4PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PARVALBUMIN
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
molecule tags Calcium binding protein
total genus 43
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4palA00
2EHBA 2JTTA 3VRQA 1XFYO 4CLNA 1BU3A 1QIWA 1V1GA 3BUXB 1WY9A 5CSFA 2K7OA 2K7CA 3A4UB 1S6CA 1CDNA 2M9GA 2KGRA 1QX5B 1G4YR 4MRYA 1IQ5A 3A8RA 2BCXA 1Y1UA 1UHJA 1YVHA 1BG1A 1J7RA 3DD4A 1Q80A 1MHOA 2FJUB 2LVIA 1WDCB 3DVEA 2K2AA 1FW4A 4AQIA 1YVLA 2G2BA 5I2OA 4YGCB 1IJ5A 4M2OA 2K7DA 2ISDA 3KHEA 1KWOC 1BJFA 1KK8C 5TNCA 3FIAA 5DKQA 2F8PA 3CTNA 4NDDA 1EJ3A 3EVVA 1F71A 5DKRA 5G08A 1JSAA 3VRPA 1BLQA 4CFQA 2BBNA 3IQOA 1OQPA 4MVFA 4I5NB 3CWGA 2O5GA 1DMOA 2AUCA 1JF0A 2KBMA 4AOMA 3GK1A 4YI9A 2K7BA 1SR6C 2KYFA 3PN7B 2LP3A 4BY5A 2IS9A 1AP4A 2JNXA 1QIVA 2BBMA 3KPXA 2L4IA 3FWBA 2K2FA 2LMUA 2MJWB 3MSEB 2O60A 2GGMA 4JQ0D 1TCOB 4BY4A 4D1EA 1J1EA 3TDUA 1NX0A 1YR5A 1W7IB 2KOTA 1YRUB 1K8UA 3BUWB 3JVTC 2KQYA 2QACA 2BL0C 4Q04A 2KHNA 4YGAA 1S3PA 1SL8A 3CR5X 2F3YA 2Q91A 2BCBA 2RGIA 3HCMA 2ZRTA 4GGFC 1TN4A 1J55A 1K9UA 1QLKA 1JWDA 2E30A 1YTZC 3ZWHA 3RM1A 1IJ6A 1CLMA 2EC6C 2CXJA 2WCBA 2H2KA 2JWWA 2NCPA 3ZNIA 2L0PA 4I5LB 3LCPC 1EG4A 1LA3A 3NSOA 3LL8B 3PATA 4PHMA 4DIRA 1L7ZA 2BE6A 1SNLA 4QJ4B 1UP5A 1CFPA 3WHTB 1S6IA 2ZKMX 2H61A 2ZFDA 3TUYC 1MXEA 5I2QA 5JOLA 1DF0B 1DT7B 1M45A 4GNKB 1MWNA 4MLWA 1AK8A 1UHIA 1CKKA 2LUCA 3O4YA 2JZIA 2I2RE 1K93D 2FOTA 1NCXA 3HX4A 4C0LA 2JTZA 2Q4UA 4ETOA 3SG6A 2SASA 1AVSA 1M46A 1RECA 1KFUL 2LLSA 1NYAA 1QXPA 1R2UA 1XA5A 2GV5A 4CFRA 4HREE 4TNCA 1WLMA 1KK7Z 1K9PA 2M97A 1SL7A 3D0YB 3JTDC 1ALWA 1YURA 1C7WA 1SCMC 1TIZA 1W7JB 3DVKA 4PE7A 5D69A 5HLVA 5HKZA 4UPGA 4A4BA 1U5IB 1CTRA 1B9AA 2NXQA 1QX2A 5I2LA 1J7OA 1NX3A 3DVMA 1GGZA 4M2PA 1EL4A 1S6JA 3AAJA 3O78A 4USLA 1A03A 4I5KA 4PDZA 1DTLA 5AANA 1ZMZA 1XFVO 4YGEB 3I5GB 4YBHB 1IG5A 2MLEC 1DJYA 1ZUZA 3JVTB 3NSIA 1YUUA 1MXLC 2BL0B 2LC5A 2D8NA 1B4CA 1DJZA 3EVRA 5D7FA 4GAOA 1QX7A 2TN4A 2WCEA 3E3RA 4PE4A 3EK7A 1OMRA 3OHMB 1JFKA 5CSIA 1AUIB 2Y4QA 3GK4X 5HKWA 4DRWA 1JF2A 1AJ4A 2EC6B 2LVVA 3IQQA 5I8NA 3ICBA 1KFXL 2L2EA 4PALA 1A75B 4ZCVA 2AAOA 2ZRSA 1CDLA 1Y1XA 2I18A 2JT8A 1DJIA 1RJVA 2NCOA 4MN0A 5PALA 3TUYB 4A4CA 1SCVA 3BOWB 2G9BA 1DJHA 3VRRA 1IRJA 1B7TZ 1KSMA 2E6WA 2KNEA 2LLTA 3O6BA 1XO5A 4DS7A 2HETA 1MR8A 3DF0B 1IQ3A 1CLBA 2KAYA 1A2XA 2WCFA 4E68A 2LVKA 2PALA 2L5XB 5CSJA 3VRNA 4YGDB 1BR4B 1S5GY 1RTP1 2I7AA 3CZTX 3AKAA 4N1GA 4XJKB 1XFZO 1RROA 2JPTA 2KSPA 3KEVA 3EK8A 4PE1A 4WRIA 1SYMA 3RLZA 2CTNA 3CR4X 3NXAA 1IKUA 1UURA 2K61A 2KQ6A 3I5IB 2F2OA 4ORCB 1CM1A 1ZACA 4PCWA 4YRUA 1UHNA 1WRLA 2CT9A 3JTDB 5J3XA 1FI6A 1CDMA 1SCMB 1SK6D 2LP2A 3WNXB 1YRTB 5AERA 2LMVA 2Y1MA 1NUBA 5ER5A 3WXAA 2LAPA 3IF7A 1HT9A 4C0KA 4OV2A 2JU0A 2JC2A 2KI4C 3I5GC 3SG3A 1ZFSA 1UHHA 1K90D 1PSBA 1AHRA 3BQ3A 3OX6A 2BE4A 3BYAA 2ZNDA 4M2QA 4MBEA 4R1EA 1C7VA 4ZCUA 1B47A 3I5FC 1L2OB 1QS7A 3TZ1A 1JBAA 1K2HA 1C07A 3H4SE 1UUSA 1XFXO 4GUKA 2OTGC 1GQMA 3SG4A 1N65A 1YUTA 1DJWA 1Y6WA 1RWYA 1QVIY 3SG7A 1F54A 3BXKA 2FCDA 1BR1B 5HLOA 1FPWA 1TNWA 2LANA 1B8RA 1WRZA 4PHJA 2PASA 4OVNF 2LVJA 1BOCA 2SCPA 2NLNA 3TDIA 2M3WA 1KQMC 3SG5A 3SIAA 1B8LA 1LKJA 1H4BA 1GGWA 1SY9A 4MSPA 5AXIA 1PK0D 3SJSA 2KFFA 1MQ1A 4OKHA 1Y0VH 3VROA 1A29A 5JJGA 3OP0A 2M0RA 3WHUB 2K8MB 4WQ2A 3I5HC 3I5IC 5AFPA 1DGVA 2KAVA 2M29A 5FYXA 1J7PA 2KGBC 4DUQA 1QJTA 1DF0A 1TTXA 2MAZA 4HSZA 4ICBA 2CCMA 2JT0A 1DVIA 1B7TY 2PRUA 1BF5A 1NWDA 1R6PA 4N5XA 1OZSA 1A4PA 2JRFA 1LXFC 2JOJA 1H8BA 2VRGA 2PSRA 1PSRA 1QV0A 2M7NA 5ER4X 1PVBA 3M0WA 2WOSA 4YGBB 1SBJA 2KDHA 4XYNA 2M49B 1VRKA 1IGVA 1OOJA 3VGOA 1L2OC 1YX7A 2KI4B 1IH0A 3LK0A 2LHIA 1TOPA 2M8UA 2WNDA 1SW8A 3D0YA 4HRGA 1EH2A 2M7LA 3D10A 3AKBA 2EGDA 2COLB 3I5FB 2NZ0A 3SIBA 2GGZA 1U5IA 1XK4C 2ZNEA 5IBWA 2AMIA 2BECA 5KU1A 1G33A 1J1DA 4U8DA 3PLFB 1CFDA 3FS7A 2OTGB 5CPVA 1F8HA 2LLUA 2CNPA 1OMDA 1S1EA 1F4OA 3GOFA 2HF5A 1SRAA 1EXRA 2LV7A 1OSAA 5B8IB 4QJ5B 1CNPA 1NIWA 1PALA 1LVCD 2KFGA 2LMTA 3EKHA 3BUOB 4IL1A 1B8CA 3LK1A 4PHKA 1SMGA 1K95A 1KFUS 4GPLB 2WC8A 4MEWA 1EG3A 2LHLA 4GGFA 1M39A 1KQMB 2WORA 4N1FA 2M1UA 4GBAA 1MF8B 1BT6A 1PRWA 2PVBA 1CDPA 1E8AA 1WRKA 3F45A 5DKNA 2K0JA 3C1VA 2QPTA 5K89A 1A75A 2HPSA 2JULA 1CMGA 4NDBA 1M31A 1FBVA 3EK4A 3I5HB 3TS5C 1NX2A 5KTYA 3BOWA 2L50A 3SG2A 1KQVA 1CB1A 2I94A 1F70A 1QATA 2HQWA 2LCPA 3CS1A 3DF0A 4PE0A 4L9MA 1TNQA 1BODA 2FCEA 1CM4A 1QV1A 2JT3A 3PM8A 2OPOA 1JC2A 1RFJA 1HQVA 1NSHA 3BUMB 2JXCA 1K9KA 1WLZA 4AQJA 2BKIB 1V1FA 2JQ6A 3OB1B 1N0YA 1ALVA 3QRXA 4I5JA 4WQ3A 4XJKA 3NSLA 1KSOA 3DVJA 4FQOA 5CSNA 4GFTA 1KK7Y 2L4HA 1N2DA 1OZOA 4YI8A 1JFJA 1JUOA 4QJ3B 3CGAA 3K21A 1D1OA 1DGUA 4CIDA 1KFXS 1XVJA 5HYDA 2V53A 1B1GA 1CFCA 5F6TA 1SL9A 4MZJA 2OS8C 1K96A 1XFWO 2LUXA 2HQ8A 3LLEA 2ZN9A 3NSKA 4MZLA 4CPVA 1ODBA 1F4QA 3CR2A 1YX8A 4ORBB 2P6BB 4F0ZB 1NX1A 3AAKA 3KF9A 1LINA 3OX5A 4FTGA 1QLSA 4GGNA 1YUSA 2Y5IA 3KO0A 4NDCA 1OMVA 1NP8A 2JNFA 3CLNA 1K94A 1Y1AA 2L98A 2MRDA 1WDCC 2KBIA 3PSRA 4MZKA 3OB2B 2L51A 4HRHA 1ZOTB 1XK4A 1GJYA 1S5GZ 1XYDA 2ZN8A 1F55A 1RK9A 1CLLA 2Y1NA 2KFHA 2LM5A 2B1UA 1TNXA 3GK2A 5AEQA 2M1KB 3O2PA 1J7QA 4DCKA 3EKJA 2KAXA 5GQQC 2BKHB 2F3ZA 3EVUA 1FF1A 4ORAB 1S26D 1TRFA 1DJGA 5BPJA 2KI6C 2BCAA 2F2PA 1M63B 1KWOB 1NCYA 3TDZA 3TS5B 1KK8B 1MUXA 3FWCA 4MRXA 4C0JA 1UHKA 2MLFC 1CMFA 4OCIA 1PULA 3PN7C 1TNPA 2JXLA 2PMYA 1CFFA 1PVAA 2F33A 2KI6D 2LE9B 4P2YB 1FI5A 1KCYA 5HKYA 1SPYA 1SR6B 1OE9B 1XFUO 1AJ5A 2R2IA 1UWOA 4P5OE 2MHHA 2LNKA 1QTXA 2MA2A 4JWQA 2CBLA 1G8IA 1DJXA 2DOQA 3BUNB 1LA0A 4OR9B 4JPZB 1NPQA 2H61C 1S36A 4PHNA 1QVIZ 4NQGA 1QASA 1BMOA 1TCFA 5KSZA 1SKTA 2A4JA 2KYCA 2MBXA 1IWQA 1X02A 1NCZA 2OS8B 3PALA 3PFVA
chains in the Genus database with same CATH superfamily
2EHBA 3R1PA 2JTTA 3VRQA 1XFYO 3L4AA 4CLNA 1BU3A 1QIWA 1V1GA 3BUXB 1WY9A 3NGVA 4IJ7A 5CSFA 2K7OA 2K7CA 3A4UB 1S6CA 1CDNA 3QMEA 2PYQA 2M9GA 2KGRA 1QX5B 1G4YR 4MRYA 1IQ5A 3A8RA 3OBVA 2BCXA 1OW4A 4PT1A 1Y1UA 1UHJA 1YVHA 1BG1A 1J7RA 3DD4A 2WCHA 1Q80A 3D74A 1MHOA 2FJUB 2LVIA 1WDCB 3DVEA 2K2AA 1FW4A 4AQIA 1YVLA 2G2BA 5I2OA 3RZSA 4YGCB 3V2LA 1IJ5A 4M2OA 2K7DA 2ISDA 3KHEA 2ERBA 1OOHA 1KWOC 1BJFA 1KK8C 5TNCA 3FIAA 5DKQA 2F8PA 3CTNA 4NDDA 1D1OA 1EJ3A 3EVVA 1F71A 5DKRA 5G08A 1JSAA 3VRPA 1BLQA 4CFQA 2BBNA 3IQOA 1Z2CB 3B87A 1OQPA 3L4LA 4MVFA 4I5NB 3CWGA 2O5GA 3BFHA 1DMOA 2AUCA 1JF0A 2KBMA 4AOMA 2K60A 3GK1A 4YI9A 2K7BA 1SR6C 2KYFA 3FE6A 3PN7B 2LP3A 4BY5A 2IS9A 1AP4A 2JNXA 1QIVA 2BBMA 3KPXA 2H8VA 2L4IA 3FWBA 2K2FA 3D76A 2LMUA 2MJWB 3MSEB 2O60A 2GGMA 4JQ0D 1TCOB 4BY4A 3D75A 3CZ2A 1J1EA 4D1EA 3TDUA 1NX0A 1YR5A 1W7IB 2KOTA 3D78A 1YRUB 1K8UA 3BUWB 3JVTC 2KQYA 2QACA 2BL0C 4Q04A 2KHNA 4YGAA 1TUJA 1S3PA 1SL8A 3CR5X 2F3YA 2Q91A 2BCBA 2RGIA 3HCMA 2ZRTA 4GGFC 1TN4A 1J55A 1K9UA 1QLKA 1JWDA 2E30A 1YTZC 3ZWHA 3RM1A 1IJ6A 1CLMA 2EC6C 2CXJA 2WCBA 2H2KA 2JWWA 2NCPA 3ZNIA 2L0PA 4I5LB 3LCPC 1EG4A 1LA3A 3NSOA 3LL8B 3S0EA 3PATA 2KPHA 4PHMA 4DIRA 1L7ZA 2BE6A 1SNLA 4QJ4B 1UP5A 1CFPA 3WHTB 1S6IA 2ZKMX 2H61A 2ZFDA 3TUYC 1MXEA 5I2QA 5JOLA 1DF0B 1LS8A 1M45A 1DT7B 4GNKB 1MWNA 4MLWA 3S0AA 1AK8A 1UHIA 1CKKA 2LUCA 3O4YA 2JZIA 2I2RE 1K93D 3DXLA 2FOTA 1NCXA 3CYZA 3HX4A 4C0LA 2JTZA 3CZ1A 2Q4UA 4ETOA 3N7HA 3SG6A 2WCJA 2YGUA 2SASA 1AVSA 1M46A 1RECA 2PQLA 1KFUL 2LLSA 1NYAA 1T14A 1QXPA 1R2UA 1XA5A 2GV5A 4CFRA 4HREE 4TNCA 1WLMA 1KK7Z 1K9PA 2M97A 1SL7A 2WCLA 3D0YB 3JTDC 1ALWA 1C3ZA 1YURA 1C7WA 1SCMC 1TIZA 1W7JB 3DVKA 2WCMA 4PE7A 5D69A 5HKZA 5HLVA 4UPGA 4A4BA 1U5IB 1CTRA 1B9AA 2NXQA 1QX2A 5I2LA 1J7OA 2L2CA 1NX3A 5FI6A 3DVMA 1W9ZA 1GGZA 2P70A 1EL4A 1S6JA 3AAJA 1Z4HA 3O78A 4M2PA 4USLA 1A03A 3DY9A 4I5KA 1DTLA 4PDZA 5AANA 1ZMZA 1XFVO 4YGEB 3I5GB 4YBHB 1IG5A 2MLEC 1DJYA 1ZUZA 3JVTB 3NSIA 1YUUA 1MXLC 2BL0B 2LC5A 2D8NA 1B4CA 1DJZA 3EVRA 5D7FA 4GAOA 1QX7A 2TN4A 2WCEA 3E3RA 4PE4A 3EK7A 1OMRA 3OHMB 1JFKA 3FE8A 5CSIA 3R72A 2KLDA 1AUIB 2Y4QA 3GK4X 5HKWA 4DRWA 1JF2A 1AJ4A 2EC6B 1DEKA 2LVVA 1TWOA 3IQQA 5I8NA 3ICBA 1KFXL 2L2EA 4PALA 2WC5A 1A75B 3L47A 4ZCVA 2AAOA 2ZRSA 1CDLA 1Y1XA 2I18A 2JT8A 1DJIA 1RJVA 2L5YA 2NCOA 4MN0A 5PALA 3TUYB 1SCVA 3BOWB 2G9BA 1DJHA 3CDNA 3VRRA 1IRJA 2GTEA 1B7TZ 1KSMA 2E6WA 2KNEA 2LLTA 3O6BA 1GM0A 1XO5A 4DS7A 3EG5B 2HETA 1MR8A 3DF0B 3K1EA 1IQ3A 1CLBA 2KAYA 1A2XA 2WCFA 4E68A 2LVKA 1OOGA 2PALA 2L5XB 5CSJA 3PM2A 3VRNA 2KLEA 4YGDB 1BR4B 1S5GY 1RTP1 2I7AA 3CZTX 3AKAA 4N1GA 4XJKB 5FI7A 1XFZO 1RROA 2JPTA 2KSPA 2QEVA 3EK8A 3KEVA 4KYNA 1SYMA 4PE1A 4WRIA 3RLZA 2CTNA 3CR4X 3NXAA 1IKUA 1UURA 2K61A 2KQ6A 3I5IB 2F2OA 4ORCB 1ZACA 1CM1A 3DYEA 4PCWA 4YRUA 1UHNA 1WRLA 2CT9A 3JTDB 5J3XA 1FI6A 3NHTA 1CDMA 1SCMB 1SK6D 2LP2A 3WNXB 1YRTB 5AERA 2LMVA 2Y1MA 1NUBA 5ER5A 3WXAA 3CABA 2LAPA 3IF7A 1HT9A 4C0KA 4OV2A 2JU0A 2JC2A 2BAPA 2KI4C 3I5GC 3SG3A 1ZFSA 1UHHA 1K90D 1PSBA 1AHRA 3BQ3A 3OX6A 2BE4A 3BYAA 2ZNDA 4M2QA 4MBEA 4R1EA 2P71A 1C7VA 4ZCUA 1B47A 2QEBA 3I5FC 2QEOA 1L2OB 1QS7A 3TZ1A 1JBAA 1K2HA 1C07A 3H4SE 1UUSA 1XFXO 4GUKA 2OTGC 1GQMA 3SG4A 1N65A 1YUTA 1DJWA 1Y6WA 1RWYA 1QVIY 3SG7A 1F54A 3D77A 3BXKA 5EL2A 2FCDA 1BR1B 5HLOA 1FPWA 1TNWA 2LANA 1B8RA 3B6XA 1SSEB 1DELA 1WRZA 4PHJA 2PASA 4OVNF 2LVJA 1BOCA 2SCPA 2NLNA 3TDIA 2M3WA 3IVTA 1KQMC 3SG5A 1IIOA 3SIAA 1B8LA 1LKJA 1H4BA 1GGWA 1SY9A 4MSPA 5AXIA 1OOFA 1PK0D 3SJSA 3DZTA 4PHNA 2KFFA 4QJ3B 1MQ1A 4OKHA 1Y0VH 3VROA 1A29A 5JJGA 3OP0A 2M0RA 3WHUB 2K8MB 4WQ2A 3I5HC 3I5IC 5AFPA 1DGVA 2KAVA 2M29A 5FYXA 1J7PA 2KGBC 4DUQA 1QJTA 1DF0A 1TTXA 2MAZA 4HSZA 4ICBA 2CCMA 2JT0A 1DVIA 1B7TY 2PRUA 1BF5A 1C3YA 1NWDA 1R6PA 4N5XA 1OZSA 1A4PA 2JRFA 1LXFC 2JOJA 1H8BA 2VRGA 2PSRA 1PSRA 3B7AA 5HL1A 2WCKA 1QV0A 3PJIA 2M7NA 5ER4X 1PVBA 3M0WA 2WOSA 4YGBB 1SBJA 2KDHA 4XYNA 1OOIX 2M49B 1VRKA 1IGVA 1OOJA 3VGOA 1L2OC 1YX7A 2KI4B 1IH0A 3FE9A 3LK0A 2LHIA 1TOPA 2M8UA 2WNDA 1SW8A 5D3OA 3D0YA 4HRGA 1EH2A 2M7LA 3D10A 2WC6A 3AKBA 2EGDA 2COLB 3I5FB 2NZ0A 5FI2A 2GGZA 1U5IA 1XK4C 2ZNEA 3SIBA 2AMIA 5IBWA 2BECA 5KU1A 1G33A 1J1DA 4U8DA 3PLFB 1CFDA 1XFRA 3FS7A 2OTGB 5CPVA 1F8HA 1P28A 2LLUA 2CNPA 1OMDA 1S1EA 1F4OA 3GOFA 2HF5A 1SRAA 1EXRA 2LV7A 1TUZA 1OSAA 4FQTA 5B8IB 4QJ5B 1CNPA 1NIWA 1PALA 1LVCD 2KFGA 2LMTA 3EKHA 3BUOB 4IL1A 1B8CA 3LK1A 3SS5A 4PHKA 1SMGA 1K95A 1KFUS 4GPLB 2WC8A 4MEWA 1EG3A 2LHLA 3D73A 4GGFA 1M39A 1KQMB 2WORA 4N1FA 2M1UA 3BFAA 4GBAA 1MF8B 1BT6A 3S0DA 1PRWA 2PVBA 1CDPA 1E8AA 1WRKA 3F45A 1ORGA 5DKNA 2K0JA 3C1VA 3O4XA 2QPTA 5K89A 1A75A 3S0FA 2HPSA 2JULA 1CMGA 4NDBA 1M31A 1FBVA 3EK4A 3I5HB 3TS5C 1NX2A 5KTYA 3Q8IA 3BFBA 2L50A 3BOWA 3SG2A 3VB1A 1KQVA 1CB1A 2I94A 1F70A 1QATA 2HQWA 2LCPA 3CS1A 3DF0A 4PE0A 4L9MA 1TNQA 1BODA 2FCEA 3SS3A 1CM4A 1QV1A 2JT3A 3PM8A 2OPOA 1JC2A 1RFJA 1HQVA 1NSHA 3BUMB 2JXCA 1K9KA 1WLZA 4AQJA 2BKIB 1V1FA 4JD9A 2JQ6A 3OB1B 1N0YA 1ALVA 3QRXA 4I5JA 4WQ3A 4XJKA 5DICA 3NSLA 1KSOA 3DVJA 4FQOA 5CSNA 4GFTA 4OZDA 1KK7Y 2L4HA 1N2DA 1OZOA 4YI8A 1JFJA 1JUOA 1QWVA 3B86A 3CGAA 3CZ0A 1DGUA 3K21A 1KFXS 1XVJA 3R1OA 4CIDA 5HYDA 2V53A 3BJHA 1B1GA 1CFCA 5F6TA 1SL9A 4MZJA 2OS8C 1K96A 1XFWO 4JKTA 2LUXA 1DC1A 2HQ8A 3LLEA 2ZN9A 3NSKA 4MZLA 2JPOA 4CPVA 1ODBA 1F4QA 3UO9A 3CR2A 1YX8A 4ORBB 2P6BB 4F0ZB 1NX1A 3AAKA 3S0BA 3KF9A 1LINA 2QEHA 4F7FA 3OX5A 4FTGA 3R1VA 1QLSA 4GGNA 1YUSA 2Y5IA 3KO0A 4NDCA 1OMVA 1NP8A 2JNFA 3CLNA 4INXA 1K94A 1Y1AA 2L98A 4A4CA 2MRDA 3SS4A 1WDCC 2KBIA 2BNXA 3PSRA 4MZKA 3OB2B 2L51A 4HRHA 1ZOTB 1XK4A 1GJYA 1S5GZ 1XYDA 2ZN8A 1F55A 1RK9A 1CLLA 2Y1NA 2KFHA 2LM5A 2B1UA 1TNXA 3GK2A 3B88A 5AEQA 2M1KB 3O2PA 1J7QA 4DCKA 3EKJA 2KAXA 5GQQC 2BKHB 2F3ZA 3EVUA 1FF1A 4ORAB 1S26D 1TRFA 1DJGA 5BPJA 2KI6C 2BCAA 2F2PA 1M63B 1KWOB 1NCYA 3TDZA 2FJYA 1KK8B 1MUXA 3FWCA 4MRXA 3TS5B 4C0JA 1UHKA 2MLFC 1CMFA 4OCIA 1PULA 3PN7C 5I94A 1TNPA 2JXLA 2PMYA 1CFFA 1PVAA 2F33A 2KI6D 2LE9B 4P2YB 1FI5A 1KCYA 5HKYA 1SPYA 1SR6B 1OE9B 1XFUO 1AJ5A 2R2IA 1UWOA 3OGNA 2MHHA 2QDIA 4P5OE 2LNKA 1QTXA 2MA2A 4JWQA 2CBLA 1G8IA 1DJXA 2DOQA 3BUNB 1LA0A 4OR9B 4JPZB 1NPQA 2H61C 1DQEA 1S36A 1QVIZ 3S0GA 3NHIA 4INWA 4NQGA 1QASA 1BMOA 1TCFA 5KSZA 3UNWA 1SKTA 2A4JA 2KYCA 2MBXA 1IWQA 1X02A 1NCZA 2OS8B 3PALA 3PFVA
chains in the Genus database with same CATH topology
2EHBA 2JTTA 3VRQA 1XFYO 4CLNA 1BU3A 1QIWA 1V1GA 3BUXB 1WY9A 5CSFA 2K7OA 2K7CA 3A4UB 1S6CA 1CDNA 2M9GA 2KGRA 1QX5B 1G4YR 4MRYA 1IQ5A 3A8RA 2BCXA 1Y1UA 1UHJA 1YVHA 1BG1A 1J7RA 3DD4A 1Q80A 1MHOA 2FJUB 2LVIA 1WDCB 3DVEA 2K2AA 1FW4A 4AQIA 1YVLA 2G2BA 5I2OA 4YGCB 1IJ5A 4M2OA 2K7DA 2ISDA 3KHEA 1KWOC 1BJFA 1KK8C 5TNCA 3FIAA 5DKQA 2F8PA 3CTNA 4NDDA 1EJ3A 3EVVA 1F71A 5DKRA 5G08A 1JSAA 3VRPA 1BLQA 4CFQA 2BBNA 3IQOA 1OQPA 4MVFA 4I5NB 3CWGA 2O5GA 1DMOA 2AUCA 1JF0A 2KBMA 4AOMA 3GK1A 4YI9A 2K7BA 1SR6C 2KYFA 3PN7B 2LP3A 4BY5A 2IS9A 1AP4A 2JNXA 1QIVA 2BBMA 3KPXA 2L4IA 3FWBA 2K2FA 2LMUA 2MJWB 3MSEB 2O60A 2GGMA 4JQ0D 1TCOB 4BY4A 4D1EA 1J1EA 3TDUA 1NX0A 1YR5A 1W7IB 2KOTA 1YRUB 1K8UA 3BUWB 3JVTC 2KQYA 2QACA 2BL0C 4Q04A 2KHNA 4YGAA 1S3PA 1SL8A 3CR5X 2F3YA 2Q91A 2BCBA 2RGIA 3HCMA 2ZRTA 4GGFC 1TN4A 1J55A 1K9UA 1QLKA 1JWDA 2E30A 1YTZC 3ZWHA 3RM1A 1IJ6A 1CLMA 2EC6C 2CXJA 2WCBA 2H2KA 2JWWA 2NCPA 3ZNIA 2L0PA 4I5LB 3LCPC 1EG4A 1LA3A 3NSOA 3LL8B 3PATA 4PHMA 4DIRA 1L7ZA 2BE6A 1SNLA 4QJ4B 1UP5A 1CFPA 3WHTB 1S6IA 2ZKMX 2H61A 2ZFDA 3TUYC 1MXEA 5I2QA 5JOLA 1DF0B 1DT7B 1M45A 4GNKB 1MWNA 4MLWA 1AK8A 1UHIA 1CKKA 2LUCA 3O4YA 2JZIA 2I2RE 1K93D 2FOTA 1NCXA 3HX4A 4C0LA 2JTZA 2Q4UA 4ETOA 3SG6A 2SASA 1AVSA 1M46A 1RECA 1KFUL 2LLSA 1NYAA 1QXPA 1R2UA 1XA5A 2GV5A 4CFRA 4HREE 4TNCA 1WLMA 1KK7Z 1K9PA 2M97A 1SL7A 3D0YB 3JTDC 1ALWA 1YURA 1C7WA 1SCMC 1TIZA 1W7JB 3DVKA 4PE7A 5D69A 5HLVA 5HKZA 4UPGA 4A4BA 1U5IB 1CTRA 1B9AA 2NXQA 1QX2A 5I2LA 1J7OA 1NX3A 3DVMA 1GGZA 4M2PA 1EL4A 1S6JA 3AAJA 3O78A 4USLA 1A03A 4I5KA 4PDZA 1DTLA 5AANA 1ZMZA 1XFVO 4YGEB 3I5GB 4YBHB 1IG5A 2MLEC 1DJYA 1ZUZA 3JVTB 3NSIA 1YUUA 1MXLC 2BL0B 2LC5A 2D8NA 1B4CA 1DJZA 3EVRA 5D7FA 4GAOA 1QX7A 2TN4A 2WCEA 3E3RA 4PE4A 3EK7A 1OMRA 3OHMB 1JFKA 5CSIA 1AUIB 2Y4QA 3GK4X 5HKWA 4DRWA 1JF2A 1AJ4A 2EC6B 2LVVA 3IQQA 5I8NA 3ICBA 1KFXL 2L2EA 4PALA 1A75B 4ZCVA 2AAOA 2ZRSA 1CDLA 1Y1XA 2I18A 2JT8A 1DJIA 1RJVA 2NCOA 4MN0A 5PALA 3TUYB 4A4CA 1SCVA 3BOWB 2G9BA 1DJHA 3VRRA 1IRJA 1B7TZ 1KSMA 2E6WA 2KNEA 2LLTA 3O6BA 1XO5A 4DS7A 2HETA 1MR8A 3DF0B 1IQ3A 1CLBA 2KAYA 1A2XA 2WCFA 4E68A 2LVKA 2PALA 2L5XB 5CSJA 3VRNA 4YGDB 1BR4B 1S5GY 1RTP1 2I7AA 3CZTX 3AKAA 4N1GA 4XJKB 1XFZO 1RROA 2JPTA 2KSPA 3KEVA 3EK8A 4PE1A 4WRIA 1SYMA 3RLZA 2CTNA 3CR4X 3NXAA 1IKUA 1UURA 2K61A 2KQ6A 3I5IB 2F2OA 4ORCB 1CM1A 1ZACA 4PCWA 4YRUA 1UHNA 1WRLA 2CT9A 3JTDB 5J3XA 1FI6A 1CDMA 1SCMB 1SK6D 2LP2A 3WNXB 1YRTB 5AERA 2LMVA 2Y1MA 1NUBA 5ER5A 3WXAA 2LAPA 3IF7A 1HT9A 4C0KA 4OV2A 2JU0A 2JC2A 2KI4C 3I5GC 3SG3A 1ZFSA 1UHHA 1K90D 1PSBA 1AHRA 3BQ3A 3OX6A 2BE4A 3BYAA 2ZNDA 4M2QA 4MBEA 4R1EA 1C7VA 4ZCUA 1B47A 3I5FC 1L2OB 1QS7A 3TZ1A 1JBAA 1K2HA 1C07A 3H4SE 1UUSA 1XFXO 4GUKA 2OTGC 1GQMA 3SG4A 1N65A 1YUTA 1DJWA 1Y6WA 1RWYA 1QVIY 3SG7A 1F54A 3BXKA 2FCDA 1BR1B 5HLOA 1FPWA 1TNWA 2LANA 1B8RA 1WRZA 4PHJA 2PASA 4OVNF 2LVJA 1BOCA 2SCPA 2NLNA 3TDIA 2M3WA 1KQMC 3SG5A 3SIAA 1B8LA 1LKJA 1H4BA 1GGWA 1SY9A 4MSPA 5AXIA 1PK0D 3SJSA 2KFFA 1MQ1A 4OKHA 1Y0VH 3VROA 1A29A 5JJGA 3OP0A 2M0RA 3WHUB 2K8MB 4WQ2A 3I5HC 3I5IC 5AFPA 1DGVA 2KAVA 2M29A 5FYXA 1J7PA 2KGBC 4DUQA 1QJTA 1DF0A 1TTXA 2MAZA 4HSZA 4ICBA 2CCMA 2JT0A 1DVIA 1B7TY 2PRUA 1BF5A 1NWDA 1R6PA 4N5XA 1OZSA 1A4PA 2JRFA 1LXFC 2JOJA 1H8BA 2VRGA 2PSRA 1PSRA 1QV0A 2M7NA 5ER4X 1PVBA 3M0WA 2WOSA 4YGBB 1SBJA 2KDHA 4XYNA 2M49B 1VRKA 1IGVA 1OOJA 3VGOA 1L2OC 1YX7A 2KI4B 1IH0A 3LK0A 2LHIA 1TOPA 2M8UA 2WNDA 1SW8A 3D0YA 4HRGA 1EH2A 2M7LA 3D10A 3AKBA 2EGDA 2COLB 3I5FB 2NZ0A 3SIBA 2GGZA 1U5IA 1XK4C 2ZNEA 5IBWA 2AMIA 2BECA 5KU1A 1G33A 1J1DA 4U8DA 3PLFB 1CFDA 3FS7A 2OTGB 5CPVA 1F8HA 2LLUA 2CNPA 1OMDA 1S1EA 1F4OA 3GOFA 2HF5A 1SRAA 1EXRA 2LV7A 1OSAA 5B8IB 4QJ5B 1CNPA 1NIWA 1PALA 1LVCD 2KFGA 2LMTA 3EKHA 3BUOB 4IL1A 1B8CA 3LK1A 4PHKA 1SMGA 1K95A 1KFUS 4GPLB 2WC8A 4MEWA 1EG3A 2LHLA 4GGFA 1M39A 1KQMB 2WORA 4N1FA 2M1UA 4GBAA 1MF8B 1BT6A 1PRWA 2PVBA 1CDPA 1E8AA 1WRKA 3F45A 5DKNA 2K0JA 3C1VA 2QPTA 5K89A 1A75A 2HPSA 2JULA 1CMGA 4NDBA 1M31A 1FBVA 3EK4A 3I5HB 3TS5C 1NX2A 5KTYA 3BOWA 2L50A 3SG2A 1KQVA 1CB1A 2I94A 1F70A 1QATA 2HQWA 2LCPA 3CS1A 3DF0A 4PE0A 4L9MA 1TNQA 1BODA 2FCEA 1CM4A 1QV1A 2JT3A 3PM8A 2OPOA 1JC2A 1RFJA 1HQVA 1NSHA 3BUMB 2JXCA 1K9KA 1WLZA 4AQJA 2BKIB 1V1FA 2JQ6A 3OB1B 1N0YA 1ALVA 3QRXA 4I5JA 4WQ3A 4XJKA 3NSLA 1KSOA 3DVJA 4FQOA 5CSNA 4GFTA 1KK7Y 2L4HA 1N2DA 1OZOA 4YI8A 1JFJA 1JUOA 4QJ3B 3CGAA 3K21A 1D1OA 1DGUA 4CIDA 1KFXS 1XVJA 5HYDA 2V53A 1B1GA 1CFCA 5F6TA 1SL9A 4MZJA 2OS8C 1K96A 1XFWO 2LUXA 2HQ8A 3LLEA 2ZN9A 3NSKA 4MZLA 4CPVA 1ODBA 1F4QA 3CR2A 1YX8A 4ORBB 2P6BB 4F0ZB 1NX1A 3AAKA 3KF9A 1LINA 3OX5A 4FTGA 1QLSA 4GGNA 1YUSA 2Y5IA 3KO0A 4NDCA 1OMVA 1NP8A 2JNFA 3CLNA 1K94A 1Y1AA 2L98A 2MRDA 1WDCC 2KBIA 3PSRA 4MZKA 3OB2B 2L51A 4HRHA 1ZOTB 1XK4A 1GJYA 1S5GZ 1XYDA 2ZN8A 1F55A 1RK9A 1CLLA 2Y1NA 2KFHA 2LM5A 2B1UA 1TNXA 3GK2A 5AEQA 2M1KB 3O2PA 1J7QA 4DCKA 3EKJA 2KAXA 5GQQC 2BKHB 2F3ZA 3EVUA 1FF1A 4ORAB 1S26D 1TRFA 1DJGA 5BPJA 2KI6C 2BCAA 2F2PA 1M63B 1KWOB 1NCYA 3TDZA 3TS5B 1KK8B 1MUXA 3FWCA 4MRXA 4C0JA 1UHKA 2MLFC 1CMFA 4OCIA 1PULA 3PN7C 1TNPA 2JXLA 2PMYA 1CFFA 1PVAA 2F33A 2KI6D 2LE9B 4P2YB 1FI5A 1KCYA 5HKYA 1SPYA 1SR6B 1OE9B 1XFUO 1AJ5A 2R2IA 1UWOA 4P5OE 2MHHA 2LNKA 1QTXA 2MA2A 4JWQA 2CBLA 1G8IA 1DJXA 2DOQA 3BUNB 1LA0A 4OR9B 4JPZB 1NPQA 2H61C 1S36A 4PHNA 1QVIZ 4NQGA 1QASA 1BMOA 1TCFA 5KSZA 1SKTA 2A4JA 2KYCA 2MBXA 1IWQA 1X02A 1NCZA 2OS8B 3PALA 3PFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHB A;  2JTT A;  3VRQ A;  1XFY O;  4CLN A;  1BU3 A;  1QIW A;  1V1G A;  3BUX B;  1WY9 A;  5CSF A;  2K7O A;  2K7C A;  3A4U B;  1S6C A;  1CDN A;  2M9G A;  2KGR A;  1QX5 B;  1G4Y R;  4MRY A;  1IQ5 A;  3A8R A;  2BCX A;  1Y1U A;  1UHJ A;  1YVH A;  1BG1 A;  1J7R A;  3DD4 A;  1Q80 A;  1MHO A;  2FJU B;  2LVI A;  1WDC B;  3DVE A;  2K2A A;  1FW4 A;  4AQI A;  1YVL A;  2G2B A;  5I2O A;  4YGC B;  1IJ5 A;  4M2O A;  2K7D A;  2ISD A;  3KHE A;  1KWO C;  1BJF A;  1KK8 C;  5TNC A;  3FIA A;  5DKQ A;  2F8P A;  3CTN A;  4NDD A;  1EJ3 A;  3EVV A;  1F71 A;  5DKR A;  5G08 A;  1JSA A;  3VRP A;  1BLQ A;  4CFQ A;  2BBN A;  3IQO A;  1OQP A;  4MVF A;  4I5N B;  3CWG A;  2O5G A;  1DMO A;  2AUC A;  1JF0 A;  2KBM A;  4AOM A;  3GK1 A;  4YI9 A;  2K7B A;  1SR6 C;  2KYF A;  3PN7 B;  2LP3 A;  4BY5 A;  2IS9 A;  1AP4 A;  2JNX A;  1QIV A;  2BBM A;  3KPX A;  2L4I A;  3FWB A;  2K2F A;  2LMU A;  2MJW B;  3MSE B;  2O60 A;  2GGM A;  4JQ0 D;  1TCO B;  4BY4 A;  4D1E A;  1J1E A;  3TDU A;  1NX0 A;  1YR5 A;  1W7I B;  2KOT A;  1YRU B;  1K8U A;  3BUW B;  3JVT C;  2KQY A;  2QAC A;  2BL0 C;  4Q04 A;  2KHN A;  4YGA A;  1S3P A;  1SL8 A;  3CR5 X;  2F3Y A;  2Q91 A;  2BCB A;  2RGI A;  3HCM A;  2ZRT A;  4GGF C;  1TN4 A;  1J55 A;  1K9U A;  1QLK A;  1JWD A;  2E30 A;  1YTZ C;  3ZWH A;  3RM1 A;  1IJ6 A;  1CLM A;  2EC6 C;  2CXJ A;  2WCB A;  2H2K A;  2JWW A;  2NCP A;  3ZNI A;  2L0P A;  4I5L B;  3LCP C;  1EG4 A;  1LA3 A;  3NSO A;  3LL8 B;  3PAT A;  4PHM A;  4DIR A;  1L7Z A;  2BE6 A;  1SNL A;  4QJ4 B;  1UP5 A;  1CFP A;  3WHT B;  1S6I A;  2ZKM X;  2H61 A;  2ZFD A;  3TUY C;  1MXE A;  5I2Q A;  5JOL A;  1DF0 B;  1DT7 B;  1M45 A;  4GNK B;  1MWN A;  4MLW A;  1AK8 A;  1UHI A;  1CKK A;  2LUC A;  3O4Y A;  2JZI A;  2I2R E;  1K93 D;  2FOT A;  1NCX A;  3HX4 A;  4C0L A;  2JTZ A;  2Q4U A;  4ETO A;  3SG6 A;  2SAS A;  1AVS A;  1M46 A;  1REC A;  1KFU L;  2LLS A;  1NYA A;  1QXP A;  1R2U A;  1XA5 A;  2GV5 A;  4CFR A;  4HRE E;  4TNC A;  1WLM A;  1KK7 Z;  1K9P A;  2M97 A;  1SL7 A;  3D0Y B;  3JTD C;  1ALW A;  1YUR A;  1C7W A;  1SCM C;  1TIZ A;  1W7J B;  3DVK A;  4PE7 A;  5D69 A;  5HLV A;  5HKZ A;  4UPG A;  4A4B A;  1U5I B;  1CTR A;  1B9A A;  2NXQ A;  1QX2 A;  5I2L A;  1J7O A;  1NX3 A;  3DVM A;  1GGZ A;  4M2P A;  1EL4 A;  1S6J A;  3AAJ A;  3O78 A;  4USL A;  1A03 A;  4I5K A;  4PDZ A;  1DTL A;  5AAN A;  1ZMZ A;  1XFV O;  4YGE B;  3I5G B;  4YBH B;  1IG5 A;  2MLE C;  1DJY A;  1ZUZ A;  3JVT B;  3NSI A;  1YUU A;  1MXL C;  2BL0 B;  2LC5 A;  2D8N A;  1B4C A;  1DJZ A;  3EVR A;  5D7F A;  4GAO A;  1QX7 A;  2TN4 A;  2WCE A;  3E3R A;  4PE4 A;  3EK7 A;  1OMR A;  3OHM B;  1JFK A;  5CSI A;  1AUI B;  2Y4Q A;  3GK4 X;  5HKW A;  4DRW A;  1JF2 A;  1AJ4 A;  2EC6 B;  2LVV A;  3IQQ A;  5I8N A;  3ICB A;  1KFX L;  2L2E A;  4PAL A;  1A75 B;  4ZCV A;  2AAO A;  2ZRS A;  1CDL A;  1Y1X A;  2I18 A;  2JT8 A;  1DJI A;  1RJV A;  2NCO A;  4MN0 A;  5PAL A;  3TUY B;  4A4C A;  1SCV A;  3BOW B;  2G9B A;  1DJH A;  3VRR A;  1IRJ A;  1B7T Z;  1KSM A;  2E6W A;  2KNE A;  2LLT A;  3O6B A;  1XO5 A;  4DS7 A;  2HET A;  1MR8 A;  3DF0 B;  1IQ3 A;  1CLB A;  2KAY A;  1A2X A;  2WCF A;  4E68 A;  2LVK A;  2PAL A;  2L5X B;  5CSJ A;  3VRN A;  4YGD B;  1BR4 B;  1S5G Y;  1RTP 1;  2I7A A;  3CZT X;  3AKA A;  4N1G A;  4XJK B;  1XFZ O;  1RRO A;  2JPT A;  2KSP A;  3KEV A;  3EK8 A;  4PE1 A;  4WRI A;  1SYM A;  3RLZ A;  2CTN A;  3CR4 X;  3NXA A;  1IKU A;  1UUR A;  2K61 A;  2KQ6 A;  3I5I B;  2F2O A;  4ORC B;  1CM1 A;  1ZAC A;  4PCW A;  4YRU A;  1UHN A;  1WRL A;  2CT9 A;  3JTD B;  5J3X A;  1FI6 A;  1CDM A;  1SCM B;  1SK6 D;  2LP2 A;  3WNX B;  1YRT B;  5AER A;  2LMV A;  2Y1M A;  1NUB A;  5ER5 A;  3WXA A;  2LAP A;  3IF7 A;  1HT9 A;  4C0K A;  4OV2 A;  2JU0 A;  2JC2 A;  2KI4 C;  3I5G C;  3SG3 A;  1ZFS A;  1UHH A;  1K90 D;  1PSB A;  1AHR A;  3BQ3 A;  3OX6 A;  2BE4 A;  3BYA A;  2ZND A;  4M2Q A;  4MBE A;  4R1E A;  1C7V A;  4ZCU A;  1B47 A;  3I5F C;  1L2O B;  1QS7 A;  3TZ1 A;  1JBA A;  1K2H A;  1C07 A;  3H4S E;  1UUS A;  1XFX O;  4GUK A;  2OTG C;  1GQM A;  3SG4 A;  1N65 A;  1YUT A;  1DJW A;  1Y6W A;  1RWY A;  1QVI Y;  3SG7 A;  1F54 A;  3BXK A;  2FCD A;  1BR1 B;  5HLO A;  1FPW A;  1TNW A;  2LAN A;  1B8R A;  1WRZ A;  4PHJ A;  2PAS A;  4OVN F;  2LVJ A;  1BOC A;  2SCP A;  2NLN A;  3TDI A;  2M3W A;  1KQM C;  3SG5 A;  3SIA A;  1B8L A;  1LKJ A;  1H4B A;  1GGW A;  1SY9 A;  4MSP A;  5AXI A;  1PK0 D;  3SJS A;  2KFF A;  1MQ1 A;  4OKH A;  1Y0V H;  3VRO A;  1A29 A;  5JJG A;  3OP0 A;  2M0R A;  3WHU B;  2K8M B;  4WQ2 A;  3I5H C;  3I5I C;  5AFP A;  1DGV A;  2KAV A;  2M29 A;  5FYX A;  1J7P A;  2KGB C;  4DUQ A;  1QJT A;  1DF0 A;  1TTX A;  2MAZ A;  4HSZ A;  4ICB A;  2CCM A;  2JT0 A;  1DVI A;  1B7T Y;  2PRU A;  1BF5 A;  1NWD A;  1R6P A;  4N5X A;  1OZS A;  1A4P A;  2JRF A;  1LXF C;  2JOJ A;  1H8B A;  2VRG A;  2PSR A;  1PSR A;  1QV0 A;  2M7N A;  5ER4 X;  1PVB A;  3M0W A;  2WOS A;  4YGB B;  1SBJ A;  2KDH A;  4XYN A;  2M49 B;  1VRK A;  1IGV A;  1OOJ A;  3VGO A;  1L2O C;  1YX7 A;  2KI4 B;  1IH0 A;  3LK0 A;  2LHI A;  1TOP A;  2M8U A;  2WND A;  1SW8 A;  3D0Y A;  4HRG A;  1EH2 A;  2M7L A;  3D10 A;  3AKB A;  2EGD A;  2COL B;  3I5F B;  2NZ0 A;  3SIB A;  2GGZ A;  1U5I A;  1XK4 C;  2ZNE A;  5IBW A;  2AMI A;  2BEC A;  5KU1 A;  1G33 A;  1J1D A;  4U8D A;  3PLF B;  1CFD A;  3FS7 A;  2OTG B;  5CPV A;  1F8H A;  2LLU A;  2CNP A;  1OMD A;  1S1E A;  1F4O A;  3GOF A;  2HF5 A;  1SRA A;  1EXR A;  2LV7 A;  1OSA A;  5B8I B;  4QJ5 B;  1CNP A;  1NIW A;  1PAL A;  1LVC D;  2KFG A;  2LMT A;  3EKH A;  3BUO B;  4IL1 A;  1B8C A;  3LK1 A;  4PHK A;  1SMG A;  1K95 A;  1KFU S;  4GPL B;  2WC8 A;  4MEW A;  1EG3 A;  2LHL A;  4GGF A;  1M39 A;  1KQM B;  2WOR A;  4N1F A;  2M1U A;  4GBA A;  1MF8 B;  1BT6 A;  1PRW A;  2PVB A;  1CDP A;  1E8A A;  1WRK A;  3F45 A;  5DKN A;  2K0J A;  3C1V A;  2QPT A;  5K89 A;  1A75 A;  2HPS A;  2JUL A;  1CMG A;  4NDB A;  1M31 A;  1FBV A;  3EK4 A;  3I5H B;  3TS5 C;  1NX2 A;  5KTY A;  3BOW A;  2L50 A;  3SG2 A;  1KQV A;  1CB1 A;  2I94 A;  1F70 A;  1QAT A;  2HQW A;  2LCP A;  3CS1 A;  3DF0 A;  4PE0 A;  4L9M A;  1TNQ A;  1BOD A;  2FCE A;  1CM4 A;  1QV1 A;  2JT3 A;  3PM8 A;  2OPO A;  1JC2 A;  1RFJ A;  1HQV A;  1NSH A;  3BUM B;  2JXC A;  1K9K A;  1WLZ A;  4AQJ A;  2BKI B;  1V1F A;  2JQ6 A;  3OB1 B;  1N0Y A;  1ALV A;  3QRX A;  4I5J A;  4WQ3 A;  4XJK A;  3NSL A;  1KSO A;  3DVJ A;  4FQO A;  5CSN A;  4GFT A;  1KK7 Y;  2L4H A;  1N2D A;  1OZO A;  4YI8 A;  1JFJ A;  1JUO A;  4QJ3 B;  3CGA A;  3K21 A;  1D1O A;  1DGU A;  4CID A;  1KFX S;  1XVJ A;  5HYD A;  2V53 A;  1B1G A;  1CFC A;  5F6T A;  1SL9 A;  4MZJ A;  2OS8 C;  1K96 A;  1XFW O;  2LUX A;  2HQ8 A;  3LLE A;  2ZN9 A;  3NSK A;  4MZL A;  4CPV A;  1ODB A;  1F4Q A;  3CR2 A;  1YX8 A;  4ORB B;  2P6B B;  4F0Z B;  1NX1 A;  3AAK A;  3KF9 A;  1LIN A;  3OX5 A;  4FTG A;  1QLS A;  4GGN A;  1YUS A;  2Y5I A;  3KO0 A;  4NDC A;  1OMV A;  1NP8 A;  2JNF A;  3CLN A;  1K94 A;  1Y1A A;  2L98 A;  2MRD A;  1WDC C;  2KBI A;  3PSR A;  4MZK A;  3OB2 B;  2L51 A;  4HRH A;  1ZOT B;  1XK4 A;  1GJY A;  1S5G Z;  1XYD A;  2ZN8 A;  1F55 A;  1RK9 A;  1CLL A;  2Y1N A;  2KFH A;  2LM5 A;  2B1U A;  1TNX A;  3GK2 A;  5AEQ A;  2M1K B;  3O2P A;  1J7Q A;  4DCK A;  3EKJ A;  2KAX A;  5GQQ C;  2BKH B;  2F3Z A;  3EVU A;  1FF1 A;  4ORA B;  1S26 D;  1TRF A;  1DJG A;  5BPJ A;  2KI6 C;  2BCA A;  2F2P A;  1M63 B;  1KWO B;  1NCY A;  3TDZ A;  3TS5 B;  1KK8 B;  1MUX A;  3FWC A;  4MRX A;  4C0J A;  1UHK A;  2MLF C;  1CMF A;  4OCI A;  1PUL A;  3PN7 C;  1TNP A;  2JXL A;  2PMY A;  1CFF A;  1PVA A;  2F33 A;  2KI6 D;  2LE9 B;  4P2Y B;  1FI5 A;  1KCY A;  5HKY A;  1SPY A;  1SR6 B;  1OE9 B;  1XFU O;  1AJ5 A;  2R2I A;  1UWO A;  4P5O E;  2MHH A;  2LNK A;  1QTX A;  2MA2 A;  4JWQ A;  2CBL A;  1G8I A;  1DJX A;  2DOQ A;  3BUN B;  1LA0 A;  4OR9 B;  4JPZ B;  1NPQ A;  2H61 C;  1S36 A;  4PHN A;  1QVI Z;  4NQG A;  1QAS A;  1BMO A;  1TCF A;  5KSZ A;  1SKT A;  2A4J A;  2KYC A;  2MBX A;  1IWQ A;  1X02 A;  1NCZ A;  2OS8 B;  3PAL A;  3PFV A; 
#chains in the Genus database with same CATH topology
 2EHB A;  3R1P A;  2JTT A;  3VRQ A;  1XFY O;  3L4A A;  4CLN A;  1BU3 A;  1QIW A;  1V1G A;  3BUX B;  1WY9 A;  3NGV A;  4IJ7 A;  5CSF A;  2K7O A;  2K7C A;  3A4U B;  1S6C A;  1CDN A;  3QME A;  2PYQ A;  2M9G A;  2KGR A;  1QX5 B;  1G4Y R;  4MRY A;  1IQ5 A;  3A8R A;  3OBV A;  2BCX A;  1OW4 A;  4PT1 A;  1Y1U A;  1UHJ A;  1YVH A;  1BG1 A;  1J7R A;  3DD4 A;  2WCH A;  1Q80 A;  3D74 A;  1MHO A;  2FJU B;  2LVI A;  1WDC B;  3DVE A;  2K2A A;  1FW4 A;  4AQI A;  1YVL A;  2G2B A;  5I2O A;  3RZS A;  4YGC B;  3V2L A;  1IJ5 A;  4M2O A;  2K7D A;  2ISD A;  3KHE A;  2ERB A;  1OOH A;  1KWO C;  1BJF A;  1KK8 C;  5TNC A;  3FIA A;  5DKQ A;  2F8P A;  3CTN A;  4NDD A;  1D1O A;  1EJ3 A;  3EVV A;  1F71 A;  5DKR A;  5G08 A;  1JSA A;  3VRP A;  1BLQ A;  4CFQ A;  2BBN A;  3IQO A;  1Z2C B;  3B87 A;  1OQP A;  3L4L A;  4MVF A;  4I5N B;  3CWG A;  2O5G A;  3BFH A;  1DMO A;  2AUC A;  1JF0 A;  2KBM A;  4AOM A;  2K60 A;  3GK1 A;  4YI9 A;  2K7B A;  1SR6 C;  2KYF A;  3FE6 A;  3PN7 B;  2LP3 A;  4BY5 A;  2IS9 A;  1AP4 A;  2JNX A;  1QIV A;  2BBM A;  3KPX A;  2H8V A;  2L4I A;  3FWB A;  2K2F A;  3D76 A;  2LMU A;  2MJW B;  3MSE B;  2O60 A;  2GGM A;  4JQ0 D;  1TCO B;  4BY4 A;  3D75 A;  3CZ2 A;  1J1E A;  4D1E A;  3TDU A;  1NX0 A;  1YR5 A;  1W7I B;  2KOT A;  3D78 A;  1YRU B;  1K8U A;  3BUW B;  3JVT C;  2KQY A;  2QAC A;  2BL0 C;  4Q04 A;  2KHN A;  4YGA A;  1TUJ A;  1S3P A;  1SL8 A;  3CR5 X;  2F3Y A;  2Q91 A;  2BCB A;  2RGI A;  3HCM A;  2ZRT A;  4GGF C;  1TN4 A;  1J55 A;  1K9U A;  1QLK A;  1JWD A;  2E30 A;  1YTZ C;  3ZWH A;  3RM1 A;  1IJ6 A;  1CLM A;  2EC6 C;  2CXJ A;  2WCB A;  2H2K A;  2JWW A;  2NCP A;  3ZNI A;  2L0P A;  4I5L B;  3LCP C;  1EG4 A;  1LA3 A;  3NSO A;  3LL8 B;  3S0E A;  3PAT A;  2KPH A;  4PHM A;  4DIR A;  1L7Z A;  2BE6 A;  1SNL A;  4QJ4 B;  1UP5 A;  1CFP A;  3WHT B;  1S6I A;  2ZKM X;  2H61 A;  2ZFD A;  3TUY C;  1MXE A;  5I2Q A;  5JOL A;  1DF0 B;  1LS8 A;  1M45 A;  1DT7 B;  4GNK B;  1MWN A;  4MLW A;  3S0A A;  1AK8 A;  1UHI A;  1CKK A;  2LUC A;  3O4Y A;  2JZI A;  2I2R E;  1K93 D;  3DXL A;  2FOT A;  1NCX A;  3CYZ A;  3HX4 A;  4C0L A;  2JTZ A;  3CZ1 A;  2Q4U A;  4ETO A;  3N7H A;  3SG6 A;  2WCJ A;  2YGU A;  2SAS A;  1AVS A;  1M46 A;  1REC A;  2PQL A;  1KFU L;  2LLS A;  1NYA A;  1T14 A;  1QXP A;  1R2U A;  1XA5 A;  2GV5 A;  4CFR A;  4HRE E;  4TNC A;  1WLM A;  1KK7 Z;  1K9P A;  2M97 A;  1SL7 A;  2WCL A;  3D0Y B;  3JTD C;  1ALW A;  1C3Z A;  1YUR A;  1C7W A;  1SCM C;  1TIZ A;  1W7J B;  3DVK A;  2WCM A;  4PE7 A;  5D69 A;  5HKZ A;  5HLV A;  4UPG A;  4A4B A;  1U5I B;  1CTR A;  1B9A A;  2NXQ A;  1QX2 A;  5I2L A;  1J7O A;  2L2C A;  1NX3 A;  5FI6 A;  3DVM A;  1W9Z A;  1GGZ A;  2P70 A;  1EL4 A;  1S6J A;  3AAJ A;  1Z4H A;  3O78 A;  4M2P A;  4USL A;  1A03 A;  3DY9 A;  4I5K A;  1DTL A;  4PDZ A;  5AAN A;  1ZMZ A;  1XFV O;  4YGE B;  3I5G B;  4YBH B;  1IG5 A;  2MLE C;  1DJY A;  1ZUZ A;  3JVT B;  3NSI A;  1YUU A;  1MXL C;  2BL0 B;  2LC5 A;  2D8N A;  1B4C A;  1DJZ A;  3EVR A;  5D7F A;  4GAO A;  1QX7 A;  2TN4 A;  2WCE A;  3E3R A;  4PE4 A;  3EK7 A;  1OMR A;  3OHM B;  1JFK A;  3FE8 A;  5CSI A;  3R72 A;  2KLD A;  1AUI B;  2Y4Q A;  3GK4 X;  5HKW A;  4DRW A;  1JF2 A;  1AJ4 A;  2EC6 B;  1DEK A;  2LVV A;  1TWO A;  3IQQ A;  5I8N A;  3ICB A;  1KFX L;  2L2E A;  4PAL A;  2WC5 A;  1A75 B;  3L47 A;  4ZCV A;  2AAO A;  2ZRS A;  1CDL A;  1Y1X A;  2I18 A;  2JT8 A;  1DJI A;  1RJV A;  2L5Y A;  2NCO A;  4MN0 A;  5PAL A;  3TUY B;  1SCV A;  3BOW B;  2G9B A;  1DJH A;  3CDN A;  3VRR A;  1IRJ A;  2GTE A;  1B7T Z;  1KSM A;  2E6W A;  2KNE A;  2LLT A;  3O6B A;  1GM0 A;  1XO5 A;  4DS7 A;  3EG5 B;  2HET A;  1MR8 A;  3DF0 B;  3K1E A;  1IQ3 A;  1CLB A;  2KAY A;  1A2X A;  2WCF A;  4E68 A;  2LVK A;  1OOG A;  2PAL A;  2L5X B;  5CSJ A;  3PM2 A;  3VRN A;  2KLE A;  4YGD B;  1BR4 B;  1S5G Y;  1RTP 1;  2I7A A;  3CZT X;  3AKA A;  4N1G A;  4XJK B;  5FI7 A;  1XFZ O;  1RRO A;  2JPT A;  2KSP A;  2QEV A;  3EK8 A;  3KEV A;  4KYN A;  1SYM A;  4PE1 A;  4WRI A;  3RLZ A;  2CTN A;  3CR4 X;  3NXA A;  1IKU A;  1UUR A;  2K61 A;  2KQ6 A;  3I5I B;  2F2O A;  4ORC B;  1ZAC A;  1CM1 A;  3DYE A;  4PCW A;  4YRU A;  1UHN A;  1WRL A;  2CT9 A;  3JTD B;  5J3X A;  1FI6 A;  3NHT A;  1CDM A;  1SCM B;  1SK6 D;  2LP2 A;  3WNX B;  1YRT B;  5AER A;  2LMV A;  2Y1M A;  1NUB A;  5ER5 A;  3WXA A;  3CAB A;  2LAP A;  3IF7 A;  1HT9 A;  4C0K A;  4OV2 A;  2JU0 A;  2JC2 A;  2BAP A;  2KI4 C;  3I5G C;  3SG3 A;  1ZFS A;  1UHH A;  1K90 D;  1PSB A;  1AHR A;  3BQ3 A;  3OX6 A;  2BE4 A;  3BYA A;  2ZND A;  4M2Q A;  4MBE A;  4R1E A;  2P71 A;  1C7V A;  4ZCU A;  1B47 A;  2QEB A;  3I5F C;  2QEO A;  1L2O B;  1QS7 A;  3TZ1 A;  1JBA A;  1K2H A;  1C07 A;  3H4S E;  1UUS A;  1XFX O;  4GUK A;  2OTG C;  1GQM A;  3SG4 A;  1N65 A;  1YUT A;  1DJW A;  1Y6W A;  1RWY A;  1QVI Y;  3SG7 A;  1F54 A;  3D77 A;  3BXK A;  5EL2 A;  2FCD A;  1BR1 B;  5HLO A;  1FPW A;  1TNW A;  2LAN A;  1B8R A;  3B6X A;  1SSE B;  1DEL A;  1WRZ A;  4PHJ A;  2PAS A;  4OVN F;  2LVJ A;  1BOC A;  2SCP A;  2NLN A;  3TDI A;  2M3W A;  3IVT A;  1KQM C;  3SG5 A;  1IIO A;  3SIA A;  1B8L A;  1LKJ A;  1H4B A;  1GGW A;  1SY9 A;  4MSP A;  5AXI A;  1OOF A;  1PK0 D;  3SJS A;  3DZT A;  4PHN A;  2KFF A;  4QJ3 B;  1MQ1 A;  4OKH A;  1Y0V H;  3VRO A;  1A29 A;  5JJG A;  3OP0 A;  2M0R A;  3WHU B;  2K8M B;  4WQ2 A;  3I5H C;  3I5I C;  5AFP A;  1DGV A;  2KAV A;  2M29 A;  5FYX A;  1J7P A;  2KGB C;  4DUQ A;  1QJT A;  1DF0 A;  1TTX A;  2MAZ A;  4HSZ A;  4ICB A;  2CCM A;  2JT0 A;  1DVI A;  1B7T Y;  2PRU A;  1BF5 A;  1C3Y A;  1NWD A;  1R6P A;  4N5X A;  1OZS A;  1A4P A;  2JRF A;  1LXF C;  2JOJ A;  1H8B A;  2VRG A;  2PSR A;  1PSR A;  3B7A A;  5HL1 A;  2WCK A;  1QV0 A;  3PJI A;  2M7N A;  5ER4 X;  1PVB A;  3M0W A;  2WOS A;  4YGB B;  1SBJ A;  2KDH A;  4XYN A;  1OOI X;  2M49 B;  1VRK A;  1IGV A;  1OOJ A;  3VGO A;  1L2O C;  1YX7 A;  2KI4 B;  1IH0 A;  3FE9 A;  3LK0 A;  2LHI A;  1TOP A;  2M8U A;  2WND A;  1SW8 A;  5D3O A;  3D0Y A;  4HRG A;  1EH2 A;  2M7L A;  3D10 A;  2WC6 A;  3AKB A;  2EGD A;  2COL B;  3I5F B;  2NZ0 A;  5FI2 A;  2GGZ A;  1U5I A;  1XK4 C;  2ZNE A;  3SIB A;  2AMI A;  5IBW A;  2BEC A;  5KU1 A;  1G33 A;  1J1D A;  4U8D A;  3PLF B;  1CFD A;  1XFR A;  3FS7 A;  2OTG B;  5CPV A;  1F8H A;  1P28 A;  2LLU A;  2CNP A;  1OMD A;  1S1E A;  1F4O A;  3GOF A;  2HF5 A;  1SRA A;  1EXR A;  2LV7 A;  1TUZ A;  1OSA A;  4FQT A;  5B8I B;  4QJ5 B;  1CNP A;  1NIW A;  1PAL A;  1LVC D;  2KFG A;  2LMT A;  3EKH A;  3BUO B;  4IL1 A;  1B8C A;  3LK1 A;  3SS5 A;  4PHK A;  1SMG A;  1K95 A;  1KFU S;  4GPL B;  2WC8 A;  4MEW A;  1EG3 A;  2LHL A;  3D73 A;  4GGF A;  1M39 A;  1KQM B;  2WOR A;  4N1F A;  2M1U A;  3BFA A;  4GBA A;  1MF8 B;  1BT6 A;  3S0D A;  1PRW A;  2PVB A;  1CDP A;  1E8A A;  1WRK A;  3F45 A;  1ORG A;  5DKN A;  2K0J A;  3C1V A;  3O4X A;  2QPT A;  5K89 A;  1A75 A;  3S0F A;  2HPS A;  2JUL A;  1CMG A;  4NDB A;  1M31 A;  1FBV A;  3EK4 A;  3I5H B;  3TS5 C;  1NX2 A;  5KTY A;  3Q8I A;  3BFB A;  2L50 A;  3BOW A;  3SG2 A;  3VB1 A;  1KQV A;  1CB1 A;  2I94 A;  1F70 A;  1QAT A;  2HQW A;  2LCP A;  3CS1 A;  3DF0 A;  4PE0 A;  4L9M A;  1TNQ A;  1BOD A;  2FCE A;  3SS3 A;  1CM4 A;  1QV1 A;  2JT3 A;  3PM8 A;  2OPO A;  1JC2 A;  1RFJ A;  1HQV A;  1NSH A;  3BUM B;  2JXC A;  1K9K A;  1WLZ A;  4AQJ A;  2BKI B;  1V1F A;  4JD9 A;  2JQ6 A;  3OB1 B;  1N0Y A;  1ALV A;  3QRX A;  4I5J A;  4WQ3 A;  4XJK A;  5DIC A;  3NSL A;  1KSO A;  3DVJ A;  4FQO A;  5CSN A;  4GFT A;  4OZD A;  1KK7 Y;  2L4H A;  1N2D A;  1OZO A;  4YI8 A;  1JFJ A;  1JUO A;  1QWV A;  3B86 A;  3CGA A;  3CZ0 A;  1DGU A;  3K21 A;  1KFX S;  1XVJ A;  3R1O A;  4CID A;  5HYD A;  2V53 A;  3BJH A;  1B1G A;  1CFC A;  5F6T A;  1SL9 A;  4MZJ A;  2OS8 C;  1K96 A;  1XFW O;  4JKT A;  2LUX A;  1DC1 A;  2HQ8 A;  3LLE A;  2ZN9 A;  3NSK A;  4MZL A;  2JPO A;  4CPV A;  1ODB A;  1F4Q A;  3UO9 A;  3CR2 A;  1YX8 A;  4ORB B;  2P6B B;  4F0Z B;  1NX1 A;  3AAK A;  3S0B A;  3KF9 A;  1LIN A;  2QEH A;  4F7F A;  3OX5 A;  4FTG A;  3R1V A;  1QLS A;  4GGN A;  1YUS A;  2Y5I A;  3KO0 A;  4NDC A;  1OMV A;  1NP8 A;  2JNF A;  3CLN A;  4INX A;  1K94 A;  1Y1A A;  2L98 A;  4A4C A;  2MRD A;  3SS4 A;  1WDC C;  2KBI A;  2BNX A;  3PSR A;  4MZK A;  3OB2 B;  2L51 A;  4HRH A;  1ZOT B;  1XK4 A;  1GJY A;  1S5G Z;  1XYD A;  2ZN8 A;  1F55 A;  1RK9 A;  1CLL A;  2Y1N A;  2KFH A;  2LM5 A;  2B1U A;  1TNX A;  3GK2 A;  3B88 A;  5AEQ A;  2M1K B;  3O2P A;  1J7Q A;  4DCK A;  3EKJ A;  2KAX A;  5GQQ C;  2BKH B;  2F3Z A;  3EVU A;  1FF1 A;  4ORA B;  1S26 D;  1TRF A;  1DJG A;  5BPJ A;  2KI6 C;  2BCA A;  2F2P A;  1M63 B;  1KWO B;  1NCY A;  3TDZ A;  2FJY A;  1KK8 B;  1MUX A;  3FWC A;  4MRX A;  3TS5 B;  4C0J A;  1UHK A;  2MLF C;  1CMF A;  4OCI A;  1PUL A;  3PN7 C;  5I94 A;  1TNP A;  2JXL A;  2PMY A;  1CFF A;  1PVA A;  2F33 A;  2KI6 D;  2LE9 B;  4P2Y B;  1FI5 A;  1KCY A;  5HKY A;  1SPY A;  1SR6 B;  1OE9 B;  1XFU O;  1AJ5 A;  2R2I A;  1UWO A;  3OGN A;  2MHH A;  2QDI A;  4P5O E;  2LNK A;  1QTX A;  2MA2 A;  4JWQ A;  2CBL A;  1G8I A;  1DJX A;  2DOQ A;  3BUN B;  1LA0 A;  4OR9 B;  4JPZ B;  1NPQ A;  2H61 C;  1DQE A;  1S36 A;  1QVI Z;  3S0G A;  3NHI A;  4INW A;  4NQG A;  1QAS A;  1BMO A;  1TCF A;  5KSZ A;  3UNW A;  1SKT A;  2A4J A;  2KYC A;  2MBX A;  1IWQ A;  1X02 A;  1NCZ A;  2OS8 B;  3PAL A;  3PFV A; 
#chains in the Genus database with same CATH homology
 2EHB A;  2JTT A;  3VRQ A;  1XFY O;  4CLN A;  1BU3 A;  1QIW A;  1V1G A;  3BUX B;  1WY9 A;  5CSF A;  2K7O A;  2K7C A;  3A4U B;  1S6C A;  1CDN A;  2M9G A;  2KGR A;  1QX5 B;  1G4Y R;  4MRY A;  1IQ5 A;  3A8R A;  2BCX A;  1Y1U A;  1UHJ A;  1YVH A;  1BG1 A;  1J7R A;  3DD4 A;  1Q80 A;  1MHO A;  2FJU B;  2LVI A;  1WDC B;  3DVE A;  2K2A A;  1FW4 A;  4AQI A;  1YVL A;  2G2B A;  5I2O A;  4YGC B;  1IJ5 A;  4M2O A;  2K7D A;  2ISD A;  3KHE A;  1KWO C;  1BJF A;  1KK8 C;  5TNC A;  3FIA A;  5DKQ A;  2F8P A;  3CTN A;  4NDD A;  1EJ3 A;  3EVV A;  1F71 A;  5DKR A;  5G08 A;  1JSA A;  3VRP A;  1BLQ A;  4CFQ A;  2BBN A;  3IQO A;  1OQP A;  4MVF A;  4I5N B;  3CWG A;  2O5G A;  1DMO A;  2AUC A;  1JF0 A;  2KBM A;  4AOM A;  3GK1 A;  4YI9 A;  2K7B A;  1SR6 C;  2KYF A;  3PN7 B;  2LP3 A;  4BY5 A;  2IS9 A;  1AP4 A;  2JNX A;  1QIV A;  2BBM A;  3KPX A;  2L4I A;  3FWB A;  2K2F A;  2LMU A;  2MJW B;  3MSE B;  2O60 A;  2GGM A;  4JQ0 D;  1TCO B;  4BY4 A;  4D1E A;  1J1E A;  3TDU A;  1NX0 A;  1YR5 A;  1W7I B;  2KOT A;  1YRU B;  1K8U A;  3BUW B;  3JVT C;  2KQY A;  2QAC A;  2BL0 C;  4Q04 A;  2KHN A;  4YGA A;  1S3P A;  1SL8 A;  3CR5 X;  2F3Y A;  2Q91 A;  2BCB A;  2RGI A;  3HCM A;  2ZRT A;  4GGF C;  1TN4 A;  1J55 A;  1K9U A;  1QLK A;  1JWD A;  2E30 A;  1YTZ C;  3ZWH A;  3RM1 A;  1IJ6 A;  1CLM A;  2EC6 C;  2CXJ A;  2WCB A;  2H2K A;  2JWW A;  2NCP A;  3ZNI A;  2L0P A;  4I5L B;  3LCP C;  1EG4 A;  1LA3 A;  3NSO A;  3LL8 B;  3PAT A;  4PHM A;  4DIR A;  1L7Z A;  2BE6 A;  1SNL A;  4QJ4 B;  1UP5 A;  1CFP A;  3WHT B;  1S6I A;  2ZKM X;  2H61 A;  2ZFD A;  3TUY C;  1MXE A;  5I2Q A;  5JOL A;  1DF0 B;  1DT7 B;  1M45 A;  4GNK B;  1MWN A;  4MLW A;  1AK8 A;  1UHI A;  1CKK A;  2LUC A;  3O4Y A;  2JZI A;  2I2R E;  1K93 D;  2FOT A;  1NCX A;  3HX4 A;  4C0L A;  2JTZ A;  2Q4U A;  4ETO A;  3SG6 A;  2SAS A;  1AVS A;  1M46 A;  1REC A;  1KFU L;  2LLS A;  1NYA A;  1QXP A;  1R2U A;  1XA5 A;  2GV5 A;  4CFR A;  4HRE E;  4TNC A;  1WLM A;  1KK7 Z;  1K9P A;  2M97 A;  1SL7 A;  3D0Y B;  3JTD C;  1ALW A;  1YUR A;  1C7W A;  1SCM C;  1TIZ A;  1W7J B;  3DVK A;  4PE7 A;  5D69 A;  5HLV A;  5HKZ A;  4UPG A;  4A4B A;  1U5I B;  1CTR A;  1B9A A;  2NXQ A;  1QX2 A;  5I2L A;  1J7O A;  1NX3 A;  3DVM A;  1GGZ A;  4M2P A;  1EL4 A;  1S6J A;  3AAJ A;  3O78 A;  4USL A;  1A03 A;  4I5K A;  4PDZ A;  1DTL A;  5AAN A;  1ZMZ A;  1XFV O;  4YGE B;  3I5G B;  4YBH B;  1IG5 A;  2MLE C;  1DJY A;  1ZUZ A;  3JVT B;  3NSI A;  1YUU A;  1MXL C;  2BL0 B;  2LC5 A;  2D8N A;  1B4C A;  1DJZ A;  3EVR A;  5D7F A;  4GAO A;  1QX7 A;  2TN4 A;  2WCE A;  3E3R A;  4PE4 A;  3EK7 A;  1OMR A;  3OHM B;  1JFK A;  5CSI A;  1AUI B;  2Y4Q A;  3GK4 X;  5HKW A;  4DRW A;  1JF2 A;  1AJ4 A;  2EC6 B;  2LVV A;  3IQQ A;  5I8N A;  3ICB A;  1KFX L;  2L2E A;  4PAL A;  1A75 B;  4ZCV A;  2AAO A;  2ZRS A;  1CDL A;  1Y1X A;  2I18 A;  2JT8 A;  1DJI A;  1RJV A;  2NCO A;  4MN0 A;  5PAL A;  3TUY B;  4A4C A;  1SCV A;  3BOW B;  2G9B A;  1DJH A;  3VRR A;  1IRJ A;  1B7T Z;  1KSM A;  2E6W A;  2KNE A;  2LLT A;  3O6B A;  1XO5 A;  4DS7 A;  2HET A;  1MR8 A;  3DF0 B;  1IQ3 A;  1CLB A;  2KAY A;  1A2X A;  2WCF A;  4E68 A;  2LVK A;  2PAL A;  2L5X B;  5CSJ A;  3VRN A;  4YGD B;  1BR4 B;  1S5G Y;  1RTP 1;  2I7A A;  3CZT X;  3AKA A;  4N1G A;  4XJK B;  1XFZ O;  1RRO A;  2JPT A;  2KSP A;  3KEV A;  3EK8 A;  4PE1 A;  4WRI A;  1SYM A;  3RLZ A;  2CTN A;  3CR4 X;  3NXA A;  1IKU A;  1UUR A;  2K61 A;  2KQ6 A;  3I5I B;  2F2O A;  4ORC B;  1CM1 A;  1ZAC A;  4PCW A;  4YRU A;  1UHN A;  1WRL A;  2CT9 A;  3JTD B;  5J3X A;  1FI6 A;  1CDM A;  1SCM B;  1SK6 D;  2LP2 A;  3WNX B;  1YRT B;  5AER A;  2LMV A;  2Y1M A;  1NUB A;  5ER5 A;  3WXA A;  2LAP A;  3IF7 A;  1HT9 A;  4C0K A;  4OV2 A;  2JU0 A;  2JC2 A;  2KI4 C;  3I5G C;  3SG3 A;  1ZFS A;  1UHH A;  1K90 D;  1PSB A;  1AHR A;  3BQ3 A;  3OX6 A;  2BE4 A;  3BYA A;  2ZND A;  4M2Q A;  4MBE A;  4R1E A;  1C7V A;  4ZCU A;  1B47 A;  3I5F C;  1L2O B;  1QS7 A;  3TZ1 A;  1JBA A;  1K2H A;  1C07 A;  3H4S E;  1UUS A;  1XFX O;  4GUK A;  2OTG C;  1GQM A;  3SG4 A;  1N65 A;  1YUT A;  1DJW A;  1Y6W A;  1RWY A;  1QVI Y;  3SG7 A;  1F54 A;  3BXK A;  2FCD A;  1BR1 B;  5HLO A;  1FPW A;  1TNW A;  2LAN A;  1B8R A;  1WRZ A;  4PHJ A;  2PAS A;  4OVN F;  2LVJ A;  1BOC A;  2SCP A;  2NLN A;  3TDI A;  2M3W A;  1KQM C;  3SG5 A;  3SIA A;  1B8L A;  1LKJ A;  1H4B A;  1GGW A;  1SY9 A;  4MSP A;  5AXI A;  1PK0 D;  3SJS A;  2KFF A;  1MQ1 A;  4OKH A;  1Y0V H;  3VRO A;  1A29 A;  5JJG A;  3OP0 A;  2M0R A;  3WHU B;  2K8M B;  4WQ2 A;  3I5H C;  3I5I C;  5AFP A;  1DGV A;  2KAV A;  2M29 A;  5FYX A;  1J7P A;  2KGB C;  4DUQ A;  1QJT A;  1DF0 A;  1TTX A;  2MAZ A;  4HSZ A;  4ICB A;  2CCM A;  2JT0 A;  1DVI A;  1B7T Y;  2PRU A;  1BF5 A;  1NWD A;  1R6P A;  4N5X A;  1OZS A;  1A4P A;  2JRF A;  1LXF C;  2JOJ A;  1H8B A;  2VRG A;  2PSR A;  1PSR A;  1QV0 A;  2M7N A;  5ER4 X;  1PVB A;  3M0W A;  2WOS A;  4YGB B;  1SBJ A;  2KDH A;  4XYN A;  2M49 B;  1VRK A;  1IGV A;  1OOJ A;  3VGO A;  1L2O C;  1YX7 A;  2KI4 B;  1IH0 A;  3LK0 A;  2LHI A;  1TOP A;  2M8U A;  2WND A;  1SW8 A;  3D0Y A;  4HRG A;  1EH2 A;  2M7L A;  3D10 A;  3AKB A;  2EGD A;  2COL B;  3I5F B;  2NZ0 A;  3SIB A;  2GGZ A;  1U5I A;  1XK4 C;  2ZNE A;  5IBW A;  2AMI A;  2BEC A;  5KU1 A;  1G33 A;  1J1D A;  4U8D A;  3PLF B;  1CFD A;  3FS7 A;  2OTG B;  5CPV A;  1F8H A;  2LLU A;  2CNP A;  1OMD A;  1S1E A;  1F4O A;  3GOF A;  2HF5 A;  1SRA A;  1EXR A;  2LV7 A;  1OSA A;  5B8I B;  4QJ5 B;  1CNP A;  1NIW A;  1PAL A;  1LVC D;  2KFG A;  2LMT A;  3EKH A;  3BUO B;  4IL1 A;  1B8C A;  3LK1 A;  4PHK A;  1SMG A;  1K95 A;  1KFU S;  4GPL B;  2WC8 A;  4MEW A;  1EG3 A;  2LHL A;  4GGF A;  1M39 A;  1KQM B;  2WOR A;  4N1F A;  2M1U A;  4GBA A;  1MF8 B;  1BT6 A;  1PRW A;  2PVB A;  1CDP A;  1E8A A;  1WRK A;  3F45 A;  5DKN A;  2K0J A;  3C1V A;  2QPT A;  5K89 A;  1A75 A;  2HPS A;  2JUL A;  1CMG A;  4NDB A;  1M31 A;  1FBV A;  3EK4 A;  3I5H B;  3TS5 C;  1NX2 A;  5KTY A;  3BOW A;  2L50 A;  3SG2 A;  1KQV A;  1CB1 A;  2I94 A;  1F70 A;  1QAT A;  2HQW A;  2LCP A;  3CS1 A;  3DF0 A;  4PE0 A;  4L9M A;  1TNQ A;  1BOD A;  2FCE A;  1CM4 A;  1QV1 A;  2JT3 A;  3PM8 A;  2OPO A;  1JC2 A;  1RFJ A;  1HQV A;  1NSH A;  3BUM B;  2JXC A;  1K9K A;  1WLZ A;  4AQJ A;  2BKI B;  1V1F A;  2JQ6 A;  3OB1 B;  1N0Y A;  1ALV A;  3QRX A;  4I5J A;  4WQ3 A;  4XJK A;  3NSL A;  1KSO A;  3DVJ A;  4FQO A;  5CSN A;  4GFT A;  1KK7 Y;  2L4H A;  1N2D A;  1OZO A;  4YI8 A;  1JFJ A;  1JUO A;  4QJ3 B;  3CGA A;  3K21 A;  1D1O A;  1DGU A;  4CID A;  1KFX S;  1XVJ A;  5HYD A;  2V53 A;  1B1G A;  1CFC A;  5F6T A;  1SL9 A;  4MZJ A;  2OS8 C;  1K96 A;  1XFW O;  2LUX A;  2HQ8 A;  3LLE A;  2ZN9 A;  3NSK A;  4MZL A;  4CPV A;  1ODB A;  1F4Q A;  3CR2 A;  1YX8 A;  4ORB B;  2P6B B;  4F0Z B;  1NX1 A;  3AAK A;  3KF9 A;  1LIN A;  3OX5 A;  4FTG A;  1QLS A;  4GGN A;  1YUS A;  2Y5I A;  3KO0 A;  4NDC A;  1OMV A;  1NP8 A;  2JNF A;  3CLN A;  1K94 A;  1Y1A A;  2L98 A;  2MRD A;  1WDC C;  2KBI A;  3PSR A;  4MZK A;  3OB2 B;  2L51 A;  4HRH A;  1ZOT B;  1XK4 A;  1GJY A;  1S5G Z;  1XYD A;  2ZN8 A;  1F55 A;  1RK9 A;  1CLL A;  2Y1N A;  2KFH A;  2LM5 A;  2B1U A;  1TNX A;  3GK2 A;  5AEQ A;  2M1K B;  3O2P A;  1J7Q A;  4DCK A;  3EKJ A;  2KAX A;  5GQQ C;  2BKH B;  2F3Z A;  3EVU A;  1FF1 A;  4ORA B;  1S26 D;  1TRF A;  1DJG A;  5BPJ A;  2KI6 C;  2BCA A;  2F2P A;  1M63 B;  1KWO B;  1NCY A;  3TDZ A;  3TS5 B;  1KK8 B;  1MUX A;  3FWC A;  4MRX A;  4C0J A;  1UHK A;  2MLF C;  1CMF A;  4OCI A;  1PUL A;  3PN7 C;  1TNP A;  2JXL A;  2PMY A;  1CFF A;  1PVA A;  2F33 A;  2KI6 D;  2LE9 B;  4P2Y B;  1FI5 A;  1KCY A;  5HKY A;  1SPY A;  1SR6 B;  1OE9 B;  1XFU O;  1AJ5 A;  2R2I A;  1UWO A;  4P5O E;  2MHH A;  2LNK A;  1QTX A;  2MA2 A;  4JWQ A;  2CBL A;  1G8I A;  1DJX A;  2DOQ A;  3BUN B;  1LA0 A;  4OR9 B;  4JPZ B;  1NPQ A;  2H61 C;  1S36 A;  4PHN A;  1QVI Z;  4NQG A;  1QAS A;  1BMO A;  1TCF A;  5KSZ A;  1SKT A;  2A4J A;  2KYC A;  2MBX A;  1IWQ A;  1X02 A;  1NCZ A;  2OS8 B;  3PAL A;  3PFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...