2L2CA

Nmr structure of mosquito odorant binding protein bound to mop pheromone
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
DVTPRRDAEYPPPELLEALKPLHDICAKKTGVTDEAIIEFSDGKIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLRDSLPNSMHDIAMHMGKRCLYPEGENLCEKAFWLHKCWKQADPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant-binding protein
publication title 1H, 13C, 15N resonance assignments for odorant protein 1
rcsb
source organism Culex quinquefasciatus
total genus 28
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2l2cA01
3B86A 3DZTA 3BFHA 2PQLA 2QEHA 2QDIA 3R1VA 5DICA 2WC6A 3L4AA 5EL2A 3D75A 3BFAA 3D74A 3B88A 3PJIA 3D76A 3VB1A 3RZSA 2FJYA 3S0FA 1LS8A 1TWOA 3R1OA 2QEOA 2WCHA 3CZ2A 2L2CA 2WCMA 3R72A 1OOHA 3V2LA 3NHIA 2WCKA 4OZDA 3FE8A 3D77A 4F7FA 4INWA 3S0DA 1P28A 1DQEA 4FQTA 1C3ZA 2ERBA 3CABA 3NHTA 3K1EA 2QEBA 3B7AA 3CYZA 3DY9A 3L4LA 2WC5A 3CZ1A 3R1PA 4INXA 2WCLA 3S0AA 1OOGA 1ORGA 3D73A 1OW4A 2JPOA 3DXLA 1TUJA 3L47A 1OOFA 3BJHA 3S0GA 1C3YA 1QWVA 3NGVA 3FE9A 3S0BA 4JD9A 2QEVA 1T14A 4PT1A 1GM0A 2GTEA 2WCJA 3N7HA 3D78A 3CZ0A 2KPHA 3B87A 3QMEA 3BFBA 3B6XA 2P71A 2H8VA 2P70A 1OOIX 1XFRA 3DYEA 3OGNA 3S0EA 3Q8IA 3CDNA 3FE6A
chains in the Genus database with same CATH superfamily
3I5IC 1YVHA 1XFZO 3DVMA 3NXAA 4MZKA 1BMOA 1L2OC 1NUBA 5IBWA 1QXPA 2QEHA 4M2OA 3SIAA 1TIZA 2WC6A 4F0ZB 5D69A 2F33A 4DIRA 1JSAA 5EL2A 3D74A 2EGDA 2NCOA 3BUMB 1BU3A 3LK1A 3VRNA 4YI9A 3PJIA 1KSMA 2PASA 4MSPA 4ZCVA 1B1GA 1BODA 3PLFB 2GV5A 1RFJA 1FF1A 3NSOA 4ORAB 3BUNB 3M0WA 2CTNA 3S0FA 1LS8A 2JOJA 1EH2A 2QEOA 3KPXA 1IRJA 3EVRA 1SPYA 5BPJA 3OX5A 1OMDA 1OQPA 4DCKA 3BOWB 3OB1B 2K60A 1IQ3A 4CFRA 5AANA 4INWA 1DQEA 1SNLA 3SIBA 1DT7B 1J1DA 1DF0A 4FQTA 4NQGA 2LM5A 2KQ6A 4E68A 4UPGA 1J1EA 1IKUA 4YGAA 1HQVA 3B7AA 3CYZA 3DY9A 1QJTA 2E30A 1ALWA 4AQJA 4AOMA 4DUQA 1CDLA 2BCXA 3BUWB 2I18A 4MLWA 2WCLA 3OX6A 2B1UA 3CR5X 3FIAA 2OTGC 4DS7A 1V1FA 3CLNA 1FI6A 4HRGA 5DKRA 2PRUA 3D73A 4YBHB 3BUOB 3EK4A 5CSIA 2SCPA 5HLOA 1LINA 1QX5B 2FJUB 2CXJA 5JOLA 2JZIA 4BY4A 1CDMA 5FI2A 1Q80A 1NYAA 2L98A 2LLUA 2LP2A 2NXQA 4M2PA 1KWOC 3EKJA 4U8DA 1DMOA 3JVTB 1K90D 2I94A 4OV2A 1K9PA 2LVVA 1IQ5A 2Y1NA 3FWBA 3OB2B 1KCYA 3BJHA 1JFKA 1NP8A 1FBVA 1B4CA 1Y1AA 4D1EA 1PSBA 1J7RA 1WLMA 2JWWA 5HYDA 1KQMB 1QWVA 1RTP1 2K7DA 3NGVA 2L5YA 1MXEA 4XJKA 3EVVA 2LVIA 1QLKA 3PSRA 2WCFA 1FI5A 2WNDA 4I5NB 3TUYC 3E3RA 4PT1A 1X02A 2CCMA 1A75A 4GBAA 1S1EA 1SMGA 2L50A 3DVEA 2K61A 3N7HA 3LK0A 5AEQA 2V53A 1UHHA 1YR5A 3OHMB 4GGFC 1QIVA 4GGFA 2F3YA 1PALA 1SY9A 3FS7A 5D7FA 2BE6A 4JWQA 2H61C 2H61A 2KAXA 1S26D 3CZ0A 1G33A 4OKHA 2BL0B 1EG4A 1OMVA 3QMEA 1K8UA 3NSLA 2L0PA 3BFBA 3VROA 1QLSA 1K2HA 2KYFA 3CZTX 5ER4X 1LVCD 1YUTA 1KK8C 5DKNA 1JWDA 2P70A 4R1EA 1OOIX 1B9AA 1KFXL 1TUZA 1K9UA 1SBJA 1WRKA 3O4XA 1SCVA 1XVJA 3IF7A 2KHNA 2PVBA 3Q8IA 5CSFA 2LP3A 1WRLA 3IQQA 1TNQA 4C0KA 1ZACA 3FE6A 1S6JA 2K7OA 4AQIA 4HRHA 1CLLA 1NSHA 1PVBA 1PK0D 1JUOA 3BQ3A 2KFFA 1SW8A 1Z4HA 2PQLA 4C0JA 5DICA 4P2YB 3RLZA 4DRWA 4YGBB 3D75A 1S6CA 3I5IB 2NLNA 2NZ0A 2MAZA 1OMRA 2AMIA 1LA0A 3DVJA 1L2OB 3D76A 3KEVA 3DD4A 2M3WA 1CLMA 5CSNA 3VB1A 1AVSA 2LVKA 3O6BA 2PSRA 5AXIA 1W7JB 1KFUS 2LMVA 1LA3A 1V1GA 3R72A 2F3ZA 2K7CA 1L7ZA 3V2LA 2MRDA 3NHIA 5D3OA 4OR9B 1K9KA 4WQ3A 2KBMA 2WCKA 3CWGA 3HX4A 1WLZA 1DJGA 4F7FA 3RM1A 2KAYA 3S0DA 1NPQA 1J7OA 1MWNA 2LLSA 2VRGA 3SG3A 2M49B 3SG6A 4A4BA 1PULA 1C3ZA 3PM2A 1B8LA 3SS3A 1U5IA 3CTNA 2M97A 1IGVA 1JFJA 2MJWB 3WHUB 1SYMA 3L4LA 1M39A 1DELA 5KSZA 4NDCA 3KHEA 3R1PA 1TNXA 1DF0B 1QV0A 3EVUA 1ORGA 1KQVA 1OSAA 1A29A 2OPOA 4YRUA 2KI6D 2Q91A 2KI4C 2F2PA 5JJGA 2R2IA 2K7BA 4N1FA 4KYNA 2OTGB 1OW4A 3DXLA 1ZUZA 3SG2A 1YUSA 1DGVA 5I94A 2CNPA 2M8UA 1NIWA 1QX2A 1BLQA 3L47A 2FCDA 1DJXA 1OOFA 1G4YR 2HPSA 2JULA 2JPTA 1QV1A 4GAOA 2O5GA 5GQQC 1IG5A 2SASA 2JTTA 1OOJA 1SKTA 1UHNA 2BNXA 1R6PA 2OS8C 2HETA 5I2OA 1BOCA 2WC8A 1DJIA 1MXLC 2AUCA 5B8IB 1KWOB 2KAVA 3S0BA 4JD9A 2YGUA 3VRPA 4MN0A 1XFUO 2ZN8A 5G08A 1GM0A 3LL8B 2QPTA 3A8RA 2WCJA 1TCFA 3PALA 1YRTB 3PN7C 2WOSA 4XJKB 3WNXB 5F6TA 1LKJA 3AAJA 1IJ6A 1JF2A 1C7WA 1CFDA 2ZFDA 3GK1A 3TDZA 3TUYB 5HL1A 1A75B 4BY5A 1UURA 1CM1A 1S6IA 1RECA 3IQOA 1NWDA 5CPVA 1YX7A 1CMFA 1S5GY 2JU0A 2ZKMX 1OZSA 1BR1B 3QRXA 2K2FA 1OE9B 3WXAA 1XFRA 5J3XA 1JF0A 2KLDA 3ICBA 1ZOTB 4N1GA 5ER5A 3S0EA 1W9ZA 1GQMA 3AKAA 1SSEB 4CPVA 2KNEA 1KK8B 3B86A 1XO5A 3BFHA 2LAPA 1UUSA 1PSRA 4GNKB 1QVIY 1CTRA 2QDIA 1J55A 3TDUA 3TS5C 3CR2A 4I5KA 1K96A 4XYNA 4WRIA 1SR6C 2Y5IA 3L4AA 1AHRA 2BECA 1W7IB 3I5HB 2LLTA 1NX3A 3SS5A 4OCIA 3EKHA 5FI6A 1WDCC 1M63B 4OVNF 3RZSA 2LANA 4P5OE 3DVKA 1DJYA 2LMUA 1YVLA 2FJYA 1NCZA 1SK6D 1BF5A 1TWOA 4ETOA 3BUXB 1N0YA 1UHKA 2JT8A 2WCHA 1S3PA 2FOTA 2L2CA 2WCMA 3F45A 3NSKA 2LNKA 5DKQA 4GPLB 1D1OA 1BR4B 1OOHA 1FPWA 2I7AA 4QJ5B 3AKBA 1AJ4A 3O78A 4OZDA 3FE8A 3I5HC 2M29A 2L4IA 2MBXA 2KYCA 2ZNDA 2RGIA 1F54A 2NCPA 2MLFC 4PE7A 4PHMA 1S36A 2L2EA 3GOFA 2M7LA 4A4CA 4PDZA 1F70A 1ZFSA 1UHIA 5KU1A 1CFCA 1CLBA 4HREE 1A2XA 3D0YA 1XFWO 1MF8B 3DF0A 1OZOA 1DJZA 2PALA 1H8BA 3NHTA 1GGWA 1R2UA 3K1EA 4JPZB 2HQ8A 4CIDA 1KK7Y 4ZCUA 4GGNA 2L4HA 1SCMC 1DTLA 1YX8A 1XYDA 3I5FC 4INXA 3H4SE 2K0JA 3K21A 1B7TY 4CLNA 2LHIA 1OOGA 1SL9A 1TNPA 1U5IB 1CM4A 2H2KA 1TRFA 1B47A 2CT9A 1YTZC 2L51A 5HKYA 2M1UA 1TNWA 1C7VA 1XK4C 1XK4A 1QTXA 2KI6C 1K93D 4YGEB 3EK7A 3EK8A 1NX0A 5TNCA 2BE4A 2JPOA 3OBVA 1TUJA 3ZNIA 4ICBA 4L9MA 2QACA 4USLA 2PMYA 1NX1A 1A03A 3UO9A 1M46A 2KI4B 2WCBA 3VRRA 2K8MB 2AAOA 4MRXA 3KO0A 1C3YA 2MLEC 1BG1A 2LV7A 1MUXA 2LMTA 2BAPA 1DC1A 3JTDC 2KFGA 3SG5A 2GTEA 3NSIA 3TZ1A 2OS8B 4ORCB 3C1VA 2EC6B 1Y1UA 2BBMA 2M0RA 1C07A 4MVFA 1AJ5A 1CNPA 3VGOA 3EG5B 5PALA 4N5XA 1QASA 2JC2A 2MA2A 4JKTA 3MSEB 3I5GC 2BCAA 1F8HA 2ZRSA 3PN7B 3B87A 1M31A 2BBNA 3B6XA 2LHLA 1LXFC 2LVJA 4Q04A 1KFXS 3D10A 3PM8A 2LC5A 4YGDB 3WHTB 1NCYA 2EC6C 4FTGA 1RK9A 1S5GZ 4IL1A 4QJ3B 5HKWA 1M45A 4M2QA 2E6WA 3BYAA 5FI7A 2L5XB 4PE4A 3SJSA 1AP4A 1K95A 3TDIA 1WRZA 2Y4QA 2ZRTA 3A4UB 4MEWA 4MRYA 2F2OA 1Y0VH 2KOTA 4I5LB 4PE0A 3DZTA 2BKHB 1VRKA 1QIWA 1SL8A 1F4QA 3HCMA 1ALVA 2JT0A 4PHJA 3R1VA 1RJVA 2I2RE 1CDNA 1PRWA 1TOPA 2M1KB 1G8IA 1CMGA 1XFXO 5KTYA 1CFFA 3BFAA 5I8NA 1IH0A 1QVIZ 1F4OA 3B88A 1MHOA 3UNWA 5K89A 3BOWA 3LCPC 3TS5B 1EG3A 2ZNEA 1SR6B 2LCPA 1QX7A 3BXKA 1N2DA 2DOQA 1EXRA 1KSOA 3CZ2A 3R1OA 1QATA 1AUIB 1WDCB 2FCEA 1KFUL 2TN4A 5I2LA 2HF5A 1AK8A 1PVAA 2GGZA 3D77A 1DJHA 1MQ1A 2KSPA 2O60A 1QS7A 1P28A 1K94A 1E8AA 2KQYA 2LUXA 1YUUA 4MZLA 1FW4A 4HSZA 4I5JA 2ERBA 1UWOA 3SG4A 4QJ4B 2KGRA 3CABA 3O2PA 4JQ0D 5HLVA 1J7PA 2QEBA 1DVIA 1XA5A 3LLEA 2G9BA 1H4BA 1DEKA 4CFQA 1EL4A 2MHHA 2WC5A 1UP5A 1DJWA 3CZ1A 1Y1XA 3CS1A 3IVTA 1IIOA 1ODBA 1CB1A 3D0YB 3DF0B 4YI8A 3GK4X 5AERA 3S0AA 1KK7Z 1ZMZA 3CR4X 1SRAA 5I2QA 1J7QA 4PE1A 1EJ3A 4YGCB 1CFPA 1DGUA 2JTZA 2PYQA 1N65A 3ZWHA 1SCMB 3JVTC 1B7TZ 3I5FB 2JRFA 1XFYO 2Q4UA 1IJ5A 4NDBA 3SS4A 2CBLA 4FQOA 1B8CA 1UHJA 3O4YA 1KQMC 2D8NA 2Y1MA 5AFPA 1JBAA 2KDHA 5CSJA 4PCWA 1MR8A 3PFVA 4IJ7A 1RWYA 3S0GA 3KF9A 1CDPA 1TTXA 2JNFA 3AAKA 1GGZA 1NX2A 1WY9A 2A4JA 3FE9A 1BJFA 2ISDA 2LE9B 2QEVA 4GUKA 1GJYA 2BCBA 1T14A 2G2BA 4ORBB 3VRQA 1XFVO 4NDDA 4PALA 4MZJA 1Z2CB 1HT9A 2K2AA 2M9GA 2HQWA 2F8PA 2WORA 2BL0C 4MBEA 1BT6A 3PATA 4TNCA 4C0LA 3JTDB 5FYXA 2GGMA 4PHKA 4WQ2A 1F71A 4PHNA 1TN4A 2LUCA 2P6BB 1A4PA 2KFHA 1YRUB 2EHBA 3D78A 1B8RA 2IS9A 2BKIB 2KPHA 3GK2A 1NCXA 1RROA 2JXCA 2COLB 2JXLA 3OP0A 3CGAA 1YURA 2JNXA 2KBIA 2P71A 2H8VA 2M7NA 1SL7A 2KGBC 1TCOB 2JQ6A 3I5GB 3FWCA 2JT3A 3DYEA 2KLEA 3OGNA 1JC2A 3SG7A 4GFTA 2ZN9A 5HKZA 1CKKA 1Y6WA 1F55A 2WCEA 1IWQA 3CDNA
chains in the Genus database with same CATH topology
3B86A 3DZTA 3BFHA 2PQLA 2QEHA 2QDIA 3R1VA 5DICA 2WC6A 3L4AA 5EL2A 3D75A 3BFAA 3D74A 3B88A 3PJIA 3D76A 3VB1A 3RZSA 2FJYA 3S0FA 1LS8A 1TWOA 3R1OA 2QEOA 2WCHA 3CZ2A 2L2CA 2WCMA 3R72A 1OOHA 3V2LA 3NHIA 2WCKA 4OZDA 3FE8A 3D77A 4F7FA 4INWA 3S0DA 1P28A 1DQEA 4FQTA 1C3ZA 2ERBA 3CABA 3NHTA 3K1EA 2QEBA 3B7AA 3CYZA 3DY9A 3L4LA 2WC5A 3CZ1A 3R1PA 4INXA 2WCLA 3S0AA 1OOGA 1ORGA 3D73A 1OW4A 2JPOA 3DXLA 1TUJA 3L47A 1OOFA 3BJHA 3S0GA 1C3YA 1QWVA 3NGVA 3FE9A 3S0BA 4JD9A 2QEVA 1T14A 4PT1A 1GM0A 2GTEA 2WCJA 3N7HA 3D78A 3CZ0A 2KPHA 3B87A 3QMEA 3BFBA 3B6XA 2P71A 2H8VA 2P70A 1OOIX 1XFRA 3DYEA 3OGNA 3S0EA 3Q8IA 3CDNA 3FE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B86 A;  3DZT A;  3BFH A;  2PQL A;  2QEH A;  2QDI A;  3R1V A;  5DIC A;  2WC6 A;  3L4A A;  5EL2 A;  3D75 A;  3BFA A;  3D74 A;  3B88 A;  3PJI A;  3D76 A;  3VB1 A;  3RZS A;  2FJY A;  3S0F A;  1LS8 A;  1TWO A;  3R1O A;  2QEO A;  2WCH A;  3CZ2 A;  2L2C A;  2WCM A;  3R72 A;  1OOH A;  3V2L A;  3NHI A;  2WCK A;  4OZD A;  3FE8 A;  3D77 A;  4F7F A;  4INW A;  3S0D A;  1P28 A;  1DQE A;  4FQT A;  1C3Z A;  2ERB A;  3CAB A;  3NHT A;  3K1E A;  2QEB A;  3B7A A;  3CYZ A;  3DY9 A;  3L4L A;  2WC5 A;  3CZ1 A;  3R1P A;  4INX A;  2WCL A;  3S0A A;  1OOG A;  1ORG A;  3D73 A;  1OW4 A;  2JPO A;  3DXL A;  1TUJ A;  3L47 A;  1OOF A;  3BJH A;  3S0G A;  1C3Y A;  1QWV A;  3NGV A;  3FE9 A;  3S0B A;  4JD9 A;  2QEV A;  1T14 A;  4PT1 A;  1GM0 A;  2GTE A;  2WCJ A;  3N7H A;  3D78 A;  3CZ0 A;  2KPH A;  3B87 A;  3QME A;  3BFB A;  3B6X A;  2P71 A;  2H8V A;  2P70 A;  1OOI X;  1XFR A;  3DYE A;  3OGN A;  3S0E A;  3Q8I A;  3CDN A;  3FE6 A; 
#chains in the Genus database with same CATH topology
 3I5I C;  1YVH A;  1XFZ O;  3DVM A;  3NXA A;  4MZK A;  1BMO A;  1L2O C;  1NUB A;  5IBW A;  1QXP A;  2QEH A;  4M2O A;  3SIA A;  1TIZ A;  2WC6 A;  4F0Z B;  5D69 A;  2F33 A;  4DIR A;  1JSA A;  5EL2 A;  3D74 A;  2EGD A;  2NCO A;  3BUM B;  1BU3 A;  3LK1 A;  3VRN A;  4YI9 A;  3PJI A;  1KSM A;  2PAS A;  4MSP A;  4ZCV A;  1B1G A;  1BOD A;  3PLF B;  2GV5 A;  1RFJ A;  1FF1 A;  3NSO A;  4ORA B;  3BUN B;  3M0W A;  2CTN A;  3S0F A;  1LS8 A;  2JOJ A;  1EH2 A;  2QEO A;  3KPX A;  1IRJ A;  3EVR A;  1SPY A;  5BPJ A;  3OX5 A;  1OMD A;  1OQP A;  4DCK A;  3BOW B;  3OB1 B;  2K60 A;  1IQ3 A;  4CFR A;  5AAN A;  4INW A;  1DQE A;  1SNL A;  3SIB A;  1DT7 B;  1J1D A;  1DF0 A;  4FQT A;  4NQG A;  2LM5 A;  2KQ6 A;  4E68 A;  4UPG A;  1J1E A;  1IKU A;  4YGA A;  1HQV A;  3B7A A;  3CYZ A;  3DY9 A;  1QJT A;  2E30 A;  1ALW A;  4AQJ A;  4AOM A;  4DUQ A;  1CDL A;  2BCX A;  3BUW B;  2I18 A;  4MLW A;  2WCL A;  3OX6 A;  2B1U A;  3CR5 X;  3FIA A;  2OTG C;  4DS7 A;  1V1F A;  3CLN A;  1FI6 A;  4HRG A;  5DKR A;  2PRU A;  3D73 A;  4YBH B;  3BUO B;  3EK4 A;  5CSI A;  2SCP A;  5HLO A;  1LIN A;  1QX5 B;  2FJU B;  2CXJ A;  5JOL A;  2JZI A;  4BY4 A;  1CDM A;  5FI2 A;  1Q80 A;  1NYA A;  2L98 A;  2LLU A;  2LP2 A;  2NXQ A;  4M2P A;  1KWO C;  3EKJ A;  4U8D A;  1DMO A;  3JVT B;  1K90 D;  2I94 A;  4OV2 A;  1K9P A;  2LVV A;  1IQ5 A;  2Y1N A;  3FWB A;  3OB2 B;  1KCY A;  3BJH A;  1JFK A;  1NP8 A;  1FBV A;  1B4C A;  1Y1A A;  4D1E A;  1PSB A;  1J7R A;  1WLM A;  2JWW A;  5HYD A;  1KQM B;  1QWV A;  1RTP 1;  2K7D A;  3NGV A;  2L5Y A;  1MXE A;  4XJK A;  3EVV A;  2LVI A;  1QLK A;  3PSR A;  2WCF A;  1FI5 A;  2WND A;  4I5N B;  3TUY C;  3E3R A;  4PT1 A;  1X02 A;  2CCM A;  1A75 A;  4GBA A;  1S1E A;  1SMG A;  2L50 A;  3DVE A;  2K61 A;  3N7H A;  3LK0 A;  5AEQ A;  2V53 A;  1UHH A;  1YR5 A;  3OHM B;  4GGF C;  1QIV A;  4GGF A;  2F3Y A;  1PAL A;  1SY9 A;  3FS7 A;  5D7F A;  2BE6 A;  4JWQ A;  2H61 C;  2H61 A;  2KAX A;  1S26 D;  3CZ0 A;  1G33 A;  4OKH A;  2BL0 B;  1EG4 A;  1OMV A;  3QME A;  1K8U A;  3NSL A;  2L0P A;  3BFB A;  3VRO A;  1QLS A;  1K2H A;  2KYF A;  3CZT X;  5ER4 X;  1LVC D;  1YUT A;  1KK8 C;  5DKN A;  1JWD A;  2P70 A;  4R1E A;  1OOI X;  1B9A A;  1KFX L;  1TUZ A;  1K9U A;  1SBJ A;  1WRK A;  3O4X A;  1SCV A;  1XVJ A;  3IF7 A;  2KHN A;  2PVB A;  3Q8I A;  5CSF A;  2LP3 A;  1WRL A;  3IQQ A;  1TNQ A;  4C0K A;  1ZAC A;  3FE6 A;  1S6J A;  2K7O A;  4AQI A;  4HRH A;  1CLL A;  1NSH A;  1PVB A;  1PK0 D;  1JUO A;  3BQ3 A;  2KFF A;  1SW8 A;  1Z4H A;  2PQL A;  4C0J A;  5DIC A;  4P2Y B;  3RLZ A;  4DRW A;  4YGB B;  3D75 A;  1S6C A;  3I5I B;  2NLN A;  2NZ0 A;  2MAZ A;  1OMR A;  2AMI A;  1LA0 A;  3DVJ A;  1L2O B;  3D76 A;  3KEV A;  3DD4 A;  2M3W A;  1CLM A;  5CSN A;  3VB1 A;  1AVS A;  2LVK A;  3O6B A;  2PSR A;  5AXI A;  1W7J B;  1KFU S;  2LMV A;  1LA3 A;  1V1G A;  3R72 A;  2F3Z A;  2K7C A;  1L7Z A;  3V2L A;  2MRD A;  3NHI A;  5D3O A;  4OR9 B;  1K9K A;  4WQ3 A;  2KBM A;  2WCK A;  3CWG A;  3HX4 A;  1WLZ A;  1DJG A;  4F7F A;  3RM1 A;  2KAY A;  3S0D A;  1NPQ A;  1J7O A;  1MWN A;  2LLS A;  2VRG A;  3SG3 A;  2M49 B;  3SG6 A;  4A4B A;  1PUL A;  1C3Z A;  3PM2 A;  1B8L A;  3SS3 A;  1U5I A;  3CTN A;  2M97 A;  1IGV A;  1JFJ A;  2MJW B;  3WHU B;  1SYM A;  3L4L A;  1M39 A;  1DEL A;  5KSZ A;  4NDC A;  3KHE A;  3R1P A;  1TNX A;  1DF0 B;  1QV0 A;  3EVU A;  1ORG A;  1KQV A;  1OSA A;  1A29 A;  2OPO A;  4YRU A;  2KI6 D;  2Q91 A;  2KI4 C;  2F2P A;  5JJG A;  2R2I A;  2K7B A;  4N1F A;  4KYN A;  2OTG B;  1OW4 A;  3DXL A;  1ZUZ A;  3SG2 A;  1YUS A;  1DGV A;  5I94 A;  2CNP A;  2M8U A;  1NIW A;  1QX2 A;  1BLQ A;  3L47 A;  2FCD A;  1DJX A;  1OOF A;  1G4Y R;  2HPS A;  2JUL A;  2JPT A;  1QV1 A;  4GAO A;  2O5G A;  5GQQ C;  1IG5 A;  2SAS A;  2JTT A;  1OOJ A;  1SKT A;  1UHN A;  2BNX A;  1R6P A;  2OS8 C;  2HET A;  5I2O A;  1BOC A;  2WC8 A;  1DJI A;  1MXL C;  2AUC A;  5B8I B;  1KWO B;  2KAV A;  3S0B A;  4JD9 A;  2YGU A;  3VRP A;  4MN0 A;  1XFU O;  2ZN8 A;  5G08 A;  1GM0 A;  3LL8 B;  2QPT A;  3A8R A;  2WCJ A;  1TCF A;  3PAL A;  1YRT B;  3PN7 C;  2WOS A;  4XJK B;  3WNX B;  5F6T A;  1LKJ A;  3AAJ A;  1IJ6 A;  1JF2 A;  1C7W A;  1CFD A;  2ZFD A;  3GK1 A;  3TDZ A;  3TUY B;  5HL1 A;  1A75 B;  4BY5 A;  1UUR A;  1CM1 A;  1S6I A;  1REC A;  3IQO A;  1NWD A;  5CPV A;  1YX7 A;  1CMF A;  1S5G Y;  2JU0 A;  2ZKM X;  1OZS A;  1BR1 B;  3QRX A;  2K2F A;  1OE9 B;  3WXA A;  1XFR A;  5J3X A;  1JF0 A;  2KLD A;  3ICB A;  1ZOT B;  4N1G A;  5ER5 A;  3S0E A;  1W9Z A;  1GQM A;  3AKA A;  1SSE B;  4CPV A;  2KNE A;  1KK8 B;  3B86 A;  1XO5 A;  3BFH A;  2LAP A;  1UUS A;  1PSR A;  4GNK B;  1QVI Y;  1CTR A;  2QDI A;  1J55 A;  3TDU A;  3TS5 C;  3CR2 A;  4I5K A;  1K96 A;  4XYN A;  4WRI A;  1SR6 C;  2Y5I A;  3L4A A;  1AHR A;  2BEC A;  1W7I B;  3I5H B;  2LLT A;  1NX3 A;  3SS5 A;  4OCI A;  3EKH A;  5FI6 A;  1WDC C;  1M63 B;  4OVN F;  3RZS A;  2LAN A;  4P5O E;  3DVK A;  1DJY A;  2LMU A;  1YVL A;  2FJY A;  1NCZ A;  1SK6 D;  1BF5 A;  1TWO A;  4ETO A;  3BUX B;  1N0Y A;  1UHK A;  2JT8 A;  2WCH A;  1S3P A;  2FOT A;  2L2C A;  2WCM A;  3F45 A;  3NSK A;  2LNK A;  5DKQ A;  4GPL B;  1D1O A;  1BR4 B;  1OOH A;  1FPW A;  2I7A A;  4QJ5 B;  3AKB A;  1AJ4 A;  3O78 A;  4OZD A;  3FE8 A;  3I5H C;  2M29 A;  2L4I A;  2MBX A;  2KYC A;  2ZND A;  2RGI A;  1F54 A;  2NCP A;  2MLF C;  4PE7 A;  4PHM A;  1S36 A;  2L2E A;  3GOF A;  2M7L A;  4A4C A;  4PDZ A;  1F70 A;  1ZFS A;  1UHI A;  5KU1 A;  1CFC A;  1CLB A;  4HRE E;  1A2X A;  3D0Y A;  1XFW O;  1MF8 B;  3DF0 A;  1OZO A;  1DJZ A;  2PAL A;  1H8B A;  3NHT A;  1GGW A;  1R2U A;  3K1E A;  4JPZ B;  2HQ8 A;  4CID A;  1KK7 Y;  4ZCU A;  4GGN A;  2L4H A;  1SCM C;  1DTL A;  1YX8 A;  1XYD A;  3I5F C;  4INX A;  3H4S E;  2K0J A;  3K21 A;  1B7T Y;  4CLN A;  2LHI A;  1OOG A;  1SL9 A;  1TNP A;  1U5I B;  1CM4 A;  2H2K A;  1TRF A;  1B47 A;  2CT9 A;  1YTZ C;  2L51 A;  5HKY A;  2M1U A;  1TNW A;  1C7V A;  1XK4 C;  1XK4 A;  1QTX A;  2KI6 C;  1K93 D;  4YGE B;  3EK7 A;  3EK8 A;  1NX0 A;  5TNC A;  2BE4 A;  2JPO A;  3OBV A;  1TUJ A;  3ZNI A;  4ICB A;  4L9M A;  2QAC A;  4USL A;  2PMY A;  1NX1 A;  1A03 A;  3UO9 A;  1M46 A;  2KI4 B;  2WCB A;  3VRR A;  2K8M B;  2AAO A;  4MRX A;  3KO0 A;  1C3Y A;  2MLE C;  1BG1 A;  2LV7 A;  1MUX A;  2LMT A;  2BAP A;  1DC1 A;  3JTD C;  2KFG A;  3SG5 A;  2GTE A;  3NSI A;  3TZ1 A;  2OS8 B;  4ORC B;  3C1V A;  2EC6 B;  1Y1U A;  2BBM A;  2M0R A;  1C07 A;  4MVF A;  1AJ5 A;  1CNP A;  3VGO A;  3EG5 B;  5PAL A;  4N5X A;  1QAS A;  2JC2 A;  2MA2 A;  4JKT A;  3MSE B;  3I5G C;  2BCA A;  1F8H A;  2ZRS A;  3PN7 B;  3B87 A;  1M31 A;  2BBN A;  3B6X A;  2LHL A;  1LXF C;  2LVJ A;  4Q04 A;  1KFX S;  3D10 A;  3PM8 A;  2LC5 A;  4YGD B;  3WHT B;  1NCY A;  2EC6 C;  4FTG A;  1RK9 A;  1S5G Z;  4IL1 A;  4QJ3 B;  5HKW A;  1M45 A;  4M2Q A;  2E6W A;  3BYA A;  5FI7 A;  2L5X B;  4PE4 A;  3SJS A;  1AP4 A;  1K95 A;  3TDI A;  1WRZ A;  2Y4Q A;  2ZRT A;  3A4U B;  4MEW A;  4MRY A;  2F2O A;  1Y0V H;  2KOT A;  4I5L B;  4PE0 A;  3DZT A;  2BKH B;  1VRK A;  1QIW A;  1SL8 A;  1F4Q A;  3HCM A;  1ALV A;  2JT0 A;  4PHJ A;  3R1V A;  1RJV A;  2I2R E;  1CDN A;  1PRW A;  1TOP A;  2M1K B;  1G8I A;  1CMG A;  1XFX O;  5KTY A;  1CFF A;  3BFA A;  5I8N A;  1IH0 A;  1QVI Z;  1F4O A;  3B88 A;  1MHO A;  3UNW A;  5K89 A;  3BOW A;  3LCP C;  3TS5 B;  1EG3 A;  2ZNE A;  1SR6 B;  2LCP A;  1QX7 A;  3BXK A;  1N2D A;  2DOQ A;  1EXR A;  1KSO A;  3CZ2 A;  3R1O A;  1QAT A;  1AUI B;  1WDC B;  2FCE A;  1KFU L;  2TN4 A;  5I2L A;  2HF5 A;  1AK8 A;  1PVA A;  2GGZ A;  3D77 A;  1DJH A;  1MQ1 A;  2KSP A;  2O60 A;  1QS7 A;  1P28 A;  1K94 A;  1E8A A;  2KQY A;  2LUX A;  1YUU A;  4MZL A;  1FW4 A;  4HSZ A;  4I5J A;  2ERB A;  1UWO A;  3SG4 A;  4QJ4 B;  2KGR A;  3CAB A;  3O2P A;  4JQ0 D;  5HLV A;  1J7P A;  2QEB A;  1DVI A;  1XA5 A;  3LLE A;  2G9B A;  1H4B A;  1DEK A;  4CFQ A;  1EL4 A;  2MHH A;  2WC5 A;  1UP5 A;  1DJW A;  3CZ1 A;  1Y1X A;  3CS1 A;  3IVT A;  1IIO A;  1ODB A;  1CB1 A;  3D0Y B;  3DF0 B;  4YI8 A;  3GK4 X;  5AER A;  3S0A A;  1KK7 Z;  1ZMZ A;  3CR4 X;  1SRA A;  5I2Q A;  1J7Q A;  4PE1 A;  1EJ3 A;  4YGC B;  1CFP A;  1DGU A;  2JTZ A;  2PYQ A;  1N65 A;  3ZWH A;  1SCM B;  3JVT C;  1B7T Z;  3I5F B;  2JRF A;  1XFY O;  2Q4U A;  1IJ5 A;  4NDB A;  3SS4 A;  2CBL A;  4FQO A;  1B8C A;  1UHJ A;  3O4Y A;  1KQM C;  2D8N A;  2Y1M A;  5AFP A;  1JBA A;  2KDH A;  5CSJ A;  4PCW A;  1MR8 A;  3PFV A;  4IJ7 A;  1RWY A;  3S0G A;  3KF9 A;  1CDP A;  1TTX A;  2JNF A;  3AAK A;  1GGZ A;  1NX2 A;  1WY9 A;  2A4J A;  3FE9 A;  1BJF A;  2ISD A;  2LE9 B;  2QEV A;  4GUK A;  1GJY A;  2BCB A;  1T14 A;  2G2B A;  4ORB B;  3VRQ A;  1XFV O;  4NDD A;  4PAL A;  4MZJ A;  1Z2C B;  1HT9 A;  2K2A A;  2M9G A;  2HQW A;  2F8P A;  2WOR A;  2BL0 C;  4MBE A;  1BT6 A;  3PAT A;  4TNC A;  4C0L A;  3JTD B;  5FYX A;  2GGM A;  4PHK A;  4WQ2 A;  1F71 A;  4PHN A;  1TN4 A;  2LUC A;  2P6B B;  1A4P A;  2KFH A;  1YRU B;  2EHB A;  3D78 A;  1B8R A;  2IS9 A;  2BKI B;  2KPH A;  3GK2 A;  1NCX A;  1RRO A;  2JXC A;  2COL B;  2JXL A;  3OP0 A;  3CGA A;  1YUR A;  2JNX A;  2KBI A;  2P71 A;  2H8V A;  2M7N A;  1SL7 A;  2KGB C;  1TCO B;  2JQ6 A;  3I5G B;  3FWC A;  2JT3 A;  3DYE A;  2KLE A;  3OGN A;  1JC2 A;  3SG7 A;  4GFT A;  2ZN9 A;  5HKZ A;  1CKK A;  1Y6W A;  1F55 A;  2WCE A;  1IWQ A;  3CDN A; 
#chains in the Genus database with same CATH homology
 3B86 A;  3DZT A;  3BFH A;  2PQL A;  2QEH A;  2QDI A;  3R1V A;  5DIC A;  2WC6 A;  3L4A A;  5EL2 A;  3D75 A;  3BFA A;  3D74 A;  3B88 A;  3PJI A;  3D76 A;  3VB1 A;  3RZS A;  2FJY A;  3S0F A;  1LS8 A;  1TWO A;  3R1O A;  2QEO A;  2WCH A;  3CZ2 A;  2L2C A;  2WCM A;  3R72 A;  1OOH A;  3V2L A;  3NHI A;  2WCK A;  4OZD A;  3FE8 A;  3D77 A;  4F7F A;  4INW A;  3S0D A;  1P28 A;  1DQE A;  4FQT A;  1C3Z A;  2ERB A;  3CAB A;  3NHT A;  3K1E A;  2QEB A;  3B7A A;  3CYZ A;  3DY9 A;  3L4L A;  2WC5 A;  3CZ1 A;  3R1P A;  4INX A;  2WCL A;  3S0A A;  1OOG A;  1ORG A;  3D73 A;  1OW4 A;  2JPO A;  3DXL A;  1TUJ A;  3L47 A;  1OOF A;  3BJH A;  3S0G A;  1C3Y A;  1QWV A;  3NGV A;  3FE9 A;  3S0B A;  4JD9 A;  2QEV A;  1T14 A;  4PT1 A;  1GM0 A;  2GTE A;  2WCJ A;  3N7H A;  3D78 A;  3CZ0 A;  2KPH A;  3B87 A;  3QME A;  3BFB A;  3B6X A;  2P71 A;  2H8V A;  2P70 A;  1OOI X;  1XFR A;  3DYE A;  3OGN A;  3S0E A;  3Q8I A;  3CDN A;  3FE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...