1QVIY

Crystal structure of scallop myosin s1 in the pre-power stroke state to 2.6 angstrom resolution: flexibility and function in the head
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
141
structure length
141
Chain Sequence
LPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of scallop Myosin s1 in the pre-power stroke state to 2.6 a resolution: flexibility and function in the head.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated muscle
total genus 41
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qviY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qviY02
1NX0A 1SY9A 2ZRTA 1EG4A 1OZSA 2WCFA 3FS7A 3IQOA 1F55A 3PM8A 3BXKA 4MBEA 1K94A 1K9UA 1QXPA 3HCMA 4GFTA 4JQ0D 4PHJA 2NZ0A 4HSZA 2ZKMX 1TCOB 1XFUO 1JWDA 2ZRSA 4XJKB 2MLFC 3SG6A 2LE9B 1Y0VH 1PVAA 2BL0C 2LUXA 2MHHA 1S26D 1AUIB 2M1KB 2JU0A 4JPZB 4CFRA 1BF5A 1XFYO 3AAKA 2LMTA 2KQ6A 1RROA 2LVIA 4QJ3B 1FI5A 1K93D 4Q04A 4DCKA 2DOQA 3PALA 2WOSA 1UHJA 4MRYA 2ZNDA 2AAOA 1GJYA 4R1EA 3SIAA 3SG5A 4MN0A 1QX7A 1UUSA 1L2OB 2KQYA 2VRGA 4YBHB 4E68A 3EVRA 1PULA 1IQ3A 3DF0A 2HQ8A 3PATA 2PVBA 1PK0D 1B7TY 1QASA 2M97A 5ER4X 1DJZA 2L50A 1BODA 1OQPA 5JOLA 2Y1NA 1YRTB 3FWBA 4BY5A 1XA5A 2LMUA 2MRDA 2M7NA 1KFXL 2OTGB 1IH0A 1GGWA 1NWDA 2I18A 1YVHA 2F3ZA 1KFUS 2PASA 3FWCA 1CLLA 1DVIA 2HETA 3CR4X 1CM4A 1SK6D 4PHKA 4PE0A 3CWGA 1NUBA 2JC2A 3CR2A 1M45A 1KWOC 4GGFA 2K7CA 1B7TZ 1CM1A 4F0ZB 1KSMA 2KYCA 4OV2A 2PSRA 1K2HA 1MXLC 1RJVA 1J1EA 1DJIA 2K7BA 2Y5IA 2K0JA 1S5GZ 3KPXA 3OHMB 4P2YB 4CFQA 2ZNEA 4PHMA 1FPWA 1TNQA 4MLWA 4FTGA 2LAPA 3I5GC 2L98A 1CFCA 1DGVA 1CLMA 1QS7A 1S6IA 3O4YA 4ICBA 1OMDA 1B8CA 2SCPA 2KI4C 4YGBB 1DJYA 3JVTB 1EG3A 2JQ6A 2JZIA 4CLNA 2M1UA 3BUWB 4C0KA 4N1GA 5ER5A 4YGAA 3QRXA 1YTZC 4FQOA 4ORCB 4C0JA 1RTP1 1MUXA 3VRRA 1UURA 1K8UA 2K7OA 3PSRA 2CT9A 1QTXA 2D8NA 5D7FA 3NSLA 1EXRA 3BUOB 1ZFSA 2F33A 1SMGA 2JT3A 1E8AA 4DS7A 1ZACA 2F2OA 1YURA 2NLNA 1QIVA 1YUTA 2JWWA 4GGNA 4HRGA 2BCAA 2O60A 3EVVA 1B4CA 4MZKA 1IRJA 3AKAA 5PALA 4PDZA 1CKKA 2MLEC 1CB1A 4NQGA 1SYMA 1JC2A 1Y1XA 5B8IB 2F3YA 5KTYA 1CTRA 1S6JA 1SCVA 1H4BA 1DF0A 4MZLA 1DF0B 3I5FC 1IJ5A 4QJ4B 1YUSA 1LKJA 1LXFC 2RGIA 1NSHA 2G2BA 2LMVA 2KBMA 2V53A 2A4JA 1SPYA 3LLEA 2JRFA 2MA2A 2JPTA 3SIBA 1C07A 3PN7C 2E6WA 3O78A 4OR9B 1FI6A 1BT6A 4P5OE 1QIWA 1QATA 1KK7Y 1MQ1A 1W7IB 3C1VA 3CLNA 3RM1A 1WDCB 2JULA 4DIRA 1WRLA 5HLVA 1KQVA 1QX5B 3RLZA 2JXLA 3ICBA 1SCMC 1BOCA 5I8NA 1F54A 1NX1A 1LINA 1SL7A 1N65A 2L2EA 3KEVA 3CGAA 3SG2A 1QV1A 2BBNA 1SW8A 3DF0B 2NXQA 4WRIA 1F71A 2CCMA 4YGEB 5BPJA 3TS5B 3SG7A 3BUNB 5AANA 4C0LA 5AXIA 4ZCUA 1K95A 1Y1AA 1JF2A 1DJGA 1LVCD 3I5FB 4XJKA 2I2RE 3NSOA 1WDCC 2LV7A 1H8BA 2PMYA 3WHTB 2BL0B 2I7AA 4I5KA 1JFKA 1XFWO 3TUYB 3DVJA 1G4YR 4MZJA 2M3WA 1U5IA 4GNKB 2Q91A 2BKHB 1MWNA 1XFVO 2EC6C 2KAVA 4GBAA 1D1OA 1NYAA 1TOPA 4YI9A 4A4BA 1BJFA 1S3PA 2L4HA 3CZTX 1BLQA 2WORA 3WHUB 1S6CA 2QPTA 4MVFA 1L2OC 2M0RA 1A75B 3D10A 1V1GA 2L51A 4M2PA 5I2LA 2MJWB 2KFFA 2FOTA 1JBAA 2LVJA 2KDHA 1PSBA 5KSZA 3GOFA 5HKWA 1OSAA 2COLB 5K89A 1G33A 1RWYA 2NCOA 1LA0A 2LLSA 1K96A 2G9BA 1SNLA 1AJ5A 3DVEA 1F4QA 1QX2A 1XFXO 4OKHA 1CLBA 1ZOTB 1B47A 1QVIZ 1WRZA 5AEQA 1GGZA 4PE1A 1CDPA 1SCMB 1IWQA 2K61A 2M49B 3SG3A 1Y1UA 3I5HC 1F8HA 1BG1A 2Q4UA 1M39A 1G8IA 2JTTA 2K7DA 3TZ1A 2NCPA 1EJ3A 3WXAA 1ODBA 2BCXA 2JNFA 3BOWA 2GGMA 4JWQA 1N2DA 1J1DA 1C7WA 1KK8B 1OE9B 2CNPA 1B9AA 1TCFA 3F45A 1KFUL 4PE7A 3CTNA 2WCEA 1KFXS 1QVIY 1UP5A 4AQJA 1DMOA 4U8DA 4NDDA 4WQ2A 1XFZO 2L4IA 4GUKA 2ZN8A 1TNWA 3LK0A 5D69A 4TNCA 2BCBA 2FJUB 2LP2A 1LA3A 4WQ3A 1IGVA 3AAJA 2HF5A 1MR8A 2LANA 3EVUA 1NX2A 1QLKA 2JT0A 3EK4A 2KI6D 3GK4X 3KO0A 5HLOA 2FCEA 1CMFA 1JFJA 1BU3A 2KI4B 4MRXA 4DUQA 1A2XA 2O5GA 1FW4A 1B8RA 2JTZA 5HKYA 2QACA 3VRQA 2WCBA 1JSAA 3VRNA 2EC6B 2F2PA 2ZFDA 1KQMC 3JTDB 2K2FA 3AKBA 1IQ5A 4D1EA 1DTLA 5AFPA 1R2UA 1NCXA 1AJ4A 1CDNA 3CS1A 2BKIB 2LNKA 4MEWA 1GQMA 1A03A 1ZMZA 2KOTA 3ZWHA 2GGZA 5GQQC 3EK7A 1C7VA 1CDMA 2KI6C 3OB1B 3H4SE 1WLZA 5G08A 1V1FA 4NDBA 1BMOA 1XVJA 1NCZA 2AMIA 4HREE 1L7ZA 3NSKA 2BE6A 2MAZA 3OX6A 1PVBA 3WNXB 3I5GB 4I5JA 2KNEA 2BBMA 3TDZA 5HKZA 1A4PA 2OTGC 5KU1A 4OCIA 1YX7A 4PCWA 4A4CA 1S36A 4I5NB 3TS5C 1SL9A 4DRWA 1OZOA 3KHEA 1JF0A 5DKNA 3SJSA 3LK1A 1TNPA 1UWOA 2ZN9A 1AP4A 2KGRA 1A75A 2CBLA 2WC8A 1WY9A 2OS8B 1PRWA 2P6BB 2WNDA 2M7LA 4YGCB 1NCYA 2JNXA 1PALA 3BUXB 1M31A 1SKTA 3I5HB 1EH2A 2JOJA 1W7JB 1J7OA 3GK1A 1SR6B 2LP3A 1K9KA 5HYDA 2LUCA 4PE4A 1MF8B 4GAOA 2K2AA 1Y6WA 3DVMA 2M8UA 3OB2B 3EK8A 1TRFA 1JUOA 1YVLA 2E30A 3KF9A 1Q80A 2LHIA 5FYXA 2KAYA 2LM5A 1RECA 2LHLA 1MHOA 2LLTA 2Y4QA 3MSEB 1KK8C 4CPVA 1RK9A 3JVTC 2H61C 1AVSA 2JT8A 4L9MA 3O6BA 1XO5A 1UHHA 1PSRA 1OMRA 3NXAA 2AUCA 2LLUA 2BE4A 1XK4C 2CXJA 1OOJA 4QJ5B 1ALWA 1TIZA 4YGDB 2ISDA 1TNXA 1MXEA 3BQ3A 2KHNA 4M2OA 2EHBA 5TNCA 3JTDC 2LVVA 1VRKA 3SG4A 1YR5A 2R2IA 2IS9A 1CDLA 2Y1MA 1NIWA 3PFVA 3LCPC 3TDUA 4ORAB 2MBXA 1DT7B 4N5XA 1QLSA 4XYNA 1K9PA 3EKJA 1X02A 3CR5X 3E3RA 1KWOB 1IKUA 1S5GY 1XK4A 1AHRA 3EKHA 4NDCA 5IBWA 1F4OA 1K90D 1J7PA 1FBVA 2KFHA 1DJXA 5J3XA 3VROA 1S1EA 1YRUB 5CSJA 3K21A 1SBJA 2KGBC 1J7RA 3BYAA 2K8MB 4ETOA 1B1GA 1CNPA 1TN4A 3GK2A 1BR4B 2LC5A 1KCYA 2JXCA 1M63B 2LVKA 1R6PA 4ZCVA 3PLFB 2KBIA 1HT9A 1WLMA 5F6TA 5AERA 3M0WA 4HRHA 1U5IB 5JJGA 3OP0A 5I2OA 1CFPA 1QJTA 5I2QA 2I94A 5CSFA 2OPOA 4AQIA 2L5XB 3I5IB 3BOWB 1CFDA 3LL8B 2BECA 5CSIA 1UHNA 1CMGA 1QV0A 1UHIA 1XYDA 2M29A 3A8RA 3O2PA 3I5IC 2EGDA 4OVNF 4BY4A 1IJ6A 1SR6C 5DKQA 2PALA 2KAXA 3DVKA 1UHKA 1DJHA 1SRAA 4GGFC 4M2QA 3DD4A 1YX8A 2FCDA 2TN4A 4AOMA 1M46A 1WRKA 4MSPA 1BR1B 1SL8A 2LCPA 3PN7B 1AK8A 4GPLB 3VRPA 4I5LB 4N1FA 1J55A 3OX5A 2KFGA 1KQMB 2OS8C 2F8PA 4IL1A 1RFJA 1CFFA 2H2KA 2KYFA 3HX4A 2PRUA 1ALVA 2HQWA 1KSOA 1F70A 2M9GA 1DJWA 1NX3A 4PHNA 4USLA 2B1UA 1NP8A 2CTNA 4UPGA 3D0YB 1NPQA 3IQQA 4CIDA 5CSNA 1ZUZA 3ZNIA 1EL4A 1J7QA 2KSPA 5CPVA 1FF1A 1HQVA 1KK7Z 2H61A 2SASA 4ORBB 4PALA 1DGUA 3D0YA 3A4UB 3IF7A 4YRUA 1TTXA 3FIAA 2HPSA 5DKRA 3BUMB 1YUUA 2L0PA 1IG5A 1B8LA 1N0YA 2GV5A 3VGOA 3TUYC 3NSIA 3TDIA 4YI8A 1OMVA 1A29A
chains in the Genus database with same CATH superfamily
1NX0A 1SY9A 2ZRTA 1EG4A 1OZSA 2WCFA 3FS7A 3IQOA 1F55A 3PM8A 3BXKA 4MBEA 1K94A 1K9UA 1QXPA 3HCMA 4GFTA 4JQ0D 4PHJA 3S0GA 2NZ0A 1OOIX 2WCHA 4HSZA 2ZKMX 1DQEA 1TCOB 1XFUO 3D75A 1JWDA 2ZRSA 4XJKB 2MLFC 3SG6A 2LE9B 1Y0VH 1PVAA 2BL0C 2LUXA 2MHHA 1S26D 4JKTA 1AUIB 2M1KB 2JU0A 4JPZB 4CFRA 1BF5A 1XFYO 3AAKA 2LMTA 2KQ6A 1RROA 1GM0A 2LVIA 4QJ3B 1FI5A 1K93D 2WC6A 4Q04A 4DCKA 2DOQA 3PALA 2QEVA 2WOSA 1UHJA 4MRYA 2ZNDA 2AAOA 1GJYA 4R1EA 3SIAA 3SG5A 4MN0A 1QX7A 1UUSA 1L2OB 2KQYA 2VRGA 4YBHB 4E68A 3EVRA 1PULA 1IQ3A 3R1VA 2KLEA 3DF0A 2HQ8A 2WC5A 3OBVA 3PATA 2PVBA 1PK0D 1B7TY 1QASA 2M97A 5ER4X 1DJZA 2L50A 1BODA 1OQPA 5JOLA 2Y1NA 1YRTB 3FWBA 4BY5A 1XA5A 2LMUA 2MRDA 2M7NA 1KFXL 2OTGB 1IH0A 1GGWA 1NWDA 2I18A 1YVHA 2F3ZA 4FQTA 1KFUS 2PASA 3FWCA 1CLLA 1DVIA 2HETA 3CR4X 1CM4A 1SK6D 4PHKA 4PE0A 3CWGA 1NUBA 2JC2A 3CR2A 3UNWA 1M45A 1KWOC 4GGFA 2K7CA 1B7TZ 1CM1A 4F0ZB 1KSMA 2KYCA 4OV2A 2PSRA 1K2HA 1MXLC 1DEKA 1J1EA 1DJIA 1RJVA 2K7BA 2K0JA 1S5GZ 2Y5IA 3KPXA 3OHMB 4P2YB 2ZNEA 4PHMA 1FPWA 1TNQA 4MLWA 4FTGA 2LAPA 3I5GC 1W9ZA 2L98A 1CFCA 1DGVA 1CLMA 1QS7A 1S6IA 3O4YA 4ICBA 1OMDA 1B8CA 2H8VA 2SCPA 2KI4C 4YGBB 1DJYA 3JVTB 1EG3A 2JQ6A 2JZIA 3B7AA 2M1UA 4CLNA 3BUWB 4C0KA 4N1GA 5ER5A 4YGAA 3QRXA 1YTZC 4FQOA 4ORCB 4C0JA 1RTP1 1MUXA 3VRRA 1UURA 1K8UA 4INWA 2K7OA 3PSRA 2CT9A 1QTXA 2D8NA 5D7FA 3NSLA 5JJGA 1EXRA 3BUOB 1ZFSA 2F33A 4OZDA 1SMGA 2JT3A 1E8AA 4DS7A 1ZACA 2F2OA 1YURA 2NLNA 1QIVA 1YUTA 2JWWA 4GGNA 4HRGA 2BCAA 2O60A 3BFHA 3EVVA 1B4CA 4MZKA 1IRJA 3AKAA 5PALA 4PDZA 1CKKA 2MLEC 1CB1A 3NHTA 4NQGA 3D73A 1SYMA 1JC2A 1Y1XA 5B8IB 2F3YA 3PJIA 1C3ZA 5KTYA 1CTRA 1S6JA 1SCVA 1H4BA 1DF0A 4MZLA 1XFRA 1DF0B 3FE8A 3I5FC 1IJ5A 4QJ4B 1YUSA 1LKJA 1LXFC 2RGIA 1NSHA 2G2BA 5I94A 2LMVA 2KBMA 3BFBA 2JPOA 2V53A 2A4JA 2L2CA 1SPYA 3LLEA 2JRFA 2MA2A 2JPTA 3SIBA 1C07A 3PN7C 2E6WA 3NGVA 3O78A 4OR9B 1FI6A 1BT6A 3V2LA 4P5OE 3PM2A 1Z2CB 1QIWA 1QATA 3B6XA 1KK7Y 1MQ1A 1W7IB 3C1VA 3CLNA 3RM1A 1WDCB 2JULA 4DIRA 1WRLA 5HLVA 1KQVA 1QX5B 3RLZA 2JXLA 3ICBA 1SCMC 1BOCA 5I8NA 1F54A 1NX1A 1LINA 1SL7A 1N65A 2L2EA 3EG5B 3KEVA 3CGAA 3SG2A 1QV1A 2BBNA 1SW8A 3DF0B 2NXQA 4WRIA 1F71A 2CCMA 2QEHA 4YGEB 3RZSA 5BPJA 3TS5B 3SG7A 3BUNB 5AANA 2KPHA 3VB1A 4C0LA 5AXIA 2P71A 4KYNA 4ZCUA 1K95A 1Y1AA 1JF2A 1DJGA 1LVCD 3I5FB 4XJKA 2I2RE 3NSOA 4IJ7A 1WDCC 3FE6A 2LV7A 1H8BA 2PMYA 3WHTB 2BL0B 2I7AA 4I5KA 3CZ2A 1JFKA 1XFWO 3TUYB 2PYQA 3DVJA 1IIOA 1G4YR 4MZJA 2M3WA 1U5IA 4GNKB 2Q91A 2BKHB 1MWNA 1XFVO 2EC6C 2KAVA 4GBAA 2QEOA 1D1OA 1NYAA 1TOPA 4YI9A 4A4BA 1BJFA 1S3PA 2L4HA 3CZTX 3R1OA 1BLQA 2WORA 3B87A 3WHUB 1S6CA 2QPTA 4MVFA 1L2OC 3SS3A 2M0RA 1A75B 3D10A 1V1GA 2L51A 4M2PA 5I2LA 2MJWB 2KFFA 2FOTA 1JBAA 2LVJA 2KDHA 1PSBA 5KSZA 2P70A 3GOFA 5EL2A 5HKWA 1OSAA 2COLB 5K89A 1G33A 1RWYA 2NCOA 1LA0A 2LLSA 1K96A 3DZTA 2G9BA 1SNLA 3IVTA 1AJ5A 1OOGA 3DVEA 1F4QA 1QX2A 1XFXO 4OKHA 1CLBA 1ZOTB 1B47A 1QVIZ 1WRZA 5AEQA 1GGZA 4PE1A 1CDPA 1SCMB 1IWQA 2K61A 2M49B 3SG3A 1Y1UA 3I5HC 1F8HA 1BG1A 2Q4UA 1M39A 1G8IA 2JTTA 2K7DA 3TZ1A 2NCPA 1EJ3A 3WXAA 1ODBA 2BCXA 2JNFA 3BOWA 2GGMA 4JWQA 1N2DA 1J1DA 1C7WA 1KK8B 1OE9B 3K1EA 2CNPA 1B9AA 1TCFA 3F45A 4PT1A 1KFUL 4PE7A 3CTNA 2WCEA 1KFXS 1QVIY 1UP5A 4AQJA 1DMOA 4U8DA 4NDDA 3BFAA 4WQ2A 1XFZO 2L4IA 4GUKA 3UO9A 2ZN8A 1TNWA 3LK0A 5D69A 5FI7A 4TNCA 3B88A 2WCJA 2KLDA 2BCBA 2FJUB 2LP2A 1LA3A 4WQ3A 1IGVA 3AAJA 2HF5A 1MR8A 2LANA 3EVUA 1NX2A 1QLKA 2JT0A 3EK4A 2KI6D 3GK4X 3KO0A 5HLOA 2FCEA 1CMFA 1JFJA 1BU3A 2KI4B 4MRXA 4DUQA 5FI6A 1A2XA 3L4AA 2O5GA 1FW4A 1C3YA 1B8RA 2JTZA 5HKYA 3CZ1A 2QACA 3VRQA 2WCBA 5DICA 1JSAA 3VRNA 2EC6B 2F2PA 2ZFDA 1KQMC 2QEBA 3JTDB 2K2FA 3AKBA 1IQ5A 4D1EA 1DTLA 5AFPA 1R2UA 1NCXA 1AJ4A 1CDNA 3CS1A 2BKIB 2LNKA 4MEWA 1GQMA 1A03A 1ZMZA 3D74A 2KOTA 3ZWHA 2GGZA 5GQQC 3EK7A 1C7VA 1CDMA 3DXLA 2KI6C 3OB1B 3H4SE 1WLZA 5G08A 1V1FA 4NDBA 1XVJA 1BMOA 1LS8A 1NCZA 2AMIA 4HREE 1L7ZA 2L5YA 3NSKA 2BE6A 2MAZA 3OX6A 3D78A 1PVBA 3WNXB 3I5GB 4I5JA 2KNEA 2BBMA 3TDZA 5D3OA 5HKZA 1A4PA 2OTGC 5KU1A 4OCIA 1YX7A 4PCWA 4A4CA 1S36A 3R1PA 4I5NB 3TS5C 1SL9A 4DRWA 1OZOA 1T14A 3KHEA 1JF0A 5DKNA 3SJSA 3S0BA 3LK1A 1TNPA 1UWOA 2ZN9A 1AP4A 2KGRA 1A75A 2CBLA 2WC8A 1WY9A 2OS8B 1PRWA 2P6BB 2WNDA 2M7LA 4YGCB 1NCYA 2JNXA 1PALA 3BUXB 1M31A 1SKTA 3I5HB 5FI2A 1EH2A 2JOJA 1W7JB 1J7OA 1ORGA 3GK1A 1SR6B 2LP3A 1K9KA 1OOHA 5HYDA 2LUCA 2PQLA 4PE4A 1MF8B 4GAOA 2K2AA 1Y6WA 3DVMA 3DYEA 2M8UA 3OB2B 3EK8A 1TRFA 1JUOA 1YVLA 2E30A 3KF9A 1Q80A 2LHIA 5FYXA 2KAYA 2LM5A 2BAPA 1RECA 2LHLA 1MHOA 2LLTA 3O4XA 2Y4QA 3MSEB 1KK8C 3CYZA 2ERBA 3L47A 4CPVA 1RK9A 3JVTC 2H61C 1AVSA 3B86A 2JT8A 4L9MA 3O6BA 1XO5A 1QWVA 4JD9A 1UHHA 1PSRA 1OMRA 2BNXA 3NXAA 2AUCA 2LLUA 2BE4A 1XK4C 2CXJA 1DC1A 1OOJA 4QJ5B 1ALWA 3D77A 4F7FA 1TIZA 4YGDB 2ISDA 1TNXA 1MXEA 3BQ3A 2KHNA 4M2OA 2EHBA 5TNCA 3JTDC 2LVVA 1VRKA 3SG4A 1YR5A 3NHIA 3QMEA 2R2IA 2IS9A 1CDLA 2K60A 2WCMA 2Y1MA 1NIWA 1OW4A 3PFVA 3LCPC 3TDUA 4ORAB 2MBXA 2GTEA 3L4LA 4INXA 4CFQA 1DT7B 4N5XA 1QLSA 4XYNA 1K9PA 3EKJA 1X02A 1P28A 2WCLA 1KWOB 3CR5X 1S5GY 3E3RA 1XK4A 1IKUA 1AHRA 3EKHA 4NDCA 5IBWA 1F4OA 1K90D 1J7PA 1FBVA 2KFHA 1DJXA 3CDNA 5J3XA 3VROA 3S0AA 1S1EA 3FE9A 1YRUB 5CSJA 3K21A 1SBJA 2KGBC 1J7RA 3BYAA 2K8MB 4ETOA 1B1GA 1CNPA 1TN4A 3GK2A 1BR4B 3CZ0A 2LC5A 1KCYA 2FJYA 2JXCA 1M63B 3SS4A 2LVKA 1R6PA 4ZCVA 3PLFB 2KBIA 1HT9A 1WLMA 5F6TA 5AERA 3M0WA 4HRHA 1Z4HA 1U5IB 1TWOA 3OP0A 5I2OA 1CFPA 1QJTA 3R72A 5I2QA 2I94A 5CSFA 3SS5A 2OPOA 4AQIA 2L5XB 3I5IB 3BOWB 1CFDA 3LL8B 3N7HA 2BECA 5CSIA 1UHNA 1TUJA 1CMGA 1QV0A 1UHIA 1XYDA 2M29A 3A8RA 3O2PA 3I5IC 2EGDA 4OVNF 4BY4A 1IJ6A 1SR6C 5DKQA 2PALA 2KAXA 3DVKA 1UHKA 3OGNA 1OOFA 1DJHA 1SRAA 4GGFC 4M2QA 3DD4A 1YX8A 2FCDA 2TN4A 4AOMA 3S0FA 1M46A 1WRKA 4MSPA 1BR1B 1SL8A 2LCPA 3PN7B 1AK8A 4GPLB 3VRPA 1DELA 4I5LB 4N1FA 1J55A 3OX5A 3Q8IA 2KFGA 1KQMB 2OS8C 2F8PA 4IL1A 1RFJA 1CFFA 2H2KA 2KYFA 3HX4A 2PRUA 1ALVA 2HQWA 2WCKA 3S0EA 1KSOA 3D76A 1F70A 2M9GA 1DJWA 1NX3A 4PHNA 4USLA 2B1UA 1NP8A 2CTNA 4UPGA 3D0YB 1NPQA 3IQQA 5HL1A 4CIDA 5CSNA 1ZUZA 3ZNIA 1SSEB 1EL4A 1J7QA 3BJHA 2KSPA 5CPVA 3S0DA 1HQVA 1KK7Z 2H61A 2SASA 4ORBB 4PALA 1FF1A 2YGUA 1DGUA 3D0YA 3A4UB 3IF7A 4YRUA 1TTXA 3DY9A 3FIAA 2HPSA 5DKRA 3BUMB 1YUUA 2L0PA 1IG5A 1B8LA 1N0YA 1TUZA 2GV5A 2QDIA 3CABA 3VGOA 3TUYC 3NSIA 3TDIA 4YI8A 1OMVA 1A29A
chains in the Genus database with same CATH topology
1NX0A 1SY9A 2ZRTA 1EG4A 1OZSA 2WCFA 3FS7A 3IQOA 1F55A 3PM8A 3BXKA 4MBEA 1K94A 1K9UA 1QXPA 3HCMA 4GFTA 4JQ0D 4PHJA 2NZ0A 4HSZA 2ZKMX 1TCOB 1XFUO 1JWDA 2ZRSA 4XJKB 2MLFC 3SG6A 2LE9B 1Y0VH 1PVAA 2BL0C 2LUXA 2MHHA 1S26D 1AUIB 2M1KB 2JU0A 4JPZB 4CFRA 1BF5A 1XFYO 3AAKA 2LMTA 2KQ6A 1RROA 2LVIA 4QJ3B 1FI5A 1K93D 4Q04A 4DCKA 2DOQA 3PALA 2WOSA 1UHJA 4MRYA 2ZNDA 2AAOA 1GJYA 4R1EA 3SIAA 3SG5A 4MN0A 1QX7A 1UUSA 1L2OB 2KQYA 2VRGA 4YBHB 4E68A 3EVRA 1PULA 1IQ3A 3DF0A 2HQ8A 3PATA 2PVBA 1PK0D 1B7TY 1QASA 2M97A 5ER4X 1DJZA 2L50A 1BODA 1OQPA 5JOLA 2Y1NA 1YRTB 3FWBA 4BY5A 1XA5A 2LMUA 2MRDA 2M7NA 1KFXL 2OTGB 1IH0A 1GGWA 1NWDA 2I18A 1YVHA 2F3ZA 1KFUS 2PASA 3FWCA 1CLLA 1DVIA 2HETA 3CR4X 1CM4A 1SK6D 4PHKA 4PE0A 3CWGA 1NUBA 2JC2A 3CR2A 1M45A 1KWOC 4GGFA 2K7CA 1B7TZ 1CM1A 4F0ZB 1KSMA 2KYCA 4OV2A 2PSRA 1K2HA 1MXLC 1RJVA 1J1EA 1DJIA 2K7BA 2Y5IA 2K0JA 1S5GZ 3KPXA 3OHMB 4P2YB 4CFQA 2ZNEA 4PHMA 1FPWA 1TNQA 4MLWA 4FTGA 2LAPA 3I5GC 2L98A 1CFCA 1DGVA 1CLMA 1QS7A 1S6IA 3O4YA 4ICBA 1OMDA 1B8CA 2SCPA 2KI4C 4YGBB 1DJYA 3JVTB 1EG3A 2JQ6A 2JZIA 4CLNA 2M1UA 3BUWB 4C0KA 4N1GA 5ER5A 4YGAA 3QRXA 1YTZC 4FQOA 4ORCB 4C0JA 1RTP1 1MUXA 3VRRA 1UURA 1K8UA 2K7OA 3PSRA 2CT9A 1QTXA 2D8NA 5D7FA 3NSLA 1EXRA 3BUOB 1ZFSA 2F33A 1SMGA 2JT3A 1E8AA 4DS7A 1ZACA 2F2OA 1YURA 2NLNA 1QIVA 1YUTA 2JWWA 4GGNA 4HRGA 2BCAA 2O60A 3EVVA 1B4CA 4MZKA 1IRJA 3AKAA 5PALA 4PDZA 1CKKA 2MLEC 1CB1A 4NQGA 1SYMA 1JC2A 1Y1XA 5B8IB 2F3YA 5KTYA 1CTRA 1S6JA 1SCVA 1H4BA 1DF0A 4MZLA 1DF0B 3I5FC 1IJ5A 4QJ4B 1YUSA 1LKJA 1LXFC 2RGIA 1NSHA 2G2BA 2LMVA 2KBMA 2V53A 2A4JA 1SPYA 3LLEA 2JRFA 2MA2A 2JPTA 3SIBA 1C07A 3PN7C 2E6WA 3O78A 4OR9B 1FI6A 1BT6A 4P5OE 1QIWA 1QATA 1KK7Y 1MQ1A 1W7IB 3C1VA 3CLNA 3RM1A 1WDCB 2JULA 4DIRA 1WRLA 5HLVA 1KQVA 1QX5B 3RLZA 2JXLA 3ICBA 1SCMC 1BOCA 5I8NA 1F54A 1NX1A 1LINA 1SL7A 1N65A 2L2EA 3KEVA 3CGAA 3SG2A 1QV1A 2BBNA 1SW8A 3DF0B 2NXQA 4WRIA 1F71A 2CCMA 4YGEB 5BPJA 3TS5B 3SG7A 3BUNB 5AANA 4C0LA 5AXIA 4ZCUA 1K95A 1Y1AA 1JF2A 1DJGA 1LVCD 3I5FB 4XJKA 2I2RE 3NSOA 1WDCC 2LV7A 1H8BA 2PMYA 3WHTB 2BL0B 2I7AA 4I5KA 1JFKA 1XFWO 3TUYB 3DVJA 1G4YR 4MZJA 2M3WA 1U5IA 4GNKB 2Q91A 2BKHB 1MWNA 1XFVO 2EC6C 2KAVA 4GBAA 1D1OA 1NYAA 1TOPA 4YI9A 4A4BA 1BJFA 1S3PA 2L4HA 3CZTX 1BLQA 2WORA 3WHUB 1S6CA 2QPTA 4MVFA 1L2OC 2M0RA 1A75B 3D10A 1V1GA 2L51A 4M2PA 5I2LA 2MJWB 2KFFA 2FOTA 1JBAA 2LVJA 2KDHA 1PSBA 5KSZA 3GOFA 5HKWA 1OSAA 2COLB 5K89A 1G33A 1RWYA 2NCOA 1LA0A 2LLSA 1K96A 2G9BA 1SNLA 1AJ5A 3DVEA 1F4QA 1QX2A 1XFXO 4OKHA 1CLBA 1ZOTB 1B47A 1QVIZ 1WRZA 5AEQA 1GGZA 4PE1A 1CDPA 1SCMB 1IWQA 2K61A 2M49B 3SG3A 1Y1UA 3I5HC 1F8HA 1BG1A 2Q4UA 1M39A 1G8IA 2JTTA 2K7DA 3TZ1A 2NCPA 1EJ3A 3WXAA 1ODBA 2BCXA 2JNFA 3BOWA 2GGMA 4JWQA 1N2DA 1J1DA 1C7WA 1KK8B 1OE9B 2CNPA 1B9AA 1TCFA 3F45A 1KFUL 4PE7A 3CTNA 2WCEA 1KFXS 1QVIY 1UP5A 4AQJA 1DMOA 4U8DA 4NDDA 4WQ2A 1XFZO 2L4IA 4GUKA 2ZN8A 1TNWA 3LK0A 5D69A 4TNCA 2BCBA 2FJUB 2LP2A 1LA3A 4WQ3A 1IGVA 3AAJA 2HF5A 1MR8A 2LANA 3EVUA 1NX2A 1QLKA 2JT0A 3EK4A 2KI6D 3GK4X 3KO0A 5HLOA 2FCEA 1CMFA 1JFJA 1BU3A 2KI4B 4MRXA 4DUQA 1A2XA 2O5GA 1FW4A 1B8RA 2JTZA 5HKYA 2QACA 3VRQA 2WCBA 1JSAA 3VRNA 2EC6B 2F2PA 2ZFDA 1KQMC 3JTDB 2K2FA 3AKBA 1IQ5A 4D1EA 1DTLA 5AFPA 1R2UA 1NCXA 1AJ4A 1CDNA 3CS1A 2BKIB 2LNKA 4MEWA 1GQMA 1A03A 1ZMZA 2KOTA 3ZWHA 2GGZA 5GQQC 3EK7A 1C7VA 1CDMA 2KI6C 3OB1B 3H4SE 1WLZA 5G08A 1V1FA 4NDBA 1BMOA 1XVJA 1NCZA 2AMIA 4HREE 1L7ZA 3NSKA 2BE6A 2MAZA 3OX6A 1PVBA 3WNXB 3I5GB 4I5JA 2KNEA 2BBMA 3TDZA 5HKZA 1A4PA 2OTGC 5KU1A 4OCIA 1YX7A 4PCWA 4A4CA 1S36A 4I5NB 3TS5C 1SL9A 4DRWA 1OZOA 3KHEA 1JF0A 5DKNA 3SJSA 3LK1A 1TNPA 1UWOA 2ZN9A 1AP4A 2KGRA 1A75A 2CBLA 2WC8A 1WY9A 2OS8B 1PRWA 2P6BB 2WNDA 2M7LA 4YGCB 1NCYA 2JNXA 1PALA 3BUXB 1M31A 1SKTA 3I5HB 1EH2A 2JOJA 1W7JB 1J7OA 3GK1A 1SR6B 2LP3A 1K9KA 5HYDA 2LUCA 4PE4A 1MF8B 4GAOA 2K2AA 1Y6WA 3DVMA 2M8UA 3OB2B 3EK8A 1TRFA 1JUOA 1YVLA 2E30A 3KF9A 1Q80A 2LHIA 5FYXA 2KAYA 2LM5A 1RECA 2LHLA 1MHOA 2LLTA 2Y4QA 3MSEB 1KK8C 4CPVA 1RK9A 3JVTC 2H61C 1AVSA 2JT8A 4L9MA 3O6BA 1XO5A 1UHHA 1PSRA 1OMRA 3NXAA 2AUCA 2LLUA 2BE4A 1XK4C 2CXJA 1OOJA 4QJ5B 1ALWA 1TIZA 4YGDB 2ISDA 1TNXA 1MXEA 3BQ3A 2KHNA 4M2OA 2EHBA 5TNCA 3JTDC 2LVVA 1VRKA 3SG4A 1YR5A 2R2IA 2IS9A 1CDLA 2Y1MA 1NIWA 3PFVA 3LCPC 3TDUA 4ORAB 2MBXA 1DT7B 4N5XA 1QLSA 4XYNA 1K9PA 3EKJA 1X02A 3CR5X 3E3RA 1KWOB 1IKUA 1S5GY 1XK4A 1AHRA 3EKHA 4NDCA 5IBWA 1F4OA 1K90D 1J7PA 1FBVA 2KFHA 1DJXA 5J3XA 3VROA 1S1EA 1YRUB 5CSJA 3K21A 1SBJA 2KGBC 1J7RA 3BYAA 2K8MB 4ETOA 1B1GA 1CNPA 1TN4A 3GK2A 1BR4B 2LC5A 1KCYA 2JXCA 1M63B 2LVKA 1R6PA 4ZCVA 3PLFB 2KBIA 1HT9A 1WLMA 5F6TA 5AERA 3M0WA 4HRHA 1U5IB 5JJGA 3OP0A 5I2OA 1CFPA 1QJTA 5I2QA 2I94A 5CSFA 2OPOA 4AQIA 2L5XB 3I5IB 3BOWB 1CFDA 3LL8B 2BECA 5CSIA 1UHNA 1CMGA 1QV0A 1UHIA 1XYDA 2M29A 3A8RA 3O2PA 3I5IC 2EGDA 4OVNF 4BY4A 1IJ6A 1SR6C 5DKQA 2PALA 2KAXA 3DVKA 1UHKA 1DJHA 1SRAA 4GGFC 4M2QA 3DD4A 1YX8A 2FCDA 2TN4A 4AOMA 1M46A 1WRKA 4MSPA 1BR1B 1SL8A 2LCPA 3PN7B 1AK8A 4GPLB 3VRPA 4I5LB 4N1FA 1J55A 3OX5A 2KFGA 1KQMB 2OS8C 2F8PA 4IL1A 1RFJA 1CFFA 2H2KA 2KYFA 3HX4A 2PRUA 1ALVA 2HQWA 1KSOA 1F70A 2M9GA 1DJWA 1NX3A 4PHNA 4USLA 2B1UA 1NP8A 2CTNA 4UPGA 3D0YB 1NPQA 3IQQA 4CIDA 5CSNA 1ZUZA 3ZNIA 1EL4A 1J7QA 2KSPA 5CPVA 1FF1A 1HQVA 1KK7Z 2H61A 2SASA 4ORBB 4PALA 1DGUA 3D0YA 3A4UB 3IF7A 4YRUA 1TTXA 3FIAA 2HPSA 5DKRA 3BUMB 1YUUA 2L0PA 1IG5A 1B8LA 1N0YA 2GV5A 3VGOA 3TUYC 3NSIA 3TDIA 4YI8A 1OMVA 1A29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NX0 A;  1SY9 A;  2ZRT A;  1EG4 A;  1OZS A;  2WCF A;  3FS7 A;  3IQO A;  1F55 A;  3PM8 A;  3BXK A;  4MBE A;  1K94 A;  1K9U A;  1QXP A;  3HCM A;  4GFT A;  4JQ0 D;  4PHJ A;  2NZ0 A;  4HSZ A;  2ZKM X;  1TCO B;  1XFU O;  1JWD A;  2ZRS A;  4XJK B;  2MLF C;  3SG6 A;  2LE9 B;  1Y0V H;  1PVA A;  2BL0 C;  2LUX A;  2MHH A;  1S26 D;  1AUI B;  2M1K B;  2JU0 A;  4JPZ B;  4CFR A;  1BF5 A;  1XFY O;  3AAK A;  2LMT A;  2KQ6 A;  1RRO A;  2LVI A;  4QJ3 B;  1FI5 A;  1K93 D;  4Q04 A;  4DCK A;  2DOQ A;  3PAL A;  2WOS A;  1UHJ A;  4MRY A;  2ZND A;  2AAO A;  1GJY A;  4R1E A;  3SIA A;  3SG5 A;  4MN0 A;  1QX7 A;  1UUS A;  1L2O B;  2KQY A;  2VRG A;  4YBH B;  4E68 A;  3EVR A;  1PUL A;  1IQ3 A;  3DF0 A;  2HQ8 A;  3PAT A;  2PVB A;  1PK0 D;  1B7T Y;  1QAS A;  2M97 A;  5ER4 X;  1DJZ A;  2L50 A;  1BOD A;  1OQP A;  5JOL A;  2Y1N A;  1YRT B;  3FWB A;  4BY5 A;  1XA5 A;  2LMU A;  2MRD A;  2M7N A;  1KFX L;  2OTG B;  1IH0 A;  1GGW A;  1NWD A;  2I18 A;  1YVH A;  2F3Z A;  1KFU S;  2PAS A;  3FWC A;  1CLL A;  1DVI A;  2HET A;  3CR4 X;  1CM4 A;  1SK6 D;  4PHK A;  4PE0 A;  3CWG A;  1NUB A;  2JC2 A;  3CR2 A;  1M45 A;  1KWO C;  4GGF A;  2K7C A;  1B7T Z;  1CM1 A;  4F0Z B;  1KSM A;  2KYC A;  4OV2 A;  2PSR A;  1K2H A;  1MXL C;  1RJV A;  1J1E A;  1DJI A;  2K7B A;  2Y5I A;  2K0J A;  1S5G Z;  3KPX A;  3OHM B;  4P2Y B;  4CFQ A;  2ZNE A;  4PHM A;  1FPW A;  1TNQ A;  4MLW A;  4FTG A;  2LAP A;  3I5G C;  2L98 A;  1CFC A;  1DGV A;  1CLM A;  1QS7 A;  1S6I A;  3O4Y A;  4ICB A;  1OMD A;  1B8C A;  2SCP A;  2KI4 C;  4YGB B;  1DJY A;  3JVT B;  1EG3 A;  2JQ6 A;  2JZI A;  4CLN A;  2M1U A;  3BUW B;  4C0K A;  4N1G A;  5ER5 A;  4YGA A;  3QRX A;  1YTZ C;  4FQO A;  4ORC B;  4C0J A;  1RTP 1;  1MUX A;  3VRR A;  1UUR A;  1K8U A;  2K7O A;  3PSR A;  2CT9 A;  1QTX A;  2D8N A;  5D7F A;  3NSL A;  1EXR A;  3BUO B;  1ZFS A;  2F33 A;  1SMG A;  2JT3 A;  1E8A A;  4DS7 A;  1ZAC A;  2F2O A;  1YUR A;  2NLN A;  1QIV A;  1YUT A;  2JWW A;  4GGN A;  4HRG A;  2BCA A;  2O60 A;  3EVV A;  1B4C A;  4MZK A;  1IRJ A;  3AKA A;  5PAL A;  4PDZ A;  1CKK A;  2MLE C;  1CB1 A;  4NQG A;  1SYM A;  1JC2 A;  1Y1X A;  5B8I B;  2F3Y A;  5KTY A;  1CTR A;  1S6J A;  1SCV A;  1H4B A;  1DF0 A;  4MZL A;  1DF0 B;  3I5F C;  1IJ5 A;  4QJ4 B;  1YUS A;  1LKJ A;  1LXF C;  2RGI A;  1NSH A;  2G2B A;  2LMV A;  2KBM A;  2V53 A;  2A4J A;  1SPY A;  3LLE A;  2JRF A;  2MA2 A;  2JPT A;  3SIB A;  1C07 A;  3PN7 C;  2E6W A;  3O78 A;  4OR9 B;  1FI6 A;  1BT6 A;  4P5O E;  1QIW A;  1QAT A;  1KK7 Y;  1MQ1 A;  1W7I B;  3C1V A;  3CLN A;  3RM1 A;  1WDC B;  2JUL A;  4DIR A;  1WRL A;  5HLV A;  1KQV A;  1QX5 B;  3RLZ A;  2JXL A;  3ICB A;  1SCM C;  1BOC A;  5I8N A;  1F54 A;  1NX1 A;  1LIN A;  1SL7 A;  1N65 A;  2L2E A;  3KEV A;  3CGA A;  3SG2 A;  1QV1 A;  2BBN A;  1SW8 A;  3DF0 B;  2NXQ A;  4WRI A;  1F71 A;  2CCM A;  4YGE B;  5BPJ A;  3TS5 B;  3SG7 A;  3BUN B;  5AAN A;  4C0L A;  5AXI A;  4ZCU A;  1K95 A;  1Y1A A;  1JF2 A;  1DJG A;  1LVC D;  3I5F B;  4XJK A;  2I2R E;  3NSO A;  1WDC C;  2LV7 A;  1H8B A;  2PMY A;  3WHT B;  2BL0 B;  2I7A A;  4I5K A;  1JFK A;  1XFW O;  3TUY B;  3DVJ A;  1G4Y R;  4MZJ A;  2M3W A;  1U5I A;  4GNK B;  2Q91 A;  2BKH B;  1MWN A;  1XFV O;  2EC6 C;  2KAV A;  4GBA A;  1D1O A;  1NYA A;  1TOP A;  4YI9 A;  4A4B A;  1BJF A;  1S3P A;  2L4H A;  3CZT X;  1BLQ A;  2WOR A;  3WHU B;  1S6C A;  2QPT A;  4MVF A;  1L2O C;  2M0R A;  1A75 B;  3D10 A;  1V1G A;  2L51 A;  4M2P A;  5I2L A;  2MJW B;  2KFF A;  2FOT A;  1JBA A;  2LVJ A;  2KDH A;  1PSB A;  5KSZ A;  3GOF A;  5HKW A;  1OSA A;  2COL B;  5K89 A;  1G33 A;  1RWY A;  2NCO A;  1LA0 A;  2LLS A;  1K96 A;  2G9B A;  1SNL A;  1AJ5 A;  3DVE A;  1F4Q A;  1QX2 A;  1XFX O;  4OKH A;  1CLB A;  1ZOT B;  1B47 A;  1QVI Z;  1WRZ A;  5AEQ A;  1GGZ A;  4PE1 A;  1CDP A;  1SCM B;  1IWQ A;  2K61 A;  2M49 B;  3SG3 A;  1Y1U A;  3I5H C;  1F8H A;  1BG1 A;  2Q4U A;  1M39 A;  1G8I A;  2JTT A;  2K7D A;  3TZ1 A;  2NCP A;  1EJ3 A;  3WXA A;  1ODB A;  2BCX A;  2JNF A;  3BOW A;  2GGM A;  4JWQ A;  1N2D A;  1J1D A;  1C7W A;  1KK8 B;  1OE9 B;  2CNP A;  1B9A A;  1TCF A;  3F45 A;  1KFU L;  4PE7 A;  3CTN A;  2WCE A;  1KFX S;  1QVI Y;  1UP5 A;  4AQJ A;  1DMO A;  4U8D A;  4NDD A;  4WQ2 A;  1XFZ O;  2L4I A;  4GUK A;  2ZN8 A;  1TNW A;  3LK0 A;  5D69 A;  4TNC A;  2BCB A;  2FJU B;  2LP2 A;  1LA3 A;  4WQ3 A;  1IGV A;  3AAJ A;  2HF5 A;  1MR8 A;  2LAN A;  3EVU A;  1NX2 A;  1QLK A;  2JT0 A;  3EK4 A;  2KI6 D;  3GK4 X;  3KO0 A;  5HLO A;  2FCE A;  1CMF A;  1JFJ A;  1BU3 A;  2KI4 B;  4MRX A;  4DUQ A;  1A2X A;  2O5G A;  1FW4 A;  1B8R A;  2JTZ A;  5HKY A;  2QAC A;  3VRQ A;  2WCB A;  1JSA A;  3VRN A;  2EC6 B;  2F2P A;  2ZFD A;  1KQM C;  3JTD B;  2K2F A;  3AKB A;  1IQ5 A;  4D1E A;  1DTL A;  5AFP A;  1R2U A;  1NCX A;  1AJ4 A;  1CDN A;  3CS1 A;  2BKI B;  2LNK A;  4MEW A;  1GQM A;  1A03 A;  1ZMZ A;  2KOT A;  3ZWH A;  2GGZ A;  5GQQ C;  3EK7 A;  1C7V A;  1CDM A;  2KI6 C;  3OB1 B;  3H4S E;  1WLZ A;  5G08 A;  1V1F A;  4NDB A;  1BMO A;  1XVJ A;  1NCZ A;  2AMI A;  4HRE E;  1L7Z A;  3NSK A;  2BE6 A;  2MAZ A;  3OX6 A;  1PVB A;  3WNX B;  3I5G B;  4I5J A;  2KNE A;  2BBM A;  3TDZ A;  5HKZ A;  1A4P A;  2OTG C;  5KU1 A;  4OCI A;  1YX7 A;  4PCW A;  4A4C A;  1S36 A;  4I5N B;  3TS5 C;  1SL9 A;  4DRW A;  1OZO A;  3KHE A;  1JF0 A;  5DKN A;  3SJS A;  3LK1 A;  1TNP A;  1UWO A;  2ZN9 A;  1AP4 A;  2KGR A;  1A75 A;  2CBL A;  2WC8 A;  1WY9 A;  2OS8 B;  1PRW A;  2P6B B;  2WND A;  2M7L A;  4YGC B;  1NCY A;  2JNX A;  1PAL A;  3BUX B;  1M31 A;  1SKT A;  3I5H B;  1EH2 A;  2JOJ A;  1W7J B;  1J7O A;  3GK1 A;  1SR6 B;  2LP3 A;  1K9K A;  5HYD A;  2LUC A;  4PE4 A;  1MF8 B;  4GAO A;  2K2A A;  1Y6W A;  3DVM A;  2M8U A;  3OB2 B;  3EK8 A;  1TRF A;  1JUO A;  1YVL A;  2E30 A;  3KF9 A;  1Q80 A;  2LHI A;  5FYX A;  2KAY A;  2LM5 A;  1REC A;  2LHL A;  1MHO A;  2LLT A;  2Y4Q A;  3MSE B;  1KK8 C;  4CPV A;  1RK9 A;  3JVT C;  2H61 C;  1AVS A;  2JT8 A;  4L9M A;  3O6B A;  1XO5 A;  1UHH A;  1PSR A;  1OMR A;  3NXA A;  2AUC A;  2LLU A;  2BE4 A;  1XK4 C;  2CXJ A;  1OOJ A;  4QJ5 B;  1ALW A;  1TIZ A;  4YGD B;  2ISD A;  1TNX A;  1MXE A;  3BQ3 A;  2KHN A;  4M2O A;  2EHB A;  5TNC A;  3JTD C;  2LVV A;  1VRK A;  3SG4 A;  1YR5 A;  2R2I A;  2IS9 A;  1CDL A;  2Y1M A;  1NIW A;  3PFV A;  3LCP C;  3TDU A;  4ORA B;  2MBX A;  1DT7 B;  4N5X A;  1QLS A;  4XYN A;  1K9P A;  3EKJ A;  1X02 A;  3CR5 X;  3E3R A;  1KWO B;  1IKU A;  1S5G Y;  1XK4 A;  1AHR A;  3EKH A;  4NDC A;  5IBW A;  1F4O A;  1K90 D;  1J7P A;  1FBV A;  2KFH A;  1DJX A;  5J3X A;  3VRO A;  1S1E A;  1YRU B;  5CSJ A;  3K21 A;  1SBJ A;  2KGB C;  1J7R A;  3BYA A;  2K8M B;  4ETO A;  1B1G A;  1CNP A;  1TN4 A;  3GK2 A;  1BR4 B;  2LC5 A;  1KCY A;  2JXC A;  1M63 B;  2LVK A;  1R6P A;  4ZCV A;  3PLF B;  2KBI A;  1HT9 A;  1WLM A;  5F6T A;  5AER A;  3M0W A;  4HRH A;  1U5I B;  5JJG A;  3OP0 A;  5I2O A;  1CFP A;  1QJT A;  5I2Q A;  2I94 A;  5CSF A;  2OPO A;  4AQI A;  2L5X B;  3I5I B;  3BOW B;  1CFD A;  3LL8 B;  2BEC A;  5CSI A;  1UHN A;  1CMG A;  1QV0 A;  1UHI A;  1XYD A;  2M29 A;  3A8R A;  3O2P A;  3I5I C;  2EGD A;  4OVN F;  4BY4 A;  1IJ6 A;  1SR6 C;  5DKQ A;  2PAL A;  2KAX A;  3DVK A;  1UHK A;  1DJH A;  1SRA A;  4GGF C;  4M2Q A;  3DD4 A;  1YX8 A;  2FCD A;  2TN4 A;  4AOM A;  1M46 A;  1WRK A;  4MSP A;  1BR1 B;  1SL8 A;  2LCP A;  3PN7 B;  1AK8 A;  4GPL B;  3VRP A;  4I5L B;  4N1F A;  1J55 A;  3OX5 A;  2KFG A;  1KQM B;  2OS8 C;  2F8P A;  4IL1 A;  1RFJ A;  1CFF A;  2H2K A;  2KYF A;  3HX4 A;  2PRU A;  1ALV A;  2HQW A;  1KSO A;  1F70 A;  2M9G A;  1DJW A;  1NX3 A;  4PHN A;  4USL A;  2B1U A;  1NP8 A;  2CTN A;  4UPG A;  3D0Y B;  1NPQ A;  3IQQ A;  4CID A;  5CSN A;  1ZUZ A;  3ZNI A;  1EL4 A;  1J7Q A;  2KSP A;  5CPV A;  1FF1 A;  1HQV A;  1KK7 Z;  2H61 A;  2SAS A;  4ORB B;  4PAL A;  1DGU A;  3D0Y A;  3A4U B;  3IF7 A;  4YRU A;  1TTX A;  3FIA A;  2HPS A;  5DKR A;  3BUM B;  1YUU A;  2L0P A;  1IG5 A;  1B8L A;  1N0Y A;  2GV5 A;  3VGO A;  3TUY C;  3NSI A;  3TDI A;  4YI8 A;  1OMV A;  1A29 A; 
#chains in the Genus database with same CATH topology
 1NX0 A;  1SY9 A;  2ZRT A;  1EG4 A;  1OZS A;  2WCF A;  3FS7 A;  3IQO A;  1F55 A;  3PM8 A;  3BXK A;  4MBE A;  1K94 A;  1K9U A;  1QXP A;  3HCM A;  4GFT A;  4JQ0 D;  4PHJ A;  3S0G A;  2NZ0 A;  1OOI X;  2WCH A;  4HSZ A;  2ZKM X;  1DQE A;  1TCO B;  1XFU O;  3D75 A;  1JWD A;  2ZRS A;  4XJK B;  2MLF C;  3SG6 A;  2LE9 B;  1Y0V H;  1PVA A;  2BL0 C;  2LUX A;  2MHH A;  1S26 D;  4JKT A;  1AUI B;  2M1K B;  2JU0 A;  4JPZ B;  4CFR A;  1BF5 A;  1XFY O;  3AAK A;  2LMT A;  2KQ6 A;  1RRO A;  1GM0 A;  2LVI A;  4QJ3 B;  1FI5 A;  1K93 D;  2WC6 A;  4Q04 A;  4DCK A;  2DOQ A;  3PAL A;  2QEV A;  2WOS A;  1UHJ A;  4MRY A;  2ZND A;  2AAO A;  1GJY A;  4R1E A;  3SIA A;  3SG5 A;  4MN0 A;  1QX7 A;  1UUS A;  1L2O B;  2KQY A;  2VRG A;  4YBH B;  4E68 A;  3EVR A;  1PUL A;  1IQ3 A;  3R1V A;  2KLE A;  3DF0 A;  2HQ8 A;  2WC5 A;  3OBV A;  3PAT A;  2PVB A;  1PK0 D;  1B7T Y;  1QAS A;  2M97 A;  5ER4 X;  1DJZ A;  2L50 A;  1BOD A;  1OQP A;  5JOL A;  2Y1N A;  1YRT B;  3FWB A;  4BY5 A;  1XA5 A;  2LMU A;  2MRD A;  2M7N A;  1KFX L;  2OTG B;  1IH0 A;  1GGW A;  1NWD A;  2I18 A;  1YVH A;  2F3Z A;  4FQT A;  1KFU S;  2PAS A;  3FWC A;  1CLL A;  1DVI A;  2HET A;  3CR4 X;  1CM4 A;  1SK6 D;  4PHK A;  4PE0 A;  3CWG A;  1NUB A;  2JC2 A;  3CR2 A;  3UNW A;  1M45 A;  1KWO C;  4GGF A;  2K7C A;  1B7T Z;  1CM1 A;  4F0Z B;  1KSM A;  2KYC A;  4OV2 A;  2PSR A;  1K2H A;  1MXL C;  1DEK A;  1J1E A;  1DJI A;  1RJV A;  2K7B A;  2K0J A;  1S5G Z;  2Y5I A;  3KPX A;  3OHM B;  4P2Y B;  2ZNE A;  4PHM A;  1FPW A;  1TNQ A;  4MLW A;  4FTG A;  2LAP A;  3I5G C;  1W9Z A;  2L98 A;  1CFC A;  1DGV A;  1CLM A;  1QS7 A;  1S6I A;  3O4Y A;  4ICB A;  1OMD A;  1B8C A;  2H8V A;  2SCP A;  2KI4 C;  4YGB B;  1DJY A;  3JVT B;  1EG3 A;  2JQ6 A;  2JZI A;  3B7A A;  2M1U A;  4CLN A;  3BUW B;  4C0K A;  4N1G A;  5ER5 A;  4YGA A;  3QRX A;  1YTZ C;  4FQO A;  4ORC B;  4C0J A;  1RTP 1;  1MUX A;  3VRR A;  1UUR A;  1K8U A;  4INW A;  2K7O A;  3PSR A;  2CT9 A;  1QTX A;  2D8N A;  5D7F A;  3NSL A;  5JJG A;  1EXR A;  3BUO B;  1ZFS A;  2F33 A;  4OZD A;  1SMG A;  2JT3 A;  1E8A A;  4DS7 A;  1ZAC A;  2F2O A;  1YUR A;  2NLN A;  1QIV A;  1YUT A;  2JWW A;  4GGN A;  4HRG A;  2BCA A;  2O60 A;  3BFH A;  3EVV A;  1B4C A;  4MZK A;  1IRJ A;  3AKA A;  5PAL A;  4PDZ A;  1CKK A;  2MLE C;  1CB1 A;  3NHT A;  4NQG A;  3D73 A;  1SYM A;  1JC2 A;  1Y1X A;  5B8I B;  2F3Y A;  3PJI A;  1C3Z A;  5KTY A;  1CTR A;  1S6J A;  1SCV A;  1H4B A;  1DF0 A;  4MZL A;  1XFR A;  1DF0 B;  3FE8 A;  3I5F C;  1IJ5 A;  4QJ4 B;  1YUS A;  1LKJ A;  1LXF C;  2RGI A;  1NSH A;  2G2B A;  5I94 A;  2LMV A;  2KBM A;  3BFB A;  2JPO A;  2V53 A;  2A4J A;  2L2C A;  1SPY A;  3LLE A;  2JRF A;  2MA2 A;  2JPT A;  3SIB A;  1C07 A;  3PN7 C;  2E6W A;  3NGV A;  3O78 A;  4OR9 B;  1FI6 A;  1BT6 A;  3V2L A;  4P5O E;  3PM2 A;  1Z2C B;  1QIW A;  1QAT A;  3B6X A;  1KK7 Y;  1MQ1 A;  1W7I B;  3C1V A;  3CLN A;  3RM1 A;  1WDC B;  2JUL A;  4DIR A;  1WRL A;  5HLV A;  1KQV A;  1QX5 B;  3RLZ A;  2JXL A;  3ICB A;  1SCM C;  1BOC A;  5I8N A;  1F54 A;  1NX1 A;  1LIN A;  1SL7 A;  1N65 A;  2L2E A;  3EG5 B;  3KEV A;  3CGA A;  3SG2 A;  1QV1 A;  2BBN A;  1SW8 A;  3DF0 B;  2NXQ A;  4WRI A;  1F71 A;  2CCM A;  2QEH A;  4YGE B;  3RZS A;  5BPJ A;  3TS5 B;  3SG7 A;  3BUN B;  5AAN A;  2KPH A;  3VB1 A;  4C0L A;  5AXI A;  2P71 A;  4KYN A;  4ZCU A;  1K95 A;  1Y1A A;  1JF2 A;  1DJG A;  1LVC D;  3I5F B;  4XJK A;  2I2R E;  3NSO A;  4IJ7 A;  1WDC C;  3FE6 A;  2LV7 A;  1H8B A;  2PMY A;  3WHT B;  2BL0 B;  2I7A A;  4I5K A;  3CZ2 A;  1JFK A;  1XFW O;  3TUY B;  2PYQ A;  3DVJ A;  1IIO A;  1G4Y R;  4MZJ A;  2M3W A;  1U5I A;  4GNK B;  2Q91 A;  2BKH B;  1MWN A;  1XFV O;  2EC6 C;  2KAV A;  4GBA A;  2QEO A;  1D1O A;  1NYA A;  1TOP A;  4YI9 A;  4A4B A;  1BJF A;  1S3P A;  2L4H A;  3CZT X;  3R1O A;  1BLQ A;  2WOR A;  3B87 A;  3WHU B;  1S6C A;  2QPT A;  4MVF A;  1L2O C;  3SS3 A;  2M0R A;  1A75 B;  3D10 A;  1V1G A;  2L51 A;  4M2P A;  5I2L A;  2MJW B;  2KFF A;  2FOT A;  1JBA A;  2LVJ A;  2KDH A;  1PSB A;  5KSZ A;  2P70 A;  3GOF A;  5EL2 A;  5HKW A;  1OSA A;  2COL B;  5K89 A;  1G33 A;  1RWY A;  2NCO A;  1LA0 A;  2LLS A;  1K96 A;  3DZT A;  2G9B A;  1SNL A;  3IVT A;  1AJ5 A;  1OOG A;  3DVE A;  1F4Q A;  1QX2 A;  1XFX O;  4OKH A;  1CLB A;  1ZOT B;  1B47 A;  1QVI Z;  1WRZ A;  5AEQ A;  1GGZ A;  4PE1 A;  1CDP A;  1SCM B;  1IWQ A;  2K61 A;  2M49 B;  3SG3 A;  1Y1U A;  3I5H C;  1F8H A;  1BG1 A;  2Q4U A;  1M39 A;  1G8I A;  2JTT A;  2K7D A;  3TZ1 A;  2NCP A;  1EJ3 A;  3WXA A;  1ODB A;  2BCX A;  2JNF A;  3BOW A;  2GGM A;  4JWQ A;  1N2D A;  1J1D A;  1C7W A;  1KK8 B;  1OE9 B;  3K1E A;  2CNP A;  1B9A A;  1TCF A;  3F45 A;  4PT1 A;  1KFU L;  4PE7 A;  3CTN A;  2WCE A;  1KFX S;  1QVI Y;  1UP5 A;  4AQJ A;  1DMO A;  4U8D A;  4NDD A;  3BFA A;  4WQ2 A;  1XFZ O;  2L4I A;  4GUK A;  3UO9 A;  2ZN8 A;  1TNW A;  3LK0 A;  5D69 A;  5FI7 A;  4TNC A;  3B88 A;  2WCJ A;  2KLD A;  2BCB A;  2FJU B;  2LP2 A;  1LA3 A;  4WQ3 A;  1IGV A;  3AAJ A;  2HF5 A;  1MR8 A;  2LAN A;  3EVU A;  1NX2 A;  1QLK A;  2JT0 A;  3EK4 A;  2KI6 D;  3GK4 X;  3KO0 A;  5HLO A;  2FCE A;  1CMF A;  1JFJ A;  1BU3 A;  2KI4 B;  4MRX A;  4DUQ A;  5FI6 A;  1A2X A;  3L4A A;  2O5G A;  1FW4 A;  1C3Y A;  1B8R A;  2JTZ A;  5HKY A;  3CZ1 A;  2QAC A;  3VRQ A;  2WCB A;  5DIC A;  1JSA A;  3VRN A;  2EC6 B;  2F2P A;  2ZFD A;  1KQM C;  2QEB A;  3JTD B;  2K2F A;  3AKB A;  1IQ5 A;  4D1E A;  1DTL A;  5AFP A;  1R2U A;  1NCX A;  1AJ4 A;  1CDN A;  3CS1 A;  2BKI B;  2LNK A;  4MEW A;  1GQM A;  1A03 A;  1ZMZ A;  3D74 A;  2KOT A;  3ZWH A;  2GGZ A;  5GQQ C;  3EK7 A;  1C7V A;  1CDM A;  3DXL A;  2KI6 C;  3OB1 B;  3H4S E;  1WLZ A;  5G08 A;  1V1F A;  4NDB A;  1XVJ A;  1BMO A;  1LS8 A;  1NCZ A;  2AMI A;  4HRE E;  1L7Z A;  2L5Y A;  3NSK A;  2BE6 A;  2MAZ A;  3OX6 A;  3D78 A;  1PVB A;  3WNX B;  3I5G B;  4I5J A;  2KNE A;  2BBM A;  3TDZ A;  5D3O A;  5HKZ A;  1A4P A;  2OTG C;  5KU1 A;  4OCI A;  1YX7 A;  4PCW A;  4A4C A;  1S36 A;  3R1P A;  4I5N B;  3TS5 C;  1SL9 A;  4DRW A;  1OZO A;  1T14 A;  3KHE A;  1JF0 A;  5DKN A;  3SJS A;  3S0B A;  3LK1 A;  1TNP A;  1UWO A;  2ZN9 A;  1AP4 A;  2KGR A;  1A75 A;  2CBL A;  2WC8 A;  1WY9 A;  2OS8 B;  1PRW A;  2P6B B;  2WND A;  2M7L A;  4YGC B;  1NCY A;  2JNX A;  1PAL A;  3BUX B;  1M31 A;  1SKT A;  3I5H B;  5FI2 A;  1EH2 A;  2JOJ A;  1W7J B;  1J7O A;  1ORG A;  3GK1 A;  1SR6 B;  2LP3 A;  1K9K A;  1OOH A;  5HYD A;  2LUC A;  2PQL A;  4PE4 A;  1MF8 B;  4GAO A;  2K2A A;  1Y6W A;  3DVM A;  3DYE A;  2M8U A;  3OB2 B;  3EK8 A;  1TRF A;  1JUO A;  1YVL A;  2E30 A;  3KF9 A;  1Q80 A;  2LHI A;  5FYX A;  2KAY A;  2LM5 A;  2BAP A;  1REC A;  2LHL A;  1MHO A;  2LLT A;  3O4X A;  2Y4Q A;  3MSE B;  1KK8 C;  3CYZ A;  2ERB A;  3L47 A;  4CPV A;  1RK9 A;  3JVT C;  2H61 C;  1AVS A;  3B86 A;  2JT8 A;  4L9M A;  3O6B A;  1XO5 A;  1QWV A;  4JD9 A;  1UHH A;  1PSR A;  1OMR A;  2BNX A;  3NXA A;  2AUC A;  2LLU A;  2BE4 A;  1XK4 C;  2CXJ A;  1DC1 A;  1OOJ A;  4QJ5 B;  1ALW A;  3D77 A;  4F7F A;  1TIZ A;  4YGD B;  2ISD A;  1TNX A;  1MXE A;  3BQ3 A;  2KHN A;  4M2O A;  2EHB A;  5TNC A;  3JTD C;  2LVV A;  1VRK A;  3SG4 A;  1YR5 A;  3NHI A;  3QME A;  2R2I A;  2IS9 A;  1CDL A;  2K60 A;  2WCM A;  2Y1M A;  1NIW A;  1OW4 A;  3PFV A;  3LCP C;  3TDU A;  4ORA B;  2MBX A;  2GTE A;  3L4L A;  4INX A;  4CFQ A;  1DT7 B;  4N5X A;  1QLS A;  4XYN A;  1K9P A;  3EKJ A;  1X02 A;  1P28 A;  2WCL A;  1KWO B;  3CR5 X;  1S5G Y;  3E3R A;  1XK4 A;  1IKU A;  1AHR A;  3EKH A;  4NDC A;  5IBW A;  1F4O A;  1K90 D;  1J7P A;  1FBV A;  2KFH A;  1DJX A;  3CDN A;  5J3X A;  3VRO A;  3S0A A;  1S1E A;  3FE9 A;  1YRU B;  5CSJ A;  3K21 A;  1SBJ A;  2KGB C;  1J7R A;  3BYA A;  2K8M B;  4ETO A;  1B1G A;  1CNP A;  1TN4 A;  3GK2 A;  1BR4 B;  3CZ0 A;  2LC5 A;  1KCY A;  2FJY A;  2JXC A;  1M63 B;  3SS4 A;  2LVK A;  1R6P A;  4ZCV A;  3PLF B;  2KBI A;  1HT9 A;  1WLM A;  5F6T A;  5AER A;  3M0W A;  4HRH A;  1Z4H A;  1U5I B;  1TWO A;  3OP0 A;  5I2O A;  1CFP A;  1QJT A;  3R72 A;  5I2Q A;  2I94 A;  5CSF A;  3SS5 A;  2OPO A;  4AQI A;  2L5X B;  3I5I B;  3BOW B;  1CFD A;  3LL8 B;  3N7H A;  2BEC A;  5CSI A;  1UHN A;  1TUJ A;  1CMG A;  1QV0 A;  1UHI A;  1XYD A;  2M29 A;  3A8R A;  3O2P A;  3I5I C;  2EGD A;  4OVN F;  4BY4 A;  1IJ6 A;  1SR6 C;  5DKQ A;  2PAL A;  2KAX A;  3DVK A;  1UHK A;  3OGN A;  1OOF A;  1DJH A;  1SRA A;  4GGF C;  4M2Q A;  3DD4 A;  1YX8 A;  2FCD A;  2TN4 A;  4AOM A;  3S0F A;  1M46 A;  1WRK A;  4MSP A;  1BR1 B;  1SL8 A;  2LCP A;  3PN7 B;  1AK8 A;  4GPL B;  3VRP A;  1DEL A;  4I5L B;  4N1F A;  1J55 A;  3OX5 A;  3Q8I A;  2KFG A;  1KQM B;  2OS8 C;  2F8P A;  4IL1 A;  1RFJ A;  1CFF A;  2H2K A;  2KYF A;  3HX4 A;  2PRU A;  1ALV A;  2HQW A;  2WCK A;  3S0E A;  1KSO A;  3D76 A;  1F70 A;  2M9G A;  1DJW A;  1NX3 A;  4PHN A;  4USL A;  2B1U A;  1NP8 A;  2CTN A;  4UPG A;  3D0Y B;  1NPQ A;  3IQQ A;  5HL1 A;  4CID A;  5CSN A;  1ZUZ A;  3ZNI A;  1SSE B;  1EL4 A;  1J7Q A;  3BJH A;  2KSP A;  5CPV A;  3S0D A;  1HQV A;  1KK7 Z;  2H61 A;  2SAS A;  4ORB B;  4PAL A;  1FF1 A;  2YGU A;  1DGU A;  3D0Y A;  3A4U B;  3IF7 A;  4YRU A;  1TTX A;  3DY9 A;  3FIA A;  2HPS A;  5DKR A;  3BUM B;  1YUU A;  2L0P A;  1IG5 A;  1B8L A;  1N0Y A;  1TUZ A;  2GV5 A;  2QDI A;  3CAB A;  3VGO A;  3TUY C;  3NSI A;  3TDI A;  4YI8 A;  1OMV A;  1A29 A; 
#chains in the Genus database with same CATH homology
 1NX0 A;  1SY9 A;  2ZRT A;  1EG4 A;  1OZS A;  2WCF A;  3FS7 A;  3IQO A;  1F55 A;  3PM8 A;  3BXK A;  4MBE A;  1K94 A;  1K9U A;  1QXP A;  3HCM A;  4GFT A;  4JQ0 D;  4PHJ A;  2NZ0 A;  4HSZ A;  2ZKM X;  1TCO B;  1XFU O;  1JWD A;  2ZRS A;  4XJK B;  2MLF C;  3SG6 A;  2LE9 B;  1Y0V H;  1PVA A;  2BL0 C;  2LUX A;  2MHH A;  1S26 D;  1AUI B;  2M1K B;  2JU0 A;  4JPZ B;  4CFR A;  1BF5 A;  1XFY O;  3AAK A;  2LMT A;  2KQ6 A;  1RRO A;  2LVI A;  4QJ3 B;  1FI5 A;  1K93 D;  4Q04 A;  4DCK A;  2DOQ A;  3PAL A;  2WOS A;  1UHJ A;  4MRY A;  2ZND A;  2AAO A;  1GJY A;  4R1E A;  3SIA A;  3SG5 A;  4MN0 A;  1QX7 A;  1UUS A;  1L2O B;  2KQY A;  2VRG A;  4YBH B;  4E68 A;  3EVR A;  1PUL A;  1IQ3 A;  3DF0 A;  2HQ8 A;  3PAT A;  2PVB A;  1PK0 D;  1B7T Y;  1QAS A;  2M97 A;  5ER4 X;  1DJZ A;  2L50 A;  1BOD A;  1OQP A;  5JOL A;  2Y1N A;  1YRT B;  3FWB A;  4BY5 A;  1XA5 A;  2LMU A;  2MRD A;  2M7N A;  1KFX L;  2OTG B;  1IH0 A;  1GGW A;  1NWD A;  2I18 A;  1YVH A;  2F3Z A;  1KFU S;  2PAS A;  3FWC A;  1CLL A;  1DVI A;  2HET A;  3CR4 X;  1CM4 A;  1SK6 D;  4PHK A;  4PE0 A;  3CWG A;  1NUB A;  2JC2 A;  3CR2 A;  1M45 A;  1KWO C;  4GGF A;  2K7C A;  1B7T Z;  1CM1 A;  4F0Z B;  1KSM A;  2KYC A;  4OV2 A;  2PSR A;  1K2H A;  1MXL C;  1RJV A;  1J1E A;  1DJI A;  2K7B A;  2Y5I A;  2K0J A;  1S5G Z;  3KPX A;  3OHM B;  4P2Y B;  4CFQ A;  2ZNE A;  4PHM A;  1FPW A;  1TNQ A;  4MLW A;  4FTG A;  2LAP A;  3I5G C;  2L98 A;  1CFC A;  1DGV A;  1CLM A;  1QS7 A;  1S6I A;  3O4Y A;  4ICB A;  1OMD A;  1B8C A;  2SCP A;  2KI4 C;  4YGB B;  1DJY A;  3JVT B;  1EG3 A;  2JQ6 A;  2JZI A;  4CLN A;  2M1U A;  3BUW B;  4C0K A;  4N1G A;  5ER5 A;  4YGA A;  3QRX A;  1YTZ C;  4FQO A;  4ORC B;  4C0J A;  1RTP 1;  1MUX A;  3VRR A;  1UUR A;  1K8U A;  2K7O A;  3PSR A;  2CT9 A;  1QTX A;  2D8N A;  5D7F A;  3NSL A;  1EXR A;  3BUO B;  1ZFS A;  2F33 A;  1SMG A;  2JT3 A;  1E8A A;  4DS7 A;  1ZAC A;  2F2O A;  1YUR A;  2NLN A;  1QIV A;  1YUT A;  2JWW A;  4GGN A;  4HRG A;  2BCA A;  2O60 A;  3EVV A;  1B4C A;  4MZK A;  1IRJ A;  3AKA A;  5PAL A;  4PDZ A;  1CKK A;  2MLE C;  1CB1 A;  4NQG A;  1SYM A;  1JC2 A;  1Y1X A;  5B8I B;  2F3Y A;  5KTY A;  1CTR A;  1S6J A;  1SCV A;  1H4B A;  1DF0 A;  4MZL A;  1DF0 B;  3I5F C;  1IJ5 A;  4QJ4 B;  1YUS A;  1LKJ A;  1LXF C;  2RGI A;  1NSH A;  2G2B A;  2LMV A;  2KBM A;  2V53 A;  2A4J A;  1SPY A;  3LLE A;  2JRF A;  2MA2 A;  2JPT A;  3SIB A;  1C07 A;  3PN7 C;  2E6W A;  3O78 A;  4OR9 B;  1FI6 A;  1BT6 A;  4P5O E;  1QIW A;  1QAT A;  1KK7 Y;  1MQ1 A;  1W7I B;  3C1V A;  3CLN A;  3RM1 A;  1WDC B;  2JUL A;  4DIR A;  1WRL A;  5HLV A;  1KQV A;  1QX5 B;  3RLZ A;  2JXL A;  3ICB A;  1SCM C;  1BOC A;  5I8N A;  1F54 A;  1NX1 A;  1LIN A;  1SL7 A;  1N65 A;  2L2E A;  3KEV A;  3CGA A;  3SG2 A;  1QV1 A;  2BBN A;  1SW8 A;  3DF0 B;  2NXQ A;  4WRI A;  1F71 A;  2CCM A;  4YGE B;  5BPJ A;  3TS5 B;  3SG7 A;  3BUN B;  5AAN A;  4C0L A;  5AXI A;  4ZCU A;  1K95 A;  1Y1A A;  1JF2 A;  1DJG A;  1LVC D;  3I5F B;  4XJK A;  2I2R E;  3NSO A;  1WDC C;  2LV7 A;  1H8B A;  2PMY A;  3WHT B;  2BL0 B;  2I7A A;  4I5K A;  1JFK A;  1XFW O;  3TUY B;  3DVJ A;  1G4Y R;  4MZJ A;  2M3W A;  1U5I A;  4GNK B;  2Q91 A;  2BKH B;  1MWN A;  1XFV O;  2EC6 C;  2KAV A;  4GBA A;  1D1O A;  1NYA A;  1TOP A;  4YI9 A;  4A4B A;  1BJF A;  1S3P A;  2L4H A;  3CZT X;  1BLQ A;  2WOR A;  3WHU B;  1S6C A;  2QPT A;  4MVF A;  1L2O C;  2M0R A;  1A75 B;  3D10 A;  1V1G A;  2L51 A;  4M2P A;  5I2L A;  2MJW B;  2KFF A;  2FOT A;  1JBA A;  2LVJ A;  2KDH A;  1PSB A;  5KSZ A;  3GOF A;  5HKW A;  1OSA A;  2COL B;  5K89 A;  1G33 A;  1RWY A;  2NCO A;  1LA0 A;  2LLS A;  1K96 A;  2G9B A;  1SNL A;  1AJ5 A;  3DVE A;  1F4Q A;  1QX2 A;  1XFX O;  4OKH A;  1CLB A;  1ZOT B;  1B47 A;  1QVI Z;  1WRZ A;  5AEQ A;  1GGZ A;  4PE1 A;  1CDP A;  1SCM B;  1IWQ A;  2K61 A;  2M49 B;  3SG3 A;  1Y1U A;  3I5H C;  1F8H A;  1BG1 A;  2Q4U A;  1M39 A;  1G8I A;  2JTT A;  2K7D A;  3TZ1 A;  2NCP A;  1EJ3 A;  3WXA A;  1ODB A;  2BCX A;  2JNF A;  3BOW A;  2GGM A;  4JWQ A;  1N2D A;  1J1D A;  1C7W A;  1KK8 B;  1OE9 B;  2CNP A;  1B9A A;  1TCF A;  3F45 A;  1KFU L;  4PE7 A;  3CTN A;  2WCE A;  1KFX S;  1QVI Y;  1UP5 A;  4AQJ A;  1DMO A;  4U8D A;  4NDD A;  4WQ2 A;  1XFZ O;  2L4I A;  4GUK A;  2ZN8 A;  1TNW A;  3LK0 A;  5D69 A;  4TNC A;  2BCB A;  2FJU B;  2LP2 A;  1LA3 A;  4WQ3 A;  1IGV A;  3AAJ A;  2HF5 A;  1MR8 A;  2LAN A;  3EVU A;  1NX2 A;  1QLK A;  2JT0 A;  3EK4 A;  2KI6 D;  3GK4 X;  3KO0 A;  5HLO A;  2FCE A;  1CMF A;  1JFJ A;  1BU3 A;  2KI4 B;  4MRX A;  4DUQ A;  1A2X A;  2O5G A;  1FW4 A;  1B8R A;  2JTZ A;  5HKY A;  2QAC A;  3VRQ A;  2WCB A;  1JSA A;  3VRN A;  2EC6 B;  2F2P A;  2ZFD A;  1KQM C;  3JTD B;  2K2F A;  3AKB A;  1IQ5 A;  4D1E A;  1DTL A;  5AFP A;  1R2U A;  1NCX A;  1AJ4 A;  1CDN A;  3CS1 A;  2BKI B;  2LNK A;  4MEW A;  1GQM A;  1A03 A;  1ZMZ A;  2KOT A;  3ZWH A;  2GGZ A;  5GQQ C;  3EK7 A;  1C7V A;  1CDM A;  2KI6 C;  3OB1 B;  3H4S E;  1WLZ A;  5G08 A;  1V1F A;  4NDB A;  1BMO A;  1XVJ A;  1NCZ A;  2AMI A;  4HRE E;  1L7Z A;  3NSK A;  2BE6 A;  2MAZ A;  3OX6 A;  1PVB A;  3WNX B;  3I5G B;  4I5J A;  2KNE A;  2BBM A;  3TDZ A;  5HKZ A;  1A4P A;  2OTG C;  5KU1 A;  4OCI A;  1YX7 A;  4PCW A;  4A4C A;  1S36 A;  4I5N B;  3TS5 C;  1SL9 A;  4DRW A;  1OZO A;  3KHE A;  1JF0 A;  5DKN A;  3SJS A;  3LK1 A;  1TNP A;  1UWO A;  2ZN9 A;  1AP4 A;  2KGR A;  1A75 A;  2CBL A;  2WC8 A;  1WY9 A;  2OS8 B;  1PRW A;  2P6B B;  2WND A;  2M7L A;  4YGC B;  1NCY A;  2JNX A;  1PAL A;  3BUX B;  1M31 A;  1SKT A;  3I5H B;  1EH2 A;  2JOJ A;  1W7J B;  1J7O A;  3GK1 A;  1SR6 B;  2LP3 A;  1K9K A;  5HYD A;  2LUC A;  4PE4 A;  1MF8 B;  4GAO A;  2K2A A;  1Y6W A;  3DVM A;  2M8U A;  3OB2 B;  3EK8 A;  1TRF A;  1JUO A;  1YVL A;  2E30 A;  3KF9 A;  1Q80 A;  2LHI A;  5FYX A;  2KAY A;  2LM5 A;  1REC A;  2LHL A;  1MHO A;  2LLT A;  2Y4Q A;  3MSE B;  1KK8 C;  4CPV A;  1RK9 A;  3JVT C;  2H61 C;  1AVS A;  2JT8 A;  4L9M A;  3O6B A;  1XO5 A;  1UHH A;  1PSR A;  1OMR A;  3NXA A;  2AUC A;  2LLU A;  2BE4 A;  1XK4 C;  2CXJ A;  1OOJ A;  4QJ5 B;  1ALW A;  1TIZ A;  4YGD B;  2ISD A;  1TNX A;  1MXE A;  3BQ3 A;  2KHN A;  4M2O A;  2EHB A;  5TNC A;  3JTD C;  2LVV A;  1VRK A;  3SG4 A;  1YR5 A;  2R2I A;  2IS9 A;  1CDL A;  2Y1M A;  1NIW A;  3PFV A;  3LCP C;  3TDU A;  4ORA B;  2MBX A;  1DT7 B;  4N5X A;  1QLS A;  4XYN A;  1K9P A;  3EKJ A;  1X02 A;  3CR5 X;  3E3R A;  1KWO B;  1IKU A;  1S5G Y;  1XK4 A;  1AHR A;  3EKH A;  4NDC A;  5IBW A;  1F4O A;  1K90 D;  1J7P A;  1FBV A;  2KFH A;  1DJX A;  5J3X A;  3VRO A;  1S1E A;  1YRU B;  5CSJ A;  3K21 A;  1SBJ A;  2KGB C;  1J7R A;  3BYA A;  2K8M B;  4ETO A;  1B1G A;  1CNP A;  1TN4 A;  3GK2 A;  1BR4 B;  2LC5 A;  1KCY A;  2JXC A;  1M63 B;  2LVK A;  1R6P A;  4ZCV A;  3PLF B;  2KBI A;  1HT9 A;  1WLM A;  5F6T A;  5AER A;  3M0W A;  4HRH A;  1U5I B;  5JJG A;  3OP0 A;  5I2O A;  1CFP A;  1QJT A;  5I2Q A;  2I94 A;  5CSF A;  2OPO A;  4AQI A;  2L5X B;  3I5I B;  3BOW B;  1CFD A;  3LL8 B;  2BEC A;  5CSI A;  1UHN A;  1CMG A;  1QV0 A;  1UHI A;  1XYD A;  2M29 A;  3A8R A;  3O2P A;  3I5I C;  2EGD A;  4OVN F;  4BY4 A;  1IJ6 A;  1SR6 C;  5DKQ A;  2PAL A;  2KAX A;  3DVK A;  1UHK A;  1DJH A;  1SRA A;  4GGF C;  4M2Q A;  3DD4 A;  1YX8 A;  2FCD A;  2TN4 A;  4AOM A;  1M46 A;  1WRK A;  4MSP A;  1BR1 B;  1SL8 A;  2LCP A;  3PN7 B;  1AK8 A;  4GPL B;  3VRP A;  4I5L B;  4N1F A;  1J55 A;  3OX5 A;  2KFG A;  1KQM B;  2OS8 C;  2F8P A;  4IL1 A;  1RFJ A;  1CFF A;  2H2K A;  2KYF A;  3HX4 A;  2PRU A;  1ALV A;  2HQW A;  1KSO A;  1F70 A;  2M9G A;  1DJW A;  1NX3 A;  4PHN A;  4USL A;  2B1U A;  1NP8 A;  2CTN A;  4UPG A;  3D0Y B;  1NPQ A;  3IQQ A;  4CID A;  5CSN A;  1ZUZ A;  3ZNI A;  1EL4 A;  1J7Q A;  2KSP A;  5CPV A;  1FF1 A;  1HQV A;  1KK7 Z;  2H61 A;  2SAS A;  4ORB B;  4PAL A;  1DGU A;  3D0Y A;  3A4U B;  3IF7 A;  4YRU A;  1TTX A;  3FIA A;  2HPS A;  5DKR A;  3BUM B;  1YUU A;  2L0P A;  1IG5 A;  1B8L A;  1N0Y A;  2GV5 A;  3VGO A;  3TUY C;  3NSI A;  3TDI A;  4YI8 A;  1OMV A;  1A29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...