4PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords PARVALBUMIN
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
total genus 43
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4palA00
4GUKA 1JC2A 1B9AA 4MZJA 2KFFA 2OTGC 1EG4A 4PHNA 2M0RA 2L4IA 3JVTB 1TTXA 1L2OB 2LVKA 2OPOA 1FF1A 5KSZA 4UPGA 3TUYB 1K95A 4MRYA 5DKNA 1PSBA 2V53A 4PDZA 4E68A 1B1GA 1SBJA 1KSOA 1M39A 1M31A 1NYAA 1WRZA 4XJKA 1KQMB 1LA0A 1CLBA 1PVBA 1KQVA 2MRDA 3EK8A 4GBAA 4MZKA 1QATA 1B47A 2KGBC 1HT9A 3WHUB 2HPSA 3JVTC 1TNWA 3EK7A 1IWQA 1L2OC 1MWNA 5I8NA 3K21A 1N0YA 1R6PA 2DOQA 3FS7A 1CFPA 1XK4A 2KI4B 4GGFC 4QJ3B 1B8LA 2HF5A 2KYFA 1F4QA 2H2KA 2Q4UA 3LLEA 4FTGA 1YUUA 1SW8A 5B8IB 1OQPA 1GGZA 2PASA 1KQMC 3DVEA 4CFQA 1BF5A 2F8PA 2KYCA 3PALA 4AQIA 2LVVA 4MLWA 1UHIA 4PCWA 1XFYO 2EGDA 4YI8A 1QV0A 2PVBA 3O4YA 5HKYA 3DF0B 1NX2A 4WQ2A 3SG4A 3FWBA 1BR4B 2FOTA 2KI4C 2MBXA 1YX8A 3TS5B 4CPVA 3LL8B 1AK8A 1QJTA 1RK9A 1UHNA 3KO0A 3DVJA 3PM8A 2OS8C 1MF8B 4YGEB 3SIBA 3TZ1A 4MEWA 1DF0B 2O5GA 1F4OA 2NXQA 1BG1A 1SPYA 1DGVA 3CTNA 4CFRA 4YGDB 5I2OA 1F54A 1SRAA 2BKIB 2B1UA 4TNCA 3TS5C 3SG7A 1U5IB 4QJ5B 2KAVA 1TOPA 2I18A 2M97A 1QVIZ 2K7OA 4N5XA 3I5GB 4OR9B 2KSPA 2BCBA 4GGFA 1UURA 4P5OE 4GPLB 2AAOA 2F2OA 1YTZC 3CS1A 4M2OA 1NWDA 2JRFA 2O60A 5AERA 2JU0A 4PHKA 1MQ1A 3BUWB 1RTP1 4PE0A 4YGAA 1RJVA 2L0PA 1KCYA 1A4PA 1LKJA 2M1KB 1GQMA 2BCAA 2AMIA 2H61C 1F70A 1WLMA 1V1GA 3KEVA 3EVUA 3I5GC 2M1UA 3PN7B 1SCMB 3VROA 1RECA 3HX4A 1Y1XA 4BY5A 1OMDA 3F45A 3TDUA 3NSKA 1AVSA 5ER5A 3BQ3A 1RFJA 5JOLA 2WCFA 5JJGA 5DKQA 1PVAA 1PK0D 1JWDA 3EVRA 1WDCC 1LINA 1SR6C 2KHNA 2LNKA 2BKHB 2LVIA 1QTXA 1UP5A 2M49B 3C1VA 3CR2A 3E3RA 3A4UB 2NLNA 4HSZA 3TDZA 5D69A 4L9MA 1RWYA 2ZRSA 3DF0A 5CSJA 1ZFSA 1A29A 4I5JA 1IQ3A 3NSIA 2NZ0A 1BR1B 1KK7Z 1YUTA 2PALA 4C0LA 1K90D 1DJYA 1PRWA 2OTGB 2L50A 4GFTA 2KGRA 1OMVA 1XA5A 2Q91A 1DF0A 3SG5A 1FBVA 1J1EA 3OX5A 3RM1A 1CM4A 3KPXA 2LVJA 4IL1A 3ICBA 1DJZA 3NSLA 2KFHA 2PMYA 3PFVA 1J7OA 1NCYA 1CMFA 2JQ6A 2LP2A 3A8RA 4NDDA 3DVMA 2WNDA 1U5IA 1WRKA 2H61A 4R1EA 2KBMA 1TN4A 5F6TA 2L5XB 2LHIA 2MLFC 2JT8A 3AKBA 3DVKA 2ZN8A 4GGNA 1AJ4A 4PE1A 5ER4X 2VRGA 2QPTA 2BL0B 3PLFB 3EKJA 3WXAA 1W7IB 4WRIA 1F55A 3JTDB 1YRTB 4A4CA 1B7TY 1LA3A 1NSHA 1F71A 3SIAA 1IJ5A 4ETOA 1IGVA 1K9PA 4D1EA 1ALWA 2LLUA 2KOTA 4MZLA 1DMOA 1IQ5A 3BUMB 4M2QA 5GQQC 1G8IA 1C7WA 4NQGA 1BT6A 1YX7A 1M46A 1YUSA 5K89A 1K9KA 2CBLA 2BL0C 4YRUA 1MR8A 2JTTA 2ZFDA 4DS7A 1BJFA 1G4YR 2KFGA 1A2XA 3JTDC 2LLTA 2MA2A 2LUXA 3GK2A 2OS8B 3VGOA 1XFVO 1H8BA 3AKAA 1JF2A 2KI6C 3SJSA 3QRXA 4YBHB 4MSPA 1EG3A 4CIDA 2EHBA 3I5HB 1J7RA 2Y1MA 5DKRA 2L4HA 3DD4A 4JQ0D 2CCMA 2KAYA 2WC8A 1ZMZA 2KDHA 1EJ3A 2CTNA 1TNXA 1IKUA 4NDBA 1S26D 1MHOA 3CR4X 2BCXA 4HRHA 1FI5A 1IRJA 1C07A 1UHJA 4DRWA 4I5NB 3M0WA 1HQVA 3O2PA 1DTLA 4OVNF 3RLZA 3VRPA 3VRRA 1BLQA 1RROA 3I5HC 1OZOA 1QX7A 4ZCUA 2LAPA 2LP3A 4PE4A 1K9UA 2GV5A 1SNLA 2WOSA 1XFXO 3NSOA 1KSMA 3BXKA 4GNKB 2KNEA 5HYDA 4DUQA 1JBAA 1NCZA 5CSNA 1G33A 3BOWB 1TCFA 2CXJA 3FWCA 3H4SE 4OKHA 5AANA 1QV1A 2K8MB 2JXLA 1S36A 1B8RA 1DJWA 1S6JA 4ORCB 1CKKA 1AP4A 1WDCB 2Y5IA 1SR6B 1NPQA 2RGIA 2L98A 3D0YB 1TRFA 4GAOA 2ZRTA 1DGUA 2BBNA 1K94A 3D10A 5HLOA 2WCEA 1FI6A 3HCMA 1K8UA 1S5GY 2Y4QA 1EH2A 1CNPA 4C0JA 1OZSA 2JXCA 1ODBA 5HKWA 1J7QA 2SASA 1EXRA 2MHHA 2I2RE 1YVLA 4P2YB 1C7VA 1A03A 1JSAA 2JT0A 1LVCD 4ORBB 4WQ3A 1M63B 2LHLA 2KQ6A 2JTZA 1NX1A 1L7ZA 4OV2A 1MUXA 4MN0A 1CDPA 1N65A 3LK0A 1UHHA 2Y1NA 1SY9A 4XYNA 1MXEA 1SCVA 3BUNB 4CLNA 3ZWHA 1LXFC 2AUCA 3MSEB 3ZNIA 1F8HA 1GGWA 1DJHA 3PATA 5D7FA 4JWQA 4C0KA 1CDMA 1XO5A 1XFUO 1KWOC 4YI9A 1AHRA 4OCIA 4DIRA 2KBIA 2JOJA 3OB2B 1KK8B 2CNPA 3LCPC 4PHJA 2LMUA 2LV7A 3GK1A 1SL9A 2A4JA 3O78A 1H4BA 1QASA 3CR5X 1UUSA 3BOWA 4Q04A 1GJYA 2P6BB 4YGCB 2D8NA 2BE6A 3CGAA 2LC5A 2ZN9A 3WNXB 4AQJA 1M45A 3IQOA 1Y1AA 1NX3A 3AAKA 1WY9A 3IF7A 4ZCVA 3SG6A 5BPJA 1YRUB 3SG3A 1B7TZ 2FCEA 3PSRA 1CDLA 1KK8C 3D0YA 2EC6C 5PALA 2KAXA 2MJWB 1JFKA 1KFXS 1QX5B 3EVVA 1YVHA 1BU3A 1DJIA 1Y6WA 2ZKMX 1AJ5A 2K2FA 1QX2A 2K7CA 2BBMA 1R2UA 2IS9A 5IBWA 1PSRA 1N2DA 2LE9B 3OX6A 3IQQA 1J1DA 2M8UA 1NP8A 2I7AA 3NXAA 3O6BA 1JFJA 2WCBA 1BMOA 3OB1B 2HETA 5FYXA 2F2PA 2I94A 2LM5A 1NX0A 1ZOTB 1FPWA 5AFPA 3EKHA 3VRNA 1V1FA 1YURA 1S6CA 1QLSA 4MBEA 1DT7B 1TCOB 1QIVA 1PALA 1X02A 3TUYC 3GOFA 4A4BA 5HLVA 2WORA 1J7PA 4QJ4B 1EL4A 1AUIB 1CFDA 1CFCA 2G2BA 1A75B 1QS7A 2K7BA 1OOJA 3I5IB 4HREE 1XFWO 1D1OA 2L51A 3BYAA 3CWGA 1IH0A 1Y0VH 2K7DA 2BECA 1CM1A 4DCKA 1CLMA 3WHTB 1PULA 4PHMA 4BY4A 1BOCA 1SYMA 1TNPA 3EK4A 1YR5A 3FIAA 1ZACA 2GGMA 2LMTA 1S6IA 2JPTA 4ORAB 3LK1A 1K96A 2E6WA 1K93D 1VRKA 4I5LB 1OSAA 3I5IC 4MRXA 1SL7A 2MAZA 3BUOB 3OP0A 2F33A 4HRGA 3SG2A 1XVJA 2M3WA 4MVFA 1S5GZ 2HQ8A 5AEQA 1CLLA 5J3XA 1WLZA 1Y1UA 2PSRA 2M29A 2M7LA 1NCXA 1W7JB 1SMGA 2LLSA 1BODA 1IG5A 1Q80A 1DJXA 2NCOA 2BE4A 1CMGA 1QVIY 2LANA 1NUBA 1CTRA 4FQOA 2F3YA 1CDNA 4JPZB 1MXLC 1DJGA 1SK6D 4PE7A 1QLKA 1B8CA 1TIZA 1KFUL 1QIWA 2JWWA 2L2EA 2QACA 5CSIA 1B4CA 4M2PA 5AXIA 1KWOB 3KHEA 1XYDA 1J55A 1OMRA 2JC2A 5HKZA 2M9GA 3CLNA 4ICBA 5I2QA 2R2IA 1IJ6A 4XJKB 1FW4A 1QXPA 2LUCA 1UWOA 3VRQA 3GK4X 2GGZA 2ZNEA 4U8DA 5KTYA 1S1EA 2ZNDA 1ALVA 1A75A 4NDCA 1KFUS 1XFZO 2COLB 2NCPA 2E30A 3BUXB 4F0ZB 2F3ZA 2G9BA 2FCDA 3I5FB 2EC6B 2KI6D 1KFXL 1SL8A 2K0JA 3PN7C 2ISDA 5CPVA 1SCMC 4AOMA 3CZTX 1DVIA 3AAJA 1UHKA 2LCPA 3OHMB 2K61A 2K2AA 1KK7Y 2JNFA 2JULA 2MLEC 1K2HA 4USLA 5CSFA 2M7NA 1JUOA 2CT9A 4N1FA 4PALA 1TNQA 2JZIA 2PRUA 1XK4C 1SKTA 4I5KA 2FJUB 1E8AA 1JF0A 2JNXA 5G08A 1CB1A 2KQYA 5TNCA 4YGBB 2SCPA 5I2LA 1CFFA 2HQWA 3I5FC 3KF9A 1OE9B 4N1GA 1ZUZA 3TDIA 1WRLA 2JT3A 1S3PA 5KU1A 1NIWA 2TN4A 2LMVA
chains in the Genus database with same CATH superfamily
4GUKA 4JKTA 4F7FA 3DY9A 1JC2A 1B9AA 4MZJA 3RZSA 2KFFA 2OTGC 1EG4A 3S0DA 3FE8A 3BFBA 4PHNA 2M0RA 2L4IA 3JVTB 1TTXA 1L2OB 2LVKA 2OPOA 1FF1A 3NGVA 5KSZA 4UPGA 3TUYB 1K95A 3CYZA 2GTEA 2L5YA 4MRYA 5DKNA 5DICA 1PSBA 2V53A 4PDZA 4E68A 3S0GA 1B1GA 1SBJA 1KSOA 1Z4HA 1M39A 1M31A 1DQEA 1NYAA 1WRZA 4XJKA 1KQMB 1LA0A 1CLBA 1PVBA 1KQVA 2MRDA 3EK8A 4GBAA 4MZKA 1QATA 1B47A 2KGBC 3VB1A 1HT9A 3WHUB 2HPSA 3JVTC 1TNWA 3EK7A 1IWQA 1L2OC 1MWNA 5I8NA 3K21A 1N0YA 1R6PA 2DOQA 3FS7A 1CFPA 1XK4A 2KI4B 4GGFC 4QJ3B 1B8LA 2HF5A 2KYFA 1F4QA 2H2KA 2Q4UA 3OBVA 3LLEA 4FTGA 1YUUA 1SW8A 3D73A 5B8IB 1OQPA 1GGZA 1LS8A 1KQMC 2PASA 3DVEA 4CFQA 2F8PA 1BF5A 2KYCA 3PALA 4AQIA 2LVVA 4MLWA 1UHIA 4PCWA 1XFYO 2EGDA 4YI8A 1QV0A 4JD9A 2PVBA 3O4YA 3FE9A 3DF0B 5HKYA 1NX2A 4WQ2A 3SG4A 3D76A 3FWBA 2L2CA 1BR4B 2FOTA 2KI4C 2MBXA 1YX8A 3TS5B 4CPVA 3LL8B 1AK8A 1QJTA 1RK9A 1UHNA 3KO0A 1SSEB 3DVJA 3PM8A 2OS8C 1MF8B 4YGEB 2ERBA 3SIBA 3TZ1A 4MEWA 1DF0B 2O5GA 1F4OA 2NXQA 1BG1A 1SPYA 1DGVA 3CTNA 4CFRA 4YGDB 5I2OA 1F54A 1SRAA 2BKIB 3S0FA 2B1UA 4TNCA 3TS5C 3SG7A 1U5IB 4QJ5B 2KAVA 1TOPA 2I18A 2M97A 1QVIZ 2K7OA 4N5XA 3I5GB 4OR9B 2KSPA 2BCBA 4GGFA 1UURA 4P5OE 4GPLB 2AAOA 2F2OA 1YTZC 3CS1A 4M2OA 2KLDA 1NWDA 2JPOA 2JRFA 2O60A 5AERA 2JU0A 4PHKA 2H8VA 1MQ1A 3BUWB 1RTP1 4PE0A 4YGAA 1RJVA 2L0PA 1KCYA 1A4PA 2QEBA 2QEVA 1LKJA 2M1KB 1GQMA 2BCAA 2AMIA 2H61C 3OGNA 1WLMA 1V1GA 3KEVA 1F70A 3EVUA 3I5GC 2M1UA 3PN7B 1SCMB 3VROA 1RECA 3HX4A 1Y1XA 4BY5A 1OMDA 3F45A 3TDUA 1DC1A 3NSKA 1TUZA 1AVSA 5ER5A 3BQ3A 4FQTA 1RFJA 5JOLA 1OOFA 2WCFA 5JJGA 5DKQA 1PVAA 1PK0D 3B6XA 1JWDA 1IIOA 3EVRA 1WDCC 1LINA 1SR6C 2KHNA 2LNKA 2BKHB 2LVIA 1QTXA 1UP5A 2M49B 3C1VA 3CR2A 3E3RA 3A4UB 2NLNA 4HSZA 3TDZA 5D69A 4L9MA 1RWYA 2ZRSA 3DF0A 5CSJA 1ZFSA 1A29A 4I5JA 1IQ3A 3NSIA 2NZ0A 3CZ2A 1BR1B 1KK7Z 1YUTA 2PALA 4C0LA 1QWVA 1K90D 1DJYA 1PRWA 2OTGB 2L50A 4GFTA 2KGRA 3L4AA 1OMVA 1XA5A 2Q91A 1DF0A 2WC5A 3SG5A 1FBVA 1J1EA 3OX5A 3RM1A 1CM4A 3KPXA 2LVJA 4IL1A 3ICBA 1DJZA 3NSLA 2KFHA 2PMYA 3PFVA 1J7OA 1NCYA 1OOIX 1CMFA 2JQ6A 2LP2A 2BNXA 3A8RA 3DVMA 4NDDA 2WNDA 3SS5A 1U5IA 1WRKA 2H61A 4R1EA 2KBMA 2PQLA 1TWOA 3O4XA 1TN4A 5F6TA 2L5XB 2LHIA 2MLFC 2JT8A 3AKBA 3DVKA 2ZN8A 4GGNA 1AJ4A 4PE1A 5ER4X 2VRGA 2QPTA 5EL2A 2BL0B 3PLFB 3NHIA 3EKJA 3WXAA 1W7IB 4WRIA 3S0BA 3JTDB 1YRTB 1F55A 2WCKA 5HL1A 4A4CA 1B7TY 1LA3A 1NSHA 1F71A 3SIAA 1IJ5A 4ETOA 1IGVA 1K9PA 4D1EA 1ALWA 2LLUA 2KOTA 3D75A 4MZLA 3S0EA 1DMOA 1IQ5A 3BUMB 4M2QA 3FE6A 5GQQC 1G8IA 1C7WA 4NQGA 1BT6A 3BFAA 1YX7A 1M46A 1YUSA 5K89A 2WC6A 1K9KA 2CBLA 2BL0C 4YRUA 1MR8A 2JTTA 2ZFDA 4DS7A 1BJFA 1G4YR 2KFGA 1A2XA 3JTDC 2LLTA 2MA2A 2LUXA 3GK2A 2OS8B 3VGOA 1XFVO 1H8BA 3AKAA 1JF2A 2KI6C 4INXA 3SJSA 1Z2CB 3QRXA 4YBHB 4MSPA 1EG3A 4CIDA 2EHBA 3I5HB 3PJIA 1J7RA 2Y1MA 5DKRA 2L4HA 3B88A 3DD4A 2CCMA 2KAYA 2WC8A 1ZMZA 4JQ0D 2KDHA 3UNWA 1GM0A 2QDIA 1EJ3A 2CTNA 1TNXA 1IKUA 3R1PA 4NDBA 1S26D 1MHOA 3CR4X 2BCXA 2WCHA 4HRHA 1IRJA 1FI5A 3CDNA 1C07A 1UHJA 4DRWA 4I5NB 3M0WA 1HQVA 3O2PA 1DTLA 4OVNF 3RLZA 3VRPA 3VRRA 1BLQA 3SS3A 1RROA 3I5HC 3V2LA 1OZOA 1QX7A 4ZCUA 2LAPA 2LP3A 4PE4A 1K9UA 2GV5A 1SNLA 3BJHA 2WOSA 1XFXO 3NSOA 1KSMA 3BXKA 4GNKB 2KNEA 5HYDA 4DUQA 1JBAA 1NCZA 3N7HA 5CSNA 3B86A 3NHTA 1G33A 3BOWB 1TCFA 2CXJA 3EG5B 3FWCA 3H4SE 4OKHA 5AANA 1QV1A 2K8MB 2JXLA 1S36A 1B8RA 2P71A 1DJWA 2WCLA 1S6JA 4ORCB 1CKKA 1AP4A 1WDCB 2Y5IA 1SR6B 3CZ0A 1NPQA 2RGIA 2L98A 3D0YB 1TRFA 3B7AA 4GAOA 2ZRTA 1DGUA 2BBNA 1K94A 3D10A 5HLOA 2WCEA 1FI6A 3HCMA 1K8UA 1S5GY 1C3YA 2Y4QA 1EH2A 1CNPA 4C0JA 1OZSA 2JXCA 1ODBA 5HKWA 3DXLA 1J7QA 2SASA 1EXRA 2MHHA 2I2RE 1YVLA 4P2YB 1C7VA 1A03A 1JSAA 2JT0A 3R72A 1LVCD 4ORBB 4WQ3A 1M63B 2LHLA 2KQ6A 3PM2A 2JTZA 1NX1A 1L7ZA 4OV2A 1MUXA 4MN0A 3QMEA 1CDPA 1N65A 3LK0A 3DYEA 2QEHA 1UHHA 3Q8IA 2Y1NA 1SY9A 4XYNA 3BFHA 1DELA 1MXEA 1SCVA 3S0AA 3BUNB 4CLNA 5D3OA 3ZWHA 1ORGA 1LXFC 2AUCA 3MSEB 3ZNIA 1F8HA 1GGWA 1DJHA 3PATA 5D7FA 4JWQA 3D77A 4IJ7A 4C0KA 1CDMA 1XO5A 1XFUO 2PYQA 1KWOC 4YI9A 1AHRA 4OCIA 4DIRA 2KBIA 2JOJA 3OB2B 1T14A 1KK8B 2CNPA 3LCPC 4PHJA 2LMUA 2LV7A 3GK1A 3R1VA 1SL9A 2A4JA 3O78A 1H4BA 1QASA 3CR5X 1UUSA 3BOWA 4Q04A 1GJYA 2P6BB 3K1EA 4YGCB 2D8NA 2BE6A 3CGAA 2LC5A 2ZN9A 3WNXB 4AQJA 1M45A 3IQOA 1Y1AA 1NX3A 3AAKA 1WY9A 3IF7A 2P70A 2KLEA 4ZCVA 3SG6A 5BPJA 1YRUB 3SG3A 1B7TZ 2FCEA 3PSRA 1CDLA 1KK8C 3D0YA 2EC6C 5PALA 3D74A 2KAXA 2MJWB 1JFKA 1KFXS 1QX5B 3EVVA 1YVHA 4PT1A 1BU3A 1DJIA 1Y6WA 2ZKMX 1AJ5A 2K2FA 1QX2A 2K7CA 2BBMA 1R2UA 2IS9A 5IBWA 1PSRA 1N2DA 2LE9B 3OX6A 3IQQA 1J1DA 1W9ZA 2M8UA 1NP8A 2I7AA 3NXAA 3O6BA 1JFJA 2WCBA 1BMOA 3OB1B 2HETA 5FYXA 1OW4A 2F2PA 2I94A 2LM5A 1NX0A 1ZOTB 1FPWA 5AFPA 1XFRA 3EKHA 3SS4A 1V1FA 1YURA 1S6CA 3VRNA 1QLSA 4MBEA 1DT7B 1TCOB 1QIVA 1PALA 1X02A 3TUYC 3B87A 3GOFA 4A4BA 5HLVA 2WORA 1J7PA 1C3ZA 4QJ4B 1EL4A 4OZDA 1AUIB 1CFDA 1CFCA 2G2BA 1A75B 1QS7A 2FJYA 2K7BA 1OOJA 3I5IB 4HREE 2QEOA 1XFWO 4INWA 1D1OA 2L51A 3BYAA 3CWGA 3UO9A 1IH0A 1Y0VH 2K7DA 2BECA 1CM1A 2WCJA 2YGUA 4DCKA 1CLMA 3WHTB 1PULA 4PHMA 4BY4A 1BOCA 1SYMA 1TNPA 3EK4A 1YR5A 3FIAA 1ZACA 2GGMA 2LMTA 1S6IA 2JPTA 4ORAB 3LK1A 1K96A 2E6WA 1K93D 1VRKA 3L4LA 4I5LB 1OSAA 3I5IC 2KPHA 4MRXA 1SL7A 2MAZA 3BUOB 3OP0A 2F33A 4HRGA 3SG2A 1XVJA 2M3WA 4KYNA 4MVFA 1S5GZ 2HQ8A 5AEQA 1CLLA 5FI7A 5J3XA 1WLZA 1Y1UA 2PSRA 2M29A 2M7LA 1NCXA 1TUJA 1W7JB 1SMGA 2LLSA 1BODA 1IG5A 1Q80A 1DJXA 2NCOA 2BE4A 1CMGA 1QVIY 2LANA 1NUBA 1CTRA 4FQOA 2F3YA 1CDNA 4JPZB 1MXLC 1DJGA 1SK6D 4PE7A 1QLKA 1B8CA 1TIZA 1KFUL 1QIWA 2JWWA 2L2EA 2QACA 3DZTA 5CSIA 1B4CA 4M2PA 5AXIA 1KWOB 3KHEA 1XYDA 1J55A 1OMRA 2JC2A 5HKZA 1DEKA 2M9GA 3CLNA 4ICBA 5I2QA 2R2IA 1IJ6A 4XJKB 1FW4A 1QXPA 2LUCA 1UWOA 3VRQA 3GK4X 2GGZA 2ZNEA 4U8DA 5KTYA 1S1EA 3L47A 2ZNDA 1OOHA 1P28A 1ALVA 1A75A 4NDCA 1KFUS 1XFZO 2COLB 2NCPA 3IVTA 2E30A 3BUXB 5FI6A 2F3ZA 2G9BA 4F0ZB 2FCDA 3I5FB 2EC6B 2KI6D 1KFXL 2K60A 1OOGA 1SL8A 2K0JA 3PN7C 2ISDA 5CPVA 5I94A 1SCMC 4AOMA 3CZTX 1DVIA 3AAJA 1UHKA 2LCPA 3D78A 2K61A 2K2AA 1KK7Y 2JNFA 2JULA 2MLEC 2WCMA 3OHMB 3R1OA 4USLA 5CSFA 2BAPA 5FI2A 2M7NA 1JUOA 2CT9A 4N1FA 4PALA 1TNQA 2JZIA 2PRUA 1XK4C 1K2HA 1SKTA 4I5KA 2FJUB 1E8AA 1JF0A 2JNXA 5G08A 1CB1A 3CZ1A 2KQYA 5TNCA 4YGBB 2SCPA 5I2LA 1CFFA 2HQWA 3I5FC 3KF9A 1OE9B 4N1GA 1ZUZA 3TDIA 3CABA 1WRLA 2JT3A 1S3PA 5KU1A 1NIWA 2TN4A 2LMVA
chains in the Genus database with same CATH topology
4GUKA 1JC2A 1B9AA 4MZJA 2KFFA 2OTGC 1EG4A 4PHNA 2M0RA 2L4IA 3JVTB 1TTXA 1L2OB 2LVKA 2OPOA 1FF1A 5KSZA 4UPGA 3TUYB 1K95A 4MRYA 5DKNA 1PSBA 2V53A 4PDZA 4E68A 1B1GA 1SBJA 1KSOA 1M39A 1M31A 1NYAA 1WRZA 4XJKA 1KQMB 1LA0A 1CLBA 1PVBA 1KQVA 2MRDA 3EK8A 4GBAA 4MZKA 1QATA 1B47A 2KGBC 1HT9A 3WHUB 2HPSA 3JVTC 1TNWA 3EK7A 1IWQA 1L2OC 1MWNA 5I8NA 3K21A 1N0YA 1R6PA 2DOQA 3FS7A 1CFPA 1XK4A 2KI4B 4GGFC 4QJ3B 1B8LA 2HF5A 2KYFA 1F4QA 2H2KA 2Q4UA 3LLEA 4FTGA 1YUUA 1SW8A 5B8IB 1OQPA 1GGZA 2PASA 1KQMC 3DVEA 4CFQA 1BF5A 2F8PA 2KYCA 3PALA 4AQIA 2LVVA 4MLWA 1UHIA 4PCWA 1XFYO 2EGDA 4YI8A 1QV0A 2PVBA 3O4YA 5HKYA 3DF0B 1NX2A 4WQ2A 3SG4A 3FWBA 1BR4B 2FOTA 2KI4C 2MBXA 1YX8A 3TS5B 4CPVA 3LL8B 1AK8A 1QJTA 1RK9A 1UHNA 3KO0A 3DVJA 3PM8A 2OS8C 1MF8B 4YGEB 3SIBA 3TZ1A 4MEWA 1DF0B 2O5GA 1F4OA 2NXQA 1BG1A 1SPYA 1DGVA 3CTNA 4CFRA 4YGDB 5I2OA 1F54A 1SRAA 2BKIB 2B1UA 4TNCA 3TS5C 3SG7A 1U5IB 4QJ5B 2KAVA 1TOPA 2I18A 2M97A 1QVIZ 2K7OA 4N5XA 3I5GB 4OR9B 2KSPA 2BCBA 4GGFA 1UURA 4P5OE 4GPLB 2AAOA 2F2OA 1YTZC 3CS1A 4M2OA 1NWDA 2JRFA 2O60A 5AERA 2JU0A 4PHKA 1MQ1A 3BUWB 1RTP1 4PE0A 4YGAA 1RJVA 2L0PA 1KCYA 1A4PA 1LKJA 2M1KB 1GQMA 2BCAA 2AMIA 2H61C 1F70A 1WLMA 1V1GA 3KEVA 3EVUA 3I5GC 2M1UA 3PN7B 1SCMB 3VROA 1RECA 3HX4A 1Y1XA 4BY5A 1OMDA 3F45A 3TDUA 3NSKA 1AVSA 5ER5A 3BQ3A 1RFJA 5JOLA 2WCFA 5JJGA 5DKQA 1PVAA 1PK0D 1JWDA 3EVRA 1WDCC 1LINA 1SR6C 2KHNA 2LNKA 2BKHB 2LVIA 1QTXA 1UP5A 2M49B 3C1VA 3CR2A 3E3RA 3A4UB 2NLNA 4HSZA 3TDZA 5D69A 4L9MA 1RWYA 2ZRSA 3DF0A 5CSJA 1ZFSA 1A29A 4I5JA 1IQ3A 3NSIA 2NZ0A 1BR1B 1KK7Z 1YUTA 2PALA 4C0LA 1K90D 1DJYA 1PRWA 2OTGB 2L50A 4GFTA 2KGRA 1OMVA 1XA5A 2Q91A 1DF0A 3SG5A 1FBVA 1J1EA 3OX5A 3RM1A 1CM4A 3KPXA 2LVJA 4IL1A 3ICBA 1DJZA 3NSLA 2KFHA 2PMYA 3PFVA 1J7OA 1NCYA 1CMFA 2JQ6A 2LP2A 3A8RA 4NDDA 3DVMA 2WNDA 1U5IA 1WRKA 2H61A 4R1EA 2KBMA 1TN4A 5F6TA 2L5XB 2LHIA 2MLFC 2JT8A 3AKBA 3DVKA 2ZN8A 4GGNA 1AJ4A 4PE1A 5ER4X 2VRGA 2QPTA 2BL0B 3PLFB 3EKJA 3WXAA 1W7IB 4WRIA 1F55A 3JTDB 1YRTB 4A4CA 1B7TY 1LA3A 1NSHA 1F71A 3SIAA 1IJ5A 4ETOA 1IGVA 1K9PA 4D1EA 1ALWA 2LLUA 2KOTA 4MZLA 1DMOA 1IQ5A 3BUMB 4M2QA 5GQQC 1G8IA 1C7WA 4NQGA 1BT6A 1YX7A 1M46A 1YUSA 5K89A 1K9KA 2CBLA 2BL0C 4YRUA 1MR8A 2JTTA 2ZFDA 4DS7A 1BJFA 1G4YR 2KFGA 1A2XA 3JTDC 2LLTA 2MA2A 2LUXA 3GK2A 2OS8B 3VGOA 1XFVO 1H8BA 3AKAA 1JF2A 2KI6C 3SJSA 3QRXA 4YBHB 4MSPA 1EG3A 4CIDA 2EHBA 3I5HB 1J7RA 2Y1MA 5DKRA 2L4HA 3DD4A 4JQ0D 2CCMA 2KAYA 2WC8A 1ZMZA 2KDHA 1EJ3A 2CTNA 1TNXA 1IKUA 4NDBA 1S26D 1MHOA 3CR4X 2BCXA 4HRHA 1FI5A 1IRJA 1C07A 1UHJA 4DRWA 4I5NB 3M0WA 1HQVA 3O2PA 1DTLA 4OVNF 3RLZA 3VRPA 3VRRA 1BLQA 1RROA 3I5HC 1OZOA 1QX7A 4ZCUA 2LAPA 2LP3A 4PE4A 1K9UA 2GV5A 1SNLA 2WOSA 1XFXO 3NSOA 1KSMA 3BXKA 4GNKB 2KNEA 5HYDA 4DUQA 1JBAA 1NCZA 5CSNA 1G33A 3BOWB 1TCFA 2CXJA 3FWCA 3H4SE 4OKHA 5AANA 1QV1A 2K8MB 2JXLA 1S36A 1B8RA 1DJWA 1S6JA 4ORCB 1CKKA 1AP4A 1WDCB 2Y5IA 1SR6B 1NPQA 2RGIA 2L98A 3D0YB 1TRFA 4GAOA 2ZRTA 1DGUA 2BBNA 1K94A 3D10A 5HLOA 2WCEA 1FI6A 3HCMA 1K8UA 1S5GY 2Y4QA 1EH2A 1CNPA 4C0JA 1OZSA 2JXCA 1ODBA 5HKWA 1J7QA 2SASA 1EXRA 2MHHA 2I2RE 1YVLA 4P2YB 1C7VA 1A03A 1JSAA 2JT0A 1LVCD 4ORBB 4WQ3A 1M63B 2LHLA 2KQ6A 2JTZA 1NX1A 1L7ZA 4OV2A 1MUXA 4MN0A 1CDPA 1N65A 3LK0A 1UHHA 2Y1NA 1SY9A 4XYNA 1MXEA 1SCVA 3BUNB 4CLNA 3ZWHA 1LXFC 2AUCA 3MSEB 3ZNIA 1F8HA 1GGWA 1DJHA 3PATA 5D7FA 4JWQA 4C0KA 1CDMA 1XO5A 1XFUO 1KWOC 4YI9A 1AHRA 4OCIA 4DIRA 2KBIA 2JOJA 3OB2B 1KK8B 2CNPA 3LCPC 4PHJA 2LMUA 2LV7A 3GK1A 1SL9A 2A4JA 3O78A 1H4BA 1QASA 3CR5X 1UUSA 3BOWA 4Q04A 1GJYA 2P6BB 4YGCB 2D8NA 2BE6A 3CGAA 2LC5A 2ZN9A 3WNXB 4AQJA 1M45A 3IQOA 1Y1AA 1NX3A 3AAKA 1WY9A 3IF7A 4ZCVA 3SG6A 5BPJA 1YRUB 3SG3A 1B7TZ 2FCEA 3PSRA 1CDLA 1KK8C 3D0YA 2EC6C 5PALA 2KAXA 2MJWB 1JFKA 1KFXS 1QX5B 3EVVA 1YVHA 1BU3A 1DJIA 1Y6WA 2ZKMX 1AJ5A 2K2FA 1QX2A 2K7CA 2BBMA 1R2UA 2IS9A 5IBWA 1PSRA 1N2DA 2LE9B 3OX6A 3IQQA 1J1DA 2M8UA 1NP8A 2I7AA 3NXAA 3O6BA 1JFJA 2WCBA 1BMOA 3OB1B 2HETA 5FYXA 2F2PA 2I94A 2LM5A 1NX0A 1ZOTB 1FPWA 5AFPA 3EKHA 3VRNA 1V1FA 1YURA 1S6CA 1QLSA 4MBEA 1DT7B 1TCOB 1QIVA 1PALA 1X02A 3TUYC 3GOFA 4A4BA 5HLVA 2WORA 1J7PA 4QJ4B 1EL4A 1AUIB 1CFDA 1CFCA 2G2BA 1A75B 1QS7A 2K7BA 1OOJA 3I5IB 4HREE 1XFWO 1D1OA 2L51A 3BYAA 3CWGA 1IH0A 1Y0VH 2K7DA 2BECA 1CM1A 4DCKA 1CLMA 3WHTB 1PULA 4PHMA 4BY4A 1BOCA 1SYMA 1TNPA 3EK4A 1YR5A 3FIAA 1ZACA 2GGMA 2LMTA 1S6IA 2JPTA 4ORAB 3LK1A 1K96A 2E6WA 1K93D 1VRKA 4I5LB 1OSAA 3I5IC 4MRXA 1SL7A 2MAZA 3BUOB 3OP0A 2F33A 4HRGA 3SG2A 1XVJA 2M3WA 4MVFA 1S5GZ 2HQ8A 5AEQA 1CLLA 5J3XA 1WLZA 1Y1UA 2PSRA 2M29A 2M7LA 1NCXA 1W7JB 1SMGA 2LLSA 1BODA 1IG5A 1Q80A 1DJXA 2NCOA 2BE4A 1CMGA 1QVIY 2LANA 1NUBA 1CTRA 4FQOA 2F3YA 1CDNA 4JPZB 1MXLC 1DJGA 1SK6D 4PE7A 1QLKA 1B8CA 1TIZA 1KFUL 1QIWA 2JWWA 2L2EA 2QACA 5CSIA 1B4CA 4M2PA 5AXIA 1KWOB 3KHEA 1XYDA 1J55A 1OMRA 2JC2A 5HKZA 2M9GA 3CLNA 4ICBA 5I2QA 2R2IA 1IJ6A 4XJKB 1FW4A 1QXPA 2LUCA 1UWOA 3VRQA 3GK4X 2GGZA 2ZNEA 4U8DA 5KTYA 1S1EA 2ZNDA 1ALVA 1A75A 4NDCA 1KFUS 1XFZO 2COLB 2NCPA 2E30A 3BUXB 4F0ZB 2F3ZA 2G9BA 2FCDA 3I5FB 2EC6B 2KI6D 1KFXL 1SL8A 2K0JA 3PN7C 2ISDA 5CPVA 1SCMC 4AOMA 3CZTX 1DVIA 3AAJA 1UHKA 2LCPA 3OHMB 2K61A 2K2AA 1KK7Y 2JNFA 2JULA 2MLEC 1K2HA 4USLA 5CSFA 2M7NA 1JUOA 2CT9A 4N1FA 4PALA 1TNQA 2JZIA 2PRUA 1XK4C 1SKTA 4I5KA 2FJUB 1E8AA 1JF0A 2JNXA 5G08A 1CB1A 2KQYA 5TNCA 4YGBB 2SCPA 5I2LA 1CFFA 2HQWA 3I5FC 3KF9A 1OE9B 4N1GA 1ZUZA 3TDIA 1WRLA 2JT3A 1S3PA 5KU1A 1NIWA 2TN4A 2LMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GUK A;  1JC2 A;  1B9A A;  4MZJ A;  2KFF A;  2OTG C;  1EG4 A;  4PHN A;  2M0R A;  2L4I A;  3JVT B;  1TTX A;  1L2O B;  2LVK A;  2OPO A;  1FF1 A;  5KSZ A;  4UPG A;  3TUY B;  1K95 A;  4MRY A;  5DKN A;  1PSB A;  2V53 A;  4PDZ A;  4E68 A;  1B1G A;  1SBJ A;  1KSO A;  1M39 A;  1M31 A;  1NYA A;  1WRZ A;  4XJK A;  1KQM B;  1LA0 A;  1CLB A;  1PVB A;  1KQV A;  2MRD A;  3EK8 A;  4GBA A;  4MZK A;  1QAT A;  1B47 A;  2KGB C;  1HT9 A;  3WHU B;  2HPS A;  3JVT C;  1TNW A;  3EK7 A;  1IWQ A;  1L2O C;  1MWN A;  5I8N A;  3K21 A;  1N0Y A;  1R6P A;  2DOQ A;  3FS7 A;  1CFP A;  1XK4 A;  2KI4 B;  4GGF C;  4QJ3 B;  1B8L A;  2HF5 A;  2KYF A;  1F4Q A;  2H2K A;  2Q4U A;  3LLE A;  4FTG A;  1YUU A;  1SW8 A;  5B8I B;  1OQP A;  1GGZ A;  2PAS A;  1KQM C;  3DVE A;  4CFQ A;  1BF5 A;  2F8P A;  2KYC A;  3PAL A;  4AQI A;  2LVV A;  4MLW A;  1UHI A;  4PCW A;  1XFY O;  2EGD A;  4YI8 A;  1QV0 A;  2PVB A;  3O4Y A;  5HKY A;  3DF0 B;  1NX2 A;  4WQ2 A;  3SG4 A;  3FWB A;  1BR4 B;  2FOT A;  2KI4 C;  2MBX A;  1YX8 A;  3TS5 B;  4CPV A;  3LL8 B;  1AK8 A;  1QJT A;  1RK9 A;  1UHN A;  3KO0 A;  3DVJ A;  3PM8 A;  2OS8 C;  1MF8 B;  4YGE B;  3SIB A;  3TZ1 A;  4MEW A;  1DF0 B;  2O5G A;  1F4O A;  2NXQ A;  1BG1 A;  1SPY A;  1DGV A;  3CTN A;  4CFR A;  4YGD B;  5I2O A;  1F54 A;  1SRA A;  2BKI B;  2B1U A;  4TNC A;  3TS5 C;  3SG7 A;  1U5I B;  4QJ5 B;  2KAV A;  1TOP A;  2I18 A;  2M97 A;  1QVI Z;  2K7O A;  4N5X A;  3I5G B;  4OR9 B;  2KSP A;  2BCB A;  4GGF A;  1UUR A;  4P5O E;  4GPL B;  2AAO A;  2F2O A;  1YTZ C;  3CS1 A;  4M2O A;  1NWD A;  2JRF A;  2O60 A;  5AER A;  2JU0 A;  4PHK A;  1MQ1 A;  3BUW B;  1RTP 1;  4PE0 A;  4YGA A;  1RJV A;  2L0P A;  1KCY A;  1A4P A;  1LKJ A;  2M1K B;  1GQM A;  2BCA A;  2AMI A;  2H61 C;  1F70 A;  1WLM A;  1V1G A;  3KEV A;  3EVU A;  3I5G C;  2M1U A;  3PN7 B;  1SCM B;  3VRO A;  1REC A;  3HX4 A;  1Y1X A;  4BY5 A;  1OMD A;  3F45 A;  3TDU A;  3NSK A;  1AVS A;  5ER5 A;  3BQ3 A;  1RFJ A;  5JOL A;  2WCF A;  5JJG A;  5DKQ A;  1PVA A;  1PK0 D;  1JWD A;  3EVR A;  1WDC C;  1LIN A;  1SR6 C;  2KHN A;  2LNK A;  2BKH B;  2LVI A;  1QTX A;  1UP5 A;  2M49 B;  3C1V A;  3CR2 A;  3E3R A;  3A4U B;  2NLN A;  4HSZ A;  3TDZ A;  5D69 A;  4L9M A;  1RWY A;  2ZRS A;  3DF0 A;  5CSJ A;  1ZFS A;  1A29 A;  4I5J A;  1IQ3 A;  3NSI A;  2NZ0 A;  1BR1 B;  1KK7 Z;  1YUT A;  2PAL A;  4C0L A;  1K90 D;  1DJY A;  1PRW A;  2OTG B;  2L50 A;  4GFT A;  2KGR A;  1OMV A;  1XA5 A;  2Q91 A;  1DF0 A;  3SG5 A;  1FBV A;  1J1E A;  3OX5 A;  3RM1 A;  1CM4 A;  3KPX A;  2LVJ A;  4IL1 A;  3ICB A;  1DJZ A;  3NSL A;  2KFH A;  2PMY A;  3PFV A;  1J7O A;  1NCY A;  1CMF A;  2JQ6 A;  2LP2 A;  3A8R A;  4NDD A;  3DVM A;  2WND A;  1U5I A;  1WRK A;  2H61 A;  4R1E A;  2KBM A;  1TN4 A;  5F6T A;  2L5X B;  2LHI A;  2MLF C;  2JT8 A;  3AKB A;  3DVK A;  2ZN8 A;  4GGN A;  1AJ4 A;  4PE1 A;  5ER4 X;  2VRG A;  2QPT A;  2BL0 B;  3PLF B;  3EKJ A;  3WXA A;  1W7I B;  4WRI A;  1F55 A;  3JTD B;  1YRT B;  4A4C A;  1B7T Y;  1LA3 A;  1NSH A;  1F71 A;  3SIA A;  1IJ5 A;  4ETO A;  1IGV A;  1K9P A;  4D1E A;  1ALW A;  2LLU A;  2KOT A;  4MZL A;  1DMO A;  1IQ5 A;  3BUM B;  4M2Q A;  5GQQ C;  1G8I A;  1C7W A;  4NQG A;  1BT6 A;  1YX7 A;  1M46 A;  1YUS A;  5K89 A;  1K9K A;  2CBL A;  2BL0 C;  4YRU A;  1MR8 A;  2JTT A;  2ZFD A;  4DS7 A;  1BJF A;  1G4Y R;  2KFG A;  1A2X A;  3JTD C;  2LLT A;  2MA2 A;  2LUX A;  3GK2 A;  2OS8 B;  3VGO A;  1XFV O;  1H8B A;  3AKA A;  1JF2 A;  2KI6 C;  3SJS A;  3QRX A;  4YBH B;  4MSP A;  1EG3 A;  4CID A;  2EHB A;  3I5H B;  1J7R A;  2Y1M A;  5DKR A;  2L4H A;  3DD4 A;  4JQ0 D;  2CCM A;  2KAY A;  2WC8 A;  1ZMZ A;  2KDH A;  1EJ3 A;  2CTN A;  1TNX A;  1IKU A;  4NDB A;  1S26 D;  1MHO A;  3CR4 X;  2BCX A;  4HRH A;  1FI5 A;  1IRJ A;  1C07 A;  1UHJ A;  4DRW A;  4I5N B;  3M0W A;  1HQV A;  3O2P A;  1DTL A;  4OVN F;  3RLZ A;  3VRP A;  3VRR A;  1BLQ A;  1RRO A;  3I5H C;  1OZO A;  1QX7 A;  4ZCU A;  2LAP A;  2LP3 A;  4PE4 A;  1K9U A;  2GV5 A;  1SNL A;  2WOS A;  1XFX O;  3NSO A;  1KSM A;  3BXK A;  4GNK B;  2KNE A;  5HYD A;  4DUQ A;  1JBA A;  1NCZ A;  5CSN A;  1G33 A;  3BOW B;  1TCF A;  2CXJ A;  3FWC A;  3H4S E;  4OKH A;  5AAN A;  1QV1 A;  2K8M B;  2JXL A;  1S36 A;  1B8R A;  1DJW A;  1S6J A;  4ORC B;  1CKK A;  1AP4 A;  1WDC B;  2Y5I A;  1SR6 B;  1NPQ A;  2RGI A;  2L98 A;  3D0Y B;  1TRF A;  4GAO A;  2ZRT A;  1DGU A;  2BBN A;  1K94 A;  3D10 A;  5HLO A;  2WCE A;  1FI6 A;  3HCM A;  1K8U A;  1S5G Y;  2Y4Q A;  1EH2 A;  1CNP A;  4C0J A;  1OZS A;  2JXC A;  1ODB A;  5HKW A;  1J7Q A;  2SAS A;  1EXR A;  2MHH A;  2I2R E;  1YVL A;  4P2Y B;  1C7V A;  1A03 A;  1JSA A;  2JT0 A;  1LVC D;  4ORB B;  4WQ3 A;  1M63 B;  2LHL A;  2KQ6 A;  2JTZ A;  1NX1 A;  1L7Z A;  4OV2 A;  1MUX A;  4MN0 A;  1CDP A;  1N65 A;  3LK0 A;  1UHH A;  2Y1N A;  1SY9 A;  4XYN A;  1MXE A;  1SCV A;  3BUN B;  4CLN A;  3ZWH A;  1LXF C;  2AUC A;  3MSE B;  3ZNI A;  1F8H A;  1GGW A;  1DJH A;  3PAT A;  5D7F A;  4JWQ A;  4C0K A;  1CDM A;  1XO5 A;  1XFU O;  1KWO C;  4YI9 A;  1AHR A;  4OCI A;  4DIR A;  2KBI A;  2JOJ A;  3OB2 B;  1KK8 B;  2CNP A;  3LCP C;  4PHJ A;  2LMU A;  2LV7 A;  3GK1 A;  1SL9 A;  2A4J A;  3O78 A;  1H4B A;  1QAS A;  3CR5 X;  1UUS A;  3BOW A;  4Q04 A;  1GJY A;  2P6B B;  4YGC B;  2D8N A;  2BE6 A;  3CGA A;  2LC5 A;  2ZN9 A;  3WNX B;  4AQJ A;  1M45 A;  3IQO A;  1Y1A A;  1NX3 A;  3AAK A;  1WY9 A;  3IF7 A;  4ZCV A;  3SG6 A;  5BPJ A;  1YRU B;  3SG3 A;  1B7T Z;  2FCE A;  3PSR A;  1CDL A;  1KK8 C;  3D0Y A;  2EC6 C;  5PAL A;  2KAX A;  2MJW B;  1JFK A;  1KFX S;  1QX5 B;  3EVV A;  1YVH A;  1BU3 A;  1DJI A;  1Y6W A;  2ZKM X;  1AJ5 A;  2K2F A;  1QX2 A;  2K7C A;  2BBM A;  1R2U A;  2IS9 A;  5IBW A;  1PSR A;  1N2D A;  2LE9 B;  3OX6 A;  3IQQ A;  1J1D A;  2M8U A;  1NP8 A;  2I7A A;  3NXA A;  3O6B A;  1JFJ A;  2WCB A;  1BMO A;  3OB1 B;  2HET A;  5FYX A;  2F2P A;  2I94 A;  2LM5 A;  1NX0 A;  1ZOT B;  1FPW A;  5AFP A;  3EKH A;  3VRN A;  1V1F A;  1YUR A;  1S6C A;  1QLS A;  4MBE A;  1DT7 B;  1TCO B;  1QIV A;  1PAL A;  1X02 A;  3TUY C;  3GOF A;  4A4B A;  5HLV A;  2WOR A;  1J7P A;  4QJ4 B;  1EL4 A;  1AUI B;  1CFD A;  1CFC A;  2G2B A;  1A75 B;  1QS7 A;  2K7B A;  1OOJ A;  3I5I B;  4HRE E;  1XFW O;  1D1O A;  2L51 A;  3BYA A;  3CWG A;  1IH0 A;  1Y0V H;  2K7D A;  2BEC A;  1CM1 A;  4DCK A;  1CLM A;  3WHT B;  1PUL A;  4PHM A;  4BY4 A;  1BOC A;  1SYM A;  1TNP A;  3EK4 A;  1YR5 A;  3FIA A;  1ZAC A;  2GGM A;  2LMT A;  1S6I A;  2JPT A;  4ORA B;  3LK1 A;  1K96 A;  2E6W A;  1K93 D;  1VRK A;  4I5L B;  1OSA A;  3I5I C;  4MRX A;  1SL7 A;  2MAZ A;  3BUO B;  3OP0 A;  2F33 A;  4HRG A;  3SG2 A;  1XVJ A;  2M3W A;  4MVF A;  1S5G Z;  2HQ8 A;  5AEQ A;  1CLL A;  5J3X A;  1WLZ A;  1Y1U A;  2PSR A;  2M29 A;  2M7L A;  1NCX A;  1W7J B;  1SMG A;  2LLS A;  1BOD A;  1IG5 A;  1Q80 A;  1DJX A;  2NCO A;  2BE4 A;  1CMG A;  1QVI Y;  2LAN A;  1NUB A;  1CTR A;  4FQO A;  2F3Y A;  1CDN A;  4JPZ B;  1MXL C;  1DJG A;  1SK6 D;  4PE7 A;  1QLK A;  1B8C A;  1TIZ A;  1KFU L;  1QIW A;  2JWW A;  2L2E A;  2QAC A;  5CSI A;  1B4C A;  4M2P A;  5AXI A;  1KWO B;  3KHE A;  1XYD A;  1J55 A;  1OMR A;  2JC2 A;  5HKZ A;  2M9G A;  3CLN A;  4ICB A;  5I2Q A;  2R2I A;  1IJ6 A;  4XJK B;  1FW4 A;  1QXP A;  2LUC A;  1UWO A;  3VRQ A;  3GK4 X;  2GGZ A;  2ZNE A;  4U8D A;  5KTY A;  1S1E A;  2ZND A;  1ALV A;  1A75 A;  4NDC A;  1KFU S;  1XFZ O;  2COL B;  2NCP A;  2E30 A;  3BUX B;  4F0Z B;  2F3Z A;  2G9B A;  2FCD A;  3I5F B;  2EC6 B;  2KI6 D;  1KFX L;  1SL8 A;  2K0J A;  3PN7 C;  2ISD A;  5CPV A;  1SCM C;  4AOM A;  3CZT X;  1DVI A;  3AAJ A;  1UHK A;  2LCP A;  3OHM B;  2K61 A;  2K2A A;  1KK7 Y;  2JNF A;  2JUL A;  2MLE C;  1K2H A;  4USL A;  5CSF A;  2M7N A;  1JUO A;  2CT9 A;  4N1F A;  4PAL A;  1TNQ A;  2JZI A;  2PRU A;  1XK4 C;  1SKT A;  4I5K A;  2FJU B;  1E8A A;  1JF0 A;  2JNX A;  5G08 A;  1CB1 A;  2KQY A;  5TNC A;  4YGB B;  2SCP A;  5I2L A;  1CFF A;  2HQW A;  3I5F C;  3KF9 A;  1OE9 B;  4N1G A;  1ZUZ A;  3TDI A;  1WRL A;  2JT3 A;  1S3P A;  5KU1 A;  1NIW A;  2TN4 A;  2LMV A; 
#chains in the Genus database with same CATH topology
 4GUK A;  4JKT A;  4F7F A;  3DY9 A;  1JC2 A;  1B9A A;  4MZJ A;  3RZS A;  2KFF A;  2OTG C;  1EG4 A;  3S0D A;  3FE8 A;  3BFB A;  4PHN A;  2M0R A;  2L4I A;  3JVT B;  1TTX A;  1L2O B;  2LVK A;  2OPO A;  1FF1 A;  3NGV A;  5KSZ A;  4UPG A;  3TUY B;  1K95 A;  3CYZ A;  2GTE A;  2L5Y A;  4MRY A;  5DKN A;  5DIC A;  1PSB A;  2V53 A;  4PDZ A;  4E68 A;  3S0G A;  1B1G A;  1SBJ A;  1KSO A;  1Z4H A;  1M39 A;  1M31 A;  1DQE A;  1NYA A;  1WRZ A;  4XJK A;  1KQM B;  1LA0 A;  1CLB A;  1PVB A;  1KQV A;  2MRD A;  3EK8 A;  4GBA A;  4MZK A;  1QAT A;  1B47 A;  2KGB C;  3VB1 A;  1HT9 A;  3WHU B;  2HPS A;  3JVT C;  1TNW A;  3EK7 A;  1IWQ A;  1L2O C;  1MWN A;  5I8N A;  3K21 A;  1N0Y A;  1R6P A;  2DOQ A;  3FS7 A;  1CFP A;  1XK4 A;  2KI4 B;  4GGF C;  4QJ3 B;  1B8L A;  2HF5 A;  2KYF A;  1F4Q A;  2H2K A;  2Q4U A;  3OBV A;  3LLE A;  4FTG A;  1YUU A;  1SW8 A;  3D73 A;  5B8I B;  1OQP A;  1GGZ A;  1LS8 A;  1KQM C;  2PAS A;  3DVE A;  4CFQ A;  2F8P A;  1BF5 A;  2KYC A;  3PAL A;  4AQI A;  2LVV A;  4MLW A;  1UHI A;  4PCW A;  1XFY O;  2EGD A;  4YI8 A;  1QV0 A;  4JD9 A;  2PVB A;  3O4Y A;  3FE9 A;  3DF0 B;  5HKY A;  1NX2 A;  4WQ2 A;  3SG4 A;  3D76 A;  3FWB A;  2L2C A;  1BR4 B;  2FOT A;  2KI4 C;  2MBX A;  1YX8 A;  3TS5 B;  4CPV A;  3LL8 B;  1AK8 A;  1QJT A;  1RK9 A;  1UHN A;  3KO0 A;  1SSE B;  3DVJ A;  3PM8 A;  2OS8 C;  1MF8 B;  4YGE B;  2ERB A;  3SIB A;  3TZ1 A;  4MEW A;  1DF0 B;  2O5G A;  1F4O A;  2NXQ A;  1BG1 A;  1SPY A;  1DGV A;  3CTN A;  4CFR A;  4YGD B;  5I2O A;  1F54 A;  1SRA A;  2BKI B;  3S0F A;  2B1U A;  4TNC A;  3TS5 C;  3SG7 A;  1U5I B;  4QJ5 B;  2KAV A;  1TOP A;  2I18 A;  2M97 A;  1QVI Z;  2K7O A;  4N5X A;  3I5G B;  4OR9 B;  2KSP A;  2BCB A;  4GGF A;  1UUR A;  4P5O E;  4GPL B;  2AAO A;  2F2O A;  1YTZ C;  3CS1 A;  4M2O A;  2KLD A;  1NWD A;  2JPO A;  2JRF A;  2O60 A;  5AER A;  2JU0 A;  4PHK A;  2H8V A;  1MQ1 A;  3BUW B;  1RTP 1;  4PE0 A;  4YGA A;  1RJV A;  2L0P A;  1KCY A;  1A4P A;  2QEB A;  2QEV A;  1LKJ A;  2M1K B;  1GQM A;  2BCA A;  2AMI A;  2H61 C;  3OGN A;  1WLM A;  1V1G A;  3KEV A;  1F70 A;  3EVU A;  3I5G C;  2M1U A;  3PN7 B;  1SCM B;  3VRO A;  1REC A;  3HX4 A;  1Y1X A;  4BY5 A;  1OMD A;  3F45 A;  3TDU A;  1DC1 A;  3NSK A;  1TUZ A;  1AVS A;  5ER5 A;  3BQ3 A;  4FQT A;  1RFJ A;  5JOL A;  1OOF A;  2WCF A;  5JJG A;  5DKQ A;  1PVA A;  1PK0 D;  3B6X A;  1JWD A;  1IIO A;  3EVR A;  1WDC C;  1LIN A;  1SR6 C;  2KHN A;  2LNK A;  2BKH B;  2LVI A;  1QTX A;  1UP5 A;  2M49 B;  3C1V A;  3CR2 A;  3E3R A;  3A4U B;  2NLN A;  4HSZ A;  3TDZ A;  5D69 A;  4L9M A;  1RWY A;  2ZRS A;  3DF0 A;  5CSJ A;  1ZFS A;  1A29 A;  4I5J A;  1IQ3 A;  3NSI A;  2NZ0 A;  3CZ2 A;  1BR1 B;  1KK7 Z;  1YUT A;  2PAL A;  4C0L A;  1QWV A;  1K90 D;  1DJY A;  1PRW A;  2OTG B;  2L50 A;  4GFT A;  2KGR A;  3L4A A;  1OMV A;  1XA5 A;  2Q91 A;  1DF0 A;  2WC5 A;  3SG5 A;  1FBV A;  1J1E A;  3OX5 A;  3RM1 A;  1CM4 A;  3KPX A;  2LVJ A;  4IL1 A;  3ICB A;  1DJZ A;  3NSL A;  2KFH A;  2PMY A;  3PFV A;  1J7O A;  1NCY A;  1OOI X;  1CMF A;  2JQ6 A;  2LP2 A;  2BNX A;  3A8R A;  3DVM A;  4NDD A;  2WND A;  3SS5 A;  1U5I A;  1WRK A;  2H61 A;  4R1E A;  2KBM A;  2PQL A;  1TWO A;  3O4X A;  1TN4 A;  5F6T A;  2L5X B;  2LHI A;  2MLF C;  2JT8 A;  3AKB A;  3DVK A;  2ZN8 A;  4GGN A;  1AJ4 A;  4PE1 A;  5ER4 X;  2VRG A;  2QPT A;  5EL2 A;  2BL0 B;  3PLF B;  3NHI A;  3EKJ A;  3WXA A;  1W7I B;  4WRI A;  3S0B A;  3JTD B;  1YRT B;  1F55 A;  2WCK A;  5HL1 A;  4A4C A;  1B7T Y;  1LA3 A;  1NSH A;  1F71 A;  3SIA A;  1IJ5 A;  4ETO A;  1IGV A;  1K9P A;  4D1E A;  1ALW A;  2LLU A;  2KOT A;  3D75 A;  4MZL A;  3S0E A;  1DMO A;  1IQ5 A;  3BUM B;  4M2Q A;  3FE6 A;  5GQQ C;  1G8I A;  1C7W A;  4NQG A;  1BT6 A;  3BFA A;  1YX7 A;  1M46 A;  1YUS A;  5K89 A;  2WC6 A;  1K9K A;  2CBL A;  2BL0 C;  4YRU A;  1MR8 A;  2JTT A;  2ZFD A;  4DS7 A;  1BJF A;  1G4Y R;  2KFG A;  1A2X A;  3JTD C;  2LLT A;  2MA2 A;  2LUX A;  3GK2 A;  2OS8 B;  3VGO A;  1XFV O;  1H8B A;  3AKA A;  1JF2 A;  2KI6 C;  4INX A;  3SJS A;  1Z2C B;  3QRX A;  4YBH B;  4MSP A;  1EG3 A;  4CID A;  2EHB A;  3I5H B;  3PJI A;  1J7R A;  2Y1M A;  5DKR A;  2L4H A;  3B88 A;  3DD4 A;  2CCM A;  2KAY A;  2WC8 A;  1ZMZ A;  4JQ0 D;  2KDH A;  3UNW A;  1GM0 A;  2QDI A;  1EJ3 A;  2CTN A;  1TNX A;  1IKU A;  3R1P A;  4NDB A;  1S26 D;  1MHO A;  3CR4 X;  2BCX A;  2WCH A;  4HRH A;  1IRJ A;  1FI5 A;  3CDN A;  1C07 A;  1UHJ A;  4DRW A;  4I5N B;  3M0W A;  1HQV A;  3O2P A;  1DTL A;  4OVN F;  3RLZ A;  3VRP A;  3VRR A;  1BLQ A;  3SS3 A;  1RRO A;  3I5H C;  3V2L A;  1OZO A;  1QX7 A;  4ZCU A;  2LAP A;  2LP3 A;  4PE4 A;  1K9U A;  2GV5 A;  1SNL A;  3BJH A;  2WOS A;  1XFX O;  3NSO A;  1KSM A;  3BXK A;  4GNK B;  2KNE A;  5HYD A;  4DUQ A;  1JBA A;  1NCZ A;  3N7H A;  5CSN A;  3B86 A;  3NHT A;  1G33 A;  3BOW B;  1TCF A;  2CXJ A;  3EG5 B;  3FWC A;  3H4S E;  4OKH A;  5AAN A;  1QV1 A;  2K8M B;  2JXL A;  1S36 A;  1B8R A;  2P71 A;  1DJW A;  2WCL A;  1S6J A;  4ORC B;  1CKK A;  1AP4 A;  1WDC B;  2Y5I A;  1SR6 B;  3CZ0 A;  1NPQ A;  2RGI A;  2L98 A;  3D0Y B;  1TRF A;  3B7A A;  4GAO A;  2ZRT A;  1DGU A;  2BBN A;  1K94 A;  3D10 A;  5HLO A;  2WCE A;  1FI6 A;  3HCM A;  1K8U A;  1S5G Y;  1C3Y A;  2Y4Q A;  1EH2 A;  1CNP A;  4C0J A;  1OZS A;  2JXC A;  1ODB A;  5HKW A;  3DXL A;  1J7Q A;  2SAS A;  1EXR A;  2MHH A;  2I2R E;  1YVL A;  4P2Y B;  1C7V A;  1A03 A;  1JSA A;  2JT0 A;  3R72 A;  1LVC D;  4ORB B;  4WQ3 A;  1M63 B;  2LHL A;  2KQ6 A;  3PM2 A;  2JTZ A;  1NX1 A;  1L7Z A;  4OV2 A;  1MUX A;  4MN0 A;  3QME A;  1CDP A;  1N65 A;  3LK0 A;  3DYE A;  2QEH A;  1UHH A;  3Q8I A;  2Y1N A;  1SY9 A;  4XYN A;  3BFH A;  1DEL A;  1MXE A;  1SCV A;  3S0A A;  3BUN B;  4CLN A;  5D3O A;  3ZWH A;  1ORG A;  1LXF C;  2AUC A;  3MSE B;  3ZNI A;  1F8H A;  1GGW A;  1DJH A;  3PAT A;  5D7F A;  4JWQ A;  3D77 A;  4IJ7 A;  4C0K A;  1CDM A;  1XO5 A;  1XFU O;  2PYQ A;  1KWO C;  4YI9 A;  1AHR A;  4OCI A;  4DIR A;  2KBI A;  2JOJ A;  3OB2 B;  1T14 A;  1KK8 B;  2CNP A;  3LCP C;  4PHJ A;  2LMU A;  2LV7 A;  3GK1 A;  3R1V A;  1SL9 A;  2A4J A;  3O78 A;  1H4B A;  1QAS A;  3CR5 X;  1UUS A;  3BOW A;  4Q04 A;  1GJY A;  2P6B B;  3K1E A;  4YGC B;  2D8N A;  2BE6 A;  3CGA A;  2LC5 A;  2ZN9 A;  3WNX B;  4AQJ A;  1M45 A;  3IQO A;  1Y1A A;  1NX3 A;  3AAK A;  1WY9 A;  3IF7 A;  2P70 A;  2KLE A;  4ZCV A;  3SG6 A;  5BPJ A;  1YRU B;  3SG3 A;  1B7T Z;  2FCE A;  3PSR A;  1CDL A;  1KK8 C;  3D0Y A;  2EC6 C;  5PAL A;  3D74 A;  2KAX A;  2MJW B;  1JFK A;  1KFX S;  1QX5 B;  3EVV A;  1YVH A;  4PT1 A;  1BU3 A;  1DJI A;  1Y6W A;  2ZKM X;  1AJ5 A;  2K2F A;  1QX2 A;  2K7C A;  2BBM A;  1R2U A;  2IS9 A;  5IBW A;  1PSR A;  1N2D A;  2LE9 B;  3OX6 A;  3IQQ A;  1J1D A;  1W9Z A;  2M8U A;  1NP8 A;  2I7A A;  3NXA A;  3O6B A;  1JFJ A;  2WCB A;  1BMO A;  3OB1 B;  2HET A;  5FYX A;  1OW4 A;  2F2P A;  2I94 A;  2LM5 A;  1NX0 A;  1ZOT B;  1FPW A;  5AFP A;  1XFR A;  3EKH A;  3SS4 A;  1V1F A;  1YUR A;  1S6C A;  3VRN A;  1QLS A;  4MBE A;  1DT7 B;  1TCO B;  1QIV A;  1PAL A;  1X02 A;  3TUY C;  3B87 A;  3GOF A;  4A4B A;  5HLV A;  2WOR A;  1J7P A;  1C3Z A;  4QJ4 B;  1EL4 A;  4OZD A;  1AUI B;  1CFD A;  1CFC A;  2G2B A;  1A75 B;  1QS7 A;  2FJY A;  2K7B A;  1OOJ A;  3I5I B;  4HRE E;  2QEO A;  1XFW O;  4INW A;  1D1O A;  2L51 A;  3BYA A;  3CWG A;  3UO9 A;  1IH0 A;  1Y0V H;  2K7D A;  2BEC A;  1CM1 A;  2WCJ A;  2YGU A;  4DCK A;  1CLM A;  3WHT B;  1PUL A;  4PHM A;  4BY4 A;  1BOC A;  1SYM A;  1TNP A;  3EK4 A;  1YR5 A;  3FIA A;  1ZAC A;  2GGM A;  2LMT A;  1S6I A;  2JPT A;  4ORA B;  3LK1 A;  1K96 A;  2E6W A;  1K93 D;  1VRK A;  3L4L A;  4I5L B;  1OSA A;  3I5I C;  2KPH A;  4MRX A;  1SL7 A;  2MAZ A;  3BUO B;  3OP0 A;  2F33 A;  4HRG A;  3SG2 A;  1XVJ A;  2M3W A;  4KYN A;  4MVF A;  1S5G Z;  2HQ8 A;  5AEQ A;  1CLL A;  5FI7 A;  5J3X A;  1WLZ A;  1Y1U A;  2PSR A;  2M29 A;  2M7L A;  1NCX A;  1TUJ A;  1W7J B;  1SMG A;  2LLS A;  1BOD A;  1IG5 A;  1Q80 A;  1DJX A;  2NCO A;  2BE4 A;  1CMG A;  1QVI Y;  2LAN A;  1NUB A;  1CTR A;  4FQO A;  2F3Y A;  1CDN A;  4JPZ B;  1MXL C;  1DJG A;  1SK6 D;  4PE7 A;  1QLK A;  1B8C A;  1TIZ A;  1KFU L;  1QIW A;  2JWW A;  2L2E A;  2QAC A;  3DZT A;  5CSI A;  1B4C A;  4M2P A;  5AXI A;  1KWO B;  3KHE A;  1XYD A;  1J55 A;  1OMR A;  2JC2 A;  5HKZ A;  1DEK A;  2M9G A;  3CLN A;  4ICB A;  5I2Q A;  2R2I A;  1IJ6 A;  4XJK B;  1FW4 A;  1QXP A;  2LUC A;  1UWO A;  3VRQ A;  3GK4 X;  2GGZ A;  2ZNE A;  4U8D A;  5KTY A;  1S1E A;  3L47 A;  2ZND A;  1OOH A;  1P28 A;  1ALV A;  1A75 A;  4NDC A;  1KFU S;  1XFZ O;  2COL B;  2NCP A;  3IVT A;  2E30 A;  3BUX B;  5FI6 A;  2F3Z A;  2G9B A;  4F0Z B;  2FCD A;  3I5F B;  2EC6 B;  2KI6 D;  1KFX L;  2K60 A;  1OOG A;  1SL8 A;  2K0J A;  3PN7 C;  2ISD A;  5CPV A;  5I94 A;  1SCM C;  4AOM A;  3CZT X;  1DVI A;  3AAJ A;  1UHK A;  2LCP A;  3D78 A;  2K61 A;  2K2A A;  1KK7 Y;  2JNF A;  2JUL A;  2MLE C;  2WCM A;  3OHM B;  3R1O A;  4USL A;  5CSF A;  2BAP A;  5FI2 A;  2M7N A;  1JUO A;  2CT9 A;  4N1F A;  4PAL A;  1TNQ A;  2JZI A;  2PRU A;  1XK4 C;  1K2H A;  1SKT A;  4I5K A;  2FJU B;  1E8A A;  1JF0 A;  2JNX A;  5G08 A;  1CB1 A;  3CZ1 A;  2KQY A;  5TNC A;  4YGB B;  2SCP A;  5I2L A;  1CFF A;  2HQW A;  3I5F C;  3KF9 A;  1OE9 B;  4N1G A;  1ZUZ A;  3TDI A;  3CAB A;  1WRL A;  2JT3 A;  1S3P A;  5KU1 A;  1NIW A;  2TN4 A;  2LMV A; 
#chains in the Genus database with same CATH homology
 4GUK A;  1JC2 A;  1B9A A;  4MZJ A;  2KFF A;  2OTG C;  1EG4 A;  4PHN A;  2M0R A;  2L4I A;  3JVT B;  1TTX A;  1L2O B;  2LVK A;  2OPO A;  1FF1 A;  5KSZ A;  4UPG A;  3TUY B;  1K95 A;  4MRY A;  5DKN A;  1PSB A;  2V53 A;  4PDZ A;  4E68 A;  1B1G A;  1SBJ A;  1KSO A;  1M39 A;  1M31 A;  1NYA A;  1WRZ A;  4XJK A;  1KQM B;  1LA0 A;  1CLB A;  1PVB A;  1KQV A;  2MRD A;  3EK8 A;  4GBA A;  4MZK A;  1QAT A;  1B47 A;  2KGB C;  1HT9 A;  3WHU B;  2HPS A;  3JVT C;  1TNW A;  3EK7 A;  1IWQ A;  1L2O C;  1MWN A;  5I8N A;  3K21 A;  1N0Y A;  1R6P A;  2DOQ A;  3FS7 A;  1CFP A;  1XK4 A;  2KI4 B;  4GGF C;  4QJ3 B;  1B8L A;  2HF5 A;  2KYF A;  1F4Q A;  2H2K A;  2Q4U A;  3LLE A;  4FTG A;  1YUU A;  1SW8 A;  5B8I B;  1OQP A;  1GGZ A;  2PAS A;  1KQM C;  3DVE A;  4CFQ A;  1BF5 A;  2F8P A;  2KYC A;  3PAL A;  4AQI A;  2LVV A;  4MLW A;  1UHI A;  4PCW A;  1XFY O;  2EGD A;  4YI8 A;  1QV0 A;  2PVB A;  3O4Y A;  5HKY A;  3DF0 B;  1NX2 A;  4WQ2 A;  3SG4 A;  3FWB A;  1BR4 B;  2FOT A;  2KI4 C;  2MBX A;  1YX8 A;  3TS5 B;  4CPV A;  3LL8 B;  1AK8 A;  1QJT A;  1RK9 A;  1UHN A;  3KO0 A;  3DVJ A;  3PM8 A;  2OS8 C;  1MF8 B;  4YGE B;  3SIB A;  3TZ1 A;  4MEW A;  1DF0 B;  2O5G A;  1F4O A;  2NXQ A;  1BG1 A;  1SPY A;  1DGV A;  3CTN A;  4CFR A;  4YGD B;  5I2O A;  1F54 A;  1SRA A;  2BKI B;  2B1U A;  4TNC A;  3TS5 C;  3SG7 A;  1U5I B;  4QJ5 B;  2KAV A;  1TOP A;  2I18 A;  2M97 A;  1QVI Z;  2K7O A;  4N5X A;  3I5G B;  4OR9 B;  2KSP A;  2BCB A;  4GGF A;  1UUR A;  4P5O E;  4GPL B;  2AAO A;  2F2O A;  1YTZ C;  3CS1 A;  4M2O A;  1NWD A;  2JRF A;  2O60 A;  5AER A;  2JU0 A;  4PHK A;  1MQ1 A;  3BUW B;  1RTP 1;  4PE0 A;  4YGA A;  1RJV A;  2L0P A;  1KCY A;  1A4P A;  1LKJ A;  2M1K B;  1GQM A;  2BCA A;  2AMI A;  2H61 C;  1F70 A;  1WLM A;  1V1G A;  3KEV A;  3EVU A;  3I5G C;  2M1U A;  3PN7 B;  1SCM B;  3VRO A;  1REC A;  3HX4 A;  1Y1X A;  4BY5 A;  1OMD A;  3F45 A;  3TDU A;  3NSK A;  1AVS A;  5ER5 A;  3BQ3 A;  1RFJ A;  5JOL A;  2WCF A;  5JJG A;  5DKQ A;  1PVA A;  1PK0 D;  1JWD A;  3EVR A;  1WDC C;  1LIN A;  1SR6 C;  2KHN A;  2LNK A;  2BKH B;  2LVI A;  1QTX A;  1UP5 A;  2M49 B;  3C1V A;  3CR2 A;  3E3R A;  3A4U B;  2NLN A;  4HSZ A;  3TDZ A;  5D69 A;  4L9M A;  1RWY A;  2ZRS A;  3DF0 A;  5CSJ A;  1ZFS A;  1A29 A;  4I5J A;  1IQ3 A;  3NSI A;  2NZ0 A;  1BR1 B;  1KK7 Z;  1YUT A;  2PAL A;  4C0L A;  1K90 D;  1DJY A;  1PRW A;  2OTG B;  2L50 A;  4GFT A;  2KGR A;  1OMV A;  1XA5 A;  2Q91 A;  1DF0 A;  3SG5 A;  1FBV A;  1J1E A;  3OX5 A;  3RM1 A;  1CM4 A;  3KPX A;  2LVJ A;  4IL1 A;  3ICB A;  1DJZ A;  3NSL A;  2KFH A;  2PMY A;  3PFV A;  1J7O A;  1NCY A;  1CMF A;  2JQ6 A;  2LP2 A;  3A8R A;  4NDD A;  3DVM A;  2WND A;  1U5I A;  1WRK A;  2H61 A;  4R1E A;  2KBM A;  1TN4 A;  5F6T A;  2L5X B;  2LHI A;  2MLF C;  2JT8 A;  3AKB A;  3DVK A;  2ZN8 A;  4GGN A;  1AJ4 A;  4PE1 A;  5ER4 X;  2VRG A;  2QPT A;  2BL0 B;  3PLF B;  3EKJ A;  3WXA A;  1W7I B;  4WRI A;  1F55 A;  3JTD B;  1YRT B;  4A4C A;  1B7T Y;  1LA3 A;  1NSH A;  1F71 A;  3SIA A;  1IJ5 A;  4ETO A;  1IGV A;  1K9P A;  4D1E A;  1ALW A;  2LLU A;  2KOT A;  4MZL A;  1DMO A;  1IQ5 A;  3BUM B;  4M2Q A;  5GQQ C;  1G8I A;  1C7W A;  4NQG A;  1BT6 A;  1YX7 A;  1M46 A;  1YUS A;  5K89 A;  1K9K A;  2CBL A;  2BL0 C;  4YRU A;  1MR8 A;  2JTT A;  2ZFD A;  4DS7 A;  1BJF A;  1G4Y R;  2KFG A;  1A2X A;  3JTD C;  2LLT A;  2MA2 A;  2LUX A;  3GK2 A;  2OS8 B;  3VGO A;  1XFV O;  1H8B A;  3AKA A;  1JF2 A;  2KI6 C;  3SJS A;  3QRX A;  4YBH B;  4MSP A;  1EG3 A;  4CID A;  2EHB A;  3I5H B;  1J7R A;  2Y1M A;  5DKR A;  2L4H A;  3DD4 A;  4JQ0 D;  2CCM A;  2KAY A;  2WC8 A;  1ZMZ A;  2KDH A;  1EJ3 A;  2CTN A;  1TNX A;  1IKU A;  4NDB A;  1S26 D;  1MHO A;  3CR4 X;  2BCX A;  4HRH A;  1FI5 A;  1IRJ A;  1C07 A;  1UHJ A;  4DRW A;  4I5N B;  3M0W A;  1HQV A;  3O2P A;  1DTL A;  4OVN F;  3RLZ A;  3VRP A;  3VRR A;  1BLQ A;  1RRO A;  3I5H C;  1OZO A;  1QX7 A;  4ZCU A;  2LAP A;  2LP3 A;  4PE4 A;  1K9U A;  2GV5 A;  1SNL A;  2WOS A;  1XFX O;  3NSO A;  1KSM A;  3BXK A;  4GNK B;  2KNE A;  5HYD A;  4DUQ A;  1JBA A;  1NCZ A;  5CSN A;  1G33 A;  3BOW B;  1TCF A;  2CXJ A;  3FWC A;  3H4S E;  4OKH A;  5AAN A;  1QV1 A;  2K8M B;  2JXL A;  1S36 A;  1B8R A;  1DJW A;  1S6J A;  4ORC B;  1CKK A;  1AP4 A;  1WDC B;  2Y5I A;  1SR6 B;  1NPQ A;  2RGI A;  2L98 A;  3D0Y B;  1TRF A;  4GAO A;  2ZRT A;  1DGU A;  2BBN A;  1K94 A;  3D10 A;  5HLO A;  2WCE A;  1FI6 A;  3HCM A;  1K8U A;  1S5G Y;  2Y4Q A;  1EH2 A;  1CNP A;  4C0J A;  1OZS A;  2JXC A;  1ODB A;  5HKW A;  1J7Q A;  2SAS A;  1EXR A;  2MHH A;  2I2R E;  1YVL A;  4P2Y B;  1C7V A;  1A03 A;  1JSA A;  2JT0 A;  1LVC D;  4ORB B;  4WQ3 A;  1M63 B;  2LHL A;  2KQ6 A;  2JTZ A;  1NX1 A;  1L7Z A;  4OV2 A;  1MUX A;  4MN0 A;  1CDP A;  1N65 A;  3LK0 A;  1UHH A;  2Y1N A;  1SY9 A;  4XYN A;  1MXE A;  1SCV A;  3BUN B;  4CLN A;  3ZWH A;  1LXF C;  2AUC A;  3MSE B;  3ZNI A;  1F8H A;  1GGW A;  1DJH A;  3PAT A;  5D7F A;  4JWQ A;  4C0K A;  1CDM A;  1XO5 A;  1XFU O;  1KWO C;  4YI9 A;  1AHR A;  4OCI A;  4DIR A;  2KBI A;  2JOJ A;  3OB2 B;  1KK8 B;  2CNP A;  3LCP C;  4PHJ A;  2LMU A;  2LV7 A;  3GK1 A;  1SL9 A;  2A4J A;  3O78 A;  1H4B A;  1QAS A;  3CR5 X;  1UUS A;  3BOW A;  4Q04 A;  1GJY A;  2P6B B;  4YGC B;  2D8N A;  2BE6 A;  3CGA A;  2LC5 A;  2ZN9 A;  3WNX B;  4AQJ A;  1M45 A;  3IQO A;  1Y1A A;  1NX3 A;  3AAK A;  1WY9 A;  3IF7 A;  4ZCV A;  3SG6 A;  5BPJ A;  1YRU B;  3SG3 A;  1B7T Z;  2FCE A;  3PSR A;  1CDL A;  1KK8 C;  3D0Y A;  2EC6 C;  5PAL A;  2KAX A;  2MJW B;  1JFK A;  1KFX S;  1QX5 B;  3EVV A;  1YVH A;  1BU3 A;  1DJI A;  1Y6W A;  2ZKM X;  1AJ5 A;  2K2F A;  1QX2 A;  2K7C A;  2BBM A;  1R2U A;  2IS9 A;  5IBW A;  1PSR A;  1N2D A;  2LE9 B;  3OX6 A;  3IQQ A;  1J1D A;  2M8U A;  1NP8 A;  2I7A A;  3NXA A;  3O6B A;  1JFJ A;  2WCB A;  1BMO A;  3OB1 B;  2HET A;  5FYX A;  2F2P A;  2I94 A;  2LM5 A;  1NX0 A;  1ZOT B;  1FPW A;  5AFP A;  3EKH A;  3VRN A;  1V1F A;  1YUR A;  1S6C A;  1QLS A;  4MBE A;  1DT7 B;  1TCO B;  1QIV A;  1PAL A;  1X02 A;  3TUY C;  3GOF A;  4A4B A;  5HLV A;  2WOR A;  1J7P A;  4QJ4 B;  1EL4 A;  1AUI B;  1CFD A;  1CFC A;  2G2B A;  1A75 B;  1QS7 A;  2K7B A;  1OOJ A;  3I5I B;  4HRE E;  1XFW O;  1D1O A;  2L51 A;  3BYA A;  3CWG A;  1IH0 A;  1Y0V H;  2K7D A;  2BEC A;  1CM1 A;  4DCK A;  1CLM A;  3WHT B;  1PUL A;  4PHM A;  4BY4 A;  1BOC A;  1SYM A;  1TNP A;  3EK4 A;  1YR5 A;  3FIA A;  1ZAC A;  2GGM A;  2LMT A;  1S6I A;  2JPT A;  4ORA B;  3LK1 A;  1K96 A;  2E6W A;  1K93 D;  1VRK A;  4I5L B;  1OSA A;  3I5I C;  4MRX A;  1SL7 A;  2MAZ A;  3BUO B;  3OP0 A;  2F33 A;  4HRG A;  3SG2 A;  1XVJ A;  2M3W A;  4MVF A;  1S5G Z;  2HQ8 A;  5AEQ A;  1CLL A;  5J3X A;  1WLZ A;  1Y1U A;  2PSR A;  2M29 A;  2M7L A;  1NCX A;  1W7J B;  1SMG A;  2LLS A;  1BOD A;  1IG5 A;  1Q80 A;  1DJX A;  2NCO A;  2BE4 A;  1CMG A;  1QVI Y;  2LAN A;  1NUB A;  1CTR A;  4FQO A;  2F3Y A;  1CDN A;  4JPZ B;  1MXL C;  1DJG A;  1SK6 D;  4PE7 A;  1QLK A;  1B8C A;  1TIZ A;  1KFU L;  1QIW A;  2JWW A;  2L2E A;  2QAC A;  5CSI A;  1B4C A;  4M2P A;  5AXI A;  1KWO B;  3KHE A;  1XYD A;  1J55 A;  1OMR A;  2JC2 A;  5HKZ A;  2M9G A;  3CLN A;  4ICB A;  5I2Q A;  2R2I A;  1IJ6 A;  4XJK B;  1FW4 A;  1QXP A;  2LUC A;  1UWO A;  3VRQ A;  3GK4 X;  2GGZ A;  2ZNE A;  4U8D A;  5KTY A;  1S1E A;  2ZND A;  1ALV A;  1A75 A;  4NDC A;  1KFU S;  1XFZ O;  2COL B;  2NCP A;  2E30 A;  3BUX B;  4F0Z B;  2F3Z A;  2G9B A;  2FCD A;  3I5F B;  2EC6 B;  2KI6 D;  1KFX L;  1SL8 A;  2K0J A;  3PN7 C;  2ISD A;  5CPV A;  1SCM C;  4AOM A;  3CZT X;  1DVI A;  3AAJ A;  1UHK A;  2LCP A;  3OHM B;  2K61 A;  2K2A A;  1KK7 Y;  2JNF A;  2JUL A;  2MLE C;  1K2H A;  4USL A;  5CSF A;  2M7N A;  1JUO A;  2CT9 A;  4N1F A;  4PAL A;  1TNQ A;  2JZI A;  2PRU A;  1XK4 C;  1SKT A;  4I5K A;  2FJU B;  1E8A A;  1JF0 A;  2JNX A;  5G08 A;  1CB1 A;  2KQY A;  5TNC A;  4YGB B;  2SCP A;  5I2L A;  1CFF A;  2HQW A;  3I5F C;  3KF9 A;  1OE9 B;  4N1G A;  1ZUZ A;  3TDI A;  1WRL A;  2JT3 A;  1S3P A;  5KU1 A;  1NIW A;  2TN4 A;  2LMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...