5I2QA

Structure of ef-hand containing protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
105
Chain Sequence
FNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFRAFLLIFRKAAAGELQEDSGLCVLARLSEIDVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EF-hand domain-containing protein D2
publication title Structural implications of Ca(2+)-dependent actin-bundling function of human EFhd2/Swiprosin-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5i2qA00
1V1GA 4Q04A 2LMTA 1GGZA 5K89A 3O2PA 2ZFDA 3LCPC 1B47A 3KEVA 1M31A 3PN7B 1NYAA 4OCIA 1GJYA 3I5HB 1JF0A 1UWOA 3SG2A 1J7OA 2LANA 5HLOA 1KQVA 3OB1B 2Q4UA 4CLNA 1FI6A 2WCEA 5CSFA 4MZLA 4NQGA 1CTRA 1BU3A 5CSIA 1B1GA 3BYAA 4PHKA 1NX3A 3DVMA 2L2EA 3FS7A 1ALVA 1N2DA 2KGRA 1QVIY 4AQJA 2MHHA 5AEQA 4AQIA 1TRFA 4PHJA 2Y4QA 1FW4A 5G08A 4QJ4B 2I7AA 5HLVA 2KGBC 1YUSA 1IGVA 3I5FC 4NDDA 1C7WA 1KQMC 2JTTA 2ZRSA 3NXAA 2BCAA 3O4YA 1SNLA 4DUQA 4I5KA 2KI6C 2LUCA 1RFJA 2KSPA 2KQ6A 2M0RA 1A03A 1NX2A 2PMYA 1AVSA 1N65A 1SMGA 2JRFA 5ER4X 4PE7A 4ETOA 3BUWB 2H61C 1UHKA 1KWOB 5FYXA 4YI8A 1IH0A 1SYMA 1DF0A 5DKNA 2K7CA 3SG4A 1WDCC 1M39A 1QJTA 1S5GZ 1XA5A 3TS5C 1DGUA 2KBMA 3HX4A 2LMVA 1YRTB 3GOFA 4N1FA 1BR1B 1NIWA 3SG6A 1F4OA 3AAJA 3DF0A 1J7PA 1V1FA 2JOJA 2FOTA 5BPJA 2NCPA 1NP8A 4C0KA 3ICBA 2M97A 2V53A 1TCOB 2LUXA 4JWQA 1CDMA 2OTGC 2LHIA 2NXQA 3EVRA 1KFUL 3DD4A 2WC8A 3ZWHA 1BF5A 1YURA 1F4QA 3MSEB 1C7VA 1QV1A 2KI6D 3CR2A 2Y1MA 1NCYA 2PASA 1XFXO 1DJYA 2R2IA 4ORAB 2L5XB 1HT9A 5HKZA 1WLZA 4A4BA 2MLEC 3CWGA 1LA3A 4YGAA 3PLFB 4PCWA 1AJ5A 2WCFA 2G2BA 4NDCA 3SG7A 1MWNA 1XFWO 1JF2A 1G8IA 2KOTA 4MZJA 1S6IA 5GQQC 4USLA 5HYDA 2MA2A 3WHUB 4M2PA 1QV0A 2JT0A 2KI4B 1CM1A 1KK8B 2F2OA 3TUYC 3VRNA 2M1UA 1SRAA 4GPLB 1KQMB 3CGAA 4PHMA 1DJIA 1F71A 3GK4X 1S5GY 2ISDA 2M49B 1OMRA 3GK1A 3LK1A 1QX2A 1CNPA 1KSOA 1BJFA 1QLSA 2GGZA 1UHIA 3EVVA 4DRWA 1CLBA 4WQ2A 1DJXA 3VRPA 4ZCVA 1SW8A 1IJ5A 1MUXA 1PULA 2JNXA 1PALA 2TN4A 2OS8B 1RK9A 4TNCA 1SR6C 2SCPA 1EXRA 1OE9B 1B9AA 1A2XA 1CMFA 1DJWA 2L98A 1OOJA 3EVUA 3I5GB 1Q80A 2MRDA 3TS5B 2PRUA 2PVBA 4OR9B 1CMGA 4XJKA 1LVCD 1Y6WA 1DJGA 2BBMA 4DCKA 2K7DA 2L50A 1ZFSA 2L0PA 1B8CA 3F45A 1L2OC 1KK7Y 5B8IB 2OTGB 3PM8A 1SCMC 1ZMZA 3NSKA 1AJ4A 2LLUA 3D10A 1MXEA 1X02A 3CS1A 2E30A 3TDZA 4MN0A 1C07A 1B8RA 2E6WA 3CLNA 1BOCA 2B1UA 3EK8A 2KNEA 3O78A 1BODA 4CFRA 1UHJA 1R2UA 2I94A 1SL7A 2JNFA 2JPTA 2KHNA 2LVJA 1F70A 2GGMA 3OB2B 4GBAA 1ALWA 5IBWA 4IL1A 3TDUA 2LP3A 1TNQA 2ZNEA 3AAKA 1K2HA 1NCXA 2LC5A 4F0ZB 5CSNA 2F2PA 1EJ3A 2JU0A 1IRJA 1K93D 2PSRA 1A4PA 1JSAA 5TNCA 3IQQA 2BBNA 2CBLA 5AFPA 1IKUA 1QTXA 4MSPA 4OV2A 2WORA 1QS7A 4MRYA 5HKWA 1SBJA 2HQWA 4PE1A 1DMOA 2BCXA 5D69A 3QRXA 1CLLA 1W7JB 4OKHA 2JTZA 1SY9A 2QACA 3BUOB 1FF1A 3DVEA 1DVIA 2K2FA 1KFXL 3I5IC 1IJ6A 2WCBA 4L9MA 1TOPA 4M2QA 5I8NA 1QIVA 2HETA 1JFKA 2FJUB 1KFXS 2WNDA 1XK4A 2KFHA 3CZTX 3JVTB 3WHTB 4PHNA 2EHBA 2Y1NA 2IS9A 1OMVA 4ICBA 1EG4A 1CKKA 1YVLA 4YI9A 4YGEB 1RECA 2EGDA 1AHRA 2M7NA 3SIBA 2KYFA 2Q91A 1S26D 1KSMA 1CDPA 4P5OE 1K8UA 2CT9A 2M1KB 1OZSA 2AMIA 1Y0VH 1CM4A 2K8MB 4HRHA 2MJWB 1RJVA 1MQ1A 1RWYA 2LVVA 1MXLC 1TIZA 3A4UB 2EC6C 4HSZA 1YUUA 4QJ5B 3NSIA 4E68A 1PVAA 1GQMA 2A4JA 4NDBA 2KAYA 1HQVA 4MLWA 5CPVA 1ZUZA 1K94A 3AKBA 1Y1AA 1S1EA 2DOQA 2OPOA 2K7BA 3BXKA 1FBVA 1CDLA 2PALA 1H8BA 1XO5A 1OMDA 1YTZC 2BL0C 4JPZB 1DTLA 1TNXA 1IQ3A 1U5IB 1TN4A 1E8AA 1XFZO 3BOWB 4R1EA 2Y5IA 3PN7C 4HRGA 4AOMA 1CLMA 1MR8A 3I5HC 2QPTA 1KK7Z 3OX5A 3VGOA 4GGFA 4HREE 4MZKA 2LV7A 1LA0A 3PALA 4XYNA 3I5FB 1CFPA 1J55A 2F3YA 5J3XA 1N0YA 3WXAA 1BR4B 2LVKA 1MF8B 3KO0A 4D1EA 2JT8A 4GGNA 2KFFA 4PE4A 3IQOA 5KSZA 1B7TY 1NUBA 2CTNA 5DKRA 5CSJA 1CDNA 4N5XA 1Y1XA 2LHLA 5F6TA 2F8PA 1UURA 1WY9A 2LE9B 1Y1UA 4UPGA 2JXLA 2LAPA 3WNXB 1F55A 5I2QA 2H2KA 3HCMA 2LLTA 1NCZA 1WDCB 3CTNA 1K9UA 2H61A 2HPSA 2MAZA 3OP0A 4GAOA 1S3PA 1OSAA 1JFJA 1B4CA 1BMOA 3SJSA 2ZRTA 5I2OA 1UHNA 1QATA 2M9GA 3VRQA 1CFCA 2HQ8A 1IG5A 1RROA 2CXJA 1BT6A 4P2YB 1NPQA 4I5JA 2LM5A 1QXPA 1FPWA 1PK0D 3CR4X 1AK8A 3D0YB 2SASA 2NZ0A 4GUKA 2LCPA 1J7RA 3NSOA 2CNPA 2M3WA 2K61A 3O6BA 5HKYA 2JQ6A 1LINA 1LXFC 3SIAA 1PVBA 4FTGA 2K0JA 2RGIA 1EG3A 1IWQA 1YR5A 3FWCA 1EL4A 1SL8A 2BE6A 1DT7B 5AERA 2BL0B 1ZACA 1RTP1 2O5GA 2CCMA 1ODBA 3TDIA 2F33A 4I5LB 1SKTA 5KTYA 2D8NA 4FQOA 1JBAA 1F54A 1NSHA 2LP2A 4PE0A 2K7OA 4PDZA 1GGWA 2KAVA 3TUYB 2FCDA 5JOLA 3EKHA 4ZCUA 4GGFC 1S6CA 1B8LA 3PSRA 1TCFA 1VRKA 4BY5A 1K96A 1F8HA 3PATA 3KF9A 4N1GA 2VRGA 5I2LA 1J7QA 4MEWA 1A29A 1MHOA 1XFYO 4YGDB 1BLQA 2KQYA 3JTDC 2KI4C 1NX1A 1KK8C 1XFUO 5AXIA 2MLFC 1G33A 4MVFA 2GV5A 3LL8B 1TNWA 4OVNF 1SR6B 1DJHA 1D1OA 2JZIA 1K95A 3C1VA 1JC2A 2KFGA 2L4HA 3ZNIA 2F3ZA 1R6PA 1YVHA 4DS7A 3H4SE 1JWDA 4U8DA 2NLNA 3KPXA 1AP4A 3EK7A 4ORCB 1B7TZ 2O60A 1YX8A 4DIRA 2I18A 1DF0B 2HF5A 3EKJA 2LVIA 2L4IA 1DJZA 3DVJA 1BG1A 3TZ1A 2OS8C 1K9PA 1FI5A 1QLKA 1WLMA 5DKQA 3SG3A 2KBIA 1L7ZA 2L51A 4YGCB 2AUCA 2LMUA 2NCOA 1J1EA 4QJ3B 3DF0B 4JQ0D 1L2OB 1K90D 1SCMB 1WRZA 2JT3A 3I5GC 4YRUA 1M63B 1DGVA 2P6BB 4MRXA 1JUOA 1XVJA 2KAXA 2M7LA 1QX7A 3GK2A 1W7IB 5D7FA 1WRKA 1QX5B 1UHHA 3RM1A 3VRRA 1H4BA 1ZOTB 1CB1A 2BCBA 2FCEA 5JJGA 1PRWA 3RLZA 3BUNB 3LLEA 4PALA 2WOSA 2COLB 2ZN8A 3IF7A 3NSLA 3M0WA 1KFUS 2BECA 4C0JA 4CIDA 1U5IA 4WRIA 2JC2A 2KYCA 4BY4A 5KU1A 1SL9A 3A8RA 1YX7A 3BOWA 1KCYA 2I2RE 2KDHA 1XFVO 3LK0A 1NX0A 1AUIB 1TNPA 1QIWA 4M2OA 4GNKB 5ER5A 4ORBB 5PALA 1IQ5A 1K9KA 1XYDA 1NWDA 2JULA 2BKIB 1OZOA 2ZKMX 3FIAA 4CFQA 3SG5A 2M8UA 3I5IB 3K21A 4I5NB 3JTDB 4YBHB 1OQPA 2JXCA 1EH2A 3KHEA 2BKHB 1PSRA 1S6JA 3BQ3A 1QASA 1SK6D 1J1DA 2LNKA 1SCVA 1XK4C 4GFTA 4C0LA 1LKJA 1A75B 1YUTA 1TTXA 1UP5A 1M46A 1QVIZ 3AKAA 2BE4A 4MBEA 3PFVA 1KWOC 1UUSA 1WRLA 1G4YR 3CR5X 3EK4A 3FWBA 2K2AA 3OX6A 1SPYA 3OHMB 5AANA 1S36A 3JVTC 1CFDA 4CPVA 2ZN9A 3BUMB 2EC6B 1M45A 2M29A 3VROA 1A75A 3BUXB 4YGBB 2JWWA 4WQ3A 4A4CA 2LLSA 1CFFA 1YRUB 4XJKB 3DVKA 2G9BA 2AAOA 1PSBA 2MBXA 2ZNDA 3E3RA 3D0YA
chains in the Genus database with same CATH superfamily
1V1GA 4Q04A 2LMTA 3S0BA 1GGZA 1OOFA 5K89A 3O2PA 2ZFDA 2YGUA 3LCPC 1B47A 3KEVA 1M31A 3PN7B 1NYAA 4OCIA 1GJYA 1TWOA 3I5HB 4JKTA 1DC1A 1JF0A 1UWOA 3SG2A 1J7OA 2LANA 5HLOA 1KQVA 1XFRA 3OB1B 2Q4UA 4CLNA 1FI6A 2WCEA 5CSFA 4MZLA 4NQGA 1CTRA 1BU3A 5CSIA 1B1GA 3BYAA 4PHKA 1NX3A 3DVMA 2L2EA 3FS7A 1ALVA 1N2DA 2KGRA 1QVIY 4AQJA 2MHHA 5AEQA 4AQIA 1TRFA 4PHJA 2Y4QA 2K60A 3RZSA 1FW4A 5G08A 4QJ4B 2I7AA 5HLVA 2KGBC 1YUSA 3S0EA 1IGVA 3I5FC 4NDDA 1C7WA 1KQMC 2JTTA 2ZRSA 3CZ0A 3NXAA 3S0GA 2BCAA 3O4YA 1SNLA 4DUQA 4I5KA 5FI2A 2KI6C 2KPHA 2LUCA 1RFJA 2KSPA 4IJ7A 2KQ6A 2M0RA 1A03A 1NX2A 2PMYA 1AVSA 1N65A 1SMGA 2JRFA 5ER4X 4PE7A 4ETOA 3BUWB 3L4LA 2H61C 1UHKA 1KWOB 5FYXA 4YI8A 5I94A 1IH0A 3Q8IA 3N7HA 1SYMA 1DF0A 5DKNA 2K7CA 3SG4A 1WDCC 1M39A 1QJTA 1S5GZ 1XA5A 1BF5A 3TS5C 1T14A 3SS3A 1DGUA 2KBMA 3HX4A 2LMVA 1YRTB 3GOFA 4N1FA 1BR1B 1NIWA 3CABA 3SG6A 1F4OA 1SSEB 1TUJA 3AAJA 3DF0A 1J7PA 3B7AA 1V1FA 2JOJA 2FOTA 5BPJA 2NCPA 1NP8A 4C0KA 3ICBA 2M97A 2V53A 1TCOB 2LUXA 4JWQA 1CDMA 2OTGC 2LHIA 2NXQA 3EVRA 1KFUL 3DD4A 2WC8A 3BFAA 3ZWHA 1YURA 3DYEA 1F4QA 3MSEB 3R1OA 1C7VA 1QV1A 2KI6D 3CR2A 2Y1MA 1NCYA 2KLDA 2PASA 1XFXO 1DJYA 2QEHA 2R2IA 4ORAB 2L5XB 1HT9A 5HKZA 1WLZA 4A4BA 2MLEC 3CWGA 1LA3A 3B87A 4YGAA 3PLFB 4PCWA 1AJ5A 2WCFA 2G2BA 3CYZA 4NDCA 3SG7A 1MWNA 3SS4A 1XFWO 1JF2A 1G8IA 2KOTA 4MZJA 1S6IA 5GQQC 4USLA 5HYDA 2MA2A 3WHUB 5D3OA 4M2PA 1QV0A 2JT0A 2KI4B 2WC5A 1CM1A 1KK8B 2F2OA 4KYNA 3VRNA 3TUYC 2M1UA 1SRAA 3DXLA 4GPLB 1KQMB 2QEBA 3CGAA 4PHMA 1DJIA 1F71A 3GK4X 1S5GY 2ISDA 2M49B 1OMRA 3DZTA 3GK1A 3LK1A 1QX2A 1CNPA 1KSOA 1BJFA 1QLSA 2GGZA 1UHIA 3EVVA 4DRWA 1CLBA 2WCJA 4WQ2A 1DJXA 3VRPA 4ZCVA 1SW8A 1IJ5A 1MUXA 1PULA 2JNXA 1PALA 3FE6A 2TN4A 2OS8B 1RK9A 3D78A 4TNCA 1SR6C 2SCPA 1OOIX 2WC6A 1EXRA 1OE9B 1B9AA 3L4AA 1A2XA 1CMFA 1DJWA 2L98A 1OOJA 3EVUA 3I5GB 3PJIA 1Q80A 2MRDA 3TS5B 2PRUA 2PVBA 4OR9B 1CMGA 4XJKA 1LVCD 1Y6WA 1DJGA 2BBMA 4DCKA 2K7DA 2L50A 1ZFSA 1C3YA 2L0PA 1B8CA 3F45A 1L2OC 1KK7Y 5B8IB 2OTGB 3PM8A 1SCMC 1ZMZA 3NSKA 1AJ4A 2LLUA 3D10A 2BNXA 1MXEA 1X02A 3CS1A 2E30A 3TDZA 4MN0A 3EG5B 1B8RA 2E6WA 3CLNA 4OZDA 1C07A 2B1UA 1BOCA 3EK8A 2KNEA 3O78A 1BODA 4CFRA 1UHJA 1R2UA 2I94A 1SL7A 2JNFA 2JPTA 2KHNA 2LVJA 1F70A 2GGMA 3OB2B 4GBAA 1ALWA 3FE8A 5IBWA 4IL1A 3TDUA 2LP3A 2P71A 1TNQA 2ZNEA 3AAKA 1K2HA 1NCXA 2LC5A 4F0ZB 5CSNA 5FI7A 2F2PA 3SS5A 1QWVA 1EJ3A 2JU0A 1IRJA 1K93D 2PSRA 1A4PA 1JSAA 5TNCA 3IQQA 2BBNA 2CBLA 5AFPA 3BJHA 1IKUA 3R1PA 1QTXA 2L5YA 4MSPA 4OV2A 2WORA 1QS7A 4MRYA 5HKWA 1SBJA 2HQWA 4PE1A 1DMOA 2BCXA 5D69A 3QRXA 1CLLA 1W7JB 4OKHA 2JTZA 1SY9A 2QACA 3BUOB 3B6XA 1FF1A 3DVEA 1DVIA 2K2FA 1KFXL 2QDIA 1IJ6A 2WCBA 1DEKA 1TOPA 3I5IC 4L9MA 4M2QA 5I8NA 2WCHA 1QIVA 2HETA 1JFKA 2FJUB 1KFXS 2WNDA 1XK4A 2KFHA 3CZTX 2PQLA 3JVTB 3WHTB 4PHNA 2EHBA 2Y1NA 2IS9A 1Z4HA 1OMVA 4ICBA 1EG4A 1CKKA 1YVLA 4YI9A 4YGEB 1RECA 2EGDA 1AHRA 2M7NA 3PM2A 2KYFA 3SIBA 2Q91A 1S26D 1KSMA 1CDPA 4P5OE 1K8UA 2P70A 2CT9A 2M1KB 1OZSA 2AMIA 1Y0VH 1CM4A 2K8MB 4HRHA 2MJWB 2H8VA 1RJVA 1MQ1A 1RWYA 2FJYA 2LVVA 4F7FA 1MXLC 1TIZA 3A4UB 3B88A 2EC6C 3CZ2A 1YUUA 4HSZA 4QJ5B 3NSIA 4E68A 1PVAA 2L2CA 1GQMA 2A4JA 4NDBA 1OW4A 1HQVA 2KAYA 4MLWA 1ZUZA 5CPVA 1K94A 3AKBA 1Y1AA 1S1EA 3R72A 2DOQA 2OPOA 2K7BA 1W9ZA 1Z2CB 3BXKA 1FBVA 1CDLA 2PALA 1H8BA 1XO5A 1OMDA 1YTZC 2BL0C 3BFHA 4JPZB 1DTLA 1TNXA 1IQ3A 1U5IB 1TN4A 1E8AA 3OBVA 1XFZO 3BOWB 4R1EA 2Y5IA 3PN7C 4HRGA 4AOMA 1CLMA 1MR8A 2KLEA 3I5HC 2QPTA 1KK7Z 3OX5A 3VGOA 4GGFA 4HREE 4MZKA 2LV7A 1LA0A 3PALA 4XYNA 3I5FB 1CFPA 1J55A 2F3YA 5J3XA 1N0YA 3WXAA 1BR4B 2LVKA 1MF8B 3KO0A 4D1EA 2JT8A 4GGNA 2KFFA 4PE4A 3IQOA 5KSZA 1B7TY 1NUBA 2CTNA 3B86A 5DKRA 5CSJA 1CDNA 4N5XA 1Y1XA 2LHLA 5F6TA 2F8PA 1UURA 1WY9A 2LE9B 1Y1UA 3V2LA 4UPGA 2JXLA 2LAPA 3WNXB 1F55A 5I2QA 4PT1A 2H2KA 3HCMA 2BAPA 2LLTA 1NCZA 1WDCB 3CTNA 1DQEA 1K9UA 1TUZA 2H61A 2HPSA 2MAZA 3OP0A 1S3PA 1OSAA 4GAOA 1JFJA 1B4CA 1BMOA 3SJSA 2ZRTA 5I2OA 1UHNA 1QATA 2M9GA 3VRQA 1CFCA 2HQ8A 1IG5A 1RROA 2CXJA 1BT6A 4P2YB 1NPQA 3S0AA 4I5JA 2LM5A 1QXPA 1FPWA 1PK0D 3CR4X 1AK8A 3D0YB 2SASA 2NZ0A 4GUKA 2LCPA 1J7RA 3NSOA 3D76A 2CNPA 2M3WA 2QEVA 2K61A 3O6BA 3K1EA 5HKYA 2JQ6A 1LINA 1LXFC 1LS8A 3SIAA 1PVBA 4FTGA 2K0JA 2RGIA 1EG3A 1IWQA 1YR5A 3FWCA 1EL4A 1SL8A 2BE6A 1DT7B 5AERA 2BL0B 1ZACA 1RTP1 2O5GA 2CCMA 4FQTA 1ODBA 3TDIA 2F33A 4I5LB 1GM0A 1SKTA 5KTYA 2D8NA 4FQOA 1JBAA 1F54A 1NSHA 2LP2A 4PE0A 2K7OA 4PDZA 3L47A 1GGWA 2KAVA 3TUYB 2FCDA 5JOLA 3EKHA 4ZCUA 4GGFC 1S6CA 1P28A 3D77A 1B8LA 3PSRA 1TCFA 1OOGA 1VRKA 4BY5A 1K96A 1F8HA 3IVTA 2WCKA 3PATA 3KF9A 4N1GA 2VRGA 3O4XA 5I2LA 1J7QA 4MEWA 1A29A 1MHOA 1XFYO 4YGDB 1BLQA 2KQYA 3JTDC 2KI4C 4INXA 1NX1A 1KK8C 1XFUO 5AXIA 2MLFC 1G33A 4MVFA 1C3ZA 2GV5A 3LL8B 3UO9A 1TNWA 4OVNF 1SR6B 1DJHA 3S0DA 1D1OA 2JZIA 1K95A 3C1VA 1JC2A 2KFGA 2L4HA 3ZNIA 2F3ZA 1R6PA 1YVHA 4DS7A 3H4SE 2WCLA 1JWDA 4U8DA 2NLNA 3KPXA 1AP4A 3EK7A 4ORCB 1B7TZ 2O60A 1YX8A 4DIRA 2I18A 1DF0B 2HF5A 3EKJA 2LVIA 2L4IA 1DJZA 3DVJA 1BG1A 3TZ1A 2OS8C 3BFBA 3VB1A 1K9PA 5DICA 1FI5A 1QLKA 1WLMA 5DKQA 3SG3A 2KBIA 1L7ZA 2L51A 4YGCB 2AUCA 3FE9A 2LMUA 2NCOA 1J1EA 4QJ3B 5HL1A 3DF0B 4JQ0D 1L2OB 3OGNA 3S0FA 1K90D 1SCMB 1WRZA 2JT3A 3I5GC 4YRUA 1M63B 1DGVA 2P6BB 2WCMA 4MRXA 1JUOA 1XVJA 2KAXA 2ERBA 2M7LA 1OOHA 1QX7A 3GK2A 1W7IB 5D7FA 1WRKA 1QX5B 1UHHA 3RM1A 3VRRA 1H4BA 1ZOTB 3CDNA 1CB1A 2BCBA 2FCEA 3DY9A 5JJGA 1PRWA 3RLZA 3D74A 3BUNB 3LLEA 4PALA 2WOSA 2COLB 2ZN8A 3IF7A 3NGVA 3M0WA 3NSLA 3QMEA 1IIOA 3UNWA 1KFUS 2BECA 4C0JA 4CIDA 1U5IA 4WRIA 2JC2A 2KYCA 4BY4A 3NHTA 5KU1A 1SL9A 3A8RA 1YX7A 3BOWA 1KCYA 2I2RE 2KDHA 1XFVO 3LK0A 1NX0A 5EL2A 1AUIB 1TNPA 1QIWA 4M2OA 4GNKB 5ER5A 4ORBB 5PALA 1IQ5A 1K9KA 1XYDA 1NWDA 2JULA 2BKIB 1OZOA 2ZKMX 3FIAA 3D73A 4CFQA 3SG5A 2M8UA 3I5IB 3K21A 1ORGA 4I5NB 3JTDB 4JD9A 4YBHB 1OQPA 2JXCA 3NHIA 1EH2A 3KHEA 3D75A 2BKHB 1PSRA 1S6JA 3BQ3A 1QASA 1SK6D 3CZ1A 1J1DA 2LNKA 1SCVA 5FI6A 1XK4C 4GFTA 4C0LA 1LKJA 1A75B 1YUTA 1TTXA 1UP5A 2GTEA 1M46A 1QVIZ 3AKAA 2BE4A 4INWA 4MBEA 3PFVA 1KWOC 1UUSA 1WRLA 1G4YR 3CR5X 3EK4A 3FWBA 2K2AA 3OX6A 1SPYA 3OHMB 5AANA 1S36A 3JVTC 1CFDA 4CPVA 2PYQA 2ZN9A 3BUMB 2EC6B 1M45A 2M29A 3VROA 1A75A 3BUXB 4YGBB 2JWWA 4WQ3A 4A4CA 2LLSA 3R1VA 1CFFA 2JPOA 1YRUB 4XJKB 3DVKA 2G9BA 1DELA 2AAOA 1PSBA 2MBXA 2ZNDA 3E3RA 2QEOA 3D0YA
chains in the Genus database with same CATH topology
1V1GA 4Q04A 2LMTA 1GGZA 5K89A 3O2PA 2ZFDA 3LCPC 1B47A 3KEVA 1M31A 3PN7B 1NYAA 4OCIA 1GJYA 3I5HB 1JF0A 1UWOA 3SG2A 1J7OA 2LANA 5HLOA 1KQVA 3OB1B 2Q4UA 4CLNA 1FI6A 2WCEA 5CSFA 4MZLA 4NQGA 1CTRA 1BU3A 5CSIA 1B1GA 3BYAA 4PHKA 1NX3A 3DVMA 2L2EA 3FS7A 1ALVA 1N2DA 2KGRA 1QVIY 4AQJA 2MHHA 5AEQA 4AQIA 1TRFA 4PHJA 2Y4QA 1FW4A 5G08A 4QJ4B 2I7AA 5HLVA 2KGBC 1YUSA 1IGVA 3I5FC 4NDDA 1C7WA 1KQMC 2JTTA 2ZRSA 3NXAA 2BCAA 3O4YA 1SNLA 4DUQA 4I5KA 2KI6C 2LUCA 1RFJA 2KSPA 2KQ6A 2M0RA 1A03A 1NX2A 2PMYA 1AVSA 1N65A 1SMGA 2JRFA 5ER4X 4PE7A 4ETOA 3BUWB 2H61C 1UHKA 1KWOB 5FYXA 4YI8A 1IH0A 1SYMA 1DF0A 5DKNA 2K7CA 3SG4A 1WDCC 1M39A 1QJTA 1S5GZ 1XA5A 3TS5C 1DGUA 2KBMA 3HX4A 2LMVA 1YRTB 3GOFA 4N1FA 1BR1B 1NIWA 3SG6A 1F4OA 3AAJA 3DF0A 1J7PA 1V1FA 2JOJA 2FOTA 5BPJA 2NCPA 1NP8A 4C0KA 3ICBA 2M97A 2V53A 1TCOB 2LUXA 4JWQA 1CDMA 2OTGC 2LHIA 2NXQA 3EVRA 1KFUL 3DD4A 2WC8A 3ZWHA 1BF5A 1YURA 1F4QA 3MSEB 1C7VA 1QV1A 2KI6D 3CR2A 2Y1MA 1NCYA 2PASA 1XFXO 1DJYA 2R2IA 4ORAB 2L5XB 1HT9A 5HKZA 1WLZA 4A4BA 2MLEC 3CWGA 1LA3A 4YGAA 3PLFB 4PCWA 1AJ5A 2WCFA 2G2BA 4NDCA 3SG7A 1MWNA 1XFWO 1JF2A 1G8IA 2KOTA 4MZJA 1S6IA 5GQQC 4USLA 5HYDA 2MA2A 3WHUB 4M2PA 1QV0A 2JT0A 2KI4B 1CM1A 1KK8B 2F2OA 3TUYC 3VRNA 2M1UA 1SRAA 4GPLB 1KQMB 3CGAA 4PHMA 1DJIA 1F71A 3GK4X 1S5GY 2ISDA 2M49B 1OMRA 3GK1A 3LK1A 1QX2A 1CNPA 1KSOA 1BJFA 1QLSA 2GGZA 1UHIA 3EVVA 4DRWA 1CLBA 4WQ2A 1DJXA 3VRPA 4ZCVA 1SW8A 1IJ5A 1MUXA 1PULA 2JNXA 1PALA 2TN4A 2OS8B 1RK9A 4TNCA 1SR6C 2SCPA 1EXRA 1OE9B 1B9AA 1A2XA 1CMFA 1DJWA 2L98A 1OOJA 3EVUA 3I5GB 1Q80A 2MRDA 3TS5B 2PRUA 2PVBA 4OR9B 1CMGA 4XJKA 1LVCD 1Y6WA 1DJGA 2BBMA 4DCKA 2K7DA 2L50A 1ZFSA 2L0PA 1B8CA 3F45A 1L2OC 1KK7Y 5B8IB 2OTGB 3PM8A 1SCMC 1ZMZA 3NSKA 1AJ4A 2LLUA 3D10A 1MXEA 1X02A 3CS1A 2E30A 3TDZA 4MN0A 1C07A 1B8RA 2E6WA 3CLNA 1BOCA 2B1UA 3EK8A 2KNEA 3O78A 1BODA 4CFRA 1UHJA 1R2UA 2I94A 1SL7A 2JNFA 2JPTA 2KHNA 2LVJA 1F70A 2GGMA 3OB2B 4GBAA 1ALWA 5IBWA 4IL1A 3TDUA 2LP3A 1TNQA 2ZNEA 3AAKA 1K2HA 1NCXA 2LC5A 4F0ZB 5CSNA 2F2PA 1EJ3A 2JU0A 1IRJA 1K93D 2PSRA 1A4PA 1JSAA 5TNCA 3IQQA 2BBNA 2CBLA 5AFPA 1IKUA 1QTXA 4MSPA 4OV2A 2WORA 1QS7A 4MRYA 5HKWA 1SBJA 2HQWA 4PE1A 1DMOA 2BCXA 5D69A 3QRXA 1CLLA 1W7JB 4OKHA 2JTZA 1SY9A 2QACA 3BUOB 1FF1A 3DVEA 1DVIA 2K2FA 1KFXL 3I5IC 1IJ6A 2WCBA 4L9MA 1TOPA 4M2QA 5I8NA 1QIVA 2HETA 1JFKA 2FJUB 1KFXS 2WNDA 1XK4A 2KFHA 3CZTX 3JVTB 3WHTB 4PHNA 2EHBA 2Y1NA 2IS9A 1OMVA 4ICBA 1EG4A 1CKKA 1YVLA 4YI9A 4YGEB 1RECA 2EGDA 1AHRA 2M7NA 3SIBA 2KYFA 2Q91A 1S26D 1KSMA 1CDPA 4P5OE 1K8UA 2CT9A 2M1KB 1OZSA 2AMIA 1Y0VH 1CM4A 2K8MB 4HRHA 2MJWB 1RJVA 1MQ1A 1RWYA 2LVVA 1MXLC 1TIZA 3A4UB 2EC6C 4HSZA 1YUUA 4QJ5B 3NSIA 4E68A 1PVAA 1GQMA 2A4JA 4NDBA 2KAYA 1HQVA 4MLWA 5CPVA 1ZUZA 1K94A 3AKBA 1Y1AA 1S1EA 2DOQA 2OPOA 2K7BA 3BXKA 1FBVA 1CDLA 2PALA 1H8BA 1XO5A 1OMDA 1YTZC 2BL0C 4JPZB 1DTLA 1TNXA 1IQ3A 1U5IB 1TN4A 1E8AA 1XFZO 3BOWB 4R1EA 2Y5IA 3PN7C 4HRGA 4AOMA 1CLMA 1MR8A 3I5HC 2QPTA 1KK7Z 3OX5A 3VGOA 4GGFA 4HREE 4MZKA 2LV7A 1LA0A 3PALA 4XYNA 3I5FB 1CFPA 1J55A 2F3YA 5J3XA 1N0YA 3WXAA 1BR4B 2LVKA 1MF8B 3KO0A 4D1EA 2JT8A 4GGNA 2KFFA 4PE4A 3IQOA 5KSZA 1B7TY 1NUBA 2CTNA 5DKRA 5CSJA 1CDNA 4N5XA 1Y1XA 2LHLA 5F6TA 2F8PA 1UURA 1WY9A 2LE9B 1Y1UA 4UPGA 2JXLA 2LAPA 3WNXB 1F55A 5I2QA 2H2KA 3HCMA 2LLTA 1NCZA 1WDCB 3CTNA 1K9UA 2H61A 2HPSA 2MAZA 3OP0A 4GAOA 1S3PA 1OSAA 1JFJA 1B4CA 1BMOA 3SJSA 2ZRTA 5I2OA 1UHNA 1QATA 2M9GA 3VRQA 1CFCA 2HQ8A 1IG5A 1RROA 2CXJA 1BT6A 4P2YB 1NPQA 4I5JA 2LM5A 1QXPA 1FPWA 1PK0D 3CR4X 1AK8A 3D0YB 2SASA 2NZ0A 4GUKA 2LCPA 1J7RA 3NSOA 2CNPA 2M3WA 2K61A 3O6BA 5HKYA 2JQ6A 1LINA 1LXFC 3SIAA 1PVBA 4FTGA 2K0JA 2RGIA 1EG3A 1IWQA 1YR5A 3FWCA 1EL4A 1SL8A 2BE6A 1DT7B 5AERA 2BL0B 1ZACA 1RTP1 2O5GA 2CCMA 1ODBA 3TDIA 2F33A 4I5LB 1SKTA 5KTYA 2D8NA 4FQOA 1JBAA 1F54A 1NSHA 2LP2A 4PE0A 2K7OA 4PDZA 1GGWA 2KAVA 3TUYB 2FCDA 5JOLA 3EKHA 4ZCUA 4GGFC 1S6CA 1B8LA 3PSRA 1TCFA 1VRKA 4BY5A 1K96A 1F8HA 3PATA 3KF9A 4N1GA 2VRGA 5I2LA 1J7QA 4MEWA 1A29A 1MHOA 1XFYO 4YGDB 1BLQA 2KQYA 3JTDC 2KI4C 1NX1A 1KK8C 1XFUO 5AXIA 2MLFC 1G33A 4MVFA 2GV5A 3LL8B 1TNWA 4OVNF 1SR6B 1DJHA 1D1OA 2JZIA 1K95A 3C1VA 1JC2A 2KFGA 2L4HA 3ZNIA 2F3ZA 1R6PA 1YVHA 4DS7A 3H4SE 1JWDA 4U8DA 2NLNA 3KPXA 1AP4A 3EK7A 4ORCB 1B7TZ 2O60A 1YX8A 4DIRA 2I18A 1DF0B 2HF5A 3EKJA 2LVIA 2L4IA 1DJZA 3DVJA 1BG1A 3TZ1A 2OS8C 1K9PA 1FI5A 1QLKA 1WLMA 5DKQA 3SG3A 2KBIA 1L7ZA 2L51A 4YGCB 2AUCA 2LMUA 2NCOA 1J1EA 4QJ3B 3DF0B 4JQ0D 1L2OB 1K90D 1SCMB 1WRZA 2JT3A 3I5GC 4YRUA 1M63B 1DGVA 2P6BB 4MRXA 1JUOA 1XVJA 2KAXA 2M7LA 1QX7A 3GK2A 1W7IB 5D7FA 1WRKA 1QX5B 1UHHA 3RM1A 3VRRA 1H4BA 1ZOTB 1CB1A 2BCBA 2FCEA 5JJGA 1PRWA 3RLZA 3BUNB 3LLEA 4PALA 2WOSA 2COLB 2ZN8A 3IF7A 3NSLA 3M0WA 1KFUS 2BECA 4C0JA 4CIDA 1U5IA 4WRIA 2JC2A 2KYCA 4BY4A 5KU1A 1SL9A 3A8RA 1YX7A 3BOWA 1KCYA 2I2RE 2KDHA 1XFVO 3LK0A 1NX0A 1AUIB 1TNPA 1QIWA 4M2OA 4GNKB 5ER5A 4ORBB 5PALA 1IQ5A 1K9KA 1XYDA 1NWDA 2JULA 2BKIB 1OZOA 2ZKMX 3FIAA 4CFQA 3SG5A 2M8UA 3I5IB 3K21A 4I5NB 3JTDB 4YBHB 1OQPA 2JXCA 1EH2A 3KHEA 2BKHB 1PSRA 1S6JA 3BQ3A 1QASA 1SK6D 1J1DA 2LNKA 1SCVA 1XK4C 4GFTA 4C0LA 1LKJA 1A75B 1YUTA 1TTXA 1UP5A 1M46A 1QVIZ 3AKAA 2BE4A 4MBEA 3PFVA 1KWOC 1UUSA 1WRLA 1G4YR 3CR5X 3EK4A 3FWBA 2K2AA 3OX6A 1SPYA 3OHMB 5AANA 1S36A 3JVTC 1CFDA 4CPVA 2ZN9A 3BUMB 2EC6B 1M45A 2M29A 3VROA 1A75A 3BUXB 4YGBB 2JWWA 4WQ3A 4A4CA 2LLSA 1CFFA 1YRUB 4XJKB 3DVKA 2G9BA 2AAOA 1PSBA 2MBXA 2ZNDA 3E3RA 3D0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1G A;  4Q04 A;  2LMT A;  1GGZ A;  5K89 A;  3O2P A;  2ZFD A;  3LCP C;  1B47 A;  3KEV A;  1M31 A;  3PN7 B;  1NYA A;  4OCI A;  1GJY A;  3I5H B;  1JF0 A;  1UWO A;  3SG2 A;  1J7O A;  2LAN A;  5HLO A;  1KQV A;  3OB1 B;  2Q4U A;  4CLN A;  1FI6 A;  2WCE A;  5CSF A;  4MZL A;  4NQG A;  1CTR A;  1BU3 A;  5CSI A;  1B1G A;  3BYA A;  4PHK A;  1NX3 A;  3DVM A;  2L2E A;  3FS7 A;  1ALV A;  1N2D A;  2KGR A;  1QVI Y;  4AQJ A;  2MHH A;  5AEQ A;  4AQI A;  1TRF A;  4PHJ A;  2Y4Q A;  1FW4 A;  5G08 A;  4QJ4 B;  2I7A A;  5HLV A;  2KGB C;  1YUS A;  1IGV A;  3I5F C;  4NDD A;  1C7W A;  1KQM C;  2JTT A;  2ZRS A;  3NXA A;  2BCA A;  3O4Y A;  1SNL A;  4DUQ A;  4I5K A;  2KI6 C;  2LUC A;  1RFJ A;  2KSP A;  2KQ6 A;  2M0R A;  1A03 A;  1NX2 A;  2PMY A;  1AVS A;  1N65 A;  1SMG A;  2JRF A;  5ER4 X;  4PE7 A;  4ETO A;  3BUW B;  2H61 C;  1UHK A;  1KWO B;  5FYX A;  4YI8 A;  1IH0 A;  1SYM A;  1DF0 A;  5DKN A;  2K7C A;  3SG4 A;  1WDC C;  1M39 A;  1QJT A;  1S5G Z;  1XA5 A;  3TS5 C;  1DGU A;  2KBM A;  3HX4 A;  2LMV A;  1YRT B;  3GOF A;  4N1F A;  1BR1 B;  1NIW A;  3SG6 A;  1F4O A;  3AAJ A;  3DF0 A;  1J7P A;  1V1F A;  2JOJ A;  2FOT A;  5BPJ A;  2NCP A;  1NP8 A;  4C0K A;  3ICB A;  2M97 A;  2V53 A;  1TCO B;  2LUX A;  4JWQ A;  1CDM A;  2OTG C;  2LHI A;  2NXQ A;  3EVR A;  1KFU L;  3DD4 A;  2WC8 A;  3ZWH A;  1BF5 A;  1YUR A;  1F4Q A;  3MSE B;  1C7V A;  1QV1 A;  2KI6 D;  3CR2 A;  2Y1M A;  1NCY A;  2PAS A;  1XFX O;  1DJY A;  2R2I A;  4ORA B;  2L5X B;  1HT9 A;  5HKZ A;  1WLZ A;  4A4B A;  2MLE C;  3CWG A;  1LA3 A;  4YGA A;  3PLF B;  4PCW A;  1AJ5 A;  2WCF A;  2G2B A;  4NDC A;  3SG7 A;  1MWN A;  1XFW O;  1JF2 A;  1G8I A;  2KOT A;  4MZJ A;  1S6I A;  5GQQ C;  4USL A;  5HYD A;  2MA2 A;  3WHU B;  4M2P A;  1QV0 A;  2JT0 A;  2KI4 B;  1CM1 A;  1KK8 B;  2F2O A;  3TUY C;  3VRN A;  2M1U A;  1SRA A;  4GPL B;  1KQM B;  3CGA A;  4PHM A;  1DJI A;  1F71 A;  3GK4 X;  1S5G Y;  2ISD A;  2M49 B;  1OMR A;  3GK1 A;  3LK1 A;  1QX2 A;  1CNP A;  1KSO A;  1BJF A;  1QLS A;  2GGZ A;  1UHI A;  3EVV A;  4DRW A;  1CLB A;  4WQ2 A;  1DJX A;  3VRP A;  4ZCV A;  1SW8 A;  1IJ5 A;  1MUX A;  1PUL A;  2JNX A;  1PAL A;  2TN4 A;  2OS8 B;  1RK9 A;  4TNC A;  1SR6 C;  2SCP A;  1EXR A;  1OE9 B;  1B9A A;  1A2X A;  1CMF A;  1DJW A;  2L98 A;  1OOJ A;  3EVU A;  3I5G B;  1Q80 A;  2MRD A;  3TS5 B;  2PRU A;  2PVB A;  4OR9 B;  1CMG A;  4XJK A;  1LVC D;  1Y6W A;  1DJG A;  2BBM A;  4DCK A;  2K7D A;  2L50 A;  1ZFS A;  2L0P A;  1B8C A;  3F45 A;  1L2O C;  1KK7 Y;  5B8I B;  2OTG B;  3PM8 A;  1SCM C;  1ZMZ A;  3NSK A;  1AJ4 A;  2LLU A;  3D10 A;  1MXE A;  1X02 A;  3CS1 A;  2E30 A;  3TDZ A;  4MN0 A;  1C07 A;  1B8R A;  2E6W A;  3CLN A;  1BOC A;  2B1U A;  3EK8 A;  2KNE A;  3O78 A;  1BOD A;  4CFR A;  1UHJ A;  1R2U A;  2I94 A;  1SL7 A;  2JNF A;  2JPT A;  2KHN A;  2LVJ A;  1F70 A;  2GGM A;  3OB2 B;  4GBA A;  1ALW A;  5IBW A;  4IL1 A;  3TDU A;  2LP3 A;  1TNQ A;  2ZNE A;  3AAK A;  1K2H A;  1NCX A;  2LC5 A;  4F0Z B;  5CSN A;  2F2P A;  1EJ3 A;  2JU0 A;  1IRJ A;  1K93 D;  2PSR A;  1A4P A;  1JSA A;  5TNC A;  3IQQ A;  2BBN A;  2CBL A;  5AFP A;  1IKU A;  1QTX A;  4MSP A;  4OV2 A;  2WOR A;  1QS7 A;  4MRY A;  5HKW A;  1SBJ A;  2HQW A;  4PE1 A;  1DMO A;  2BCX A;  5D69 A;  3QRX A;  1CLL A;  1W7J B;  4OKH A;  2JTZ A;  1SY9 A;  2QAC A;  3BUO B;  1FF1 A;  3DVE A;  1DVI A;  2K2F A;  1KFX L;  3I5I C;  1IJ6 A;  2WCB A;  4L9M A;  1TOP A;  4M2Q A;  5I8N A;  1QIV A;  2HET A;  1JFK A;  2FJU B;  1KFX S;  2WND A;  1XK4 A;  2KFH A;  3CZT X;  3JVT B;  3WHT B;  4PHN A;  2EHB A;  2Y1N A;  2IS9 A;  1OMV A;  4ICB A;  1EG4 A;  1CKK A;  1YVL A;  4YI9 A;  4YGE B;  1REC A;  2EGD A;  1AHR A;  2M7N A;  3SIB A;  2KYF A;  2Q91 A;  1S26 D;  1KSM A;  1CDP A;  4P5O E;  1K8U A;  2CT9 A;  2M1K B;  1OZS A;  2AMI A;  1Y0V H;  1CM4 A;  2K8M B;  4HRH A;  2MJW B;  1RJV A;  1MQ1 A;  1RWY A;  2LVV A;  1MXL C;  1TIZ A;  3A4U B;  2EC6 C;  4HSZ A;  1YUU A;  4QJ5 B;  3NSI A;  4E68 A;  1PVA A;  1GQM A;  2A4J A;  4NDB A;  2KAY A;  1HQV A;  4MLW A;  5CPV A;  1ZUZ A;  1K94 A;  3AKB A;  1Y1A A;  1S1E A;  2DOQ A;  2OPO A;  2K7B A;  3BXK A;  1FBV A;  1CDL A;  2PAL A;  1H8B A;  1XO5 A;  1OMD A;  1YTZ C;  2BL0 C;  4JPZ B;  1DTL A;  1TNX A;  1IQ3 A;  1U5I B;  1TN4 A;  1E8A A;  1XFZ O;  3BOW B;  4R1E A;  2Y5I A;  3PN7 C;  4HRG A;  4AOM A;  1CLM A;  1MR8 A;  3I5H C;  2QPT A;  1KK7 Z;  3OX5 A;  3VGO A;  4GGF A;  4HRE E;  4MZK A;  2LV7 A;  1LA0 A;  3PAL A;  4XYN A;  3I5F B;  1CFP A;  1J55 A;  2F3Y A;  5J3X A;  1N0Y A;  3WXA A;  1BR4 B;  2LVK A;  1MF8 B;  3KO0 A;  4D1E A;  2JT8 A;  4GGN A;  2KFF A;  4PE4 A;  3IQO A;  5KSZ A;  1B7T Y;  1NUB A;  2CTN A;  5DKR A;  5CSJ A;  1CDN A;  4N5X A;  1Y1X A;  2LHL A;  5F6T A;  2F8P A;  1UUR A;  1WY9 A;  2LE9 B;  1Y1U A;  4UPG A;  2JXL A;  2LAP A;  3WNX B;  1F55 A;  5I2Q A;  2H2K A;  3HCM A;  2LLT A;  1NCZ A;  1WDC B;  3CTN A;  1K9U A;  2H61 A;  2HPS A;  2MAZ A;  3OP0 A;  4GAO A;  1S3P A;  1OSA A;  1JFJ A;  1B4C A;  1BMO A;  3SJS A;  2ZRT A;  5I2O A;  1UHN A;  1QAT A;  2M9G A;  3VRQ A;  1CFC A;  2HQ8 A;  1IG5 A;  1RRO A;  2CXJ A;  1BT6 A;  4P2Y B;  1NPQ A;  4I5J A;  2LM5 A;  1QXP A;  1FPW A;  1PK0 D;  3CR4 X;  1AK8 A;  3D0Y B;  2SAS A;  2NZ0 A;  4GUK A;  2LCP A;  1J7R A;  3NSO A;  2CNP A;  2M3W A;  2K61 A;  3O6B A;  5HKY A;  2JQ6 A;  1LIN A;  1LXF C;  3SIA A;  1PVB A;  4FTG A;  2K0J A;  2RGI A;  1EG3 A;  1IWQ A;  1YR5 A;  3FWC A;  1EL4 A;  1SL8 A;  2BE6 A;  1DT7 B;  5AER A;  2BL0 B;  1ZAC A;  1RTP 1;  2O5G A;  2CCM A;  1ODB A;  3TDI A;  2F33 A;  4I5L B;  1SKT A;  5KTY A;  2D8N A;  4FQO A;  1JBA A;  1F54 A;  1NSH A;  2LP2 A;  4PE0 A;  2K7O A;  4PDZ A;  1GGW A;  2KAV A;  3TUY B;  2FCD A;  5JOL A;  3EKH A;  4ZCU A;  4GGF C;  1S6C A;  1B8L A;  3PSR A;  1TCF A;  1VRK A;  4BY5 A;  1K96 A;  1F8H A;  3PAT A;  3KF9 A;  4N1G A;  2VRG A;  5I2L A;  1J7Q A;  4MEW A;  1A29 A;  1MHO A;  1XFY O;  4YGD B;  1BLQ A;  2KQY A;  3JTD C;  2KI4 C;  1NX1 A;  1KK8 C;  1XFU O;  5AXI A;  2MLF C;  1G33 A;  4MVF A;  2GV5 A;  3LL8 B;  1TNW A;  4OVN F;  1SR6 B;  1DJH A;  1D1O A;  2JZI A;  1K95 A;  3C1V A;  1JC2 A;  2KFG A;  2L4H A;  3ZNI A;  2F3Z A;  1R6P A;  1YVH A;  4DS7 A;  3H4S E;  1JWD A;  4U8D A;  2NLN A;  3KPX A;  1AP4 A;  3EK7 A;  4ORC B;  1B7T Z;  2O60 A;  1YX8 A;  4DIR A;  2I18 A;  1DF0 B;  2HF5 A;  3EKJ A;  2LVI A;  2L4I A;  1DJZ A;  3DVJ A;  1BG1 A;  3TZ1 A;  2OS8 C;  1K9P A;  1FI5 A;  1QLK A;  1WLM A;  5DKQ A;  3SG3 A;  2KBI A;  1L7Z A;  2L51 A;  4YGC B;  2AUC A;  2LMU A;  2NCO A;  1J1E A;  4QJ3 B;  3DF0 B;  4JQ0 D;  1L2O B;  1K90 D;  1SCM B;  1WRZ A;  2JT3 A;  3I5G C;  4YRU A;  1M63 B;  1DGV A;  2P6B B;  4MRX A;  1JUO A;  1XVJ A;  2KAX A;  2M7L A;  1QX7 A;  3GK2 A;  1W7I B;  5D7F A;  1WRK A;  1QX5 B;  1UHH A;  3RM1 A;  3VRR A;  1H4B A;  1ZOT B;  1CB1 A;  2BCB A;  2FCE A;  5JJG A;  1PRW A;  3RLZ A;  3BUN B;  3LLE A;  4PAL A;  2WOS A;  2COL B;  2ZN8 A;  3IF7 A;  3NSL A;  3M0W A;  1KFU S;  2BEC A;  4C0J A;  4CID A;  1U5I A;  4WRI A;  2JC2 A;  2KYC A;  4BY4 A;  5KU1 A;  1SL9 A;  3A8R A;  1YX7 A;  3BOW A;  1KCY A;  2I2R E;  2KDH A;  1XFV O;  3LK0 A;  1NX0 A;  1AUI B;  1TNP A;  1QIW A;  4M2O A;  4GNK B;  5ER5 A;  4ORB B;  5PAL A;  1IQ5 A;  1K9K A;  1XYD A;  1NWD A;  2JUL A;  2BKI B;  1OZO A;  2ZKM X;  3FIA A;  4CFQ A;  3SG5 A;  2M8U A;  3I5I B;  3K21 A;  4I5N B;  3JTD B;  4YBH B;  1OQP A;  2JXC A;  1EH2 A;  3KHE A;  2BKH B;  1PSR A;  1S6J A;  3BQ3 A;  1QAS A;  1SK6 D;  1J1D A;  2LNK A;  1SCV A;  1XK4 C;  4GFT A;  4C0L A;  1LKJ A;  1A75 B;  1YUT A;  1TTX A;  1UP5 A;  1M46 A;  1QVI Z;  3AKA A;  2BE4 A;  4MBE A;  3PFV A;  1KWO C;  1UUS A;  1WRL A;  1G4Y R;  3CR5 X;  3EK4 A;  3FWB A;  2K2A A;  3OX6 A;  1SPY A;  3OHM B;  5AAN A;  1S36 A;  3JVT C;  1CFD A;  4CPV A;  2ZN9 A;  3BUM B;  2EC6 B;  1M45 A;  2M29 A;  3VRO A;  1A75 A;  3BUX B;  4YGB B;  2JWW A;  4WQ3 A;  4A4C A;  2LLS A;  1CFF A;  1YRU B;  4XJK B;  3DVK A;  2G9B A;  2AAO A;  1PSB A;  2MBX A;  2ZND A;  3E3R A;  3D0Y A; 
#chains in the Genus database with same CATH topology
 1V1G A;  4Q04 A;  2LMT A;  3S0B A;  1GGZ A;  1OOF A;  5K89 A;  3O2P A;  2ZFD A;  2YGU A;  3LCP C;  1B47 A;  3KEV A;  1M31 A;  3PN7 B;  1NYA A;  4OCI A;  1GJY A;  1TWO A;  3I5H B;  4JKT A;  1DC1 A;  1JF0 A;  1UWO A;  3SG2 A;  1J7O A;  2LAN A;  5HLO A;  1KQV A;  1XFR A;  3OB1 B;  2Q4U A;  4CLN A;  1FI6 A;  2WCE A;  5CSF A;  4MZL A;  4NQG A;  1CTR A;  1BU3 A;  5CSI A;  1B1G A;  3BYA A;  4PHK A;  1NX3 A;  3DVM A;  2L2E A;  3FS7 A;  1ALV A;  1N2D A;  2KGR A;  1QVI Y;  4AQJ A;  2MHH A;  5AEQ A;  4AQI A;  1TRF A;  4PHJ A;  2Y4Q A;  2K60 A;  3RZS A;  1FW4 A;  5G08 A;  4QJ4 B;  2I7A A;  5HLV A;  2KGB C;  1YUS A;  3S0E A;  1IGV A;  3I5F C;  4NDD A;  1C7W A;  1KQM C;  2JTT A;  2ZRS A;  3CZ0 A;  3NXA A;  3S0G A;  2BCA A;  3O4Y A;  1SNL A;  4DUQ A;  4I5K A;  5FI2 A;  2KI6 C;  2KPH A;  2LUC A;  1RFJ A;  2KSP A;  4IJ7 A;  2KQ6 A;  2M0R A;  1A03 A;  1NX2 A;  2PMY A;  1AVS A;  1N65 A;  1SMG A;  2JRF A;  5ER4 X;  4PE7 A;  4ETO A;  3BUW B;  3L4L A;  2H61 C;  1UHK A;  1KWO B;  5FYX A;  4YI8 A;  5I94 A;  1IH0 A;  3Q8I A;  3N7H A;  1SYM A;  1DF0 A;  5DKN A;  2K7C A;  3SG4 A;  1WDC C;  1M39 A;  1QJT A;  1S5G Z;  1XA5 A;  1BF5 A;  3TS5 C;  1T14 A;  3SS3 A;  1DGU A;  2KBM A;  3HX4 A;  2LMV A;  1YRT B;  3GOF A;  4N1F A;  1BR1 B;  1NIW A;  3CAB A;  3SG6 A;  1F4O A;  1SSE B;  1TUJ A;  3AAJ A;  3DF0 A;  1J7P A;  3B7A A;  1V1F A;  2JOJ A;  2FOT A;  5BPJ A;  2NCP A;  1NP8 A;  4C0K A;  3ICB A;  2M97 A;  2V53 A;  1TCO B;  2LUX A;  4JWQ A;  1CDM A;  2OTG C;  2LHI A;  2NXQ A;  3EVR A;  1KFU L;  3DD4 A;  2WC8 A;  3BFA A;  3ZWH A;  1YUR A;  3DYE A;  1F4Q A;  3MSE B;  3R1O A;  1C7V A;  1QV1 A;  2KI6 D;  3CR2 A;  2Y1M A;  1NCY A;  2KLD A;  2PAS A;  1XFX O;  1DJY A;  2QEH A;  2R2I A;  4ORA B;  2L5X B;  1HT9 A;  5HKZ A;  1WLZ A;  4A4B A;  2MLE C;  3CWG A;  1LA3 A;  3B87 A;  4YGA A;  3PLF B;  4PCW A;  1AJ5 A;  2WCF A;  2G2B A;  3CYZ A;  4NDC A;  3SG7 A;  1MWN A;  3SS4 A;  1XFW O;  1JF2 A;  1G8I A;  2KOT A;  4MZJ A;  1S6I A;  5GQQ C;  4USL A;  5HYD A;  2MA2 A;  3WHU B;  5D3O A;  4M2P A;  1QV0 A;  2JT0 A;  2KI4 B;  2WC5 A;  1CM1 A;  1KK8 B;  2F2O A;  4KYN A;  3VRN A;  3TUY C;  2M1U A;  1SRA A;  3DXL A;  4GPL B;  1KQM B;  2QEB A;  3CGA A;  4PHM A;  1DJI A;  1F71 A;  3GK4 X;  1S5G Y;  2ISD A;  2M49 B;  1OMR A;  3DZT A;  3GK1 A;  3LK1 A;  1QX2 A;  1CNP A;  1KSO A;  1BJF A;  1QLS A;  2GGZ A;  1UHI A;  3EVV A;  4DRW A;  1CLB A;  2WCJ A;  4WQ2 A;  1DJX A;  3VRP A;  4ZCV A;  1SW8 A;  1IJ5 A;  1MUX A;  1PUL A;  2JNX A;  1PAL A;  3FE6 A;  2TN4 A;  2OS8 B;  1RK9 A;  3D78 A;  4TNC A;  1SR6 C;  2SCP A;  1OOI X;  2WC6 A;  1EXR A;  1OE9 B;  1B9A A;  3L4A A;  1A2X A;  1CMF A;  1DJW A;  2L98 A;  1OOJ A;  3EVU A;  3I5G B;  3PJI A;  1Q80 A;  2MRD A;  3TS5 B;  2PRU A;  2PVB A;  4OR9 B;  1CMG A;  4XJK A;  1LVC D;  1Y6W A;  1DJG A;  2BBM A;  4DCK A;  2K7D A;  2L50 A;  1ZFS A;  1C3Y A;  2L0P A;  1B8C A;  3F45 A;  1L2O C;  1KK7 Y;  5B8I B;  2OTG B;  3PM8 A;  1SCM C;  1ZMZ A;  3NSK A;  1AJ4 A;  2LLU A;  3D10 A;  2BNX A;  1MXE A;  1X02 A;  3CS1 A;  2E30 A;  3TDZ A;  4MN0 A;  3EG5 B;  1B8R A;  2E6W A;  3CLN A;  4OZD A;  1C07 A;  2B1U A;  1BOC A;  3EK8 A;  2KNE A;  3O78 A;  1BOD A;  4CFR A;  1UHJ A;  1R2U A;  2I94 A;  1SL7 A;  2JNF A;  2JPT A;  2KHN A;  2LVJ A;  1F70 A;  2GGM A;  3OB2 B;  4GBA A;  1ALW A;  3FE8 A;  5IBW A;  4IL1 A;  3TDU A;  2LP3 A;  2P71 A;  1TNQ A;  2ZNE A;  3AAK A;  1K2H A;  1NCX A;  2LC5 A;  4F0Z B;  5CSN A;  5FI7 A;  2F2P A;  3SS5 A;  1QWV A;  1EJ3 A;  2JU0 A;  1IRJ A;  1K93 D;  2PSR A;  1A4P A;  1JSA A;  5TNC A;  3IQQ A;  2BBN A;  2CBL A;  5AFP A;  3BJH A;  1IKU A;  3R1P A;  1QTX A;  2L5Y A;  4MSP A;  4OV2 A;  2WOR A;  1QS7 A;  4MRY A;  5HKW A;  1SBJ A;  2HQW A;  4PE1 A;  1DMO A;  2BCX A;  5D69 A;  3QRX A;  1CLL A;  1W7J B;  4OKH A;  2JTZ A;  1SY9 A;  2QAC A;  3BUO B;  3B6X A;  1FF1 A;  3DVE A;  1DVI A;  2K2F A;  1KFX L;  2QDI A;  1IJ6 A;  2WCB A;  1DEK A;  1TOP A;  3I5I C;  4L9M A;  4M2Q A;  5I8N A;  2WCH A;  1QIV A;  2HET A;  1JFK A;  2FJU B;  1KFX S;  2WND A;  1XK4 A;  2KFH A;  3CZT X;  2PQL A;  3JVT B;  3WHT B;  4PHN A;  2EHB A;  2Y1N A;  2IS9 A;  1Z4H A;  1OMV A;  4ICB A;  1EG4 A;  1CKK A;  1YVL A;  4YI9 A;  4YGE B;  1REC A;  2EGD A;  1AHR A;  2M7N A;  3PM2 A;  2KYF A;  3SIB A;  2Q91 A;  1S26 D;  1KSM A;  1CDP A;  4P5O E;  1K8U A;  2P70 A;  2CT9 A;  2M1K B;  1OZS A;  2AMI A;  1Y0V H;  1CM4 A;  2K8M B;  4HRH A;  2MJW B;  2H8V A;  1RJV A;  1MQ1 A;  1RWY A;  2FJY A;  2LVV A;  4F7F A;  1MXL C;  1TIZ A;  3A4U B;  3B88 A;  2EC6 C;  3CZ2 A;  1YUU A;  4HSZ A;  4QJ5 B;  3NSI A;  4E68 A;  1PVA A;  2L2C A;  1GQM A;  2A4J A;  4NDB A;  1OW4 A;  1HQV A;  2KAY A;  4MLW A;  1ZUZ A;  5CPV A;  1K94 A;  3AKB A;  1Y1A A;  1S1E A;  3R72 A;  2DOQ A;  2OPO A;  2K7B A;  1W9Z A;  1Z2C B;  3BXK A;  1FBV A;  1CDL A;  2PAL A;  1H8B A;  1XO5 A;  1OMD A;  1YTZ C;  2BL0 C;  3BFH A;  4JPZ B;  1DTL A;  1TNX A;  1IQ3 A;  1U5I B;  1TN4 A;  1E8A A;  3OBV A;  1XFZ O;  3BOW B;  4R1E A;  2Y5I A;  3PN7 C;  4HRG A;  4AOM A;  1CLM A;  1MR8 A;  2KLE A;  3I5H C;  2QPT A;  1KK7 Z;  3OX5 A;  3VGO A;  4GGF A;  4HRE E;  4MZK A;  2LV7 A;  1LA0 A;  3PAL A;  4XYN A;  3I5F B;  1CFP A;  1J55 A;  2F3Y A;  5J3X A;  1N0Y A;  3WXA A;  1BR4 B;  2LVK A;  1MF8 B;  3KO0 A;  4D1E A;  2JT8 A;  4GGN A;  2KFF A;  4PE4 A;  3IQO A;  5KSZ A;  1B7T Y;  1NUB A;  2CTN A;  3B86 A;  5DKR A;  5CSJ A;  1CDN A;  4N5X A;  1Y1X A;  2LHL A;  5F6T A;  2F8P A;  1UUR A;  1WY9 A;  2LE9 B;  1Y1U A;  3V2L A;  4UPG A;  2JXL A;  2LAP A;  3WNX B;  1F55 A;  5I2Q A;  4PT1 A;  2H2K A;  3HCM A;  2BAP A;  2LLT A;  1NCZ A;  1WDC B;  3CTN A;  1DQE A;  1K9U A;  1TUZ A;  2H61 A;  2HPS A;  2MAZ A;  3OP0 A;  1S3P A;  1OSA A;  4GAO A;  1JFJ A;  1B4C A;  1BMO A;  3SJS A;  2ZRT A;  5I2O A;  1UHN A;  1QAT A;  2M9G A;  3VRQ A;  1CFC A;  2HQ8 A;  1IG5 A;  1RRO A;  2CXJ A;  1BT6 A;  4P2Y B;  1NPQ A;  3S0A A;  4I5J A;  2LM5 A;  1QXP A;  1FPW A;  1PK0 D;  3CR4 X;  1AK8 A;  3D0Y B;  2SAS A;  2NZ0 A;  4GUK A;  2LCP A;  1J7R A;  3NSO A;  3D76 A;  2CNP A;  2M3W A;  2QEV A;  2K61 A;  3O6B A;  3K1E A;  5HKY A;  2JQ6 A;  1LIN A;  1LXF C;  1LS8 A;  3SIA A;  1PVB A;  4FTG A;  2K0J A;  2RGI A;  1EG3 A;  1IWQ A;  1YR5 A;  3FWC A;  1EL4 A;  1SL8 A;  2BE6 A;  1DT7 B;  5AER A;  2BL0 B;  1ZAC A;  1RTP 1;  2O5G A;  2CCM A;  4FQT A;  1ODB A;  3TDI A;  2F33 A;  4I5L B;  1GM0 A;  1SKT A;  5KTY A;  2D8N A;  4FQO A;  1JBA A;  1F54 A;  1NSH A;  2LP2 A;  4PE0 A;  2K7O A;  4PDZ A;  3L47 A;  1GGW A;  2KAV A;  3TUY B;  2FCD A;  5JOL A;  3EKH A;  4ZCU A;  4GGF C;  1S6C A;  1P28 A;  3D77 A;  1B8L A;  3PSR A;  1TCF A;  1OOG A;  1VRK A;  4BY5 A;  1K96 A;  1F8H A;  3IVT A;  2WCK A;  3PAT A;  3KF9 A;  4N1G A;  2VRG A;  3O4X A;  5I2L A;  1J7Q A;  4MEW A;  1A29 A;  1MHO A;  1XFY O;  4YGD B;  1BLQ A;  2KQY A;  3JTD C;  2KI4 C;  4INX A;  1NX1 A;  1KK8 C;  1XFU O;  5AXI A;  2MLF C;  1G33 A;  4MVF A;  1C3Z A;  2GV5 A;  3LL8 B;  3UO9 A;  1TNW A;  4OVN F;  1SR6 B;  1DJH A;  3S0D A;  1D1O A;  2JZI A;  1K95 A;  3C1V A;  1JC2 A;  2KFG A;  2L4H A;  3ZNI A;  2F3Z A;  1R6P A;  1YVH A;  4DS7 A;  3H4S E;  2WCL A;  1JWD A;  4U8D A;  2NLN A;  3KPX A;  1AP4 A;  3EK7 A;  4ORC B;  1B7T Z;  2O60 A;  1YX8 A;  4DIR A;  2I18 A;  1DF0 B;  2HF5 A;  3EKJ A;  2LVI A;  2L4I A;  1DJZ A;  3DVJ A;  1BG1 A;  3TZ1 A;  2OS8 C;  3BFB A;  3VB1 A;  1K9P A;  5DIC A;  1FI5 A;  1QLK A;  1WLM A;  5DKQ A;  3SG3 A;  2KBI A;  1L7Z A;  2L51 A;  4YGC B;  2AUC A;  3FE9 A;  2LMU A;  2NCO A;  1J1E A;  4QJ3 B;  5HL1 A;  3DF0 B;  4JQ0 D;  1L2O B;  3OGN A;  3S0F A;  1K90 D;  1SCM B;  1WRZ A;  2JT3 A;  3I5G C;  4YRU A;  1M63 B;  1DGV A;  2P6B B;  2WCM A;  4MRX A;  1JUO A;  1XVJ A;  2KAX A;  2ERB A;  2M7L A;  1OOH A;  1QX7 A;  3GK2 A;  1W7I B;  5D7F A;  1WRK A;  1QX5 B;  1UHH A;  3RM1 A;  3VRR A;  1H4B A;  1ZOT B;  3CDN A;  1CB1 A;  2BCB A;  2FCE A;  3DY9 A;  5JJG A;  1PRW A;  3RLZ A;  3D74 A;  3BUN B;  3LLE A;  4PAL A;  2WOS A;  2COL B;  2ZN8 A;  3IF7 A;  3NGV A;  3M0W A;  3NSL A;  3QME A;  1IIO A;  3UNW A;  1KFU S;  2BEC A;  4C0J A;  4CID A;  1U5I A;  4WRI A;  2JC2 A;  2KYC A;  4BY4 A;  3NHT A;  5KU1 A;  1SL9 A;  3A8R A;  1YX7 A;  3BOW A;  1KCY A;  2I2R E;  2KDH A;  1XFV O;  3LK0 A;  1NX0 A;  5EL2 A;  1AUI B;  1TNP A;  1QIW A;  4M2O A;  4GNK B;  5ER5 A;  4ORB B;  5PAL A;  1IQ5 A;  1K9K A;  1XYD A;  1NWD A;  2JUL A;  2BKI B;  1OZO A;  2ZKM X;  3FIA A;  3D73 A;  4CFQ A;  3SG5 A;  2M8U A;  3I5I B;  3K21 A;  1ORG A;  4I5N B;  3JTD B;  4JD9 A;  4YBH B;  1OQP A;  2JXC A;  3NHI A;  1EH2 A;  3KHE A;  3D75 A;  2BKH B;  1PSR A;  1S6J A;  3BQ3 A;  1QAS A;  1SK6 D;  3CZ1 A;  1J1D A;  2LNK A;  1SCV A;  5FI6 A;  1XK4 C;  4GFT A;  4C0L A;  1LKJ A;  1A75 B;  1YUT A;  1TTX A;  1UP5 A;  2GTE A;  1M46 A;  1QVI Z;  3AKA A;  2BE4 A;  4INW A;  4MBE A;  3PFV A;  1KWO C;  1UUS A;  1WRL A;  1G4Y R;  3CR5 X;  3EK4 A;  3FWB A;  2K2A A;  3OX6 A;  1SPY A;  3OHM B;  5AAN A;  1S36 A;  3JVT C;  1CFD A;  4CPV A;  2PYQ A;  2ZN9 A;  3BUM B;  2EC6 B;  1M45 A;  2M29 A;  3VRO A;  1A75 A;  3BUX B;  4YGB B;  2JWW A;  4WQ3 A;  4A4C A;  2LLS A;  3R1V A;  1CFF A;  2JPO A;  1YRU B;  4XJK B;  3DVK A;  2G9B A;  1DEL A;  2AAO A;  1PSB A;  2MBX A;  2ZND A;  3E3R A;  2QEO A;  3D0Y A; 
#chains in the Genus database with same CATH homology
 1V1G A;  4Q04 A;  2LMT A;  1GGZ A;  5K89 A;  3O2P A;  2ZFD A;  3LCP C;  1B47 A;  3KEV A;  1M31 A;  3PN7 B;  1NYA A;  4OCI A;  1GJY A;  3I5H B;  1JF0 A;  1UWO A;  3SG2 A;  1J7O A;  2LAN A;  5HLO A;  1KQV A;  3OB1 B;  2Q4U A;  4CLN A;  1FI6 A;  2WCE A;  5CSF A;  4MZL A;  4NQG A;  1CTR A;  1BU3 A;  5CSI A;  1B1G A;  3BYA A;  4PHK A;  1NX3 A;  3DVM A;  2L2E A;  3FS7 A;  1ALV A;  1N2D A;  2KGR A;  1QVI Y;  4AQJ A;  2MHH A;  5AEQ A;  4AQI A;  1TRF A;  4PHJ A;  2Y4Q A;  1FW4 A;  5G08 A;  4QJ4 B;  2I7A A;  5HLV A;  2KGB C;  1YUS A;  1IGV A;  3I5F C;  4NDD A;  1C7W A;  1KQM C;  2JTT A;  2ZRS A;  3NXA A;  2BCA A;  3O4Y A;  1SNL A;  4DUQ A;  4I5K A;  2KI6 C;  2LUC A;  1RFJ A;  2KSP A;  2KQ6 A;  2M0R A;  1A03 A;  1NX2 A;  2PMY A;  1AVS A;  1N65 A;  1SMG A;  2JRF A;  5ER4 X;  4PE7 A;  4ETO A;  3BUW B;  2H61 C;  1UHK A;  1KWO B;  5FYX A;  4YI8 A;  1IH0 A;  1SYM A;  1DF0 A;  5DKN A;  2K7C A;  3SG4 A;  1WDC C;  1M39 A;  1QJT A;  1S5G Z;  1XA5 A;  3TS5 C;  1DGU A;  2KBM A;  3HX4 A;  2LMV A;  1YRT B;  3GOF A;  4N1F A;  1BR1 B;  1NIW A;  3SG6 A;  1F4O A;  3AAJ A;  3DF0 A;  1J7P A;  1V1F A;  2JOJ A;  2FOT A;  5BPJ A;  2NCP A;  1NP8 A;  4C0K A;  3ICB A;  2M97 A;  2V53 A;  1TCO B;  2LUX A;  4JWQ A;  1CDM A;  2OTG C;  2LHI A;  2NXQ A;  3EVR A;  1KFU L;  3DD4 A;  2WC8 A;  3ZWH A;  1BF5 A;  1YUR A;  1F4Q A;  3MSE B;  1C7V A;  1QV1 A;  2KI6 D;  3CR2 A;  2Y1M A;  1NCY A;  2PAS A;  1XFX O;  1DJY A;  2R2I A;  4ORA B;  2L5X B;  1HT9 A;  5HKZ A;  1WLZ A;  4A4B A;  2MLE C;  3CWG A;  1LA3 A;  4YGA A;  3PLF B;  4PCW A;  1AJ5 A;  2WCF A;  2G2B A;  4NDC A;  3SG7 A;  1MWN A;  1XFW O;  1JF2 A;  1G8I A;  2KOT A;  4MZJ A;  1S6I A;  5GQQ C;  4USL A;  5HYD A;  2MA2 A;  3WHU B;  4M2P A;  1QV0 A;  2JT0 A;  2KI4 B;  1CM1 A;  1KK8 B;  2F2O A;  3TUY C;  3VRN A;  2M1U A;  1SRA A;  4GPL B;  1KQM B;  3CGA A;  4PHM A;  1DJI A;  1F71 A;  3GK4 X;  1S5G Y;  2ISD A;  2M49 B;  1OMR A;  3GK1 A;  3LK1 A;  1QX2 A;  1CNP A;  1KSO A;  1BJF A;  1QLS A;  2GGZ A;  1UHI A;  3EVV A;  4DRW A;  1CLB A;  4WQ2 A;  1DJX A;  3VRP A;  4ZCV A;  1SW8 A;  1IJ5 A;  1MUX A;  1PUL A;  2JNX A;  1PAL A;  2TN4 A;  2OS8 B;  1RK9 A;  4TNC A;  1SR6 C;  2SCP A;  1EXR A;  1OE9 B;  1B9A A;  1A2X A;  1CMF A;  1DJW A;  2L98 A;  1OOJ A;  3EVU A;  3I5G B;  1Q80 A;  2MRD A;  3TS5 B;  2PRU A;  2PVB A;  4OR9 B;  1CMG A;  4XJK A;  1LVC D;  1Y6W A;  1DJG A;  2BBM A;  4DCK A;  2K7D A;  2L50 A;  1ZFS A;  2L0P A;  1B8C A;  3F45 A;  1L2O C;  1KK7 Y;  5B8I B;  2OTG B;  3PM8 A;  1SCM C;  1ZMZ A;  3NSK A;  1AJ4 A;  2LLU A;  3D10 A;  1MXE A;  1X02 A;  3CS1 A;  2E30 A;  3TDZ A;  4MN0 A;  1C07 A;  1B8R A;  2E6W A;  3CLN A;  1BOC A;  2B1U A;  3EK8 A;  2KNE A;  3O78 A;  1BOD A;  4CFR A;  1UHJ A;  1R2U A;  2I94 A;  1SL7 A;  2JNF A;  2JPT A;  2KHN A;  2LVJ A;  1F70 A;  2GGM A;  3OB2 B;  4GBA A;  1ALW A;  5IBW A;  4IL1 A;  3TDU A;  2LP3 A;  1TNQ A;  2ZNE A;  3AAK A;  1K2H A;  1NCX A;  2LC5 A;  4F0Z B;  5CSN A;  2F2P A;  1EJ3 A;  2JU0 A;  1IRJ A;  1K93 D;  2PSR A;  1A4P A;  1JSA A;  5TNC A;  3IQQ A;  2BBN A;  2CBL A;  5AFP A;  1IKU A;  1QTX A;  4MSP A;  4OV2 A;  2WOR A;  1QS7 A;  4MRY A;  5HKW A;  1SBJ A;  2HQW A;  4PE1 A;  1DMO A;  2BCX A;  5D69 A;  3QRX A;  1CLL A;  1W7J B;  4OKH A;  2JTZ A;  1SY9 A;  2QAC A;  3BUO B;  1FF1 A;  3DVE A;  1DVI A;  2K2F A;  1KFX L;  3I5I C;  1IJ6 A;  2WCB A;  4L9M A;  1TOP A;  4M2Q A;  5I8N A;  1QIV A;  2HET A;  1JFK A;  2FJU B;  1KFX S;  2WND A;  1XK4 A;  2KFH A;  3CZT X;  3JVT B;  3WHT B;  4PHN A;  2EHB A;  2Y1N A;  2IS9 A;  1OMV A;  4ICB A;  1EG4 A;  1CKK A;  1YVL A;  4YI9 A;  4YGE B;  1REC A;  2EGD A;  1AHR A;  2M7N A;  3SIB A;  2KYF A;  2Q91 A;  1S26 D;  1KSM A;  1CDP A;  4P5O E;  1K8U A;  2CT9 A;  2M1K B;  1OZS A;  2AMI A;  1Y0V H;  1CM4 A;  2K8M B;  4HRH A;  2MJW B;  1RJV A;  1MQ1 A;  1RWY A;  2LVV A;  1MXL C;  1TIZ A;  3A4U B;  2EC6 C;  4HSZ A;  1YUU A;  4QJ5 B;  3NSI A;  4E68 A;  1PVA A;  1GQM A;  2A4J A;  4NDB A;  2KAY A;  1HQV A;  4MLW A;  5CPV A;  1ZUZ A;  1K94 A;  3AKB A;  1Y1A A;  1S1E A;  2DOQ A;  2OPO A;  2K7B A;  3BXK A;  1FBV A;  1CDL A;  2PAL A;  1H8B A;  1XO5 A;  1OMD A;  1YTZ C;  2BL0 C;  4JPZ B;  1DTL A;  1TNX A;  1IQ3 A;  1U5I B;  1TN4 A;  1E8A A;  1XFZ O;  3BOW B;  4R1E A;  2Y5I A;  3PN7 C;  4HRG A;  4AOM A;  1CLM A;  1MR8 A;  3I5H C;  2QPT A;  1KK7 Z;  3OX5 A;  3VGO A;  4GGF A;  4HRE E;  4MZK A;  2LV7 A;  1LA0 A;  3PAL A;  4XYN A;  3I5F B;  1CFP A;  1J55 A;  2F3Y A;  5J3X A;  1N0Y A;  3WXA A;  1BR4 B;  2LVK A;  1MF8 B;  3KO0 A;  4D1E A;  2JT8 A;  4GGN A;  2KFF A;  4PE4 A;  3IQO A;  5KSZ A;  1B7T Y;  1NUB A;  2CTN A;  5DKR A;  5CSJ A;  1CDN A;  4N5X A;  1Y1X A;  2LHL A;  5F6T A;  2F8P A;  1UUR A;  1WY9 A;  2LE9 B;  1Y1U A;  4UPG A;  2JXL A;  2LAP A;  3WNX B;  1F55 A;  5I2Q A;  2H2K A;  3HCM A;  2LLT A;  1NCZ A;  1WDC B;  3CTN A;  1K9U A;  2H61 A;  2HPS A;  2MAZ A;  3OP0 A;  4GAO A;  1S3P A;  1OSA A;  1JFJ A;  1B4C A;  1BMO A;  3SJS A;  2ZRT A;  5I2O A;  1UHN A;  1QAT A;  2M9G A;  3VRQ A;  1CFC A;  2HQ8 A;  1IG5 A;  1RRO A;  2CXJ A;  1BT6 A;  4P2Y B;  1NPQ A;  4I5J A;  2LM5 A;  1QXP A;  1FPW A;  1PK0 D;  3CR4 X;  1AK8 A;  3D0Y B;  2SAS A;  2NZ0 A;  4GUK A;  2LCP A;  1J7R A;  3NSO A;  2CNP A;  2M3W A;  2K61 A;  3O6B A;  5HKY A;  2JQ6 A;  1LIN A;  1LXF C;  3SIA A;  1PVB A;  4FTG A;  2K0J A;  2RGI A;  1EG3 A;  1IWQ A;  1YR5 A;  3FWC A;  1EL4 A;  1SL8 A;  2BE6 A;  1DT7 B;  5AER A;  2BL0 B;  1ZAC A;  1RTP 1;  2O5G A;  2CCM A;  1ODB A;  3TDI A;  2F33 A;  4I5L B;  1SKT A;  5KTY A;  2D8N A;  4FQO A;  1JBA A;  1F54 A;  1NSH A;  2LP2 A;  4PE0 A;  2K7O A;  4PDZ A;  1GGW A;  2KAV A;  3TUY B;  2FCD A;  5JOL A;  3EKH A;  4ZCU A;  4GGF C;  1S6C A;  1B8L A;  3PSR A;  1TCF A;  1VRK A;  4BY5 A;  1K96 A;  1F8H A;  3PAT A;  3KF9 A;  4N1G A;  2VRG A;  5I2L A;  1J7Q A;  4MEW A;  1A29 A;  1MHO A;  1XFY O;  4YGD B;  1BLQ A;  2KQY A;  3JTD C;  2KI4 C;  1NX1 A;  1KK8 C;  1XFU O;  5AXI A;  2MLF C;  1G33 A;  4MVF A;  2GV5 A;  3LL8 B;  1TNW A;  4OVN F;  1SR6 B;  1DJH A;  1D1O A;  2JZI A;  1K95 A;  3C1V A;  1JC2 A;  2KFG A;  2L4H A;  3ZNI A;  2F3Z A;  1R6P A;  1YVH A;  4DS7 A;  3H4S E;  1JWD A;  4U8D A;  2NLN A;  3KPX A;  1AP4 A;  3EK7 A;  4ORC B;  1B7T Z;  2O60 A;  1YX8 A;  4DIR A;  2I18 A;  1DF0 B;  2HF5 A;  3EKJ A;  2LVI A;  2L4I A;  1DJZ A;  3DVJ A;  1BG1 A;  3TZ1 A;  2OS8 C;  1K9P A;  1FI5 A;  1QLK A;  1WLM A;  5DKQ A;  3SG3 A;  2KBI A;  1L7Z A;  2L51 A;  4YGC B;  2AUC A;  2LMU A;  2NCO A;  1J1E A;  4QJ3 B;  3DF0 B;  4JQ0 D;  1L2O B;  1K90 D;  1SCM B;  1WRZ A;  2JT3 A;  3I5G C;  4YRU A;  1M63 B;  1DGV A;  2P6B B;  4MRX A;  1JUO A;  1XVJ A;  2KAX A;  2M7L A;  1QX7 A;  3GK2 A;  1W7I B;  5D7F A;  1WRK A;  1QX5 B;  1UHH A;  3RM1 A;  3VRR A;  1H4B A;  1ZOT B;  1CB1 A;  2BCB A;  2FCE A;  5JJG A;  1PRW A;  3RLZ A;  3BUN B;  3LLE A;  4PAL A;  2WOS A;  2COL B;  2ZN8 A;  3IF7 A;  3NSL A;  3M0W A;  1KFU S;  2BEC A;  4C0J A;  4CID A;  1U5I A;  4WRI A;  2JC2 A;  2KYC A;  4BY4 A;  5KU1 A;  1SL9 A;  3A8R A;  1YX7 A;  3BOW A;  1KCY A;  2I2R E;  2KDH A;  1XFV O;  3LK0 A;  1NX0 A;  1AUI B;  1TNP A;  1QIW A;  4M2O A;  4GNK B;  5ER5 A;  4ORB B;  5PAL A;  1IQ5 A;  1K9K A;  1XYD A;  1NWD A;  2JUL A;  2BKI B;  1OZO A;  2ZKM X;  3FIA A;  4CFQ A;  3SG5 A;  2M8U A;  3I5I B;  3K21 A;  4I5N B;  3JTD B;  4YBH B;  1OQP A;  2JXC A;  1EH2 A;  3KHE A;  2BKH B;  1PSR A;  1S6J A;  3BQ3 A;  1QAS A;  1SK6 D;  1J1D A;  2LNK A;  1SCV A;  1XK4 C;  4GFT A;  4C0L A;  1LKJ A;  1A75 B;  1YUT A;  1TTX A;  1UP5 A;  1M46 A;  1QVI Z;  3AKA A;  2BE4 A;  4MBE A;  3PFV A;  1KWO C;  1UUS A;  1WRL A;  1G4Y R;  3CR5 X;  3EK4 A;  3FWB A;  2K2A A;  3OX6 A;  1SPY A;  3OHM B;  5AAN A;  1S36 A;  3JVT C;  1CFD A;  4CPV A;  2ZN9 A;  3BUM B;  2EC6 B;  1M45 A;  2M29 A;  3VRO A;  1A75 A;  3BUX B;  4YGB B;  2JWW A;  4WQ3 A;  4A4C A;  2LLS A;  1CFF A;  1YRU B;  4XJK B;  3DVK A;  2G9B A;  2AAO A;  1PSB A;  2MBX A;  2ZND A;  3E3R A;  3D0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...