4ORBB

Crystal structure of mouse calcineurin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
rcsb
source organism Mus musculus
molecule tags Hydrolase/metal binding protein
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit al
total genus 56
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4orbB00
2BE4A 1QATA 4ICBA 4MRYA 4NDDA 4ZCVA 1B4CA 3D10A 1K90D 5F6TA 3HX4A 4YRUA 1NPQA 2PALA 2BECA 1LVCD 2HQ8A 4YI8A 1KSOA 2D8NA 3FWBA 4IL1A 4DS7A 1IQ5A 1NP8A 3ICBA 5GQQC 1X02A 1BR4B 3BXKA 1IQ3A 1YUSA 4GFTA 2M8UA 2MJWB 1CFCA 2LUCA 1DJIA 1SYMA 1V1GA 4WRIA 5KU1A 1UWOA 4GUKA 3EK7A 3EVVA 1EJ3A 2PASA 4MVFA 4MBEA 1Q80A 2ZN8A 3F45A 1SL9A 2F33A 2PMYA 1LINA 4CIDA 3NSKA 3LLEA 1SCVA 1Y0VH 3CWGA 1WDCB 3EK8A 3TDZA 2KHNA 4YGDB 3KEVA 5AANA 1BT6A 2K61A 3H4SE 1UHJA 1NX3A 2M0RA 5I8NA 1NCZA 3IQOA 3JVTC 2MLFC 3VRNA 1OE9B 1OMRA 1CB1A 5KTYA 2LVVA 1CKKA 2JRFA 1ZACA 3LL8B 4OKHA 2HETA 4ORAB 1C07A 4PHJA 1CLBA 1S1EA 4YGBB 1VRKA 2NCPA 4MN0A 1AJ4A 1MHOA 1SPYA 1YX7A 1KQVA 1JF0A 3BUWB 3EK4A 1YX8A 2K0JA 2HQWA 1TOPA 3I5GC 2M7NA 3O4YA 3BUMB 2H61A 4A4CA 5J3XA 4XJKA 1QV0A 3MSEB 1K2HA 2VRGA 1FI5A 1K95A 3OX6A 1YRTB 1V1FA 3D0YB 3PN7B 3TUYB 2JQ6A 2LLUA 2I94A 3DF0A 1CLLA 2WNDA 4JWQA 2MHHA 1SBJA 3PLFB 1LA0A 2BCBA 1JWDA 4CPVA 2ZRSA 3OHMB 1A4PA 1DJGA 1YRUB 1OQPA 2KFHA 4HRHA 5FYXA 4F0ZB 4ORBB 3ZWHA 1C7WA 1AUIB 2FOTA 1J7QA 2KYFA 3I5FC 1TCOB 3SIBA 1G4YR 1GQMA 4U8DA 1KK7Z 1XK4C 1KWOB 4DRWA 4M2OA 1KFXL 2F3ZA 1CTRA 1YR5A 2LHIA 2LUXA 2NCOA 5HLOA 3LCPC 1N0YA 1GGZA 2EHBA 4MZKA 4R1EA 1MR8A 2EGDA 1AVSA 1QX2A 2PVBA 4NQGA 3PN7C 1GJYA 1TCFA 1FW4A 4JQ0D 3TDUA 3TUYC 1QJTA 3EVRA 2O5GA 1CMFA 4PCWA 3K21A 3LK0A 1JFJA 3PALA 1ALVA 4NDCA 3TS5B 1U5IA 1NUBA 4OCIA 4PHNA 3DVJA 1Y1AA 2Q4UA 1XFUO 1CFPA 1SR6C 3BQ3A 2CNPA 3NXAA 3WXAA 1TRFA 1EL4A 1Y1XA 4D1EA 2Y4QA 1NYAA 4YGAA 4I5NB 4JPZB 4C0LA 1SKTA 2JULA 3GOFA 5PALA 1PSBA 1YTZC 4XYNA 1IJ5A 2CBLA 2K2AA 2H61C 2L2EA 3CZTX 5B8IB 2MA2A 3SIAA 1SNLA 2WOSA 1J7PA 2BBMA 5ER5A 1S5GY 2KAXA 3AKBA 3BOWA 4TNCA 2M97A 2K8MB 2KBMA 1NSHA 1WDCC 2MRDA 2E30A 2K7CA 4OR9B 1M31A 2GV5A 2ZNDA 4C0JA 1DT7B 1K8UA 4GGFA 2LLSA 1IG5A 1MUXA 3DVMA 1NWDA 3I5IC 4MEWA 1UUSA 2L0PA 2KI4B 1QLSA 1MXLC 4QJ5B 5ER4X 1FF1A 2KI4C 1TIZA 5HKZA 4BY5A 1C7VA 1H8BA 4I5LB 1DF0A 5CPVA 2GGMA 1OOJA 1BLQA 4HRGA 1KSMA 4PE4A 3AAKA 1XO5A 2JWWA 2F2OA 1F4OA 2KDHA 2M49B 4CLNA 3OB1B 1QS7A 4MZJA 1K93D 2LMUA 1EG3A 1KQMC 3PSRA 4P5OE 2P6BB 2JT0A 1MQ1A 5BPJA 1XFWO 1JFKA 2JXCA 1OSAA 1CDPA 3EVUA 4AQIA 2M3WA 1YURA 3BUNB 1RTP1 1IJ6A 1S36A 4XJKB 2KFGA 2CTNA 1QX7A 1LA3A 1DTLA 3JTDB 1B47A 2LAPA 5HYDA 2MBXA 2LHLA 1OMVA 1A29A 1ZUZA 1M63B 2KNEA 2NZ0A 2G9BA 3I5HB 2F2PA 2KI6C 2LNKA 1LKJA 1ZOTB 1DGVA 2FCEA 1NX1A 1CFDA 1UURA 2LC5A 2QPTA 3BOWB 5AERA 1UHNA 2M7LA 1A75A 1CFFA 1B7TY 2EC6B 1CNPA 2AAOA 2I7AA 2FCDA 4DUQA 2EC6C 2ZKMX 1ZFSA 2CT9A 1D1OA 1F70A 3TZ1A 2LVJA 1CM4A 3EKJA 4PE7A 3VRPA 3SG6A 2KFFA 1J1EA 2B1UA 3CLNA 3NSIA 3NSLA 1QIWA 3ZNIA 1BJFA 1QIVA 1RECA 2WORA 3VRQA 1F54A 1J55A 2H2KA 2WCBA 1CDLA 1W7JB 1UHKA 4PHMA 3C1VA 3DVKA 4L9MA 1MF8B 1IRJA 3FIAA 1KFXS 3FS7A 1Y6WA 5CSIA 3PFVA 2LMTA 1G33A 2MAZA 4YI9A 5AFPA 1KK7Y 5G08A 1BU3A 2JU0A 3HCMA 1YUUA 2M9GA 5JJGA 4CFQA 1TNQA 2KGRA 1BG1A 4BY4A 4GPLB 2LP2A 1RJVA 3FWCA 4I5JA 1CMGA 1K94A 1KFUS 1K9UA 1XFYO 2G2BA 3I5GB 1H4BA 4A4BA 3M0WA 1FPWA 1XFXO 1UHIA 1QVIY 2Y1MA 1DGUA 4PALA 1XFVO 1N65A 4PE0A 2QACA 2ZRTA 2K7BA 2GGZA 1K9KA 1NCYA 4AQJA 2COLB 1G8IA 1F71A 1NIWA 1EG4A 1DVIA 1Y1UA 2LANA 3KHEA 3PM8A 1SRAA 4GBAA 4GGNA 1SCMB 2LCPA 1TNPA 1RROA 1ZMZA 2JOJA 1KWOC 5DKNA 2BKHB 1A2XA 1JC2A 1B8LA 1XFZO 3OB2B 2Q91A 1QX5B 4HREE 2ISDA 1YVLA 4QJ3B 3WNXB 4I5KA 2KI6D 3A8RA 1IWQA 1TN4A 2F8PA 2ZN9A 1A75B 2BL0B 5CSNA 5DKRA 2RGIA 4M2PA 4WQ2A 1OZOA 1YVHA 2IS9A 1AHRA 1SCMC 4PDZA 4YGEB 4QJ4B 1S26D 2PSRA 3VROA 2ZFDA 1QXPA 3JTDC 2JTZA 2BE6A 2TN4A 4OV2A 2WCFA 1N2DA 1QVIZ 3RLZA 3DVEA 1BOCA 2KAVA 1S6IA 2O60A 2OS8C 3CTNA 4MSPA 4UPGA 1CDNA 2L4IA 4PE1A 5AEQA 3TDIA 1B9AA 2BCAA 2BKIB 5HLVA 1TNXA 5TNCA 1UP5A 5I2OA 3BUXB 2NXQA 2KQ6A 1U5IB 4N5XA 1DJHA 2WCEA 2LV7A 1F55A 1SW8A 4MZLA 1K96A 2KAYA 1DJWA 3BUOB 1WRZA 3SG7A 1A03A 2JTTA 2A4JA 1MXEA 4CFRA 4OVNF 1CDMA 4FTGA 5KSZA 2L98A 1EH2A 4FQOA 2HPSA 3CR5X 1EXRA 3AAJA 1RK9A 1OMDA 1E8AA 2JT8A 4WQ3A 2K7OA 3CR2A 4GGFC 1SY9A 3CGAA 3IQQA 3SG3A 1ALWA 1UHHA 3O6BA 5HKWA 3EKHA 1PSRA 1WY9A 1BMOA 1XVJA 1K9PA 4M2QA 1R2UA 1SL7A 1BF5A 1PRWA 5IBWA 2CXJA 1J1DA 1HT9A 2JT3A 5I2LA 1QASA 4HSZA 4DIRA 1AK8A 2DOQA 2LVIA 1PULA 4YBHB 1WRLA 2NLNA 2M1KB 3NSOA 4E68A 1JBAA 1M46A 1PALA 1NX2A 5I2QA 2LVKA 1J7OA 1DMOA 3O2PA 5D69A 2KBIA 2Y1NA 4N1FA 1M39A 2KGBC 2L50A 5HKYA 1AP4A 1B7TZ 1TTXA 1WRKA 3BYAA 1YUTA 3A4UB 2OPOA 2WC8A 4MRXA 1FI6A 1B1GA 2SASA 2F3YA 2BBNA 1OZSA 1DJYA 2L4HA 1F8HA 3QRXA 2OTGC 1F4QA 2LMVA 3SJSA 2OS8B 1AJ5A 1SMGA 4P2YB 1WLZA 3SG4A 1B8CA 5CSJA 2L51A 1KFUL 2Y5IA 4NDBA 5DKQA 1ODBA 2MLEC 1PK0D 2HF5A 3I5IB 2KQYA 2SCPA 1MWNA 1KCYA 3TS5C 1W7IB 1CLMA 2M29A 1JUOA 4GNKB 3WHUB 1PVAA 4ZCUA 3E3RA 1XA5A 3GK4X 1QV1A 3AKAA 5D7FA 2E6WA 1R6PA 1CM1A 1TNWA 1IGVA 1BR1B 1SK6D 1S3PA 2FJUB 2AMIA 1L7ZA 3LK1A 1BODA 3D0YA 2R2IA 1XK4A 1JF2A 1RFJA 3DD4A 1SR6B 1LXFC 1IKUA 2JZIA 2M1UA 4DCKA 2LLTA 3SG2A 2JNXA 1IH0A 3VGOA 5JOLA 3DF0B 3SG5A 1DJZA 1NCXA 1WLMA 1GGWA 3O78A 4ETOA 4PHKA 4AOMA 1KK8B 2PRUA 3IF7A 3KF9A 4YGCB 2JNFA 4N1GA 2JXLA 1JSAA 2AUCA 2BCXA 1S6CA 2K2FA 2JC2A 2BL0C 1XYDA 1S5GZ 1FBVA 1L2OB 4ORCB 4C0KA 5CSFA 2CCMA 3I5HC 3CR4X 2JPTA 3OP0A 4GAOA 5K89A 2I18A 1L2OC 3PATA 1RWYA 2KSPA 2V53A 3JVTB 5AXIA 1PVBA 2ZNEA 2KYCA 2OTGB 2K7DA 2L5XB 1QTXA 3CS1A 1DJXA 3WHTB 4USLA 1M45A 1J7RA 2LP3A 1DF0B 1QLKA 1KK8C 3I5FB 4MLWA 1S6JA 3KPXA 2LM5A 3RM1A 4Q04A 2I2RE 3VRRA 1SL8A 1NX0A 3OX5A 1B8RA 1HQVA 1KQMB 3KO0A 2LE9B 2KOTA 3GK2A 3GK1A
chains in the Genus database with same CATH superfamily
2BE4A 1QATA 4ICBA 4MRYA 4NDDA 4ZCVA 3S0AA 3DZTA 1B4CA 3D10A 1K90D 5F6TA 3CYZA 3HX4A 4YRUA 1NPQA 5I94A 2PALA 3D77A 2BECA 1LVCD 2HQ8A 4YI8A 1KSOA 2D8NA 3FWBA 4IL1A 4DS7A 1IQ5A 1NP8A 4IJ7A 3ICBA 5GQQC 1X02A 1BR4B 3BXKA 1IQ3A 1YUSA 4GFTA 3S0DA 2M8UA 2MJWB 5D3OA 1CFCA 2LUCA 1DJIA 1SYMA 1V1GA 4WRIA 5KU1A 1UWOA 4GUKA 3EK7A 3EVVA 1EJ3A 2PASA 2QDIA 4MVFA 1OOGA 1Q80A 4MBEA 2ZN8A 3F45A 1SL9A 2F33A 2PMYA 3SS4A 1LINA 4CIDA 3NSKA 3FE9A 3LLEA 1LS8A 1SCVA 1Y0VH 3CWGA 1WDCB 3EK8A 3QMEA 3TDZA 2KHNA 4YGDB 3KEVA 5AANA 1BT6A 2K61A 3H4SE 1UHJA 1NX3A 1W9ZA 3D73A 2M0RA 5I8NA 1NCZA 3IQOA 3JVTC 2MLFC 3VRNA 1OE9B 1OMRA 1CB1A 5KTYA 2LVVA 1CKKA 2JRFA 1ZACA 2BNXA 3LL8B 4OKHA 2HETA 4ORAB 1C07A 4PHJA 1CLBA 1S1EA 4YGBB 1VRKA 2NCPA 4MN0A 1AJ4A 1MHOA 1SPYA 1YX7A 1KQVA 1JF0A 3R72A 3BUWB 3EK4A 1YX8A 3L47A 2K0JA 2HQWA 1TOPA 3I5GC 2M7NA 3O4YA 3BUMB 2H61A 4A4CA 5J3XA 4XJKA 1QV0A 3MSEB 1K2HA 2VRGA 1FI5A 4KYNA 1K95A 3OX6A 1YRTB 2PYQA 1V1FA 3D0YB 3PN7B 3TUYB 1C3YA 2JQ6A 2LLUA 1IIOA 2I94A 3DF0A 1CLLA 2WNDA 4JWQA 2MHHA 1SBJA 3PLFB 3UO9A 1LA0A 2BCBA 2L2CA 4CPVA 1JWDA 1Z2CB 2ZRSA 3OHMB 1A4PA 1DJGA 1YRUB 1OQPA 2KFHA 3DY9A 4HRHA 5FYXA 4ORBB 3ZWHA 4F0ZB 1C7WA 1AUIB 2FOTA 3D78A 1J7QA 2KYFA 3I5FC 1TCOB 3SIBA 1G4YR 1GQMA 4U8DA 1KK7Z 1XK4C 1KWOB 4DRWA 4M2OA 1KFXL 2F3ZA 1CTRA 1YR5A 2LHIA 2LUXA 2NCOA 3K1EA 3LCPC 5HLOA 1N0YA 1GGZA 2EHBA 4MZKA 4R1EA 1MR8A 2EGDA 1AVSA 1QX2A 2PVBA 4NQGA 3PN7C 1GJYA 1TCFA 1FW4A 3DYEA 4JQ0D 3S0EA 3TDUA 1QJTA 3TUYC 3EVRA 2O5GA 1CMFA 4PCWA 3K21A 3LK0A 1JFJA 3PALA 3R1VA 1ALVA 4NDCA 3TS5B 1U5IA 1NUBA 4OCIA 4PHNA 3DVJA 1Y1AA 2Q4UA 2WCJA 1XFUO 1CFPA 1SR6C 1T14A 2CNPA 3BQ3A 1DQEA 3NXAA 3WXAA 3BFBA 1TRFA 1EL4A 1Y1XA 2WCKA 4D1EA 2Y4QA 1NYAA 4YGAA 4I5NB 4JPZB 4C0LA 1SKTA 2JULA 3GOFA 5PALA 1PSBA 1YTZC 4XYNA 1IJ5A 2CBLA 2K2AA 2H61C 2L2EA 3CZTX 5B8IB 2MA2A 3SIAA 1SNLA 2WOSA 1J7PA 2BBMA 5ER5A 1S5GY 2KAXA 3AKBA 3BOWA 1C3ZA 4TNCA 2M97A 2K8MB 3N7HA 2KBMA 1NSHA 1WDCC 2MRDA 2E30A 2K7CA 3CZ0A 4OR9B 1M31A 2GV5A 2ZNDA 3NHTA 4C0JA 1DT7B 1K8UA 4GGFA 2LLSA 1IG5A 1MUXA 3DVMA 1NWDA 3I5IC 4JD9A 4MEWA 1UUSA 2L0PA 2KI4B 1SSEB 1QLSA 3L4AA 1MXLC 4QJ5B 5ER4X 1FF1A 2KI4C 3O4XA 1TIZA 5HKZA 2FJYA 5DICA 4BY5A 1C7VA 1GM0A 1H8BA 4I5LB 1DF0A 5CPVA 2GGMA 1OOJA 4FQTA 1BLQA 4HRGA 1KSMA 4PE4A 3AAKA 1XO5A 3D74A 2JWWA 2F2OA 1F4OA 2KDHA 2M49B 4CLNA 5EL2A 5AERA 3OB1B 1QS7A 4MZJA 1K93D 2LMUA 1EG3A 1KQMC 2L5YA 3PSRA 4P5OE 2P6BB 2JT0A 1MQ1A 5BPJA 1XFWO 1JFKA 2JXCA 1OSAA 3CZ2A 1CDPA 3EVUA 4AQIA 2M3WA 1YURA 3BUNB 1RTP1 1IJ6A 1S36A 4XJKB 2KFGA 2CTNA 1QX7A 3D76A 1LA3A 1DTLA 3JTDB 1B47A 2LAPA 3PJIA 5HYDA 2MBXA 2LHLA 1OMVA 1A29A 1ZUZA 1M63B 2KNEA 2NZ0A 2G9BA 3I5HB 2F2PA 2KI6C 2LNKA 1LKJA 1ZOTB 1DGVA 1NX1A 1CFDA 1UURA 2FCEA 2LC5A 2QPTA 3BOWB 3EG5B 1UHNA 2M7LA 1A75A 1CFFA 1B7TY 2EC6B 1CNPA 3Q8IA 3UNWA 2AAOA 2I7AA 1DC1A 2FCDA 4JKTA 4DUQA 2EC6C 2ZKMX 1ZFSA 2CT9A 3RZSA 3B88A 1ORGA 2WCLA 1D1OA 5FI7A 1F70A 3TZ1A 2LVJA 1CM4A 1TUZA 3EKJA 4PE7A 3VRPA 3SG6A 2KFFA 1J1EA 2B1UA 3CLNA 3NSIA 3NSLA 5FI6A 4OZDA 1QIWA 3ZNIA 1BJFA 1QIVA 1RECA 2WORA 3R1OA 3VRQA 1F54A 1J55A 2H2KA 2WCBA 1CDLA 1W7JB 1UHKA 4PHMA 3C1VA 3DVKA 4INXA 4L9MA 1MF8B 1IRJA 3FIAA 1KFXS 3FS7A 1Y6WA 5CSIA 3PFVA 2LMTA 1G33A 2MAZA 4YI9A 5AFPA 1KK7Y 5G08A 1BU3A 2JU0A 2KLDA 3BJHA 2PQLA 1YUUA 2M9GA 2QEHA 3HCMA 5JJGA 2QEOA 4PT1A 4CFQA 1TNQA 2KGRA 1BG1A 4BY4A 4GPLB 2LP2A 1RJVA 3FWCA 4I5JA 1CMGA 1K94A 1KFUS 1K9UA 1XFYO 2QEBA 2G2BA 3I5GB 1H4BA 4A4BA 3M0WA 1FPWA 1XFXO 1UHIA 1QVIY 2Y1MA 1DGUA 4PALA 1XFVO 1N65A 2ERBA 4PE0A 2QACA 2ZRTA 2K7BA 2GGZA 1K9KA 1NCYA 4AQJA 2COLB 1G8IA 1F71A 1NIWA 1EG4A 1DVIA 1Y1UA 2LANA 3KHEA 3PM8A 1SRAA 4GBAA 4GGNA 1SCMB 2LCPA 1TNPA 1P28A 1RROA 3V2LA 1ZMZA 2JOJA 1KWOC 5DKNA 2BKHB 1A2XA 1JC2A 1B8LA 1XFZO 3OB2B 2Q91A 1QX5B 4HREE 2ISDA 1YVLA 4QJ3B 3CABA 3WNXB 4I5KA 2KI6D 3A8RA 1IWQA 1TN4A 2F8PA 2ZN9A 3S0BA 3L4LA 1A75B 2BL0B 5CSNA 5DKRA 2RGIA 4M2PA 4WQ2A 1OZOA 1YVHA 2IS9A 3CZ1A 1AHRA 1SCMC 4PDZA 4YGEB 4QJ4B 1S26D 2PSRA 3VROA 2ZFDA 2P70A 1OOIX 1QXPA 3JTDC 2JTZA 3CDNA 2BE6A 2TN4A 4OV2A 2WCFA 1N2DA 1QVIZ 1Z4HA 3RLZA 2P71A 3DVEA 1BOCA 2KAVA 1S6IA 2JPOA 2O60A 2OS8C 3CTNA 1DEKA 4MSPA 4UPGA 1CDNA 2L4IA 4PE1A 5AEQA 3TDIA 1B9AA 2BCAA 2BKIB 5HLVA 1TNXA 5TNCA 1DELA 1UP5A 1OOHA 3BUXB 5I2OA 2NXQA 2KQ6A 1U5IB 2YGUA 1DJHA 2WCEA 4N5XA 3SS5A 2LV7A 1F55A 1SW8A 4MZLA 1K96A 2KAYA 1DJWA 3BUOB 1WRZA 1TUJA 3SG7A 1A03A 2JTTA 2A4JA 1MXEA 4CFRA 4OVNF 1CDMA 4FTGA 5KSZA 2L98A 1EH2A 4FQOA 2GTEA 2HPSA 3CR5X 1EXRA 3AAJA 1RK9A 1OMDA 1E8AA 3FE6A 4F7FA 2WCMA 2JT8A 4WQ3A 2K7OA 3CR2A 4GGFC 1SY9A 3CGAA 3IQQA 4INWA 3SG3A 1ALWA 1UHHA 3O6BA 5HKWA 1QWVA 3EKHA 1PSRA 1WY9A 1BMOA 3B86A 1XVJA 1K9PA 4M2QA 1R2UA 3R1PA 1SL7A 1BF5A 3B87A 3FE8A 1PRWA 2WCHA 5IBWA 2CXJA 1J1DA 1HT9A 2JT3A 5I2LA 1QASA 4HSZA 4DIRA 1AK8A 2DOQA 2LVIA 1PULA 4YBHB 1WRLA 2NLNA 2M1KB 3NSOA 4E68A 2QEVA 2WC6A 1JBAA 2H8VA 1M46A 1PALA 1NX2A 5I2QA 2LVKA 1J7OA 3OGNA 1DMOA 3O2PA 5D69A 2KBIA 2Y1NA 4N1FA 1M39A 2KGBC 2L50A 5HKYA 1AP4A 1B7TZ 1TTXA 1WRKA 3BYAA 1YUTA 3A4UB 2OPOA 2WC8A 4MRXA 1FI6A 2KPHA 3DXLA 1B1GA 2SASA 2F3YA 2BBNA 1OZSA 1DJYA 2L4HA 1F8HA 3QRXA 2OTGC 1F4QA 2LMVA 3SJSA 2OS8B 1AJ5A 1SMGA 1XFRA 4P2YB 3BFHA 1WLZA 3SG4A 1B8CA 5CSJA 3B6XA 2L51A 5HL1A 1KFUL 2Y5IA 4NDBA 5DKQA 1ODBA 2MLEC 1TWOA 1PK0D 2HF5A 3I5IB 2KQYA 2SCPA 1MWNA 1KCYA 3TS5C 1W7IB 1CLMA 2M29A 1JUOA 4GNKB 3WHUB 1PVAA 4ZCUA 3E3RA 1XA5A 3GK4X 1QV1A 3AKAA 5D7FA 2E6WA 1R6PA 3BFAA 1CM1A 1TNWA 1IGVA 1BR1B 1SK6D 1S3PA 2FJUB 2AMIA 1L7ZA 3LK1A 1BODA 3D0YA 2R2IA 1XK4A 3OBVA 1JF2A 1OOFA 1RFJA 3DD4A 1SR6B 1LXFC 1IKUA 2JZIA 2M1UA 4DCKA 3SS3A 2LLTA 2WC5A 3SG2A 2JNXA 1IH0A 3S0GA 3VGOA 5JOLA 3DF0B 2K60A 3SG5A 1DJZA 3NGVA 1OW4A 1NCXA 1WLMA 1GGWA 3O78A 4ETOA 4PHKA 4AOMA 1KK8B 2PRUA 3IF7A 3KF9A 3IVTA 2BAPA 2JNFA 4N1GA 2JXLA 4YGCB 1JSAA 2AUCA 2BCXA 1S6CA 2K2FA 2JC2A 3B7AA 3S0FA 2BL0C 1XYDA 1S5GZ 3NHIA 1FBVA 1L2OB 4ORCB 4C0KA 5CSFA 2CCMA 3I5HC 3CR4X 2JPTA 3OP0A 4GAOA 5K89A 1L2OC 2I18A 3PATA 1RWYA 2KSPA 2V53A 3JVTB 5AXIA 3VB1A 1PVBA 2ZNEA 2KYCA 2OTGB 2K7DA 2L5XB 1QTXA 3CS1A 1DJXA 3WHTB 4USLA 1M45A 1J7RA 2LP3A 1DF0B 3D75A 3PM2A 1QLKA 1KK8C 3I5FB 4MLWA 1S6JA 3KPXA 2KLEA 2LM5A 3RM1A 5FI2A 4Q04A 2I2RE 3VRRA 1SL8A 1NX0A 3OX5A 1B8RA 1HQVA 1KQMB 3KO0A 2LE9B 2KOTA 3GK2A 3GK1A
chains in the Genus database with same CATH topology
2BE4A 1QATA 4ICBA 4MRYA 4NDDA 4ZCVA 1B4CA 3D10A 1K90D 5F6TA 3HX4A 4YRUA 1NPQA 2PALA 2BECA 1LVCD 2HQ8A 4YI8A 1KSOA 2D8NA 3FWBA 4IL1A 4DS7A 1IQ5A 1NP8A 3ICBA 5GQQC 1X02A 1BR4B 3BXKA 1IQ3A 1YUSA 4GFTA 2M8UA 2MJWB 1CFCA 2LUCA 1DJIA 1SYMA 1V1GA 4WRIA 5KU1A 1UWOA 4GUKA 3EK7A 3EVVA 1EJ3A 2PASA 4MVFA 4MBEA 1Q80A 2ZN8A 3F45A 1SL9A 2F33A 2PMYA 1LINA 4CIDA 3NSKA 3LLEA 1SCVA 1Y0VH 3CWGA 1WDCB 3EK8A 3TDZA 2KHNA 4YGDB 3KEVA 5AANA 1BT6A 2K61A 3H4SE 1UHJA 1NX3A 2M0RA 5I8NA 1NCZA 3IQOA 3JVTC 2MLFC 3VRNA 1OE9B 1OMRA 1CB1A 5KTYA 2LVVA 1CKKA 2JRFA 1ZACA 3LL8B 4OKHA 2HETA 4ORAB 1C07A 4PHJA 1CLBA 1S1EA 4YGBB 1VRKA 2NCPA 4MN0A 1AJ4A 1MHOA 1SPYA 1YX7A 1KQVA 1JF0A 3BUWB 3EK4A 1YX8A 2K0JA 2HQWA 1TOPA 3I5GC 2M7NA 3O4YA 3BUMB 2H61A 4A4CA 5J3XA 4XJKA 1QV0A 3MSEB 1K2HA 2VRGA 1FI5A 1K95A 3OX6A 1YRTB 1V1FA 3D0YB 3PN7B 3TUYB 2JQ6A 2LLUA 2I94A 3DF0A 1CLLA 2WNDA 4JWQA 2MHHA 1SBJA 3PLFB 1LA0A 2BCBA 1JWDA 4CPVA 2ZRSA 3OHMB 1A4PA 1DJGA 1YRUB 1OQPA 2KFHA 4HRHA 5FYXA 4F0ZB 4ORBB 3ZWHA 1C7WA 1AUIB 2FOTA 1J7QA 2KYFA 3I5FC 1TCOB 3SIBA 1G4YR 1GQMA 4U8DA 1KK7Z 1XK4C 1KWOB 4DRWA 4M2OA 1KFXL 2F3ZA 1CTRA 1YR5A 2LHIA 2LUXA 2NCOA 5HLOA 3LCPC 1N0YA 1GGZA 2EHBA 4MZKA 4R1EA 1MR8A 2EGDA 1AVSA 1QX2A 2PVBA 4NQGA 3PN7C 1GJYA 1TCFA 1FW4A 4JQ0D 3TDUA 3TUYC 1QJTA 3EVRA 2O5GA 1CMFA 4PCWA 3K21A 3LK0A 1JFJA 3PALA 1ALVA 4NDCA 3TS5B 1U5IA 1NUBA 4OCIA 4PHNA 3DVJA 1Y1AA 2Q4UA 1XFUO 1CFPA 1SR6C 3BQ3A 2CNPA 3NXAA 3WXAA 1TRFA 1EL4A 1Y1XA 4D1EA 2Y4QA 1NYAA 4YGAA 4I5NB 4JPZB 4C0LA 1SKTA 2JULA 3GOFA 5PALA 1PSBA 1YTZC 4XYNA 1IJ5A 2CBLA 2K2AA 2H61C 2L2EA 3CZTX 5B8IB 2MA2A 3SIAA 1SNLA 2WOSA 1J7PA 2BBMA 5ER5A 1S5GY 2KAXA 3AKBA 3BOWA 4TNCA 2M97A 2K8MB 2KBMA 1NSHA 1WDCC 2MRDA 2E30A 2K7CA 4OR9B 1M31A 2GV5A 2ZNDA 4C0JA 1DT7B 1K8UA 4GGFA 2LLSA 1IG5A 1MUXA 3DVMA 1NWDA 3I5IC 4MEWA 1UUSA 2L0PA 2KI4B 1QLSA 1MXLC 4QJ5B 5ER4X 1FF1A 2KI4C 1TIZA 5HKZA 4BY5A 1C7VA 1H8BA 4I5LB 1DF0A 5CPVA 2GGMA 1OOJA 1BLQA 4HRGA 1KSMA 4PE4A 3AAKA 1XO5A 2JWWA 2F2OA 1F4OA 2KDHA 2M49B 4CLNA 3OB1B 1QS7A 4MZJA 1K93D 2LMUA 1EG3A 1KQMC 3PSRA 4P5OE 2P6BB 2JT0A 1MQ1A 5BPJA 1XFWO 1JFKA 2JXCA 1OSAA 1CDPA 3EVUA 4AQIA 2M3WA 1YURA 3BUNB 1RTP1 1IJ6A 1S36A 4XJKB 2KFGA 2CTNA 1QX7A 1LA3A 1DTLA 3JTDB 1B47A 2LAPA 5HYDA 2MBXA 2LHLA 1OMVA 1A29A 1ZUZA 1M63B 2KNEA 2NZ0A 2G9BA 3I5HB 2F2PA 2KI6C 2LNKA 1LKJA 1ZOTB 1DGVA 2FCEA 1NX1A 1CFDA 1UURA 2LC5A 2QPTA 3BOWB 5AERA 1UHNA 2M7LA 1A75A 1CFFA 1B7TY 2EC6B 1CNPA 2AAOA 2I7AA 2FCDA 4DUQA 2EC6C 2ZKMX 1ZFSA 2CT9A 1D1OA 1F70A 3TZ1A 2LVJA 1CM4A 3EKJA 4PE7A 3VRPA 3SG6A 2KFFA 1J1EA 2B1UA 3CLNA 3NSIA 3NSLA 1QIWA 3ZNIA 1BJFA 1QIVA 1RECA 2WORA 3VRQA 1F54A 1J55A 2H2KA 2WCBA 1CDLA 1W7JB 1UHKA 4PHMA 3C1VA 3DVKA 4L9MA 1MF8B 1IRJA 3FIAA 1KFXS 3FS7A 1Y6WA 5CSIA 3PFVA 2LMTA 1G33A 2MAZA 4YI9A 5AFPA 1KK7Y 5G08A 1BU3A 2JU0A 3HCMA 1YUUA 2M9GA 5JJGA 4CFQA 1TNQA 2KGRA 1BG1A 4BY4A 4GPLB 2LP2A 1RJVA 3FWCA 4I5JA 1CMGA 1K94A 1KFUS 1K9UA 1XFYO 2G2BA 3I5GB 1H4BA 4A4BA 3M0WA 1FPWA 1XFXO 1UHIA 1QVIY 2Y1MA 1DGUA 4PALA 1XFVO 1N65A 4PE0A 2QACA 2ZRTA 2K7BA 2GGZA 1K9KA 1NCYA 4AQJA 2COLB 1G8IA 1F71A 1NIWA 1EG4A 1DVIA 1Y1UA 2LANA 3KHEA 3PM8A 1SRAA 4GBAA 4GGNA 1SCMB 2LCPA 1TNPA 1RROA 1ZMZA 2JOJA 1KWOC 5DKNA 2BKHB 1A2XA 1JC2A 1B8LA 1XFZO 3OB2B 2Q91A 1QX5B 4HREE 2ISDA 1YVLA 4QJ3B 3WNXB 4I5KA 2KI6D 3A8RA 1IWQA 1TN4A 2F8PA 2ZN9A 1A75B 2BL0B 5CSNA 5DKRA 2RGIA 4M2PA 4WQ2A 1OZOA 1YVHA 2IS9A 1AHRA 1SCMC 4PDZA 4YGEB 4QJ4B 1S26D 2PSRA 3VROA 2ZFDA 1QXPA 3JTDC 2JTZA 2BE6A 2TN4A 4OV2A 2WCFA 1N2DA 1QVIZ 3RLZA 3DVEA 1BOCA 2KAVA 1S6IA 2O60A 2OS8C 3CTNA 4MSPA 4UPGA 1CDNA 2L4IA 4PE1A 5AEQA 3TDIA 1B9AA 2BCAA 2BKIB 5HLVA 1TNXA 5TNCA 1UP5A 5I2OA 3BUXB 2NXQA 2KQ6A 1U5IB 4N5XA 1DJHA 2WCEA 2LV7A 1F55A 1SW8A 4MZLA 1K96A 2KAYA 1DJWA 3BUOB 1WRZA 3SG7A 1A03A 2JTTA 2A4JA 1MXEA 4CFRA 4OVNF 1CDMA 4FTGA 5KSZA 2L98A 1EH2A 4FQOA 2HPSA 3CR5X 1EXRA 3AAJA 1RK9A 1OMDA 1E8AA 2JT8A 4WQ3A 2K7OA 3CR2A 4GGFC 1SY9A 3CGAA 3IQQA 3SG3A 1ALWA 1UHHA 3O6BA 5HKWA 3EKHA 1PSRA 1WY9A 1BMOA 1XVJA 1K9PA 4M2QA 1R2UA 1SL7A 1BF5A 1PRWA 5IBWA 2CXJA 1J1DA 1HT9A 2JT3A 5I2LA 1QASA 4HSZA 4DIRA 1AK8A 2DOQA 2LVIA 1PULA 4YBHB 1WRLA 2NLNA 2M1KB 3NSOA 4E68A 1JBAA 1M46A 1PALA 1NX2A 5I2QA 2LVKA 1J7OA 1DMOA 3O2PA 5D69A 2KBIA 2Y1NA 4N1FA 1M39A 2KGBC 2L50A 5HKYA 1AP4A 1B7TZ 1TTXA 1WRKA 3BYAA 1YUTA 3A4UB 2OPOA 2WC8A 4MRXA 1FI6A 1B1GA 2SASA 2F3YA 2BBNA 1OZSA 1DJYA 2L4HA 1F8HA 3QRXA 2OTGC 1F4QA 2LMVA 3SJSA 2OS8B 1AJ5A 1SMGA 4P2YB 1WLZA 3SG4A 1B8CA 5CSJA 2L51A 1KFUL 2Y5IA 4NDBA 5DKQA 1ODBA 2MLEC 1PK0D 2HF5A 3I5IB 2KQYA 2SCPA 1MWNA 1KCYA 3TS5C 1W7IB 1CLMA 2M29A 1JUOA 4GNKB 3WHUB 1PVAA 4ZCUA 3E3RA 1XA5A 3GK4X 1QV1A 3AKAA 5D7FA 2E6WA 1R6PA 1CM1A 1TNWA 1IGVA 1BR1B 1SK6D 1S3PA 2FJUB 2AMIA 1L7ZA 3LK1A 1BODA 3D0YA 2R2IA 1XK4A 1JF2A 1RFJA 3DD4A 1SR6B 1LXFC 1IKUA 2JZIA 2M1UA 4DCKA 2LLTA 3SG2A 2JNXA 1IH0A 3VGOA 5JOLA 3DF0B 3SG5A 1DJZA 1NCXA 1WLMA 1GGWA 3O78A 4ETOA 4PHKA 4AOMA 1KK8B 2PRUA 3IF7A 3KF9A 4YGCB 2JNFA 4N1GA 2JXLA 1JSAA 2AUCA 2BCXA 1S6CA 2K2FA 2JC2A 2BL0C 1XYDA 1S5GZ 1FBVA 1L2OB 4ORCB 4C0KA 5CSFA 2CCMA 3I5HC 3CR4X 2JPTA 3OP0A 4GAOA 5K89A 2I18A 1L2OC 3PATA 1RWYA 2KSPA 2V53A 3JVTB 5AXIA 1PVBA 2ZNEA 2KYCA 2OTGB 2K7DA 2L5XB 1QTXA 3CS1A 1DJXA 3WHTB 4USLA 1M45A 1J7RA 2LP3A 1DF0B 1QLKA 1KK8C 3I5FB 4MLWA 1S6JA 3KPXA 2LM5A 3RM1A 4Q04A 2I2RE 3VRRA 1SL8A 1NX0A 3OX5A 1B8RA 1HQVA 1KQMB 3KO0A 2LE9B 2KOTA 3GK2A 3GK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE4 A;  1QAT A;  4ICB A;  4MRY A;  4NDD A;  4ZCV A;  1B4C A;  3D10 A;  1K90 D;  5F6T A;  3HX4 A;  4YRU A;  1NPQ A;  2PAL A;  2BEC A;  1LVC D;  2HQ8 A;  4YI8 A;  1KSO A;  2D8N A;  3FWB A;  4IL1 A;  4DS7 A;  1IQ5 A;  1NP8 A;  3ICB A;  5GQQ C;  1X02 A;  1BR4 B;  3BXK A;  1IQ3 A;  1YUS A;  4GFT A;  2M8U A;  2MJW B;  1CFC A;  2LUC A;  1DJI A;  1SYM A;  1V1G A;  4WRI A;  5KU1 A;  1UWO A;  4GUK A;  3EK7 A;  3EVV A;  1EJ3 A;  2PAS A;  4MVF A;  4MBE A;  1Q80 A;  2ZN8 A;  3F45 A;  1SL9 A;  2F33 A;  2PMY A;  1LIN A;  4CID A;  3NSK A;  3LLE A;  1SCV A;  1Y0V H;  3CWG A;  1WDC B;  3EK8 A;  3TDZ A;  2KHN A;  4YGD B;  3KEV A;  5AAN A;  1BT6 A;  2K61 A;  3H4S E;  1UHJ A;  1NX3 A;  2M0R A;  5I8N A;  1NCZ A;  3IQO A;  3JVT C;  2MLF C;  3VRN A;  1OE9 B;  1OMR A;  1CB1 A;  5KTY A;  2LVV A;  1CKK A;  2JRF A;  1ZAC A;  3LL8 B;  4OKH A;  2HET A;  4ORA B;  1C07 A;  4PHJ A;  1CLB A;  1S1E A;  4YGB B;  1VRK A;  2NCP A;  4MN0 A;  1AJ4 A;  1MHO A;  1SPY A;  1YX7 A;  1KQV A;  1JF0 A;  3BUW B;  3EK4 A;  1YX8 A;  2K0J A;  2HQW A;  1TOP A;  3I5G C;  2M7N A;  3O4Y A;  3BUM B;  2H61 A;  4A4C A;  5J3X A;  4XJK A;  1QV0 A;  3MSE B;  1K2H A;  2VRG A;  1FI5 A;  1K95 A;  3OX6 A;  1YRT B;  1V1F A;  3D0Y B;  3PN7 B;  3TUY B;  2JQ6 A;  2LLU A;  2I94 A;  3DF0 A;  1CLL A;  2WND A;  4JWQ A;  2MHH A;  1SBJ A;  3PLF B;  1LA0 A;  2BCB A;  1JWD A;  4CPV A;  2ZRS A;  3OHM B;  1A4P A;  1DJG A;  1YRU B;  1OQP A;  2KFH A;  4HRH A;  5FYX A;  4F0Z B;  4ORB B;  3ZWH A;  1C7W A;  1AUI B;  2FOT A;  1J7Q A;  2KYF A;  3I5F C;  1TCO B;  3SIB A;  1G4Y R;  1GQM A;  4U8D A;  1KK7 Z;  1XK4 C;  1KWO B;  4DRW A;  4M2O A;  1KFX L;  2F3Z A;  1CTR A;  1YR5 A;  2LHI A;  2LUX A;  2NCO A;  5HLO A;  3LCP C;  1N0Y A;  1GGZ A;  2EHB A;  4MZK A;  4R1E A;  1MR8 A;  2EGD A;  1AVS A;  1QX2 A;  2PVB A;  4NQG A;  3PN7 C;  1GJY A;  1TCF A;  1FW4 A;  4JQ0 D;  3TDU A;  3TUY C;  1QJT A;  3EVR A;  2O5G A;  1CMF A;  4PCW A;  3K21 A;  3LK0 A;  1JFJ A;  3PAL A;  1ALV A;  4NDC A;  3TS5 B;  1U5I A;  1NUB A;  4OCI A;  4PHN A;  3DVJ A;  1Y1A A;  2Q4U A;  1XFU O;  1CFP A;  1SR6 C;  3BQ3 A;  2CNP A;  3NXA A;  3WXA A;  1TRF A;  1EL4 A;  1Y1X A;  4D1E A;  2Y4Q A;  1NYA A;  4YGA A;  4I5N B;  4JPZ B;  4C0L A;  1SKT A;  2JUL A;  3GOF A;  5PAL A;  1PSB A;  1YTZ C;  4XYN A;  1IJ5 A;  2CBL A;  2K2A A;  2H61 C;  2L2E A;  3CZT X;  5B8I B;  2MA2 A;  3SIA A;  1SNL A;  2WOS A;  1J7P A;  2BBM A;  5ER5 A;  1S5G Y;  2KAX A;  3AKB A;  3BOW A;  4TNC A;  2M97 A;  2K8M B;  2KBM A;  1NSH A;  1WDC C;  2MRD A;  2E30 A;  2K7C A;  4OR9 B;  1M31 A;  2GV5 A;  2ZND A;  4C0J A;  1DT7 B;  1K8U A;  4GGF A;  2LLS A;  1IG5 A;  1MUX A;  3DVM A;  1NWD A;  3I5I C;  4MEW A;  1UUS A;  2L0P A;  2KI4 B;  1QLS A;  1MXL C;  4QJ5 B;  5ER4 X;  1FF1 A;  2KI4 C;  1TIZ A;  5HKZ A;  4BY5 A;  1C7V A;  1H8B A;  4I5L B;  1DF0 A;  5CPV A;  2GGM A;  1OOJ A;  1BLQ A;  4HRG A;  1KSM A;  4PE4 A;  3AAK A;  1XO5 A;  2JWW A;  2F2O A;  1F4O A;  2KDH A;  2M49 B;  4CLN A;  3OB1 B;  1QS7 A;  4MZJ A;  1K93 D;  2LMU A;  1EG3 A;  1KQM C;  3PSR A;  4P5O E;  2P6B B;  2JT0 A;  1MQ1 A;  5BPJ A;  1XFW O;  1JFK A;  2JXC A;  1OSA A;  1CDP A;  3EVU A;  4AQI A;  2M3W A;  1YUR A;  3BUN B;  1RTP 1;  1IJ6 A;  1S36 A;  4XJK B;  2KFG A;  2CTN A;  1QX7 A;  1LA3 A;  1DTL A;  3JTD B;  1B47 A;  2LAP A;  5HYD A;  2MBX A;  2LHL A;  1OMV A;  1A29 A;  1ZUZ A;  1M63 B;  2KNE A;  2NZ0 A;  2G9B A;  3I5H B;  2F2P A;  2KI6 C;  2LNK A;  1LKJ A;  1ZOT B;  1DGV A;  2FCE A;  1NX1 A;  1CFD A;  1UUR A;  2LC5 A;  2QPT A;  3BOW B;  5AER A;  1UHN A;  2M7L A;  1A75 A;  1CFF A;  1B7T Y;  2EC6 B;  1CNP A;  2AAO A;  2I7A A;  2FCD A;  4DUQ A;  2EC6 C;  2ZKM X;  1ZFS A;  2CT9 A;  1D1O A;  1F70 A;  3TZ1 A;  2LVJ A;  1CM4 A;  3EKJ A;  4PE7 A;  3VRP A;  3SG6 A;  2KFF A;  1J1E A;  2B1U A;  3CLN A;  3NSI A;  3NSL A;  1QIW A;  3ZNI A;  1BJF A;  1QIV A;  1REC A;  2WOR A;  3VRQ A;  1F54 A;  1J55 A;  2H2K A;  2WCB A;  1CDL A;  1W7J B;  1UHK A;  4PHM A;  3C1V A;  3DVK A;  4L9M A;  1MF8 B;  1IRJ A;  3FIA A;  1KFX S;  3FS7 A;  1Y6W A;  5CSI A;  3PFV A;  2LMT A;  1G33 A;  2MAZ A;  4YI9 A;  5AFP A;  1KK7 Y;  5G08 A;  1BU3 A;  2JU0 A;  3HCM A;  1YUU A;  2M9G A;  5JJG A;  4CFQ A;  1TNQ A;  2KGR A;  1BG1 A;  4BY4 A;  4GPL B;  2LP2 A;  1RJV A;  3FWC A;  4I5J A;  1CMG A;  1K94 A;  1KFU S;  1K9U A;  1XFY O;  2G2B A;  3I5G B;  1H4B A;  4A4B A;  3M0W A;  1FPW A;  1XFX O;  1UHI A;  1QVI Y;  2Y1M A;  1DGU A;  4PAL A;  1XFV O;  1N65 A;  4PE0 A;  2QAC A;  2ZRT A;  2K7B A;  2GGZ A;  1K9K A;  1NCY A;  4AQJ A;  2COL B;  1G8I A;  1F71 A;  1NIW A;  1EG4 A;  1DVI A;  1Y1U A;  2LAN A;  3KHE A;  3PM8 A;  1SRA A;  4GBA A;  4GGN A;  1SCM B;  2LCP A;  1TNP A;  1RRO A;  1ZMZ A;  2JOJ A;  1KWO C;  5DKN A;  2BKH B;  1A2X A;  1JC2 A;  1B8L A;  1XFZ O;  3OB2 B;  2Q91 A;  1QX5 B;  4HRE E;  2ISD A;  1YVL A;  4QJ3 B;  3WNX B;  4I5K A;  2KI6 D;  3A8R A;  1IWQ A;  1TN4 A;  2F8P A;  2ZN9 A;  1A75 B;  2BL0 B;  5CSN A;  5DKR A;  2RGI A;  4M2P A;  4WQ2 A;  1OZO A;  1YVH A;  2IS9 A;  1AHR A;  1SCM C;  4PDZ A;  4YGE B;  4QJ4 B;  1S26 D;  2PSR A;  3VRO A;  2ZFD A;  1QXP A;  3JTD C;  2JTZ A;  2BE6 A;  2TN4 A;  4OV2 A;  2WCF A;  1N2D A;  1QVI Z;  3RLZ A;  3DVE A;  1BOC A;  2KAV A;  1S6I A;  2O60 A;  2OS8 C;  3CTN A;  4MSP A;  4UPG A;  1CDN A;  2L4I A;  4PE1 A;  5AEQ A;  3TDI A;  1B9A A;  2BCA A;  2BKI B;  5HLV A;  1TNX A;  5TNC A;  1UP5 A;  5I2O A;  3BUX B;  2NXQ A;  2KQ6 A;  1U5I B;  4N5X A;  1DJH A;  2WCE A;  2LV7 A;  1F55 A;  1SW8 A;  4MZL A;  1K96 A;  2KAY A;  1DJW A;  3BUO B;  1WRZ A;  3SG7 A;  1A03 A;  2JTT A;  2A4J A;  1MXE A;  4CFR A;  4OVN F;  1CDM A;  4FTG A;  5KSZ A;  2L98 A;  1EH2 A;  4FQO A;  2HPS A;  3CR5 X;  1EXR A;  3AAJ A;  1RK9 A;  1OMD A;  1E8A A;  2JT8 A;  4WQ3 A;  2K7O A;  3CR2 A;  4GGF C;  1SY9 A;  3CGA A;  3IQQ A;  3SG3 A;  1ALW A;  1UHH A;  3O6B A;  5HKW A;  3EKH A;  1PSR A;  1WY9 A;  1BMO A;  1XVJ A;  1K9P A;  4M2Q A;  1R2U A;  1SL7 A;  1BF5 A;  1PRW A;  5IBW A;  2CXJ A;  1J1D A;  1HT9 A;  2JT3 A;  5I2L A;  1QAS A;  4HSZ A;  4DIR A;  1AK8 A;  2DOQ A;  2LVI A;  1PUL A;  4YBH B;  1WRL A;  2NLN A;  2M1K B;  3NSO A;  4E68 A;  1JBA A;  1M46 A;  1PAL A;  1NX2 A;  5I2Q A;  2LVK A;  1J7O A;  1DMO A;  3O2P A;  5D69 A;  2KBI A;  2Y1N A;  4N1F A;  1M39 A;  2KGB C;  2L50 A;  5HKY A;  1AP4 A;  1B7T Z;  1TTX A;  1WRK A;  3BYA A;  1YUT A;  3A4U B;  2OPO A;  2WC8 A;  4MRX A;  1FI6 A;  1B1G A;  2SAS A;  2F3Y A;  2BBN A;  1OZS A;  1DJY A;  2L4H A;  1F8H A;  3QRX A;  2OTG C;  1F4Q A;  2LMV A;  3SJS A;  2OS8 B;  1AJ5 A;  1SMG A;  4P2Y B;  1WLZ A;  3SG4 A;  1B8C A;  5CSJ A;  2L51 A;  1KFU L;  2Y5I A;  4NDB A;  5DKQ A;  1ODB A;  2MLE C;  1PK0 D;  2HF5 A;  3I5I B;  2KQY A;  2SCP A;  1MWN A;  1KCY A;  3TS5 C;  1W7I B;  1CLM A;  2M29 A;  1JUO A;  4GNK B;  3WHU B;  1PVA A;  4ZCU A;  3E3R A;  1XA5 A;  3GK4 X;  1QV1 A;  3AKA A;  5D7F A;  2E6W A;  1R6P A;  1CM1 A;  1TNW A;  1IGV A;  1BR1 B;  1SK6 D;  1S3P A;  2FJU B;  2AMI A;  1L7Z A;  3LK1 A;  1BOD A;  3D0Y A;  2R2I A;  1XK4 A;  1JF2 A;  1RFJ A;  3DD4 A;  1SR6 B;  1LXF C;  1IKU A;  2JZI A;  2M1U A;  4DCK A;  2LLT A;  3SG2 A;  2JNX A;  1IH0 A;  3VGO A;  5JOL A;  3DF0 B;  3SG5 A;  1DJZ A;  1NCX A;  1WLM A;  1GGW A;  3O78 A;  4ETO A;  4PHK A;  4AOM A;  1KK8 B;  2PRU A;  3IF7 A;  3KF9 A;  4YGC B;  2JNF A;  4N1G A;  2JXL A;  1JSA A;  2AUC A;  2BCX A;  1S6C A;  2K2F A;  2JC2 A;  2BL0 C;  1XYD A;  1S5G Z;  1FBV A;  1L2O B;  4ORC B;  4C0K A;  5CSF A;  2CCM A;  3I5H C;  3CR4 X;  2JPT A;  3OP0 A;  4GAO A;  5K89 A;  2I18 A;  1L2O C;  3PAT A;  1RWY A;  2KSP A;  2V53 A;  3JVT B;  5AXI A;  1PVB A;  2ZNE A;  2KYC A;  2OTG B;  2K7D A;  2L5X B;  1QTX A;  3CS1 A;  1DJX A;  3WHT B;  4USL A;  1M45 A;  1J7R A;  2LP3 A;  1DF0 B;  1QLK A;  1KK8 C;  3I5F B;  4MLW A;  1S6J A;  3KPX A;  2LM5 A;  3RM1 A;  4Q04 A;  2I2R E;  3VRR A;  1SL8 A;  1NX0 A;  3OX5 A;  1B8R A;  1HQV A;  1KQM B;  3KO0 A;  2LE9 B;  2KOT A;  3GK2 A;  3GK1 A; 
#chains in the Genus database with same CATH topology
 2BE4 A;  1QAT A;  4ICB A;  4MRY A;  4NDD A;  4ZCV A;  3S0A A;  3DZT A;  1B4C A;  3D10 A;  1K90 D;  5F6T A;  3CYZ A;  3HX4 A;  4YRU A;  1NPQ A;  5I94 A;  2PAL A;  3D77 A;  2BEC A;  1LVC D;  2HQ8 A;  4YI8 A;  1KSO A;  2D8N A;  3FWB A;  4IL1 A;  4DS7 A;  1IQ5 A;  1NP8 A;  4IJ7 A;  3ICB A;  5GQQ C;  1X02 A;  1BR4 B;  3BXK A;  1IQ3 A;  1YUS A;  4GFT A;  3S0D A;  2M8U A;  2MJW B;  5D3O A;  1CFC A;  2LUC A;  1DJI A;  1SYM A;  1V1G A;  4WRI A;  5KU1 A;  1UWO A;  4GUK A;  3EK7 A;  3EVV A;  1EJ3 A;  2PAS A;  2QDI A;  4MVF A;  1OOG A;  1Q80 A;  4MBE A;  2ZN8 A;  3F45 A;  1SL9 A;  2F33 A;  2PMY A;  3SS4 A;  1LIN A;  4CID A;  3NSK A;  3FE9 A;  3LLE A;  1LS8 A;  1SCV A;  1Y0V H;  3CWG A;  1WDC B;  3EK8 A;  3QME A;  3TDZ A;  2KHN A;  4YGD B;  3KEV A;  5AAN A;  1BT6 A;  2K61 A;  3H4S E;  1UHJ A;  1NX3 A;  1W9Z A;  3D73 A;  2M0R A;  5I8N A;  1NCZ A;  3IQO A;  3JVT C;  2MLF C;  3VRN A;  1OE9 B;  1OMR A;  1CB1 A;  5KTY A;  2LVV A;  1CKK A;  2JRF A;  1ZAC A;  2BNX A;  3LL8 B;  4OKH A;  2HET A;  4ORA B;  1C07 A;  4PHJ A;  1CLB A;  1S1E A;  4YGB B;  1VRK A;  2NCP A;  4MN0 A;  1AJ4 A;  1MHO A;  1SPY A;  1YX7 A;  1KQV A;  1JF0 A;  3R72 A;  3BUW B;  3EK4 A;  1YX8 A;  3L47 A;  2K0J A;  2HQW A;  1TOP A;  3I5G C;  2M7N A;  3O4Y A;  3BUM B;  2H61 A;  4A4C A;  5J3X A;  4XJK A;  1QV0 A;  3MSE B;  1K2H A;  2VRG A;  1FI5 A;  4KYN A;  1K95 A;  3OX6 A;  1YRT B;  2PYQ A;  1V1F A;  3D0Y B;  3PN7 B;  3TUY B;  1C3Y A;  2JQ6 A;  2LLU A;  1IIO A;  2I94 A;  3DF0 A;  1CLL A;  2WND A;  4JWQ A;  2MHH A;  1SBJ A;  3PLF B;  3UO9 A;  1LA0 A;  2BCB A;  2L2C A;  4CPV A;  1JWD A;  1Z2C B;  2ZRS A;  3OHM B;  1A4P A;  1DJG A;  1YRU B;  1OQP A;  2KFH A;  3DY9 A;  4HRH A;  5FYX A;  4ORB B;  3ZWH A;  4F0Z B;  1C7W A;  1AUI B;  2FOT A;  3D78 A;  1J7Q A;  2KYF A;  3I5F C;  1TCO B;  3SIB A;  1G4Y R;  1GQM A;  4U8D A;  1KK7 Z;  1XK4 C;  1KWO B;  4DRW A;  4M2O A;  1KFX L;  2F3Z A;  1CTR A;  1YR5 A;  2LHI A;  2LUX A;  2NCO A;  3K1E A;  3LCP C;  5HLO A;  1N0Y A;  1GGZ A;  2EHB A;  4MZK A;  4R1E A;  1MR8 A;  2EGD A;  1AVS A;  1QX2 A;  2PVB A;  4NQG A;  3PN7 C;  1GJY A;  1TCF A;  1FW4 A;  3DYE A;  4JQ0 D;  3S0E A;  3TDU A;  1QJT A;  3TUY C;  3EVR A;  2O5G A;  1CMF A;  4PCW A;  3K21 A;  3LK0 A;  1JFJ A;  3PAL A;  3R1V A;  1ALV A;  4NDC A;  3TS5 B;  1U5I A;  1NUB A;  4OCI A;  4PHN A;  3DVJ A;  1Y1A A;  2Q4U A;  2WCJ A;  1XFU O;  1CFP A;  1SR6 C;  1T14 A;  2CNP A;  3BQ3 A;  1DQE A;  3NXA A;  3WXA A;  3BFB A;  1TRF A;  1EL4 A;  1Y1X A;  2WCK A;  4D1E A;  2Y4Q A;  1NYA A;  4YGA A;  4I5N B;  4JPZ B;  4C0L A;  1SKT A;  2JUL A;  3GOF A;  5PAL A;  1PSB A;  1YTZ C;  4XYN A;  1IJ5 A;  2CBL A;  2K2A A;  2H61 C;  2L2E A;  3CZT X;  5B8I B;  2MA2 A;  3SIA A;  1SNL A;  2WOS A;  1J7P A;  2BBM A;  5ER5 A;  1S5G Y;  2KAX A;  3AKB A;  3BOW A;  1C3Z A;  4TNC A;  2M97 A;  2K8M B;  3N7H A;  2KBM A;  1NSH A;  1WDC C;  2MRD A;  2E30 A;  2K7C A;  3CZ0 A;  4OR9 B;  1M31 A;  2GV5 A;  2ZND A;  3NHT A;  4C0J A;  1DT7 B;  1K8U A;  4GGF A;  2LLS A;  1IG5 A;  1MUX A;  3DVM A;  1NWD A;  3I5I C;  4JD9 A;  4MEW A;  1UUS A;  2L0P A;  2KI4 B;  1SSE B;  1QLS A;  3L4A A;  1MXL C;  4QJ5 B;  5ER4 X;  1FF1 A;  2KI4 C;  3O4X A;  1TIZ A;  5HKZ A;  2FJY A;  5DIC A;  4BY5 A;  1C7V A;  1GM0 A;  1H8B A;  4I5L B;  1DF0 A;  5CPV A;  2GGM A;  1OOJ A;  4FQT A;  1BLQ A;  4HRG A;  1KSM A;  4PE4 A;  3AAK A;  1XO5 A;  3D74 A;  2JWW A;  2F2O A;  1F4O A;  2KDH A;  2M49 B;  4CLN A;  5EL2 A;  5AER A;  3OB1 B;  1QS7 A;  4MZJ A;  1K93 D;  2LMU A;  1EG3 A;  1KQM C;  2L5Y A;  3PSR A;  4P5O E;  2P6B B;  2JT0 A;  1MQ1 A;  5BPJ A;  1XFW O;  1JFK A;  2JXC A;  1OSA A;  3CZ2 A;  1CDP A;  3EVU A;  4AQI A;  2M3W A;  1YUR A;  3BUN B;  1RTP 1;  1IJ6 A;  1S36 A;  4XJK B;  2KFG A;  2CTN A;  1QX7 A;  3D76 A;  1LA3 A;  1DTL A;  3JTD B;  1B47 A;  2LAP A;  3PJI A;  5HYD A;  2MBX A;  2LHL A;  1OMV A;  1A29 A;  1ZUZ A;  1M63 B;  2KNE A;  2NZ0 A;  2G9B A;  3I5H B;  2F2P A;  2KI6 C;  2LNK A;  1LKJ A;  1ZOT B;  1DGV A;  1NX1 A;  1CFD A;  1UUR A;  2FCE A;  2LC5 A;  2QPT A;  3BOW B;  3EG5 B;  1UHN A;  2M7L A;  1A75 A;  1CFF A;  1B7T Y;  2EC6 B;  1CNP A;  3Q8I A;  3UNW A;  2AAO A;  2I7A A;  1DC1 A;  2FCD A;  4JKT A;  4DUQ A;  2EC6 C;  2ZKM X;  1ZFS A;  2CT9 A;  3RZS A;  3B88 A;  1ORG A;  2WCL A;  1D1O A;  5FI7 A;  1F70 A;  3TZ1 A;  2LVJ A;  1CM4 A;  1TUZ A;  3EKJ A;  4PE7 A;  3VRP A;  3SG6 A;  2KFF A;  1J1E A;  2B1U A;  3CLN A;  3NSI A;  3NSL A;  5FI6 A;  4OZD A;  1QIW A;  3ZNI A;  1BJF A;  1QIV A;  1REC A;  2WOR A;  3R1O A;  3VRQ A;  1F54 A;  1J55 A;  2H2K A;  2WCB A;  1CDL A;  1W7J B;  1UHK A;  4PHM A;  3C1V A;  3DVK A;  4INX A;  4L9M A;  1MF8 B;  1IRJ A;  3FIA A;  1KFX S;  3FS7 A;  1Y6W A;  5CSI A;  3PFV A;  2LMT A;  1G33 A;  2MAZ A;  4YI9 A;  5AFP A;  1KK7 Y;  5G08 A;  1BU3 A;  2JU0 A;  2KLD A;  3BJH A;  2PQL A;  1YUU A;  2M9G A;  2QEH A;  3HCM A;  5JJG A;  2QEO A;  4PT1 A;  4CFQ A;  1TNQ A;  2KGR A;  1BG1 A;  4BY4 A;  4GPL B;  2LP2 A;  1RJV A;  3FWC A;  4I5J A;  1CMG A;  1K94 A;  1KFU S;  1K9U A;  1XFY O;  2QEB A;  2G2B A;  3I5G B;  1H4B A;  4A4B A;  3M0W A;  1FPW A;  1XFX O;  1UHI A;  1QVI Y;  2Y1M A;  1DGU A;  4PAL A;  1XFV O;  1N65 A;  2ERB A;  4PE0 A;  2QAC A;  2ZRT A;  2K7B A;  2GGZ A;  1K9K A;  1NCY A;  4AQJ A;  2COL B;  1G8I A;  1F71 A;  1NIW A;  1EG4 A;  1DVI A;  1Y1U A;  2LAN A;  3KHE A;  3PM8 A;  1SRA A;  4GBA A;  4GGN A;  1SCM B;  2LCP A;  1TNP A;  1P28 A;  1RRO A;  3V2L A;  1ZMZ A;  2JOJ A;  1KWO C;  5DKN A;  2BKH B;  1A2X A;  1JC2 A;  1B8L A;  1XFZ O;  3OB2 B;  2Q91 A;  1QX5 B;  4HRE E;  2ISD A;  1YVL A;  4QJ3 B;  3CAB A;  3WNX B;  4I5K A;  2KI6 D;  3A8R A;  1IWQ A;  1TN4 A;  2F8P A;  2ZN9 A;  3S0B A;  3L4L A;  1A75 B;  2BL0 B;  5CSN A;  5DKR A;  2RGI A;  4M2P A;  4WQ2 A;  1OZO A;  1YVH A;  2IS9 A;  3CZ1 A;  1AHR A;  1SCM C;  4PDZ A;  4YGE B;  4QJ4 B;  1S26 D;  2PSR A;  3VRO A;  2ZFD A;  2P70 A;  1OOI X;  1QXP A;  3JTD C;  2JTZ A;  3CDN A;  2BE6 A;  2TN4 A;  4OV2 A;  2WCF A;  1N2D A;  1QVI Z;  1Z4H A;  3RLZ A;  2P71 A;  3DVE A;  1BOC A;  2KAV A;  1S6I A;  2JPO A;  2O60 A;  2OS8 C;  3CTN A;  1DEK A;  4MSP A;  4UPG A;  1CDN A;  2L4I A;  4PE1 A;  5AEQ A;  3TDI A;  1B9A A;  2BCA A;  2BKI B;  5HLV A;  1TNX A;  5TNC A;  1DEL A;  1UP5 A;  1OOH A;  3BUX B;  5I2O A;  2NXQ A;  2KQ6 A;  1U5I B;  2YGU A;  1DJH A;  2WCE A;  4N5X A;  3SS5 A;  2LV7 A;  1F55 A;  1SW8 A;  4MZL A;  1K96 A;  2KAY A;  1DJW A;  3BUO B;  1WRZ A;  1TUJ A;  3SG7 A;  1A03 A;  2JTT A;  2A4J A;  1MXE A;  4CFR A;  4OVN F;  1CDM A;  4FTG A;  5KSZ A;  2L98 A;  1EH2 A;  4FQO A;  2GTE A;  2HPS A;  3CR5 X;  1EXR A;  3AAJ A;  1RK9 A;  1OMD A;  1E8A A;  3FE6 A;  4F7F A;  2WCM A;  2JT8 A;  4WQ3 A;  2K7O A;  3CR2 A;  4GGF C;  1SY9 A;  3CGA A;  3IQQ A;  4INW A;  3SG3 A;  1ALW A;  1UHH A;  3O6B A;  5HKW A;  1QWV A;  3EKH A;  1PSR A;  1WY9 A;  1BMO A;  3B86 A;  1XVJ A;  1K9P A;  4M2Q A;  1R2U A;  3R1P A;  1SL7 A;  1BF5 A;  3B87 A;  3FE8 A;  1PRW A;  2WCH A;  5IBW A;  2CXJ A;  1J1D A;  1HT9 A;  2JT3 A;  5I2L A;  1QAS A;  4HSZ A;  4DIR A;  1AK8 A;  2DOQ A;  2LVI A;  1PUL A;  4YBH B;  1WRL A;  2NLN A;  2M1K B;  3NSO A;  4E68 A;  2QEV A;  2WC6 A;  1JBA A;  2H8V A;  1M46 A;  1PAL A;  1NX2 A;  5I2Q A;  2LVK A;  1J7O A;  3OGN A;  1DMO A;  3O2P A;  5D69 A;  2KBI A;  2Y1N A;  4N1F A;  1M39 A;  2KGB C;  2L50 A;  5HKY A;  1AP4 A;  1B7T Z;  1TTX A;  1WRK A;  3BYA A;  1YUT A;  3A4U B;  2OPO A;  2WC8 A;  4MRX A;  1FI6 A;  2KPH A;  3DXL A;  1B1G A;  2SAS A;  2F3Y A;  2BBN A;  1OZS A;  1DJY A;  2L4H A;  1F8H A;  3QRX A;  2OTG C;  1F4Q A;  2LMV A;  3SJS A;  2OS8 B;  1AJ5 A;  1SMG A;  1XFR A;  4P2Y B;  3BFH A;  1WLZ A;  3SG4 A;  1B8C A;  5CSJ A;  3B6X A;  2L51 A;  5HL1 A;  1KFU L;  2Y5I A;  4NDB A;  5DKQ A;  1ODB A;  2MLE C;  1TWO A;  1PK0 D;  2HF5 A;  3I5I B;  2KQY A;  2SCP A;  1MWN A;  1KCY A;  3TS5 C;  1W7I B;  1CLM A;  2M29 A;  1JUO A;  4GNK B;  3WHU B;  1PVA A;  4ZCU A;  3E3R A;  1XA5 A;  3GK4 X;  1QV1 A;  3AKA A;  5D7F A;  2E6W A;  1R6P A;  3BFA A;  1CM1 A;  1TNW A;  1IGV A;  1BR1 B;  1SK6 D;  1S3P A;  2FJU B;  2AMI A;  1L7Z A;  3LK1 A;  1BOD A;  3D0Y A;  2R2I A;  1XK4 A;  3OBV A;  1JF2 A;  1OOF A;  1RFJ A;  3DD4 A;  1SR6 B;  1LXF C;  1IKU A;  2JZI A;  2M1U A;  4DCK A;  3SS3 A;  2LLT A;  2WC5 A;  3SG2 A;  2JNX A;  1IH0 A;  3S0G A;  3VGO A;  5JOL A;  3DF0 B;  2K60 A;  3SG5 A;  1DJZ A;  3NGV A;  1OW4 A;  1NCX A;  1WLM A;  1GGW A;  3O78 A;  4ETO A;  4PHK A;  4AOM A;  1KK8 B;  2PRU A;  3IF7 A;  3KF9 A;  3IVT A;  2BAP A;  2JNF A;  4N1G A;  2JXL A;  4YGC B;  1JSA A;  2AUC A;  2BCX A;  1S6C A;  2K2F A;  2JC2 A;  3B7A A;  3S0F A;  2BL0 C;  1XYD A;  1S5G Z;  3NHI A;  1FBV A;  1L2O B;  4ORC B;  4C0K A;  5CSF A;  2CCM A;  3I5H C;  3CR4 X;  2JPT A;  3OP0 A;  4GAO A;  5K89 A;  1L2O C;  2I18 A;  3PAT A;  1RWY A;  2KSP A;  2V53 A;  3JVT B;  5AXI A;  3VB1 A;  1PVB A;  2ZNE A;  2KYC A;  2OTG B;  2K7D A;  2L5X B;  1QTX A;  3CS1 A;  1DJX A;  3WHT B;  4USL A;  1M45 A;  1J7R A;  2LP3 A;  1DF0 B;  3D75 A;  3PM2 A;  1QLK A;  1KK8 C;  3I5F B;  4MLW A;  1S6J A;  3KPX A;  2KLE A;  2LM5 A;  3RM1 A;  5FI2 A;  4Q04 A;  2I2R E;  3VRR A;  1SL8 A;  1NX0 A;  3OX5 A;  1B8R A;  1HQV A;  1KQM B;  3KO0 A;  2LE9 B;  2KOT A;  3GK2 A;  3GK1 A; 
#chains in the Genus database with same CATH homology
 2BE4 A;  1QAT A;  4ICB A;  4MRY A;  4NDD A;  4ZCV A;  1B4C A;  3D10 A;  1K90 D;  5F6T A;  3HX4 A;  4YRU A;  1NPQ A;  2PAL A;  2BEC A;  1LVC D;  2HQ8 A;  4YI8 A;  1KSO A;  2D8N A;  3FWB A;  4IL1 A;  4DS7 A;  1IQ5 A;  1NP8 A;  3ICB A;  5GQQ C;  1X02 A;  1BR4 B;  3BXK A;  1IQ3 A;  1YUS A;  4GFT A;  2M8U A;  2MJW B;  1CFC A;  2LUC A;  1DJI A;  1SYM A;  1V1G A;  4WRI A;  5KU1 A;  1UWO A;  4GUK A;  3EK7 A;  3EVV A;  1EJ3 A;  2PAS A;  4MVF A;  4MBE A;  1Q80 A;  2ZN8 A;  3F45 A;  1SL9 A;  2F33 A;  2PMY A;  1LIN A;  4CID A;  3NSK A;  3LLE A;  1SCV A;  1Y0V H;  3CWG A;  1WDC B;  3EK8 A;  3TDZ A;  2KHN A;  4YGD B;  3KEV A;  5AAN A;  1BT6 A;  2K61 A;  3H4S E;  1UHJ A;  1NX3 A;  2M0R A;  5I8N A;  1NCZ A;  3IQO A;  3JVT C;  2MLF C;  3VRN A;  1OE9 B;  1OMR A;  1CB1 A;  5KTY A;  2LVV A;  1CKK A;  2JRF A;  1ZAC A;  3LL8 B;  4OKH A;  2HET A;  4ORA B;  1C07 A;  4PHJ A;  1CLB A;  1S1E A;  4YGB B;  1VRK A;  2NCP A;  4MN0 A;  1AJ4 A;  1MHO A;  1SPY A;  1YX7 A;  1KQV A;  1JF0 A;  3BUW B;  3EK4 A;  1YX8 A;  2K0J A;  2HQW A;  1TOP A;  3I5G C;  2M7N A;  3O4Y A;  3BUM B;  2H61 A;  4A4C A;  5J3X A;  4XJK A;  1QV0 A;  3MSE B;  1K2H A;  2VRG A;  1FI5 A;  1K95 A;  3OX6 A;  1YRT B;  1V1F A;  3D0Y B;  3PN7 B;  3TUY B;  2JQ6 A;  2LLU A;  2I94 A;  3DF0 A;  1CLL A;  2WND A;  4JWQ A;  2MHH A;  1SBJ A;  3PLF B;  1LA0 A;  2BCB A;  1JWD A;  4CPV A;  2ZRS A;  3OHM B;  1A4P A;  1DJG A;  1YRU B;  1OQP A;  2KFH A;  4HRH A;  5FYX A;  4F0Z B;  4ORB B;  3ZWH A;  1C7W A;  1AUI B;  2FOT A;  1J7Q A;  2KYF A;  3I5F C;  1TCO B;  3SIB A;  1G4Y R;  1GQM A;  4U8D A;  1KK7 Z;  1XK4 C;  1KWO B;  4DRW A;  4M2O A;  1KFX L;  2F3Z A;  1CTR A;  1YR5 A;  2LHI A;  2LUX A;  2NCO A;  5HLO A;  3LCP C;  1N0Y A;  1GGZ A;  2EHB A;  4MZK A;  4R1E A;  1MR8 A;  2EGD A;  1AVS A;  1QX2 A;  2PVB A;  4NQG A;  3PN7 C;  1GJY A;  1TCF A;  1FW4 A;  4JQ0 D;  3TDU A;  3TUY C;  1QJT A;  3EVR A;  2O5G A;  1CMF A;  4PCW A;  3K21 A;  3LK0 A;  1JFJ A;  3PAL A;  1ALV A;  4NDC A;  3TS5 B;  1U5I A;  1NUB A;  4OCI A;  4PHN A;  3DVJ A;  1Y1A A;  2Q4U A;  1XFU O;  1CFP A;  1SR6 C;  3BQ3 A;  2CNP A;  3NXA A;  3WXA A;  1TRF A;  1EL4 A;  1Y1X A;  4D1E A;  2Y4Q A;  1NYA A;  4YGA A;  4I5N B;  4JPZ B;  4C0L A;  1SKT A;  2JUL A;  3GOF A;  5PAL A;  1PSB A;  1YTZ C;  4XYN A;  1IJ5 A;  2CBL A;  2K2A A;  2H61 C;  2L2E A;  3CZT X;  5B8I B;  2MA2 A;  3SIA A;  1SNL A;  2WOS A;  1J7P A;  2BBM A;  5ER5 A;  1S5G Y;  2KAX A;  3AKB A;  3BOW A;  4TNC A;  2M97 A;  2K8M B;  2KBM A;  1NSH A;  1WDC C;  2MRD A;  2E30 A;  2K7C A;  4OR9 B;  1M31 A;  2GV5 A;  2ZND A;  4C0J A;  1DT7 B;  1K8U A;  4GGF A;  2LLS A;  1IG5 A;  1MUX A;  3DVM A;  1NWD A;  3I5I C;  4MEW A;  1UUS A;  2L0P A;  2KI4 B;  1QLS A;  1MXL C;  4QJ5 B;  5ER4 X;  1FF1 A;  2KI4 C;  1TIZ A;  5HKZ A;  4BY5 A;  1C7V A;  1H8B A;  4I5L B;  1DF0 A;  5CPV A;  2GGM A;  1OOJ A;  1BLQ A;  4HRG A;  1KSM A;  4PE4 A;  3AAK A;  1XO5 A;  2JWW A;  2F2O A;  1F4O A;  2KDH A;  2M49 B;  4CLN A;  3OB1 B;  1QS7 A;  4MZJ A;  1K93 D;  2LMU A;  1EG3 A;  1KQM C;  3PSR A;  4P5O E;  2P6B B;  2JT0 A;  1MQ1 A;  5BPJ A;  1XFW O;  1JFK A;  2JXC A;  1OSA A;  1CDP A;  3EVU A;  4AQI A;  2M3W A;  1YUR A;  3BUN B;  1RTP 1;  1IJ6 A;  1S36 A;  4XJK B;  2KFG A;  2CTN A;  1QX7 A;  1LA3 A;  1DTL A;  3JTD B;  1B47 A;  2LAP A;  5HYD A;  2MBX A;  2LHL A;  1OMV A;  1A29 A;  1ZUZ A;  1M63 B;  2KNE A;  2NZ0 A;  2G9B A;  3I5H B;  2F2P A;  2KI6 C;  2LNK A;  1LKJ A;  1ZOT B;  1DGV A;  2FCE A;  1NX1 A;  1CFD A;  1UUR A;  2LC5 A;  2QPT A;  3BOW B;  5AER A;  1UHN A;  2M7L A;  1A75 A;  1CFF A;  1B7T Y;  2EC6 B;  1CNP A;  2AAO A;  2I7A A;  2FCD A;  4DUQ A;  2EC6 C;  2ZKM X;  1ZFS A;  2CT9 A;  1D1O A;  1F70 A;  3TZ1 A;  2LVJ A;  1CM4 A;  3EKJ A;  4PE7 A;  3VRP A;  3SG6 A;  2KFF A;  1J1E A;  2B1U A;  3CLN A;  3NSI A;  3NSL A;  1QIW A;  3ZNI A;  1BJF A;  1QIV A;  1REC A;  2WOR A;  3VRQ A;  1F54 A;  1J55 A;  2H2K A;  2WCB A;  1CDL A;  1W7J B;  1UHK A;  4PHM A;  3C1V A;  3DVK A;  4L9M A;  1MF8 B;  1IRJ A;  3FIA A;  1KFX S;  3FS7 A;  1Y6W A;  5CSI A;  3PFV A;  2LMT A;  1G33 A;  2MAZ A;  4YI9 A;  5AFP A;  1KK7 Y;  5G08 A;  1BU3 A;  2JU0 A;  3HCM A;  1YUU A;  2M9G A;  5JJG A;  4CFQ A;  1TNQ A;  2KGR A;  1BG1 A;  4BY4 A;  4GPL B;  2LP2 A;  1RJV A;  3FWC A;  4I5J A;  1CMG A;  1K94 A;  1KFU S;  1K9U A;  1XFY O;  2G2B A;  3I5G B;  1H4B A;  4A4B A;  3M0W A;  1FPW A;  1XFX O;  1UHI A;  1QVI Y;  2Y1M A;  1DGU A;  4PAL A;  1XFV O;  1N65 A;  4PE0 A;  2QAC A;  2ZRT A;  2K7B A;  2GGZ A;  1K9K A;  1NCY A;  4AQJ A;  2COL B;  1G8I A;  1F71 A;  1NIW A;  1EG4 A;  1DVI A;  1Y1U A;  2LAN A;  3KHE A;  3PM8 A;  1SRA A;  4GBA A;  4GGN A;  1SCM B;  2LCP A;  1TNP A;  1RRO A;  1ZMZ A;  2JOJ A;  1KWO C;  5DKN A;  2BKH B;  1A2X A;  1JC2 A;  1B8L A;  1XFZ O;  3OB2 B;  2Q91 A;  1QX5 B;  4HRE E;  2ISD A;  1YVL A;  4QJ3 B;  3WNX B;  4I5K A;  2KI6 D;  3A8R A;  1IWQ A;  1TN4 A;  2F8P A;  2ZN9 A;  1A75 B;  2BL0 B;  5CSN A;  5DKR A;  2RGI A;  4M2P A;  4WQ2 A;  1OZO A;  1YVH A;  2IS9 A;  1AHR A;  1SCM C;  4PDZ A;  4YGE B;  4QJ4 B;  1S26 D;  2PSR A;  3VRO A;  2ZFD A;  1QXP A;  3JTD C;  2JTZ A;  2BE6 A;  2TN4 A;  4OV2 A;  2WCF A;  1N2D A;  1QVI Z;  3RLZ A;  3DVE A;  1BOC A;  2KAV A;  1S6I A;  2O60 A;  2OS8 C;  3CTN A;  4MSP A;  4UPG A;  1CDN A;  2L4I A;  4PE1 A;  5AEQ A;  3TDI A;  1B9A A;  2BCA A;  2BKI B;  5HLV A;  1TNX A;  5TNC A;  1UP5 A;  5I2O A;  3BUX B;  2NXQ A;  2KQ6 A;  1U5I B;  4N5X A;  1DJH A;  2WCE A;  2LV7 A;  1F55 A;  1SW8 A;  4MZL A;  1K96 A;  2KAY A;  1DJW A;  3BUO B;  1WRZ A;  3SG7 A;  1A03 A;  2JTT A;  2A4J A;  1MXE A;  4CFR A;  4OVN F;  1CDM A;  4FTG A;  5KSZ A;  2L98 A;  1EH2 A;  4FQO A;  2HPS A;  3CR5 X;  1EXR A;  3AAJ A;  1RK9 A;  1OMD A;  1E8A A;  2JT8 A;  4WQ3 A;  2K7O A;  3CR2 A;  4GGF C;  1SY9 A;  3CGA A;  3IQQ A;  3SG3 A;  1ALW A;  1UHH A;  3O6B A;  5HKW A;  3EKH A;  1PSR A;  1WY9 A;  1BMO A;  1XVJ A;  1K9P A;  4M2Q A;  1R2U A;  1SL7 A;  1BF5 A;  1PRW A;  5IBW A;  2CXJ A;  1J1D A;  1HT9 A;  2JT3 A;  5I2L A;  1QAS A;  4HSZ A;  4DIR A;  1AK8 A;  2DOQ A;  2LVI A;  1PUL A;  4YBH B;  1WRL A;  2NLN A;  2M1K B;  3NSO A;  4E68 A;  1JBA A;  1M46 A;  1PAL A;  1NX2 A;  5I2Q A;  2LVK A;  1J7O A;  1DMO A;  3O2P A;  5D69 A;  2KBI A;  2Y1N A;  4N1F A;  1M39 A;  2KGB C;  2L50 A;  5HKY A;  1AP4 A;  1B7T Z;  1TTX A;  1WRK A;  3BYA A;  1YUT A;  3A4U B;  2OPO A;  2WC8 A;  4MRX A;  1FI6 A;  1B1G A;  2SAS A;  2F3Y A;  2BBN A;  1OZS A;  1DJY A;  2L4H A;  1F8H A;  3QRX A;  2OTG C;  1F4Q A;  2LMV A;  3SJS A;  2OS8 B;  1AJ5 A;  1SMG A;  4P2Y B;  1WLZ A;  3SG4 A;  1B8C A;  5CSJ A;  2L51 A;  1KFU L;  2Y5I A;  4NDB A;  5DKQ A;  1ODB A;  2MLE C;  1PK0 D;  2HF5 A;  3I5I B;  2KQY A;  2SCP A;  1MWN A;  1KCY A;  3TS5 C;  1W7I B;  1CLM A;  2M29 A;  1JUO A;  4GNK B;  3WHU B;  1PVA A;  4ZCU A;  3E3R A;  1XA5 A;  3GK4 X;  1QV1 A;  3AKA A;  5D7F A;  2E6W A;  1R6P A;  1CM1 A;  1TNW A;  1IGV A;  1BR1 B;  1SK6 D;  1S3P A;  2FJU B;  2AMI A;  1L7Z A;  3LK1 A;  1BOD A;  3D0Y A;  2R2I A;  1XK4 A;  1JF2 A;  1RFJ A;  3DD4 A;  1SR6 B;  1LXF C;  1IKU A;  2JZI A;  2M1U A;  4DCK A;  2LLT A;  3SG2 A;  2JNX A;  1IH0 A;  3VGO A;  5JOL A;  3DF0 B;  3SG5 A;  1DJZ A;  1NCX A;  1WLM A;  1GGW A;  3O78 A;  4ETO A;  4PHK A;  4AOM A;  1KK8 B;  2PRU A;  3IF7 A;  3KF9 A;  4YGC B;  2JNF A;  4N1G A;  2JXL A;  1JSA A;  2AUC A;  2BCX A;  1S6C A;  2K2F A;  2JC2 A;  2BL0 C;  1XYD A;  1S5G Z;  1FBV A;  1L2O B;  4ORC B;  4C0K A;  5CSF A;  2CCM A;  3I5H C;  3CR4 X;  2JPT A;  3OP0 A;  4GAO A;  5K89 A;  2I18 A;  1L2O C;  3PAT A;  1RWY A;  2KSP A;  2V53 A;  3JVT B;  5AXI A;  1PVB A;  2ZNE A;  2KYC A;  2OTG B;  2K7D A;  2L5X B;  1QTX A;  3CS1 A;  1DJX A;  3WHT B;  4USL A;  1M45 A;  1J7R A;  2LP3 A;  1DF0 B;  1QLK A;  1KK8 C;  3I5F B;  4MLW A;  1S6J A;  3KPX A;  2LM5 A;  3RM1 A;  4Q04 A;  2I2R E;  3VRR A;  1SL8 A;  1NX0 A;  3OX5 A;  1B8R A;  1HQV A;  1KQM B;  3KO0 A;  2LE9 B;  2KOT A;  3GK2 A;  3GK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...