1QVIY

Crystal structure of scallop myosin s1 in the pre-power stroke state to 2.6 angstrom resolution: flexibility and function in the head
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
141
structure length
141
Chain Sequence
LPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated muscle
publication title Crystal structure of scallop Myosin s1 in the pre-power stroke state to 2.6 a resolution: flexibility and function in the head.
pubmed doi rcsb
total genus 41
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qviY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qviY02
1KCYA 1ZMZA 4AOMA 2KYCA 1JBAA 1OMRA 2B1UA 1NX1A 1IQ3A 1B9AA 5TNCA 1SL7A 1YR5A 3KHEA 1CM4A 1HQVA 2K2FA 5KU1A 1NYAA 2F3YA 1ZFSA 1PK0D 2JT8A 4DRWA 1LA0A 2LAPA 3TS5C 5KTYA 3EVVA 1BT6A 2H2KA 4FQOA 2LV7A 1HT9A 4MRYA 3NSKA 1F8HA 1V1GA 4MRXA 1SCMB 1YTZC 4CPVA 2JWWA 1BR1B 3ZNIA 1KFXS 2K2AA 4GGFC 3PALA 1A2XA 1ODBA 3I5FB 1OZSA 3BUXB 1UHNA 1MWNA 2KNEA 4BY4A 4NQGA 1CLLA 3GK1A 1CNPA 4GGFA 3E3RA 4ORBB 2AUCA 5CSJA 4JPZB 2VRGA 3CWGA 4YGBB 3OHMB 1AJ4A 1F54A 3D10A 1GGWA 2PASA 2BCXA 2F33A 2KQ6A 2BE4A 1VRKA 1XFWO 2WOSA 2NZ0A 3LL8B 4YGCB 1KQMB 1QX7A 3OP0A 2L50A 5CPVA 3EVRA 1SPYA 1EL4A 2G9BA 3CTNA 2GGMA 1S5GY 2TN4A 1U5IA 1MR8A 3SG3A 2FCDA 2LCPA 1B8LA 3GK2A 1N65A 3LK1A 2K7DA 2KI6D 4DUQA 3EK8A 1FI5A 2JC2A 3BUWB 3DVJA 4PHMA 4WQ3A 4ORAB 2K61A 4P2YB 1NPQA 2I94A 4JWQA 4IL1A 4ZCUA 1PULA 4GPLB 1LVCD 1K94A 1KQMC 3JTDB 2L98A 4DIRA 1XK4C 1KSOA 2V53A 1RJVA 1N2DA 1QJTA 1YRUB 1ZUZA 3IQOA 1R6PA 2NCOA 1UHHA 1GQMA 2DOQA 2KGBC 1JF2A 1WY9A 4USLA 4YRUA 4NDDA 1XK4A 4JQ0D 3DF0B 5HYDA 1SCVA 2LLUA 1KFUL 1G4YR 1ZACA 5ER4X 4AQIA 4NDCA 4GBAA 1L7ZA 4GUKA 1OSAA 2M1UA 1CFPA 3VRQA 3AKBA 3BUOB 2OTGB 4YGDB 1QV1A 3O6BA 2KAXA 3ZWHA 1TCOB 3OX5A 4P5OE 4TNCA 1S6JA 3BOWA 1J7PA 2WCBA 1JWDA 3IF7A 1W7IB 2A4JA 4YI9A 1B8CA 5D69A 4QJ4B 1RROA 2D8NA 1BJFA 2O60A 3TUYC 1S1EA 1DJGA 2Y1NA 1YVHA 5HLOA 4QJ5B 1SYMA 4NDBA 1J7OA 4HREE 4MN0A 1TOPA 2OTGC 1SR6B 1WLMA 3O2PA 2ZRTA 1OQPA 2M0RA 2LE9B 1A03A 1S6IA 4PALA 1NCZA 4MZKA 1NX3A 1TCFA 2M3WA 3AAKA 1W7JB 3NSLA 1AK8A 2JNXA 2CNPA 2CXJA 1JUOA 3PN7B 4CLNA 1LA3A 1A29A 1SNLA 2M7NA 2JOJA 2P6BB 3SG5A 4PHNA 1SR6C 2HQWA 1AVSA 1S26D 5JJGA 3JVTC 1DF0B 5HKWA 1UURA 2WCFA 4OV2A 1E8AA 3AKAA 1XVJA 1UUSA 2I7AA 2LC5A 2QPTA 1DVIA 3PFVA 1S6CA 2F2OA 3AAJA 4PDZA 2MRDA 2EGDA 1SKTA 3BQ3A 3QRXA 2E6WA 1KFXL 1K93D 1L2OC 2FJUB 1D1OA 1A4PA 1WRKA 1TRFA 4I5LB 2M97A 3PM8A 4HSZA 1NX2A 1TNWA 1IG5A 1MQ1A 2BBNA 1B4CA 1SRAA 2K7BA 3NSIA 2M29A 3RLZA 1DT7B 1SBJA 4YI8A 1GJYA 3WNXB 2FCEA 5KSZA 1F4QA 3RM1A 1J1EA 2AMIA 1EH2A 3DVKA 1F4OA 1NWDA 4U8DA 4UPGA 1F55A 1KK8B 5IBWA 2KFGA 2ZNDA 1UP5A 1XFXO 1AUIB 1SW8A 3VGOA 1CKKA 1YURA 1PVAA 2JPTA 2BKHB 4PHJA 5GQQC 1CFDA 2IS9A 3CS1A 4E68A 4N1FA 5HKZA 2MJWB 3OB2B 1SCMC 4HRHA 3TDUA 4I5NB 4CFQA 1K95A 4ICBA 5ER5A 5DKNA 3I5FC 4YGAA 1C07A 1TNXA 2LLTA 1J7QA 3EK4A 2ZN9A 2KGRA 2GV5A 3A4UB 3GK4X 3KPXA 5CSIA 2KFHA 3OX6A 4GAOA 3PATA 1QATA 2L4HA 2ZN8A 1AHRA 1DMOA 2LUXA 3WHUB 3I5IB 4MVFA 5PALA 1MHOA 1RECA 1BF5A 1IQ5A 3LK0A 2LHLA 3TDZA 1J1DA 5AEQA 1EG3A 1WRLA 1QVIZ 4FTGA 3FIAA 1PSBA 5J3XA 3KEVA 2RGIA 1IH0A 5AANA 1IRJA 2JRFA 4D1EA 4AQJA 1QX2A 1BU3A 3KF9A 1Y1XA 3DVEA 1IWQA 4N5XA 1AJ5A 1QX5B 2CCMA 2KQYA 2WNDA 1DGVA 3TZ1A 3O4YA 3CLNA 4A4BA 4YBHB 1TN4A 1K8UA 3JTDC 5FYXA 1OMVA 1EJ3A 5CSFA 1BOCA 4OKHA 1N0YA 2R2IA 5I2QA 4QJ3B 2SASA 4C0LA 2O5GA 1FBVA 1QXPA 1K9KA 1CDPA 1QV0A 1KK7Z 4M2QA 1M45A 1ALVA 4M2OA 1KWOB 1OMDA 4OCIA 2KBIA 2K7OA 1MUXA 2MAZA 3D0YB 1KQVA 3DF0A 4GNKB 2L2EA 1QLKA 2PALA 3EK7A 1FPWA 2K8MB 2CT9A 5G08A 2I2RE 4MZLA 2KAVA 1B47A 1XO5A 1LXFC 1TIZA 2JT3A 1BODA 3FS7A 4OVNF 1XFVO 2KAYA 2L4IA 1IKUA 3VRNA 1M46A 2MLEC 1FF1A 1DJYA 1YX8A 2NXQA 1Y1AA 1J55A 2JQ6A 3BUNB 1PALA 3CR5X 3HCMA 1PSRA 1H4BA 1K96A 3BUMB 3I5HB 1G33A 1SK6D 1DJHA 1SL8A 1EG4A 2ZFDA 2BE6A 2JXLA 1CLMA 1YUUA 1IGVA 3WHTB 1NCXA 3FWCA 1QTXA 4PE7A 2ZRSA 1A75B 2NLNA 2OS8B 4CFRA 1QS7A 5AFPA 5B8IB 5AERA 4DCKA 3PLFB 1RWYA 4CIDA 2EC6B 1FI6A 1C7WA 1XFZO 1WRZA 1M31A 2LM5A 2LVIA 1S36A 2HETA 2LLSA 3PN7C 3SJSA 5I2OA 1KSMA 3CR2A 4C0JA 3TDIA 4ETOA 5DKQA 1JFKA 1CLBA 2Q4UA 1CM1A 1PVBA 1QLSA 1S3PA 4XJKB 5I8NA 1NX0A 1OOJA 4MSPA 2JTZA 1BG1A 2PVBA 1GGZA 1DJWA 2LHIA 2LUCA 1BLQA 1LKJA 1UHKA 1DF0A 2OPOA 3EKHA 3VRRA 1CDNA 1NCYA 1B7TZ 2L0PA 1TTXA 2JU0A 4A4CA 1WLZA 2LP2A 2JNFA 2WCEA 2BKIB 2F2PA 2LANA 1EXRA 2PRUA 1QIVA 1CMFA 2MHHA 2M49B 4XJKA 2KSPA 1LINA 4ZCVA 2LVKA 4I5KA 2BL0B 3CGAA 4PE1A 1WDCB 2M7LA 2LMVA 1UHJA 1F70A 2BBMA 5I2LA 3SG7A 2Q91A 1TNQA 2PSRA 1H8BA 1C7VA 2LMTA 1KK8C 1Y1UA 2JXCA 1JSAA 3FWBA 2HQ8A 1U5IB 2LVJA 2F3ZA 1XFYO 4WRIA 1M63B 3NSOA 2CTNA 4M2PA 2L5XB 5CSNA 3CR4X 2I18A 5K89A 4MZJA 2ZKMX 2BL0C 3VRPA 5JOLA 1WDCC 4XYNA 1SY9A 3SIBA 1G8IA 1ALWA 4I5JA 1V1FA 3SG4A 3VROA 2KOTA 2COLB 2M1KB 2BCBA 3I5GB 1IJ5A 1YVLA 2WORA 1QVIY 4R1EA 2EHBA 5HLVA 2JZIA 2K0JA 4N1GA 2ZNEA 1XFUO 1XYDA 1S5GZ 3GOFA 4DS7A 4WQ2A 2LVVA 2F8PA 3C1VA 1B1GA 3K21A 1UWOA 2JT0A 3I5IC 4MEWA 3EKJA 4MBEA 2QACA 2E30A 2FOTA 1CTRA 1F71A 3MSEB 4PE0A 2KI6C 3SG2A 1MXEA 3IQQA 2Y1MA 2L51A 3I5GC 1M39A 1ZOTB 3BOWB 1CDLA 2SCPA 3H4SE 1RTP1 1BR4B 1CB1A 3CZTX 1CMGA 1TNPA 5AXIA 1K9PA 1KK7Y 1SMGA 2KHNA 4YGEB 4C0KA 1PRWA 1CDMA 4PE4A 2JTTA 1JFJA 3TUYB 2MA2A 3BYAA 1MF8B 2BECA 2KBMA 1K90D 2KYFA 2H61C 3O78A 1RFJA 3HX4A 1NSHA 3SIAA 1OE9B 2M8UA 4MLWA 2KDHA 4GGNA 1QIWA 1YUSA 1SL9A 2GGZA 2H61A 1Y6WA 3DVMA 1BMOA 2KI4B 3F45A 5F6TA 1AP4A 4GFTA 1KWOC 1Q80A 1DJXA 1XA5A 1X02A 2HF5A 1KFUS 1JF0A 3KO0A 1NP8A 3WXAA 1MXLC 2MBXA 2WC8A 1DTLA 3D0YA 4OR9B 1K2HA 3PSRA 2HPSA 4L9MA 1CFFA 3ICBA 2NCPA 2KI4C 2G2BA 1DJIA 1IJ6A 1Y0VH 1UHIA 1YRTB 3JVTB 3NXAA 4Q04A 4ORCB 1OZOA 2Y5IA 3OB1B 5BPJA 2LP3A 1QASA 3SG6A 3BXKA 2KFFA 1FW4A 2LNKA 2ISDA 3DD4A 3I5HC 4PHKA 1J7RA 1RK9A 2JULA 4F0ZB 3LCPC 1YUTA 4BY5A 2CBLA 2M9GA 5D7FA 2MLFC 1YX7A 1DGUA 1L2OB 1B8RA 1NUBA 1CFCA 1K9UA 3A8RA 5DKRA 2OS8C 5HKYA 1NIWA 1DJZA 2K7CA 2Y4QA 3EVUA 3TS5B 3LLEA 2EC6C 2LMUA 3M0WA 1A75A 1R2UA 2BCAA 4PCWA 1JC2A 4HRGA 1B7TY 2PMYA 2AAOA
chains in the Genus database with same CATH superfamily
1KCYA 1ZMZA 4AOMA 2KYCA 1JBAA 1OMRA 2B1UA 1NX1A 1IQ3A 1B9AA 5TNCA 1SL7A 1YR5A 3KHEA 1CM4A 1HQVA 2K2FA 3R1PA 5KU1A 1NYAA 2F3YA 1ZFSA 1PK0D 2JT8A 2QEOA 4DRWA 1LA0A 2LAPA 3TS5C 5KTYA 3B87A 3EVVA 4OZDA 1BT6A 2H2KA 4FQOA 1OOFA 1HT9A 2LV7A 4MRYA 3NSKA 1F8HA 3R72A 1V1GA 4MRXA 1SCMB 1YTZC 4CPVA 3D77A 2JWWA 1BR1B 3ZNIA 1KFXS 2K2AA 4GGFC 3PALA 1A2XA 1ODBA 3I5FB 2ERBA 1OZSA 3BUXB 1UHNA 1MWNA 2KNEA 4BY4A 1TUZA 4NQGA 1CLLA 3GK1A 1CNPA 4GGFA 3E3RA 4ORBB 2AUCA 5CSJA 4JPZB 2VRGA 3CWGA 4YGBB 3OHMB 1AJ4A 1F54A 3D10A 1GGWA 2PASA 2BCXA 2F33A 2KQ6A 2BE4A 3V2LA 1VRKA 1XFWO 2WOSA 2NZ0A 3LL8B 4YGCB 1KQMB 1QX7A 3OP0A 2L50A 5CPVA 3EVRA 1T14A 1SPYA 1EL4A 2G9BA 3CTNA 2GGMA 1S5GY 2TN4A 1U5IA 2BNXA 1MR8A 1LS8A 2QEVA 2FCDA 2LCPA 3OGNA 1B8LA 1DQEA 3GK2A 3NHTA 1N65A 3LK1A 2K7DA 2KI6D 3DZTA 3EK8A 4DUQA 1FI5A 2JC2A 3BUWB 3DVJA 4PHMA 4WQ3A 4ORAB 2K61A 4P2YB 1NPQA 2I94A 3FE9A 3BFHA 4IL1A 4JWQA 4ZCUA 1PULA 4GPLB 1LVCD 1OOHA 1K94A 1KQMC 2QEHA 2L98A 3JTDB 4DIRA 1XK4C 1KSOA 2V53A 3S0BA 1RJVA 1N2DA 1QJTA 1YRUB 1ZUZA 3IQOA 1R6PA 2NCOA 1UHHA 1GQMA 2DOQA 2KGBC 1JF2A 1WY9A 4USLA 4YRUA 4NDDA 1XK4A 3S0EA 4JQ0D 3DF0B 5HYDA 1SCVA 2LLUA 1KFUL 1G4YR 1ZACA 5ER4X 4AQIA 3CYZA 4NDCA 4GBAA 3BFBA 1OOGA 1L7ZA 4GUKA 1OSAA 3D76A 2M1UA 1CFPA 3VRQA 3AKBA 3BUOB 2OTGB 2WC5A 3L4AA 4YGDB 1QV1A 3O6BA 2KAXA 3ZWHA 1TCOB 3OX5A 4P5OE 4TNCA 1S6JA 3BOWA 3CZ0A 5FI2A 1J7PA 2WCBA 1JWDA 3IF7A 1W7IB 2A4JA 2WC6A 1B8CA 4YI9A 5D69A 1RROA 2D8NA 1BJFA 2O60A 4QJ4B 3TUYC 1S1EA 1DJGA 2KPHA 2Y1NA 1YVHA 5HLOA 5DICA 4QJ5B 1SYMA 3OBVA 4NDBA 1J7OA 4HREE 4MN0A 1TOPA 2OTGC 1SR6B 1WLMA 3O2PA 2ZRTA 1OQPA 2M0RA 3CZ2A 2LE9B 1A03A 1S6IA 4PALA 1NCZA 2JPOA 4MZKA 1NX3A 1TCFA 1TUJA 2M3WA 1W7JB 3AAKA 3NSLA 1AK8A 2JNXA 2CNPA 2CXJA 1JUOA 3PN7B 4CLNA 1LA3A 1A29A 1SNLA 2M7NA 2JOJA 2P6BB 3NHIA 3SG5A 4PHNA 1SR6C 2KLDA 2HQWA 1AVSA 1S26D 5JJGA 3JVTC 1DF0B 3S0GA 5HKWA 1UURA 2WCFA 4OV2A 1E8AA 3D75A 3B88A 3AKAA 1XVJA 1UUSA 2I7AA 2LC5A 2QPTA 1DVIA 5FI7A 3PFVA 1S6CA 2F2OA 3AAJA 4PDZA 2MRDA 2EGDA 1SKTA 3BQ3A 3QRXA 2E6WA 1KFXL 1K93D 1L2OC 2FJUB 1D1OA 1A4PA 1TRFA 4I5LB 2M97A 3PM8A 4HSZA 1NX2A 1TNWA 1IG5A 1MQ1A 2BBNA 1B4CA 1SRAA 2K7BA 3NSIA 2M29A 2L5YA 3RLZA 1DT7B 1SBJA 4YI8A 3S0FA 1GJYA 3SS4A 3WNXB 2FCEA 3S0DA 2PQLA 5KSZA 1F4QA 1XFRA 3RM1A 1J1EA 2AMIA 3QMEA 1EH2A 1IIOA 3DVKA 1F4OA 1NWDA 4U8DA 4UPGA 1F55A 1KK8B 3O4XA 5IBWA 2KFGA 2ZNDA 1UP5A 1XFXO 1AUIB 1SW8A 2H8VA 3L47A 1YURA 1PVAA 2JPTA 4INWA 1Z4HA 2BKHB 4PHJA 5GQQC 1Z2CB 1CFDA 2IS9A 3CS1A 1OOIX 3BFAA 4E68A 4N1FA 2FJYA 5HKZA 2MJWB 3OB2B 1SCMC 4HRHA 3TDUA 4I5NB 4CFQA 1K95A 3CZ1A 3NGVA 4ICBA 5ER5A 3DYEA 5DKNA 3I5FC 3IVTA 4YGAA 1C07A 1TNXA 2LLTA 3S0AA 1J7QA 2WCLA 3EK4A 2PYQA 5EL2A 2ZN9A 2KGRA 2GV5A 3A4UB 3GK4X 3KPXA 5CSIA 2KFHA 3OX6A 4GAOA 3PATA 1QATA 2L4HA 2ZN8A 1AHRA 3FE8A 1DMOA 2LUXA 3WHUB 3I5IB 4MVFA 5PALA 1MHOA 1RECA 1BF5A 1IQ5A 2AAOA 3LK0A 2LHLA 3TDZA 1J1DA 5AEQA 1EG3A 1WRLA 1QVIZ 4FTGA 3FIAA 1PSBA 5J3XA 3KEVA 2RGIA 1IH0A 5AANA 1IRJA 2JRFA 4D1EA 1ORGA 4AQJA 1QX2A 1BU3A 3KF9A 1Y1XA 3DVEA 1IWQA 4N5XA 1AJ5A 1QX5B 2P70A 1QWVA 2CCMA 2KQYA 2WNDA 3VGOA 1DGVA 3TZ1A 3O4YA 3CLNA 4A4BA 4YBHB 1TN4A 1K8UA 3JTDC 5FYXA 1OMVA 1EJ3A 5CSFA 1BOCA 4OKHA 1N0YA 2R2IA 5I2QA 3DXLA 2SASA 4QJ3B 4C0LA 2O5GA 1DEKA 1FBVA 1QXPA 1K9KA 3SS5A 1CDPA 1QV0A 1KK7Z 4M2QA 1M45A 1ALVA 4M2OA 1KWOB 1OMDA 4OCIA 2KBIA 2K7OA 2GTEA 1MUXA 2MAZA 3B86A 3D0YB 1KQVA 5HL1A 3DF0A 4GNKB 2L2EA 1QLKA 2PALA 3EK7A 1FPWA 2K8MB 2CT9A 5G08A 2I2RE 4MZLA 2KAVA 1B47A 1XO5A 1LXFC 1TIZA 2JT3A 1CKKA 1BODA 3FS7A 4OVNF 1XFVO 2KAYA 2L4IA 1IKUA 3VRNA 1M46A 2MLEC 1FF1A 1DJYA 1YX8A 2NXQA 1Y1AA 1J55A 2JQ6A 2WCKA 1PALA 3BUNB 3CR5X 1PSRA 3HCMA 1K96A 3BUMB 1H4BA 3I5HB 1G33A 1SK6D 1DJHA 3DY9A 1SL8A 1EG4A 2ZFDA 2BE6A 2JXLA 1CLMA 1YUUA 4IJ7A 1IGVA 3WHTB 1NCXA 3FWCA 1QTXA 4PE7A 2ZRSA 1A75B 2NLNA 2OS8B 4CFRA 1QS7A 5AFPA 5B8IB 5AERA 4DCKA 3PLFB 1RWYA 4CIDA 2EC6B 1FI6A 1XFZO 1C7WA 1WRZA 1M31A 2KLEA 3R1VA 2LM5A 2LVIA 1S36A 2HETA 2LLSA 3PN7C 3PJIA 2WCHA 1KSMA 3R1OA 3CR2A 3SJSA 4C0JA 3SG3A 2QEBA 3TDIA 4FQTA 5DKQA 4ETOA 1JFKA 1CLBA 2Q4UA 3D73A 1CM1A 1PVBA 1QLSA 1S3PA 3K1EA 2K60A 1NX0A 1OOJA 4MSPA 4XJKB 2JTZA 5I8NA 2PVBA 1BG1A 1GGZA 1DJWA 2LHIA 2LUCA 1BLQA 1LKJA 1UHKA 1DF0A 2OPOA 3EKHA 4JKTA 3VRRA 1CDNA 2WCJA 1NCYA 1B7TZ 2L0PA 1TTXA 1DC1A 2JU0A 4A4CA 3D74A 1WLZA 1P28A 2LP2A 2JNFA 2WCEA 2BKIB 2F2PA 3EG5B 2LANA 1EXRA 2PRUA 1QIVA 4F7FA 2P71A 3CABA 1CMFA 2MHHA 2M49B 4XJKA 2KSPA 1LINA 4ZCVA 2LVKA 4I5KA 2BL0B 3CGAA 4JD9A 1WDCB 4PE1A 2LMVA 1UHJA 2M7LA 1DELA 1F70A 2BBMA 5I2LA 3SG7A 2Q91A 1TNQA 2PSRA 1SSEB 1TWOA 1H8BA 1C7VA 2LMTA 1KK8C 1Y1UA 2JXCA 4KYNA 1JSAA 3FWBA 2HQ8A 1GM0A 1U5IB 2LVJA 2F3ZA 1XFYO 4WRIA 1M63B 3NSOA 2CTNA 3Q8IA 2L5XB 4M2PA 5CSNA 3CR4X 3RZSA 2I18A 5K89A 3B7AA 4MZJA 5I94A 2ZKMX 2BL0C 3VRPA 5JOLA 1WDCC 4XYNA 1SY9A 3SIBA 1G8IA 1ALWA 3BJHA 4I5JA 1V1FA 3SG4A 3VROA 2KOTA 3UO9A 2COLB 2M1KB 2BCBA 3I5GB 1IJ5A 1YVLA 2WCMA 1QVIY 2WORA 4R1EA 2EHBA 5HLVA 3SS3A 2JZIA 2K0JA 2L2CA 4N1GA 2ZNEA 1XFUO 1XYDA 1S5GZ 3GOFA 4DS7A 4WQ2A 2LVVA 2F8PA 3C1VA 1B1GA 3K21A 1UWOA 2JT0A 3B6XA 3I5IC 4MEWA 3EKJA 4MBEA 2QACA 2E30A 2FOTA 1CTRA 1F71A 3MSEB 4PE0A 2KI6C 3SG2A 1MXEA 3IQQA 2Y1MA 2L51A 3I5GC 1M39A 1ZOTB 3BOWB 1CDLA 2SCPA 3H4SE 1RTP1 1BR4B 1CB1A 3CZTX 5D3OA 1CMGA 1TNPA 5AXIA 1K9PA 1KK7Y 1SMGA 2KHNA 4YGEB 2YGUA 4C0KA 1PRWA 1CDMA 4PE4A 2JTTA 1JFJA 3TUYB 2MA2A 2QDIA 1W9ZA 1MF8B 2BECA 2KBMA 3BYAA 3CDNA 1K90D 2KYFA 2H61C 3O78A 1RFJA 3HX4A 1NSHA 3PM2A 1OE9B 3SIAA 1C3ZA 2M8UA 4MLWA 2KDHA 4GGNA 1QIWA 1YUSA 1SL9A 2GGZA 2H61A 1Y6WA 3DVMA 1BMOA 2KI4B 3F45A 5F6TA 1AP4A 4GFTA 1KWOC 1Q80A 1DJXA 1XA5A 1X02A 2HF5A 1KFUS 1C3YA 1JF0A 3KO0A 1NP8A 3D78A 1MXLC 3WXAA 2MBXA 5I2OA 2WC8A 1DTLA 3D0YA 4OR9B 1K2HA 3PSRA 2HPSA 4L9MA 4PT1A 1CFFA 3ICBA 2NCPA 3FE6A 2KI4C 2G2BA 1DJIA 1IJ6A 1Y0VH 1UHIA 1YRTB 3JVTB 3NXAA 4Q04A 4ORCB 1OZOA 2Y5IA 3OB1B 3L4LA 5BPJA 2LP3A 1QASA 3SG6A 3BXKA 2KFFA 1FW4A 2LNKA 1OW4A 3VB1A 2ISDA 2BAPA 3DD4A 3I5HC 4PHKA 1J7RA 3N7HA 1RK9A 2JULA 4F0ZB 3LCPC 1YUTA 4BY5A 2CBLA 2M9GA 5D7FA 2MLFC 1YX7A 1DGUA 1L2OB 1B8RA 1NUBA 1CFCA 1K9UA 3A8RA 5DKRA 2OS8C 5HKYA 1NIWA 1DJZA 2K7CA 2Y4QA 3EVUA 3TS5B 5FI6A 4INXA 3LLEA 2EC6C 2LMUA 3M0WA 1A75A 1R2UA 2BCAA 4PCWA 1JC2A 4HRGA 1B7TY 3UNWA 2PMYA 1WRKA
chains in the Genus database with same CATH topology
1KCYA 1ZMZA 4AOMA 2KYCA 1JBAA 1OMRA 2B1UA 1NX1A 1IQ3A 1B9AA 5TNCA 1SL7A 1YR5A 3KHEA 1CM4A 1HQVA 2K2FA 5KU1A 1NYAA 2F3YA 1ZFSA 1PK0D 2JT8A 4DRWA 1LA0A 2LAPA 3TS5C 5KTYA 3EVVA 1BT6A 2H2KA 4FQOA 2LV7A 1HT9A 4MRYA 3NSKA 1F8HA 1V1GA 4MRXA 1SCMB 1YTZC 4CPVA 2JWWA 1BR1B 3ZNIA 1KFXS 2K2AA 4GGFC 3PALA 1A2XA 1ODBA 3I5FB 1OZSA 3BUXB 1UHNA 1MWNA 2KNEA 4BY4A 4NQGA 1CLLA 3GK1A 1CNPA 4GGFA 3E3RA 4ORBB 2AUCA 5CSJA 4JPZB 2VRGA 3CWGA 4YGBB 3OHMB 1AJ4A 1F54A 3D10A 1GGWA 2PASA 2BCXA 2F33A 2KQ6A 2BE4A 1VRKA 1XFWO 2WOSA 2NZ0A 3LL8B 4YGCB 1KQMB 1QX7A 3OP0A 2L50A 5CPVA 3EVRA 1SPYA 1EL4A 2G9BA 3CTNA 2GGMA 1S5GY 2TN4A 1U5IA 1MR8A 3SG3A 2FCDA 2LCPA 1B8LA 3GK2A 1N65A 3LK1A 2K7DA 2KI6D 4DUQA 3EK8A 1FI5A 2JC2A 3BUWB 3DVJA 4PHMA 4WQ3A 4ORAB 2K61A 4P2YB 1NPQA 2I94A 4JWQA 4IL1A 4ZCUA 1PULA 4GPLB 1LVCD 1K94A 1KQMC 3JTDB 2L98A 4DIRA 1XK4C 1KSOA 2V53A 1RJVA 1N2DA 1QJTA 1YRUB 1ZUZA 3IQOA 1R6PA 2NCOA 1UHHA 1GQMA 2DOQA 2KGBC 1JF2A 1WY9A 4USLA 4YRUA 4NDDA 1XK4A 4JQ0D 3DF0B 5HYDA 1SCVA 2LLUA 1KFUL 1G4YR 1ZACA 5ER4X 4AQIA 4NDCA 4GBAA 1L7ZA 4GUKA 1OSAA 2M1UA 1CFPA 3VRQA 3AKBA 3BUOB 2OTGB 4YGDB 1QV1A 3O6BA 2KAXA 3ZWHA 1TCOB 3OX5A 4P5OE 4TNCA 1S6JA 3BOWA 1J7PA 2WCBA 1JWDA 3IF7A 1W7IB 2A4JA 4YI9A 1B8CA 5D69A 4QJ4B 1RROA 2D8NA 1BJFA 2O60A 3TUYC 1S1EA 1DJGA 2Y1NA 1YVHA 5HLOA 4QJ5B 1SYMA 4NDBA 1J7OA 4HREE 4MN0A 1TOPA 2OTGC 1SR6B 1WLMA 3O2PA 2ZRTA 1OQPA 2M0RA 2LE9B 1A03A 1S6IA 4PALA 1NCZA 4MZKA 1NX3A 1TCFA 2M3WA 3AAKA 1W7JB 3NSLA 1AK8A 2JNXA 2CNPA 2CXJA 1JUOA 3PN7B 4CLNA 1LA3A 1A29A 1SNLA 2M7NA 2JOJA 2P6BB 3SG5A 4PHNA 1SR6C 2HQWA 1AVSA 1S26D 5JJGA 3JVTC 1DF0B 5HKWA 1UURA 2WCFA 4OV2A 1E8AA 3AKAA 1XVJA 1UUSA 2I7AA 2LC5A 2QPTA 1DVIA 3PFVA 1S6CA 2F2OA 3AAJA 4PDZA 2MRDA 2EGDA 1SKTA 3BQ3A 3QRXA 2E6WA 1KFXL 1K93D 1L2OC 2FJUB 1D1OA 1A4PA 1WRKA 1TRFA 4I5LB 2M97A 3PM8A 4HSZA 1NX2A 1TNWA 1IG5A 1MQ1A 2BBNA 1B4CA 1SRAA 2K7BA 3NSIA 2M29A 3RLZA 1DT7B 1SBJA 4YI8A 1GJYA 3WNXB 2FCEA 5KSZA 1F4QA 3RM1A 1J1EA 2AMIA 1EH2A 3DVKA 1F4OA 1NWDA 4U8DA 4UPGA 1F55A 1KK8B 5IBWA 2KFGA 2ZNDA 1UP5A 1XFXO 1AUIB 1SW8A 3VGOA 1CKKA 1YURA 1PVAA 2JPTA 2BKHB 4PHJA 5GQQC 1CFDA 2IS9A 3CS1A 4E68A 4N1FA 5HKZA 2MJWB 3OB2B 1SCMC 4HRHA 3TDUA 4I5NB 4CFQA 1K95A 4ICBA 5ER5A 5DKNA 3I5FC 4YGAA 1C07A 1TNXA 2LLTA 1J7QA 3EK4A 2ZN9A 2KGRA 2GV5A 3A4UB 3GK4X 3KPXA 5CSIA 2KFHA 3OX6A 4GAOA 3PATA 1QATA 2L4HA 2ZN8A 1AHRA 1DMOA 2LUXA 3WHUB 3I5IB 4MVFA 5PALA 1MHOA 1RECA 1BF5A 1IQ5A 3LK0A 2LHLA 3TDZA 1J1DA 5AEQA 1EG3A 1WRLA 1QVIZ 4FTGA 3FIAA 1PSBA 5J3XA 3KEVA 2RGIA 1IH0A 5AANA 1IRJA 2JRFA 4D1EA 4AQJA 1QX2A 1BU3A 3KF9A 1Y1XA 3DVEA 1IWQA 4N5XA 1AJ5A 1QX5B 2CCMA 2KQYA 2WNDA 1DGVA 3TZ1A 3O4YA 3CLNA 4A4BA 4YBHB 1TN4A 1K8UA 3JTDC 5FYXA 1OMVA 1EJ3A 5CSFA 1BOCA 4OKHA 1N0YA 2R2IA 5I2QA 4QJ3B 2SASA 4C0LA 2O5GA 1FBVA 1QXPA 1K9KA 1CDPA 1QV0A 1KK7Z 4M2QA 1M45A 1ALVA 4M2OA 1KWOB 1OMDA 4OCIA 2KBIA 2K7OA 1MUXA 2MAZA 3D0YB 1KQVA 3DF0A 4GNKB 2L2EA 1QLKA 2PALA 3EK7A 1FPWA 2K8MB 2CT9A 5G08A 2I2RE 4MZLA 2KAVA 1B47A 1XO5A 1LXFC 1TIZA 2JT3A 1BODA 3FS7A 4OVNF 1XFVO 2KAYA 2L4IA 1IKUA 3VRNA 1M46A 2MLEC 1FF1A 1DJYA 1YX8A 2NXQA 1Y1AA 1J55A 2JQ6A 3BUNB 1PALA 3CR5X 3HCMA 1PSRA 1H4BA 1K96A 3BUMB 3I5HB 1G33A 1SK6D 1DJHA 1SL8A 1EG4A 2ZFDA 2BE6A 2JXLA 1CLMA 1YUUA 1IGVA 3WHTB 1NCXA 3FWCA 1QTXA 4PE7A 2ZRSA 1A75B 2NLNA 2OS8B 4CFRA 1QS7A 5AFPA 5B8IB 5AERA 4DCKA 3PLFB 1RWYA 4CIDA 2EC6B 1FI6A 1C7WA 1XFZO 1WRZA 1M31A 2LM5A 2LVIA 1S36A 2HETA 2LLSA 3PN7C 3SJSA 5I2OA 1KSMA 3CR2A 4C0JA 3TDIA 4ETOA 5DKQA 1JFKA 1CLBA 2Q4UA 1CM1A 1PVBA 1QLSA 1S3PA 4XJKB 5I8NA 1NX0A 1OOJA 4MSPA 2JTZA 1BG1A 2PVBA 1GGZA 1DJWA 2LHIA 2LUCA 1BLQA 1LKJA 1UHKA 1DF0A 2OPOA 3EKHA 3VRRA 1CDNA 1NCYA 1B7TZ 2L0PA 1TTXA 2JU0A 4A4CA 1WLZA 2LP2A 2JNFA 2WCEA 2BKIB 2F2PA 2LANA 1EXRA 2PRUA 1QIVA 1CMFA 2MHHA 2M49B 4XJKA 2KSPA 1LINA 4ZCVA 2LVKA 4I5KA 2BL0B 3CGAA 4PE1A 1WDCB 2M7LA 2LMVA 1UHJA 1F70A 2BBMA 5I2LA 3SG7A 2Q91A 1TNQA 2PSRA 1H8BA 1C7VA 2LMTA 1KK8C 1Y1UA 2JXCA 1JSAA 3FWBA 2HQ8A 1U5IB 2LVJA 2F3ZA 1XFYO 4WRIA 1M63B 3NSOA 2CTNA 4M2PA 2L5XB 5CSNA 3CR4X 2I18A 5K89A 4MZJA 2ZKMX 2BL0C 3VRPA 5JOLA 1WDCC 4XYNA 1SY9A 3SIBA 1G8IA 1ALWA 4I5JA 1V1FA 3SG4A 3VROA 2KOTA 2COLB 2M1KB 2BCBA 3I5GB 1IJ5A 1YVLA 2WORA 1QVIY 4R1EA 2EHBA 5HLVA 2JZIA 2K0JA 4N1GA 2ZNEA 1XFUO 1XYDA 1S5GZ 3GOFA 4DS7A 4WQ2A 2LVVA 2F8PA 3C1VA 1B1GA 3K21A 1UWOA 2JT0A 3I5IC 4MEWA 3EKJA 4MBEA 2QACA 2E30A 2FOTA 1CTRA 1F71A 3MSEB 4PE0A 2KI6C 3SG2A 1MXEA 3IQQA 2Y1MA 2L51A 3I5GC 1M39A 1ZOTB 3BOWB 1CDLA 2SCPA 3H4SE 1RTP1 1BR4B 1CB1A 3CZTX 1CMGA 1TNPA 5AXIA 1K9PA 1KK7Y 1SMGA 2KHNA 4YGEB 4C0KA 1PRWA 1CDMA 4PE4A 2JTTA 1JFJA 3TUYB 2MA2A 3BYAA 1MF8B 2BECA 2KBMA 1K90D 2KYFA 2H61C 3O78A 1RFJA 3HX4A 1NSHA 3SIAA 1OE9B 2M8UA 4MLWA 2KDHA 4GGNA 1QIWA 1YUSA 1SL9A 2GGZA 2H61A 1Y6WA 3DVMA 1BMOA 2KI4B 3F45A 5F6TA 1AP4A 4GFTA 1KWOC 1Q80A 1DJXA 1XA5A 1X02A 2HF5A 1KFUS 1JF0A 3KO0A 1NP8A 3WXAA 1MXLC 2MBXA 2WC8A 1DTLA 3D0YA 4OR9B 1K2HA 3PSRA 2HPSA 4L9MA 1CFFA 3ICBA 2NCPA 2KI4C 2G2BA 1DJIA 1IJ6A 1Y0VH 1UHIA 1YRTB 3JVTB 3NXAA 4Q04A 4ORCB 1OZOA 2Y5IA 3OB1B 5BPJA 2LP3A 1QASA 3SG6A 3BXKA 2KFFA 1FW4A 2LNKA 2ISDA 3DD4A 3I5HC 4PHKA 1J7RA 1RK9A 2JULA 4F0ZB 3LCPC 1YUTA 4BY5A 2CBLA 2M9GA 5D7FA 2MLFC 1YX7A 1DGUA 1L2OB 1B8RA 1NUBA 1CFCA 1K9UA 3A8RA 5DKRA 2OS8C 5HKYA 1NIWA 1DJZA 2K7CA 2Y4QA 3EVUA 3TS5B 3LLEA 2EC6C 2LMUA 3M0WA 1A75A 1R2UA 2BCAA 4PCWA 1JC2A 4HRGA 1B7TY 2PMYA 2AAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KCY A;  1ZMZ A;  4AOM A;  2KYC A;  1JBA A;  1OMR A;  2B1U A;  1NX1 A;  1IQ3 A;  1B9A A;  5TNC A;  1SL7 A;  1YR5 A;  3KHE A;  1CM4 A;  1HQV A;  2K2F A;  5KU1 A;  1NYA A;  2F3Y A;  1ZFS A;  1PK0 D;  2JT8 A;  4DRW A;  1LA0 A;  2LAP A;  3TS5 C;  5KTY A;  3EVV A;  1BT6 A;  2H2K A;  4FQO A;  2LV7 A;  1HT9 A;  4MRY A;  3NSK A;  1F8H A;  1V1G A;  4MRX A;  1SCM B;  1YTZ C;  4CPV A;  2JWW A;  1BR1 B;  3ZNI A;  1KFX S;  2K2A A;  4GGF C;  3PAL A;  1A2X A;  1ODB A;  3I5F B;  1OZS A;  3BUX B;  1UHN A;  1MWN A;  2KNE A;  4BY4 A;  4NQG A;  1CLL A;  3GK1 A;  1CNP A;  4GGF A;  3E3R A;  4ORB B;  2AUC A;  5CSJ A;  4JPZ B;  2VRG A;  3CWG A;  4YGB B;  3OHM B;  1AJ4 A;  1F54 A;  3D10 A;  1GGW A;  2PAS A;  2BCX A;  2F33 A;  2KQ6 A;  2BE4 A;  1VRK A;  1XFW O;  2WOS A;  2NZ0 A;  3LL8 B;  4YGC B;  1KQM B;  1QX7 A;  3OP0 A;  2L50 A;  5CPV A;  3EVR A;  1SPY A;  1EL4 A;  2G9B A;  3CTN A;  2GGM A;  1S5G Y;  2TN4 A;  1U5I A;  1MR8 A;  3SG3 A;  2FCD A;  2LCP A;  1B8L A;  3GK2 A;  1N65 A;  3LK1 A;  2K7D A;  2KI6 D;  4DUQ A;  3EK8 A;  1FI5 A;  2JC2 A;  3BUW B;  3DVJ A;  4PHM A;  4WQ3 A;  4ORA B;  2K61 A;  4P2Y B;  1NPQ A;  2I94 A;  4JWQ A;  4IL1 A;  4ZCU A;  1PUL A;  4GPL B;  1LVC D;  1K94 A;  1KQM C;  3JTD B;  2L98 A;  4DIR A;  1XK4 C;  1KSO A;  2V53 A;  1RJV A;  1N2D A;  1QJT A;  1YRU B;  1ZUZ A;  3IQO A;  1R6P A;  2NCO A;  1UHH A;  1GQM A;  2DOQ A;  2KGB C;  1JF2 A;  1WY9 A;  4USL A;  4YRU A;  4NDD A;  1XK4 A;  4JQ0 D;  3DF0 B;  5HYD A;  1SCV A;  2LLU A;  1KFU L;  1G4Y R;  1ZAC A;  5ER4 X;  4AQI A;  4NDC A;  4GBA A;  1L7Z A;  4GUK A;  1OSA A;  2M1U A;  1CFP A;  3VRQ A;  3AKB A;  3BUO B;  2OTG B;  4YGD B;  1QV1 A;  3O6B A;  2KAX A;  3ZWH A;  1TCO B;  3OX5 A;  4P5O E;  4TNC A;  1S6J A;  3BOW A;  1J7P A;  2WCB A;  1JWD A;  3IF7 A;  1W7I B;  2A4J A;  4YI9 A;  1B8C A;  5D69 A;  4QJ4 B;  1RRO A;  2D8N A;  1BJF A;  2O60 A;  3TUY C;  1S1E A;  1DJG A;  2Y1N A;  1YVH A;  5HLO A;  4QJ5 B;  1SYM A;  4NDB A;  1J7O A;  4HRE E;  4MN0 A;  1TOP A;  2OTG C;  1SR6 B;  1WLM A;  3O2P A;  2ZRT A;  1OQP A;  2M0R A;  2LE9 B;  1A03 A;  1S6I A;  4PAL A;  1NCZ A;  4MZK A;  1NX3 A;  1TCF A;  2M3W A;  3AAK A;  1W7J B;  3NSL A;  1AK8 A;  2JNX A;  2CNP A;  2CXJ A;  1JUO A;  3PN7 B;  4CLN A;  1LA3 A;  1A29 A;  1SNL A;  2M7N A;  2JOJ A;  2P6B B;  3SG5 A;  4PHN A;  1SR6 C;  2HQW A;  1AVS A;  1S26 D;  5JJG A;  3JVT C;  1DF0 B;  5HKW A;  1UUR A;  2WCF A;  4OV2 A;  1E8A A;  3AKA A;  1XVJ A;  1UUS A;  2I7A A;  2LC5 A;  2QPT A;  1DVI A;  3PFV A;  1S6C A;  2F2O A;  3AAJ A;  4PDZ A;  2MRD A;  2EGD A;  1SKT A;  3BQ3 A;  3QRX A;  2E6W A;  1KFX L;  1K93 D;  1L2O C;  2FJU B;  1D1O A;  1A4P A;  1WRK A;  1TRF A;  4I5L B;  2M97 A;  3PM8 A;  4HSZ A;  1NX2 A;  1TNW A;  1IG5 A;  1MQ1 A;  2BBN A;  1B4C A;  1SRA A;  2K7B A;  3NSI A;  2M29 A;  3RLZ A;  1DT7 B;  1SBJ A;  4YI8 A;  1GJY A;  3WNX B;  2FCE A;  5KSZ A;  1F4Q A;  3RM1 A;  1J1E A;  2AMI A;  1EH2 A;  3DVK A;  1F4O A;  1NWD A;  4U8D A;  4UPG A;  1F55 A;  1KK8 B;  5IBW A;  2KFG A;  2ZND A;  1UP5 A;  1XFX O;  1AUI B;  1SW8 A;  3VGO A;  1CKK A;  1YUR A;  1PVA A;  2JPT A;  2BKH B;  4PHJ A;  5GQQ C;  1CFD A;  2IS9 A;  3CS1 A;  4E68 A;  4N1F A;  5HKZ A;  2MJW B;  3OB2 B;  1SCM C;  4HRH A;  3TDU A;  4I5N B;  4CFQ A;  1K95 A;  4ICB A;  5ER5 A;  5DKN A;  3I5F C;  4YGA A;  1C07 A;  1TNX A;  2LLT A;  1J7Q A;  3EK4 A;  2ZN9 A;  2KGR A;  2GV5 A;  3A4U B;  3GK4 X;  3KPX A;  5CSI A;  2KFH A;  3OX6 A;  4GAO A;  3PAT A;  1QAT A;  2L4H A;  2ZN8 A;  1AHR A;  1DMO A;  2LUX A;  3WHU B;  3I5I B;  4MVF A;  5PAL A;  1MHO A;  1REC A;  1BF5 A;  1IQ5 A;  3LK0 A;  2LHL A;  3TDZ A;  1J1D A;  5AEQ A;  1EG3 A;  1WRL A;  1QVI Z;  4FTG A;  3FIA A;  1PSB A;  5J3X A;  3KEV A;  2RGI A;  1IH0 A;  5AAN A;  1IRJ A;  2JRF A;  4D1E A;  4AQJ A;  1QX2 A;  1BU3 A;  3KF9 A;  1Y1X A;  3DVE A;  1IWQ A;  4N5X A;  1AJ5 A;  1QX5 B;  2CCM A;  2KQY A;  2WND A;  1DGV A;  3TZ1 A;  3O4Y A;  3CLN A;  4A4B A;  4YBH B;  1TN4 A;  1K8U A;  3JTD C;  5FYX A;  1OMV A;  1EJ3 A;  5CSF A;  1BOC A;  4OKH A;  1N0Y A;  2R2I A;  5I2Q A;  4QJ3 B;  2SAS A;  4C0L A;  2O5G A;  1FBV A;  1QXP A;  1K9K A;  1CDP A;  1QV0 A;  1KK7 Z;  4M2Q A;  1M45 A;  1ALV A;  4M2O A;  1KWO B;  1OMD A;  4OCI A;  2KBI A;  2K7O A;  1MUX A;  2MAZ A;  3D0Y B;  1KQV A;  3DF0 A;  4GNK B;  2L2E A;  1QLK A;  2PAL A;  3EK7 A;  1FPW A;  2K8M B;  2CT9 A;  5G08 A;  2I2R E;  4MZL A;  2KAV A;  1B47 A;  1XO5 A;  1LXF C;  1TIZ A;  2JT3 A;  1BOD A;  3FS7 A;  4OVN F;  1XFV O;  2KAY A;  2L4I A;  1IKU A;  3VRN A;  1M46 A;  2MLE C;  1FF1 A;  1DJY A;  1YX8 A;  2NXQ A;  1Y1A A;  1J55 A;  2JQ6 A;  3BUN B;  1PAL A;  3CR5 X;  3HCM A;  1PSR A;  1H4B A;  1K96 A;  3BUM B;  3I5H B;  1G33 A;  1SK6 D;  1DJH A;  1SL8 A;  1EG4 A;  2ZFD A;  2BE6 A;  2JXL A;  1CLM A;  1YUU A;  1IGV A;  3WHT B;  1NCX A;  3FWC A;  1QTX A;  4PE7 A;  2ZRS A;  1A75 B;  2NLN A;  2OS8 B;  4CFR A;  1QS7 A;  5AFP A;  5B8I B;  5AER A;  4DCK A;  3PLF B;  1RWY A;  4CID A;  2EC6 B;  1FI6 A;  1C7W A;  1XFZ O;  1WRZ A;  1M31 A;  2LM5 A;  2LVI A;  1S36 A;  2HET A;  2LLS A;  3PN7 C;  3SJS A;  5I2O A;  1KSM A;  3CR2 A;  4C0J A;  3TDI A;  4ETO A;  5DKQ A;  1JFK A;  1CLB A;  2Q4U A;  1CM1 A;  1PVB A;  1QLS A;  1S3P A;  4XJK B;  5I8N A;  1NX0 A;  1OOJ A;  4MSP A;  2JTZ A;  1BG1 A;  2PVB A;  1GGZ A;  1DJW A;  2LHI A;  2LUC A;  1BLQ A;  1LKJ A;  1UHK A;  1DF0 A;  2OPO A;  3EKH A;  3VRR A;  1CDN A;  1NCY A;  1B7T Z;  2L0P A;  1TTX A;  2JU0 A;  4A4C A;  1WLZ A;  2LP2 A;  2JNF A;  2WCE A;  2BKI B;  2F2P A;  2LAN A;  1EXR A;  2PRU A;  1QIV A;  1CMF A;  2MHH A;  2M49 B;  4XJK A;  2KSP A;  1LIN A;  4ZCV A;  2LVK A;  4I5K A;  2BL0 B;  3CGA A;  4PE1 A;  1WDC B;  2M7L A;  2LMV A;  1UHJ A;  1F70 A;  2BBM A;  5I2L A;  3SG7 A;  2Q91 A;  1TNQ A;  2PSR A;  1H8B A;  1C7V A;  2LMT A;  1KK8 C;  1Y1U A;  2JXC A;  1JSA A;  3FWB A;  2HQ8 A;  1U5I B;  2LVJ A;  2F3Z A;  1XFY O;  4WRI A;  1M63 B;  3NSO A;  2CTN A;  4M2P A;  2L5X B;  5CSN A;  3CR4 X;  2I18 A;  5K89 A;  4MZJ A;  2ZKM X;  2BL0 C;  3VRP A;  5JOL A;  1WDC C;  4XYN A;  1SY9 A;  3SIB A;  1G8I A;  1ALW A;  4I5J A;  1V1F A;  3SG4 A;  3VRO A;  2KOT A;  2COL B;  2M1K B;  2BCB A;  3I5G B;  1IJ5 A;  1YVL A;  2WOR A;  1QVI Y;  4R1E A;  2EHB A;  5HLV A;  2JZI A;  2K0J A;  4N1G A;  2ZNE A;  1XFU O;  1XYD A;  1S5G Z;  3GOF A;  4DS7 A;  4WQ2 A;  2LVV A;  2F8P A;  3C1V A;  1B1G A;  3K21 A;  1UWO A;  2JT0 A;  3I5I C;  4MEW A;  3EKJ A;  4MBE A;  2QAC A;  2E30 A;  2FOT A;  1CTR A;  1F71 A;  3MSE B;  4PE0 A;  2KI6 C;  3SG2 A;  1MXE A;  3IQQ A;  2Y1M A;  2L51 A;  3I5G C;  1M39 A;  1ZOT B;  3BOW B;  1CDL A;  2SCP A;  3H4S E;  1RTP 1;  1BR4 B;  1CB1 A;  3CZT X;  1CMG A;  1TNP A;  5AXI A;  1K9P A;  1KK7 Y;  1SMG A;  2KHN A;  4YGE B;  4C0K A;  1PRW A;  1CDM A;  4PE4 A;  2JTT A;  1JFJ A;  3TUY B;  2MA2 A;  3BYA A;  1MF8 B;  2BEC A;  2KBM A;  1K90 D;  2KYF A;  2H61 C;  3O78 A;  1RFJ A;  3HX4 A;  1NSH A;  3SIA A;  1OE9 B;  2M8U A;  4MLW A;  2KDH A;  4GGN A;  1QIW A;  1YUS A;  1SL9 A;  2GGZ A;  2H61 A;  1Y6W A;  3DVM A;  1BMO A;  2KI4 B;  3F45 A;  5F6T A;  1AP4 A;  4GFT A;  1KWO C;  1Q80 A;  1DJX A;  1XA5 A;  1X02 A;  2HF5 A;  1KFU S;  1JF0 A;  3KO0 A;  1NP8 A;  3WXA A;  1MXL C;  2MBX A;  2WC8 A;  1DTL A;  3D0Y A;  4OR9 B;  1K2H A;  3PSR A;  2HPS A;  4L9M A;  1CFF A;  3ICB A;  2NCP A;  2KI4 C;  2G2B A;  1DJI A;  1IJ6 A;  1Y0V H;  1UHI A;  1YRT B;  3JVT B;  3NXA A;  4Q04 A;  4ORC B;  1OZO A;  2Y5I A;  3OB1 B;  5BPJ A;  2LP3 A;  1QAS A;  3SG6 A;  3BXK A;  2KFF A;  1FW4 A;  2LNK A;  2ISD A;  3DD4 A;  3I5H C;  4PHK A;  1J7R A;  1RK9 A;  2JUL A;  4F0Z B;  3LCP C;  1YUT A;  4BY5 A;  2CBL A;  2M9G A;  5D7F A;  2MLF C;  1YX7 A;  1DGU A;  1L2O B;  1B8R A;  1NUB A;  1CFC A;  1K9U A;  3A8R A;  5DKR A;  2OS8 C;  5HKY A;  1NIW A;  1DJZ A;  2K7C A;  2Y4Q A;  3EVU A;  3TS5 B;  3LLE A;  2EC6 C;  2LMU A;  3M0W A;  1A75 A;  1R2U A;  2BCA A;  4PCW A;  1JC2 A;  4HRG A;  1B7T Y;  2PMY A;  2AAO A; 
#chains in the Genus database with same CATH topology
 1KCY A;  1ZMZ A;  4AOM A;  2KYC A;  1JBA A;  1OMR A;  2B1U A;  1NX1 A;  1IQ3 A;  1B9A A;  5TNC A;  1SL7 A;  1YR5 A;  3KHE A;  1CM4 A;  1HQV A;  2K2F A;  3R1P A;  5KU1 A;  1NYA A;  2F3Y A;  1ZFS A;  1PK0 D;  2JT8 A;  2QEO A;  4DRW A;  1LA0 A;  2LAP A;  3TS5 C;  5KTY A;  3B87 A;  3EVV A;  4OZD A;  1BT6 A;  2H2K A;  4FQO A;  1OOF A;  1HT9 A;  2LV7 A;  4MRY A;  3NSK A;  1F8H A;  3R72 A;  1V1G A;  4MRX A;  1SCM B;  1YTZ C;  4CPV A;  3D77 A;  2JWW A;  1BR1 B;  3ZNI A;  1KFX S;  2K2A A;  4GGF C;  3PAL A;  1A2X A;  1ODB A;  3I5F B;  2ERB A;  1OZS A;  3BUX B;  1UHN A;  1MWN A;  2KNE A;  4BY4 A;  1TUZ A;  4NQG A;  1CLL A;  3GK1 A;  1CNP A;  4GGF A;  3E3R A;  4ORB B;  2AUC A;  5CSJ A;  4JPZ B;  2VRG A;  3CWG A;  4YGB B;  3OHM B;  1AJ4 A;  1F54 A;  3D10 A;  1GGW A;  2PAS A;  2BCX A;  2F33 A;  2KQ6 A;  2BE4 A;  3V2L A;  1VRK A;  1XFW O;  2WOS A;  2NZ0 A;  3LL8 B;  4YGC B;  1KQM B;  1QX7 A;  3OP0 A;  2L50 A;  5CPV A;  3EVR A;  1T14 A;  1SPY A;  1EL4 A;  2G9B A;  3CTN A;  2GGM A;  1S5G Y;  2TN4 A;  1U5I A;  2BNX A;  1MR8 A;  1LS8 A;  2QEV A;  2FCD A;  2LCP A;  3OGN A;  1B8L A;  1DQE A;  3GK2 A;  3NHT A;  1N65 A;  3LK1 A;  2K7D A;  2KI6 D;  3DZT A;  3EK8 A;  4DUQ A;  1FI5 A;  2JC2 A;  3BUW B;  3DVJ A;  4PHM A;  4WQ3 A;  4ORA B;  2K61 A;  4P2Y B;  1NPQ A;  2I94 A;  3FE9 A;  3BFH A;  4IL1 A;  4JWQ A;  4ZCU A;  1PUL A;  4GPL B;  1LVC D;  1OOH A;  1K94 A;  1KQM C;  2QEH A;  2L98 A;  3JTD B;  4DIR A;  1XK4 C;  1KSO A;  2V53 A;  3S0B A;  1RJV A;  1N2D A;  1QJT A;  1YRU B;  1ZUZ A;  3IQO A;  1R6P A;  2NCO A;  1UHH A;  1GQM A;  2DOQ A;  2KGB C;  1JF2 A;  1WY9 A;  4USL A;  4YRU A;  4NDD A;  1XK4 A;  3S0E A;  4JQ0 D;  3DF0 B;  5HYD A;  1SCV A;  2LLU A;  1KFU L;  1G4Y R;  1ZAC A;  5ER4 X;  4AQI A;  3CYZ A;  4NDC A;  4GBA A;  3BFB A;  1OOG A;  1L7Z A;  4GUK A;  1OSA A;  3D76 A;  2M1U A;  1CFP A;  3VRQ A;  3AKB A;  3BUO B;  2OTG B;  2WC5 A;  3L4A A;  4YGD B;  1QV1 A;  3O6B A;  2KAX A;  3ZWH A;  1TCO B;  3OX5 A;  4P5O E;  4TNC A;  1S6J A;  3BOW A;  3CZ0 A;  5FI2 A;  1J7P A;  2WCB A;  1JWD A;  3IF7 A;  1W7I B;  2A4J A;  2WC6 A;  1B8C A;  4YI9 A;  5D69 A;  1RRO A;  2D8N A;  1BJF A;  2O60 A;  4QJ4 B;  3TUY C;  1S1E A;  1DJG A;  2KPH A;  2Y1N A;  1YVH A;  5HLO A;  5DIC A;  4QJ5 B;  1SYM A;  3OBV A;  4NDB A;  1J7O A;  4HRE E;  4MN0 A;  1TOP A;  2OTG C;  1SR6 B;  1WLM A;  3O2P A;  2ZRT A;  1OQP A;  2M0R A;  3CZ2 A;  2LE9 B;  1A03 A;  1S6I A;  4PAL A;  1NCZ A;  2JPO A;  4MZK A;  1NX3 A;  1TCF A;  1TUJ A;  2M3W A;  1W7J B;  3AAK A;  3NSL A;  1AK8 A;  2JNX A;  2CNP A;  2CXJ A;  1JUO A;  3PN7 B;  4CLN A;  1LA3 A;  1A29 A;  1SNL A;  2M7N A;  2JOJ A;  2P6B B;  3NHI A;  3SG5 A;  4PHN A;  1SR6 C;  2KLD A;  2HQW A;  1AVS A;  1S26 D;  5JJG A;  3JVT C;  1DF0 B;  3S0G A;  5HKW A;  1UUR A;  2WCF A;  4OV2 A;  1E8A A;  3D75 A;  3B88 A;  3AKA A;  1XVJ A;  1UUS A;  2I7A A;  2LC5 A;  2QPT A;  1DVI A;  5FI7 A;  3PFV A;  1S6C A;  2F2O A;  3AAJ A;  4PDZ A;  2MRD A;  2EGD A;  1SKT A;  3BQ3 A;  3QRX A;  2E6W A;  1KFX L;  1K93 D;  1L2O C;  2FJU B;  1D1O A;  1A4P A;  1TRF A;  4I5L B;  2M97 A;  3PM8 A;  4HSZ A;  1NX2 A;  1TNW A;  1IG5 A;  1MQ1 A;  2BBN A;  1B4C A;  1SRA A;  2K7B A;  3NSI A;  2M29 A;  2L5Y A;  3RLZ A;  1DT7 B;  1SBJ A;  4YI8 A;  3S0F A;  1GJY A;  3SS4 A;  3WNX B;  2FCE A;  3S0D A;  2PQL A;  5KSZ A;  1F4Q A;  1XFR A;  3RM1 A;  1J1E A;  2AMI A;  3QME A;  1EH2 A;  1IIO A;  3DVK A;  1F4O A;  1NWD A;  4U8D A;  4UPG A;  1F55 A;  1KK8 B;  3O4X A;  5IBW A;  2KFG A;  2ZND A;  1UP5 A;  1XFX O;  1AUI B;  1SW8 A;  2H8V A;  3L47 A;  1YUR A;  1PVA A;  2JPT A;  4INW A;  1Z4H A;  2BKH B;  4PHJ A;  5GQQ C;  1Z2C B;  1CFD A;  2IS9 A;  3CS1 A;  1OOI X;  3BFA A;  4E68 A;  4N1F A;  2FJY A;  5HKZ A;  2MJW B;  3OB2 B;  1SCM C;  4HRH A;  3TDU A;  4I5N B;  4CFQ A;  1K95 A;  3CZ1 A;  3NGV A;  4ICB A;  5ER5 A;  3DYE A;  5DKN A;  3I5F C;  3IVT A;  4YGA A;  1C07 A;  1TNX A;  2LLT A;  3S0A A;  1J7Q A;  2WCL A;  3EK4 A;  2PYQ A;  5EL2 A;  2ZN9 A;  2KGR A;  2GV5 A;  3A4U B;  3GK4 X;  3KPX A;  5CSI A;  2KFH A;  3OX6 A;  4GAO A;  3PAT A;  1QAT A;  2L4H A;  2ZN8 A;  1AHR A;  3FE8 A;  1DMO A;  2LUX A;  3WHU B;  3I5I B;  4MVF A;  5PAL A;  1MHO A;  1REC A;  1BF5 A;  1IQ5 A;  2AAO A;  3LK0 A;  2LHL A;  3TDZ A;  1J1D A;  5AEQ A;  1EG3 A;  1WRL A;  1QVI Z;  4FTG A;  3FIA A;  1PSB A;  5J3X A;  3KEV A;  2RGI A;  1IH0 A;  5AAN A;  1IRJ A;  2JRF A;  4D1E A;  1ORG A;  4AQJ A;  1QX2 A;  1BU3 A;  3KF9 A;  1Y1X A;  3DVE A;  1IWQ A;  4N5X A;  1AJ5 A;  1QX5 B;  2P70 A;  1QWV A;  2CCM A;  2KQY A;  2WND A;  3VGO A;  1DGV A;  3TZ1 A;  3O4Y A;  3CLN A;  4A4B A;  4YBH B;  1TN4 A;  1K8U A;  3JTD C;  5FYX A;  1OMV A;  1EJ3 A;  5CSF A;  1BOC A;  4OKH A;  1N0Y A;  2R2I A;  5I2Q A;  3DXL A;  2SAS A;  4QJ3 B;  4C0L A;  2O5G A;  1DEK A;  1FBV A;  1QXP A;  1K9K A;  3SS5 A;  1CDP A;  1QV0 A;  1KK7 Z;  4M2Q A;  1M45 A;  1ALV A;  4M2O A;  1KWO B;  1OMD A;  4OCI A;  2KBI A;  2K7O A;  2GTE A;  1MUX A;  2MAZ A;  3B86 A;  3D0Y B;  1KQV A;  5HL1 A;  3DF0 A;  4GNK B;  2L2E A;  1QLK A;  2PAL A;  3EK7 A;  1FPW A;  2K8M B;  2CT9 A;  5G08 A;  2I2R E;  4MZL A;  2KAV A;  1B47 A;  1XO5 A;  1LXF C;  1TIZ A;  2JT3 A;  1CKK A;  1BOD A;  3FS7 A;  4OVN F;  1XFV O;  2KAY A;  2L4I A;  1IKU A;  3VRN A;  1M46 A;  2MLE C;  1FF1 A;  1DJY A;  1YX8 A;  2NXQ A;  1Y1A A;  1J55 A;  2JQ6 A;  2WCK A;  1PAL A;  3BUN B;  3CR5 X;  1PSR A;  3HCM A;  1K96 A;  3BUM B;  1H4B A;  3I5H B;  1G33 A;  1SK6 D;  1DJH A;  3DY9 A;  1SL8 A;  1EG4 A;  2ZFD A;  2BE6 A;  2JXL A;  1CLM A;  1YUU A;  4IJ7 A;  1IGV A;  3WHT B;  1NCX A;  3FWC A;  1QTX A;  4PE7 A;  2ZRS A;  1A75 B;  2NLN A;  2OS8 B;  4CFR A;  1QS7 A;  5AFP A;  5B8I B;  5AER A;  4DCK A;  3PLF B;  1RWY A;  4CID A;  2EC6 B;  1FI6 A;  1XFZ O;  1C7W A;  1WRZ A;  1M31 A;  2KLE A;  3R1V A;  2LM5 A;  2LVI A;  1S36 A;  2HET A;  2LLS A;  3PN7 C;  3PJI A;  2WCH A;  1KSM A;  3R1O A;  3CR2 A;  3SJS A;  4C0J A;  3SG3 A;  2QEB A;  3TDI A;  4FQT A;  5DKQ A;  4ETO A;  1JFK A;  1CLB A;  2Q4U A;  3D73 A;  1CM1 A;  1PVB A;  1QLS A;  1S3P A;  3K1E A;  2K60 A;  1NX0 A;  1OOJ A;  4MSP A;  4XJK B;  2JTZ A;  5I8N A;  2PVB A;  1BG1 A;  1GGZ A;  1DJW A;  2LHI A;  2LUC A;  1BLQ A;  1LKJ A;  1UHK A;  1DF0 A;  2OPO A;  3EKH A;  4JKT A;  3VRR A;  1CDN A;  2WCJ A;  1NCY A;  1B7T Z;  2L0P A;  1TTX A;  1DC1 A;  2JU0 A;  4A4C A;  3D74 A;  1WLZ A;  1P28 A;  2LP2 A;  2JNF A;  2WCE A;  2BKI B;  2F2P A;  3EG5 B;  2LAN A;  1EXR A;  2PRU A;  1QIV A;  4F7F A;  2P71 A;  3CAB A;  1CMF A;  2MHH A;  2M49 B;  4XJK A;  2KSP A;  1LIN A;  4ZCV A;  2LVK A;  4I5K A;  2BL0 B;  3CGA A;  4JD9 A;  1WDC B;  4PE1 A;  2LMV A;  1UHJ A;  2M7L A;  1DEL A;  1F70 A;  2BBM A;  5I2L A;  3SG7 A;  2Q91 A;  1TNQ A;  2PSR A;  1SSE B;  1TWO A;  1H8B A;  1C7V A;  2LMT A;  1KK8 C;  1Y1U A;  2JXC A;  4KYN A;  1JSA A;  3FWB A;  2HQ8 A;  1GM0 A;  1U5I B;  2LVJ A;  2F3Z A;  1XFY O;  4WRI A;  1M63 B;  3NSO A;  2CTN A;  3Q8I A;  2L5X B;  4M2P A;  5CSN A;  3CR4 X;  3RZS A;  2I18 A;  5K89 A;  3B7A A;  4MZJ A;  5I94 A;  2ZKM X;  2BL0 C;  3VRP A;  5JOL A;  1WDC C;  4XYN A;  1SY9 A;  3SIB A;  1G8I A;  1ALW A;  3BJH A;  4I5J A;  1V1F A;  3SG4 A;  3VRO A;  2KOT A;  3UO9 A;  2COL B;  2M1K B;  2BCB A;  3I5G B;  1IJ5 A;  1YVL A;  2WCM A;  1QVI Y;  2WOR A;  4R1E A;  2EHB A;  5HLV A;  3SS3 A;  2JZI A;  2K0J A;  2L2C A;  4N1G A;  2ZNE A;  1XFU O;  1XYD A;  1S5G Z;  3GOF A;  4DS7 A;  4WQ2 A;  2LVV A;  2F8P A;  3C1V A;  1B1G A;  3K21 A;  1UWO A;  2JT0 A;  3B6X A;  3I5I C;  4MEW A;  3EKJ A;  4MBE A;  2QAC A;  2E30 A;  2FOT A;  1CTR A;  1F71 A;  3MSE B;  4PE0 A;  2KI6 C;  3SG2 A;  1MXE A;  3IQQ A;  2Y1M A;  2L51 A;  3I5G C;  1M39 A;  1ZOT B;  3BOW B;  1CDL A;  2SCP A;  3H4S E;  1RTP 1;  1BR4 B;  1CB1 A;  3CZT X;  5D3O A;  1CMG A;  1TNP A;  5AXI A;  1K9P A;  1KK7 Y;  1SMG A;  2KHN A;  4YGE B;  2YGU A;  4C0K A;  1PRW A;  1CDM A;  4PE4 A;  2JTT A;  1JFJ A;  3TUY B;  2MA2 A;  2QDI A;  1W9Z A;  1MF8 B;  2BEC A;  2KBM A;  3BYA A;  3CDN A;  1K90 D;  2KYF A;  2H61 C;  3O78 A;  1RFJ A;  3HX4 A;  1NSH A;  3PM2 A;  1OE9 B;  3SIA A;  1C3Z A;  2M8U A;  4MLW A;  2KDH A;  4GGN A;  1QIW A;  1YUS A;  1SL9 A;  2GGZ A;  2H61 A;  1Y6W A;  3DVM A;  1BMO A;  2KI4 B;  3F45 A;  5F6T A;  1AP4 A;  4GFT A;  1KWO C;  1Q80 A;  1DJX A;  1XA5 A;  1X02 A;  2HF5 A;  1KFU S;  1C3Y A;  1JF0 A;  3KO0 A;  1NP8 A;  3D78 A;  1MXL C;  3WXA A;  2MBX A;  5I2O A;  2WC8 A;  1DTL A;  3D0Y A;  4OR9 B;  1K2H A;  3PSR A;  2HPS A;  4L9M A;  4PT1 A;  1CFF A;  3ICB A;  2NCP A;  3FE6 A;  2KI4 C;  2G2B A;  1DJI A;  1IJ6 A;  1Y0V H;  1UHI A;  1YRT B;  3JVT B;  3NXA A;  4Q04 A;  4ORC B;  1OZO A;  2Y5I A;  3OB1 B;  3L4L A;  5BPJ A;  2LP3 A;  1QAS A;  3SG6 A;  3BXK A;  2KFF A;  1FW4 A;  2LNK A;  1OW4 A;  3VB1 A;  2ISD A;  2BAP A;  3DD4 A;  3I5H C;  4PHK A;  1J7R A;  3N7H A;  1RK9 A;  2JUL A;  4F0Z B;  3LCP C;  1YUT A;  4BY5 A;  2CBL A;  2M9G A;  5D7F A;  2MLF C;  1YX7 A;  1DGU A;  1L2O B;  1B8R A;  1NUB A;  1CFC A;  1K9U A;  3A8R A;  5DKR A;  2OS8 C;  5HKY A;  1NIW A;  1DJZ A;  2K7C A;  2Y4Q A;  3EVU A;  3TS5 B;  5FI6 A;  4INX A;  3LLE A;  2EC6 C;  2LMU A;  3M0W A;  1A75 A;  1R2U A;  2BCA A;  4PCW A;  1JC2 A;  4HRG A;  1B7T Y;  3UNW A;  2PMY A;  1WRK A; 
#chains in the Genus database with same CATH homology
 1KCY A;  1ZMZ A;  4AOM A;  2KYC A;  1JBA A;  1OMR A;  2B1U A;  1NX1 A;  1IQ3 A;  1B9A A;  5TNC A;  1SL7 A;  1YR5 A;  3KHE A;  1CM4 A;  1HQV A;  2K2F A;  5KU1 A;  1NYA A;  2F3Y A;  1ZFS A;  1PK0 D;  2JT8 A;  4DRW A;  1LA0 A;  2LAP A;  3TS5 C;  5KTY A;  3EVV A;  1BT6 A;  2H2K A;  4FQO A;  2LV7 A;  1HT9 A;  4MRY A;  3NSK A;  1F8H A;  1V1G A;  4MRX A;  1SCM B;  1YTZ C;  4CPV A;  2JWW A;  1BR1 B;  3ZNI A;  1KFX S;  2K2A A;  4GGF C;  3PAL A;  1A2X A;  1ODB A;  3I5F B;  1OZS A;  3BUX B;  1UHN A;  1MWN A;  2KNE A;  4BY4 A;  4NQG A;  1CLL A;  3GK1 A;  1CNP A;  4GGF A;  3E3R A;  4ORB B;  2AUC A;  5CSJ A;  4JPZ B;  2VRG A;  3CWG A;  4YGB B;  3OHM B;  1AJ4 A;  1F54 A;  3D10 A;  1GGW A;  2PAS A;  2BCX A;  2F33 A;  2KQ6 A;  2BE4 A;  1VRK A;  1XFW O;  2WOS A;  2NZ0 A;  3LL8 B;  4YGC B;  1KQM B;  1QX7 A;  3OP0 A;  2L50 A;  5CPV A;  3EVR A;  1SPY A;  1EL4 A;  2G9B A;  3CTN A;  2GGM A;  1S5G Y;  2TN4 A;  1U5I A;  1MR8 A;  3SG3 A;  2FCD A;  2LCP A;  1B8L A;  3GK2 A;  1N65 A;  3LK1 A;  2K7D A;  2KI6 D;  4DUQ A;  3EK8 A;  1FI5 A;  2JC2 A;  3BUW B;  3DVJ A;  4PHM A;  4WQ3 A;  4ORA B;  2K61 A;  4P2Y B;  1NPQ A;  2I94 A;  4JWQ A;  4IL1 A;  4ZCU A;  1PUL A;  4GPL B;  1LVC D;  1K94 A;  1KQM C;  3JTD B;  2L98 A;  4DIR A;  1XK4 C;  1KSO A;  2V53 A;  1RJV A;  1N2D A;  1QJT A;  1YRU B;  1ZUZ A;  3IQO A;  1R6P A;  2NCO A;  1UHH A;  1GQM A;  2DOQ A;  2KGB C;  1JF2 A;  1WY9 A;  4USL A;  4YRU A;  4NDD A;  1XK4 A;  4JQ0 D;  3DF0 B;  5HYD A;  1SCV A;  2LLU A;  1KFU L;  1G4Y R;  1ZAC A;  5ER4 X;  4AQI A;  4NDC A;  4GBA A;  1L7Z A;  4GUK A;  1OSA A;  2M1U A;  1CFP A;  3VRQ A;  3AKB A;  3BUO B;  2OTG B;  4YGD B;  1QV1 A;  3O6B A;  2KAX A;  3ZWH A;  1TCO B;  3OX5 A;  4P5O E;  4TNC A;  1S6J A;  3BOW A;  1J7P A;  2WCB A;  1JWD A;  3IF7 A;  1W7I B;  2A4J A;  4YI9 A;  1B8C A;  5D69 A;  4QJ4 B;  1RRO A;  2D8N A;  1BJF A;  2O60 A;  3TUY C;  1S1E A;  1DJG A;  2Y1N A;  1YVH A;  5HLO A;  4QJ5 B;  1SYM A;  4NDB A;  1J7O A;  4HRE E;  4MN0 A;  1TOP A;  2OTG C;  1SR6 B;  1WLM A;  3O2P A;  2ZRT A;  1OQP A;  2M0R A;  2LE9 B;  1A03 A;  1S6I A;  4PAL A;  1NCZ A;  4MZK A;  1NX3 A;  1TCF A;  2M3W A;  3AAK A;  1W7J B;  3NSL A;  1AK8 A;  2JNX A;  2CNP A;  2CXJ A;  1JUO A;  3PN7 B;  4CLN A;  1LA3 A;  1A29 A;  1SNL A;  2M7N A;  2JOJ A;  2P6B B;  3SG5 A;  4PHN A;  1SR6 C;  2HQW A;  1AVS A;  1S26 D;  5JJG A;  3JVT C;  1DF0 B;  5HKW A;  1UUR A;  2WCF A;  4OV2 A;  1E8A A;  3AKA A;  1XVJ A;  1UUS A;  2I7A A;  2LC5 A;  2QPT A;  1DVI A;  3PFV A;  1S6C A;  2F2O A;  3AAJ A;  4PDZ A;  2MRD A;  2EGD A;  1SKT A;  3BQ3 A;  3QRX A;  2E6W A;  1KFX L;  1K93 D;  1L2O C;  2FJU B;  1D1O A;  1A4P A;  1WRK A;  1TRF A;  4I5L B;  2M97 A;  3PM8 A;  4HSZ A;  1NX2 A;  1TNW A;  1IG5 A;  1MQ1 A;  2BBN A;  1B4C A;  1SRA A;  2K7B A;  3NSI A;  2M29 A;  3RLZ A;  1DT7 B;  1SBJ A;  4YI8 A;  1GJY A;  3WNX B;  2FCE A;  5KSZ A;  1F4Q A;  3RM1 A;  1J1E A;  2AMI A;  1EH2 A;  3DVK A;  1F4O A;  1NWD A;  4U8D A;  4UPG A;  1F55 A;  1KK8 B;  5IBW A;  2KFG A;  2ZND A;  1UP5 A;  1XFX O;  1AUI B;  1SW8 A;  3VGO A;  1CKK A;  1YUR A;  1PVA A;  2JPT A;  2BKH B;  4PHJ A;  5GQQ C;  1CFD A;  2IS9 A;  3CS1 A;  4E68 A;  4N1F A;  5HKZ A;  2MJW B;  3OB2 B;  1SCM C;  4HRH A;  3TDU A;  4I5N B;  4CFQ A;  1K95 A;  4ICB A;  5ER5 A;  5DKN A;  3I5F C;  4YGA A;  1C07 A;  1TNX A;  2LLT A;  1J7Q A;  3EK4 A;  2ZN9 A;  2KGR A;  2GV5 A;  3A4U B;  3GK4 X;  3KPX A;  5CSI A;  2KFH A;  3OX6 A;  4GAO A;  3PAT A;  1QAT A;  2L4H A;  2ZN8 A;  1AHR A;  1DMO A;  2LUX A;  3WHU B;  3I5I B;  4MVF A;  5PAL A;  1MHO A;  1REC A;  1BF5 A;  1IQ5 A;  3LK0 A;  2LHL A;  3TDZ A;  1J1D A;  5AEQ A;  1EG3 A;  1WRL A;  1QVI Z;  4FTG A;  3FIA A;  1PSB A;  5J3X A;  3KEV A;  2RGI A;  1IH0 A;  5AAN A;  1IRJ A;  2JRF A;  4D1E A;  4AQJ A;  1QX2 A;  1BU3 A;  3KF9 A;  1Y1X A;  3DVE A;  1IWQ A;  4N5X A;  1AJ5 A;  1QX5 B;  2CCM A;  2KQY A;  2WND A;  1DGV A;  3TZ1 A;  3O4Y A;  3CLN A;  4A4B A;  4YBH B;  1TN4 A;  1K8U A;  3JTD C;  5FYX A;  1OMV A;  1EJ3 A;  5CSF A;  1BOC A;  4OKH A;  1N0Y A;  2R2I A;  5I2Q A;  4QJ3 B;  2SAS A;  4C0L A;  2O5G A;  1FBV A;  1QXP A;  1K9K A;  1CDP A;  1QV0 A;  1KK7 Z;  4M2Q A;  1M45 A;  1ALV A;  4M2O A;  1KWO B;  1OMD A;  4OCI A;  2KBI A;  2K7O A;  1MUX A;  2MAZ A;  3D0Y B;  1KQV A;  3DF0 A;  4GNK B;  2L2E A;  1QLK A;  2PAL A;  3EK7 A;  1FPW A;  2K8M B;  2CT9 A;  5G08 A;  2I2R E;  4MZL A;  2KAV A;  1B47 A;  1XO5 A;  1LXF C;  1TIZ A;  2JT3 A;  1BOD A;  3FS7 A;  4OVN F;  1XFV O;  2KAY A;  2L4I A;  1IKU A;  3VRN A;  1M46 A;  2MLE C;  1FF1 A;  1DJY A;  1YX8 A;  2NXQ A;  1Y1A A;  1J55 A;  2JQ6 A;  3BUN B;  1PAL A;  3CR5 X;  3HCM A;  1PSR A;  1H4B A;  1K96 A;  3BUM B;  3I5H B;  1G33 A;  1SK6 D;  1DJH A;  1SL8 A;  1EG4 A;  2ZFD A;  2BE6 A;  2JXL A;  1CLM A;  1YUU A;  1IGV A;  3WHT B;  1NCX A;  3FWC A;  1QTX A;  4PE7 A;  2ZRS A;  1A75 B;  2NLN A;  2OS8 B;  4CFR A;  1QS7 A;  5AFP A;  5B8I B;  5AER A;  4DCK A;  3PLF B;  1RWY A;  4CID A;  2EC6 B;  1FI6 A;  1C7W A;  1XFZ O;  1WRZ A;  1M31 A;  2LM5 A;  2LVI A;  1S36 A;  2HET A;  2LLS A;  3PN7 C;  3SJS A;  5I2O A;  1KSM A;  3CR2 A;  4C0J A;  3TDI A;  4ETO A;  5DKQ A;  1JFK A;  1CLB A;  2Q4U A;  1CM1 A;  1PVB A;  1QLS A;  1S3P A;  4XJK B;  5I8N A;  1NX0 A;  1OOJ A;  4MSP A;  2JTZ A;  1BG1 A;  2PVB A;  1GGZ A;  1DJW A;  2LHI A;  2LUC A;  1BLQ A;  1LKJ A;  1UHK A;  1DF0 A;  2OPO A;  3EKH A;  3VRR A;  1CDN A;  1NCY A;  1B7T Z;  2L0P A;  1TTX A;  2JU0 A;  4A4C A;  1WLZ A;  2LP2 A;  2JNF A;  2WCE A;  2BKI B;  2F2P A;  2LAN A;  1EXR A;  2PRU A;  1QIV A;  1CMF A;  2MHH A;  2M49 B;  4XJK A;  2KSP A;  1LIN A;  4ZCV A;  2LVK A;  4I5K A;  2BL0 B;  3CGA A;  4PE1 A;  1WDC B;  2M7L A;  2LMV A;  1UHJ A;  1F70 A;  2BBM A;  5I2L A;  3SG7 A;  2Q91 A;  1TNQ A;  2PSR A;  1H8B A;  1C7V A;  2LMT A;  1KK8 C;  1Y1U A;  2JXC A;  1JSA A;  3FWB A;  2HQ8 A;  1U5I B;  2LVJ A;  2F3Z A;  1XFY O;  4WRI A;  1M63 B;  3NSO A;  2CTN A;  4M2P A;  2L5X B;  5CSN A;  3CR4 X;  2I18 A;  5K89 A;  4MZJ A;  2ZKM X;  2BL0 C;  3VRP A;  5JOL A;  1WDC C;  4XYN A;  1SY9 A;  3SIB A;  1G8I A;  1ALW A;  4I5J A;  1V1F A;  3SG4 A;  3VRO A;  2KOT A;  2COL B;  2M1K B;  2BCB A;  3I5G B;  1IJ5 A;  1YVL A;  2WOR A;  1QVI Y;  4R1E A;  2EHB A;  5HLV A;  2JZI A;  2K0J A;  4N1G A;  2ZNE A;  1XFU O;  1XYD A;  1S5G Z;  3GOF A;  4DS7 A;  4WQ2 A;  2LVV A;  2F8P A;  3C1V A;  1B1G A;  3K21 A;  1UWO A;  2JT0 A;  3I5I C;  4MEW A;  3EKJ A;  4MBE A;  2QAC A;  2E30 A;  2FOT A;  1CTR A;  1F71 A;  3MSE B;  4PE0 A;  2KI6 C;  3SG2 A;  1MXE A;  3IQQ A;  2Y1M A;  2L51 A;  3I5G C;  1M39 A;  1ZOT B;  3BOW B;  1CDL A;  2SCP A;  3H4S E;  1RTP 1;  1BR4 B;  1CB1 A;  3CZT X;  1CMG A;  1TNP A;  5AXI A;  1K9P A;  1KK7 Y;  1SMG A;  2KHN A;  4YGE B;  4C0K A;  1PRW A;  1CDM A;  4PE4 A;  2JTT A;  1JFJ A;  3TUY B;  2MA2 A;  3BYA A;  1MF8 B;  2BEC A;  2KBM A;  1K90 D;  2KYF A;  2H61 C;  3O78 A;  1RFJ A;  3HX4 A;  1NSH A;  3SIA A;  1OE9 B;  2M8U A;  4MLW A;  2KDH A;  4GGN A;  1QIW A;  1YUS A;  1SL9 A;  2GGZ A;  2H61 A;  1Y6W A;  3DVM A;  1BMO A;  2KI4 B;  3F45 A;  5F6T A;  1AP4 A;  4GFT A;  1KWO C;  1Q80 A;  1DJX A;  1XA5 A;  1X02 A;  2HF5 A;  1KFU S;  1JF0 A;  3KO0 A;  1NP8 A;  3WXA A;  1MXL C;  2MBX A;  2WC8 A;  1DTL A;  3D0Y A;  4OR9 B;  1K2H A;  3PSR A;  2HPS A;  4L9M A;  1CFF A;  3ICB A;  2NCP A;  2KI4 C;  2G2B A;  1DJI A;  1IJ6 A;  1Y0V H;  1UHI A;  1YRT B;  3JVT B;  3NXA A;  4Q04 A;  4ORC B;  1OZO A;  2Y5I A;  3OB1 B;  5BPJ A;  2LP3 A;  1QAS A;  3SG6 A;  3BXK A;  2KFF A;  1FW4 A;  2LNK A;  2ISD A;  3DD4 A;  3I5H C;  4PHK A;  1J7R A;  1RK9 A;  2JUL A;  4F0Z B;  3LCP C;  1YUT A;  4BY5 A;  2CBL A;  2M9G A;  5D7F A;  2MLF C;  1YX7 A;  1DGU A;  1L2O B;  1B8R A;  1NUB A;  1CFC A;  1K9U A;  3A8R A;  5DKR A;  2OS8 C;  5HKY A;  1NIW A;  1DJZ A;  2K7C A;  2Y4Q A;  3EVU A;  3TS5 B;  3LLE A;  2EC6 C;  2LMU A;  3M0W A;  1A75 A;  1R2U A;  2BCA A;  4PCW A;  1JC2 A;  4HRG A;  1B7T Y;  2PMY A;  2AAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...