2WCM A;  4DUQ A;  5IBW A;  1DT7 B;  4I5N B;  1L2O C;  2MA2 A;  4MSP A;  5BPJ A;  1J1E A;  2Q91 A;  1K8U A;  3O4Y A;  5CSI A;  4R1E A;  1S6C A;  4KYN A;  1DMO A;  2HET A;  1Y1A A;  2Q4U A;  3CR4 X;  1CKK A;  3LK0 A;  3PLF B;  1KK8 B;  1MHO A;  1UUR A;  2JTZ A;  1QAT A;  2F2P A;  1PVA A;  1IGV A;  2WCK A;  3HCM A;  3PAL A;  1YUR A;  3VRO A;  4F0Z B;  1BOC A;  5HLV A;  2KNE A;  4NDD A;  1G8I A;  1QWV A;  1WLZ A;  1M46 A;  2K7C A;  3BJH A;  1GM0 A;  5D3O A;  1YX7 A;  2LE9 B;  1K95 A;  2JPO A;  2P71 A;  3I5F B;  2KI4 C;  3R1P A;  2BE4 A;  1WRL A;  2PVB A;  2LLT A;  1EL4 A;  2BCA A;  4M2Q A;  1NPQ A;  4E68 A;  4HRE E;  5AFP A;  3DD4 A;  3I5G C;  2P6B B;  3K21 A;  4INX A;  2KGR A;  1RJV A;  3S0A A;  1OZO A;  2CCM A;  3BQ3 A;  1BF5 A;  1RK9 A;  1AJ4 A;  1K90 D;  2CXJ A;  3SG2 A;  2WOR A;  2R2I A;  2F8P A;  3OB1 B;  1CDP A;  3BUN B;  5CPV A;  1NX0 A;  2VRG A;  3SS4 A;  1J7Q A;  2WND A;  1SCV A;  2L2C A;  1BOD A;  2LLU A;  1NIW A;  3S0F A;  2JU0 A;  5HLO A;  1HT9 A;  5I2L A;  1CLM A;  1N65 A;  4YGD B;  3I5I B;  2JXC A;  3I5H C;  3TUY B;  3BOW A;  1UWO A;  3NSO A;  1KWO B;  2LNK A;  4ZCU A;  5DKR A;  1ZUZ A;  2L98 A;  2MRD A;  1A4P A;  2WC6 A;  3OB2 B;  1SBJ A;  1TNX A;  1YRU B;  3ICB A;  5HKW A;  1SKT A;  2QEO A;  2ZNE A;  4OKH A;  2LVK A;  4MBE A;  1ZFS A;  3SG7 A;  4PE4 A;  4L9M A;  1QLK A;  2F3Z A;  2ZRT A;  2FJY A;  1CDN A;  1TNP A;  3A4U B;  3D0Y A;  3E3R A;  3H4S E;  2KHN A;  3D73 A;  3EVR A;  2LLS A;  1ZMZ A;  3OP0 A;  1KFU S;  1C3Z A;  1K9P A;  1XFY O;  2JWW A;  2V53 A;  5ER4 X;  2WCJ A;  1TNQ A;  2L0P A;  3CWG A;  1M45 A;  4N1F A;  1SMG A;  2BEC A;  1SPY A;  2ISD A;  4DIR A;  4IL1 A;  4NQG A;  3VGO A;  4C0J A;  1YUU A;  1QIV A;  1JFK A;  2LC5 A;  2M1K B;  2JZI A;  2K61 A;  3DVM A;  4M2O A;  1AJ5 A;  2HF5 A;  1JF0 A;  3VRQ A;  3SJS A;  1K9U A;  3EK8 A;  1XFX O;  1N0Y A;  4N5X A;  1A2X A;  1S6I A;  3SIB A;  1BT6 A;  1B7T Z;  1DF0 B;  2KBM A;  1IKU A;  1IG5 A;  3B87 A;  1ODB A;  1SCM C;  1YX8 A;  3GK4 X;  1KFX S;  1CLL A;  3O4X A;  3WHU B;  3WNX B;  1CM4 A;  1CDM A;  1R6P A;  1SL7 A;  2JXL A;  1YVH A;  1VRK A;  4Q04 A;  3TDZ A;  2QPT A;  2M7L A;  1UUS A;  3B88 A;  4MEW A;  1Y6W A;  1L2O B;  2I94 A;  1AUI B;  5CSF A;  3UO9 A;  4CID A;  3VRN A;  1D1O A;  2NZ0 A;  1QV1 A;  2CBL A;  2DOQ A;  2M8U A;  3JVT C;  3SG4 A;  4FQT A;  1DQE A;  2KI6 C;  1J7O A;  2WCB A;  1K2H A;  4DRW A;  5F6T A;  4C0K A;  1YUT A;  3PFV A;  1V1G A;  4ETO A;  3O6B A;  1FBV A;  1DC1 A;  1EXR A;  1C7W A;  1OSA A;  1OZS A;  1WLM A;  2L5X B;  2LAP A;  3CAB A;  2BAP A;  5JOL A;  1IIO A;  1QVI Y;  1TNW A;  2H8V A;  2QAC A;  4XJK B;  5HKY A;  2L4H A;  4DS7 A;  2KI4 B;  1K9K A;  5EL2 A;  1EJ3 A;  5AER A;  1NCY A;  3DY9 A;  3EKJ A;  1NX3 A;  1QAS A;  5FI6 A;  4MZK A;  2NXQ A;  2D8N A;  4GGF A;  2SCP A;  1L7Z A;  1OOH A;  3I5G B;  3BUO B;  1FPW A;  4I5J A;  1WDC C;  3CYZ A;  4DCK A;  4GFT A;  1M63 B;  1MXE A;  2GGZ A;  2QEB A;  2COL B;  2BE6 A;  1T14 A;  1JF2 A;  3DF0 B;  1OOF A;  1U5I A;  3EKH A;  4CPV A;  2CTN A;  1W9Z A;  1OOI X;  3CZ2 A;  1JWD A;  1SNL A;  1DJW A;  1GQM A;  5D7F A;  3FIA A;  3ZWH A;  2M49 B;  1XA5 A;  3QME A;  1WY9 A;  2LV7 A;  2WCE A;  4PHJ A;  3S0G A;  2GTE A;  2BKI B;  3C1V A;  1ORG A;  3DVJ A;  2JT8 A;  3I5H B;  2L51 A;  4PT1 A;  1UHN A;  3D10 A;  2E30 A;  4IJ7 A;  1J1D A;  1DJY A;  3BFH A;  4OR9 B;  1TN4 A;  3PSR A;  3O78 A;  3TS5 C;  2KYC A;  1SK6 D;  4QJ3 B;  4A4C A;  4YBH B;  1UP5 A;  2CNP A;  1CNP A;  1FI5 A;  4GUK A;  4HSZ A;  1KK7 Z;  1F4O A;  2RGI A;  3FS7 A;  3R1V A;  2KQ6 A;  1QV0 A;  1Y1U A;  2JTT A;  1CB1 A;  2L4I A;  3D74 A;  1CLB A;  1SSE B;  2KFF A;  2JUL A;  4GGF C;  4MLW A;  3TZ1 A;  1OOJ A;  4QJ4 B;  2P70 A;  4USL A;  2G2B A;  2MLF C;  3WHT B;  4AOM A;  1JBA A;  3F45 A;  1B8C A;  2FJU B;  4A4B A;  4OVN F;  3AKB A;  1DJI A;  2ZRS A;  4M2P A;  1SL9 A;  1LKJ A;  2BBM A;  1CFC A;  4FTG A;  1OOG A;  2AAO A;  2JQ6 A;  1PRW A;  1GGW A;  1MR8 A;  1Z4H A;  3CLN A;  1NUB A;  5D69 A;  1RFJ A;  1DJZ A;  2LP3 A;  2KLD A;  1S5G Y;  2BCX A;  1SL8 A;  3S0E A;  4MN0 A;  2NCP A;  4CFR A;  2FCD A;  1ALW A;  1TUZ A;  3EVU A;  1A03 A;  2MAZ A;  4I5K A;  1XFW O;  1SCM B;  2LHL A;  3IF7 A;  2BKH B;  4GPL B;  2PYQ A;  1S36 A;  2B1U A;  1TCO B;  1XFZ O;  1UHK A;  3K1E A;  2LMU A;  4I5L B;  1B8R A;  1J7R A;  1M39 A;  3NXA A;  4HRG A;  2JT0 A;  1IRJ A;  1F8H A;  4U8D A;  3JVT B;  3EG5 B;  4AQI A;  3DZT A;  4PHN A;  2EHB A;  3BUM B;  5FYX A;  1R2U A;  1G4Y R;  1IH0 A;  2ZN9 A;  1AP4 A;  1A29 A;  1OMR A;  2WCF A;  1DEL A;  4GAO A;  4HRH A;  1V1F A;  1LVC D;  5AXI A;  2KAV A;  2WOS A;  3DVK A;  3GK1 A;  3SG6 A;  1UHH A;  4F7F A;  1YRT B;  2EC6 C;  2WCL A;  4MRX A;  5DIC A;  1GJY A;  1S3P A;  1QTX A;  2BL0 C;  3S0B A;  1LA0 A;  1NP8 A;  3JTD C;  1MF8 B;  2MJW B;  1DGV A;  3SS5 A;  3BYA A;  1NCZ A;  3D75 A;  4OCI A;  4XYN A;  1FW4 A;  2K2A A;  3FE6 A;  1BR4 B;  3A8R A;  4YGE B;  4GNK B;  1B8L A;  1WDC B;  2JNX A;  1KFU L;  1TTX A;  1KQM B;  2PRU A;  3CS1 A;  1SY9 A;  2KAY A;  4MZL A;  1K93 D;  2H61 A;  4ORC B;  5FI2 A;  2JC2 A;  3DXL A;  3Q8I A;  2OTG C;  1KSM A;  3FWC A;  3IQQ A;  1QJT A;  3BXK A;  4ORA B;  2JT3 A;  1B1G A;  1NWD A;  2M0R A;  3TUY C;  1TUJ A;  3AAJ A;  2OS8 C;  5HKZ A;  4P5O E;  1LS8 A;  5HYD A;  2FOT A;  1JFJ A;  3FE9 A;  4UPG A;  3AAK A;  5I8N A;  2M29 A;  1NX2 A;  1MWN A;  1F70 A;  4MZJ A; 
#chains in the Genus database with same CATH homology
 2H2K A;  1K94 A;  1C07 A;  2KQY A;  3SG5 A;  4WQ2 A;  3TDI A;  1NSH A;  1YTZ C;  5JJG A;  1E8A A;  1WRZ A;  2MHH A;  3KPX A;  3TS5 B;  3TDU A;  4YGC B;  2LP2 A;  4PHK A;  2HPS A;  4JQ0 D;  2KFH A;  5DKN A;  2KYF A;  5I2O A;  1UHJ A;  2PMY A;  2PAS A;  1GGZ A;  3WXA A;  2LMV A;  1LA3 A;  1XO5 A;  4OV2 A;  1MUX A;  1PSB A;  3PN7 C;  2LM5 A;  5ER5 A;  3GK2 A;  1MQ1 A;  1Q80 A;  1QIW A;  2M97 A;  5KTY A;  1AK8 A;  3BUX B;  3CGA A;  1OMD A;  2O5G A;  4PAL A;  4AQJ A;  1FF1 A;  1RTP 1;  4GGN A;  1A75 B;  2ZKM X;  1F4Q A;  4C0L A;  1JSA A;  3VRR A;  1JC2 A;  1F54 A;  2MBX A;  1DVI A;  2FCE A;  2M3W A;  1IJ6 A;  1U5I B;  2NLN A;  4ICB A;  5KSZ A;  4PHM A;  2KOT A;  1F71 A;  4WQ3 A;  1F55 A;  3CZT X;  2AMI A;  2I18 A;  5KU1 A;  1H8B A;  2WC8 A;  1XFU O;  1XK4 A;  3O2P A;  1BLQ A;  1JUO A;  3KO0 A;  1BR1 B;  5CSN A;  3NSI A;  1DJG A;  2LVJ A;  4YGB B;  1X02 A;  2GV5 A;  1BJF A;  1CFP A;  4P2Y B;  5B8I B;  1QVI Z;  5GQQ C;  1BMO A;  1MXL C;  3LCP C;  2L2E A;  2LCP A;  3MSE B;  2M7N A;  3RLZ A;  4CLN A;  1EH2 A;  1RWY A;  2OPO A;  1IWQ A;  4TNC A;  4DIR A;  1YVL A;  4N1G A;  1QX2 A;  1SR6 C;  2KSP A;  4MVF A;  1S6J A;  2AUC A;  5K89 A;  2MLE C;  2K2F A;  4YI8 A;  1QS7 A;  3OX5 A;  1G33 A;  2K7D A;  2I2R E;  1XVJ A;  2E6W A;  2KAX A;  4GBA A;  1TCF A;  1OE9 B;  2K7B A;  4PE1 A;  3FWB A;  2EC6 B;  1OQP A;  2Y4Q A;  4JWQ A;  5CSJ A;  2BL0 B;  3JTD B;  3NSK A;  1B9A A;  3CTN A;  3EVV A;  1CM1 A;  1NYA A;  2A4J A;  4QJ5 B;  3CR2 A;  2HQW A;  3BOW B;  1OMV A;  1S1E A;  1LIN A;  1XK4 C;  2SAS A;  1K96 A;  1KSO A;  2PAL A;  3LL8 B;  1TOP A;  1H4B A;  3QRX A;  4NDB A;  4NDC A;  4PE7 A;  2TN4 A;  2PSR A;  3EK4 A;  1WRK A;  2JPT A;  2ZND A;  3BUW B;  1EG3 A;  2I7A A;  2OTG B;  1KK8 C;  3EK7 A;  3LLE A;  1C7V A;  3NSL A;  1N2D A;  2G9B A;  1NX1 A;  2BBN A;  5G08 A;  1B7T Y;  2F3Y A;  2OS8 B;  3D0Y B;  1TIZ A;  1REC A;  1BG1 A;  2M9G A;  2ZN8 A;  3I5F C;  2JOJ A;  2K0J A;  2LHI A;  1J7P A;  2F2O A;  4ZCV A;  1PAL A;  4PCW A;  4PDZ A;  1LXF C;  2M1U A;  3AKA A;  2IS9 A;  1IQ5 A;  1AVS A;  2LMT A;  1J55 A;  1SRA A;  2BCB A;  3SIA A;  1Y1X A;  4YRU A;  1SYM A;  4YGA A;  2Y1M A;  1QX5 B;  5I2Q A;  1KCY A;  2ZFD A;  1S5G Z;  5AEQ A;  1CFD A;  1TRF A;  2LAN A;  3PN7 B;  4JPZ B;  1DGU A;  3RM1 A;  2CT9 A;  1ZAC A;  1QLS A;  2KDH A;  2JRF A;  3IQO A;  1B4C A;  1PSR A;  2O60 A;  4CFQ A;  5TNC A;  3I5I C;  1DF0 A;  2NCO A;  1S26 D;  3CR5 X;  2LVV A;  4FQO A;  1KWO C;  1UHI A;  1DJX A;  1CTR A;  4PE0 A;  2GGM A;  1PUL A;  2K7O A;  2LUC A;  1FI6 A;  1YR5 A;  1SW8 A;  1XYD A;  2K8M B;  1KFX L;  1CMF A;  1HQV A;  3VRP A;  2KGB C;  1W7I B;  1IJ5 A;  3LK1 A;  3DVE A;  4BY4 A;  3OHM B;  1Y0V H;  1IQ3 A;  5DKQ A;  2F33 A;  3PAT A;  2HQ8 A;  1EG4 A;  1PK0 D;  3GOF A;  3KF9 A;  3SG3 A;  1DTL A;  1M31 A;  1ALV A;  1SR6 B;  1YUS A;  4MRY A;  4XJK A;  2EGD A;  5J3X A;  1CFF A;  2Y1N A;  5AAN A;  4BY5 A;  1QXP A;  2H61 C;  2KI6 D;  1KK7 Y;  3KHE A;  4YI9 A;  4WRI A;  1RRO A;  4ORB B;  2LUX A;  1ZOT B;  3M0W A;  3HX4 A;  1CDL A;  3KEV A;  2KBI A;  1AHR A;  1BU3 A;  1QX7 A;  1CMG A;  2KFG A;  2L50 A;  3DF0 A;  2LVI A;  1XFV O;  1DJH A;  1KQM C;  3PM8 A;  1B47 A;  5PAL A;  1A75 A;  2Y5I A;  1KQV A;  3ZNI A;  2JNF A;  1PVB A;  3OX6 A;  1NCX A;  1W7J B;  4DUQ A;  5IBW A;  1DT7 B;  4I5N B;  1L2O C;  2MA2 A;  4MSP A;  5BPJ A;  1J1E A;  2Q91 A;  1K8U A;  3O4Y A;  5CSI A;  4R1E A;  1S6C A;  1DMO A;  2HET A;  1Y1A A;  2Q4U A;  3CR4 X;  1CKK A;  3LK0 A;  3PLF B;  1KK8 B;  1MHO A;  1UUR A;  2JTZ A;  1QAT A;  2F2P A;  1PVA A;  1IGV A;  3HCM A;  3PAL A;  4F0Z B;  1YUR A;  3VRO A;  1BOC A;  5HLV A;  2KNE A;  4NDD A;  1G8I A;  1WLZ A;  1M46 A;  2K7C A;  1YX7 A;  2LE9 B;  1K95 A;  3I5F B;  2KI4 C;  2BE4 A;  1WRL A;  2PVB A;  2LLT A;  1EL4 A;  2BCA A;  4M2Q A;  1NPQ A;  4E68 A;  4HRE E;  5AFP A;  3DD4 A;  3I5G C;  2P6B B;  3K21 A;  2KGR A;  1RJV A;  1OZO A;  2CCM A;  3BQ3 A;  1BF5 A;  1RK9 A;  1AJ4 A;  1K90 D;  2CXJ A;  3SG2 A;  2WOR A;  2R2I A;  2F8P A;  3OB1 B;  1CDP A;  3BUN B;  5CPV A;  1NX0 A;  2VRG A;  1J7Q A;  2WND A;  1SCV A;  1BOD A;  2LLU A;  1NIW A;  2JU0 A;  5HLO A;  1HT9 A;  5I2L A;  1CLM A;  1N65 A;  4YGD B;  3I5I B;  2JXC A;  3I5H C;  3TUY B;  3BOW A;  1UWO A;  3NSO A;  1KWO B;  2LNK A;  4ZCU A;  5DKR A;  1ZUZ A;  2L98 A;  2MRD A;  1A4P A;  3OB2 B;  1SBJ A;  1TNX A;  1YRU B;  3ICB A;  5HKW A;  1SKT A;  2ZNE A;  4OKH A;  2LVK A;  4MBE A;  1ZFS A;  3SG7 A;  4PE4 A;  4L9M A;  1QLK A;  2F3Z A;  2ZRT A;  1CDN A;  1TNP A;  3A4U B;  3D0Y A;  3E3R A;  3H4S E;  2KHN A;  3EVR A;  2LLS A;  1ZMZ A;  3OP0 A;  1KFU S;  1XFY O;  1K9P A;  2JWW A;  2V53 A;  5ER4 X;  4N1F A;  1TNQ A;  2L0P A;  3CWG A;  1M45 A;  1SMG A;  2BEC A;  1SPY A;  2ISD A;  4IL1 A;  4NQG A;  3VGO A;  4C0J A;  1YUU A;  1QIV A;  1JFK A;  2LC5 A;  2M1K B;  2JZI A;  2K61 A;  3DVM A;  4M2O A;  1AJ5 A;  2HF5 A;  1JF0 A;  3VRQ A;  3SJS A;  1K9U A;  3EK8 A;  1XFX O;  1N0Y A;  4N5X A;  1A2X A;  1S6I A;  3SIB A;  1BT6 A;  1B7T Z;  1DF0 B;  2KBM A;  1IKU A;  1IG5 A;  1ODB A;  1SCM C;  1YX8 A;  3GK4 X;  1KFX S;  1CLL A;  3WHU B;  3WNX B;  1CM4 A;  1CDM A;  1R6P A;  1SL7 A;  2JXL A;  1YVH A;  1VRK A;  4Q04 A;  3TDZ A;  2QPT A;  2M7L A;  1UUS A;  4MEW A;  1Y6W A;  1L2O B;  2I94 A;  1AUI B;  5CSF A;  4CID A;  3VRN A;  1D1O A;  2NZ0 A;  1QV1 A;  2CBL A;  2DOQ A;  2M8U A;  3JVT C;  3SG4 A;  4D1E A;  2KI6 C;  1K2H A;  1J7O A;  2WCB A;  4DRW A;  5F6T A;  4C0K A;  1YUT A;  3PFV A;  1V1G A;  4ETO A;  3O6B A;  1FBV A;  1EXR A;  1C7W A;  1OSA A;  1OZS A;  1WLM A;  2L5X B;  2LAP A;  5JOL A;  1QVI Y;  1TNW A;  2QAC A;  4XJK B;  5HKY A;  2L4H A;  4DS7 A;  2KI4 B;  1K9K A;  1EJ3 A;  5AER A;  1NCY A;  3EKJ A;  1NX3 A;  1QAS A;  4MZK A;  2NXQ A;  2D8N A;  4GGF A;  2SCP A;  1L7Z A;  3I5G B;  3BUO B;  1FPW A;  4I5J A;  1WDC C;  4DCK A;  4GFT A;  1M63 B;  1MXE A;  2GGZ A;  2COL B;  2BE6 A;  1JF2 A;  3DF0 B;  1U5I A;  3EKH A;  4CPV A;  2CTN A;  1JWD A;  1SNL A;  1DJW A;  1GQM A;  5D7F A;  3FIA A;  3ZWH A;  2M49 B;  1XA5 A;  4PHJ A;  1WY9 A;  2LV7 A;  2WCE A;  3C1V A;  2BKI B;  3I5H B;  3DVJ A;  2JT8 A;  2L51 A;  1UHN A;  3D10 A;  2E30 A;  4OR9 B;  1J1D A;  1DJY A;  1TN4 A;  3PSR A;  3O78 A;  3TS5 C;  2KYC A;  1SK6 D;  4QJ3 B;  4A4C A;  4YBH B;  1UP5 A;  2CNP A;  1CNP A;  1FI5 A;  4GUK A;  4HSZ A;  1KK7 Z;  1F4O A;  2RGI A;  3FS7 A;  2KQ6 A;  1QV0 A;  1Y1U A;  2JTT A;  1CB1 A;  2L4I A;  1CLB A;  2KFF A;  2JUL A;  4GGF C;  4MLW A;  3TZ1 A;  1OOJ A;  4QJ4 B;  4USL A;  2G2B A;  2MLF C;  3WHT B;  4AOM A;  1JBA A;  3F45 A;  1B8C A;  2FJU B;  4A4B A;  4OVN F;  3AKB A;  1DJI A;  2ZRS A;  4M2P A;  1SL9 A;  1LKJ A;  2BBM A;  1CFC A;  4FTG A;  2AAO A;  2JQ6 A;  1PRW A;  1GGW A;  1MR8 A;  3CLN A;  1NUB A;  5D69 A;  1RFJ A;  1DJZ A;  2LP3 A;  1S5G Y;  2BCX A;  1SL8 A;  4MN0 A;  2NCP A;  4CFR A;  2FCD A;  1ALW A;  3EVU A;  1A03 A;  2MAZ A;  4I5K A;  1XFW O;  1SCM B;  2LHL A;  3IF7 A;  2BKH B;  4GPL B;  1S36 A;  2B1U A;  1TCO B;  1XFZ O;  1UHK A;  2LMU A;  4I5L B;  1B8R A;  1J7R A;  1M39 A;  3NXA A;  4HRG A;  2JT0 A;  1IRJ A;  1F8H A;  4U8D A;  3JVT B;  4AQI A;  4PHN A;  2EHB A;  3BUM B;  5FYX A;  1R2U A;  1G4Y R;  1IH0 A;  2ZN9 A;  1AP4 A;  1A29 A;  1OMR A;  2WCF A;  4GAO A;  4HRH A;  1V1F A;  1LVC D;  5AXI A;  2KAV A;  2WOS A;  3DVK A;  3GK1 A;  3SG6 A;  1UHH A;  1YRT B;  2EC6 C;  4MRX A;  1GJY A;  1S3P A;  1QTX A;  2BL0 C;  1LA0 A;  1NP8 A;  3JTD C;  1MF8 B;  2MJW B;  1DGV A;  3BYA A;  1NCZ A;  4OCI A;  4XYN A;  1FW4 A;  2K2A A;  1BR4 B;  3A8R A;  4YGE B;  4GNK B;  1B8L A;  1WDC B;  2JNX A;  1KFU L;  1TTX A;  1KQM B;  2PRU A;  3CS1 A;  1SY9 A;  2KAY A;  4MZL A;  1K93 D;  2H61 A;  4ORC B;  2JC2 A;  2OTG C;  1KSM A;  3FWC A;  3IQQ A;  1QJT A;  3BXK A;  4ORA B;  2JT3 A;  1B1G A;  1NWD A;  2M0R A;  3TUY C;  3AAJ A;  2OS8 C;  5HKZ A;  4P5O E;  5HYD A;  2FOT A;  1JFJ A;  4UPG A;  3AAK A;  5I8N A;  2M29 A;  1NX2 A;  1MWN A;  1F70 A;  4MZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...