4PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
total genus 43
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4palA00
2ZNDA 2WOSA 1A03A 2A4JA 1SR6C 1RWYA 1BLQA 1DGVA 1DJXA 1QVIY 3EVVA 4JQ0D 3ZWHA 1QX7A 2KOTA 3EK8A 4ORCB 3EK7A 4XYNA 5D7FA 4DCKA 2GGMA 4GPLB 1QV0A 2PRUA 1K2HA 3BUNB 1MXEA 2JTZA 4I5LB 4USLA 1SYMA 2JXCA 2LMTA 1PRWA 3CTNA 1JF0A 1BT6A 2OTGC 1A29A 4CLNA 1CDLA 2LC5A 1Y0VH 3ZNIA 2HQWA 1XFYO 3CWGA 3NSIA 1QLKA 4MZJA 2P6BB 1SMGA 2V53A 1IG5A 1J1DA 1UWOA 1QTXA 1CFCA 3OX6A 4L9MA 2LP3A 1J7PA 2KQYA 2LVKA 1F55A 4ICBA 2M0RA 1CB1A 1K9KA 2LUXA 2WCEA 4PHNA 1A75A 2M9GA 2LM5A 3O2PA 1YUUA 1WRKA 1LINA 2LP2A 2NXQA 2EC6B 3I5IB 3O78A 1WRZA 1OQPA 1S6IA 1HT9A 3VRNA 2KSPA 1A2XA 1RK9A 2PALA 3QRXA 1M46A 2PASA 4ORBB 1QIWA 3AAJA 5AEQA 3FWCA 2HQ8A 1DJHA 1CFFA 4DIRA 4PHKA 1QX2A 3ICBA 1CLMA 3LK0A 3OX5A 1SL8A 1EH2A 4N1GA 3TS5B 2WNDA 3GOFA 3HX4A 2L98A 1KFUS 1S6CA 3BOWB 1XK4C 1CDMA 1SK6D 1F4OA 1GJYA 1WY9A 2FCEA 3A8RA 2LVVA 1K9PA 2JTTA 1B7TZ 4YI8A 2KAYA 1FF1A 5HLVA 2MLFC 2K2AA 3TDUA 2AAOA 4WQ2A 3SG5A 5CPVA 2MRDA 4YGBB 5J3XA 2NCOA 2ZNEA 2COLB 2JPTA 2H61A 1XVJA 2LMUA 4PE4A 4C0JA 2BCXA 1XFXO 4OV2A 3I5HB 5DKNA 2JULA 3BXKA 5GQQC 2BKIB 3JTDC 2I18A 4YGDB 4YI9A 1F4QA 4ZCUA 2PVBA 5AERA 4WRIA 1D1OA 3SG4A 3JVTC 2NCPA 1TNQA 1C07A 1UUSA 2BE4A 2HETA 3I5FC 2JXLA 1NCZA 4I5NB 1CDNA 4PE7A 3KF9A 3KPXA 4M2PA 1JFJA 4HRHA 2NZ0A 2BCBA 1L2OC 1CM4A 2K7CA 3DVJA 3OHMB 2LLTA 1PALA 1H4BA 1B9AA 1TTXA 1Y1AA 5JJGA 4PHMA 3PN7B 4GGFA 4P5OE 5KSZA 4BY5A 1UURA 2I94A 3OB1B 1PVAA 5HKZA 5I2OA 1CKKA 3BOWA 4F0ZB 2BL0B 1BF5A 5BPJA 4A4BA 2K7DA 5KU1A 2I2RE 5TNCA 3D0YB 2BE6A 3PLFB 2FOTA 3RLZA 4N5XA 1FBVA 1S1EA 1TOPA 2SASA 5CSNA 2QPTA 1KWOB 5I8NA 1DJGA 2CTNA 2MA2A 3SIAA 1SCMC 1R6PA 3AKBA 1CLBA 3M0WA 2HPSA 2LHLA 2LVJA 1UHIA 4D1EA 4ETOA 1NX1A 2JT0A 2KYFA 4AQJA 1Y1XA 2ZN9A 3AAKA 1J55A 2OS8B 1RECA 3EKHA 4QJ5B 1DGUA 1B4CA 3LCPC 1RJVA 4QJ4B 1OMDA 3PFVA 4PDZA 5JOLA 1S5GY 3SG7A 4IL1A 1K94A 1SL7A 2GGZA 2K2FA 3TS5C 3GK1A 2HF5A 3MSEB 1UP5A 3DVKA 1NP8A 1NCXA 1YRTB 3GK4X 1KFUL 1UHKA 2LUCA 1BU3A 1YTZC 2F2OA 1CMGA 1F54A 1ZOTB 1FI6A 4GNKB 1NX0A 2K61A 1KQVA 1QX5B 4BY4A 4U8DA 5AFPA 1U5IA 3CZTX 2WCBA 1LA3A 3D0YA 3VROA 2BCAA 2E30A 5K89A 3AKAA 3TUYC 1AP4A 1IKUA 4YGAA 3DF0B 1KSMA 2JT8A 1B8CA 4ORAB 2JNXA 4FTGA 1K96A 3IQOA 2VRGA 4A4CA 2FCDA 1KK8C 1C7VA 4DUQA 2M3WA 5CSIA 2ISDA 1YVHA 1YX8A 1CFPA 4CFRA 2KI4B 1DJYA 2KFGA 1YURA 2L50A 1BMOA 1SW8A 2M1UA 3PALA 5DKQA 1NCYA 1WDCC 1LVCD 1XFZO 2Q4UA 4UPGA 1F71A 1CM1A 1G8IA 2F8PA 3WNXB 1UHNA 4CIDA 1BR4B 3PN7C 3CR4X 3A4UB 1K90D 1TNWA 1QJTA 2LAPA 1IGVA 2KFFA 1YVLA 2L5XB 2O5GA 2F2PA 1EG4A 1ZFSA 3NXAA 2KQ6A 2I7AA 2RGIA 2GV5A 3DVMA 5CSFA 2E6WA 1IQ3A 1LXFC 4GBAA 1DF0A 4MEWA 2JWWA 2CCMA 2KYCA 2K0JA 1GQMA 2CT9A 2O60A 3I5GB 3TDIA 4CFQA 3O4YA 1XA5A 4YRUA 1JWDA 1SR6B 4NDDA 5B8IB 1K8UA 1W7JB 1SL9A 3WHTB 4NDBA 1MF8B 1BOCA 4YGCB 1K95A 2ZRSA 2IS9A 3KHEA 3PM8A 2EGDA 5I2QA 1M63B 1FW4A 1PSBA 3C1VA 1MQ1A 1KQMC 2DOQA 3DF0A 1IJ6A 4HSZA 1J7RA 1ZUZA 1CDPA 1OSAA 4HREE 2PSRA 1OZSA 2G2BA 1AJ4A 3KEVA 1RTP1 3CS1A 5FYXA 2QACA 1G33A 4AOMA 1F70A 4JPZB 2CNPA 1QVIZ 1JC2A 1MUXA 2JZIA 1BODA 4E68A 3KO0A 3BUXB 2OPOA 5HYDA 4OR9B 1SNLA 4I5KA 1A4PA 1U5IB 3EVRA 3NSOA 1SPYA 1JBAA 1V1FA 3H4SE 4P2YB 4M2QA 1SRAA 1E8AA 2H61C 2CXJA 2FJUB 4QJ3B 2EHBA 2ZKMX 3BUWB 3HCMA 1QXPA 1SCVA 1NX2A 1N0YA 2KGBC 5PALA 1B1GA 2L2EA 1BG1A 1RFJA 2D8NA 1LA0A 3BUOB 4PE0A 1B7TY 4CPVA 1QS7A 2EC6C 3F45A 3I5IC 5ER4X 4ZCVA 1PK0D 1M31A 3BQ3A 4MZLA 2KAVA 3EK4A 1K93D 1TNPA 1OOJA 3CLNA 3SG3A 1OMRA 3BUMB 2L4IA 4FQOA 2KHNA 2KAXA 1F8HA 2M7LA 4MRXA 3LL8B 2B1UA 4GGFC 1N2DA 3SG6A 4MZKA 5ER5A 1XFVO 1YX7A 2KDHA 4MRYA 5D69A 2LLSA 1EG3A 1QV1A 1EXRA 2K7OA 1DF0B 1ZACA 2JQ6A 5AANA 4XJKA 4JWQA 1DJZA 3DD4A 1DJIA 1K9UA 1MHOA 2R2IA 4WQ3A 1UHHA 1QLSA 2MAZA 1DMOA 2JRFA 1C7WA 2MBXA 1QASA 2KFHA 1QATA 3JVTB 5CSJA 5F6TA 3I5FB 1AUIB 1R2UA 3SG2A 2CBLA 1B8LA 2LNKA 2PMYA 4OVNF 4GFTA 1IH0A 4OKHA 1AVSA 5AXIA 2KI6C 2SCPA 1L2OB 1BJFA 3EVUA 1W7IB 3I5HC 2MJWB 3TDZA 2F3ZA 3FWBA 1KFXL 1NUBA 1MWNA 1NSHA 2M8UA 2WC8A 5G08A 1Y6WA 1HQVA 3CR2A 1TCOB 4PALA 3NSLA 1CNPA 4AQIA 2TN4A 1DTLA 2KI6D 3O6BA 1TNXA 4N1FA 2F33A 3WXAA 1ALWA 3FIAA 1XK4A 4MSPA 2LLUA 1NIWA 1WLZA 1JUOA 4MBEA 1UHJA 2L4HA 3GK2A 1VRKA 1KK7Y 1SY9A 1KCYA 1JFKA 3FS7A 1S6JA 1TCFA 1SCMB 3IQQA 2KGRA 1WRLA 3E3RA 1PVBA 2Y5IA 1ALVA 1X02A 3LLEA 5HKYA 1G4YR 3VGOA 1S3PA 1FPWA 1IWQA 1IRJA 2AMIA 1AHRA 2BL0C 2MLEC 2KNEA 2BBMA 4PCWA 1PSRA 2KBIA 2LCPA 4GUKA 1AK8A 1YUSA 3BYAA 3OP0A 1KWOC 1QIVA 1TN4A 1DVIA 2JNFA 3SJSA 3SIBA 2Q91A 1CMFA 2BECA 1J7OA 2LANA 1RROA 1S26D 1B8RA 2KBMA 1KFXS 5IBWA 1CFDA 2JU0A 4YGEB 2G9BA 1TRFA 4HRGA 1NYAA 2ZRTA 5HKWA 2OS8C 4M2OA 4NDCA 1SBJA 1YUTA 2OTGB 1N65A 1NPQA 3K21A 3IF7A 3EKJA 4OCIA 1OZOA 2L0PA 1XFUO 1AJ5A 1BR1B 1L7ZA 3PATA 4C0KA 1KSOA 1CTRA 1XFWO 1MR8A 1Q80A 2ZN8A 3TUYB 1M45A 4XJKB 2LE9B 2BKHB 1DJWA 1S5GZ 4MN0A 3WHUB 1CLLA 5I2LA 2NLNA 2JC2A 1JSAA 3OB2B 4GAOA 2LV7A 3D10A 4PE1A 1KK8B 5HLOA 4DRWA 2MHHA 3RM1A 2WCFA 1NX3A 2Y1MA 1YRUB 4DS7A 1EL4A 1PULA 2LHIA 2M1KB 1J7QA 3VRRA 4R1EA 1S36A 3DVEA 1WLMA 4MVFA 4TNCA 1J1EA 4NQGA 1H8BA 1WDCB 1YR5A 3CR5X 1NWDA 1V1GA 1SKTA 2H2KA 2WORA 2Y4QA 1IQ5A 1ODBA 1XO5A 1XYDA 1ZMZA 2ZFDA 2M29A 1LKJA 2K7BA 4PHJA 1OE9B 2M97A 4I5JA 4C0LA 2KI4C 4Q04A 2LMVA 1EJ3A 4GGNA 1MXLC 2LVIA 2K8MB 1A75B 1TIZA 2Y1NA 3NSKA 1IJ5A 2F3YA 2M7NA 2JOJA 1Y1UA 1DT7B 1GGWA 3CGAA 1B47A 1JF2A 1GGZA 1KK7Z 1OMVA 2AUCA 2M49B 5DKRA 4YBHB 3TZ1A 4MLWA 2L51A 3PSRA 3VRPA 1KQMB 3JTDB 1M39A 3VRQA 2BBNA 1FI5A 5KTYA 3I5GC 2JT3A 3LK1A
chains in the Genus database with same CATH superfamily
2ZNDA 2JPOA 5D3OA 2WOSA 1A03A 2A4JA 1SR6C 1RWYA 1BLQA 1DGVA 1DJXA 1QVIY 3EVVA 4JQ0D 3ZWHA 1QX7A 2KOTA 3EK8A 4ORCB 3EK7A 4XYNA 5D7FA 4DCKA 1OOHA 2GGMA 4GPLB 1QV0A 2PRUA 1K2HA 3BUNB 1MXEA 2JTZA 4I5LB 4USLA 4F7FA 1SYMA 2JXCA 2LMTA 1PRWA 3CTNA 4INWA 1JF0A 1BT6A 2OTGC 1A29A 2GTEA 4CLNA 2WCMA 1CDLA 2LC5A 1Y0VH 4PT1A 3ZNIA 2HQWA 1XFYO 3CWGA 3NSIA 1QLKA 4MZJA 2P6BB 1SMGA 2V53A 1IG5A 1J1DA 1OOGA 1QTXA 1UWOA 3OX6A 1CFCA 4L9MA 2K60A 3RZSA 2LP3A 1J7PA 2KQYA 2LVKA 1F55A 4ICBA 2M0RA 1CB1A 1K9KA 2LUXA 2WCEA 4PHNA 1A75A 2M9GA 1Z4HA 4INXA 2LM5A 3O2PA 2H8VA 1YUUA 1WRKA 1LINA 2LP2A 2NXQA 2EC6B 3I5IB 3O78A 1WRZA 1OQPA 1S6IA 1HT9A 3VRNA 3SS4A 2KSPA 1A2XA 1RK9A 2PALA 3QRXA 1M46A 2PASA 2PYQA 1QIWA 2BAPA 3AAJA 4ORBB 5AEQA 3FWCA 2HQ8A 1DJHA 1CFFA 4DIRA 4PHKA 1QX2A 3ICBA 1CLMA 3LK0A 3O4XA 3OX5A 1SL8A 1EH2A 4N1GA 3TS5B 2WNDA 3GOFA 3HX4A 2L98A 1KFUS 1S6CA 2QEVA 1XK4C 3BOWB 1CDMA 1SK6D 2WCKA 3CZ1A 1F4OA 1GJYA 1WY9A 2FCEA 3A8RA 2LVVA 3S0AA 1K9PA 2JTTA 1B7TZ 4YI8A 2KAYA 1FF1A 5HLVA 2MLFC 2K2AA 3TDUA 2AAOA 4WQ2A 3SG5A 2WCJA 5CPVA 2MRDA 4YGBB 5J3XA 2NCOA 2ZNEA 2COLB 2JPTA 2H61A 1XVJA 2LMUA 4PE4A 4C0JA 2BCXA 1XFXO 4OV2A 3I5HB 5DKNA 2JULA 3BXKA 5GQQC 2BKIB 3JTDC 2I18A 4YGDB 4YI9A 1F4QA 4ZCUA 2PVBA 5AERA 4WRIA 1D1OA 3SG4A 3BFBA 3JVTC 2NCPA 1TNQA 1C07A 1UUSA 2BE4A 2HETA 3I5FC 2JXLA 1NCZA 3OGNA 4I5NB 3DXLA 3Q8IA 4PE7A 3KF9A 3KPXA 5FI6A 1CDNA 4M2PA 1JFJA 4HRHA 2NZ0A 2BCBA 1L2OC 1CM4A 2K7CA 3DVJA 3OHMB 4FQTA 2LLTA 1PALA 1Z2CB 1H4BA 1B9AA 1TTXA 1Y1AA 5JJGA 4PHMA 3PN7B 4GGFA 4P5OE 5KSZA 4BY5A 1UURA 2I94A 3OB1B 1PVAA 5HKZA 5I2OA 1CKKA 3UO9A 3BOWA 3S0EA 2BL0B 4F0ZB 1BF5A 5BPJA 4A4BA 2K7DA 3R1VA 5KU1A 2I2RE 5TNCA 3D0YB 2BE6A 3PLFB 2FOTA 3RLZA 5I94A 3DY9A 4N5XA 1FBVA 1S1EA 1TOPA 2SASA 5CSNA 2QPTA 1KWOB 5I8NA 1DJGA 2CTNA 2MA2A 3SIAA 1SCMC 3D73A 1R6PA 3AKBA 1CLBA 3M0WA 2HPSA 2P71A 2LHLA 2LVJA 1UHIA 4D1EA 4ETOA 1NX1A 2JT0A 2KYFA 4AQJA 1Y1XA 3D78A 2ZN9A 3S0FA 1P28A 3K1EA 3AAKA 1J55A 2OS8B 1RECA 3EKHA 4QJ5B 1DGUA 1B4CA 3LCPC 1RJVA 4QJ4B 1OMDA 3PFVA 2YGUA 4PDZA 5JOLA 1S5GY 2KLDA 3SG7A 4IL1A 1K94A 1SL7A 2GGZA 2K2FA 3R1OA 3TS5C 3GK1A 3PJIA 2HF5A 3MSEB 1UP5A 3DVKA 1NP8A 1NCXA 1YRTB 3GK4X 3S0DA 1KFUL 1UHKA 2LUCA 3B88A 3NGVA 1BU3A 1YTZC 2F2OA 1CMGA 1F54A 1ZOTB 1FI6A 4GNKB 1NX0A 2K61A 1KQVA 1QX5B 3B86A 4BY4A 1T14A 4U8DA 3FE6A 5AFPA 1U5IA 3CZTX 2WCBA 1LA3A 3D0YA 3VROA 2BCAA 2E30A 5K89A 3AKAA 3TUYC 1AP4A 1IKUA 4YGAA 3DF0B 1KSMA 2JT8A 1B8CA 4ORAB 2JNXA 4FTGA 1K96A 3BFHA 3IQOA 2VRGA 4A4CA 2FCDA 1KK8C 1C7VA 2KLEA 4DUQA 2M3WA 5CSIA 3OBVA 1YVHA 1YX8A 2ISDA 3NHIA 4CFRA 2KPHA 1CFPA 4OZDA 1DQEA 2KI4B 2BNXA 2WC6A 1DJYA 2KFGA 1YURA 2L50A 1BMOA 1SW8A 2M1UA 3PALA 5DKQA 1NCYA 1WDCC 1LVCD 1XFZO 2Q4UA 5EL2A 4UPGA 1F71A 1CM1A 1G8IA 2F8PA 3BJHA 3WNXB 1UHNA 4CIDA 1BR4B 3PN7C 3CR4X 3A4UB 1K90D 1TNWA 1QJTA 2LAPA 1IGVA 2KFFA 1YVLA 2L5XB 2O5GA 2F2PA 1EG4A 1ZFSA 3NXAA 2KQ6A 3CABA 2I7AA 2RGIA 2GV5A 3DVMA 5CSFA 3UNWA 2E6WA 2QDIA 1IQ3A 1LXFC 4GBAA 1DF0A 4MEWA 1OW4A 2JWWA 2CCMA 2KYCA 2K0JA 1GQMA 2CT9A 2O60A 3I5GB 3TDIA 4CFQA 1DC1A 3O4YA 3B87A 3L4LA 1XA5A 3CYZA 4YRUA 1JWDA 1SR6B 4NDDA 5B8IB 1K8UA 1W7JB 1SL9A 3WHTB 4NDBA 1MF8B 1BOCA 4YGCB 1K95A 2ZRSA 2IS9A 3KHEA 3PM8A 2EGDA 5I2QA 1M63B 1FW4A 1PSBA 3C1VA 3CZ0A 1MQ1A 1KQMC 2DOQA 3DF0A 1IJ6A 4HSZA 1J7RA 1ZUZA 1CDPA 1OSAA 4HREE 3NHTA 2PSRA 1OZSA 2G2BA 1AJ4A 3CZ2A 1RTP1 3KEVA 3CS1A 3L4AA 5FYXA 2QACA 1G33A 3SS3A 2L5YA 4AOMA 1F70A 3PM2A 4JPZB 2CNPA 1QVIZ 1JC2A 1MUXA 2JZIA 3D74A 1BODA 1DEKA 4E68A 3KO0A 3BUXB 2OPOA 5HYDA 4OR9B 2QEBA 1SNLA 4I5KA 1XFRA 1A4PA 1U5IB 3EVRA 3NSOA 4JKTA 1SPYA 1JBAA 1V1FA 3H4SE 4P2YB 4M2QA 1SRAA 1E8AA 2H61C 2CXJA 2FJUB 4QJ3B 2EHBA 2ZKMX 3BUWB 3HCMA 1QXPA 1SCVA 1NX2A 1N0YA 2KGBC 5PALA 1B1GA 2L2EA 1BG1A 1RFJA 2D8NA 4JD9A 1LA0A 3BUOB 4PE0A 1B7TY 4CPVA 1QS7A 2EC6C 3D75A 3F45A 3I5IC 5ER4X 4ZCVA 1PK0D 3SS5A 1M31A 3BQ3A 4MZLA 1C3ZA 2KAVA 3EK4A 1K93D 1TNPA 1OOJA 3CLNA 3SG3A 1OMRA 3BUMB 2L4IA 4FQOA 3L47A 2KHNA 2KAXA 4KYNA 1F8HA 2M7LA 4MRXA 3LL8B 2B1UA 4GGFC 1N2DA 3SG6A 4MZKA 2L2CA 5ER5A 1XFVO 1YX7A 2KDHA 4MRYA 5D69A 2LLSA 1EG3A 1QV1A 2WCLA 3EG5B 1EXRA 2K7OA 1DF0B 1ZACA 2JQ6A 5AANA 4XJKA 3R1PA 4JWQA 1ORGA 1DJZA 3DD4A 1DJIA 1K9UA 1MHOA 2R2IA 4WQ3A 1UHHA 1QLSA 2MAZA 1DMOA 2JRFA 1C7WA 2MBXA 3VB1A 1QASA 2KFHA 1QATA 2WCHA 3JVTB 5CSJA 5F6TA 3I5FB 1AUIB 1QWVA 1R2UA 3SG2A 3D76A 2CBLA 1B8LA 2LNKA 2PMYA 3R72A 2P70A 4OVNF 3S0BA 4GFTA 1IH0A 4OKHA 1AVSA 5AXIA 2KI6C 2SCPA 1L2OB 1BJFA 3EVUA 1W7IB 3I5HC 2MJWB 3TDZA 2F3ZA 3FWBA 1KFXL 1NUBA 1MWNA 1NSHA 2M8UA 2WC8A 5G08A 1Y6WA 1HQVA 3CR2A 1TCOB 4PALA 3NSLA 1CNPA 4AQIA 2TN4A 1DTLA 2KI6D 3O6BA 1TNXA 4N1FA 2F33A 3WXAA 1ALWA 3B7AA 1XK4A 3FIAA 4MSPA 2LLUA 1NIWA 1WLZA 1JUOA 4MBEA 1UHJA 2L4HA 3GK2A 1VRKA 1KK7Y 1SY9A 3FE9A 4IJ7A 1KCYA 1JFKA 3FS7A 1S6JA 1TCFA 1SCMB 3IQQA 2KGRA 1WRLA 3E3RA 1PVBA 2Y5IA 1ALVA 1X02A 1OOIX 3LLEA 5HKYA 1G4YR 3N7HA 1S3PA 3VGOA 1FPWA 2ERBA 1IWQA 1W9ZA 1IRJA 2AMIA 1AHRA 2BL0C 2MLEC 1SSEB 2KNEA 2BBMA 4PCWA 1PSRA 2KBIA 2LCPA 5HL1A 4GUKA 1AK8A 1YUSA 3BYAA 2QEOA 3OP0A 1KWOC 1QIVA 1TN4A 1DVIA 2JNFA 3DYEA 3SIBA 2Q91A 3SJSA 1CMFA 2BECA 1J7OA 3B6XA 2LANA 2PQLA 3V2LA 1RROA 1S26D 1B8RA 2KBMA 1KFXS 5IBWA 1CFDA 2JU0A 4YGEB 2G9BA 1TRFA 4HRGA 1NYAA 2ZRTA 5HKWA 2OS8C 4M2OA 4NDCA 1SBJA 1YUTA 2OTGB 1N65A 1NPQA 3K21A 3IF7A 3EKJA 4OCIA 1OZOA 2L0PA 1XFUO 2WC5A 1AJ5A 1BR1B 1L7ZA 3PATA 5FI2A 4C0KA 1KSOA 1CTRA 1XFWO 3BFAA 1MR8A 1Q80A 3S0GA 2ZN8A 3FE8A 3TUYB 3DZTA 1M45A 4XJKB 2LE9B 1TUZA 1DJWA 1S5GZ 2BKHB 4MN0A 1CLLA 5I2LA 2NLNA 3WHUB 1C3YA 1DELA 2JC2A 1JSAA 3OB2B 4GAOA 2LV7A 3D10A 4PE1A 3QMEA 1KK8B 5HLOA 5DICA 2MHHA 4DRWA 3RM1A 2WCFA 1NX3A 2Y1MA 1YRUB 4DS7A 1EL4A 1PULA 2LHIA 1TUJA 2M1KB 1J7QA 3VRRA 4R1EA 1S36A 3DVEA 1WLMA 4MVFA 4TNCA 1J1EA 4NQGA 3IVTA 1H8BA 1WDCB 1YR5A 3CR5X 1OOFA 1NWDA 1V1GA 2QEHA 1LS8A 1SKTA 2H2KA 2WORA 2Y4QA 1IQ5A 1ODBA 1XO5A 1ZMZA 1XYDA 2ZFDA 1IIOA 3CDNA 2M29A 1LKJA 1TWOA 2K7BA 4PHJA 1OE9B 2M97A 4I5JA 4C0LA 2KI4C 4Q04A 2FJYA 2LMVA 1EJ3A 4GGNA 1MXLC 2LVIA 2K8MB 1A75B 1TIZA 2Y1NA 3NSKA 1IJ5A 2F3YA 2M7NA 5FI7A 2JOJA 1Y1UA 1DT7B 1GGWA 1GM0A 3CGAA 1B47A 1JF2A 1GGZA 1KK7Z 1OMVA 2AUCA 2M49B 5DKRA 3D77A 4YBHB 3TZ1A 4MLWA 2L51A 3PSRA 3VRPA 1KQMB 3JTDB 1M39A 3VRQA 2BBNA 1FI5A 5KTYA 3I5GC 2JT3A 3LK1A
chains in the Genus database with same CATH topology
2ZNDA 2WOSA 1A03A 2A4JA 1SR6C 1RWYA 1BLQA 1DGVA 1DJXA 1QVIY 3EVVA 4JQ0D 3ZWHA 1QX7A 2KOTA 3EK8A 4ORCB 3EK7A 4XYNA 5D7FA 4DCKA 2GGMA 4GPLB 1QV0A 2PRUA 1K2HA 3BUNB 1MXEA 2JTZA 4I5LB 4USLA 1SYMA 2JXCA 2LMTA 1PRWA 3CTNA 1JF0A 1BT6A 2OTGC 1A29A 4CLNA 1CDLA 2LC5A 1Y0VH 3ZNIA 2HQWA 1XFYO 3CWGA 3NSIA 1QLKA 4MZJA 2P6BB 1SMGA 2V53A 1IG5A 1J1DA 1UWOA 1QTXA 1CFCA 3OX6A 4L9MA 2LP3A 1J7PA 2KQYA 2LVKA 1F55A 4ICBA 2M0RA 1CB1A 1K9KA 2LUXA 2WCEA 4PHNA 1A75A 2M9GA 2LM5A 3O2PA 1YUUA 1WRKA 1LINA 2LP2A 2NXQA 2EC6B 3I5IB 3O78A 1WRZA 1OQPA 1S6IA 1HT9A 3VRNA 2KSPA 1A2XA 1RK9A 2PALA 3QRXA 1M46A 2PASA 4ORBB 1QIWA 3AAJA 5AEQA 3FWCA 2HQ8A 1DJHA 1CFFA 4DIRA 4PHKA 1QX2A 3ICBA 1CLMA 3LK0A 3OX5A 1SL8A 1EH2A 4N1GA 3TS5B 2WNDA 3GOFA 3HX4A 2L98A 1KFUS 1S6CA 3BOWB 1XK4C 1CDMA 1SK6D 1F4OA 1GJYA 1WY9A 2FCEA 3A8RA 2LVVA 1K9PA 2JTTA 1B7TZ 4YI8A 2KAYA 1FF1A 5HLVA 2MLFC 2K2AA 3TDUA 2AAOA 4WQ2A 3SG5A 5CPVA 2MRDA 4YGBB 5J3XA 2NCOA 2ZNEA 2COLB 2JPTA 2H61A 1XVJA 2LMUA 4PE4A 4C0JA 2BCXA 1XFXO 4OV2A 3I5HB 5DKNA 2JULA 3BXKA 5GQQC 2BKIB 3JTDC 2I18A 4YGDB 4YI9A 1F4QA 4ZCUA 2PVBA 5AERA 4WRIA 1D1OA 3SG4A 3JVTC 2NCPA 1TNQA 1C07A 1UUSA 2BE4A 2HETA 3I5FC 2JXLA 1NCZA 4I5NB 1CDNA 4PE7A 3KF9A 3KPXA 4M2PA 1JFJA 4HRHA 2NZ0A 2BCBA 1L2OC 1CM4A 2K7CA 3DVJA 3OHMB 2LLTA 1PALA 1H4BA 1B9AA 1TTXA 1Y1AA 5JJGA 4PHMA 3PN7B 4GGFA 4P5OE 5KSZA 4BY5A 1UURA 2I94A 3OB1B 1PVAA 5HKZA 5I2OA 1CKKA 3BOWA 4F0ZB 2BL0B 1BF5A 5BPJA 4A4BA 2K7DA 5KU1A 2I2RE 5TNCA 3D0YB 2BE6A 3PLFB 2FOTA 3RLZA 4N5XA 1FBVA 1S1EA 1TOPA 2SASA 5CSNA 2QPTA 1KWOB 5I8NA 1DJGA 2CTNA 2MA2A 3SIAA 1SCMC 1R6PA 3AKBA 1CLBA 3M0WA 2HPSA 2LHLA 2LVJA 1UHIA 4D1EA 4ETOA 1NX1A 2JT0A 2KYFA 4AQJA 1Y1XA 2ZN9A 3AAKA 1J55A 2OS8B 1RECA 3EKHA 4QJ5B 1DGUA 1B4CA 3LCPC 1RJVA 4QJ4B 1OMDA 3PFVA 4PDZA 5JOLA 1S5GY 3SG7A 4IL1A 1K94A 1SL7A 2GGZA 2K2FA 3TS5C 3GK1A 2HF5A 3MSEB 1UP5A 3DVKA 1NP8A 1NCXA 1YRTB 3GK4X 1KFUL 1UHKA 2LUCA 1BU3A 1YTZC 2F2OA 1CMGA 1F54A 1ZOTB 1FI6A 4GNKB 1NX0A 2K61A 1KQVA 1QX5B 4BY4A 4U8DA 5AFPA 1U5IA 3CZTX 2WCBA 1LA3A 3D0YA 3VROA 2BCAA 2E30A 5K89A 3AKAA 3TUYC 1AP4A 1IKUA 4YGAA 3DF0B 1KSMA 2JT8A 1B8CA 4ORAB 2JNXA 4FTGA 1K96A 3IQOA 2VRGA 4A4CA 2FCDA 1KK8C 1C7VA 4DUQA 2M3WA 5CSIA 2ISDA 1YVHA 1YX8A 1CFPA 4CFRA 2KI4B 1DJYA 2KFGA 1YURA 2L50A 1BMOA 1SW8A 2M1UA 3PALA 5DKQA 1NCYA 1WDCC 1LVCD 1XFZO 2Q4UA 4UPGA 1F71A 1CM1A 1G8IA 2F8PA 3WNXB 1UHNA 4CIDA 1BR4B 3PN7C 3CR4X 3A4UB 1K90D 1TNWA 1QJTA 2LAPA 1IGVA 2KFFA 1YVLA 2L5XB 2O5GA 2F2PA 1EG4A 1ZFSA 3NXAA 2KQ6A 2I7AA 2RGIA 2GV5A 3DVMA 5CSFA 2E6WA 1IQ3A 1LXFC 4GBAA 1DF0A 4MEWA 2JWWA 2CCMA 2KYCA 2K0JA 1GQMA 2CT9A 2O60A 3I5GB 3TDIA 4CFQA 3O4YA 1XA5A 4YRUA 1JWDA 1SR6B 4NDDA 5B8IB 1K8UA 1W7JB 1SL9A 3WHTB 4NDBA 1MF8B 1BOCA 4YGCB 1K95A 2ZRSA 2IS9A 3KHEA 3PM8A 2EGDA 5I2QA 1M63B 1FW4A 1PSBA 3C1VA 1MQ1A 1KQMC 2DOQA 3DF0A 1IJ6A 4HSZA 1J7RA 1ZUZA 1CDPA 1OSAA 4HREE 2PSRA 1OZSA 2G2BA 1AJ4A 3KEVA 1RTP1 3CS1A 5FYXA 2QACA 1G33A 4AOMA 1F70A 4JPZB 2CNPA 1QVIZ 1JC2A 1MUXA 2JZIA 1BODA 4E68A 3KO0A 3BUXB 2OPOA 5HYDA 4OR9B 1SNLA 4I5KA 1A4PA 1U5IB 3EVRA 3NSOA 1SPYA 1JBAA 1V1FA 3H4SE 4P2YB 4M2QA 1SRAA 1E8AA 2H61C 2CXJA 2FJUB 4QJ3B 2EHBA 2ZKMX 3BUWB 3HCMA 1QXPA 1SCVA 1NX2A 1N0YA 2KGBC 5PALA 1B1GA 2L2EA 1BG1A 1RFJA 2D8NA 1LA0A 3BUOB 4PE0A 1B7TY 4CPVA 1QS7A 2EC6C 3F45A 3I5IC 5ER4X 4ZCVA 1PK0D 1M31A 3BQ3A 4MZLA 2KAVA 3EK4A 1K93D 1TNPA 1OOJA 3CLNA 3SG3A 1OMRA 3BUMB 2L4IA 4FQOA 2KHNA 2KAXA 1F8HA 2M7LA 4MRXA 3LL8B 2B1UA 4GGFC 1N2DA 3SG6A 4MZKA 5ER5A 1XFVO 1YX7A 2KDHA 4MRYA 5D69A 2LLSA 1EG3A 1QV1A 1EXRA 2K7OA 1DF0B 1ZACA 2JQ6A 5AANA 4XJKA 4JWQA 1DJZA 3DD4A 1DJIA 1K9UA 1MHOA 2R2IA 4WQ3A 1UHHA 1QLSA 2MAZA 1DMOA 2JRFA 1C7WA 2MBXA 1QASA 2KFHA 1QATA 3JVTB 5CSJA 5F6TA 3I5FB 1AUIB 1R2UA 3SG2A 2CBLA 1B8LA 2LNKA 2PMYA 4OVNF 4GFTA 1IH0A 4OKHA 1AVSA 5AXIA 2KI6C 2SCPA 1L2OB 1BJFA 3EVUA 1W7IB 3I5HC 2MJWB 3TDZA 2F3ZA 3FWBA 1KFXL 1NUBA 1MWNA 1NSHA 2M8UA 2WC8A 5G08A 1Y6WA 1HQVA 3CR2A 1TCOB 4PALA 3NSLA 1CNPA 4AQIA 2TN4A 1DTLA 2KI6D 3O6BA 1TNXA 4N1FA 2F33A 3WXAA 1ALWA 3FIAA 1XK4A 4MSPA 2LLUA 1NIWA 1WLZA 1JUOA 4MBEA 1UHJA 2L4HA 3GK2A 1VRKA 1KK7Y 1SY9A 1KCYA 1JFKA 3FS7A 1S6JA 1TCFA 1SCMB 3IQQA 2KGRA 1WRLA 3E3RA 1PVBA 2Y5IA 1ALVA 1X02A 3LLEA 5HKYA 1G4YR 3VGOA 1S3PA 1FPWA 1IWQA 1IRJA 2AMIA 1AHRA 2BL0C 2MLEC 2KNEA 2BBMA 4PCWA 1PSRA 2KBIA 2LCPA 4GUKA 1AK8A 1YUSA 3BYAA 3OP0A 1KWOC 1QIVA 1TN4A 1DVIA 2JNFA 3SJSA 3SIBA 2Q91A 1CMFA 2BECA 1J7OA 2LANA 1RROA 1S26D 1B8RA 2KBMA 1KFXS 5IBWA 1CFDA 2JU0A 4YGEB 2G9BA 1TRFA 4HRGA 1NYAA 2ZRTA 5HKWA 2OS8C 4M2OA 4NDCA 1SBJA 1YUTA 2OTGB 1N65A 1NPQA 3K21A 3IF7A 3EKJA 4OCIA 1OZOA 2L0PA 1XFUO 1AJ5A 1BR1B 1L7ZA 3PATA 4C0KA 1KSOA 1CTRA 1XFWO 1MR8A 1Q80A 2ZN8A 3TUYB 1M45A 4XJKB 2LE9B 2BKHB 1DJWA 1S5GZ 4MN0A 3WHUB 1CLLA 5I2LA 2NLNA 2JC2A 1JSAA 3OB2B 4GAOA 2LV7A 3D10A 4PE1A 1KK8B 5HLOA 4DRWA 2MHHA 3RM1A 2WCFA 1NX3A 2Y1MA 1YRUB 4DS7A 1EL4A 1PULA 2LHIA 2M1KB 1J7QA 3VRRA 4R1EA 1S36A 3DVEA 1WLMA 4MVFA 4TNCA 1J1EA 4NQGA 1H8BA 1WDCB 1YR5A 3CR5X 1NWDA 1V1GA 1SKTA 2H2KA 2WORA 2Y4QA 1IQ5A 1ODBA 1XO5A 1XYDA 1ZMZA 2ZFDA 2M29A 1LKJA 2K7BA 4PHJA 1OE9B 2M97A 4I5JA 4C0LA 2KI4C 4Q04A 2LMVA 1EJ3A 4GGNA 1MXLC 2LVIA 2K8MB 1A75B 1TIZA 2Y1NA 3NSKA 1IJ5A 2F3YA 2M7NA 2JOJA 1Y1UA 1DT7B 1GGWA 3CGAA 1B47A 1JF2A 1GGZA 1KK7Z 1OMVA 2AUCA 2M49B 5DKRA 4YBHB 3TZ1A 4MLWA 2L51A 3PSRA 3VRPA 1KQMB 3JTDB 1M39A 3VRQA 2BBNA 1FI5A 5KTYA 3I5GC 2JT3A 3LK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZND A;  2WOS A;  1A03 A;  2A4J A;  1SR6 C;  1RWY A;  1BLQ A;  1DGV A;  1DJX A;  1QVI Y;  3EVV A;  4JQ0 D;  3ZWH A;  1QX7 A;  2KOT A;  3EK8 A;  4ORC B;  3EK7 A;  4XYN A;  5D7F A;  4DCK A;  2GGM A;  4GPL B;  1QV0 A;  2PRU A;  1K2H A;  3BUN B;  1MXE A;  2JTZ A;  4I5L B;  4USL A;  1SYM A;  2JXC A;  2LMT A;  1PRW A;  3CTN A;  1JF0 A;  1BT6 A;  2OTG C;  1A29 A;  4CLN A;  1CDL A;  2LC5 A;  1Y0V H;  3ZNI A;  2HQW A;  1XFY O;  3CWG A;  3NSI A;  1QLK A;  4MZJ A;  2P6B B;  1SMG A;  2V53 A;  1IG5 A;  1J1D A;  1UWO A;  1QTX A;  1CFC A;  3OX6 A;  4L9M A;  2LP3 A;  1J7P A;  2KQY A;  2LVK A;  1F55 A;  4ICB A;  2M0R A;  1CB1 A;  1K9K A;  2LUX A;  2WCE A;  4PHN A;  1A75 A;  2M9G A;  2LM5 A;  3O2P A;  1YUU A;  1WRK A;  1LIN A;  2LP2 A;  2NXQ A;  2EC6 B;  3I5I B;  3O78 A;  1WRZ A;  1OQP A;  1S6I A;  1HT9 A;  3VRN A;  2KSP A;  1A2X A;  1RK9 A;  2PAL A;  3QRX A;  1M46 A;  2PAS A;  4ORB B;  1QIW A;  3AAJ A;  5AEQ A;  3FWC A;  2HQ8 A;  1DJH A;  1CFF A;  4DIR A;  4PHK A;  1QX2 A;  3ICB A;  1CLM A;  3LK0 A;  3OX5 A;  1SL8 A;  1EH2 A;  4N1G A;  3TS5 B;  2WND A;  3GOF A;  3HX4 A;  2L98 A;  1KFU S;  1S6C A;  3BOW B;  1XK4 C;  1CDM A;  1SK6 D;  1F4O A;  1GJY A;  1WY9 A;  2FCE A;  3A8R A;  2LVV A;  1K9P A;  2JTT A;  1B7T Z;  4YI8 A;  2KAY A;  1FF1 A;  5HLV A;  2MLF C;  2K2A A;  3TDU A;  2AAO A;  4WQ2 A;  3SG5 A;  5CPV A;  2MRD A;  4YGB B;  5J3X A;  2NCO A;  2ZNE A;  2COL B;  2JPT A;  2H61 A;  1XVJ A;  2LMU A;  4PE4 A;  4C0J A;  2BCX A;  1XFX O;  4OV2 A;  3I5H B;  5DKN A;  2JUL A;  3BXK A;  5GQQ C;  2BKI B;  3JTD C;  2I18 A;  4YGD B;  4YI9 A;  1F4Q A;  4ZCU A;  2PVB A;  5AER A;  4WRI A;  1D1O A;  3SG4 A;  3JVT C;  2NCP A;  1TNQ A;  1C07 A;  1UUS A;  2BE4 A;  2HET A;  3I5F C;  2JXL A;  1NCZ A;  4I5N B;  1CDN A;  4PE7 A;  3KF9 A;  3KPX A;  4M2P A;  1JFJ A;  4HRH A;  2NZ0 A;  2BCB A;  1L2O C;  1CM4 A;  2K7C A;  3DVJ A;  3OHM B;  2LLT A;  1PAL A;  1H4B A;  1B9A A;  1TTX A;  1Y1A A;  5JJG A;  4PHM A;  3PN7 B;  4GGF A;  4P5O E;  5KSZ A;  4BY5 A;  1UUR A;  2I94 A;  3OB1 B;  1PVA A;  5HKZ A;  5I2O A;  1CKK A;  3BOW A;  4F0Z B;  2BL0 B;  1BF5 A;  5BPJ A;  4A4B A;  2K7D A;  5KU1 A;  2I2R E;  5TNC A;  3D0Y B;  2BE6 A;  3PLF B;  2FOT A;  3RLZ A;  4N5X A;  1FBV A;  1S1E A;  1TOP A;  2SAS A;  5CSN A;  2QPT A;  1KWO B;  5I8N A;  1DJG A;  2CTN A;  2MA2 A;  3SIA A;  1SCM C;  1R6P A;  3AKB A;  1CLB A;  3M0W A;  2HPS A;  2LHL A;  2LVJ A;  1UHI A;  4D1E A;  4ETO A;  1NX1 A;  2JT0 A;  2KYF A;  4AQJ A;  1Y1X A;  2ZN9 A;  3AAK A;  1J55 A;  2OS8 B;  1REC A;  3EKH A;  4QJ5 B;  1DGU A;  1B4C A;  3LCP C;  1RJV A;  4QJ4 B;  1OMD A;  3PFV A;  4PDZ A;  5JOL A;  1S5G Y;  3SG7 A;  4IL1 A;  1K94 A;  1SL7 A;  2GGZ A;  2K2F A;  3TS5 C;  3GK1 A;  2HF5 A;  3MSE B;  1UP5 A;  3DVK A;  1NP8 A;  1NCX A;  1YRT B;  3GK4 X;  1KFU L;  1UHK A;  2LUC A;  1BU3 A;  1YTZ C;  2F2O A;  1CMG A;  1F54 A;  1ZOT B;  1FI6 A;  4GNK B;  1NX0 A;  2K61 A;  1KQV A;  1QX5 B;  4BY4 A;  4U8D A;  5AFP A;  1U5I A;  3CZT X;  2WCB A;  1LA3 A;  3D0Y A;  3VRO A;  2BCA A;  2E30 A;  5K89 A;  3AKA A;  3TUY C;  1AP4 A;  1IKU A;  4YGA A;  3DF0 B;  1KSM A;  2JT8 A;  1B8C A;  4ORA B;  2JNX A;  4FTG A;  1K96 A;  3IQO A;  2VRG A;  4A4C A;  2FCD A;  1KK8 C;  1C7V A;  4DUQ A;  2M3W A;  5CSI A;  2ISD A;  1YVH A;  1YX8 A;  1CFP A;  4CFR A;  2KI4 B;  1DJY A;  2KFG A;  1YUR A;  2L50 A;  1BMO A;  1SW8 A;  2M1U A;  3PAL A;  5DKQ A;  1NCY A;  1WDC C;  1LVC D;  1XFZ O;  2Q4U A;  4UPG A;  1F71 A;  1CM1 A;  1G8I A;  2F8P A;  3WNX B;  1UHN A;  4CID A;  1BR4 B;  3PN7 C;  3CR4 X;  3A4U B;  1K90 D;  1TNW A;  1QJT A;  2LAP A;  1IGV A;  2KFF A;  1YVL A;  2L5X B;  2O5G A;  2F2P A;  1EG4 A;  1ZFS A;  3NXA A;  2KQ6 A;  2I7A A;  2RGI A;  2GV5 A;  3DVM A;  5CSF A;  2E6W A;  1IQ3 A;  1LXF C;  4GBA A;  1DF0 A;  4MEW A;  2JWW A;  2CCM A;  2KYC A;  2K0J A;  1GQM A;  2CT9 A;  2O60 A;  3I5G B;  3TDI A;  4CFQ A;  3O4Y A;  1XA5 A;  4YRU A;  1JWD A;  1SR6 B;  4NDD A;  5B8I B;  1K8U A;  1W7J B;  1SL9 A;  3WHT B;  4NDB A;  1MF8 B;  1BOC A;  4YGC B;  1K95 A;  2ZRS A;  2IS9 A;  3KHE A;  3PM8 A;  2EGD A;  5I2Q A;  1M63 B;  1FW4 A;  1PSB A;  3C1V A;  1MQ1 A;  1KQM C;  2DOQ A;  3DF0 A;  1IJ6 A;  4HSZ A;  1J7R A;  1ZUZ A;  1CDP A;  1OSA A;  4HRE E;  2PSR A;  1OZS A;  2G2B A;  1AJ4 A;  3KEV A;  1RTP 1;  3CS1 A;  5FYX A;  2QAC A;  1G33 A;  4AOM A;  1F70 A;  4JPZ B;  2CNP A;  1QVI Z;  1JC2 A;  1MUX A;  2JZI A;  1BOD A;  4E68 A;  3KO0 A;  3BUX B;  2OPO A;  5HYD A;  4OR9 B;  1SNL A;  4I5K A;  1A4P A;  1U5I B;  3EVR A;  3NSO A;  1SPY A;  1JBA A;  1V1F A;  3H4S E;  4P2Y B;  4M2Q A;  1SRA A;  1E8A A;  2H61 C;  2CXJ A;  2FJU B;  4QJ3 B;  2EHB A;  2ZKM X;  3BUW B;  3HCM A;  1QXP A;  1SCV A;  1NX2 A;  1N0Y A;  2KGB C;  5PAL A;  1B1G A;  2L2E A;  1BG1 A;  1RFJ A;  2D8N A;  1LA0 A;  3BUO B;  4PE0 A;  1B7T Y;  4CPV A;  1QS7 A;  2EC6 C;  3F45 A;  3I5I C;  5ER4 X;  4ZCV A;  1PK0 D;  1M31 A;  3BQ3 A;  4MZL A;  2KAV A;  3EK4 A;  1K93 D;  1TNP A;  1OOJ A;  3CLN A;  3SG3 A;  1OMR A;  3BUM B;  2L4I A;  4FQO A;  2KHN A;  2KAX A;  1F8H A;  2M7L A;  4MRX A;  3LL8 B;  2B1U A;  4GGF C;  1N2D A;  3SG6 A;  4MZK A;  5ER5 A;  1XFV O;  1YX7 A;  2KDH A;  4MRY A;  5D69 A;  2LLS A;  1EG3 A;  1QV1 A;  1EXR A;  2K7O A;  1DF0 B;  1ZAC A;  2JQ6 A;  5AAN A;  4XJK A;  4JWQ A;  1DJZ A;  3DD4 A;  1DJI A;  1K9U A;  1MHO A;  2R2I A;  4WQ3 A;  1UHH A;  1QLS A;  2MAZ A;  1DMO A;  2JRF A;  1C7W A;  2MBX A;  1QAS A;  2KFH A;  1QAT A;  3JVT B;  5CSJ A;  5F6T A;  3I5F B;  1AUI B;  1R2U A;  3SG2 A;  2CBL A;  1B8L A;  2LNK A;  2PMY A;  4OVN F;  4GFT A;  1IH0 A;  4OKH A;  1AVS A;  5AXI A;  2KI6 C;  2SCP A;  1L2O B;  1BJF A;  3EVU A;  1W7I B;  3I5H C;  2MJW B;  3TDZ A;  2F3Z A;  3FWB A;  1KFX L;  1NUB A;  1MWN A;  1NSH A;  2M8U A;  2WC8 A;  5G08 A;  1Y6W A;  1HQV A;  3CR2 A;  1TCO B;  4PAL A;  3NSL A;  1CNP A;  4AQI A;  2TN4 A;  1DTL A;  2KI6 D;  3O6B A;  1TNX A;  4N1F A;  2F33 A;  3WXA A;  1ALW A;  3FIA A;  1XK4 A;  4MSP A;  2LLU A;  1NIW A;  1WLZ A;  1JUO A;  4MBE A;  1UHJ A;  2L4H A;  3GK2 A;  1VRK A;  1KK7 Y;  1SY9 A;  1KCY A;  1JFK A;  3FS7 A;  1S6J A;  1TCF A;  1SCM B;  3IQQ A;  2KGR A;  1WRL A;  3E3R A;  1PVB A;  2Y5I A;  1ALV A;  1X02 A;  3LLE A;  5HKY A;  1G4Y R;  3VGO A;  1S3P A;  1FPW A;  1IWQ A;  1IRJ A;  2AMI A;  1AHR A;  2BL0 C;  2MLE C;  2KNE A;  2BBM A;  4PCW A;  1PSR A;  2KBI A;  2LCP A;  4GUK A;  1AK8 A;  1YUS A;  3BYA A;  3OP0 A;  1KWO C;  1QIV A;  1TN4 A;  1DVI A;  2JNF A;  3SJS A;  3SIB A;  2Q91 A;  1CMF A;  2BEC A;  1J7O A;  2LAN A;  1RRO A;  1S26 D;  1B8R A;  2KBM A;  1KFX S;  5IBW A;  1CFD A;  2JU0 A;  4YGE B;  2G9B A;  1TRF A;  4HRG A;  1NYA A;  2ZRT A;  5HKW A;  2OS8 C;  4M2O A;  4NDC A;  1SBJ A;  1YUT A;  2OTG B;  1N65 A;  1NPQ A;  3K21 A;  3IF7 A;  3EKJ A;  4OCI A;  1OZO A;  2L0P A;  1XFU O;  1AJ5 A;  1BR1 B;  1L7Z A;  3PAT A;  4C0K A;  1KSO A;  1CTR A;  1XFW O;  1MR8 A;  1Q80 A;  2ZN8 A;  3TUY B;  1M45 A;  4XJK B;  2LE9 B;  2BKH B;  1DJW A;  1S5G Z;  4MN0 A;  3WHU B;  1CLL A;  5I2L A;  2NLN A;  2JC2 A;  1JSA A;  3OB2 B;  4GAO A;  2LV7 A;  3D10 A;  4PE1 A;  1KK8 B;  5HLO A;  4DRW A;  2MHH A;  3RM1 A;  2WCF A;  1NX3 A;  2Y1M A;  1YRU B;  4DS7 A;  1EL4 A;  1PUL A;  2LHI A;  2M1K B;  1J7Q A;  3VRR A;  4R1E A;  1S36 A;  3DVE A;  1WLM A;  4MVF A;  4TNC A;  1J1E A;  4NQG A;  1H8B A;  1WDC B;  1YR5 A;  3CR5 X;  1NWD A;  1V1G A;  1SKT A;  2H2K A;  2WOR A;  2Y4Q A;  1IQ5 A;  1ODB A;  1XO5 A;  1XYD A;  1ZMZ A;  2ZFD A;  2M29 A;  1LKJ A;  2K7B A;  4PHJ A;  1OE9 B;  2M97 A;  4I5J A;  4C0L A;  2KI4 C;  4Q04 A;  2LMV A;  1EJ3 A;  4GGN A;  1MXL C;  2LVI A;  2K8M B;  1A75 B;  1TIZ A;  2Y1N A;  3NSK A;  1IJ5 A;  2F3Y A;  2M7N A;  2JOJ A;  1Y1U A;  1DT7 B;  1GGW A;  3CGA A;  1B47 A;  1JF2 A;  1GGZ A;  1KK7 Z;  1OMV A;  2AUC A;  2M49 B;  5DKR A;  4YBH B;  3TZ1 A;  4MLW A;  2L51 A;  3PSR A;  3VRP A;  1KQM B;  3JTD B;  1M39 A;  3VRQ A;  2BBN A;  1FI5 A;  5KTY A;  3I5G C;  2JT3 A;  3LK1 A; 
#chains in the Genus database with same CATH topology
 2ZND A;  2JPO A;  5D3O A;  2WOS A;  1A03 A;  2A4J A;  1SR6 C;  1RWY A;  1BLQ A;  1DGV A;  1DJX A;  1QVI Y;  3EVV A;  4JQ0 D;  3ZWH A;  1QX7 A;  2KOT A;  3EK8 A;  4ORC B;  3EK7 A;  4XYN A;  5D7F A;  4DCK A;  1OOH A;  2GGM A;  4GPL B;  1QV0 A;  2PRU A;  1K2H A;  3BUN B;  1MXE A;  2JTZ A;  4I5L B;  4USL A;  4F7F A;  1SYM A;  2JXC A;  2LMT A;  1PRW A;  3CTN A;  4INW A;  1JF0 A;  1BT6 A;  2OTG C;  1A29 A;  2GTE A;  4CLN A;  2WCM A;  1CDL A;  2LC5 A;  1Y0V H;  4PT1 A;  3ZNI A;  2HQW A;  1XFY O;  3CWG A;  3NSI A;  1QLK A;  4MZJ A;  2P6B B;  1SMG A;  2V53 A;  1IG5 A;  1J1D A;  1OOG A;  1QTX A;  1UWO A;  3OX6 A;  1CFC A;  4L9M A;  2K60 A;  3RZS A;  2LP3 A;  1J7P A;  2KQY A;  2LVK A;  1F55 A;  4ICB A;  2M0R A;  1CB1 A;  1K9K A;  2LUX A;  2WCE A;  4PHN A;  1A75 A;  2M9G A;  1Z4H A;  4INX A;  2LM5 A;  3O2P A;  2H8V A;  1YUU A;  1WRK A;  1LIN A;  2LP2 A;  2NXQ A;  2EC6 B;  3I5I B;  3O78 A;  1WRZ A;  1OQP A;  1S6I A;  1HT9 A;  3VRN A;  3SS4 A;  2KSP A;  1A2X A;  1RK9 A;  2PAL A;  3QRX A;  1M46 A;  2PAS A;  2PYQ A;  1QIW A;  2BAP A;  3AAJ A;  4ORB B;  5AEQ A;  3FWC A;  2HQ8 A;  1DJH A;  1CFF A;  4DIR A;  4PHK A;  1QX2 A;  3ICB A;  1CLM A;  3LK0 A;  3O4X A;  3OX5 A;  1SL8 A;  1EH2 A;  4N1G A;  3TS5 B;  2WND A;  3GOF A;  3HX4 A;  2L98 A;  1KFU S;  1S6C A;  2QEV A;  1XK4 C;  3BOW B;  1CDM A;  1SK6 D;  2WCK A;  3CZ1 A;  1F4O A;  1GJY A;  1WY9 A;  2FCE A;  3A8R A;  2LVV A;  3S0A A;  1K9P A;  2JTT A;  1B7T Z;  4YI8 A;  2KAY A;  1FF1 A;  5HLV A;  2MLF C;  2K2A A;  3TDU A;  2AAO A;  4WQ2 A;  3SG5 A;  2WCJ A;  5CPV A;  2MRD A;  4YGB B;  5J3X A;  2NCO A;  2ZNE A;  2COL B;  2JPT A;  2H61 A;  1XVJ A;  2LMU A;  4PE4 A;  4C0J A;  2BCX A;  1XFX O;  4OV2 A;  3I5H B;  5DKN A;  2JUL A;  3BXK A;  5GQQ C;  2BKI B;  3JTD C;  2I18 A;  4YGD B;  4YI9 A;  1F4Q A;  4ZCU A;  2PVB A;  5AER A;  4WRI A;  1D1O A;  3SG4 A;  3BFB A;  3JVT C;  2NCP A;  1TNQ A;  1C07 A;  1UUS A;  2BE4 A;  2HET A;  3I5F C;  2JXL A;  1NCZ A;  3OGN A;  4I5N B;  3DXL A;  3Q8I A;  4PE7 A;  3KF9 A;  3KPX A;  5FI6 A;  1CDN A;  4M2P A;  1JFJ A;  4HRH A;  2NZ0 A;  2BCB A;  1L2O C;  1CM4 A;  2K7C A;  3DVJ A;  3OHM B;  4FQT A;  2LLT A;  1PAL A;  1Z2C B;  1H4B A;  1B9A A;  1TTX A;  1Y1A A;  5JJG A;  4PHM A;  3PN7 B;  4GGF A;  4P5O E;  5KSZ A;  4BY5 A;  1UUR A;  2I94 A;  3OB1 B;  1PVA A;  5HKZ A;  5I2O A;  1CKK A;  3UO9 A;  3BOW A;  3S0E A;  2BL0 B;  4F0Z B;  1BF5 A;  5BPJ A;  4A4B A;  2K7D A;  3R1V A;  5KU1 A;  2I2R E;  5TNC A;  3D0Y B;  2BE6 A;  3PLF B;  2FOT A;  3RLZ A;  5I94 A;  3DY9 A;  4N5X A;  1FBV A;  1S1E A;  1TOP A;  2SAS A;  5CSN A;  2QPT A;  1KWO B;  5I8N A;  1DJG A;  2CTN A;  2MA2 A;  3SIA A;  1SCM C;  3D73 A;  1R6P A;  3AKB A;  1CLB A;  3M0W A;  2HPS A;  2P71 A;  2LHL A;  2LVJ A;  1UHI A;  4D1E A;  4ETO A;  1NX1 A;  2JT0 A;  2KYF A;  4AQJ A;  1Y1X A;  3D78 A;  2ZN9 A;  3S0F A;  1P28 A;  3K1E A;  3AAK A;  1J55 A;  2OS8 B;  1REC A;  3EKH A;  4QJ5 B;  1DGU A;  1B4C A;  3LCP C;  1RJV A;  4QJ4 B;  1OMD A;  3PFV A;  2YGU A;  4PDZ A;  5JOL A;  1S5G Y;  2KLD A;  3SG7 A;  4IL1 A;  1K94 A;  1SL7 A;  2GGZ A;  2K2F A;  3R1O A;  3TS5 C;  3GK1 A;  3PJI A;  2HF5 A;  3MSE B;  1UP5 A;  3DVK A;  1NP8 A;  1NCX A;  1YRT B;  3GK4 X;  3S0D A;  1KFU L;  1UHK A;  2LUC A;  3B88 A;  3NGV A;  1BU3 A;  1YTZ C;  2F2O A;  1CMG A;  1F54 A;  1ZOT B;  1FI6 A;  4GNK B;  1NX0 A;  2K61 A;  1KQV A;  1QX5 B;  3B86 A;  4BY4 A;  1T14 A;  4U8D A;  3FE6 A;  5AFP A;  1U5I A;  3CZT X;  2WCB A;  1LA3 A;  3D0Y A;  3VRO A;  2BCA A;  2E30 A;  5K89 A;  3AKA A;  3TUY C;  1AP4 A;  1IKU A;  4YGA A;  3DF0 B;  1KSM A;  2JT8 A;  1B8C A;  4ORA B;  2JNX A;  4FTG A;  1K96 A;  3BFH A;  3IQO A;  2VRG A;  4A4C A;  2FCD A;  1KK8 C;  1C7V A;  2KLE A;  4DUQ A;  2M3W A;  5CSI A;  3OBV A;  1YVH A;  1YX8 A;  2ISD A;  3NHI A;  4CFR A;  2KPH A;  1CFP A;  4OZD A;  1DQE A;  2KI4 B;  2BNX A;  2WC6 A;  1DJY A;  2KFG A;  1YUR A;  2L50 A;  1BMO A;  1SW8 A;  2M1U A;  3PAL A;  5DKQ A;  1NCY A;  1WDC C;  1LVC D;  1XFZ O;  2Q4U A;  5EL2 A;  4UPG A;  1F71 A;  1CM1 A;  1G8I A;  2F8P A;  3BJH A;  3WNX B;  1UHN A;  4CID A;  1BR4 B;  3PN7 C;  3CR4 X;  3A4U B;  1K90 D;  1TNW A;  1QJT A;  2LAP A;  1IGV A;  2KFF A;  1YVL A;  2L5X B;  2O5G A;  2F2P A;  1EG4 A;  1ZFS A;  3NXA A;  2KQ6 A;  3CAB A;  2I7A A;  2RGI A;  2GV5 A;  3DVM A;  5CSF A;  3UNW A;  2E6W A;  2QDI A;  1IQ3 A;  1LXF C;  4GBA A;  1DF0 A;  4MEW A;  1OW4 A;  2JWW A;  2CCM A;  2KYC A;  2K0J A;  1GQM A;  2CT9 A;  2O60 A;  3I5G B;  3TDI A;  4CFQ A;  1DC1 A;  3O4Y A;  3B87 A;  3L4L A;  1XA5 A;  3CYZ A;  4YRU A;  1JWD A;  1SR6 B;  4NDD A;  5B8I B;  1K8U A;  1W7J B;  1SL9 A;  3WHT B;  4NDB A;  1MF8 B;  1BOC A;  4YGC B;  1K95 A;  2ZRS A;  2IS9 A;  3KHE A;  3PM8 A;  2EGD A;  5I2Q A;  1M63 B;  1FW4 A;  1PSB A;  3C1V A;  3CZ0 A;  1MQ1 A;  1KQM C;  2DOQ A;  3DF0 A;  1IJ6 A;  4HSZ A;  1J7R A;  1ZUZ A;  1CDP A;  1OSA A;  4HRE E;  3NHT A;  2PSR A;  1OZS A;  2G2B A;  1AJ4 A;  3CZ2 A;  1RTP 1;  3KEV A;  3CS1 A;  3L4A A;  5FYX A;  2QAC A;  1G33 A;  3SS3 A;  2L5Y A;  4AOM A;  1F70 A;  3PM2 A;  4JPZ B;  2CNP A;  1QVI Z;  1JC2 A;  1MUX A;  2JZI A;  3D74 A;  1BOD A;  1DEK A;  4E68 A;  3KO0 A;  3BUX B;  2OPO A;  5HYD A;  4OR9 B;  2QEB A;  1SNL A;  4I5K A;  1XFR A;  1A4P A;  1U5I B;  3EVR A;  3NSO A;  4JKT A;  1SPY A;  1JBA A;  1V1F A;  3H4S E;  4P2Y B;  4M2Q A;  1SRA A;  1E8A A;  2H61 C;  2CXJ A;  2FJU B;  4QJ3 B;  2EHB A;  2ZKM X;  3BUW B;  3HCM A;  1QXP A;  1SCV A;  1NX2 A;  1N0Y A;  2KGB C;  5PAL A;  1B1G A;  2L2E A;  1BG1 A;  1RFJ A;  2D8N A;  4JD9 A;  1LA0 A;  3BUO B;  4PE0 A;  1B7T Y;  4CPV A;  1QS7 A;  2EC6 C;  3D75 A;  3F45 A;  3I5I C;  5ER4 X;  4ZCV A;  1PK0 D;  3SS5 A;  1M31 A;  3BQ3 A;  4MZL A;  1C3Z A;  2KAV A;  3EK4 A;  1K93 D;  1TNP A;  1OOJ A;  3CLN A;  3SG3 A;  1OMR A;  3BUM B;  2L4I A;  4FQO A;  3L47 A;  2KHN A;  2KAX A;  4KYN A;  1F8H A;  2M7L A;  4MRX A;  3LL8 B;  2B1U A;  4GGF C;  1N2D A;  3SG6 A;  4MZK A;  2L2C A;  5ER5 A;  1XFV O;  1YX7 A;  2KDH A;  4MRY A;  5D69 A;  2LLS A;  1EG3 A;  1QV1 A;  2WCL A;  3EG5 B;  1EXR A;  2K7O A;  1DF0 B;  1ZAC A;  2JQ6 A;  5AAN A;  4XJK A;  3R1P A;  4JWQ A;  1ORG A;  1DJZ A;  3DD4 A;  1DJI A;  1K9U A;  1MHO A;  2R2I A;  4WQ3 A;  1UHH A;  1QLS A;  2MAZ A;  1DMO A;  2JRF A;  1C7W A;  2MBX A;  3VB1 A;  1QAS A;  2KFH A;  1QAT A;  2WCH A;  3JVT B;  5CSJ A;  5F6T A;  3I5F B;  1AUI B;  1QWV A;  1R2U A;  3SG2 A;  3D76 A;  2CBL A;  1B8L A;  2LNK A;  2PMY A;  3R72 A;  2P70 A;  4OVN F;  3S0B A;  4GFT A;  1IH0 A;  4OKH A;  1AVS A;  5AXI A;  2KI6 C;  2SCP A;  1L2O B;  1BJF A;  3EVU A;  1W7I B;  3I5H C;  2MJW B;  3TDZ A;  2F3Z A;  3FWB A;  1KFX L;  1NUB A;  1MWN A;  1NSH A;  2M8U A;  2WC8 A;  5G08 A;  1Y6W A;  1HQV A;  3CR2 A;  1TCO B;  4PAL A;  3NSL A;  1CNP A;  4AQI A;  2TN4 A;  1DTL A;  2KI6 D;  3O6B A;  1TNX A;  4N1F A;  2F33 A;  3WXA A;  1ALW A;  3B7A A;  1XK4 A;  3FIA A;  4MSP A;  2LLU A;  1NIW A;  1WLZ A;  1JUO A;  4MBE A;  1UHJ A;  2L4H A;  3GK2 A;  1VRK A;  1KK7 Y;  1SY9 A;  3FE9 A;  4IJ7 A;  1KCY A;  1JFK A;  3FS7 A;  1S6J A;  1TCF A;  1SCM B;  3IQQ A;  2KGR A;  1WRL A;  3E3R A;  1PVB A;  2Y5I A;  1ALV A;  1X02 A;  1OOI X;  3LLE A;  5HKY A;  1G4Y R;  3N7H A;  1S3P A;  3VGO A;  1FPW A;  2ERB A;  1IWQ A;  1W9Z A;  1IRJ A;  2AMI A;  1AHR A;  2BL0 C;  2MLE C;  1SSE B;  2KNE A;  2BBM A;  4PCW A;  1PSR A;  2KBI A;  2LCP A;  5HL1 A;  4GUK A;  1AK8 A;  1YUS A;  3BYA A;  2QEO A;  3OP0 A;  1KWO C;  1QIV A;  1TN4 A;  1DVI A;  2JNF A;  3DYE A;  3SIB A;  2Q91 A;  3SJS A;  1CMF A;  2BEC A;  1J7O A;  3B6X A;  2LAN A;  2PQL A;  3V2L A;  1RRO A;  1S26 D;  1B8R A;  2KBM A;  1KFX S;  5IBW A;  1CFD A;  2JU0 A;  4YGE B;  2G9B A;  1TRF A;  4HRG A;  1NYA A;  2ZRT A;  5HKW A;  2OS8 C;  4M2O A;  4NDC A;  1SBJ A;  1YUT A;  2OTG B;  1N65 A;  1NPQ A;  3K21 A;  3IF7 A;  3EKJ A;  4OCI A;  1OZO A;  2L0P A;  1XFU O;  2WC5 A;  1AJ5 A;  1BR1 B;  1L7Z A;  3PAT A;  5FI2 A;  4C0K A;  1KSO A;  1CTR A;  1XFW O;  3BFA A;  1MR8 A;  1Q80 A;  3S0G A;  2ZN8 A;  3FE8 A;  3TUY B;  3DZT A;  1M45 A;  4XJK B;  2LE9 B;  1TUZ A;  1DJW A;  1S5G Z;  2BKH B;  4MN0 A;  1CLL A;  5I2L A;  2NLN A;  3WHU B;  1C3Y A;  1DEL A;  2JC2 A;  1JSA A;  3OB2 B;  4GAO A;  2LV7 A;  3D10 A;  4PE1 A;  3QME A;  1KK8 B;  5HLO A;  5DIC A;  2MHH A;  4DRW A;  3RM1 A;  2WCF A;  1NX3 A;  2Y1M A;  1YRU B;  4DS7 A;  1EL4 A;  1PUL A;  2LHI A;  1TUJ A;  2M1K B;  1J7Q A;  3VRR A;  4R1E A;  1S36 A;  3DVE A;  1WLM A;  4MVF A;  4TNC A;  1J1E A;  4NQG A;  3IVT A;  1H8B A;  1WDC B;  1YR5 A;  3CR5 X;  1OOF A;  1NWD A;  1V1G A;  2QEH A;  1LS8 A;  1SKT A;  2H2K A;  2WOR A;  2Y4Q A;  1IQ5 A;  1ODB A;  1XO5 A;  1ZMZ A;  1XYD A;  2ZFD A;  1IIO A;  3CDN A;  2M29 A;  1LKJ A;  1TWO A;  2K7B A;  4PHJ A;  1OE9 B;  2M97 A;  4I5J A;  4C0L A;  2KI4 C;  4Q04 A;  2FJY A;  2LMV A;  1EJ3 A;  4GGN A;  1MXL C;  2LVI A;  2K8M B;  1A75 B;  1TIZ A;  2Y1N A;  3NSK A;  1IJ5 A;  2F3Y A;  2M7N A;  5FI7 A;  2JOJ A;  1Y1U A;  1DT7 B;  1GGW A;  1GM0 A;  3CGA A;  1B47 A;  1JF2 A;  1GGZ A;  1KK7 Z;  1OMV A;  2AUC A;  2M49 B;  5DKR A;  3D77 A;  4YBH B;  3TZ1 A;  4MLW A;  2L51 A;  3PSR A;  3VRP A;  1KQM B;  3JTD B;  1M39 A;  3VRQ A;  2BBN A;  1FI5 A;  5KTY A;  3I5G C;  2JT3 A;  3LK1 A; 
#chains in the Genus database with same CATH homology
 2ZND A;  2WOS A;  1A03 A;  2A4J A;  1SR6 C;  1RWY A;  1BLQ A;  1DGV A;  1DJX A;  1QVI Y;  3EVV A;  4JQ0 D;  3ZWH A;  1QX7 A;  2KOT A;  3EK8 A;  4ORC B;  3EK7 A;  4XYN A;  5D7F A;  4DCK A;  2GGM A;  4GPL B;  1QV0 A;  2PRU A;  1K2H A;  3BUN B;  1MXE A;  2JTZ A;  4I5L B;  4USL A;  1SYM A;  2JXC A;  2LMT A;  1PRW A;  3CTN A;  1JF0 A;  1BT6 A;  2OTG C;  1A29 A;  4CLN A;  1CDL A;  2LC5 A;  1Y0V H;  3ZNI A;  2HQW A;  1XFY O;  3CWG A;  3NSI A;  1QLK A;  4MZJ A;  2P6B B;  1SMG A;  2V53 A;  1IG5 A;  1J1D A;  1UWO A;  1QTX A;  1CFC A;  3OX6 A;  4L9M A;  2LP3 A;  1J7P A;  2KQY A;  2LVK A;  1F55 A;  4ICB A;  2M0R A;  1CB1 A;  1K9K A;  2LUX A;  2WCE A;  4PHN A;  1A75 A;  2M9G A;  2LM5 A;  3O2P A;  1YUU A;  1WRK A;  1LIN A;  2LP2 A;  2NXQ A;  2EC6 B;  3I5I B;  3O78 A;  1WRZ A;  1OQP A;  1S6I A;  1HT9 A;  3VRN A;  2KSP A;  1A2X A;  1RK9 A;  2PAL A;  3QRX A;  1M46 A;  2PAS A;  4ORB B;  1QIW A;  3AAJ A;  5AEQ A;  3FWC A;  2HQ8 A;  1DJH A;  1CFF A;  4DIR A;  4PHK A;  1QX2 A;  3ICB A;  1CLM A;  3LK0 A;  3OX5 A;  1SL8 A;  1EH2 A;  4N1G A;  3TS5 B;  2WND A;  3GOF A;  3HX4 A;  2L98 A;  1KFU S;  1S6C A;  3BOW B;  1XK4 C;  1CDM A;  1SK6 D;  1F4O A;  1GJY A;  1WY9 A;  2FCE A;  3A8R A;  2LVV A;  1K9P A;  2JTT A;  1B7T Z;  4YI8 A;  2KAY A;  1FF1 A;  5HLV A;  2MLF C;  2K2A A;  3TDU A;  2AAO A;  4WQ2 A;  3SG5 A;  5CPV A;  2MRD A;  4YGB B;  5J3X A;  2NCO A;  2ZNE A;  2COL B;  2JPT A;  2H61 A;  1XVJ A;  2LMU A;  4PE4 A;  4C0J A;  2BCX A;  1XFX O;  4OV2 A;  3I5H B;  5DKN A;  2JUL A;  3BXK A;  5GQQ C;  2BKI B;  3JTD C;  2I18 A;  4YGD B;  4YI9 A;  1F4Q A;  4ZCU A;  2PVB A;  5AER A;  4WRI A;  1D1O A;  3SG4 A;  3JVT C;  2NCP A;  1TNQ A;  1C07 A;  1UUS A;  2BE4 A;  2HET A;  3I5F C;  2JXL A;  1NCZ A;  4I5N B;  1CDN A;  4PE7 A;  3KF9 A;  3KPX A;  4M2P A;  1JFJ A;  4HRH A;  2NZ0 A;  2BCB A;  1L2O C;  1CM4 A;  2K7C A;  3DVJ A;  3OHM B;  2LLT A;  1PAL A;  1H4B A;  1B9A A;  1TTX A;  1Y1A A;  5JJG A;  4PHM A;  3PN7 B;  4GGF A;  4P5O E;  5KSZ A;  4BY5 A;  1UUR A;  2I94 A;  3OB1 B;  1PVA A;  5HKZ A;  5I2O A;  1CKK A;  3BOW A;  4F0Z B;  2BL0 B;  1BF5 A;  5BPJ A;  4A4B A;  2K7D A;  5KU1 A;  2I2R E;  5TNC A;  3D0Y B;  2BE6 A;  3PLF B;  2FOT A;  3RLZ A;  4N5X A;  1FBV A;  1S1E A;  1TOP A;  2SAS A;  5CSN A;  2QPT A;  1KWO B;  5I8N A;  1DJG A;  2CTN A;  2MA2 A;  3SIA A;  1SCM C;  1R6P A;  3AKB A;  1CLB A;  3M0W A;  2HPS A;  2LHL A;  2LVJ A;  1UHI A;  4D1E A;  4ETO A;  1NX1 A;  2JT0 A;  2KYF A;  4AQJ A;  1Y1X A;  2ZN9 A;  3AAK A;  1J55 A;  2OS8 B;  1REC A;  3EKH A;  4QJ5 B;  1DGU A;  1B4C A;  3LCP C;  1RJV A;  4QJ4 B;  1OMD A;  3PFV A;  4PDZ A;  5JOL A;  1S5G Y;  3SG7 A;  4IL1 A;  1K94 A;  1SL7 A;  2GGZ A;  2K2F A;  3TS5 C;  3GK1 A;  2HF5 A;  3MSE B;  1UP5 A;  3DVK A;  1NP8 A;  1NCX A;  1YRT B;  3GK4 X;  1KFU L;  1UHK A;  2LUC A;  1BU3 A;  1YTZ C;  2F2O A;  1CMG A;  1F54 A;  1ZOT B;  1FI6 A;  4GNK B;  1NX0 A;  2K61 A;  1KQV A;  1QX5 B;  4BY4 A;  4U8D A;  5AFP A;  1U5I A;  3CZT X;  2WCB A;  1LA3 A;  3D0Y A;  3VRO A;  2BCA A;  2E30 A;  5K89 A;  3AKA A;  3TUY C;  1AP4 A;  1IKU A;  4YGA A;  3DF0 B;  1KSM A;  2JT8 A;  1B8C A;  4ORA B;  2JNX A;  4FTG A;  1K96 A;  3IQO A;  2VRG A;  4A4C A;  2FCD A;  1KK8 C;  1C7V A;  4DUQ A;  2M3W A;  5CSI A;  2ISD A;  1YVH A;  1YX8 A;  1CFP A;  4CFR A;  2KI4 B;  1DJY A;  2KFG A;  1YUR A;  2L50 A;  1BMO A;  1SW8 A;  2M1U A;  3PAL A;  5DKQ A;  1NCY A;  1WDC C;  1LVC D;  1XFZ O;  2Q4U A;  4UPG A;  1F71 A;  1CM1 A;  1G8I A;  2F8P A;  3WNX B;  1UHN A;  4CID A;  1BR4 B;  3PN7 C;  3CR4 X;  3A4U B;  1K90 D;  1TNW A;  1QJT A;  2LAP A;  1IGV A;  2KFF A;  1YVL A;  2L5X B;  2O5G A;  2F2P A;  1EG4 A;  1ZFS A;  3NXA A;  2KQ6 A;  2I7A A;  2RGI A;  2GV5 A;  3DVM A;  5CSF A;  2E6W A;  1IQ3 A;  1LXF C;  4GBA A;  1DF0 A;  4MEW A;  2JWW A;  2CCM A;  2KYC A;  2K0J A;  1GQM A;  2CT9 A;  2O60 A;  3I5G B;  3TDI A;  4CFQ A;  3O4Y A;  1XA5 A;  4YRU A;  1JWD A;  1SR6 B;  4NDD A;  5B8I B;  1K8U A;  1W7J B;  1SL9 A;  3WHT B;  4NDB A;  1MF8 B;  1BOC A;  4YGC B;  1K95 A;  2ZRS A;  2IS9 A;  3KHE A;  3PM8 A;  2EGD A;  5I2Q A;  1M63 B;  1FW4 A;  1PSB A;  3C1V A;  1MQ1 A;  1KQM C;  2DOQ A;  3DF0 A;  1IJ6 A;  4HSZ A;  1J7R A;  1ZUZ A;  1CDP A;  1OSA A;  4HRE E;  2PSR A;  1OZS A;  2G2B A;  1AJ4 A;  3KEV A;  1RTP 1;  3CS1 A;  5FYX A;  2QAC A;  1G33 A;  4AOM A;  1F70 A;  4JPZ B;  2CNP A;  1QVI Z;  1JC2 A;  1MUX A;  2JZI A;  1BOD A;  4E68 A;  3KO0 A;  3BUX B;  2OPO A;  5HYD A;  4OR9 B;  1SNL A;  4I5K A;  1A4P A;  1U5I B;  3EVR A;  3NSO A;  1SPY A;  1JBA A;  1V1F A;  3H4S E;  4P2Y B;  4M2Q A;  1SRA A;  1E8A A;  2H61 C;  2CXJ A;  2FJU B;  4QJ3 B;  2EHB A;  2ZKM X;  3BUW B;  3HCM A;  1QXP A;  1SCV A;  1NX2 A;  1N0Y A;  2KGB C;  5PAL A;  1B1G A;  2L2E A;  1BG1 A;  1RFJ A;  2D8N A;  1LA0 A;  3BUO B;  4PE0 A;  1B7T Y;  4CPV A;  1QS7 A;  2EC6 C;  3F45 A;  3I5I C;  5ER4 X;  4ZCV A;  1PK0 D;  1M31 A;  3BQ3 A;  4MZL A;  2KAV A;  3EK4 A;  1K93 D;  1TNP A;  1OOJ A;  3CLN A;  3SG3 A;  1OMR A;  3BUM B;  2L4I A;  4FQO A;  2KHN A;  2KAX A;  1F8H A;  2M7L A;  4MRX A;  3LL8 B;  2B1U A;  4GGF C;  1N2D A;  3SG6 A;  4MZK A;  5ER5 A;  1XFV O;  1YX7 A;  2KDH A;  4MRY A;  5D69 A;  2LLS A;  1EG3 A;  1QV1 A;  1EXR A;  2K7O A;  1DF0 B;  1ZAC A;  2JQ6 A;  5AAN A;  4XJK A;  4JWQ A;  1DJZ A;  3DD4 A;  1DJI A;  1K9U A;  1MHO A;  2R2I A;  4WQ3 A;  1UHH A;  1QLS A;  2MAZ A;  1DMO A;  2JRF A;  1C7W A;  2MBX A;  1QAS A;  2KFH A;  1QAT A;  3JVT B;  5CSJ A;  5F6T A;  3I5F B;  1AUI B;  1R2U A;  3SG2 A;  2CBL A;  1B8L A;  2LNK A;  2PMY A;  4OVN F;  4GFT A;  1IH0 A;  4OKH A;  1AVS A;  5AXI A;  2KI6 C;  2SCP A;  1L2O B;  1BJF A;  3EVU A;  1W7I B;  3I5H C;  2MJW B;  3TDZ A;  2F3Z A;  3FWB A;  1KFX L;  1NUB A;  1MWN A;  1NSH A;  2M8U A;  2WC8 A;  5G08 A;  1Y6W A;  1HQV A;  3CR2 A;  1TCO B;  4PAL A;  3NSL A;  1CNP A;  4AQI A;  2TN4 A;  1DTL A;  2KI6 D;  3O6B A;  1TNX A;  4N1F A;  2F33 A;  3WXA A;  1ALW A;  3FIA A;  1XK4 A;  4MSP A;  2LLU A;  1NIW A;  1WLZ A;  1JUO A;  4MBE A;  1UHJ A;  2L4H A;  3GK2 A;  1VRK A;  1KK7 Y;  1SY9 A;  1KCY A;  1JFK A;  3FS7 A;  1S6J A;  1TCF A;  1SCM B;  3IQQ A;  2KGR A;  1WRL A;  3E3R A;  1PVB A;  2Y5I A;  1ALV A;  1X02 A;  3LLE A;  5HKY A;  1G4Y R;  3VGO A;  1S3P A;  1FPW A;  1IWQ A;  1IRJ A;  2AMI A;  1AHR A;  2BL0 C;  2MLE C;  2KNE A;  2BBM A;  4PCW A;  1PSR A;  2KBI A;  2LCP A;  4GUK A;  1AK8 A;  1YUS A;  3BYA A;  3OP0 A;  1KWO C;  1QIV A;  1TN4 A;  1DVI A;  2JNF A;  3SJS A;  3SIB A;  2Q91 A;  1CMF A;  2BEC A;  1J7O A;  2LAN A;  1RRO A;  1S26 D;  1B8R A;  2KBM A;  1KFX S;  5IBW A;  1CFD A;  2JU0 A;  4YGE B;  2G9B A;  1TRF A;  4HRG A;  1NYA A;  2ZRT A;  5HKW A;  2OS8 C;  4M2O A;  4NDC A;  1SBJ A;  1YUT A;  2OTG B;  1N65 A;  1NPQ A;  3K21 A;  3IF7 A;  3EKJ A;  4OCI A;  1OZO A;  2L0P A;  1XFU O;  1AJ5 A;  1BR1 B;  1L7Z A;  3PAT A;  4C0K A;  1KSO A;  1CTR A;  1XFW O;  1MR8 A;  1Q80 A;  2ZN8 A;  3TUY B;  1M45 A;  4XJK B;  2LE9 B;  2BKH B;  1DJW A;  1S5G Z;  4MN0 A;  3WHU B;  1CLL A;  5I2L A;  2NLN A;  2JC2 A;  1JSA A;  3OB2 B;  4GAO A;  2LV7 A;  3D10 A;  4PE1 A;  1KK8 B;  5HLO A;  4DRW A;  2MHH A;  3RM1 A;  2WCF A;  1NX3 A;  2Y1M A;  1YRU B;  4DS7 A;  1EL4 A;  1PUL A;  2LHI A;  2M1K B;  1J7Q A;  3VRR A;  4R1E A;  1S36 A;  3DVE A;  1WLM A;  4MVF A;  4TNC A;  1J1E A;  4NQG A;  1H8B A;  1WDC B;  1YR5 A;  3CR5 X;  1NWD A;  1V1G A;  1SKT A;  2H2K A;  2WOR A;  2Y4Q A;  1IQ5 A;  1ODB A;  1XO5 A;  1XYD A;  1ZMZ A;  2ZFD A;  2M29 A;  1LKJ A;  2K7B A;  4PHJ A;  1OE9 B;  2M97 A;  4I5J A;  4C0L A;  2KI4 C;  4Q04 A;  2LMV A;  1EJ3 A;  4GGN A;  1MXL C;  2LVI A;  2K8M B;  1A75 B;  1TIZ A;  2Y1N A;  3NSK A;  1IJ5 A;  2F3Y A;  2M7N A;  2JOJ A;  1Y1U A;  1DT7 B;  1GGW A;  3CGA A;  1B47 A;  1JF2 A;  1GGZ A;  1KK7 Z;  1OMV A;  2AUC A;  2M49 B;  5DKR A;  4YBH B;  3TZ1 A;  4MLW A;  2L51 A;  3PSR A;  3VRP A;  1KQM B;  3JTD B;  1M39 A;  3VRQ A;  2BBN A;  1FI5 A;  5KTY A;  3I5G C;  2JT3 A;  3LK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...