5I2QA

Structure of ef-hand containing protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
105
Chain Sequence
b'FNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFRAFLLIFRKAAAGELQEDSGLCVLARLSEIDVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EF-hand domain-containing protein D2
publication title Structural implications of Ca(2+)-dependent actin-bundling function of human EFhd2/Swiprosin-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5i2qA00
1SR6B 3A8RA 1MR8A 1ALWA 1KK7Z 1CFCA 3I5FB 1LINA 1IQ5A 2LMVA 5I2QA 3CGAA 1DJHA 1GGWA 1KWOB 3TDZA 2IS9A 1L2OB 4MRXA 3ZWHA 3EK7A 1ALVA 3OP0A 2H2KA 3D0YA 1XFYO 1MXEA 3GK1A 5DKRA 1BJFA 1V1GA 2L4HA 2MLFC 3FWCA 3EVRA 4CLNA 1X02A 1FI6A 2ZKMX 1EG3A 5CPVA 2BL0B 1KK8C 1S36A 1XFVO 5ER4X 1B7TZ 1W7IB 3CS1A 4QJ5B 2KFGA 1CDNA 1TRFA 2MRDA 2EC6C 4OV2A 1WRZA 3TZ1A 4OKHA 1ZMZA 4WRIA 3K21A 2MBXA 1SY9A 1UHIA 4PE7A 2I2RE 3DVMA 2F33A 1A29A 4QJ4B 5KU1A 2OS8B 5PALA 1E8AA 2BBNA 1UWOA 2G9BA 2PASA 1PSBA 3VGOA 2M9GA 3PN7B 4FTGA 1PVAA 2K0JA 4GGNA 1AJ4A 3KHEA 3VRNA 2MAZA 2VRGA 1S6CA 1Y6WA 4N1GA 3BXKA 1XA5A 1TNQA 2KQ6A 4NQGA 2ISDA 1W7JB 1EH2A 2GGMA 2L98A 2RGIA 1A75B 2Q4UA 3JVTB 4I5LB 1NIWA 5CSIA 2K7BA 2PVBA 2WOSA 3FS7A 5FYXA 3GOFA 3BUNB 2FCDA 3D0YB 4DCKA 1UHJA 1JF2A 1MWNA 2WCFA 2JXLA 3NSKA 5D69A 1B4CA 1K94A 1K2HA 3TDIA 4USLA 3CR2A 3AAJA 2KYFA 1KFUS 2F2OA 2TN4A 1NX1A 4I5KA 3LK1A 5KTYA 1QLSA 1SCMC 5GQQC 2V53A 3O2PA 5K89A 1CLLA 2JXCA 1FPWA 1G8IA 2O60A 1D1OA 2PALA 4PHNA 1DJYA 2JNXA 5I2OA 1SKTA 4ORAB 1BOCA 3SG2A 3GK4X 1NCYA 4GNKB 1CDLA 1CFDA 4ORBB 1QASA 3D10A 2QACA 2M49B 1JBAA 1YR5A 1NX2A 2LMTA 1A03A 1K9KA 1B1GA 2H61A 3BUMB 1U5IB 5JJGA 2AUCA 4E68A 2JWWA 3SIBA 1AHRA 2Q91A 1KK7Y 4R1EA 2KYCA 1NYAA 1QTXA 3NSIA 1BT6A 2AAOA 1J55A 2M8UA 2WCEA 1CM1A 3LCPC 1M46A 2BE6A 1SPYA 2E6WA 1PSRA 1CDPA 2JOJA 3DVEA 1F54A 2HQ8A 3HX4A 1LXFC 1J1DA 2FCEA 4Q04A 1CFPA 1OZOA 1TNXA 4AQJA 1K8UA 4PHKA 2M7LA 3SG6A 1G33A 1XK4C 2LVJA 1NCZA 1H8BA 2BCBA 2D8NA 1B7TY 1DJZA 3I5HC 2FJUB 1J7RA 1JFJA 1SL7A 4GPLB 1AK8A 1WDCC 1YRUB 2M29A 3SG5A 1TCOB 3JTDC 2BCAA 3TS5B 3IQQA 1DTLA 1GGZA 1KFXS 1TCFA 1F4QA 1RK9A 3CR4X 1YUUA 4HSZA 2NCOA 1MQ1A 4XYNA 1YURA 1DF0B 2O5GA 2KAXA 4GGFC 4UPGA 1UP5A 3DD4A 1XO5A 1IQ3A 2I94A 2ZNDA 3NSLA 1QLKA 1XVJA 1A75A 1ZACA 1R2UA 1NWDA 2HETA 5DKNA 5HLOA 1KK8B 2L2EA 4CIDA 4ZCUA 1DJGA 4N1FA 3EK4A 4TNCA 3I5GC 1QX2A 4OR9B 2M3WA 3LLEA 2JULA 1F55A 1PULA 1SL8A 2ZNEA 2F2PA 4NDCA 3SJSA 3CTNA 2AMIA 3H4SE 3RM1A 1MHOA 1XFXO 1UHNA 1NX3A 1SK6D 5AFPA 4YI8A 3VRRA 2JZIA 4F0ZB 4MBEA 3TUYC 1OZSA 1IKUA 3M0WA 1SR6C 1BU3A 4BY5A 4A4CA 2WC8A 1KSOA 1M45A 4I5JA 3VRPA 1F4OA 4YI9A 1B9AA 1KWOC 3CLNA 4CFQA 1S5GZ 1SNLA 1YVHA 1QIWA 3BUOB 2KNEA 1OQPA 1U5IA 1XFWO 1Y1XA 1F71A 1B8LA 1ODBA 1IWQA 1J1EA 1BG1A 2NLNA 1NPQA 4YGBB 4GAOA 2KGBC 2KI4B 3EVVA 4OVNF 1S6JA 3VROA 3ZNIA 1DMOA 2GV5A 4CFRA 3I5IC 4PHMA 2K2FA 1K96A 1BMOA 1S3PA 4WQ2A 1S1EA 1S26D 5KSZA 4ICBA 4FQOA 1SCMB 1TOPA 2HQWA 1SL9A 1KFXL 5I2LA 1IJ5A 2CT9A 3WHUB 2KSPA 1EXRA 1Y1UA 1FBVA 5CSNA 4YGAA 3TDUA 2L0PA 1SMGA 2LNKA 4JQ0D 4M2OA 2LLTA 4OCIA 5HLVA 3KF9A 2MLEC 2CTNA 2F8PA 2LUCA 2KBMA 3GK2A 1CMGA 1SCVA 2KGRA 2KOTA 4MN0A 2M97A 5F6TA 1K95A 1ZFSA 1A2XA 1DF0A 1OE9B 2Y1NA 1YX8A 3BUWB 2BE4A 3CR5X 2K7CA 1CM4A 4PE0A 4ORCB 3PSRA 1WLMA 1KSMA 1EL4A 5J3XA 4MZLA 2KI6D 1OSAA 2BBMA 4YBHB 2JT0A 3KPXA 4L9MA 3FWBA 1PK0D 2JT3A 3EKJA 1M63B 2BKIB 1TNWA 1XYDA 1B8CA 1PRWA 1RECA 1RWYA 1FW4A 2BCXA 3AKAA 1Q80A 4NDDA 5AERA 2KDHA 4GBAA 3OB1B 5BPJA 1CMFA 3DVJA 1WY9A 2LE9B 2LLSA 4IL1A 1IGVA 3BQ3A 3WHTB 4GFTA 4MSPA 1BR4B 3FIAA 3OHMB 3WNXB 2CCMA 3JTDB 4PALA 3AAKA 1M31A 5CSJA 1KQVA 2CBLA 3PALA 4ZCVA 1CB1A 1EG4A 1MF8B 2LHLA 2COLB 3NXAA 5CSFA 1JFKA 2B1UA 2JT8A 2K7DA 1AVSA 2P6BB 2WORA 2ZN8A 4HRGA 1GJYA 1JC2A 4DS7A 1B47A 2M1UA 1WRKA 2OTGC 2LVIA 1AP4A 1J7OA 2KHNA 1S5GY 2CNPA 2R2IA 4MEWA 2M7NA 3PFVA 1NSHA 1B8RA 1JF0A 3PM8A 2LANA 1IRJA 1UUSA 3BOWB 3I5GB 1C07A 2ZFDA 1KFUL 4DRWA 1DGUA 2M0RA 4MVFA 3LL8B 3PATA 4U8DA 1NUBA 2MJWB 2JTTA 1QV0A 1QXPA 4NDBA 2NCPA 1CKKA 2I18A 1CDMA 1EJ3A 2F3YA 2G2BA 2KFHA 2EC6B 2F3ZA 1SW8A 3BUXB 1XFZO 2KFFA 1J7QA 2EGDA 1KCYA 2LCPA 3TUYB 1JSAA 3EK8A 1SYMA 2K8MB 3TS5C 4AOMA 2BECA 2QPTA 3IF7A 1VRKA 1BF5A 4ETOA 1G4YR 1IG5A 1IH0A 1KQMC 1NCXA 1NP8A 1YUSA 4MZKA 3CZTX 2JTZA 2LP3A 1LKJA 1K90D 2NXQA 4GUKA 1QVIZ 2LM5A 2HF5A 3IQOA 3EVUA 3I5FC 1Y1AA 1QATA 1TN4A 3VRQA 2H61C 1JUOA 1QJTA 5D7FA 1C7WA 1N65A 4C0KA 4C0LA 1C7VA 1L2OC 2I7AA 1LVCD 1MUXA 5TNCA 3PLFB 2OPOA 3I5IB 1GQMA 4P5OE 3BYAA 4BY4A 1JWDA 1BODA 2LC5A 2BL0C 1IJ6A 2SCPA 4I5NB 4PCWA 2ZRSA 4AQIA 2L50A 1YRTB 5HYDA 1QIVA 1XK4A 1K9PA 1NX0A 2NZ0A 1S6IA 5IBWA 1OOJA 1YTZC 4XJKB 2L4IA 5AEQA 5HKYA 4YGDB 1SBJA 1HT9A 5AANA 2ZN9A 1QS7A 1J7PA 1WLZA 1LA3A 3SG3A 2OS8C 2LHIA 5AXIA 1RROA 1UHKA 5HKZA 3ICBA 3DF0B 3PN7C 1DJWA 1LA0A 2Y5IA 2GGZA 1DJXA 2KBIA 4YGEB 4GGFA 3KO0A 1F8HA 2L5XB 3LK0A 1ZOTB 3EKHA 1F70A 3SIAA 2KI4C 4PDZA 3SG4A 2BKHB 1UHHA 3JVTC 1CLBA 2LP2A 1TTXA 1XFUO 2LVVA 1RFJA 2L51A 1CLMA 3BOWA 2LLUA 5I8NA 2PRUA 3F45A 1QX5B 3OX5A 2LVKA 4YGCB 3CWGA 4DUQA 2Y4QA 2KI6C 1AJ5A 3KEVA 1AUIB 3E3RA 3OB2B 4M2QA 1TIZA 2JNFA 4JPZB 1QX7A 3OX6A 2LMUA 1YVLA 1FF1A 1Y0VH 1N0YA 3I5HB 1RJVA 3A4UB 1HQVA 2DOQA 1WDCB 2MHHA 4PHJA 5B8IB 3O78A 5DKQA 1DVIA 2A4JA 2ZRTA 5ER5A 1ZUZA 2K2AA 4PE4A 2LV7A 2HPSA 1V1FA 1YX7A 2K7OA 1DT7B 1PVBA 2LUXA 2OTGB 2Y1MA 4WQ3A 4D1EA 2WNDA 2JQ6A 4MLWA 2CXJA 1R6PA 2EHBA 2KQYA 3QRXA 4QJ3B 1A4PA 1MXLC 1K93D 1WRLA 1QVIY 3WXAA 1YUTA 4JWQA 2JC2A 1M39A 4A4BA 1BR1B 5G08A 3RLZA 1L7ZA 2JPTA 4YRUA 1BLQA 1DJIA 4PE1A 1CTRA 2JU0A 3O4YA 3O6BA 5HKWA 4MZJA 4HRHA 2WCBA 4MRYA 2KAYA 2JRFA 3MSEB 4M2PA 5JOLA 3NSOA 1H4BA 3SG7A 2E30A 1SRAA 1QV1A 2LAPA 2MA2A 2M1KB 1CNPA 2KAVA 1N2DA 2PSRA 4XJKA 1OMRA 4HREE 4C0JA 1RTP1 1UURA 2FOTA 1DGVA 3HCMA 1OMDA 4N5XA 3C1VA 1K9UA 2K61A 2SASA 1PALA 1TNPA 3DVKA 2PMYA 4DIRA 4P2YB 1FI5A 4CPVA 1KQMB 1CFFA 1OMVA 3AKBA 3DF0A
chains in the Genus database with same CATH superfamily
1SR6B 3A8RA 1MR8A 2WCMA 1ALWA 1KK7Z 1CFCA 3I5FB 1LINA 1IQ5A 2LMVA 5I2QA 2BNXA 3CGAA 1DJHA 1GGWA 1KWOB 3TDZA 2IS9A 1L2OB 4MRXA 3ZWHA 3EK7A 1ALVA 3OP0A 4INXA 2H2KA 3D0YA 1XFYO 1MXEA 3GK1A 5DKRA 1BJFA 1V1GA 2L4HA 2MLFC 3FWCA 3EVRA 4CLNA 1X02A 1FI6A 2ZKMX 1EG3A 5CPVA 2BL0B 3D73A 1KK8C 1S36A 1XFVO 5ER4X 1B7TZ 3S0GA 1LS8A 1W7IB 3CS1A 4QJ5B 2KFGA 1DC1A 1CDNA 1TRFA 2MRDA 2EC6C 4OV2A 1WRZA 1T14A 3TZ1A 4OKHA 1ZMZA 4WRIA 3K21A 2MBXA 1SY9A 1UHIA 4PE7A 2I2RE 3DVMA 2F33A 1A29A 4QJ4B 5KU1A 2OS8B 2KLDA 5PALA 1E8AA 2BBNA 1UWOA 2G9BA 2PASA 1PSBA 3VGOA 2M9GA 3PN7B 4FTGA 1PVAA 2K0JA 4GGNA 1AJ4A 3KHEA 3VRNA 2MAZA 2VRGA 3SS4A 1S6CA 1Y6WA 4N1GA 3BXKA 2PYQA 1XA5A 1TNQA 2KQ6A 4NQGA 2ISDA 1W7JB 3RZSA 1EH2A 5D3OA 2GGMA 2L98A 2RGIA 1A75B 2Q4UA 3JVTB 2H8VA 4I5LB 1NIWA 4KYNA 5CSIA 2K7BA 5FI7A 2PVBA 2WOSA 3FS7A 3OGNA 2L2CA 5FYXA 3GOFA 3BUNB 2FCDA 3D0YB 4DCKA 3Q8IA 1UHJA 1JF2A 1MWNA 2WCFA 2JXLA 3NSKA 5D69A 1B4CA 1K94A 1K2HA 3TDIA 4USLA 3CR2A 3AAJA 2KYFA 1KFUS 2F2OA 2TN4A 3R1OA 3BJHA 1NX1A 4I5KA 3LK1A 5KTYA 1QLSA 1SCMC 5GQQC 2V53A 3O2PA 5K89A 1CLLA 2JXCA 1FPWA 3D76A 1OW4A 1G8IA 2O60A 1D1OA 2PALA 4PHNA 1DJYA 2JNXA 5I2OA 1SKTA 4ORAB 3IVTA 1BOCA 3SG2A 3GK4X 1NCYA 4GNKB 1CDLA 1CFDA 3R1VA 4ORBB 1QASA 3D10A 2QACA 3B6XA 2M49B 1JBAA 1YR5A 1NX2A 2QEVA 2LMTA 1A03A 3DY9A 1K9KA 1B1GA 1OOIX 2H61A 3D75A 3BUMB 1U5IB 5JJGA 2AUCA 4E68A 3B88A 2JWWA 3SIBA 1AHRA 2Q91A 1KK7Y 1OOHA 4R1EA 2KYCA 1NYAA 1QTXA 3NSIA 1BT6A 2AAOA 1J55A 2M8UA 2WCEA 3D77A 1CM1A 3LCPC 1M46A 2BE6A 1SPYA 2E6WA 1PSRA 1CDPA 2JOJA 3B87A 3DVEA 1F54A 2HQ8A 3HX4A 1LXFC 1J1DA 2FCEA 2K60A 4Q04A 1OZOA 1TNXA 3L4LA 4AQJA 1CFPA 1K8UA 4PHKA 2M7LA 3SG6A 1G33A 1XK4C 2LVJA 1NCZA 1H8BA 2BCBA 2D8NA 1B7TY 1DJZA 3I5HC 2FJUB 1J7RA 1JFJA 1SL7A 4GPLB 2WC6A 1SSEB 1AK8A 1WDCC 1YRUB 2M29A 3SG5A 1TCOB 5DICA 2BAPA 3JTDC 2BCAA 3TS5B 3IQQA 1DTLA 1GGZA 1KFXS 1TCFA 1F4QA 1XFRA 3SS3A 1OOFA 1RK9A 3CR4X 1YUUA 3NGVA 4HSZA 2NCOA 1MQ1A 1Z2CB 2JPOA 2KPHA 1YURA 1DF0B 2O5GA 2KAXA 4GGFC 4XYNA 4UPGA 1UP5A 3DD4A 1XO5A 1IQ3A 2I94A 2ZNDA 2QEBA 3NSLA 1QLKA 1XVJA 1A75A 1ZACA 1R2UA 1NWDA 3EG5B 2HETA 5DKNA 5HLOA 1KK8B 2PQLA 2L2EA 4CIDA 4INWA 1C3YA 4ZCUA 1DJGA 4N1FA 3EK4A 4TNCA 3I5GC 1QX2A 4OR9B 2FJYA 2M3WA 3LLEA 2JULA 5FI2A 1PULA 1SL8A 1F55A 2ZNEA 2F2PA 4IJ7A 3S0DA 4NDCA 3SJSA 3CTNA 2AMIA 3H4SE 3RM1A 1MHOA 1QWVA 1XFXO 1UHNA 1NX3A 3S0FA 1SK6D 5AFPA 4YI8A 3VRRA 2JZIA 4F0ZB 4MBEA 3TUYC 1OZSA 1IKUA 3M0WA 3R1PA 1SR6C 1BU3A 4BY5A 2QDIA 4A4CA 2WCLA 2WC8A 1KSOA 1M45A 3DYEA 4I5JA 3VRPA 1F4OA 4YI9A 1B9AA 1KWOC 2P71A 3CLNA 1S5GZ 1SNLA 4CFQA 1YVHA 1QIWA 3BUOB 2KNEA 1OQPA 2P70A 1U5IA 1XFWO 1Y1XA 1F71A 1B8LA 1ODBA 1IWQA 1J1EA 1BG1A 2NLNA 3FE8A 1NPQA 4YGBB 4GAOA 2KGBC 2KI4B 3EVVA 4OVNF 1S6JA 3VROA 3ZNIA 1DMOA 2GV5A 4CFRA 3I5IC 4PHMA 2K2FA 1K96A 1BMOA 1DELA 3QMEA 1S3PA 4WQ2A 1S1EA 1S26D 3R72A 5KSZA 4ICBA 4FQOA 1SCMB 1TOPA 2HQWA 1SL9A 1KFXL 5I2LA 1IJ5A 2CT9A 3WHUB 2KSPA 1EXRA 1Y1UA 1FBVA 1TWOA 5CSNA 4YGAA 3TDUA 2L0PA 1SMGA 2LNKA 3K1EA 4JQ0D 2LLTA 4M2OA 4OCIA 5HLVA 3D78A 2MLEC 2CTNA 2YGUA 3KF9A 2F8PA 2LUCA 2KBMA 3GK2A 1CMGA 1SCVA 2KGRA 2KOTA 4MN0A 2M97A 5F6TA 1K95A 1ZFSA 1A2XA 1DF0A 1OE9B 2Y1NA 1YX8A 3BUWB 2BE4A 3CR5X 2K7CA 1CM4A 2QEHA 4PE0A 4ORCB 3PSRA 1WLMA 1KSMA 1EL4A 5J3XA 4MZLA 2KI6D 1OSAA 2BBMA 4YBHB 2JT0A 3KPXA 4L9MA 1TUJA 3FWBA 1PK0D 2JT3A 3EKJA 1M63B 2BKIB 1TNWA 1XYDA 1B8CA 1PRWA 1RECA 1RWYA 1FW4A 2BCXA 3AKAA 1Q80A 4NDDA 5AERA 2KDHA 4GBAA 3CYZA 3OB1B 5BPJA 1DQEA 1CMFA 3CZ0A 3DVJA 1WY9A 2LE9B 2LLSA 4IL1A 1IGVA 3BQ3A 3WHTB 4GFTA 4MSPA 1BR4B 3FIAA 3OHMB 3WNXB 2CCMA 3JTDB 5I94A 4PALA 3AAKA 1M31A 5CSJA 1KQVA 2CBLA 3PALA 4ZCVA 1CB1A 1EG4A 1MF8B 2LHLA 2COLB 3NXAA 5CSFA 1JFKA 2B1UA 2JT8A 2K7DA 1AVSA 2P6BB 2WORA 2ZN8A 3CDNA 4HRGA 1GJYA 3VB1A 1JC2A 4DS7A 1B47A 2M1UA 1WRKA 1Z4HA 2OTGC 1DEKA 2LVIA 3FE9A 1AP4A 1J7OA 2KHNA 1S5GY 2CNPA 2R2IA 4MEWA 2M7NA 3PFVA 1NSHA 1B8RA 1JF0A 3PJIA 3PM8A 2LANA 1IRJA 1UUSA 3BOWB 3I5GB 1C07A 2ZFDA 1KFUL 4DRWA 1DGUA 2M0RA 4MVFA 3LL8B 3PATA 4U8DA 2L5YA 1NUBA 2MJWB 2JTTA 1QV0A 1QXPA 4NDBA 3NHIA 2NCPA 3FE6A 1CKKA 2I18A 1CDMA 1EJ3A 2F3YA 2G2BA 4OZDA 2KFHA 5FI6A 2EC6B 2F3ZA 1GM0A 1SW8A 3BUXB 1XFZO 2KFFA 3S0EA 1J7QA 2EGDA 1KCYA 2LCPA 3TUYB 1JSAA 3EK8A 1SYMA 2K8MB 3TS5C 4AOMA 2BECA 2QPTA 3IF7A 1VRKA 1BF5A 4ETOA 1P28A 1G4YR 1IG5A 1IH0A 1KQMC 1NCXA 1NP8A 1YUSA 4MZKA 3CZTX 2JTZA 2LP3A 3UNWA 1LKJA 1K90D 2NXQA 4GUKA 1QVIZ 2LM5A 3BFBA 2HF5A 3IQOA 3EVUA 3I5FC 1Y1AA 1QATA 1TN4A 3VRQA 2H61C 1JUOA 1QJTA 2KLEA 1C7WA 5D7FA 1N65A 4C0KA 4C0LA 1C7VA 1L2OC 2I7AA 1LVCD 1MUXA 5TNCA 3N7HA 3PLFB 3UO9A 5HL1A 2GTEA 4PT1A 2OPOA 3I5IB 1GQMA 4P5OE 3BFAA 3BYAA 4BY4A 4F7FA 1JWDA 1BODA 2LC5A 2BL0C 1IJ6A 2SCPA 2WC5A 4I5NB 4PCWA 2ZRSA 4AQIA 3CZ2A 2L50A 1YRTB 5HYDA 1QIVA 1XK4A 1K9PA 1NX0A 2NZ0A 1S6IA 5IBWA 1OOJA 1YTZC 4XJKB 2L4IA 5AEQA 5HKYA 4YGDB 1IIOA 1SBJA 1HT9A 5AANA 2ZN9A 2WCHA 1QS7A 1J7PA 1WLZA 1LA3A 3SG3A 2OS8C 2LHIA 5AXIA 1RROA 1UHKA 5HKZA 3ICBA 1C3ZA 3DF0B 3PN7C 1DJWA 1LA0A 2Y5IA 2GGZA 1DJXA 2KBIA 4YGEB 4GGFA 3KO0A 2WCKA 1F8HA 2L5XB 3LK0A 1ZOTB 3EKHA 3L47A 3SIAA 1F70A 2KI4C 4PDZA 3SG4A 2BKHB 1UHHA 3JVTC 1CLBA 2LP2A 1TTXA 1XFUO 2LVVA 1RFJA 2L51A 1CLMA 3BOWA 2LLUA 3DXLA 5I8NA 2PRUA 3F45A 3DZTA 1QX5B 3OX5A 2LVKA 4YGCB 3CWGA 4DUQA 2Y4QA 2KI6C 1AJ5A 3CABA 3KEVA 1AUIB 3E3RA 3OB2B 3NHTA 3L4AA 1TIZA 1TUZA 4M2QA 2JNFA 4JPZB 1QX7A 1W9ZA 3OX6A 2LMUA 1YVLA 3BFHA 3D74A 1FF1A 1Y0VH 1N0YA 3B86A 3I5HB 1RJVA 2ERBA 3A4UB 1HQVA 2DOQA 1WDCB 1ORGA 2MHHA 4PHJA 5EL2A 3O78A 5DKQA 5B8IB 1DVIA 4JD9A 2A4JA 2ZRTA 5ER5A 1ZUZA 2K2AA 4PE4A 2LV7A 2HPSA 1V1FA 1YX7A 2K7OA 1DT7B 1PVBA 2LUXA 2OTGB 2Y1MA 4WQ3A 4D1EA 2WNDA 2JQ6A 4MLWA 1OOGA 2CXJA 1R6PA 2EHBA 2KQYA 3CZ1A 3QRXA 1A4PA 4QJ3B 1MXLC 1K93D 1WRLA 1QVIY 2QEOA 3WXAA 1YUTA 4JWQA 2JC2A 1M39A 3SS5A 4A4BA 1BR1B 5G08A 3RLZA 3S0AA 1L7ZA 2JPTA 4YRUA 1BLQA 1DJIA 4JKTA 4PE1A 1CTRA 2JU0A 3O4YA 3O6BA 5HKWA 4MZJA 4HRHA 2WCBA 4MRYA 2KAYA 2JRFA 2WCJA 3MSEB 4M2PA 5JOLA 3NSOA 1H4BA 3SG7A 2E30A 1SRAA 3O4XA 1QV1A 2LAPA 2MA2A 2M1KB 1CNPA 2KAVA 1N2DA 2PSRA 4XJKA 1OMRA 4HREE 3S0BA 4C0JA 1RTP1 1UURA 2FOTA 1DGVA 3HCMA 1OMDA 4N5XA 3C1VA 1K9UA 3OBVA 2K61A 4FQTA 2SASA 3B7AA 1PALA 1TNPA 3DVKA 3PM2A 2PMYA 4DIRA 4P2YB 3V2LA 1FI5A 4CPVA 1KQMB 1CFFA 1OMVA 3AKBA 3DF0A
chains in the Genus database with same CATH topology
1SR6B 3A8RA 1MR8A 1ALWA 1KK7Z 1CFCA 3I5FB 1LINA 1IQ5A 2LMVA 5I2QA 3CGAA 1DJHA 1GGWA 1KWOB 3TDZA 2IS9A 1L2OB 4MRXA 3ZWHA 3EK7A 1ALVA 3OP0A 2H2KA 3D0YA 1XFYO 1MXEA 3GK1A 5DKRA 1BJFA 1V1GA 2L4HA 2MLFC 3FWCA 3EVRA 4CLNA 1X02A 1FI6A 2ZKMX 1EG3A 5CPVA 2BL0B 1KK8C 1S36A 1XFVO 5ER4X 1B7TZ 1W7IB 3CS1A 4QJ5B 2KFGA 1CDNA 1TRFA 2MRDA 2EC6C 4OV2A 1WRZA 3TZ1A 4OKHA 1ZMZA 4WRIA 3K21A 2MBXA 1SY9A 1UHIA 4PE7A 2I2RE 3DVMA 2F33A 1A29A 4QJ4B 5KU1A 2OS8B 5PALA 1E8AA 2BBNA 1UWOA 2G9BA 2PASA 1PSBA 3VGOA 2M9GA 3PN7B 4FTGA 1PVAA 2K0JA 4GGNA 1AJ4A 3KHEA 3VRNA 2MAZA 2VRGA 1S6CA 1Y6WA 4N1GA 3BXKA 1XA5A 1TNQA 2KQ6A 4NQGA 2ISDA 1W7JB 1EH2A 2GGMA 2L98A 2RGIA 1A75B 2Q4UA 3JVTB 4I5LB 1NIWA 5CSIA 2K7BA 2PVBA 2WOSA 3FS7A 5FYXA 3GOFA 3BUNB 2FCDA 3D0YB 4DCKA 1UHJA 1JF2A 1MWNA 2WCFA 2JXLA 3NSKA 5D69A 1B4CA 1K94A 1K2HA 3TDIA 4USLA 3CR2A 3AAJA 2KYFA 1KFUS 2F2OA 2TN4A 1NX1A 4I5KA 3LK1A 5KTYA 1QLSA 1SCMC 5GQQC 2V53A 3O2PA 5K89A 1CLLA 2JXCA 1FPWA 1G8IA 2O60A 1D1OA 2PALA 4PHNA 1DJYA 2JNXA 5I2OA 1SKTA 4ORAB 1BOCA 3SG2A 3GK4X 1NCYA 4GNKB 1CDLA 1CFDA 4ORBB 1QASA 3D10A 2QACA 2M49B 1JBAA 1YR5A 1NX2A 2LMTA 1A03A 1K9KA 1B1GA 2H61A 3BUMB 1U5IB 5JJGA 2AUCA 4E68A 2JWWA 3SIBA 1AHRA 2Q91A 1KK7Y 4R1EA 2KYCA 1NYAA 1QTXA 3NSIA 1BT6A 2AAOA 1J55A 2M8UA 2WCEA 1CM1A 3LCPC 1M46A 2BE6A 1SPYA 2E6WA 1PSRA 1CDPA 2JOJA 3DVEA 1F54A 2HQ8A 3HX4A 1LXFC 1J1DA 2FCEA 4Q04A 1CFPA 1OZOA 1TNXA 4AQJA 1K8UA 4PHKA 2M7LA 3SG6A 1G33A 1XK4C 2LVJA 1NCZA 1H8BA 2BCBA 2D8NA 1B7TY 1DJZA 3I5HC 2FJUB 1J7RA 1JFJA 1SL7A 4GPLB 1AK8A 1WDCC 1YRUB 2M29A 3SG5A 1TCOB 3JTDC 2BCAA 3TS5B 3IQQA 1DTLA 1GGZA 1KFXS 1TCFA 1F4QA 1RK9A 3CR4X 1YUUA 4HSZA 2NCOA 1MQ1A 4XYNA 1YURA 1DF0B 2O5GA 2KAXA 4GGFC 4UPGA 1UP5A 3DD4A 1XO5A 1IQ3A 2I94A 2ZNDA 3NSLA 1QLKA 1XVJA 1A75A 1ZACA 1R2UA 1NWDA 2HETA 5DKNA 5HLOA 1KK8B 2L2EA 4CIDA 4ZCUA 1DJGA 4N1FA 3EK4A 4TNCA 3I5GC 1QX2A 4OR9B 2M3WA 3LLEA 2JULA 1F55A 1PULA 1SL8A 2ZNEA 2F2PA 4NDCA 3SJSA 3CTNA 2AMIA 3H4SE 3RM1A 1MHOA 1XFXO 1UHNA 1NX3A 1SK6D 5AFPA 4YI8A 3VRRA 2JZIA 4F0ZB 4MBEA 3TUYC 1OZSA 1IKUA 3M0WA 1SR6C 1BU3A 4BY5A 4A4CA 2WC8A 1KSOA 1M45A 4I5JA 3VRPA 1F4OA 4YI9A 1B9AA 1KWOC 3CLNA 4CFQA 1S5GZ 1SNLA 1YVHA 1QIWA 3BUOB 2KNEA 1OQPA 1U5IA 1XFWO 1Y1XA 1F71A 1B8LA 1ODBA 1IWQA 1J1EA 1BG1A 2NLNA 1NPQA 4YGBB 4GAOA 2KGBC 2KI4B 3EVVA 4OVNF 1S6JA 3VROA 3ZNIA 1DMOA 2GV5A 4CFRA 3I5IC 4PHMA 2K2FA 1K96A 1BMOA 1S3PA 4WQ2A 1S1EA 1S26D 5KSZA 4ICBA 4FQOA 1SCMB 1TOPA 2HQWA 1SL9A 1KFXL 5I2LA 1IJ5A 2CT9A 3WHUB 2KSPA 1EXRA 1Y1UA 1FBVA 5CSNA 4YGAA 3TDUA 2L0PA 1SMGA 2LNKA 4JQ0D 4M2OA 2LLTA 4OCIA 5HLVA 3KF9A 2MLEC 2CTNA 2F8PA 2LUCA 2KBMA 3GK2A 1CMGA 1SCVA 2KGRA 2KOTA 4MN0A 2M97A 5F6TA 1K95A 1ZFSA 1A2XA 1DF0A 1OE9B 2Y1NA 1YX8A 3BUWB 2BE4A 3CR5X 2K7CA 1CM4A 4PE0A 4ORCB 3PSRA 1WLMA 1KSMA 1EL4A 5J3XA 4MZLA 2KI6D 1OSAA 2BBMA 4YBHB 2JT0A 3KPXA 4L9MA 3FWBA 1PK0D 2JT3A 3EKJA 1M63B 2BKIB 1TNWA 1XYDA 1B8CA 1PRWA 1RECA 1RWYA 1FW4A 2BCXA 3AKAA 1Q80A 4NDDA 5AERA 2KDHA 4GBAA 3OB1B 5BPJA 1CMFA 3DVJA 1WY9A 2LE9B 2LLSA 4IL1A 1IGVA 3BQ3A 3WHTB 4GFTA 4MSPA 1BR4B 3FIAA 3OHMB 3WNXB 2CCMA 3JTDB 4PALA 3AAKA 1M31A 5CSJA 1KQVA 2CBLA 3PALA 4ZCVA 1CB1A 1EG4A 1MF8B 2LHLA 2COLB 3NXAA 5CSFA 1JFKA 2B1UA 2JT8A 2K7DA 1AVSA 2P6BB 2WORA 2ZN8A 4HRGA 1GJYA 1JC2A 4DS7A 1B47A 2M1UA 1WRKA 2OTGC 2LVIA 1AP4A 1J7OA 2KHNA 1S5GY 2CNPA 2R2IA 4MEWA 2M7NA 3PFVA 1NSHA 1B8RA 1JF0A 3PM8A 2LANA 1IRJA 1UUSA 3BOWB 3I5GB 1C07A 2ZFDA 1KFUL 4DRWA 1DGUA 2M0RA 4MVFA 3LL8B 3PATA 4U8DA 1NUBA 2MJWB 2JTTA 1QV0A 1QXPA 4NDBA 2NCPA 1CKKA 2I18A 1CDMA 1EJ3A 2F3YA 2G2BA 2KFHA 2EC6B 2F3ZA 1SW8A 3BUXB 1XFZO 2KFFA 1J7QA 2EGDA 1KCYA 2LCPA 3TUYB 1JSAA 3EK8A 1SYMA 2K8MB 3TS5C 4AOMA 2BECA 2QPTA 3IF7A 1VRKA 1BF5A 4ETOA 1G4YR 1IG5A 1IH0A 1KQMC 1NCXA 1NP8A 1YUSA 4MZKA 3CZTX 2JTZA 2LP3A 1LKJA 1K90D 2NXQA 4GUKA 1QVIZ 2LM5A 2HF5A 3IQOA 3EVUA 3I5FC 1Y1AA 1QATA 1TN4A 3VRQA 2H61C 1JUOA 1QJTA 5D7FA 1C7WA 1N65A 4C0KA 4C0LA 1C7VA 1L2OC 2I7AA 1LVCD 1MUXA 5TNCA 3PLFB 2OPOA 3I5IB 1GQMA 4P5OE 3BYAA 4BY4A 1JWDA 1BODA 2LC5A 2BL0C 1IJ6A 2SCPA 4I5NB 4PCWA 2ZRSA 4AQIA 2L50A 1YRTB 5HYDA 1QIVA 1XK4A 1K9PA 1NX0A 2NZ0A 1S6IA 5IBWA 1OOJA 1YTZC 4XJKB 2L4IA 5AEQA 5HKYA 4YGDB 1SBJA 1HT9A 5AANA 2ZN9A 1QS7A 1J7PA 1WLZA 1LA3A 3SG3A 2OS8C 2LHIA 5AXIA 1RROA 1UHKA 5HKZA 3ICBA 3DF0B 3PN7C 1DJWA 1LA0A 2Y5IA 2GGZA 1DJXA 2KBIA 4YGEB 4GGFA 3KO0A 1F8HA 2L5XB 3LK0A 1ZOTB 3EKHA 1F70A 3SIAA 2KI4C 4PDZA 3SG4A 2BKHB 1UHHA 3JVTC 1CLBA 2LP2A 1TTXA 1XFUO 2LVVA 1RFJA 2L51A 1CLMA 3BOWA 2LLUA 5I8NA 2PRUA 3F45A 1QX5B 3OX5A 2LVKA 4YGCB 3CWGA 4DUQA 2Y4QA 2KI6C 1AJ5A 3KEVA 1AUIB 3E3RA 3OB2B 4M2QA 1TIZA 2JNFA 4JPZB 1QX7A 3OX6A 2LMUA 1YVLA 1FF1A 1Y0VH 1N0YA 3I5HB 1RJVA 3A4UB 1HQVA 2DOQA 1WDCB 2MHHA 4PHJA 5B8IB 3O78A 5DKQA 1DVIA 2A4JA 2ZRTA 5ER5A 1ZUZA 2K2AA 4PE4A 2LV7A 2HPSA 1V1FA 1YX7A 2K7OA 1DT7B 1PVBA 2LUXA 2OTGB 2Y1MA 4WQ3A 4D1EA 2WNDA 2JQ6A 4MLWA 2CXJA 1R6PA 2EHBA 2KQYA 3QRXA 4QJ3B 1A4PA 1MXLC 1K93D 1WRLA 1QVIY 3WXAA 1YUTA 4JWQA 2JC2A 1M39A 4A4BA 1BR1B 5G08A 3RLZA 1L7ZA 2JPTA 4YRUA 1BLQA 1DJIA 4PE1A 1CTRA 2JU0A 3O4YA 3O6BA 5HKWA 4MZJA 4HRHA 2WCBA 4MRYA 2KAYA 2JRFA 3MSEB 4M2PA 5JOLA 3NSOA 1H4BA 3SG7A 2E30A 1SRAA 1QV1A 2LAPA 2MA2A 2M1KB 1CNPA 2KAVA 1N2DA 2PSRA 4XJKA 1OMRA 4HREE 4C0JA 1RTP1 1UURA 2FOTA 1DGVA 3HCMA 1OMDA 4N5XA 3C1VA 1K9UA 2K61A 2SASA 1PALA 1TNPA 3DVKA 2PMYA 4DIRA 4P2YB 1FI5A 4CPVA 1KQMB 1CFFA 1OMVA 3AKBA 3DF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SR6 B;  3A8R A;  1MR8 A;  1ALW A;  1KK7 Z;  1CFC A;  3I5F B;  1LIN A;  1IQ5 A;  2LMV A;  5I2Q A;  3CGA A;  1DJH A;  1GGW A;  1KWO B;  3TDZ A;  2IS9 A;  1L2O B;  4MRX A;  3ZWH A;  3EK7 A;  1ALV A;  3OP0 A;  2H2K A;  3D0Y A;  1XFY O;  1MXE A;  3GK1 A;  5DKR A;  1BJF A;  1V1G A;  2L4H A;  2MLF C;  3FWC A;  3EVR A;  4CLN A;  1X02 A;  1FI6 A;  2ZKM X;  1EG3 A;  5CPV A;  2BL0 B;  1KK8 C;  1S36 A;  1XFV O;  5ER4 X;  1B7T Z;  1W7I B;  3CS1 A;  4QJ5 B;  2KFG A;  1CDN A;  1TRF A;  2MRD A;  2EC6 C;  4OV2 A;  1WRZ A;  3TZ1 A;  4OKH A;  1ZMZ A;  4WRI A;  3K21 A;  2MBX A;  1SY9 A;  1UHI A;  4PE7 A;  2I2R E;  3DVM A;  2F33 A;  1A29 A;  4QJ4 B;  5KU1 A;  2OS8 B;  5PAL A;  1E8A A;  2BBN A;  1UWO A;  2G9B A;  2PAS A;  1PSB A;  3VGO A;  2M9G A;  3PN7 B;  4FTG A;  1PVA A;  2K0J A;  4GGN A;  1AJ4 A;  3KHE A;  3VRN A;  2MAZ A;  2VRG A;  1S6C A;  1Y6W A;  4N1G A;  3BXK A;  1XA5 A;  1TNQ A;  2KQ6 A;  4NQG A;  2ISD A;  1W7J B;  1EH2 A;  2GGM A;  2L98 A;  2RGI A;  1A75 B;  2Q4U A;  3JVT B;  4I5L B;  1NIW A;  5CSI A;  2K7B A;  2PVB A;  2WOS A;  3FS7 A;  5FYX A;  3GOF A;  3BUN B;  2FCD A;  3D0Y B;  4DCK A;  1UHJ A;  1JF2 A;  1MWN A;  2WCF A;  2JXL A;  3NSK A;  5D69 A;  1B4C A;  1K94 A;  1K2H A;  3TDI A;  4USL A;  3CR2 A;  3AAJ A;  2KYF A;  1KFU S;  2F2O A;  2TN4 A;  1NX1 A;  4I5K A;  3LK1 A;  5KTY A;  1QLS A;  1SCM C;  5GQQ C;  2V53 A;  3O2P A;  5K89 A;  1CLL A;  2JXC A;  1FPW A;  1G8I A;  2O60 A;  1D1O A;  2PAL A;  4PHN A;  1DJY A;  2JNX A;  5I2O A;  1SKT A;  4ORA B;  1BOC A;  3SG2 A;  3GK4 X;  1NCY A;  4GNK B;  1CDL A;  1CFD A;  4ORB B;  1QAS A;  3D10 A;  2QAC A;  2M49 B;  1JBA A;  1YR5 A;  1NX2 A;  2LMT A;  1A03 A;  1K9K A;  1B1G A;  2H61 A;  3BUM B;  1U5I B;  5JJG A;  2AUC A;  4E68 A;  2JWW A;  3SIB A;  1AHR A;  2Q91 A;  1KK7 Y;  4R1E A;  2KYC A;  1NYA A;  1QTX A;  3NSI A;  1BT6 A;  2AAO A;  1J55 A;  2M8U A;  2WCE A;  1CM1 A;  3LCP C;  1M46 A;  2BE6 A;  1SPY A;  2E6W A;  1PSR A;  1CDP A;  2JOJ A;  3DVE A;  1F54 A;  2HQ8 A;  3HX4 A;  1LXF C;  1J1D A;  2FCE A;  4Q04 A;  1CFP A;  1OZO A;  1TNX A;  4AQJ A;  1K8U A;  4PHK A;  2M7L A;  3SG6 A;  1G33 A;  1XK4 C;  2LVJ A;  1NCZ A;  1H8B A;  2BCB A;  2D8N A;  1B7T Y;  1DJZ A;  3I5H C;  2FJU B;  1J7R A;  1JFJ A;  1SL7 A;  4GPL B;  1AK8 A;  1WDC C;  1YRU B;  2M29 A;  3SG5 A;  1TCO B;  3JTD C;  2BCA A;  3TS5 B;  3IQQ A;  1DTL A;  1GGZ A;  1KFX S;  1TCF A;  1F4Q A;  1RK9 A;  3CR4 X;  1YUU A;  4HSZ A;  2NCO A;  1MQ1 A;  4XYN A;  1YUR A;  1DF0 B;  2O5G A;  2KAX A;  4GGF C;  4UPG A;  1UP5 A;  3DD4 A;  1XO5 A;  1IQ3 A;  2I94 A;  2ZND A;  3NSL A;  1QLK A;  1XVJ A;  1A75 A;  1ZAC A;  1R2U A;  1NWD A;  2HET A;  5DKN A;  5HLO A;  1KK8 B;  2L2E A;  4CID A;  4ZCU A;  1DJG A;  4N1F A;  3EK4 A;  4TNC A;  3I5G C;  1QX2 A;  4OR9 B;  2M3W A;  3LLE A;  2JUL A;  1F55 A;  1PUL A;  1SL8 A;  2ZNE A;  2F2P A;  4NDC A;  3SJS A;  3CTN A;  2AMI A;  3H4S E;  3RM1 A;  1MHO A;  1XFX O;  1UHN A;  1NX3 A;  1SK6 D;  5AFP A;  4YI8 A;  3VRR A;  2JZI A;  4F0Z B;  4MBE A;  3TUY C;  1OZS A;  1IKU A;  3M0W A;  1SR6 C;  1BU3 A;  4BY5 A;  4A4C A;  2WC8 A;  1KSO A;  1M45 A;  4I5J A;  3VRP A;  1F4O A;  4YI9 A;  1B9A A;  1KWO C;  3CLN A;  4CFQ A;  1S5G Z;  1SNL A;  1YVH A;  1QIW A;  3BUO B;  2KNE A;  1OQP A;  1U5I A;  1XFW O;  1Y1X A;  1F71 A;  1B8L A;  1ODB A;  1IWQ A;  1J1E A;  1BG1 A;  2NLN A;  1NPQ A;  4YGB B;  4GAO A;  2KGB C;  2KI4 B;  3EVV A;  4OVN F;  1S6J A;  3VRO A;  3ZNI A;  1DMO A;  2GV5 A;  4CFR A;  3I5I C;  4PHM A;  2K2F A;  1K96 A;  1BMO A;  1S3P A;  4WQ2 A;  1S1E A;  1S26 D;  5KSZ A;  4ICB A;  4FQO A;  1SCM B;  1TOP A;  2HQW A;  1SL9 A;  1KFX L;  5I2L A;  1IJ5 A;  2CT9 A;  3WHU B;  2KSP A;  1EXR A;  1Y1U A;  1FBV A;  5CSN A;  4YGA A;  3TDU A;  2L0P A;  1SMG A;  2LNK A;  4JQ0 D;  4M2O A;  2LLT A;  4OCI A;  5HLV A;  3KF9 A;  2MLE C;  2CTN A;  2F8P A;  2LUC A;  2KBM A;  3GK2 A;  1CMG A;  1SCV A;  2KGR A;  2KOT A;  4MN0 A;  2M97 A;  5F6T A;  1K95 A;  1ZFS A;  1A2X A;  1DF0 A;  1OE9 B;  2Y1N A;  1YX8 A;  3BUW B;  2BE4 A;  3CR5 X;  2K7C A;  1CM4 A;  4PE0 A;  4ORC B;  3PSR A;  1WLM A;  1KSM A;  1EL4 A;  5J3X A;  4MZL A;  2KI6 D;  1OSA A;  2BBM A;  4YBH B;  2JT0 A;  3KPX A;  4L9M A;  3FWB A;  1PK0 D;  2JT3 A;  3EKJ A;  1M63 B;  2BKI B;  1TNW A;  1XYD A;  1B8C A;  1PRW A;  1REC A;  1RWY A;  1FW4 A;  2BCX A;  3AKA A;  1Q80 A;  4NDD A;  5AER A;  2KDH A;  4GBA A;  3OB1 B;  5BPJ A;  1CMF A;  3DVJ A;  1WY9 A;  2LE9 B;  2LLS A;  4IL1 A;  1IGV A;  3BQ3 A;  3WHT B;  4GFT A;  4MSP A;  1BR4 B;  3FIA A;  3OHM B;  3WNX B;  2CCM A;  3JTD B;  4PAL A;  3AAK A;  1M31 A;  5CSJ A;  1KQV A;  2CBL A;  3PAL A;  4ZCV A;  1CB1 A;  1EG4 A;  1MF8 B;  2LHL A;  2COL B;  3NXA A;  5CSF A;  1JFK A;  2B1U A;  2JT8 A;  2K7D A;  1AVS A;  2P6B B;  2WOR A;  2ZN8 A;  4HRG A;  1GJY A;  1JC2 A;  4DS7 A;  1B47 A;  2M1U A;  1WRK A;  2OTG C;  2LVI A;  1AP4 A;  1J7O A;  2KHN A;  1S5G Y;  2CNP A;  2R2I A;  4MEW A;  2M7N A;  3PFV A;  1NSH A;  1B8R A;  1JF0 A;  3PM8 A;  2LAN A;  1IRJ A;  1UUS A;  3BOW B;  3I5G B;  1C07 A;  2ZFD A;  1KFU L;  4DRW A;  1DGU A;  2M0R A;  4MVF A;  3LL8 B;  3PAT A;  4U8D A;  1NUB A;  2MJW B;  2JTT A;  1QV0 A;  1QXP A;  4NDB A;  2NCP A;  1CKK A;  2I18 A;  1CDM A;  1EJ3 A;  2F3Y A;  2G2B A;  2KFH A;  2EC6 B;  2F3Z A;  1SW8 A;  3BUX B;  1XFZ O;  2KFF A;  1J7Q A;  2EGD A;  1KCY A;  2LCP A;  3TUY B;  1JSA A;  3EK8 A;  1SYM A;  2K8M B;  3TS5 C;  4AOM A;  2BEC A;  2QPT A;  3IF7 A;  1VRK A;  1BF5 A;  4ETO A;  1G4Y R;  1IG5 A;  1IH0 A;  1KQM C;  1NCX A;  1NP8 A;  1YUS A;  4MZK A;  3CZT X;  2JTZ A;  2LP3 A;  1LKJ A;  1K90 D;  2NXQ A;  4GUK A;  1QVI Z;  2LM5 A;  2HF5 A;  3IQO A;  3EVU A;  3I5F C;  1Y1A A;  1QAT A;  1TN4 A;  3VRQ A;  2H61 C;  1JUO A;  1QJT A;  5D7F A;  1C7W A;  1N65 A;  4C0K A;  4C0L A;  1C7V A;  1L2O C;  2I7A A;  1LVC D;  1MUX A;  5TNC A;  3PLF B;  2OPO A;  3I5I B;  1GQM A;  4P5O E;  3BYA A;  4BY4 A;  1JWD A;  1BOD A;  2LC5 A;  2BL0 C;  1IJ6 A;  2SCP A;  4I5N B;  4PCW A;  2ZRS A;  4AQI A;  2L50 A;  1YRT B;  5HYD A;  1QIV A;  1XK4 A;  1K9P A;  1NX0 A;  2NZ0 A;  1S6I A;  5IBW A;  1OOJ A;  1YTZ C;  4XJK B;  2L4I A;  5AEQ A;  5HKY A;  4YGD B;  1SBJ A;  1HT9 A;  5AAN A;  2ZN9 A;  1QS7 A;  1J7P A;  1WLZ A;  1LA3 A;  3SG3 A;  2OS8 C;  2LHI A;  5AXI A;  1RRO A;  1UHK A;  5HKZ A;  3ICB A;  3DF0 B;  3PN7 C;  1DJW A;  1LA0 A;  2Y5I A;  2GGZ A;  1DJX A;  2KBI A;  4YGE B;  4GGF A;  3KO0 A;  1F8H A;  2L5X B;  3LK0 A;  1ZOT B;  3EKH A;  1F70 A;  3SIA A;  2KI4 C;  4PDZ A;  3SG4 A;  2BKH B;  1UHH A;  3JVT C;  1CLB A;  2LP2 A;  1TTX A;  1XFU O;  2LVV A;  1RFJ A;  2L51 A;  1CLM A;  3BOW A;  2LLU A;  5I8N A;  2PRU A;  3F45 A;  1QX5 B;  3OX5 A;  2LVK A;  4YGC B;  3CWG A;  4DUQ A;  2Y4Q A;  2KI6 C;  1AJ5 A;  3KEV A;  1AUI B;  3E3R A;  3OB2 B;  4M2Q A;  1TIZ A;  2JNF A;  4JPZ B;  1QX7 A;  3OX6 A;  2LMU A;  1YVL A;  1FF1 A;  1Y0V H;  1N0Y A;  3I5H B;  1RJV A;  3A4U B;  1HQV A;  2DOQ A;  1WDC B;  2MHH A;  4PHJ A;  5B8I B;  3O78 A;  5DKQ A;  1DVI A;  2A4J A;  2ZRT A;  5ER5 A;  1ZUZ A;  2K2A A;  4PE4 A;  2LV7 A;  2HPS A;  1V1F A;  1YX7 A;  2K7O A;  1DT7 B;  1PVB A;  2LUX A;  2OTG B;  2Y1M A;  4WQ3 A;  4D1E A;  2WND A;  2JQ6 A;  4MLW A;  2CXJ A;  1R6P A;  2EHB A;  2KQY A;  3QRX A;  4QJ3 B;  1A4P A;  1MXL C;  1K93 D;  1WRL A;  1QVI Y;  3WXA A;  1YUT A;  4JWQ A;  2JC2 A;  1M39 A;  4A4B A;  1BR1 B;  5G08 A;  3RLZ A;  1L7Z A;  2JPT A;  4YRU A;  1BLQ A;  1DJI A;  4PE1 A;  1CTR A;  2JU0 A;  3O4Y A;  3O6B A;  5HKW A;  4MZJ A;  4HRH A;  2WCB A;  4MRY A;  2KAY A;  2JRF A;  3MSE B;  4M2P A;  5JOL A;  3NSO A;  1H4B A;  3SG7 A;  2E30 A;  1SRA A;  1QV1 A;  2LAP A;  2MA2 A;  2M1K B;  1CNP A;  2KAV A;  1N2D A;  2PSR A;  4XJK A;  1OMR A;  4HRE E;  4C0J A;  1RTP 1;  1UUR A;  2FOT A;  1DGV A;  3HCM A;  1OMD A;  4N5X A;  3C1V A;  1K9U A;  2K61 A;  2SAS A;  1PAL A;  1TNP A;  3DVK A;  2PMY A;  4DIR A;  4P2Y B;  1FI5 A;  4CPV A;  1KQM B;  1CFF A;  1OMV A;  3AKB A;  3DF0 A; 
#chains in the Genus database with same CATH topology
 1SR6 B;  3A8R A;  1MR8 A;  2WCM A;  1ALW A;  1KK7 Z;  1CFC A;  3I5F B;  1LIN A;  1IQ5 A;  2LMV A;  5I2Q A;  2BNX A;  3CGA A;  1DJH A;  1GGW A;  1KWO B;  3TDZ A;  2IS9 A;  1L2O B;  4MRX A;  3ZWH A;  3EK7 A;  1ALV A;  3OP0 A;  4INX A;  2H2K A;  3D0Y A;  1XFY O;  1MXE A;  3GK1 A;  5DKR A;  1BJF A;  1V1G A;  2L4H A;  2MLF C;  3FWC A;  3EVR A;  4CLN A;  1X02 A;  1FI6 A;  2ZKM X;  1EG3 A;  5CPV A;  2BL0 B;  3D73 A;  1KK8 C;  1S36 A;  1XFV O;  5ER4 X;  1B7T Z;  3S0G A;  1LS8 A;  1W7I B;  3CS1 A;  4QJ5 B;  2KFG A;  1DC1 A;  1CDN A;  1TRF A;  2MRD A;  2EC6 C;  4OV2 A;  1WRZ A;  1T14 A;  3TZ1 A;  4OKH A;  1ZMZ A;  4WRI A;  3K21 A;  2MBX A;  1SY9 A;  1UHI A;  4PE7 A;  2I2R E;  3DVM A;  2F33 A;  1A29 A;  4QJ4 B;  5KU1 A;  2OS8 B;  2KLD A;  5PAL A;  1E8A A;  2BBN A;  1UWO A;  2G9B A;  2PAS A;  1PSB A;  3VGO A;  2M9G A;  3PN7 B;  4FTG A;  1PVA A;  2K0J A;  4GGN A;  1AJ4 A;  3KHE A;  3VRN A;  2MAZ A;  2VRG A;  3SS4 A;  1S6C A;  1Y6W A;  4N1G A;  3BXK A;  2PYQ A;  1XA5 A;  1TNQ A;  2KQ6 A;  4NQG A;  2ISD A;  1W7J B;  3RZS A;  1EH2 A;  5D3O A;  2GGM A;  2L98 A;  2RGI A;  1A75 B;  2Q4U A;  3JVT B;  2H8V A;  4I5L B;  1NIW A;  4KYN A;  5CSI A;  2K7B A;  5FI7 A;  2PVB A;  2WOS A;  3FS7 A;  3OGN A;  2L2C A;  5FYX A;  3GOF A;  3BUN B;  2FCD A;  3D0Y B;  4DCK A;  3Q8I A;  1UHJ A;  1JF2 A;  1MWN A;  2WCF A;  2JXL A;  3NSK A;  5D69 A;  1B4C A;  1K94 A;  1K2H A;  3TDI A;  4USL A;  3CR2 A;  3AAJ A;  2KYF A;  1KFU S;  2F2O A;  2TN4 A;  3R1O A;  3BJH A;  1NX1 A;  4I5K A;  3LK1 A;  5KTY A;  1QLS A;  1SCM C;  5GQQ C;  2V53 A;  3O2P A;  5K89 A;  1CLL A;  2JXC A;  1FPW A;  3D76 A;  1OW4 A;  1G8I A;  2O60 A;  1D1O A;  2PAL A;  4PHN A;  1DJY A;  2JNX A;  5I2O A;  1SKT A;  4ORA B;  3IVT A;  1BOC A;  3SG2 A;  3GK4 X;  1NCY A;  4GNK B;  1CDL A;  1CFD A;  3R1V A;  4ORB B;  1QAS A;  3D10 A;  2QAC A;  3B6X A;  2M49 B;  1JBA A;  1YR5 A;  1NX2 A;  2QEV A;  2LMT A;  1A03 A;  3DY9 A;  1K9K A;  1B1G A;  1OOI X;  2H61 A;  3D75 A;  3BUM B;  1U5I B;  5JJG A;  2AUC A;  4E68 A;  3B88 A;  2JWW A;  3SIB A;  1AHR A;  2Q91 A;  1KK7 Y;  1OOH A;  4R1E A;  2KYC A;  1NYA A;  1QTX A;  3NSI A;  1BT6 A;  2AAO A;  1J55 A;  2M8U A;  2WCE A;  3D77 A;  1CM1 A;  3LCP C;  1M46 A;  2BE6 A;  1SPY A;  2E6W A;  1PSR A;  1CDP A;  2JOJ A;  3B87 A;  3DVE A;  1F54 A;  2HQ8 A;  3HX4 A;  1LXF C;  1J1D A;  2FCE A;  2K60 A;  4Q04 A;  1OZO A;  1TNX A;  3L4L A;  4AQJ A;  1CFP A;  1K8U A;  4PHK A;  2M7L A;  3SG6 A;  1G33 A;  1XK4 C;  2LVJ A;  1NCZ A;  1H8B A;  2BCB A;  2D8N A;  1B7T Y;  1DJZ A;  3I5H C;  2FJU B;  1J7R A;  1JFJ A;  1SL7 A;  4GPL B;  2WC6 A;  1SSE B;  1AK8 A;  1WDC C;  1YRU B;  2M29 A;  3SG5 A;  1TCO B;  5DIC A;  2BAP A;  3JTD C;  2BCA A;  3TS5 B;  3IQQ A;  1DTL A;  1GGZ A;  1KFX S;  1TCF A;  1F4Q A;  1XFR A;  3SS3 A;  1OOF A;  1RK9 A;  3CR4 X;  1YUU A;  3NGV A;  4HSZ A;  2NCO A;  1MQ1 A;  1Z2C B;  2JPO A;  2KPH A;  1YUR A;  1DF0 B;  2O5G A;  2KAX A;  4GGF C;  4XYN A;  4UPG A;  1UP5 A;  3DD4 A;  1XO5 A;  1IQ3 A;  2I94 A;  2ZND A;  2QEB A;  3NSL A;  1QLK A;  1XVJ A;  1A75 A;  1ZAC A;  1R2U A;  1NWD A;  3EG5 B;  2HET A;  5DKN A;  5HLO A;  1KK8 B;  2PQL A;  2L2E A;  4CID A;  4INW A;  1C3Y A;  4ZCU A;  1DJG A;  4N1F A;  3EK4 A;  4TNC A;  3I5G C;  1QX2 A;  4OR9 B;  2FJY A;  2M3W A;  3LLE A;  2JUL A;  5FI2 A;  1PUL A;  1SL8 A;  1F55 A;  2ZNE A;  2F2P A;  4IJ7 A;  3S0D A;  4NDC A;  3SJS A;  3CTN A;  2AMI A;  3H4S E;  3RM1 A;  1MHO A;  1QWV A;  1XFX O;  1UHN A;  1NX3 A;  3S0F A;  1SK6 D;  5AFP A;  4YI8 A;  3VRR A;  2JZI A;  4F0Z B;  4MBE A;  3TUY C;  1OZS A;  1IKU A;  3M0W A;  3R1P A;  1SR6 C;  1BU3 A;  4BY5 A;  2QDI A;  4A4C A;  2WCL A;  2WC8 A;  1KSO A;  1M45 A;  3DYE A;  4I5J A;  3VRP A;  1F4O A;  4YI9 A;  1B9A A;  1KWO C;  2P71 A;  3CLN A;  1S5G Z;  1SNL A;  4CFQ A;  1YVH A;  1QIW A;  3BUO B;  2KNE A;  1OQP A;  2P70 A;  1U5I A;  1XFW O;  1Y1X A;  1F71 A;  1B8L A;  1ODB A;  1IWQ A;  1J1E A;  1BG1 A;  2NLN A;  3FE8 A;  1NPQ A;  4YGB B;  4GAO A;  2KGB C;  2KI4 B;  3EVV A;  4OVN F;  1S6J A;  3VRO A;  3ZNI A;  1DMO A;  2GV5 A;  4CFR A;  3I5I C;  4PHM A;  2K2F A;  1K96 A;  1BMO A;  1DEL A;  3QME A;  1S3P A;  4WQ2 A;  1S1E A;  1S26 D;  3R72 A;  5KSZ A;  4ICB A;  4FQO A;  1SCM B;  1TOP A;  2HQW A;  1SL9 A;  1KFX L;  5I2L A;  1IJ5 A;  2CT9 A;  3WHU B;  2KSP A;  1EXR A;  1Y1U A;  1FBV A;  1TWO A;  5CSN A;  4YGA A;  3TDU A;  2L0P A;  1SMG A;  2LNK A;  3K1E A;  4JQ0 D;  2LLT A;  4M2O A;  4OCI A;  5HLV A;  3D78 A;  2MLE C;  2CTN A;  2YGU A;  3KF9 A;  2F8P A;  2LUC A;  2KBM A;  3GK2 A;  1CMG A;  1SCV A;  2KGR A;  2KOT A;  4MN0 A;  2M97 A;  5F6T A;  1K95 A;  1ZFS A;  1A2X A;  1DF0 A;  1OE9 B;  2Y1N A;  1YX8 A;  3BUW B;  2BE4 A;  3CR5 X;  2K7C A;  1CM4 A;  2QEH A;  4PE0 A;  4ORC B;  3PSR A;  1WLM A;  1KSM A;  1EL4 A;  5J3X A;  4MZL A;  2KI6 D;  1OSA A;  2BBM A;  4YBH B;  2JT0 A;  3KPX A;  4L9M A;  1TUJ A;  3FWB A;  1PK0 D;  2JT3 A;  3EKJ A;  1M63 B;  2BKI B;  1TNW A;  1XYD A;  1B8C A;  1PRW A;  1REC A;  1RWY A;  1FW4 A;  2BCX A;  3AKA A;  1Q80 A;  4NDD A;  5AER A;  2KDH A;  4GBA A;  3CYZ A;  3OB1 B;  5BPJ A;  1DQE A;  1CMF A;  3CZ0 A;  3DVJ A;  1WY9 A;  2LE9 B;  2LLS A;  4IL1 A;  1IGV A;  3BQ3 A;  3WHT B;  4GFT A;  4MSP A;  1BR4 B;  3FIA A;  3OHM B;  3WNX B;  2CCM A;  3JTD B;  5I94 A;  4PAL A;  3AAK A;  1M31 A;  5CSJ A;  1KQV A;  2CBL A;  3PAL A;  4ZCV A;  1CB1 A;  1EG4 A;  1MF8 B;  2LHL A;  2COL B;  3NXA A;  5CSF A;  1JFK A;  2B1U A;  2JT8 A;  2K7D A;  1AVS A;  2P6B B;  2WOR A;  2ZN8 A;  3CDN A;  4HRG A;  1GJY A;  3VB1 A;  1JC2 A;  4DS7 A;  1B47 A;  2M1U A;  1WRK A;  1Z4H A;  2OTG C;  1DEK A;  2LVI A;  3FE9 A;  1AP4 A;  1J7O A;  2KHN A;  1S5G Y;  2CNP A;  2R2I A;  4MEW A;  2M7N A;  3PFV A;  1NSH A;  1B8R A;  1JF0 A;  3PJI A;  3PM8 A;  2LAN A;  1IRJ A;  1UUS A;  3BOW B;  3I5G B;  1C07 A;  2ZFD A;  1KFU L;  4DRW A;  1DGU A;  2M0R A;  4MVF A;  3LL8 B;  3PAT A;  4U8D A;  2L5Y A;  1NUB A;  2MJW B;  2JTT A;  1QV0 A;  1QXP A;  4NDB A;  3NHI A;  2NCP A;  3FE6 A;  1CKK A;  2I18 A;  1CDM A;  1EJ3 A;  2F3Y A;  2G2B A;  4OZD A;  2KFH A;  5FI6 A;  2EC6 B;  2F3Z A;  1GM0 A;  1SW8 A;  3BUX B;  1XFZ O;  2KFF A;  3S0E A;  1J7Q A;  2EGD A;  1KCY A;  2LCP A;  3TUY B;  1JSA A;  3EK8 A;  1SYM A;  2K8M B;  3TS5 C;  4AOM A;  2BEC A;  2QPT A;  3IF7 A;  1VRK A;  1BF5 A;  4ETO A;  1P28 A;  1G4Y R;  1IG5 A;  1IH0 A;  1KQM C;  1NCX A;  1NP8 A;  1YUS A;  4MZK A;  3CZT X;  2JTZ A;  2LP3 A;  3UNW A;  1LKJ A;  1K90 D;  2NXQ A;  4GUK A;  1QVI Z;  2LM5 A;  3BFB A;  2HF5 A;  3IQO A;  3EVU A;  3I5F C;  1Y1A A;  1QAT A;  1TN4 A;  3VRQ A;  2H61 C;  1JUO A;  1QJT A;  2KLE A;  1C7W A;  5D7F A;  1N65 A;  4C0K A;  4C0L A;  1C7V A;  1L2O C;  2I7A A;  1LVC D;  1MUX A;  5TNC A;  3N7H A;  3PLF B;  3UO9 A;  5HL1 A;  2GTE A;  4PT1 A;  2OPO A;  3I5I B;  1GQM A;  4P5O E;  3BFA A;  3BYA A;  4BY4 A;  4F7F A;  1JWD A;  1BOD A;  2LC5 A;  2BL0 C;  1IJ6 A;  2SCP A;  2WC5 A;  4I5N B;  4PCW A;  2ZRS A;  4AQI A;  3CZ2 A;  2L50 A;  1YRT B;  5HYD A;  1QIV A;  1XK4 A;  1K9P A;  1NX0 A;  2NZ0 A;  1S6I A;  5IBW A;  1OOJ A;  1YTZ C;  4XJK B;  2L4I A;  5AEQ A;  5HKY A;  4YGD B;  1IIO A;  1SBJ A;  1HT9 A;  5AAN A;  2ZN9 A;  2WCH A;  1QS7 A;  1J7P A;  1WLZ A;  1LA3 A;  3SG3 A;  2OS8 C;  2LHI A;  5AXI A;  1RRO A;  1UHK A;  5HKZ A;  3ICB A;  1C3Z A;  3DF0 B;  3PN7 C;  1DJW A;  1LA0 A;  2Y5I A;  2GGZ A;  1DJX A;  2KBI A;  4YGE B;  4GGF A;  3KO0 A;  2WCK A;  1F8H A;  2L5X B;  3LK0 A;  1ZOT B;  3EKH A;  3L47 A;  3SIA A;  1F70 A;  2KI4 C;  4PDZ A;  3SG4 A;  2BKH B;  1UHH A;  3JVT C;  1CLB A;  2LP2 A;  1TTX A;  1XFU O;  2LVV A;  1RFJ A;  2L51 A;  1CLM A;  3BOW A;  2LLU A;  3DXL A;  5I8N A;  2PRU A;  3F45 A;  3DZT A;  1QX5 B;  3OX5 A;  2LVK A;  4YGC B;  3CWG A;  4DUQ A;  2Y4Q A;  2KI6 C;  1AJ5 A;  3CAB A;  3KEV A;  1AUI B;  3E3R A;  3OB2 B;  3NHT A;  3L4A A;  1TIZ A;  1TUZ A;  4M2Q A;  2JNF A;  4JPZ B;  1QX7 A;  1W9Z A;  3OX6 A;  2LMU A;  1YVL A;  3BFH A;  3D74 A;  1FF1 A;  1Y0V H;  1N0Y A;  3B86 A;  3I5H B;  1RJV A;  2ERB A;  3A4U B;  1HQV A;  2DOQ A;  1WDC B;  1ORG A;  2MHH A;  4PHJ A;  5EL2 A;  3O78 A;  5DKQ A;  5B8I B;  1DVI A;  4JD9 A;  2A4J A;  2ZRT A;  5ER5 A;  1ZUZ A;  2K2A A;  4PE4 A;  2LV7 A;  2HPS A;  1V1F A;  1YX7 A;  2K7O A;  1DT7 B;  1PVB A;  2LUX A;  2OTG B;  2Y1M A;  4WQ3 A;  4D1E A;  2WND A;  2JQ6 A;  4MLW A;  1OOG A;  2CXJ A;  1R6P A;  2EHB A;  2KQY A;  3CZ1 A;  3QRX A;  1A4P A;  4QJ3 B;  1MXL C;  1K93 D;  1WRL A;  1QVI Y;  2QEO A;  3WXA A;  1YUT A;  4JWQ A;  2JC2 A;  1M39 A;  3SS5 A;  4A4B A;  1BR1 B;  5G08 A;  3RLZ A;  3S0A A;  1L7Z A;  2JPT A;  4YRU A;  1BLQ A;  1DJI A;  4JKT A;  4PE1 A;  1CTR A;  2JU0 A;  3O4Y A;  3O6B A;  5HKW A;  4MZJ A;  4HRH A;  2WCB A;  4MRY A;  2KAY A;  2JRF A;  2WCJ A;  3MSE B;  4M2P A;  5JOL A;  3NSO A;  1H4B A;  3SG7 A;  2E30 A;  1SRA A;  3O4X A;  1QV1 A;  2LAP A;  2MA2 A;  2M1K B;  1CNP A;  2KAV A;  1N2D A;  2PSR A;  4XJK A;  1OMR A;  4HRE E;  3S0B A;  4C0J A;  1RTP 1;  1UUR A;  2FOT A;  1DGV A;  3HCM A;  1OMD A;  4N5X A;  3C1V A;  1K9U A;  3OBV A;  2K61 A;  4FQT A;  2SAS A;  3B7A A;  1PAL A;  1TNP A;  3DVK A;  3PM2 A;  2PMY A;  4DIR A;  4P2Y B;  3V2L A;  1FI5 A;  4CPV A;  1KQM B;  1CFF A;  1OMV A;  3AKB A;  3DF0 A; 
#chains in the Genus database with same CATH homology
 1SR6 B;  3A8R A;  1MR8 A;  1ALW A;  1KK7 Z;  1CFC A;  3I5F B;  1LIN A;  1IQ5 A;  2LMV A;  5I2Q A;  3CGA A;  1DJH A;  1GGW A;  1KWO B;  3TDZ A;  2IS9 A;  1L2O B;  4MRX A;  3ZWH A;  3EK7 A;  1ALV A;  3OP0 A;  2H2K A;  3D0Y A;  1XFY O;  1MXE A;  3GK1 A;  5DKR A;  1BJF A;  1V1G A;  2L4H A;  2MLF C;  3FWC A;  3EVR A;  4CLN A;  1X02 A;  1FI6 A;  2ZKM X;  1EG3 A;  5CPV A;  2BL0 B;  1KK8 C;  1S36 A;  1XFV O;  5ER4 X;  1B7T Z;  1W7I B;  3CS1 A;  4QJ5 B;  2KFG A;  1CDN A;  1TRF A;  2MRD A;  2EC6 C;  4OV2 A;  1WRZ A;  3TZ1 A;  4OKH A;  1ZMZ A;  4WRI A;  3K21 A;  2MBX A;  1SY9 A;  1UHI A;  4PE7 A;  2I2R E;  3DVM A;  2F33 A;  1A29 A;  4QJ4 B;  5KU1 A;  2OS8 B;  5PAL A;  1E8A A;  2BBN A;  1UWO A;  2G9B A;  2PAS A;  1PSB A;  3VGO A;  2M9G A;  3PN7 B;  4FTG A;  1PVA A;  2K0J A;  4GGN A;  1AJ4 A;  3KHE A;  3VRN A;  2MAZ A;  2VRG A;  1S6C A;  1Y6W A;  4N1G A;  3BXK A;  1XA5 A;  1TNQ A;  2KQ6 A;  4NQG A;  2ISD A;  1W7J B;  1EH2 A;  2GGM A;  2L98 A;  2RGI A;  1A75 B;  2Q4U A;  3JVT B;  4I5L B;  1NIW A;  5CSI A;  2K7B A;  2PVB A;  2WOS A;  3FS7 A;  5FYX A;  3GOF A;  3BUN B;  2FCD A;  3D0Y B;  4DCK A;  1UHJ A;  1JF2 A;  1MWN A;  2WCF A;  2JXL A;  3NSK A;  5D69 A;  1B4C A;  1K94 A;  1K2H A;  3TDI A;  4USL A;  3CR2 A;  3AAJ A;  2KYF A;  1KFU S;  2F2O A;  2TN4 A;  1NX1 A;  4I5K A;  3LK1 A;  5KTY A;  1QLS A;  1SCM C;  5GQQ C;  2V53 A;  3O2P A;  5K89 A;  1CLL A;  2JXC A;  1FPW A;  1G8I A;  2O60 A;  1D1O A;  2PAL A;  4PHN A;  1DJY A;  2JNX A;  5I2O A;  1SKT A;  4ORA B;  1BOC A;  3SG2 A;  3GK4 X;  1NCY A;  4GNK B;  1CDL A;  1CFD A;  4ORB B;  1QAS A;  3D10 A;  2QAC A;  2M49 B;  1JBA A;  1YR5 A;  1NX2 A;  2LMT A;  1A03 A;  1K9K A;  1B1G A;  2H61 A;  3BUM B;  1U5I B;  5JJG A;  2AUC A;  4E68 A;  2JWW A;  3SIB A;  1AHR A;  2Q91 A;  1KK7 Y;  4R1E A;  2KYC A;  1NYA A;  1QTX A;  3NSI A;  1BT6 A;  2AAO A;  1J55 A;  2M8U A;  2WCE A;  1CM1 A;  3LCP C;  1M46 A;  2BE6 A;  1SPY A;  2E6W A;  1PSR A;  1CDP A;  2JOJ A;  3DVE A;  1F54 A;  2HQ8 A;  3HX4 A;  1LXF C;  1J1D A;  2FCE A;  4Q04 A;  1CFP A;  1OZO A;  1TNX A;  4AQJ A;  1K8U A;  4PHK A;  2M7L A;  3SG6 A;  1G33 A;  1XK4 C;  2LVJ A;  1NCZ A;  1H8B A;  2BCB A;  2D8N A;  1B7T Y;  1DJZ A;  3I5H C;  2FJU B;  1J7R A;  1JFJ A;  1SL7 A;  4GPL B;  1AK8 A;  1WDC C;  1YRU B;  2M29 A;  3SG5 A;  1TCO B;  3JTD C;  2BCA A;  3TS5 B;  3IQQ A;  1DTL A;  1GGZ A;  1KFX S;  1TCF A;  1F4Q A;  1RK9 A;  3CR4 X;  1YUU A;  4HSZ A;  2NCO A;  1MQ1 A;  4XYN A;  1YUR A;  1DF0 B;  2O5G A;  2KAX A;  4GGF C;  4UPG A;  1UP5 A;  3DD4 A;  1XO5 A;  1IQ3 A;  2I94 A;  2ZND A;  3NSL A;  1QLK A;  1XVJ A;  1A75 A;  1ZAC A;  1R2U A;  1NWD A;  2HET A;  5DKN A;  5HLO A;  1KK8 B;  2L2E A;  4CID A;  4ZCU A;  1DJG A;  4N1F A;  3EK4 A;  4TNC A;  3I5G C;  1QX2 A;  4OR9 B;  2M3W A;  3LLE A;  2JUL A;  1F55 A;  1PUL A;  1SL8 A;  2ZNE A;  2F2P A;  4NDC A;  3SJS A;  3CTN A;  2AMI A;  3H4S E;  3RM1 A;  1MHO A;  1XFX O;  1UHN A;  1NX3 A;  1SK6 D;  5AFP A;  4YI8 A;  3VRR A;  2JZI A;  4F0Z B;  4MBE A;  3TUY C;  1OZS A;  1IKU A;  3M0W A;  1SR6 C;  1BU3 A;  4BY5 A;  4A4C A;  2WC8 A;  1KSO A;  1M45 A;  4I5J A;  3VRP A;  1F4O A;  4YI9 A;  1B9A A;  1KWO C;  3CLN A;  4CFQ A;  1S5G Z;  1SNL A;  1YVH A;  1QIW A;  3BUO B;  2KNE A;  1OQP A;  1U5I A;  1XFW O;  1Y1X A;  1F71 A;  1B8L A;  1ODB A;  1IWQ A;  1J1E A;  1BG1 A;  2NLN A;  1NPQ A;  4YGB B;  4GAO A;  2KGB C;  2KI4 B;  3EVV A;  4OVN F;  1S6J A;  3VRO A;  3ZNI A;  1DMO A;  2GV5 A;  4CFR A;  3I5I C;  4PHM A;  2K2F A;  1K96 A;  1BMO A;  1S3P A;  4WQ2 A;  1S1E A;  1S26 D;  5KSZ A;  4ICB A;  4FQO A;  1SCM B;  1TOP A;  2HQW A;  1SL9 A;  1KFX L;  5I2L A;  1IJ5 A;  2CT9 A;  3WHU B;  2KSP A;  1EXR A;  1Y1U A;  1FBV A;  5CSN A;  4YGA A;  3TDU A;  2L0P A;  1SMG A;  2LNK A;  4JQ0 D;  4M2O A;  2LLT A;  4OCI A;  5HLV A;  3KF9 A;  2MLE C;  2CTN A;  2F8P A;  2LUC A;  2KBM A;  3GK2 A;  1CMG A;  1SCV A;  2KGR A;  2KOT A;  4MN0 A;  2M97 A;  5F6T A;  1K95 A;  1ZFS A;  1A2X A;  1DF0 A;  1OE9 B;  2Y1N A;  1YX8 A;  3BUW B;  2BE4 A;  3CR5 X;  2K7C A;  1CM4 A;  4PE0 A;  4ORC B;  3PSR A;  1WLM A;  1KSM A;  1EL4 A;  5J3X A;  4MZL A;  2KI6 D;  1OSA A;  2BBM A;  4YBH B;  2JT0 A;  3KPX A;  4L9M A;  3FWB A;  1PK0 D;  2JT3 A;  3EKJ A;  1M63 B;  2BKI B;  1TNW A;  1XYD A;  1B8C A;  1PRW A;  1REC A;  1RWY A;  1FW4 A;  2BCX A;  3AKA A;  1Q80 A;  4NDD A;  5AER A;  2KDH A;  4GBA A;  3OB1 B;  5BPJ A;  1CMF A;  3DVJ A;  1WY9 A;  2LE9 B;  2LLS A;  4IL1 A;  1IGV A;  3BQ3 A;  3WHT B;  4GFT A;  4MSP A;  1BR4 B;  3FIA A;  3OHM B;  3WNX B;  2CCM A;  3JTD B;  4PAL A;  3AAK A;  1M31 A;  5CSJ A;  1KQV A;  2CBL A;  3PAL A;  4ZCV A;  1CB1 A;  1EG4 A;  1MF8 B;  2LHL A;  2COL B;  3NXA A;  5CSF A;  1JFK A;  2B1U A;  2JT8 A;  2K7D A;  1AVS A;  2P6B B;  2WOR A;  2ZN8 A;  4HRG A;  1GJY A;  1JC2 A;  4DS7 A;  1B47 A;  2M1U A;  1WRK A;  2OTG C;  2LVI A;  1AP4 A;  1J7O A;  2KHN A;  1S5G Y;  2CNP A;  2R2I A;  4MEW A;  2M7N A;  3PFV A;  1NSH A;  1B8R A;  1JF0 A;  3PM8 A;  2LAN A;  1IRJ A;  1UUS A;  3BOW B;  3I5G B;  1C07 A;  2ZFD A;  1KFU L;  4DRW A;  1DGU A;  2M0R A;  4MVF A;  3LL8 B;  3PAT A;  4U8D A;  1NUB A;  2MJW B;  2JTT A;  1QV0 A;  1QXP A;  4NDB A;  2NCP A;  1CKK A;  2I18 A;  1CDM A;  1EJ3 A;  2F3Y A;  2G2B A;  2KFH A;  2EC6 B;  2F3Z A;  1SW8 A;  3BUX B;  1XFZ O;  2KFF A;  1J7Q A;  2EGD A;  1KCY A;  2LCP A;  3TUY B;  1JSA A;  3EK8 A;  1SYM A;  2K8M B;  3TS5 C;  4AOM A;  2BEC A;  2QPT A;  3IF7 A;  1VRK A;  1BF5 A;  4ETO A;  1G4Y R;  1IG5 A;  1IH0 A;  1KQM C;  1NCX A;  1NP8 A;  1YUS A;  4MZK A;  3CZT X;  2JTZ A;  2LP3 A;  1LKJ A;  1K90 D;  2NXQ A;  4GUK A;  1QVI Z;  2LM5 A;  2HF5 A;  3IQO A;  3EVU A;  3I5F C;  1Y1A A;  1QAT A;  1TN4 A;  3VRQ A;  2H61 C;  1JUO A;  1QJT A;  5D7F A;  1C7W A;  1N65 A;  4C0K A;  4C0L A;  1C7V A;  1L2O C;  2I7A A;  1LVC D;  1MUX A;  5TNC A;  3PLF B;  2OPO A;  3I5I B;  1GQM A;  4P5O E;  3BYA A;  4BY4 A;  1JWD A;  1BOD A;  2LC5 A;  2BL0 C;  1IJ6 A;  2SCP A;  4I5N B;  4PCW A;  2ZRS A;  4AQI A;  2L50 A;  1YRT B;  5HYD A;  1QIV A;  1XK4 A;  1K9P A;  1NX0 A;  2NZ0 A;  1S6I A;  5IBW A;  1OOJ A;  1YTZ C;  4XJK B;  2L4I A;  5AEQ A;  5HKY A;  4YGD B;  1SBJ A;  1HT9 A;  5AAN A;  2ZN9 A;  1QS7 A;  1J7P A;  1WLZ A;  1LA3 A;  3SG3 A;  2OS8 C;  2LHI A;  5AXI A;  1RRO A;  1UHK A;  5HKZ A;  3ICB A;  3DF0 B;  3PN7 C;  1DJW A;  1LA0 A;  2Y5I A;  2GGZ A;  1DJX A;  2KBI A;  4YGE B;  4GGF A;  3KO0 A;  1F8H A;  2L5X B;  3LK0 A;  1ZOT B;  3EKH A;  1F70 A;  3SIA A;  2KI4 C;  4PDZ A;  3SG4 A;  2BKH B;  1UHH A;  3JVT C;  1CLB A;  2LP2 A;  1TTX A;  1XFU O;  2LVV A;  1RFJ A;  2L51 A;  1CLM A;  3BOW A;  2LLU A;  5I8N A;  2PRU A;  3F45 A;  1QX5 B;  3OX5 A;  2LVK A;  4YGC B;  3CWG A;  4DUQ A;  2Y4Q A;  2KI6 C;  1AJ5 A;  3KEV A;  1AUI B;  3E3R A;  3OB2 B;  4M2Q A;  1TIZ A;  2JNF A;  4JPZ B;  1QX7 A;  3OX6 A;  2LMU A;  1YVL A;  1FF1 A;  1Y0V H;  1N0Y A;  3I5H B;  1RJV A;  3A4U B;  1HQV A;  2DOQ A;  1WDC B;  2MHH A;  4PHJ A;  5B8I B;  3O78 A;  5DKQ A;  1DVI A;  2A4J A;  2ZRT A;  5ER5 A;  1ZUZ A;  2K2A A;  4PE4 A;  2LV7 A;  2HPS A;  1V1F A;  1YX7 A;  2K7O A;  1DT7 B;  1PVB A;  2LUX A;  2OTG B;  2Y1M A;  4WQ3 A;  4D1E A;  2WND A;  2JQ6 A;  4MLW A;  2CXJ A;  1R6P A;  2EHB A;  2KQY A;  3QRX A;  4QJ3 B;  1A4P A;  1MXL C;  1K93 D;  1WRL A;  1QVI Y;  3WXA A;  1YUT A;  4JWQ A;  2JC2 A;  1M39 A;  4A4B A;  1BR1 B;  5G08 A;  3RLZ A;  1L7Z A;  2JPT A;  4YRU A;  1BLQ A;  1DJI A;  4PE1 A;  1CTR A;  2JU0 A;  3O4Y A;  3O6B A;  5HKW A;  4MZJ A;  4HRH A;  2WCB A;  4MRY A;  2KAY A;  2JRF A;  3MSE B;  4M2P A;  5JOL A;  3NSO A;  1H4B A;  3SG7 A;  2E30 A;  1SRA A;  1QV1 A;  2LAP A;  2MA2 A;  2M1K B;  1CNP A;  2KAV A;  1N2D A;  2PSR A;  4XJK A;  1OMR A;  4HRE E;  4C0J A;  1RTP 1;  1UUR A;  2FOT A;  1DGV A;  3HCM A;  1OMD A;  4N5X A;  3C1V A;  1K9U A;  2K61 A;  2SAS A;  1PAL A;  1TNP A;  3DVK A;  2PMY A;  4DIR A;  4P2Y B;  1FI5 A;  4CPV A;  1KQM B;  1CFF A;  1OMV A;  3AKB A;  3DF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...