4ORBB

Crystal structure of mouse calcineurin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit al
publication title Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
rcsb
source organism Mus musculus
molecule tags Hydrolase/metal binding protein
total genus 56
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4orbB00
1YX7A 4USLA 5KTYA 1RECA 1TCOB 2MRDA 1RJVA 4YI8A 1JFJA 1J7OA 1XVJA 2KDHA 1BODA 2JT0A 2LP3A 3BQ3A 1FPWA 3KPXA 1SL8A 2LHLA 1IG5A 1C7WA 2JPTA 1K94A 3NSOA 1PSBA 4YGDB 3JTDC 4I5KA 1K96A 1Y1AA 2LV7A 1M63B 2BBMA 1OMVA 4PALA 2CTNA 3I5FB 5CSNA 2IS9A 1DGUA 2LMVA 1Y1XA 2LM5A 1XFUO 4PE0A 1ZOTB 5TNCA 3NSKA 2F8PA 4DIRA 1Y0VH 1M45A 1SMGA 4ORCB 1PULA 1QXPA 1S6CA 3BUMB 1NX3A 1KK8B 1WDCC 3VGOA 4M2OA 2KAXA 1W7JB 2ZN9A 2M7NA 3FIAA 3TDZA 2JRFA 3LLEA 1H8BA 1B7TZ 3NSIA 1A29A 3CZTX 1Y6WA 2CT9A 4DRWA 3GK4X 2L4HA 2WOSA 1S5GY 2LLTA 3SJSA 1B1GA 4TNCA 2JNFA 5HKWA 3CR4X 2KAVA 1GJYA 1E8AA 1WRKA 3DVKA 3OP0A 3VRRA 4JWQA 1QS7A 3RLZA 1LINA 1TNXA 2PMYA 5KSZA 1XFXO 1EXRA 2SCPA 2KAYA 2HQWA 5BPJA 2ZKMX 5D7FA 2LNKA 2MA2A 2L50A 3DVJA 4CFRA 4YGAA 1SNLA 3EK7A 3I5IB 4I5NB 1AK8A 5ER4X 1TNQA 1K90D 3D0YB 3CLNA 1RWYA 3I5GB 5J3XA 5AANA 1NX2A 1R6PA 2K2AA 2NCPA 2K7CA 3KEVA 3O6BA 1QX2A 1DJXA 3OB2B 4QJ5B 1TTXA 1SY9A 4HSZA 2B1UA 1MXEA 5GQQC 4NDBA 1M39A 2K2FA 1IGVA 3SG6A 5I8NA 1SR6B 2H2KA 3VRPA 4NDDA 2PSRA 3AKAA 1AJ4A 2Q4UA 1Y1UA 5IBWA 2PASA 4E68A 1B7TY 1PALA 1A75A 1A4PA 1XFYO 3HCMA 1DJHA 3NSLA 2KSPA 1TIZA 1K95A 2KI6C 4JQ0D 3BOWB 1KQMB 4PDZA 3ZNIA 3RM1A 1DMOA 1B8LA 2JXLA 1SYMA 4YGBB 4YRUA 4JPZB 4GBAA 4OVNF 1DT7B 1DJWA 4UPGA 2LP2A 4AQJA 1J7QA 1HT9A 1LKJA 1UHHA 1CLLA 1FI6A 4MSPA 2OPOA 5F6TA 2KNEA 1GGWA 4C0KA 1CLBA 4ZCUA 1N2DA 3CR5X 1PVBA 1UWOA 1K9PA 1YVHA 2FOTA 4MZKA 1BF5A 2KYCA 2M0RA 1NCZA 1BU3A 2ZFDA 1JWDA 3OB1B 1EG4A 2I7AA 3PN7C 4OR9B 1L2OB 3WHTB 3VRNA 1K9KA 1XK4A 3GK1A 5HLOA 3TUYB 4HREE 3LK0A 4I5JA 1MXLC 2BECA 2M8UA 2F2OA 1YUSA 4M2PA 1KK7Z 1G8IA 4OV2A 5HYDA 3PFVA 5HKYA 3O2PA 2BKIB 4OCIA 1TRFA 3AAKA 1QJTA 3BUOB 1KSOA 2NXQA 3O78A 3OHMB 4GNKB 2JC2A 2KGRA 1SCMB 1B9AA 2AMIA 2KFGA 1F4OA 1XO5A 1U5IA 2L5XB 2DOQA 3CWGA 4QJ3B 5CPVA 1WY9A 1DJZA 2WNDA 1L7ZA 1RROA 1YURA 5ER5A 1CKKA 3BUXB 2H61C 1V1GA 4XJKA 1CMGA 2KI4C 1J1EA 2GGMA 1KWOB 1MUXA 2LLSA 3FWCA 1QV1A 2E30A 4CIDA 1NYAA 2GV5A 2MLEC 4AOMA 4GGFC 3SG3A 1CM4A 2CCMA 1RFJA 2WORA 3GOFA 3E3RA 2BE4A 1H4BA 4I5LB 2Y5IA 1OZOA 4C0LA 2G2BA 1XFVO 3A4UB 1B8RA 2FCEA 3GK2A 1NIWA 1EJ3A 1NX0A 1PVAA 1LVCD 1W7IB 3I5HC 1KK7Y 2BCAA 1OOJA 1Q80A 2JWWA 2LUXA 4R1EA 1N0YA 2OS8B 1CDNA 2KHNA 2KBIA 2EC6C 2RGIA 1N65A 1XYDA 2KBMA 1JC2A 2M7LA 1XFZO 3CR2A 1BR4B 1X02A 3QRXA 1KFUL 1UUSA 3O4YA 1FF1A 4QJ4B 2Y1NA 3D10A 4MRXA 1DJIA 2LMTA 3WHUB 4ETOA 1AHRA 1S1EA 1C07A 4WQ3A 1CDLA 2M1KB 3MSEB 3FWBA 1UHNA 1CFPA 2MBXA 1V1FA 1S6JA 1TCFA 1M46A 2MAZA 1F54A 1JSAA 2M1UA 4CFQA 1BMOA 4MZJA 2KYFA 2O60A 2OTGB 3EKHA 2JOJA 2LCPA 1OZSA 4F0ZB 4WQ2A 2WCEA 1IQ3A 5AXIA 4PHNA 1NPQA 3LK1A 4M2QA 2F3YA 4A4BA 4U8DA 1FW4A 2TN4A 2CNPA 1YVLA 2WCFA 3SG5A 1CNPA 2Y4QA 2LVIA 3DVMA 5CSIA 3I5FC 4ICBA 3PSRA 1A75B 1DVIA 1DJYA 1F8HA 5AEQA 1S26D 3CTNA 3DF0A 4PHMA 1F70A 1SKTA 1LA0A 1SCVA 5I2LA 3LCPC 2BL0B 2BBNA 2KFHA 1SK6D 1YRTB 1EH2A 2M3WA 4YGEB 1KK8C 1ZMZA 5JOLA 1K9UA 1B4CA 1IJ6A 1NCXA 1CLMA 4L9MA 1JF0A 1OSAA 4C0JA 4GUKA 3SG2A 1CFFA 1DF0B 2L0PA 3TDIA 1SRAA 5AFPA 1K93D 2LC5A 3IQOA 3OX6A 1DF0A 4PE7A 2F2PA 1TNWA 1CTRA 2LMUA 2QPTA 2I2RE 4FQOA 2JNXA 2G9BA 4YI9A 1OE9B 5FYXA 2ZNDA 2MHHA 3DVEA 2D8NA 1TOPA 2ZN8A 3JTDB 3NXAA 3EK8A 2LE9B 3I5IC 2ZRTA 3K21A 2H61A 1F55A 1UURA 3I5GC 3EKJA 3WNXB 4DUQA 3LL8B 1J55A 2KQ6A 1IH0A 4GGFA 1J7RA 2HPSA 1CFCA 1IRJA 1CFDA 1NSHA 2WCBA 1DJGA 1R2UA 1XFWO 1CDMA 5I2OA 4N5XA 1SR6C 3PM8A 4NDCA 1CMFA 2EGDA 3VROA 1U5IB 1OMRA 5HLVA 4FTGA 4CLNA 2A4JA 1MF8B 4ZCVA 5CSJA 4IL1A 3SG4A 2MLFC 2BE6A 5CSFA 3FS7A 2I18A 1NX1A 2JXCA 4XJKB 1RTP1 2M49B 2K61A 2LVVA 1NUBA 2M9GA 1KQMC 3C1VA 5D69A 2LLUA 2JULA 4HRGA 1ZFSA 3TDUA 1IWQA 1K2HA 3EVVA 1ZACA 3JVTB 4PHJA 1QTXA 1YTZC 1ZUZA 1WRLA 2I94A 1DGVA 1QV0A 1UHIA 3BYAA 5PALA 2HQ8A 3TZ1A 1BG1A 1S6IA 2PRUA 1KFUS 1WRZA 1ALVA 2WC8A 2Y1MA 1CB1A 3KF9A 3SIAA 1IQ5A 1PRWA 1QLKA 1FBVA 2VRGA 2O5GA 1XK4C 1F4QA 1YUTA 5DKNA 1L2OC 4NQGA 1QVIZ 1BJFA 2K7BA 2L2EA 4MEWA 1S36A 1ODBA 4XYNA 2F33A 4ORAB 1AUIB 3TUYC 2NZ0A 1PSRA 4N1FA 1TNPA 1AVSA 1KFXL 2BCXA 2BKHB 2AUCA 2K0JA 2LHIA 3F45A 3TS5B 1AP4A 2EHBA 1YR5A 4BY4A 1JF2A 1QATA 1VRKA 2KOTA 3IQQA 2L4IA 1UP5A 2F3ZA 1GGZA 1MWNA 5JJGA 2ISDA 2QACA 1CM1A 2NLNA 1SCMC 3DD4A 2PVBA 2JTTA 1AJ5A 3OX5A 3PATA 2COLB 2JT3A 1QLSA 1GQMA 2P6BB 1MHOA 3KHEA 3PLFB 1QX5B 4PE1A 1KQVA 2FCDA 3H4SE 1KWOC 2LUCA 1YRUB 4YGCB 4MVFA 3PN7B 3DF0B 2CXJA 2M97A 3AAJA 1DTLA 2HETA 3JVTC 4PHKA 2ZNEA 4MRYA 2KGBC 4BY5A 4OKHA 1SL9A 3D0YA 1HQVA 1QVIY 2GGZA 3A8RA 3SG7A 4AQIA 4MZLA 2PALA 3CS1A 1OQPA 2K8MB 1BLQA 4GGNA 1KCYA 1UHJA 4DS7A 1BR1B 1UHKA 1JFKA 2KFFA 1B8CA 2R2IA 3EVRA 1QASA 3ZWHA 4GFTA 2K7OA 2OS8C 3CGAA 5G08A 1C7VA 4WRIA 1EG3A 2CBLA 1A03A 1NP8A 3BUNB 4PCWA 1TN4A 4P5OE 2AAOA 4GAOA 1J1DA 1RK9A 3ICBA 2M29A 2JU0A 2JTZA 5AERA 1JBAA 1D1OA 1WLZA 3TS5C 2KI4B 4HRHA 4ORBB 1SPYA 1BT6A 1XA5A 1WLMA 3AKBA 3BOWA 1B47A 2KI6D 4P2YB 5K89A 1BOCA 2LVKA 4MLWA 1YUUA 1A2XA 1LA3A 3BXKA 4PE4A 1MR8A 3VRQA 3HX4A 3KO0A 2K7DA 2JT8A 2KQYA 5I2QA 2SASA 2FJUB 5DKRA 1S3PA 2OTGC 1YX8A 1WDCB 2LAPA 2V53A 5KU1A 1EL4A 4N1GA 1K8UA 1LXFC 5B8IB 1JUOA 1QX7A 5DKQA 1G33A 3WXAA 1PK0D 2L51A 3BUWB 5HKZA 1QIVA 1F71A 3I5HB 1M31A 4CPVA 2ZRSA 3SIBA 1ALWA 1SL7A 3IF7A 4DCKA 4YBHB 1MQ1A 1SBJA 2JQ6A 2JZIA 2EC6B 2BCBA 1QIWA 4GPLB 1FI5A 1IJ5A 1CDPA 2L98A 4MBEA 2E6WA 3EK4A 2BL0C 4MN0A 4A4CA 1SW8A 2Q91A 3M0WA 4D1EA 4Q04A 1J7PA 2HF5A 1OMDA 1S5GZ 1IKUA 3EVUA 2MJWB 1G4YR 2LVJA 1KFXS 1KSMA 2NCOA 2LANA 1NCYA 3PALA 1NWDA
chains in the Genus database with same CATH superfamily
1YX7A 4USLA 5KTYA 2KLEA 1RECA 1TCOB 2MRDA 1RJVA 4IJ7A 4YI8A 4PT1A 3S0FA 1XVJA 2KDHA 1J7OA 1BODA 2JT0A 2LP3A 3BQ3A 1FPWA 3KPXA 1SL8A 2LHLA 1IG5A 1C7WA 2JPTA 1K94A 3NSOA 1PSBA 4YGDB 3JTDC 4I5KA 3B88A 1K96A 1Y1AA 2LV7A 1M63B 2BBMA 1OMVA 4PALA 2CTNA 2WCJA 3I5FB 5CSNA 2IS9A 1DGUA 2LMVA 1C3YA 1Y1XA 2LM5A 1XFUO 4PE0A 1ZOTB 5TNCA 3D75A 3NSKA 2F8PA 1SSEB 1Y0VH 1M45A 3UNWA 4DIRA 1SMGA 4ORCB 1PULA 1QXPA 1S6CA 3BUMB 1NX3A 1KK8B 1WDCC 3VGOA 4M2OA 2KAXA 1W7JB 2ZN9A 2M7NA 3FIAA 3TDZA 2JRFA 3LLEA 1H8BA 1B7TZ 3NSIA 1A29A 3CZTX 2QDIA 1Y6WA 2CT9A 4DRWA 3GK4X 2L4HA 2WOSA 1OOIX 1S5GY 2LLTA 3SJSA 1B1GA 4TNCA 1JFJA 2JNFA 5HKWA 3CR4X 2KAVA 1GJYA 1E8AA 1WRKA 3DVKA 3OP0A 3VRRA 3OBVA 1QS7A 4JWQA 3RLZA 1LINA 1TNXA 2PMYA 5KSZA 1XFXO 1EXRA 2SCPA 2KAYA 1Z4HA 2HQWA 2ZKMX 5D7FA 5BPJA 2LNKA 2MA2A 2L50A 3DVJA 4CFRA 4YGAA 1SNLA 3BFAA 3EK7A 3I5IB 4I5NB 1AK8A 5ER4X 1TNQA 1K90D 3D0YB 3CLNA 1RWYA 3I5GB 5J3XA 5AANA 1NX2A 1R6PA 2P71A 2K2AA 2NCPA 2K7CA 1OW4A 3KEVA 3O6BA 1QX2A 1DJXA 3OB2B 4QJ5B 1TTXA 1SY9A 4HSZA 2B1UA 2QEOA 1MXEA 5GQQC 1TUJA 4NDBA 1M39A 2K2FA 2QEBA 1IGVA 3UO9A 3SG6A 5I8NA 1SR6B 2BAPA 2H2KA 2KPHA 4NDDA 2PSRA 3VRPA 3AKAA 1AJ4A 2Q4UA 1Y1UA 5IBWA 2PASA 4E68A 1B7TY 1OOHA 1PALA 1A75A 2BNXA 1A4PA 2GTEA 1XFYO 4FQTA 3HCMA 1DJHA 3NSLA 2KSPA 1TIZA 1K95A 2KI6C 4JQ0D 3BOWB 1KQMB 4PDZA 3ZNIA 3RM1A 1DMOA 1B8LA 2JXLA 1SYMA 4YGBB 4YRUA 2WC5A 4GBAA 4JPZB 4OVNF 1DT7B 1DJWA 4UPGA 2LP2A 4AQJA 1J7QA 3EG5B 1HT9A 1LKJA 1UHHA 1CLLA 1FI6A 4MSPA 2OPOA 5F6TA 2KNEA 1GGWA 4C0KA 1CLBA 4ZCUA 1N2DA 3CR5X 1PVBA 1UWOA 1K9PA 1YVHA 2FOTA 2KLDA 4MZKA 1BF5A 2KYCA 2M0RA 1NCZA 3CZ0A 1BU3A 2ZFDA 1JWDA 3OB1B 1EG4A 2I7AA 3OGNA 3PN7C 1L2OB 4JD9A 4OR9B 3WHTB 3VRNA 1K9KA 1XK4A 3GK1A 5HLOA 4OZDA 3SS3A 3TUYB 4HREE 3LK0A 4I5JA 1MXLC 2BECA 2M8UA 2F2OA 1YUSA 3D73A 4M2PA 1KK7Z 1G8IA 3NGVA 4OV2A 1T14A 3BFBA 5HYDA 3PFVA 5HKYA 3O2PA 2BKIB 4OCIA 1TRFA 3AAKA 1QJTA 3BUOB 1KSOA 1DEKA 2NXQA 3O78A 3OHMB 4GNKB 2JC2A 2KGRA 3QMEA 3CYZA 1SCMB 1B9AA 2AMIA 2KFGA 1F4OA 1XO5A 1U5IA 2L5XB 3N7HA 2DOQA 3CWGA 4QJ3B 5CPVA 1WY9A 1DJZA 2WC6A 2WNDA 1L7ZA 3B7AA 1RROA 1YURA 5ER5A 1CKKA 3BUXB 2H61C 1V1GA 4XJKA 1CMGA 2KI4C 1J1EA 2GGMA 1KWOB 1MUXA 2LLSA 3FWCA 1QV1A 2E30A 4CIDA 1NYAA 2ERBA 2GV5A 2MLEC 4AOMA 4GGFC 3SG3A 3BJHA 1CM4A 2CCMA 1RFJA 2WORA 3GOFA 3E3RA 2BE4A 3S0DA 1H4BA 4I5LB 2Y5IA 1OZOA 4C0LA 2G2BA 1XFVO 3A4UB 1B8RA 2FCEA 3GK2A 3L47A 1NIWA 1EJ3A 1NX0A 1PVAA 1LVCD 1W7IB 3I5HC 1KK7Y 2BCAA 1OOJA 1Q80A 2JWWA 2LUXA 4R1EA 1N0YA 2OS8B 1CDNA 2KHNA 5EL2A 2KBIA 2EC6C 2RGIA 3PM2A 1N65A 5D3OA 1XYDA 2KBMA 1JC2A 3R1VA 2M7LA 1XFZO 3CR2A 3PJIA 1BR4B 1X02A 1TWOA 3Q8IA 3QRXA 1KFUL 1UUSA 3O4YA 5FI7A 1FF1A 4QJ4B 2Y1NA 3D10A 4MRXA 1DJIA 2LMTA 3WHUB 4ETOA 1AHRA 1S1EA 3O4XA 3DY9A 4WQ3A 1CDLA 2M1KB 3K1EA 3MSEB 5FI6A 3FWBA 1DC1A 1UHNA 1CFPA 2MBXA 1V1FA 1S6JA 1TCFA 1M46A 2MAZA 1F54A 1JSAA 2M1UA 1LS8A 4CFQA 1BMOA 4MZJA 2KYFA 2O60A 2OTGB 3EKHA 2JOJA 2LCPA 1OZSA 4F0ZB 4WQ2A 2WCEA 1IQ3A 5AXIA 4PHNA 1NPQA 3LK1A 4M2QA 2F3YA 4A4BA 4U8DA 1FW4A 2TN4A 2CNPA 3B86A 1YVLA 2WCFA 3SG5A 1CNPA 2Y4QA 2LVIA 3DVMA 5CSIA 3I5FC 3R1OA 3PSRA 4ICBA 1A75B 1DVIA 1DJYA 1F8HA 5AEQA 1S26D 2WCMA 3CTNA 3DF0A 4PHMA 1F70A 1SKTA 1LA0A 1SCVA 5I2LA 3LCPC 2BL0B 2BBNA 2KFHA 1SK6D 1YRTB 1EH2A 2M3WA 4YGEB 1KK8C 1ZMZA 5JOLA 1K9UA 3SS5A 3R72A 1B4CA 1ORGA 1IJ6A 1NCXA 1CLMA 4L9MA 1JF0A 1OSAA 4C0JA 4GUKA 3SG2A 1CFFA 1DF0B 2L0PA 4F7FA 3TDIA 1SRAA 5AFPA 1K93D 2LC5A 3IQOA 3NHTA 1DF0A 2QEHA 3OX6A 4PE7A 2F2PA 3CDNA 1TNWA 1CTRA 2LMUA 2QPTA 2I2RE 4FQOA 2JNXA 2G9BA 4YI9A 1OE9B 5FYXA 2ZNDA 2MHHA 3DVEA 2D8NA 3L4LA 4JKTA 1TOPA 2ZN8A 3JTDB 3NXAA 3EK8A 2LE9B 3I5IC 2ZRTA 3K21A 2H61A 1F55A 1UURA 3I5GC 3EKJA 3WNXB 4DUQA 3LL8B 1J55A 2KQ6A 1IH0A 4GGFA 1J7RA 2HPSA 2JPOA 2L2CA 3S0EA 1CFCA 1IRJA 1CFDA 1NSHA 2WCBA 1DJGA 1R2UA 2K60A 1XFWO 1CDMA 5DICA 5I2OA 4N5XA 1SR6C 4INXA 3PM8A 4NDCA 1CMFA 2EGDA 3VROA 1U5IB 1OMRA 5HLVA 4FTGA 4CLNA 2A4JA 1MF8B 4ZCVA 5CSJA 4IL1A 3SG4A 3D74A 2MLFC 5FI2A 3S0GA 2BE6A 4INWA 3FS7A 5CSFA 1DELA 1NX1A 2I18A 2JXCA 1RTP1 2M49B 4XJKB 2K61A 2LVVA 1NUBA 2M9GA 1KQMC 3C1VA 5D69A 2LLUA 2JULA 4HRGA 1ZFSA 2FJYA 3TDUA 3DZTA 1IWQA 1K2HA 3EVVA 1ZACA 3JVTB 3SS4A 4PHJA 1QTXA 1YTZC 3D78A 1ZUZA 1WRLA 2I94A 3DYEA 1DGVA 1QV0A 1UHIA 3BYAA 5PALA 2HQ8A 3TZ1A 2PQLA 1BG1A 1DQEA 1S6IA 1KFUS 1WRZA 1ALVA 2PRUA 2WC8A 2Y1MA 3CABA 1CB1A 1IIOA 3KF9A 3SIAA 1IQ5A 1PRWA 3S0AA 1QLKA 1FBVA 2VRGA 2O5GA 1XK4C 1F4QA 1YUTA 5DKNA 1L2OC 4NQGA 1QVIZ 1BJFA 1C3ZA 1P28A 2K7BA 2L2EA 4MEWA 1S36A 1ODBA 4XYNA 2F33A 4ORAB 1AUIB 3TUYC 3DXLA 1Z2CB 2NZ0A 1PSRA 1C07A 4N1FA 3RZSA 1TNPA 1AVSA 1KFXL 2BCXA 2BKHB 2AUCA 3V2LA 2K0JA 2LHIA 3F45A 3TS5B 2P70A 1AP4A 2EHBA 1YR5A 4BY4A 1JF2A 1QATA 1VRKA 2KOTA 3IQQA 5HL1A 2L4IA 1UP5A 2F3ZA 1GGZA 1MWNA 5JJGA 2ISDA 2QACA 1CM1A 2NLNA 1SCMC 3DD4A 3CZ2A 2PVBA 2JTTA 2WCLA 2YGUA 5I94A 1AJ5A 3OX5A 3PATA 2COLB 2JT3A 1QLSA 1GQMA 2P6BB 1MHOA 3KHEA 3PLFB 1QX5B 4PE1A 1KQVA 2FCDA 3H4SE 1KWOC 2LUCA 1YRUB 4YGCB 2WCHA 4MVFA 3PN7B 3DF0B 2CXJA 2M97A 3AAJA 1DTLA 2HETA 3FE9A 3JVTC 4PHKA 2ZNEA 4MRYA 2KGBC 3IVTA 4BY5A 4OKHA 1SL9A 3D0YA 1HQVA 1QVIY 2GGZA 1W9ZA 3A8RA 3SG7A 4AQIA 4MZLA 2PALA 3CS1A 1OQPA 2K8MB 3VB1A 3FE8A 4GGNA 1BLQA 1KCYA 3B6XA 1UHJA 4DS7A 1BR1B 1UHKA 1JFKA 2KFFA 1B8CA 2R2IA 3EVRA 1QASA 3ZWHA 4GFTA 2K7OA 2OS8C 3CGAA 5G08A 1QWVA 1C7VA 4WRIA 3R1PA 1EG3A 2CBLA 1A03A 1NP8A 3BUNB 4PCWA 1TN4A 3D77A 4P5OE 2AAOA 4GAOA 1J1DA 1RK9A 3ICBA 2M29A 2JU0A 2JTZA 3NHIA 5AERA 1JBAA 1D1OA 1WLZA 1GM0A 3TS5C 2KI4B 4HRHA 4ORBB 1SPYA 1BT6A 1XA5A 1WLMA 3AKBA 3BOWA 1B47A 2KI6D 4P2YB 5K89A 4KYNA 2LVKA 4MLWA 1YUUA 1A2XA 1BOCA 1LA3A 3BXKA 4PE4A 1MR8A 3VRQA 3HX4A 3KO0A 3L4AA 2K7DA 2JT8A 2KQYA 5I2QA 2SASA 2FJUB 5DKRA 1S3PA 1TUZA 2OTGC 1YX8A 2H8VA 1WDCB 2LAPA 2V53A 5KU1A 1EL4A 3S0BA 4N1GA 1K8UA 1LXFC 2QEVA 5B8IB 1QX7A 1JUOA 5DKQA 1G33A 3WXAA 1PK0D 2L51A 3BUWB 5HKZA 1QIVA 1F71A 3I5HB 1M31A 4CPVA 2ZRSA 3SIBA 1ALWA 1SL7A 3IF7A 4DCKA 4YBHB 1MQ1A 1SBJA 2JQ6A 2JZIA 2EC6B 2BCBA 3BFHA 1QIWA 3FE6A 4GPLB 1FI5A 1IJ5A 1CDPA 2L98A 4MBEA 2E6WA 2PYQA 3EK4A 2BL0C 4MN0A 2L5YA 4A4CA 1SW8A 2Q91A 3M0WA 4D1EA 4Q04A 1J7PA 3B87A 2HF5A 2WCKA 1OOGA 1OMDA 1S5GZ 1IKUA 3EVUA 2MJWB 1G4YR 3D76A 1OOFA 3CZ1A 2LVJA 1XFRA 1KFXS 1KSMA 2NCOA 2LANA 1NCYA 3PALA 1NWDA
chains in the Genus database with same CATH topology
1YX7A 4USLA 5KTYA 1RECA 1TCOB 2MRDA 1RJVA 4YI8A 1JFJA 1J7OA 1XVJA 2KDHA 1BODA 2JT0A 2LP3A 3BQ3A 1FPWA 3KPXA 1SL8A 2LHLA 1IG5A 1C7WA 2JPTA 1K94A 3NSOA 1PSBA 4YGDB 3JTDC 4I5KA 1K96A 1Y1AA 2LV7A 1M63B 2BBMA 1OMVA 4PALA 2CTNA 3I5FB 5CSNA 2IS9A 1DGUA 2LMVA 1Y1XA 2LM5A 1XFUO 4PE0A 1ZOTB 5TNCA 3NSKA 2F8PA 4DIRA 1Y0VH 1M45A 1SMGA 4ORCB 1PULA 1QXPA 1S6CA 3BUMB 1NX3A 1KK8B 1WDCC 3VGOA 4M2OA 2KAXA 1W7JB 2ZN9A 2M7NA 3FIAA 3TDZA 2JRFA 3LLEA 1H8BA 1B7TZ 3NSIA 1A29A 3CZTX 1Y6WA 2CT9A 4DRWA 3GK4X 2L4HA 2WOSA 1S5GY 2LLTA 3SJSA 1B1GA 4TNCA 2JNFA 5HKWA 3CR4X 2KAVA 1GJYA 1E8AA 1WRKA 3DVKA 3OP0A 3VRRA 4JWQA 1QS7A 3RLZA 1LINA 1TNXA 2PMYA 5KSZA 1XFXO 1EXRA 2SCPA 2KAYA 2HQWA 5BPJA 2ZKMX 5D7FA 2LNKA 2MA2A 2L50A 3DVJA 4CFRA 4YGAA 1SNLA 3EK7A 3I5IB 4I5NB 1AK8A 5ER4X 1TNQA 1K90D 3D0YB 3CLNA 1RWYA 3I5GB 5J3XA 5AANA 1NX2A 1R6PA 2K2AA 2NCPA 2K7CA 3KEVA 3O6BA 1QX2A 1DJXA 3OB2B 4QJ5B 1TTXA 1SY9A 4HSZA 2B1UA 1MXEA 5GQQC 4NDBA 1M39A 2K2FA 1IGVA 3SG6A 5I8NA 1SR6B 2H2KA 3VRPA 4NDDA 2PSRA 3AKAA 1AJ4A 2Q4UA 1Y1UA 5IBWA 2PASA 4E68A 1B7TY 1PALA 1A75A 1A4PA 1XFYO 3HCMA 1DJHA 3NSLA 2KSPA 1TIZA 1K95A 2KI6C 4JQ0D 3BOWB 1KQMB 4PDZA 3ZNIA 3RM1A 1DMOA 1B8LA 2JXLA 1SYMA 4YGBB 4YRUA 4JPZB 4GBAA 4OVNF 1DT7B 1DJWA 4UPGA 2LP2A 4AQJA 1J7QA 1HT9A 1LKJA 1UHHA 1CLLA 1FI6A 4MSPA 2OPOA 5F6TA 2KNEA 1GGWA 4C0KA 1CLBA 4ZCUA 1N2DA 3CR5X 1PVBA 1UWOA 1K9PA 1YVHA 2FOTA 4MZKA 1BF5A 2KYCA 2M0RA 1NCZA 1BU3A 2ZFDA 1JWDA 3OB1B 1EG4A 2I7AA 3PN7C 4OR9B 1L2OB 3WHTB 3VRNA 1K9KA 1XK4A 3GK1A 5HLOA 3TUYB 4HREE 3LK0A 4I5JA 1MXLC 2BECA 2M8UA 2F2OA 1YUSA 4M2PA 1KK7Z 1G8IA 4OV2A 5HYDA 3PFVA 5HKYA 3O2PA 2BKIB 4OCIA 1TRFA 3AAKA 1QJTA 3BUOB 1KSOA 2NXQA 3O78A 3OHMB 4GNKB 2JC2A 2KGRA 1SCMB 1B9AA 2AMIA 2KFGA 1F4OA 1XO5A 1U5IA 2L5XB 2DOQA 3CWGA 4QJ3B 5CPVA 1WY9A 1DJZA 2WNDA 1L7ZA 1RROA 1YURA 5ER5A 1CKKA 3BUXB 2H61C 1V1GA 4XJKA 1CMGA 2KI4C 1J1EA 2GGMA 1KWOB 1MUXA 2LLSA 3FWCA 1QV1A 2E30A 4CIDA 1NYAA 2GV5A 2MLEC 4AOMA 4GGFC 3SG3A 1CM4A 2CCMA 1RFJA 2WORA 3GOFA 3E3RA 2BE4A 1H4BA 4I5LB 2Y5IA 1OZOA 4C0LA 2G2BA 1XFVO 3A4UB 1B8RA 2FCEA 3GK2A 1NIWA 1EJ3A 1NX0A 1PVAA 1LVCD 1W7IB 3I5HC 1KK7Y 2BCAA 1OOJA 1Q80A 2JWWA 2LUXA 4R1EA 1N0YA 2OS8B 1CDNA 2KHNA 2KBIA 2EC6C 2RGIA 1N65A 1XYDA 2KBMA 1JC2A 2M7LA 1XFZO 3CR2A 1BR4B 1X02A 3QRXA 1KFUL 1UUSA 3O4YA 1FF1A 4QJ4B 2Y1NA 3D10A 4MRXA 1DJIA 2LMTA 3WHUB 4ETOA 1AHRA 1S1EA 1C07A 4WQ3A 1CDLA 2M1KB 3MSEB 3FWBA 1UHNA 1CFPA 2MBXA 1V1FA 1S6JA 1TCFA 1M46A 2MAZA 1F54A 1JSAA 2M1UA 4CFQA 1BMOA 4MZJA 2KYFA 2O60A 2OTGB 3EKHA 2JOJA 2LCPA 1OZSA 4F0ZB 4WQ2A 2WCEA 1IQ3A 5AXIA 4PHNA 1NPQA 3LK1A 4M2QA 2F3YA 4A4BA 4U8DA 1FW4A 2TN4A 2CNPA 1YVLA 2WCFA 3SG5A 1CNPA 2Y4QA 2LVIA 3DVMA 5CSIA 3I5FC 4ICBA 3PSRA 1A75B 1DVIA 1DJYA 1F8HA 5AEQA 1S26D 3CTNA 3DF0A 4PHMA 1F70A 1SKTA 1LA0A 1SCVA 5I2LA 3LCPC 2BL0B 2BBNA 2KFHA 1SK6D 1YRTB 1EH2A 2M3WA 4YGEB 1KK8C 1ZMZA 5JOLA 1K9UA 1B4CA 1IJ6A 1NCXA 1CLMA 4L9MA 1JF0A 1OSAA 4C0JA 4GUKA 3SG2A 1CFFA 1DF0B 2L0PA 3TDIA 1SRAA 5AFPA 1K93D 2LC5A 3IQOA 3OX6A 1DF0A 4PE7A 2F2PA 1TNWA 1CTRA 2LMUA 2QPTA 2I2RE 4FQOA 2JNXA 2G9BA 4YI9A 1OE9B 5FYXA 2ZNDA 2MHHA 3DVEA 2D8NA 1TOPA 2ZN8A 3JTDB 3NXAA 3EK8A 2LE9B 3I5IC 2ZRTA 3K21A 2H61A 1F55A 1UURA 3I5GC 3EKJA 3WNXB 4DUQA 3LL8B 1J55A 2KQ6A 1IH0A 4GGFA 1J7RA 2HPSA 1CFCA 1IRJA 1CFDA 1NSHA 2WCBA 1DJGA 1R2UA 1XFWO 1CDMA 5I2OA 4N5XA 1SR6C 3PM8A 4NDCA 1CMFA 2EGDA 3VROA 1U5IB 1OMRA 5HLVA 4FTGA 4CLNA 2A4JA 1MF8B 4ZCVA 5CSJA 4IL1A 3SG4A 2MLFC 2BE6A 5CSFA 3FS7A 2I18A 1NX1A 2JXCA 4XJKB 1RTP1 2M49B 2K61A 2LVVA 1NUBA 2M9GA 1KQMC 3C1VA 5D69A 2LLUA 2JULA 4HRGA 1ZFSA 3TDUA 1IWQA 1K2HA 3EVVA 1ZACA 3JVTB 4PHJA 1QTXA 1YTZC 1ZUZA 1WRLA 2I94A 1DGVA 1QV0A 1UHIA 3BYAA 5PALA 2HQ8A 3TZ1A 1BG1A 1S6IA 2PRUA 1KFUS 1WRZA 1ALVA 2WC8A 2Y1MA 1CB1A 3KF9A 3SIAA 1IQ5A 1PRWA 1QLKA 1FBVA 2VRGA 2O5GA 1XK4C 1F4QA 1YUTA 5DKNA 1L2OC 4NQGA 1QVIZ 1BJFA 2K7BA 2L2EA 4MEWA 1S36A 1ODBA 4XYNA 2F33A 4ORAB 1AUIB 3TUYC 2NZ0A 1PSRA 4N1FA 1TNPA 1AVSA 1KFXL 2BCXA 2BKHB 2AUCA 2K0JA 2LHIA 3F45A 3TS5B 1AP4A 2EHBA 1YR5A 4BY4A 1JF2A 1QATA 1VRKA 2KOTA 3IQQA 2L4IA 1UP5A 2F3ZA 1GGZA 1MWNA 5JJGA 2ISDA 2QACA 1CM1A 2NLNA 1SCMC 3DD4A 2PVBA 2JTTA 1AJ5A 3OX5A 3PATA 2COLB 2JT3A 1QLSA 1GQMA 2P6BB 1MHOA 3KHEA 3PLFB 1QX5B 4PE1A 1KQVA 2FCDA 3H4SE 1KWOC 2LUCA 1YRUB 4YGCB 4MVFA 3PN7B 3DF0B 2CXJA 2M97A 3AAJA 1DTLA 2HETA 3JVTC 4PHKA 2ZNEA 4MRYA 2KGBC 4BY5A 4OKHA 1SL9A 3D0YA 1HQVA 1QVIY 2GGZA 3A8RA 3SG7A 4AQIA 4MZLA 2PALA 3CS1A 1OQPA 2K8MB 1BLQA 4GGNA 1KCYA 1UHJA 4DS7A 1BR1B 1UHKA 1JFKA 2KFFA 1B8CA 2R2IA 3EVRA 1QASA 3ZWHA 4GFTA 2K7OA 2OS8C 3CGAA 5G08A 1C7VA 4WRIA 1EG3A 2CBLA 1A03A 1NP8A 3BUNB 4PCWA 1TN4A 4P5OE 2AAOA 4GAOA 1J1DA 1RK9A 3ICBA 2M29A 2JU0A 2JTZA 5AERA 1JBAA 1D1OA 1WLZA 3TS5C 2KI4B 4HRHA 4ORBB 1SPYA 1BT6A 1XA5A 1WLMA 3AKBA 3BOWA 1B47A 2KI6D 4P2YB 5K89A 1BOCA 2LVKA 4MLWA 1YUUA 1A2XA 1LA3A 3BXKA 4PE4A 1MR8A 3VRQA 3HX4A 3KO0A 2K7DA 2JT8A 2KQYA 5I2QA 2SASA 2FJUB 5DKRA 1S3PA 2OTGC 1YX8A 1WDCB 2LAPA 2V53A 5KU1A 1EL4A 4N1GA 1K8UA 1LXFC 5B8IB 1JUOA 1QX7A 5DKQA 1G33A 3WXAA 1PK0D 2L51A 3BUWB 5HKZA 1QIVA 1F71A 3I5HB 1M31A 4CPVA 2ZRSA 3SIBA 1ALWA 1SL7A 3IF7A 4DCKA 4YBHB 1MQ1A 1SBJA 2JQ6A 2JZIA 2EC6B 2BCBA 1QIWA 4GPLB 1FI5A 1IJ5A 1CDPA 2L98A 4MBEA 2E6WA 3EK4A 2BL0C 4MN0A 4A4CA 1SW8A 2Q91A 3M0WA 4D1EA 4Q04A 1J7PA 2HF5A 1OMDA 1S5GZ 1IKUA 3EVUA 2MJWB 1G4YR 2LVJA 1KFXS 1KSMA 2NCOA 2LANA 1NCYA 3PALA 1NWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX7 A;  4USL A;  5KTY A;  1REC A;  1TCO B;  2MRD A;  1RJV A;  4YI8 A;  1JFJ A;  1J7O A;  1XVJ A;  2KDH A;  1BOD A;  2JT0 A;  2LP3 A;  3BQ3 A;  1FPW A;  3KPX A;  1SL8 A;  2LHL A;  1IG5 A;  1C7W A;  2JPT A;  1K94 A;  3NSO A;  1PSB A;  4YGD B;  3JTD C;  4I5K A;  1K96 A;  1Y1A A;  2LV7 A;  1M63 B;  2BBM A;  1OMV A;  4PAL A;  2CTN A;  3I5F B;  5CSN A;  2IS9 A;  1DGU A;  2LMV A;  1Y1X A;  2LM5 A;  1XFU O;  4PE0 A;  1ZOT B;  5TNC A;  3NSK A;  2F8P A;  4DIR A;  1Y0V H;  1M45 A;  1SMG A;  4ORC B;  1PUL A;  1QXP A;  1S6C A;  3BUM B;  1NX3 A;  1KK8 B;  1WDC C;  3VGO A;  4M2O A;  2KAX A;  1W7J B;  2ZN9 A;  2M7N A;  3FIA A;  3TDZ A;  2JRF A;  3LLE A;  1H8B A;  1B7T Z;  3NSI A;  1A29 A;  3CZT X;  1Y6W A;  2CT9 A;  4DRW A;  3GK4 X;  2L4H A;  2WOS A;  1S5G Y;  2LLT A;  3SJS A;  1B1G A;  4TNC A;  2JNF A;  5HKW A;  3CR4 X;  2KAV A;  1GJY A;  1E8A A;  1WRK A;  3DVK A;  3OP0 A;  3VRR A;  4JWQ A;  1QS7 A;  3RLZ A;  1LIN A;  1TNX A;  2PMY A;  5KSZ A;  1XFX O;  1EXR A;  2SCP A;  2KAY A;  2HQW A;  5BPJ A;  2ZKM X;  5D7F A;  2LNK A;  2MA2 A;  2L50 A;  3DVJ A;  4CFR A;  4YGA A;  1SNL A;  3EK7 A;  3I5I B;  4I5N B;  1AK8 A;  5ER4 X;  1TNQ A;  1K90 D;  3D0Y B;  3CLN A;  1RWY A;  3I5G B;  5J3X A;  5AAN A;  1NX2 A;  1R6P A;  2K2A A;  2NCP A;  2K7C A;  3KEV A;  3O6B A;  1QX2 A;  1DJX A;  3OB2 B;  4QJ5 B;  1TTX A;  1SY9 A;  4HSZ A;  2B1U A;  1MXE A;  5GQQ C;  4NDB A;  1M39 A;  2K2F A;  1IGV A;  3SG6 A;  5I8N A;  1SR6 B;  2H2K A;  3VRP A;  4NDD A;  2PSR A;  3AKA A;  1AJ4 A;  2Q4U A;  1Y1U A;  5IBW A;  2PAS A;  4E68 A;  1B7T Y;  1PAL A;  1A75 A;  1A4P A;  1XFY O;  3HCM A;  1DJH A;  3NSL A;  2KSP A;  1TIZ A;  1K95 A;  2KI6 C;  4JQ0 D;  3BOW B;  1KQM B;  4PDZ A;  3ZNI A;  3RM1 A;  1DMO A;  1B8L A;  2JXL A;  1SYM A;  4YGB B;  4YRU A;  4JPZ B;  4GBA A;  4OVN F;  1DT7 B;  1DJW A;  4UPG A;  2LP2 A;  4AQJ A;  1J7Q A;  1HT9 A;  1LKJ A;  1UHH A;  1CLL A;  1FI6 A;  4MSP A;  2OPO A;  5F6T A;  2KNE A;  1GGW A;  4C0K A;  1CLB A;  4ZCU A;  1N2D A;  3CR5 X;  1PVB A;  1UWO A;  1K9P A;  1YVH A;  2FOT A;  4MZK A;  1BF5 A;  2KYC A;  2M0R A;  1NCZ A;  1BU3 A;  2ZFD A;  1JWD A;  3OB1 B;  1EG4 A;  2I7A A;  3PN7 C;  4OR9 B;  1L2O B;  3WHT B;  3VRN A;  1K9K A;  1XK4 A;  3GK1 A;  5HLO A;  3TUY B;  4HRE E;  3LK0 A;  4I5J A;  1MXL C;  2BEC A;  2M8U A;  2F2O A;  1YUS A;  4M2P A;  1KK7 Z;  1G8I A;  4OV2 A;  5HYD A;  3PFV A;  5HKY A;  3O2P A;  2BKI B;  4OCI A;  1TRF A;  3AAK A;  1QJT A;  3BUO B;  1KSO A;  2NXQ A;  3O78 A;  3OHM B;  4GNK B;  2JC2 A;  2KGR A;  1SCM B;  1B9A A;  2AMI A;  2KFG A;  1F4O A;  1XO5 A;  1U5I A;  2L5X B;  2DOQ A;  3CWG A;  4QJ3 B;  5CPV A;  1WY9 A;  1DJZ A;  2WND A;  1L7Z A;  1RRO A;  1YUR A;  5ER5 A;  1CKK A;  3BUX B;  2H61 C;  1V1G A;  4XJK A;  1CMG A;  2KI4 C;  1J1E A;  2GGM A;  1KWO B;  1MUX A;  2LLS A;  3FWC A;  1QV1 A;  2E30 A;  4CID A;  1NYA A;  2GV5 A;  2MLE C;  4AOM A;  4GGF C;  3SG3 A;  1CM4 A;  2CCM A;  1RFJ A;  2WOR A;  3GOF A;  3E3R A;  2BE4 A;  1H4B A;  4I5L B;  2Y5I A;  1OZO A;  4C0L A;  2G2B A;  1XFV O;  3A4U B;  1B8R A;  2FCE A;  3GK2 A;  1NIW A;  1EJ3 A;  1NX0 A;  1PVA A;  1LVC D;  1W7I B;  3I5H C;  1KK7 Y;  2BCA A;  1OOJ A;  1Q80 A;  2JWW A;  2LUX A;  4R1E A;  1N0Y A;  2OS8 B;  1CDN A;  2KHN A;  2KBI A;  2EC6 C;  2RGI A;  1N65 A;  1XYD A;  2KBM A;  1JC2 A;  2M7L A;  1XFZ O;  3CR2 A;  1BR4 B;  1X02 A;  3QRX A;  1KFU L;  1UUS A;  3O4Y A;  1FF1 A;  4QJ4 B;  2Y1N A;  3D10 A;  4MRX A;  1DJI A;  2LMT A;  3WHU B;  4ETO A;  1AHR A;  1S1E A;  1C07 A;  4WQ3 A;  1CDL A;  2M1K B;  3MSE B;  3FWB A;  1UHN A;  1CFP A;  2MBX A;  1V1F A;  1S6J A;  1TCF A;  1M46 A;  2MAZ A;  1F54 A;  1JSA A;  2M1U A;  4CFQ A;  1BMO A;  4MZJ A;  2KYF A;  2O60 A;  2OTG B;  3EKH A;  2JOJ A;  2LCP A;  1OZS A;  4F0Z B;  4WQ2 A;  2WCE A;  1IQ3 A;  5AXI A;  4PHN A;  1NPQ A;  3LK1 A;  4M2Q A;  2F3Y A;  4A4B A;  4U8D A;  1FW4 A;  2TN4 A;  2CNP A;  1YVL A;  2WCF A;  3SG5 A;  1CNP A;  2Y4Q A;  2LVI A;  3DVM A;  5CSI A;  3I5F C;  4ICB A;  3PSR A;  1A75 B;  1DVI A;  1DJY A;  1F8H A;  5AEQ A;  1S26 D;  3CTN A;  3DF0 A;  4PHM A;  1F70 A;  1SKT A;  1LA0 A;  1SCV A;  5I2L A;  3LCP C;  2BL0 B;  2BBN A;  2KFH A;  1SK6 D;  1YRT B;  1EH2 A;  2M3W A;  4YGE B;  1KK8 C;  1ZMZ A;  5JOL A;  1K9U A;  1B4C A;  1IJ6 A;  1NCX A;  1CLM A;  4L9M A;  1JF0 A;  1OSA A;  4C0J A;  4GUK A;  3SG2 A;  1CFF A;  1DF0 B;  2L0P A;  3TDI A;  1SRA A;  5AFP A;  1K93 D;  2LC5 A;  3IQO A;  3OX6 A;  1DF0 A;  4PE7 A;  2F2P A;  1TNW A;  1CTR A;  2LMU A;  2QPT A;  2I2R E;  4FQO A;  2JNX A;  2G9B A;  4YI9 A;  1OE9 B;  5FYX A;  2ZND A;  2MHH A;  3DVE A;  2D8N A;  1TOP A;  2ZN8 A;  3JTD B;  3NXA A;  3EK8 A;  2LE9 B;  3I5I C;  2ZRT A;  3K21 A;  2H61 A;  1F55 A;  1UUR A;  3I5G C;  3EKJ A;  3WNX B;  4DUQ A;  3LL8 B;  1J55 A;  2KQ6 A;  1IH0 A;  4GGF A;  1J7R A;  2HPS A;  1CFC A;  1IRJ A;  1CFD A;  1NSH A;  2WCB A;  1DJG A;  1R2U A;  1XFW O;  1CDM A;  5I2O A;  4N5X A;  1SR6 C;  3PM8 A;  4NDC A;  1CMF A;  2EGD A;  3VRO A;  1U5I B;  1OMR A;  5HLV A;  4FTG A;  4CLN A;  2A4J A;  1MF8 B;  4ZCV A;  5CSJ A;  4IL1 A;  3SG4 A;  2MLF C;  2BE6 A;  5CSF A;  3FS7 A;  2I18 A;  1NX1 A;  2JXC A;  4XJK B;  1RTP 1;  2M49 B;  2K61 A;  2LVV A;  1NUB A;  2M9G A;  1KQM C;  3C1V A;  5D69 A;  2LLU A;  2JUL A;  4HRG A;  1ZFS A;  3TDU A;  1IWQ A;  1K2H A;  3EVV A;  1ZAC A;  3JVT B;  4PHJ A;  1QTX A;  1YTZ C;  1ZUZ A;  1WRL A;  2I94 A;  1DGV A;  1QV0 A;  1UHI A;  3BYA A;  5PAL A;  2HQ8 A;  3TZ1 A;  1BG1 A;  1S6I A;  2PRU A;  1KFU S;  1WRZ A;  1ALV A;  2WC8 A;  2Y1M A;  1CB1 A;  3KF9 A;  3SIA A;  1IQ5 A;  1PRW A;  1QLK A;  1FBV A;  2VRG A;  2O5G A;  1XK4 C;  1F4Q A;  1YUT A;  5DKN A;  1L2O C;  4NQG A;  1QVI Z;  1BJF A;  2K7B A;  2L2E A;  4MEW A;  1S36 A;  1ODB A;  4XYN A;  2F33 A;  4ORA B;  1AUI B;  3TUY C;  2NZ0 A;  1PSR A;  4N1F A;  1TNP A;  1AVS A;  1KFX L;  2BCX A;  2BKH B;  2AUC A;  2K0J A;  2LHI A;  3F45 A;  3TS5 B;  1AP4 A;  2EHB A;  1YR5 A;  4BY4 A;  1JF2 A;  1QAT A;  1VRK A;  2KOT A;  3IQQ A;  2L4I A;  1UP5 A;  2F3Z A;  1GGZ A;  1MWN A;  5JJG A;  2ISD A;  2QAC A;  1CM1 A;  2NLN A;  1SCM C;  3DD4 A;  2PVB A;  2JTT A;  1AJ5 A;  3OX5 A;  3PAT A;  2COL B;  2JT3 A;  1QLS A;  1GQM A;  2P6B B;  1MHO A;  3KHE A;  3PLF B;  1QX5 B;  4PE1 A;  1KQV A;  2FCD A;  3H4S E;  1KWO C;  2LUC A;  1YRU B;  4YGC B;  4MVF A;  3PN7 B;  3DF0 B;  2CXJ A;  2M97 A;  3AAJ A;  1DTL A;  2HET A;  3JVT C;  4PHK A;  2ZNE A;  4MRY A;  2KGB C;  4BY5 A;  4OKH A;  1SL9 A;  3D0Y A;  1HQV A;  1QVI Y;  2GGZ A;  3A8R A;  3SG7 A;  4AQI A;  4MZL A;  2PAL A;  3CS1 A;  1OQP A;  2K8M B;  1BLQ A;  4GGN A;  1KCY A;  1UHJ A;  4DS7 A;  1BR1 B;  1UHK A;  1JFK A;  2KFF A;  1B8C A;  2R2I A;  3EVR A;  1QAS A;  3ZWH A;  4GFT A;  2K7O A;  2OS8 C;  3CGA A;  5G08 A;  1C7V A;  4WRI A;  1EG3 A;  2CBL A;  1A03 A;  1NP8 A;  3BUN B;  4PCW A;  1TN4 A;  4P5O E;  2AAO A;  4GAO A;  1J1D A;  1RK9 A;  3ICB A;  2M29 A;  2JU0 A;  2JTZ A;  5AER A;  1JBA A;  1D1O A;  1WLZ A;  3TS5 C;  2KI4 B;  4HRH A;  4ORB B;  1SPY A;  1BT6 A;  1XA5 A;  1WLM A;  3AKB A;  3BOW A;  1B47 A;  2KI6 D;  4P2Y B;  5K89 A;  1BOC A;  2LVK A;  4MLW A;  1YUU A;  1A2X A;  1LA3 A;  3BXK A;  4PE4 A;  1MR8 A;  3VRQ A;  3HX4 A;  3KO0 A;  2K7D A;  2JT8 A;  2KQY A;  5I2Q A;  2SAS A;  2FJU B;  5DKR A;  1S3P A;  2OTG C;  1YX8 A;  1WDC B;  2LAP A;  2V53 A;  5KU1 A;  1EL4 A;  4N1G A;  1K8U A;  1LXF C;  5B8I B;  1JUO A;  1QX7 A;  5DKQ A;  1G33 A;  3WXA A;  1PK0 D;  2L51 A;  3BUW B;  5HKZ A;  1QIV A;  1F71 A;  3I5H B;  1M31 A;  4CPV A;  2ZRS A;  3SIB A;  1ALW A;  1SL7 A;  3IF7 A;  4DCK A;  4YBH B;  1MQ1 A;  1SBJ A;  2JQ6 A;  2JZI A;  2EC6 B;  2BCB A;  1QIW A;  4GPL B;  1FI5 A;  1IJ5 A;  1CDP A;  2L98 A;  4MBE A;  2E6W A;  3EK4 A;  2BL0 C;  4MN0 A;  4A4C A;  1SW8 A;  2Q91 A;  3M0W A;  4D1E A;  4Q04 A;  1J7P A;  2HF5 A;  1OMD A;  1S5G Z;  1IKU A;  3EVU A;  2MJW B;  1G4Y R;  2LVJ A;  1KFX S;  1KSM A;  2NCO A;  2LAN A;  1NCY A;  3PAL A;  1NWD A; 
#chains in the Genus database with same CATH topology
 1YX7 A;  4USL A;  5KTY A;  2KLE A;  1REC A;  1TCO B;  2MRD A;  1RJV A;  4IJ7 A;  4YI8 A;  4PT1 A;  3S0F A;  1XVJ A;  2KDH A;  1J7O A;  1BOD A;  2JT0 A;  2LP3 A;  3BQ3 A;  1FPW A;  3KPX A;  1SL8 A;  2LHL A;  1IG5 A;  1C7W A;  2JPT A;  1K94 A;  3NSO A;  1PSB A;  4YGD B;  3JTD C;  4I5K A;  3B88 A;  1K96 A;  1Y1A A;  2LV7 A;  1M63 B;  2BBM A;  1OMV A;  4PAL A;  2CTN A;  2WCJ A;  3I5F B;  5CSN A;  2IS9 A;  1DGU A;  2LMV A;  1C3Y A;  1Y1X A;  2LM5 A;  1XFU O;  4PE0 A;  1ZOT B;  5TNC A;  3D75 A;  3NSK A;  2F8P A;  1SSE B;  1Y0V H;  1M45 A;  3UNW A;  4DIR A;  1SMG A;  4ORC B;  1PUL A;  1QXP A;  1S6C A;  3BUM B;  1NX3 A;  1KK8 B;  1WDC C;  3VGO A;  4M2O A;  2KAX A;  1W7J B;  2ZN9 A;  2M7N A;  3FIA A;  3TDZ A;  2JRF A;  3LLE A;  1H8B A;  1B7T Z;  3NSI A;  1A29 A;  3CZT X;  2QDI A;  1Y6W A;  2CT9 A;  4DRW A;  3GK4 X;  2L4H A;  2WOS A;  1OOI X;  1S5G Y;  2LLT A;  3SJS A;  1B1G A;  4TNC A;  1JFJ A;  2JNF A;  5HKW A;  3CR4 X;  2KAV A;  1GJY A;  1E8A A;  1WRK A;  3DVK A;  3OP0 A;  3VRR A;  3OBV A;  1QS7 A;  4JWQ A;  3RLZ A;  1LIN A;  1TNX A;  2PMY A;  5KSZ A;  1XFX O;  1EXR A;  2SCP A;  2KAY A;  1Z4H A;  2HQW A;  2ZKM X;  5D7F A;  5BPJ A;  2LNK A;  2MA2 A;  2L50 A;  3DVJ A;  4CFR A;  4YGA A;  1SNL A;  3BFA A;  3EK7 A;  3I5I B;  4I5N B;  1AK8 A;  5ER4 X;  1TNQ A;  1K90 D;  3D0Y B;  3CLN A;  1RWY A;  3I5G B;  5J3X A;  5AAN A;  1NX2 A;  1R6P A;  2P71 A;  2K2A A;  2NCP A;  2K7C A;  1OW4 A;  3KEV A;  3O6B A;  1QX2 A;  1DJX A;  3OB2 B;  4QJ5 B;  1TTX A;  1SY9 A;  4HSZ A;  2B1U A;  2QEO A;  1MXE A;  5GQQ C;  1TUJ A;  4NDB A;  1M39 A;  2K2F A;  2QEB A;  1IGV A;  3UO9 A;  3SG6 A;  5I8N A;  1SR6 B;  2BAP A;  2H2K A;  2KPH A;  4NDD A;  2PSR A;  3VRP A;  3AKA A;  1AJ4 A;  2Q4U A;  1Y1U A;  5IBW A;  2PAS A;  4E68 A;  1B7T Y;  1OOH A;  1PAL A;  1A75 A;  2BNX A;  1A4P A;  2GTE A;  1XFY O;  4FQT A;  3HCM A;  1DJH A;  3NSL A;  2KSP A;  1TIZ A;  1K95 A;  2KI6 C;  4JQ0 D;  3BOW B;  1KQM B;  4PDZ A;  3ZNI A;  3RM1 A;  1DMO A;  1B8L A;  2JXL A;  1SYM A;  4YGB B;  4YRU A;  2WC5 A;  4GBA A;  4JPZ B;  4OVN F;  1DT7 B;  1DJW A;  4UPG A;  2LP2 A;  4AQJ A;  1J7Q A;  3EG5 B;  1HT9 A;  1LKJ A;  1UHH A;  1CLL A;  1FI6 A;  4MSP A;  2OPO A;  5F6T A;  2KNE A;  1GGW A;  4C0K A;  1CLB A;  4ZCU A;  1N2D A;  3CR5 X;  1PVB A;  1UWO A;  1K9P A;  1YVH A;  2FOT A;  2KLD A;  4MZK A;  1BF5 A;  2KYC A;  2M0R A;  1NCZ A;  3CZ0 A;  1BU3 A;  2ZFD A;  1JWD A;  3OB1 B;  1EG4 A;  2I7A A;  3OGN A;  3PN7 C;  1L2O B;  4JD9 A;  4OR9 B;  3WHT B;  3VRN A;  1K9K A;  1XK4 A;  3GK1 A;  5HLO A;  4OZD A;  3SS3 A;  3TUY B;  4HRE E;  3LK0 A;  4I5J A;  1MXL C;  2BEC A;  2M8U A;  2F2O A;  1YUS A;  3D73 A;  4M2P A;  1KK7 Z;  1G8I A;  3NGV A;  4OV2 A;  1T14 A;  3BFB A;  5HYD A;  3PFV A;  5HKY A;  3O2P A;  2BKI B;  4OCI A;  1TRF A;  3AAK A;  1QJT A;  3BUO B;  1KSO A;  1DEK A;  2NXQ A;  3O78 A;  3OHM B;  4GNK B;  2JC2 A;  2KGR A;  3QME A;  3CYZ A;  1SCM B;  1B9A A;  2AMI A;  2KFG A;  1F4O A;  1XO5 A;  1U5I A;  2L5X B;  3N7H A;  2DOQ A;  3CWG A;  4QJ3 B;  5CPV A;  1WY9 A;  1DJZ A;  2WC6 A;  2WND A;  1L7Z A;  3B7A A;  1RRO A;  1YUR A;  5ER5 A;  1CKK A;  3BUX B;  2H61 C;  1V1G A;  4XJK A;  1CMG A;  2KI4 C;  1J1E A;  2GGM A;  1KWO B;  1MUX A;  2LLS A;  3FWC A;  1QV1 A;  2E30 A;  4CID A;  1NYA A;  2ERB A;  2GV5 A;  2MLE C;  4AOM A;  4GGF C;  3SG3 A;  3BJH A;  1CM4 A;  2CCM A;  1RFJ A;  2WOR A;  3GOF A;  3E3R A;  2BE4 A;  3S0D A;  1H4B A;  4I5L B;  2Y5I A;  1OZO A;  4C0L A;  2G2B A;  1XFV O;  3A4U B;  1B8R A;  2FCE A;  3GK2 A;  3L47 A;  1NIW A;  1EJ3 A;  1NX0 A;  1PVA A;  1LVC D;  1W7I B;  3I5H C;  1KK7 Y;  2BCA A;  1OOJ A;  1Q80 A;  2JWW A;  2LUX A;  4R1E A;  1N0Y A;  2OS8 B;  1CDN A;  2KHN A;  5EL2 A;  2KBI A;  2EC6 C;  2RGI A;  3PM2 A;  1N65 A;  5D3O A;  1XYD A;  2KBM A;  1JC2 A;  3R1V A;  2M7L A;  1XFZ O;  3CR2 A;  3PJI A;  1BR4 B;  1X02 A;  1TWO A;  3Q8I A;  3QRX A;  1KFU L;  1UUS A;  3O4Y A;  5FI7 A;  1FF1 A;  4QJ4 B;  2Y1N A;  3D10 A;  4MRX A;  1DJI A;  2LMT A;  3WHU B;  4ETO A;  1AHR A;  1S1E A;  3O4X A;  3DY9 A;  4WQ3 A;  1CDL A;  2M1K B;  3K1E A;  3MSE B;  5FI6 A;  3FWB A;  1DC1 A;  1UHN A;  1CFP A;  2MBX A;  1V1F A;  1S6J A;  1TCF A;  1M46 A;  2MAZ A;  1F54 A;  1JSA A;  2M1U A;  1LS8 A;  4CFQ A;  1BMO A;  4MZJ A;  2KYF A;  2O60 A;  2OTG B;  3EKH A;  2JOJ A;  2LCP A;  1OZS A;  4F0Z B;  4WQ2 A;  2WCE A;  1IQ3 A;  5AXI A;  4PHN A;  1NPQ A;  3LK1 A;  4M2Q A;  2F3Y A;  4A4B A;  4U8D A;  1FW4 A;  2TN4 A;  2CNP A;  3B86 A;  1YVL A;  2WCF A;  3SG5 A;  1CNP A;  2Y4Q A;  2LVI A;  3DVM A;  5CSI A;  3I5F C;  3R1O A;  3PSR A;  4ICB A;  1A75 B;  1DVI A;  1DJY A;  1F8H A;  5AEQ A;  1S26 D;  2WCM A;  3CTN A;  3DF0 A;  4PHM A;  1F70 A;  1SKT A;  1LA0 A;  1SCV A;  5I2L A;  3LCP C;  2BL0 B;  2BBN A;  2KFH A;  1SK6 D;  1YRT B;  1EH2 A;  2M3W A;  4YGE B;  1KK8 C;  1ZMZ A;  5JOL A;  1K9U A;  3SS5 A;  3R72 A;  1B4C A;  1ORG A;  1IJ6 A;  1NCX A;  1CLM A;  4L9M A;  1JF0 A;  1OSA A;  4C0J A;  4GUK A;  3SG2 A;  1CFF A;  1DF0 B;  2L0P A;  4F7F A;  3TDI A;  1SRA A;  5AFP A;  1K93 D;  2LC5 A;  3IQO A;  3NHT A;  1DF0 A;  2QEH A;  3OX6 A;  4PE7 A;  2F2P A;  3CDN A;  1TNW A;  1CTR A;  2LMU A;  2QPT A;  2I2R E;  4FQO A;  2JNX A;  2G9B A;  4YI9 A;  1OE9 B;  5FYX A;  2ZND A;  2MHH A;  3DVE A;  2D8N A;  3L4L A;  4JKT A;  1TOP A;  2ZN8 A;  3JTD B;  3NXA A;  3EK8 A;  2LE9 B;  3I5I C;  2ZRT A;  3K21 A;  2H61 A;  1F55 A;  1UUR A;  3I5G C;  3EKJ A;  3WNX B;  4DUQ A;  3LL8 B;  1J55 A;  2KQ6 A;  1IH0 A;  4GGF A;  1J7R A;  2HPS A;  2JPO A;  2L2C A;  3S0E A;  1CFC A;  1IRJ A;  1CFD A;  1NSH A;  2WCB A;  1DJG A;  1R2U A;  2K60 A;  1XFW O;  1CDM A;  5DIC A;  5I2O A;  4N5X A;  1SR6 C;  4INX A;  3PM8 A;  4NDC A;  1CMF A;  2EGD A;  3VRO A;  1U5I B;  1OMR A;  5HLV A;  4FTG A;  4CLN A;  2A4J A;  1MF8 B;  4ZCV A;  5CSJ A;  4IL1 A;  3SG4 A;  3D74 A;  2MLF C;  5FI2 A;  3S0G A;  2BE6 A;  4INW A;  3FS7 A;  5CSF A;  1DEL A;  1NX1 A;  2I18 A;  2JXC A;  1RTP 1;  2M49 B;  4XJK B;  2K61 A;  2LVV A;  1NUB A;  2M9G A;  1KQM C;  3C1V A;  5D69 A;  2LLU A;  2JUL A;  4HRG A;  1ZFS A;  2FJY A;  3TDU A;  3DZT A;  1IWQ A;  1K2H A;  3EVV A;  1ZAC A;  3JVT B;  3SS4 A;  4PHJ A;  1QTX A;  1YTZ C;  3D78 A;  1ZUZ A;  1WRL A;  2I94 A;  3DYE A;  1DGV A;  1QV0 A;  1UHI A;  3BYA A;  5PAL A;  2HQ8 A;  3TZ1 A;  2PQL A;  1BG1 A;  1DQE A;  1S6I A;  1KFU S;  1WRZ A;  1ALV A;  2PRU A;  2WC8 A;  2Y1M A;  3CAB A;  1CB1 A;  1IIO A;  3KF9 A;  3SIA A;  1IQ5 A;  1PRW A;  3S0A A;  1QLK A;  1FBV A;  2VRG A;  2O5G A;  1XK4 C;  1F4Q A;  1YUT A;  5DKN A;  1L2O C;  4NQG A;  1QVI Z;  1BJF A;  1C3Z A;  1P28 A;  2K7B A;  2L2E A;  4MEW A;  1S36 A;  1ODB A;  4XYN A;  2F33 A;  4ORA B;  1AUI B;  3TUY C;  3DXL A;  1Z2C B;  2NZ0 A;  1PSR A;  1C07 A;  4N1F A;  3RZS A;  1TNP A;  1AVS A;  1KFX L;  2BCX A;  2BKH B;  2AUC A;  3V2L A;  2K0J A;  2LHI A;  3F45 A;  3TS5 B;  2P70 A;  1AP4 A;  2EHB A;  1YR5 A;  4BY4 A;  1JF2 A;  1QAT A;  1VRK A;  2KOT A;  3IQQ A;  5HL1 A;  2L4I A;  1UP5 A;  2F3Z A;  1GGZ A;  1MWN A;  5JJG A;  2ISD A;  2QAC A;  1CM1 A;  2NLN A;  1SCM C;  3DD4 A;  3CZ2 A;  2PVB A;  2JTT A;  2WCL A;  2YGU A;  5I94 A;  1AJ5 A;  3OX5 A;  3PAT A;  2COL B;  2JT3 A;  1QLS A;  1GQM A;  2P6B B;  1MHO A;  3KHE A;  3PLF B;  1QX5 B;  4PE1 A;  1KQV A;  2FCD A;  3H4S E;  1KWO C;  2LUC A;  1YRU B;  4YGC B;  2WCH A;  4MVF A;  3PN7 B;  3DF0 B;  2CXJ A;  2M97 A;  3AAJ A;  1DTL A;  2HET A;  3FE9 A;  3JVT C;  4PHK A;  2ZNE A;  4MRY A;  2KGB C;  3IVT A;  4BY5 A;  4OKH A;  1SL9 A;  3D0Y A;  1HQV A;  1QVI Y;  2GGZ A;  1W9Z A;  3A8R A;  3SG7 A;  4AQI A;  4MZL A;  2PAL A;  3CS1 A;  1OQP A;  2K8M B;  3VB1 A;  3FE8 A;  4GGN A;  1BLQ A;  1KCY A;  3B6X A;  1UHJ A;  4DS7 A;  1BR1 B;  1UHK A;  1JFK A;  2KFF A;  1B8C A;  2R2I A;  3EVR A;  1QAS A;  3ZWH A;  4GFT A;  2K7O A;  2OS8 C;  3CGA A;  5G08 A;  1QWV A;  1C7V A;  4WRI A;  3R1P A;  1EG3 A;  2CBL A;  1A03 A;  1NP8 A;  3BUN B;  4PCW A;  1TN4 A;  3D77 A;  4P5O E;  2AAO A;  4GAO A;  1J1D A;  1RK9 A;  3ICB A;  2M29 A;  2JU0 A;  2JTZ A;  3NHI A;  5AER A;  1JBA A;  1D1O A;  1WLZ A;  1GM0 A;  3TS5 C;  2KI4 B;  4HRH A;  4ORB B;  1SPY A;  1BT6 A;  1XA5 A;  1WLM A;  3AKB A;  3BOW A;  1B47 A;  2KI6 D;  4P2Y B;  5K89 A;  4KYN A;  2LVK A;  4MLW A;  1YUU A;  1A2X A;  1BOC A;  1LA3 A;  3BXK A;  4PE4 A;  1MR8 A;  3VRQ A;  3HX4 A;  3KO0 A;  3L4A A;  2K7D A;  2JT8 A;  2KQY A;  5I2Q A;  2SAS A;  2FJU B;  5DKR A;  1S3P A;  1TUZ A;  2OTG C;  1YX8 A;  2H8V A;  1WDC B;  2LAP A;  2V53 A;  5KU1 A;  1EL4 A;  3S0B A;  4N1G A;  1K8U A;  1LXF C;  2QEV A;  5B8I B;  1QX7 A;  1JUO A;  5DKQ A;  1G33 A;  3WXA A;  1PK0 D;  2L51 A;  3BUW B;  5HKZ A;  1QIV A;  1F71 A;  3I5H B;  1M31 A;  4CPV A;  2ZRS A;  3SIB A;  1ALW A;  1SL7 A;  3IF7 A;  4DCK A;  4YBH B;  1MQ1 A;  1SBJ A;  2JQ6 A;  2JZI A;  2EC6 B;  2BCB A;  3BFH A;  1QIW A;  3FE6 A;  4GPL B;  1FI5 A;  1IJ5 A;  1CDP A;  2L98 A;  4MBE A;  2E6W A;  2PYQ A;  3EK4 A;  2BL0 C;  4MN0 A;  2L5Y A;  4A4C A;  1SW8 A;  2Q91 A;  3M0W A;  4D1E A;  4Q04 A;  1J7P A;  3B87 A;  2HF5 A;  2WCK A;  1OOG A;  1OMD A;  1S5G Z;  1IKU A;  3EVU A;  2MJW B;  1G4Y R;  3D76 A;  1OOF A;  3CZ1 A;  2LVJ A;  1XFR A;  1KFX S;  1KSM A;  2NCO A;  2LAN A;  1NCY A;  3PAL A;  1NWD A; 
#chains in the Genus database with same CATH homology
 1YX7 A;  4USL A;  5KTY A;  1REC A;  1TCO B;  2MRD A;  1RJV A;  4YI8 A;  1JFJ A;  1J7O A;  1XVJ A;  2KDH A;  1BOD A;  2JT0 A;  2LP3 A;  3BQ3 A;  1FPW A;  3KPX A;  1SL8 A;  2LHL A;  1IG5 A;  1C7W A;  2JPT A;  1K94 A;  3NSO A;  1PSB A;  4YGD B;  3JTD C;  4I5K A;  1K96 A;  1Y1A A;  2LV7 A;  1M63 B;  2BBM A;  1OMV A;  4PAL A;  2CTN A;  3I5F B;  5CSN A;  2IS9 A;  1DGU A;  2LMV A;  1Y1X A;  2LM5 A;  1XFU O;  4PE0 A;  1ZOT B;  5TNC A;  3NSK A;  2F8P A;  4DIR A;  1Y0V H;  1M45 A;  1SMG A;  4ORC B;  1PUL A;  1QXP A;  1S6C A;  3BUM B;  1NX3 A;  1KK8 B;  1WDC C;  3VGO A;  4M2O A;  2KAX A;  1W7J B;  2ZN9 A;  2M7N A;  3FIA A;  3TDZ A;  2JRF A;  3LLE A;  1H8B A;  1B7T Z;  3NSI A;  1A29 A;  3CZT X;  1Y6W A;  2CT9 A;  4DRW A;  3GK4 X;  2L4H A;  2WOS A;  1S5G Y;  2LLT A;  3SJS A;  1B1G A;  4TNC A;  2JNF A;  5HKW A;  3CR4 X;  2KAV A;  1GJY A;  1E8A A;  1WRK A;  3DVK A;  3OP0 A;  3VRR A;  4JWQ A;  1QS7 A;  3RLZ A;  1LIN A;  1TNX A;  2PMY A;  5KSZ A;  1XFX O;  1EXR A;  2SCP A;  2KAY A;  2HQW A;  5BPJ A;  2ZKM X;  5D7F A;  2LNK A;  2MA2 A;  2L50 A;  3DVJ A;  4CFR A;  4YGA A;  1SNL A;  3EK7 A;  3I5I B;  4I5N B;  1AK8 A;  5ER4 X;  1TNQ A;  1K90 D;  3D0Y B;  3CLN A;  1RWY A;  3I5G B;  5J3X A;  5AAN A;  1NX2 A;  1R6P A;  2K2A A;  2NCP A;  2K7C A;  3KEV A;  3O6B A;  1QX2 A;  1DJX A;  3OB2 B;  4QJ5 B;  1TTX A;  1SY9 A;  4HSZ A;  2B1U A;  1MXE A;  5GQQ C;  4NDB A;  1M39 A;  2K2F A;  1IGV A;  3SG6 A;  5I8N A;  1SR6 B;  2H2K A;  3VRP A;  4NDD A;  2PSR A;  3AKA A;  1AJ4 A;  2Q4U A;  1Y1U A;  5IBW A;  2PAS A;  4E68 A;  1B7T Y;  1PAL A;  1A75 A;  1A4P A;  1XFY O;  3HCM A;  1DJH A;  3NSL A;  2KSP A;  1TIZ A;  1K95 A;  2KI6 C;  4JQ0 D;  3BOW B;  1KQM B;  4PDZ A;  3ZNI A;  3RM1 A;  1DMO A;  1B8L A;  2JXL A;  1SYM A;  4YGB B;  4YRU A;  4JPZ B;  4GBA A;  4OVN F;  1DT7 B;  1DJW A;  4UPG A;  2LP2 A;  4AQJ A;  1J7Q A;  1HT9 A;  1LKJ A;  1UHH A;  1CLL A;  1FI6 A;  4MSP A;  2OPO A;  5F6T A;  2KNE A;  1GGW A;  4C0K A;  1CLB A;  4ZCU A;  1N2D A;  3CR5 X;  1PVB A;  1UWO A;  1K9P A;  1YVH A;  2FOT A;  4MZK A;  1BF5 A;  2KYC A;  2M0R A;  1NCZ A;  1BU3 A;  2ZFD A;  1JWD A;  3OB1 B;  1EG4 A;  2I7A A;  3PN7 C;  4OR9 B;  1L2O B;  3WHT B;  3VRN A;  1K9K A;  1XK4 A;  3GK1 A;  5HLO A;  3TUY B;  4HRE E;  3LK0 A;  4I5J A;  1MXL C;  2BEC A;  2M8U A;  2F2O A;  1YUS A;  4M2P A;  1KK7 Z;  1G8I A;  4OV2 A;  5HYD A;  3PFV A;  5HKY A;  3O2P A;  2BKI B;  4OCI A;  1TRF A;  3AAK A;  1QJT A;  3BUO B;  1KSO A;  2NXQ A;  3O78 A;  3OHM B;  4GNK B;  2JC2 A;  2KGR A;  1SCM B;  1B9A A;  2AMI A;  2KFG A;  1F4O A;  1XO5 A;  1U5I A;  2L5X B;  2DOQ A;  3CWG A;  4QJ3 B;  5CPV A;  1WY9 A;  1DJZ A;  2WND A;  1L7Z A;  1RRO A;  1YUR A;  5ER5 A;  1CKK A;  3BUX B;  2H61 C;  1V1G A;  4XJK A;  1CMG A;  2KI4 C;  1J1E A;  2GGM A;  1KWO B;  1MUX A;  2LLS A;  3FWC A;  1QV1 A;  2E30 A;  4CID A;  1NYA A;  2GV5 A;  2MLE C;  4AOM A;  4GGF C;  3SG3 A;  1CM4 A;  2CCM A;  1RFJ A;  2WOR A;  3GOF A;  3E3R A;  2BE4 A;  1H4B A;  4I5L B;  2Y5I A;  1OZO A;  4C0L A;  2G2B A;  1XFV O;  3A4U B;  1B8R A;  2FCE A;  3GK2 A;  1NIW A;  1EJ3 A;  1NX0 A;  1PVA A;  1LVC D;  1W7I B;  3I5H C;  1KK7 Y;  2BCA A;  1OOJ A;  1Q80 A;  2JWW A;  2LUX A;  4R1E A;  1N0Y A;  2OS8 B;  1CDN A;  2KHN A;  2KBI A;  2EC6 C;  2RGI A;  1N65 A;  1XYD A;  2KBM A;  1JC2 A;  2M7L A;  1XFZ O;  3CR2 A;  1BR4 B;  1X02 A;  3QRX A;  1KFU L;  1UUS A;  3O4Y A;  1FF1 A;  4QJ4 B;  2Y1N A;  3D10 A;  4MRX A;  1DJI A;  2LMT A;  3WHU B;  4ETO A;  1AHR A;  1S1E A;  1C07 A;  4WQ3 A;  1CDL A;  2M1K B;  3MSE B;  3FWB A;  1UHN A;  1CFP A;  2MBX A;  1V1F A;  1S6J A;  1TCF A;  1M46 A;  2MAZ A;  1F54 A;  1JSA A;  2M1U A;  4CFQ A;  1BMO A;  4MZJ A;  2KYF A;  2O60 A;  2OTG B;  3EKH A;  2JOJ A;  2LCP A;  1OZS A;  4F0Z B;  4WQ2 A;  2WCE A;  1IQ3 A;  5AXI A;  4PHN A;  1NPQ A;  3LK1 A;  4M2Q A;  2F3Y A;  4A4B A;  4U8D A;  1FW4 A;  2TN4 A;  2CNP A;  1YVL A;  2WCF A;  3SG5 A;  1CNP A;  2Y4Q A;  2LVI A;  3DVM A;  5CSI A;  3I5F C;  4ICB A;  3PSR A;  1A75 B;  1DVI A;  1DJY A;  1F8H A;  5AEQ A;  1S26 D;  3CTN A;  3DF0 A;  4PHM A;  1F70 A;  1SKT A;  1LA0 A;  1SCV A;  5I2L A;  3LCP C;  2BL0 B;  2BBN A;  2KFH A;  1SK6 D;  1YRT B;  1EH2 A;  2M3W A;  4YGE B;  1KK8 C;  1ZMZ A;  5JOL A;  1K9U A;  1B4C A;  1IJ6 A;  1NCX A;  1CLM A;  4L9M A;  1JF0 A;  1OSA A;  4C0J A;  4GUK A;  3SG2 A;  1CFF A;  1DF0 B;  2L0P A;  3TDI A;  1SRA A;  5AFP A;  1K93 D;  2LC5 A;  3IQO A;  3OX6 A;  1DF0 A;  4PE7 A;  2F2P A;  1TNW A;  1CTR A;  2LMU A;  2QPT A;  2I2R E;  4FQO A;  2JNX A;  2G9B A;  4YI9 A;  1OE9 B;  5FYX A;  2ZND A;  2MHH A;  3DVE A;  2D8N A;  1TOP A;  2ZN8 A;  3JTD B;  3NXA A;  3EK8 A;  2LE9 B;  3I5I C;  2ZRT A;  3K21 A;  2H61 A;  1F55 A;  1UUR A;  3I5G C;  3EKJ A;  3WNX B;  4DUQ A;  3LL8 B;  1J55 A;  2KQ6 A;  1IH0 A;  4GGF A;  1J7R A;  2HPS A;  1CFC A;  1IRJ A;  1CFD A;  1NSH A;  2WCB A;  1DJG A;  1R2U A;  1XFW O;  1CDM A;  5I2O A;  4N5X A;  1SR6 C;  3PM8 A;  4NDC A;  1CMF A;  2EGD A;  3VRO A;  1U5I B;  1OMR A;  5HLV A;  4FTG A;  4CLN A;  2A4J A;  1MF8 B;  4ZCV A;  5CSJ A;  4IL1 A;  3SG4 A;  2MLF C;  2BE6 A;  5CSF A;  3FS7 A;  2I18 A;  1NX1 A;  2JXC A;  4XJK B;  1RTP 1;  2M49 B;  2K61 A;  2LVV A;  1NUB A;  2M9G A;  1KQM C;  3C1V A;  5D69 A;  2LLU A;  2JUL A;  4HRG A;  1ZFS A;  3TDU A;  1IWQ A;  1K2H A;  3EVV A;  1ZAC A;  3JVT B;  4PHJ A;  1QTX A;  1YTZ C;  1ZUZ A;  1WRL A;  2I94 A;  1DGV A;  1QV0 A;  1UHI A;  3BYA A;  5PAL A;  2HQ8 A;  3TZ1 A;  1BG1 A;  1S6I A;  2PRU A;  1KFU S;  1WRZ A;  1ALV A;  2WC8 A;  2Y1M A;  1CB1 A;  3KF9 A;  3SIA A;  1IQ5 A;  1PRW A;  1QLK A;  1FBV A;  2VRG A;  2O5G A;  1XK4 C;  1F4Q A;  1YUT A;  5DKN A;  1L2O C;  4NQG A;  1QVI Z;  1BJF A;  2K7B A;  2L2E A;  4MEW A;  1S36 A;  1ODB A;  4XYN A;  2F33 A;  4ORA B;  1AUI B;  3TUY C;  2NZ0 A;  1PSR A;  4N1F A;  1TNP A;  1AVS A;  1KFX L;  2BCX A;  2BKH B;  2AUC A;  2K0J A;  2LHI A;  3F45 A;  3TS5 B;  1AP4 A;  2EHB A;  1YR5 A;  4BY4 A;  1JF2 A;  1QAT A;  1VRK A;  2KOT A;  3IQQ A;  2L4I A;  1UP5 A;  2F3Z A;  1GGZ A;  1MWN A;  5JJG A;  2ISD A;  2QAC A;  1CM1 A;  2NLN A;  1SCM C;  3DD4 A;  2PVB A;  2JTT A;  1AJ5 A;  3OX5 A;  3PAT A;  2COL B;  2JT3 A;  1QLS A;  1GQM A;  2P6B B;  1MHO A;  3KHE A;  3PLF B;  1QX5 B;  4PE1 A;  1KQV A;  2FCD A;  3H4S E;  1KWO C;  2LUC A;  1YRU B;  4YGC B;  4MVF A;  3PN7 B;  3DF0 B;  2CXJ A;  2M97 A;  3AAJ A;  1DTL A;  2HET A;  3JVT C;  4PHK A;  2ZNE A;  4MRY A;  2KGB C;  4BY5 A;  4OKH A;  1SL9 A;  3D0Y A;  1HQV A;  1QVI Y;  2GGZ A;  3A8R A;  3SG7 A;  4AQI A;  4MZL A;  2PAL A;  3CS1 A;  1OQP A;  2K8M B;  1BLQ A;  4GGN A;  1KCY A;  1UHJ A;  4DS7 A;  1BR1 B;  1UHK A;  1JFK A;  2KFF A;  1B8C A;  2R2I A;  3EVR A;  1QAS A;  3ZWH A;  4GFT A;  2K7O A;  2OS8 C;  3CGA A;  5G08 A;  1C7V A;  4WRI A;  1EG3 A;  2CBL A;  1A03 A;  1NP8 A;  3BUN B;  4PCW A;  1TN4 A;  4P5O E;  2AAO A;  4GAO A;  1J1D A;  1RK9 A;  3ICB A;  2M29 A;  2JU0 A;  2JTZ A;  5AER A;  1JBA A;  1D1O A;  1WLZ A;  3TS5 C;  2KI4 B;  4HRH A;  4ORB B;  1SPY A;  1BT6 A;  1XA5 A;  1WLM A;  3AKB A;  3BOW A;  1B47 A;  2KI6 D;  4P2Y B;  5K89 A;  1BOC A;  2LVK A;  4MLW A;  1YUU A;  1A2X A;  1LA3 A;  3BXK A;  4PE4 A;  1MR8 A;  3VRQ A;  3HX4 A;  3KO0 A;  2K7D A;  2JT8 A;  2KQY A;  5I2Q A;  2SAS A;  2FJU B;  5DKR A;  1S3P A;  2OTG C;  1YX8 A;  1WDC B;  2LAP A;  2V53 A;  5KU1 A;  1EL4 A;  4N1G A;  1K8U A;  1LXF C;  5B8I B;  1JUO A;  1QX7 A;  5DKQ A;  1G33 A;  3WXA A;  1PK0 D;  2L51 A;  3BUW B;  5HKZ A;  1QIV A;  1F71 A;  3I5H B;  1M31 A;  4CPV A;  2ZRS A;  3SIB A;  1ALW A;  1SL7 A;  3IF7 A;  4DCK A;  4YBH B;  1MQ1 A;  1SBJ A;  2JQ6 A;  2JZI A;  2EC6 B;  2BCB A;  1QIW A;  4GPL B;  1FI5 A;  1IJ5 A;  1CDP A;  2L98 A;  4MBE A;  2E6W A;  3EK4 A;  2BL0 C;  4MN0 A;  4A4C A;  1SW8 A;  2Q91 A;  3M0W A;  4D1E A;  4Q04 A;  1J7P A;  2HF5 A;  1OMD A;  1S5G Z;  1IKU A;  3EVU A;  2MJW B;  1G4Y R;  2LVJ A;  1KFX S;  1KSM A;  2NCO A;  2LAN A;  1NCY A;  3PAL A;  1NWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...