4ORBB

Crystal structure of mouse calcineurin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
SYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2B catalytic subunit al
publication title Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
rcsb
source organism Mus musculus
molecule tags Hydrolase/metal binding protein
total genus 56
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4orbB00
3CGAA 1SMGA 1XFVO 2WORA 1LKJA 5HLOA 2KBIA 5AANA 4YRUA 4OVNF 1BF5A 2JQ6A 1AHRA 2ZRSA 1S1EA 1QLKA 2MA2A 1CB1A 4P2YB 2ZFDA 1R2UA 3LLEA 5AEQA 3DF0A 4GBAA 3JTDC 1UP5A 1ODBA 1SL7A 1M45A 1G33A 1V1GA 1SYMA 4JPZB 3VRRA 3PALA 4DS7A 2MLFC 1L2OC 1NWDA 4OKHA 5PALA 3KPXA 3AAJA 5TNCA 4CFQA 4UPGA 1OMRA 2CT9A 1M46A 5CSIA 3KO0A 2LMTA 1RJVA 1NIWA 1MWNA 1KK8C 2FOTA 1NCZA 1AP4A 4GGNA 2LE9B 4N1GA 1KCYA 2F2OA 1XA5A 1UHJA 2KAXA 3PN7C 2JXLA 2CTNA 4XYNA 2O5GA 5G08A 2MBXA 2V53A 1N65A 1C07A 1SL8A 1S6IA 3CS1A 5GQQC 2H2KA 2MJWB 2M7NA 3K21A 3SG4A 1GJYA 3GK2A 5K89A 2L4HA 3AKAA 1JFJA 1UHHA 1FBVA 2PSRA 1IJ6A 2CCMA 2KAYA 1F54A 1OZSA 1CDLA 1J1DA 2QACA 3CZTX 4L9MA 4F0ZB 2PMYA 1XK4C 2K2FA 1BU3A 2Q91A 1Y1XA 1YR5A 5HYDA 1A75B 1BR4B 3I5HC 1N0YA 4MSPA 4ORBB 1QATA 1B8RA 1KFXL 1J55A 2KFGA 4CFRA 1QVIY 1PSRA 5CSNA 1KSMA 4DIRA 2NLNA 5DKQA 1JUOA 2AUCA 1SCVA 2G2BA 4FQOA 4ZCVA 3WXAA 3LCPC 1SY9A 2MHHA 2BCAA 4NDBA 4A4CA 2LV7A 4CLNA 4GPLB 3JVTB 2LM5A 1K90D 1WLZA 3PLFB 1NYAA 1B8CA 1XFUO 4PE0A 1CTRA 1IG5A 1NX2A 1J7QA 5I2QA 1A75A 1GGZA 2JT8A 2LUXA 1NCXA 1QV1A 3I5GC 2EC6C 3RLZA 1N2DA 1TNXA 2LLUA 1QLSA 2M8UA 1DTLA 1XFZO 2WCEA 1SCMB 3SJSA 3TDZA 1TN4A 2TN4A 1BLQA 1E8AA 2Q4UA 1DJWA 1QIWA 4AQJA 2K0JA 2HQWA 3BXKA 3OHMB 4AOMA 3BYAA 1TTXA 2WOSA 1DJXA 2WC8A 3O2PA 4MBEA 3CTNA 5AFPA 4GFTA 1V1FA 1K9PA 1QJTA 5D69A 5AERA 1DGVA 2BECA 1CLLA 2LNKA 3DVMA 2K61A 4JWQA 4MZKA 2I18A 1CMFA 3SIAA 1A29A 2KYFA 3D0YB 5JJGA 1IJ5A 1M39A 3TS5C 1LXFC 3VRPA 1MXEA 2ISDA 2IS9A 2K7CA 3CWGA 3DVKA 2MLEC 2GV5A 3SG3A 5KU1A 1KQVA 2JOJA 1CDNA 3I5FC 1UUSA 1ALWA 4MN0A 1FPWA 2PVBA 3O6BA 1G8IA 1KK7Y 3D0YA 3I5IB 1NCYA 1DJIA 1YRTB 4N5XA 2KOTA 1Y1AA 1TRFA 2LVJA 3MSEB 3VGOA 1CKKA 2JWWA 2MAZA 5DKNA 2BKHB 3TS5B 1CMGA 3H4SE 2KBMA 3EK4A 1KK7Z 3GOFA 4U8DA 3LK1A 2FCEA 1UHKA 1C7WA 2M49B 3DF0B 4AQIA 1JWDA 1W7JB 2KHNA 1QIVA 1DT7B 4XJKA 2CNPA 2KNEA 1XVJA 2L50A 2LANA 2LHIA 2R2IA 5CSJA 2FJUB 3EKJA 2D8NA 2ZNDA 4GGFA 4YGEB 1NSHA 4D1EA 4HRGA 4P5OE 1K94A 4YGAA 4QJ3B 1B7TY 1ALVA 1K8UA 3VRNA 3KEVA 3NSIA 4WQ3A 1DGUA 3NSOA 2MRDA 1F71A 2JXCA 2L0PA 2O60A 1IWQA 1F4OA 1RWYA 3DVJA 1QTXA 1KFUS 1CDMA 2JRFA 4PHJA 4DCKA 3IF7A 1DJYA 1YRUB 2L5XB 4YGDB 1S5GY 3HX4A 2HF5A 1XFWO 4TNCA 3CR2A 1AVSA 4OCIA 1PALA 5HKZA 1J7OA 1NPQA 1JBAA 1HQVA 2NCPA 1J1EA 1QASA 1TCFA 3JVTC 2EGDA 1YTZC 1DVIA 2F3YA 4PHNA 1QS7A 1B9AA 4DRWA 2COLB 1ZMZA 1BMOA 3LL8B 2FCDA 1PVAA 2KI6C 1DJGA 2Y4QA 1SR6C 1SCMC 1OSAA 2KYCA 2JPTA 2NCOA 1F70A 2ZKMX 2GGMA 3DD4A 1GQMA 1WRKA 1SRAA 5HLVA 2ZN8A 1OQPA 2VRGA 4E68A 1CFPA 1H4BA 2LMUA 1S3PA 1KWOB 2LVIA 2JNXA 4Q04A 1MQ1A 1U5IA 1WLMA 4GNKB 3OX5A 1BT6A 2L98A 2WCFA 5J3XA 1QVIZ 1EG4A 2K7BA 1SR6B 2BKIB 2LP2A 1A2XA 1M31A 3F45A 1XYDA 3OB1B 3I5IC 5I2OA 2G9BA 2NXQA 2H61C 1QXPA 2HPSA 1TIZA 2E6WA 2F33A 3BOWA 2RGIA 1MR8A 2F3ZA 4NDCA 1JC2A 2OS8B 3VRQA 4QJ5B 1NUBA 4A4BA 1CFCA 1SNLA 3ZWHA 1Y0VH 4HSZA 2K2AA 1K95A 4ZCUA 1DMOA 2Y1NA 4MRXA 1XFXO 1EXRA 2JTZA 3BUOB 1IKUA 3TZ1A 1G4YR 4QJ4B 1CLMA 1J7PA 1CM4A 3EK7A 1S6JA 2M1KB 4CIDA 1A4PA 2JT0A 5IBWA 1ZFSA 4M2QA 1XK4A 1GGWA 1B4CA 1NX0A 2K8MB 4YGCB 1CLBA 2B1UA 3IQOA 2WNDA 3TUYB 1CDPA 4YI9A 1MF8B 3BUXB 4C0LA 1KSOA 3TDUA 4XJKB 2LMVA 2M97A 1OMVA 2KI4B 3KF9A 4MRYA 1AJ4A 5F6TA 2BE6A 3VROA 3AKBA 4MEWA 4BY4A 1BOCA 4MLWA 3NXAA 3D10A 1A03A 1B8LA 1S36A 4MZLA 1YUTA 2M1UA 1F8HA 2LLTA 5CPVA 1IH0A 3IQQA 1NP8A 2JNFA 2L2EA 2LHLA 2LLSA 4JQ0D 5FYXA 3CR4X 1FI5A 3O4YA 3EVUA 5KSZA 2LCPA 1SKTA 2KFHA 3FWBA 1W7IB 4MZJA 4NDDA 2KQYA 4OR9B 4PDZA 1EH2A 3OX6A 2BCXA 1RROA 1FF1A 1CNPA 4M2PA 1WDCB 3QRXA 2M7LA 1RK9A 4M2OA 1OOJA 1TOPA 2JULA 4MVFA 4ORCB 1K93D 5B8IB 3GK1A 4OV2A 1QV0A 4WRIA 1ZOTB 1BODA 1YVLA 1SK6D 1S26D 1MHOA 1YURA 2ZNEA 4CPVA 3PFVA 1B7TZ 4ICBA 1K9UA 1NX3A 4NQGA 2M29A 2BBMA 1BR1B 1YX7A 1DF0A 2KDHA 2Y5IA 2PRUA 2SASA 1LINA 4IL1A 2LVKA 2E30A 2L4IA 1KWOC 3SG7A 2BL0B 1UHIA 1YUUA 4FTGA 1TNQA 3SIBA 1Y1UA 5DKRA 1ZACA 1K2HA 1S5GZ 1IQ5A 1IQ3A 1Y6WA 2AMIA 1XFYO 1KFXS 1HT9A 1KQMC 3PATA 2PASA 1PULA 4GAOA 1JF2A 2M3WA 4C0JA 2SCPA 2ZN9A 1IGVA 1XO5A 1C7VA 3OB2B 1OZOA 1KFUL 1U5IB 2I7AA 3A8RA 1TCOB 2KFFA 1PSBA 1PVBA 4C0KA 3JTDB 1UWOA 3FS7A 1JF0A 1UHNA 2P6BB 1B47A 1EJ3A 3A4UB 3EVRA 2OS8C 4GUKA 1L2OB 5I2LA 3OP0A 3E3RA 3ZNIA 3GK4X 2L51A 1NX1A 5D7FA 1S6CA 1WY9A 5AXIA 1UURA 2K7OA 2HETA 2M0RA 3HCMA 4I5JA 4PCWA 1KK8B 2F2PA 1KQMB 1YUSA 1MXLC 2Y1MA 3BOWB 5ER5A 1YVHA 4DUQA 4WQ2A 5HKYA 3M0WA 4YI8A 4YBHB 3PN7B 2JTTA 4PALA 1JSAA 3TDIA 2WCBA 1CM1A 2OPOA 1YX8A 1FW4A 4I5LB 2LAPA 5KTYA 3SG2A 5ER4X 5BPJA 4YGBB 5JOLA 2DOQA 1J7RA 3PM8A 3TUYC 2CBLA 3BUMB 4PE4A 1RFJA 2JU0A 2KI4C 4PHMA 3WHTB 4GGFC 2HQ8A 1OMDA 3FWCA 2BBNA 3NSLA 1QX5B 4PHKA 1RTP1 5CSFA 1Q80A 2KGBC 1SW8A 1DJHA 1BG1A 1D1OA 3I5HB 2M9GA 1AJ5A 1JFKA 1X02A 1H8BA 4ETOA 2KGRA 3SG5A 2KAVA 1ZUZA 2GGZA 3PSRA 2OTGC 1F4QA 4HREE 2JT3A 2LP3A 2ZRTA 1WRLA 3ICBA 1LA3A 5I8NA 3EVVA 3CR5X 1FI6A 4PE1A 2KSPA 1TNWA 2PALA 3SG6A 3BQ3A 1SBJA 4R1EA 1DJZA 1WDCC 2A4JA 2EC6B 2EHBA 3I5GB 1OE9B 1EL4A 1MUXA 1LA0A 1TNPA 2BCBA 2LVVA 4I5KA 4BY5A 1F55A 1K9KA 4N1FA 2JZIA 2LUCA 3AAKA 1SPYA 1L7ZA 1QX7A 1SL9A 3NSKA 1RECA 2LC5A 2OTGB 1AUIB 2I2RE 2K7DA 1WRZA 1K96A 3DVEA 1M63B 2BE4A 1AK8A 1LVCD 4HRHA 2F8PA 3BUNB 3EK8A 3RM1A 5HKWA 4USLA 2CXJA 4PE7A 1PK0D 2NZ0A 3FIAA 4ORAB 1QX2A 2I94A 2QPTA 2H61A 2BL0C 2JC2A 3EKHA 1EG3A 3KHEA 2AAOA 3LK0A 1B1GA 1CFFA 1R6PA 3CLNA 1CFDA 3C1VA 3I5FB 3BUWB 1IRJA 1PRWA 4I5NB 1DF0B 3WNXB 2KQ6A 3WHUB 3O78A 1BJFA 1VRKA 2KI6D
chains in the Genus database with same CATH superfamily
3CGAA 1SMGA 1XFVO 2WORA 3B88A 4PCWA 2WCLA 1LKJA 5HLOA 2KBIA 5AANA 4YRUA 4OVNF 3R1PA 1BF5A 2JQ6A 1AHRA 2ZRSA 1S1EA 1QLKA 2MA2A 1CB1A 4P2YB 2ZFDA 1R2UA 3BFAA 3LLEA 3DF0A 5AEQA 4GBAA 3JTDC 1UP5A 1ODBA 1SL7A 1M45A 1G33A 1V1GA 1SYMA 4JPZB 3VRRA 3PALA 4DS7A 2MLFC 1L2OC 1NWDA 4OKHA 5PALA 3KPXA 3AAJA 5TNCA 4CFQA 4UPGA 1OMRA 2CT9A 1M46A 5CSIA 3KO0A 2LMTA 1RJVA 1NIWA 1MWNA 1KK8C 2FOTA 3IVTA 1NCZA 1AP4A 4GGNA 2LE9B 4N1GA 1KCYA 2F2OA 1XA5A 1UHJA 2KAXA 3NHTA 3PN7C 2JXLA 2CTNA 4XYNA 1Z4HA 2O5GA 5G08A 2P70A 5FI2A 2V53A 1N65A 2MBXA 3V2LA 1C07A 1SL8A 1S6IA 3CS1A 5GQQC 2H2KA 2MJWB 2M7NA 3K21A 3SG4A 1GJYA 3B6XA 3GK2A 5K89A 2L4HA 3AKAA 1JFJA 1UHHA 1FBVA 2PSRA 1IJ6A 2CCMA 2KAYA 1F54A 1OZSA 1CDLA 1J1DA 3S0AA 2QACA 3CZTX 4L9MA 2BAPA 4F0ZB 2PMYA 3D76A 1XK4C 2K2FA 1BU3A 2Q91A 1Y1XA 1YR5A 2QEVA 5HYDA 1A75B 1BR4B 3I5HC 1N0YA 4MSPA 4ORBB 1QATA 1B8RA 1KFXL 1J55A 2KFGA 4CFRA 1QVIY 1PSRA 5CSNA 1KSMA 4DIRA 2NLNA 5DKQA 1JUOA 2AUCA 1SCVA 2G2BA 4FQOA 4ZCVA 3WXAA 3LCPC 3EG5B 1SY9A 2MHHA 1W9ZA 2BCAA 4NDBA 4A4CA 1QWVA 2LV7A 4CLNA 4GPLB 3JVTB 2LM5A 1K90D 1WLZA 2KPHA 3PLFB 1NYAA 1B8CA 1XFUO 4PE0A 1CTRA 1IG5A 1NX2A 3CABA 3FE9A 1J7QA 5I2QA 1A75A 1GGZA 2JT8A 2LUXA 1NCXA 1QV1A 3I5GC 2EC6C 3RLZA 3S0DA 1N2DA 1TNXA 2LLUA 1QLSA 2M8UA 1DTLA 3D78A 1XFZO 2WCEA 1SCMB 3SJSA 3TDZA 1TN4A 2TN4A 1BLQA 1E8AA 2Q4UA 1DJWA 1QIWA 4AQJA 2K0JA 2HQWA 3BXKA 3OHMB 4AOMA 3BYAA 1TTXA 2WOSA 1DJXA 2WC8A 3O2PA 4MBEA 3SS3A 3CTNA 5AFPA 4GFTA 1V1FA 1K9PA 1QJTA 5D69A 5EL2A 5AERA 1DGVA 2BECA 1CLLA 2LNKA 3DVMA 2K61A 4JWQA 4MZKA 2I18A 3D73A 1CMFA 3SIAA 1A29A 2KYFA 3D0YB 5JJGA 1IJ5A 1M39A 3TS5C 1LXFC 3VRPA 3SS4A 2QDIA 1MXEA 2ISDA 2IS9A 2K7CA 3CWGA 3DVKA 2MLEC 2GV5A 3L47A 3SG3A 5KU1A 1KQVA 2JOJA 1CDNA 3I5FC 1UUSA 1ALWA 4MN0A 1FPWA 2PVBA 3CDNA 3O6BA 1G8IA 1KK7Y 3D0YA 5FI7A 1TUJA 2WC6A 3I5IB 1NCYA 1DJIA 1YRTB 4N5XA 3DXLA 2KOTA 1Y1AA 1TRFA 2LVJA 4PT1A 3MSEB 3VGOA 1CKKA 2JWWA 2MAZA 5DKNA 2FJYA 2BKHB 3TS5B 1CMGA 3H4SE 2KBMA 3EK4A 1KK7Z 3GOFA 4U8DA 3LK1A 3R1OA 2PYQA 2FCEA 1LS8A 1UHKA 1C7WA 2M49B 3DF0B 4AQIA 1JWDA 1W7JB 2KHNA 1QIVA 1DT7B 4XJKA 2CNPA 2KNEA 1XVJA 2L50A 2LANA 2LHIA 2R2IA 5CSJA 2FJUB 3EKJA 2D8NA 2ZNDA 4GGFA 4YGEB 1NSHA 3NGVA 4D1EA 4HRGA 4P5OE 1K94A 4YGAA 1OW4A 4QJ3B 1B7TY 1ALVA 1K8UA 3VRNA 3D74A 3KEVA 3NSIA 4WQ3A 1DGUA 3NSOA 2MRDA 1F71A 2JXCA 2L0PA 2O60A 1IWQA 1F4OA 1RWYA 1OOFA 2WCKA 3DVJA 1QTXA 1KFUS 1CDMA 2JRFA 4PHJA 4DCKA 5DICA 3IF7A 1DJYA 1YRUB 2L5XB 4YGDB 1S5GY 3HX4A 2HF5A 3SS5A 1XFWO 4TNCA 3CR2A 1AVSA 4OCIA 1PALA 5HKZA 3QMEA 1J7OA 1NPQA 1JBAA 1HQVA 2NCPA 3PM2A 1J1EA 1XFRA 1QASA 1TCFA 2EGDA 3JVTC 1YTZC 5D3OA 1DVIA 2F3YA 4PHNA 1QS7A 1B9AA 3OBVA 4DRWA 2COLB 1ZMZA 1BMOA 3LL8B 2FCDA 1PVAA 2KI6C 1DJGA 2Y4QA 1SR6C 1SCMC 1OSAA 2KYCA 2JPTA 2NCOA 1F70A 2QEOA 2ZKMX 2GGMA 3DD4A 3CZ0A 1DC1A 1GQMA 1WRKA 1SRAA 5HLVA 2ZN8A 1OQPA 3Q8IA 2VRGA 4E68A 1CFPA 3S0GA 1H4BA 2LMUA 1S3PA 1KWOB 2LVIA 2JNXA 4Q04A 1MQ1A 1U5IA 1WLMA 4GNKB 3OX5A 1BT6A 4IJ7A 1Z2CB 2L98A 2WCFA 5J3XA 1QVIZ 1EG4A 2K7BA 1SR6B 2BKIB 4I5JA 2LP2A 1A2XA 1C3YA 1M31A 3F45A 1XYDA 3OB1B 3I5IC 5I2OA 2G9BA 2NXQA 2YGUA 2H61C 1QXPA 3OGNA 2WC5A 3UNWA 2HPSA 2L5YA 1TIZA 2E6WA 2F33A 3BOWA 2RGIA 1MR8A 2F3ZA 4NDCA 1JC2A 2OS8B 3CYZA 3S0EA 3VRQA 4QJ5B 1NUBA 3CZ2A 4A4BA 1CFCA 1SNLA 3DYEA 3FE6A 3ZWHA 1Y0VH 2WCHA 4HSZA 2K2AA 1K95A 3D75A 4ZCUA 1P28A 1DMOA 2WCMA 2Y1NA 4MRXA 1XFXO 1EXRA 2JTZA 3BUOB 1IKUA 3TZ1A 1G4YR 4QJ4B 1CLMA 4INWA 1J7PA 1CM4A 3EK7A 3FE8A 1S6JA 2M1KB 1DEKA 4CIDA 1A4PA 2JT0A 5IBWA 1OOGA 1ZFSA 4M2QA 1XK4A 3R1VA 1GGWA 2BNXA 1B4CA 1NX0A 2K8MB 4YGCB 1CLBA 2B1UA 3IQOA 2WNDA 3L4LA 3TUYB 1CDPA 4YI9A 1MF8B 2L2CA 3BUXB 1KSOA 3TDUA 4XJKB 2LMVA 4C0LA 2M97A 1OMVA 2KI4B 3KF9A 4MRYA 1AJ4A 2ERBA 5F6TA 2BE6A 3VROA 3AKBA 4MEWA 4BY4A 1BOCA 4MLWA 4JKTA 3NXAA 3D10A 1A03A 5I94A 1B8LA 1S36A 1TWOA 1SSEB 4MZLA 4OZDA 1YUTA 2M1UA 1F8HA 2LLTA 5CPVA 1IH0A 2WCJA 3IQQA 1NP8A 2JNFA 2L2EA 2LHLA 2LLSA 4JQ0D 5FYXA 3CR4X 1FI5A 3O4YA 3EVUA 5KSZA 2LCPA 1SKTA 2KFHA 3FWBA 1W7IB 4MZJA 4NDDA 2KQYA 4OR9B 4PDZA 1EH2A 3OX6A 2BCXA 1RROA 1FF1A 1CNPA 4M2PA 1WDCB 3QRXA 2M7LA 1RK9A 4M2OA 1OOJA 1TOPA 2JULA 4MVFA 4ORCB 1K93D 3O4XA 3PJIA 5B8IB 2H8VA 3GK1A 4OV2A 1QV0A 4WRIA 1ZOTB 1BODA 1YVLA 1SK6D 1S26D 1MHOA 1YURA 2ZNEA 3S0BA 4CPVA 3S0FA 3PFVA 1B7TZ 1GM0A 4ICBA 1K9UA 1NX3A 4NQGA 2M29A 2BBMA 1BR1B 1YX7A 1DF0A 2KDHA 2Y5IA 2PRUA 2SASA 1LINA 4IL1A 1IIOA 2LVKA 3BFHA 2E30A 2L4IA 4KYNA 1KWOC 3SG7A 2BL0B 1UHIA 1YUUA 4FTGA 1TNQA 3SIBA 1Y1UA 5DKRA 1ZACA 1K2HA 2JPOA 1S5GZ 1IQ5A 1IQ3A 1Y6WA 2AMIA 1XFYO 1KFXS 1HT9A 1KQMC 3PATA 1OOIX 2PASA 1PULA 4GAOA 2KLEA 1JF2A 2M3WA 4C0JA 1C3ZA 2SCPA 2ZN9A 1IGVA 1XO5A 3BFBA 1C7VA 3OB2B 1OZOA 1KFUL 3R72A 1U5IB 2I7AA 3A8RA 1TCOB 2KFFA 3B7AA 2QEHA 1PSBA 1PVBA 4C0KA 3JTDB 3UO9A 1UWOA 3FS7A 1JF0A 1UHNA 2P6BB 1B47A 1EJ3A 3A4UB 3EVRA 2OS8C 4GUKA 1DQEA 1L2OB 5I2LA 3OP0A 3E3RA 3ZNIA 3GK4X 2L51A 1NX1A 4INXA 5D7FA 5FI6A 1S6CA 1WY9A 5AXIA 1UURA 2K7OA 2HETA 2M0RA 3HCMA 2GTEA 3B87A 1KK8B 2F2PA 1KQMB 1YUSA 1MXLC 2Y1MA 3BOWB 5ER5A 1YVHA 4DUQA 4WQ2A 5HKYA 3M0WA 4YI8A 4YBHB 3PN7B 2JTTA 4PALA 1JSAA 3TDIA 2WCBA 1CM1A 2OPOA 2KLDA 1YX8A 1FW4A 3N7HA 4I5LB 2K60A 2LAPA 5KTYA 3SG2A 5ER4X 5BPJA 4YGBB 2QEBA 5JOLA 2DOQA 1J7RA 3PM8A 3TUYC 1T14A 2CBLA 3BUMB 4PE4A 1RFJA 2JU0A 2KI4C 4PHMA 3WHTB 4GGFC 2HQ8A 1OMDA 3CZ1A 1DELA 2BBNA 3FWCA 3D77A 1QX5B 3NSLA 1RTP1 4PHKA 1Q80A 5CSFA 2KGBC 1SW8A 1DJHA 1BG1A 1D1OA 3I5HB 2M9GA 1AJ5A 1JFKA 1X02A 1H8BA 4ETOA 2KGRA 3SG5A 2KAVA 1ZUZA 2GGZA 3PSRA 2OTGC 1F4QA 4HREE 2JT3A 2LP3A 2ZRTA 1WRLA 3ICBA 1LA3A 5I8NA 3EVVA 3CR5X 2PQLA 1FI6A 3DY9A 2KSPA 4PE1A 4F7FA 5HL1A 1TNWA 2PALA 3SG6A 3BQ3A 1SBJA 4R1EA 1DJZA 1WDCC 2A4JA 2EC6B 2EHBA 3I5GB 4FQTA 1OOHA 1OE9B 1EL4A 1MUXA 1LA0A 1TNPA 2BCBA 2LVVA 4I5KA 3NHIA 4BY5A 1F55A 1K9KA 4N1FA 2JZIA 1ORGA 3DZTA 2LUCA 3AAKA 1SPYA 1L7ZA 1QX7A 1SL9A 3NSKA 1RECA 2LC5A 2OTGB 2P71A 1AUIB 2I2RE 2K7DA 1WRZA 3B86A 1K96A 3K1EA 3DVEA 1M63B 2BE4A 1AK8A 1LVCD 4JD9A 4HRHA 2F8PA 3BUNB 3EK8A 3RM1A 5HKWA 4USLA 2CXJA 3L4AA 1TUZA 4PE7A 1PK0D 2NZ0A 3BJHA 3FIAA 1QX2A 4ORAB 2I94A 2QPTA 2H61A 2BL0C 2JC2A 3EKHA 1EG3A 3KHEA 2AAOA 3LK0A 3RZSA 1B1GA 1CFFA 1R6PA 3CLNA 1CFDA 3C1VA 3I5FB 3VB1A 3BUWB 1IRJA 1PRWA 4I5NB 1DF0B 3WNXB 2KQ6A 3WHUB 3O78A 1BJFA 1VRKA 2KI6D
chains in the Genus database with same CATH topology
3CGAA 1SMGA 1XFVO 2WORA 1LKJA 5HLOA 2KBIA 5AANA 4YRUA 4OVNF 1BF5A 2JQ6A 1AHRA 2ZRSA 1S1EA 1QLKA 2MA2A 1CB1A 4P2YB 2ZFDA 1R2UA 3LLEA 5AEQA 3DF0A 4GBAA 3JTDC 1UP5A 1ODBA 1SL7A 1M45A 1G33A 1V1GA 1SYMA 4JPZB 3VRRA 3PALA 4DS7A 2MLFC 1L2OC 1NWDA 4OKHA 5PALA 3KPXA 3AAJA 5TNCA 4CFQA 4UPGA 1OMRA 2CT9A 1M46A 5CSIA 3KO0A 2LMTA 1RJVA 1NIWA 1MWNA 1KK8C 2FOTA 1NCZA 1AP4A 4GGNA 2LE9B 4N1GA 1KCYA 2F2OA 1XA5A 1UHJA 2KAXA 3PN7C 2JXLA 2CTNA 4XYNA 2O5GA 5G08A 2MBXA 2V53A 1N65A 1C07A 1SL8A 1S6IA 3CS1A 5GQQC 2H2KA 2MJWB 2M7NA 3K21A 3SG4A 1GJYA 3GK2A 5K89A 2L4HA 3AKAA 1JFJA 1UHHA 1FBVA 2PSRA 1IJ6A 2CCMA 2KAYA 1F54A 1OZSA 1CDLA 1J1DA 2QACA 3CZTX 4L9MA 4F0ZB 2PMYA 1XK4C 2K2FA 1BU3A 2Q91A 1Y1XA 1YR5A 5HYDA 1A75B 1BR4B 3I5HC 1N0YA 4MSPA 4ORBB 1QATA 1B8RA 1KFXL 1J55A 2KFGA 4CFRA 1QVIY 1PSRA 5CSNA 1KSMA 4DIRA 2NLNA 5DKQA 1JUOA 2AUCA 1SCVA 2G2BA 4FQOA 4ZCVA 3WXAA 3LCPC 1SY9A 2MHHA 2BCAA 4NDBA 4A4CA 2LV7A 4CLNA 4GPLB 3JVTB 2LM5A 1K90D 1WLZA 3PLFB 1NYAA 1B8CA 1XFUO 4PE0A 1CTRA 1IG5A 1NX2A 1J7QA 5I2QA 1A75A 1GGZA 2JT8A 2LUXA 1NCXA 1QV1A 3I5GC 2EC6C 3RLZA 1N2DA 1TNXA 2LLUA 1QLSA 2M8UA 1DTLA 1XFZO 2WCEA 1SCMB 3SJSA 3TDZA 1TN4A 2TN4A 1BLQA 1E8AA 2Q4UA 1DJWA 1QIWA 4AQJA 2K0JA 2HQWA 3BXKA 3OHMB 4AOMA 3BYAA 1TTXA 2WOSA 1DJXA 2WC8A 3O2PA 4MBEA 3CTNA 5AFPA 4GFTA 1V1FA 1K9PA 1QJTA 5D69A 5AERA 1DGVA 2BECA 1CLLA 2LNKA 3DVMA 2K61A 4JWQA 4MZKA 2I18A 1CMFA 3SIAA 1A29A 2KYFA 3D0YB 5JJGA 1IJ5A 1M39A 3TS5C 1LXFC 3VRPA 1MXEA 2ISDA 2IS9A 2K7CA 3CWGA 3DVKA 2MLEC 2GV5A 3SG3A 5KU1A 1KQVA 2JOJA 1CDNA 3I5FC 1UUSA 1ALWA 4MN0A 1FPWA 2PVBA 3O6BA 1G8IA 1KK7Y 3D0YA 3I5IB 1NCYA 1DJIA 1YRTB 4N5XA 2KOTA 1Y1AA 1TRFA 2LVJA 3MSEB 3VGOA 1CKKA 2JWWA 2MAZA 5DKNA 2BKHB 3TS5B 1CMGA 3H4SE 2KBMA 3EK4A 1KK7Z 3GOFA 4U8DA 3LK1A 2FCEA 1UHKA 1C7WA 2M49B 3DF0B 4AQIA 1JWDA 1W7JB 2KHNA 1QIVA 1DT7B 4XJKA 2CNPA 2KNEA 1XVJA 2L50A 2LANA 2LHIA 2R2IA 5CSJA 2FJUB 3EKJA 2D8NA 2ZNDA 4GGFA 4YGEB 1NSHA 4D1EA 4HRGA 4P5OE 1K94A 4YGAA 4QJ3B 1B7TY 1ALVA 1K8UA 3VRNA 3KEVA 3NSIA 4WQ3A 1DGUA 3NSOA 2MRDA 1F71A 2JXCA 2L0PA 2O60A 1IWQA 1F4OA 1RWYA 3DVJA 1QTXA 1KFUS 1CDMA 2JRFA 4PHJA 4DCKA 3IF7A 1DJYA 1YRUB 2L5XB 4YGDB 1S5GY 3HX4A 2HF5A 1XFWO 4TNCA 3CR2A 1AVSA 4OCIA 1PALA 5HKZA 1J7OA 1NPQA 1JBAA 1HQVA 2NCPA 1J1EA 1QASA 1TCFA 3JVTC 2EGDA 1YTZC 1DVIA 2F3YA 4PHNA 1QS7A 1B9AA 4DRWA 2COLB 1ZMZA 1BMOA 3LL8B 2FCDA 1PVAA 2KI6C 1DJGA 2Y4QA 1SR6C 1SCMC 1OSAA 2KYCA 2JPTA 2NCOA 1F70A 2ZKMX 2GGMA 3DD4A 1GQMA 1WRKA 1SRAA 5HLVA 2ZN8A 1OQPA 2VRGA 4E68A 1CFPA 1H4BA 2LMUA 1S3PA 1KWOB 2LVIA 2JNXA 4Q04A 1MQ1A 1U5IA 1WLMA 4GNKB 3OX5A 1BT6A 2L98A 2WCFA 5J3XA 1QVIZ 1EG4A 2K7BA 1SR6B 2BKIB 2LP2A 1A2XA 1M31A 3F45A 1XYDA 3OB1B 3I5IC 5I2OA 2G9BA 2NXQA 2H61C 1QXPA 2HPSA 1TIZA 2E6WA 2F33A 3BOWA 2RGIA 1MR8A 2F3ZA 4NDCA 1JC2A 2OS8B 3VRQA 4QJ5B 1NUBA 4A4BA 1CFCA 1SNLA 3ZWHA 1Y0VH 4HSZA 2K2AA 1K95A 4ZCUA 1DMOA 2Y1NA 4MRXA 1XFXO 1EXRA 2JTZA 3BUOB 1IKUA 3TZ1A 1G4YR 4QJ4B 1CLMA 1J7PA 1CM4A 3EK7A 1S6JA 2M1KB 4CIDA 1A4PA 2JT0A 5IBWA 1ZFSA 4M2QA 1XK4A 1GGWA 1B4CA 1NX0A 2K8MB 4YGCB 1CLBA 2B1UA 3IQOA 2WNDA 3TUYB 1CDPA 4YI9A 1MF8B 3BUXB 4C0LA 1KSOA 3TDUA 4XJKB 2LMVA 2M97A 1OMVA 2KI4B 3KF9A 4MRYA 1AJ4A 5F6TA 2BE6A 3VROA 3AKBA 4MEWA 4BY4A 1BOCA 4MLWA 3NXAA 3D10A 1A03A 1B8LA 1S36A 4MZLA 1YUTA 2M1UA 1F8HA 2LLTA 5CPVA 1IH0A 3IQQA 1NP8A 2JNFA 2L2EA 2LHLA 2LLSA 4JQ0D 5FYXA 3CR4X 1FI5A 3O4YA 3EVUA 5KSZA 2LCPA 1SKTA 2KFHA 3FWBA 1W7IB 4MZJA 4NDDA 2KQYA 4OR9B 4PDZA 1EH2A 3OX6A 2BCXA 1RROA 1FF1A 1CNPA 4M2PA 1WDCB 3QRXA 2M7LA 1RK9A 4M2OA 1OOJA 1TOPA 2JULA 4MVFA 4ORCB 1K93D 5B8IB 3GK1A 4OV2A 1QV0A 4WRIA 1ZOTB 1BODA 1YVLA 1SK6D 1S26D 1MHOA 1YURA 2ZNEA 4CPVA 3PFVA 1B7TZ 4ICBA 1K9UA 1NX3A 4NQGA 2M29A 2BBMA 1BR1B 1YX7A 1DF0A 2KDHA 2Y5IA 2PRUA 2SASA 1LINA 4IL1A 2LVKA 2E30A 2L4IA 1KWOC 3SG7A 2BL0B 1UHIA 1YUUA 4FTGA 1TNQA 3SIBA 1Y1UA 5DKRA 1ZACA 1K2HA 1S5GZ 1IQ5A 1IQ3A 1Y6WA 2AMIA 1XFYO 1KFXS 1HT9A 1KQMC 3PATA 2PASA 1PULA 4GAOA 1JF2A 2M3WA 4C0JA 2SCPA 2ZN9A 1IGVA 1XO5A 1C7VA 3OB2B 1OZOA 1KFUL 1U5IB 2I7AA 3A8RA 1TCOB 2KFFA 1PSBA 1PVBA 4C0KA 3JTDB 1UWOA 3FS7A 1JF0A 1UHNA 2P6BB 1B47A 1EJ3A 3A4UB 3EVRA 2OS8C 4GUKA 1L2OB 5I2LA 3OP0A 3E3RA 3ZNIA 3GK4X 2L51A 1NX1A 5D7FA 1S6CA 1WY9A 5AXIA 1UURA 2K7OA 2HETA 2M0RA 3HCMA 4I5JA 4PCWA 1KK8B 2F2PA 1KQMB 1YUSA 1MXLC 2Y1MA 3BOWB 5ER5A 1YVHA 4DUQA 4WQ2A 5HKYA 3M0WA 4YI8A 4YBHB 3PN7B 2JTTA 4PALA 1JSAA 3TDIA 2WCBA 1CM1A 2OPOA 1YX8A 1FW4A 4I5LB 2LAPA 5KTYA 3SG2A 5ER4X 5BPJA 4YGBB 5JOLA 2DOQA 1J7RA 3PM8A 3TUYC 2CBLA 3BUMB 4PE4A 1RFJA 2JU0A 2KI4C 4PHMA 3WHTB 4GGFC 2HQ8A 1OMDA 3FWCA 2BBNA 3NSLA 1QX5B 4PHKA 1RTP1 5CSFA 1Q80A 2KGBC 1SW8A 1DJHA 1BG1A 1D1OA 3I5HB 2M9GA 1AJ5A 1JFKA 1X02A 1H8BA 4ETOA 2KGRA 3SG5A 2KAVA 1ZUZA 2GGZA 3PSRA 2OTGC 1F4QA 4HREE 2JT3A 2LP3A 2ZRTA 1WRLA 3ICBA 1LA3A 5I8NA 3EVVA 3CR5X 1FI6A 4PE1A 2KSPA 1TNWA 2PALA 3SG6A 3BQ3A 1SBJA 4R1EA 1DJZA 1WDCC 2A4JA 2EC6B 2EHBA 3I5GB 1OE9B 1EL4A 1MUXA 1LA0A 1TNPA 2BCBA 2LVVA 4I5KA 4BY5A 1F55A 1K9KA 4N1FA 2JZIA 2LUCA 3AAKA 1SPYA 1L7ZA 1QX7A 1SL9A 3NSKA 1RECA 2LC5A 2OTGB 1AUIB 2I2RE 2K7DA 1WRZA 1K96A 3DVEA 1M63B 2BE4A 1AK8A 1LVCD 4HRHA 2F8PA 3BUNB 3EK8A 3RM1A 5HKWA 4USLA 2CXJA 4PE7A 1PK0D 2NZ0A 3FIAA 4ORAB 1QX2A 2I94A 2QPTA 2H61A 2BL0C 2JC2A 3EKHA 1EG3A 3KHEA 2AAOA 3LK0A 1B1GA 1CFFA 1R6PA 3CLNA 1CFDA 3C1VA 3I5FB 3BUWB 1IRJA 1PRWA 4I5NB 1DF0B 3WNXB 2KQ6A 3WHUB 3O78A 1BJFA 1VRKA 2KI6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGA A;  1SMG A;  1XFV O;  2WOR A;  1LKJ A;  5HLO A;  2KBI A;  5AAN A;  4YRU A;  4OVN F;  1BF5 A;  2JQ6 A;  1AHR A;  2ZRS A;  1S1E A;  1QLK A;  2MA2 A;  1CB1 A;  4P2Y B;  2ZFD A;  1R2U A;  3LLE A;  5AEQ A;  3DF0 A;  4GBA A;  3JTD C;  1UP5 A;  1ODB A;  1SL7 A;  1M45 A;  1G33 A;  1V1G A;  1SYM A;  4JPZ B;  3VRR A;  3PAL A;  4DS7 A;  2MLF C;  1L2O C;  1NWD A;  4OKH A;  5PAL A;  3KPX A;  3AAJ A;  5TNC A;  4CFQ A;  4UPG A;  1OMR A;  2CT9 A;  1M46 A;  5CSI A;  3KO0 A;  2LMT A;  1RJV A;  1NIW A;  1MWN A;  1KK8 C;  2FOT A;  1NCZ A;  1AP4 A;  4GGN A;  2LE9 B;  4N1G A;  1KCY A;  2F2O A;  1XA5 A;  1UHJ A;  2KAX A;  3PN7 C;  2JXL A;  2CTN A;  4XYN A;  2O5G A;  5G08 A;  2MBX A;  2V53 A;  1N65 A;  1C07 A;  1SL8 A;  1S6I A;  3CS1 A;  5GQQ C;  2H2K A;  2MJW B;  2M7N A;  3K21 A;  3SG4 A;  1GJY A;  3GK2 A;  5K89 A;  2L4H A;  3AKA A;  1JFJ A;  1UHH A;  1FBV A;  2PSR A;  1IJ6 A;  2CCM A;  2KAY A;  1F54 A;  1OZS A;  1CDL A;  1J1D A;  2QAC A;  3CZT X;  4L9M A;  4F0Z B;  2PMY A;  1XK4 C;  2K2F A;  1BU3 A;  2Q91 A;  1Y1X A;  1YR5 A;  5HYD A;  1A75 B;  1BR4 B;  3I5H C;  1N0Y A;  4MSP A;  4ORB B;  1QAT A;  1B8R A;  1KFX L;  1J55 A;  2KFG A;  4CFR A;  1QVI Y;  1PSR A;  5CSN A;  1KSM A;  4DIR A;  2NLN A;  5DKQ A;  1JUO A;  2AUC A;  1SCV A;  2G2B A;  4FQO A;  4ZCV A;  3WXA A;  3LCP C;  1SY9 A;  2MHH A;  2BCA A;  4NDB A;  4A4C A;  2LV7 A;  4CLN A;  4GPL B;  3JVT B;  2LM5 A;  1K90 D;  1WLZ A;  3PLF B;  1NYA A;  1B8C A;  1XFU O;  4PE0 A;  1CTR A;  1IG5 A;  1NX2 A;  1J7Q A;  5I2Q A;  1A75 A;  1GGZ A;  2JT8 A;  2LUX A;  1NCX A;  1QV1 A;  3I5G C;  2EC6 C;  3RLZ A;  1N2D A;  1TNX A;  2LLU A;  1QLS A;  2M8U A;  1DTL A;  1XFZ O;  2WCE A;  1SCM B;  3SJS A;  3TDZ A;  1TN4 A;  2TN4 A;  1BLQ A;  1E8A A;  2Q4U A;  1DJW A;  1QIW A;  4AQJ A;  2K0J A;  2HQW A;  3BXK A;  3OHM B;  4AOM A;  3BYA A;  1TTX A;  2WOS A;  1DJX A;  2WC8 A;  3O2P A;  4MBE A;  3CTN A;  5AFP A;  4GFT A;  1V1F A;  1K9P A;  1QJT A;  5D69 A;  5AER A;  1DGV A;  2BEC A;  1CLL A;  2LNK A;  3DVM A;  2K61 A;  4JWQ A;  4MZK A;  2I18 A;  1CMF A;  3SIA A;  1A29 A;  2KYF A;  3D0Y B;  5JJG A;  1IJ5 A;  1M39 A;  3TS5 C;  1LXF C;  3VRP A;  1MXE A;  2ISD A;  2IS9 A;  2K7C A;  3CWG A;  3DVK A;  2MLE C;  2GV5 A;  3SG3 A;  5KU1 A;  1KQV A;  2JOJ A;  1CDN A;  3I5F C;  1UUS A;  1ALW A;  4MN0 A;  1FPW A;  2PVB A;  3O6B A;  1G8I A;  1KK7 Y;  3D0Y A;  3I5I B;  1NCY A;  1DJI A;  1YRT B;  4N5X A;  2KOT A;  1Y1A A;  1TRF A;  2LVJ A;  3MSE B;  3VGO A;  1CKK A;  2JWW A;  2MAZ A;  5DKN A;  2BKH B;  3TS5 B;  1CMG A;  3H4S E;  2KBM A;  3EK4 A;  1KK7 Z;  3GOF A;  4U8D A;  3LK1 A;  2FCE A;  1UHK A;  1C7W A;  2M49 B;  3DF0 B;  4AQI A;  1JWD A;  1W7J B;  2KHN A;  1QIV A;  1DT7 B;  4XJK A;  2CNP A;  2KNE A;  1XVJ A;  2L50 A;  2LAN A;  2LHI A;  2R2I A;  5CSJ A;  2FJU B;  3EKJ A;  2D8N A;  2ZND A;  4GGF A;  4YGE B;  1NSH A;  4D1E A;  4HRG A;  4P5O E;  1K94 A;  4YGA A;  4QJ3 B;  1B7T Y;  1ALV A;  1K8U A;  3VRN A;  3KEV A;  3NSI A;  4WQ3 A;  1DGU A;  3NSO A;  2MRD A;  1F71 A;  2JXC A;  2L0P A;  2O60 A;  1IWQ A;  1F4O A;  1RWY A;  3DVJ A;  1QTX A;  1KFU S;  1CDM A;  2JRF A;  4PHJ A;  4DCK A;  3IF7 A;  1DJY A;  1YRU B;  2L5X B;  4YGD B;  1S5G Y;  3HX4 A;  2HF5 A;  1XFW O;  4TNC A;  3CR2 A;  1AVS A;  4OCI A;  1PAL A;  5HKZ A;  1J7O A;  1NPQ A;  1JBA A;  1HQV A;  2NCP A;  1J1E A;  1QAS A;  1TCF A;  3JVT C;  2EGD A;  1YTZ C;  1DVI A;  2F3Y A;  4PHN A;  1QS7 A;  1B9A A;  4DRW A;  2COL B;  1ZMZ A;  1BMO A;  3LL8 B;  2FCD A;  1PVA A;  2KI6 C;  1DJG A;  2Y4Q A;  1SR6 C;  1SCM C;  1OSA A;  2KYC A;  2JPT A;  2NCO A;  1F70 A;  2ZKM X;  2GGM A;  3DD4 A;  1GQM A;  1WRK A;  1SRA A;  5HLV A;  2ZN8 A;  1OQP A;  2VRG A;  4E68 A;  1CFP A;  1H4B A;  2LMU A;  1S3P A;  1KWO B;  2LVI A;  2JNX A;  4Q04 A;  1MQ1 A;  1U5I A;  1WLM A;  4GNK B;  3OX5 A;  1BT6 A;  2L98 A;  2WCF A;  5J3X A;  1QVI Z;  1EG4 A;  2K7B A;  1SR6 B;  2BKI B;  2LP2 A;  1A2X A;  1M31 A;  3F45 A;  1XYD A;  3OB1 B;  3I5I C;  5I2O A;  2G9B A;  2NXQ A;  2H61 C;  1QXP A;  2HPS A;  1TIZ A;  2E6W A;  2F33 A;  3BOW A;  2RGI A;  1MR8 A;  2F3Z A;  4NDC A;  1JC2 A;  2OS8 B;  3VRQ A;  4QJ5 B;  1NUB A;  4A4B A;  1CFC A;  1SNL A;  3ZWH A;  1Y0V H;  4HSZ A;  2K2A A;  1K95 A;  4ZCU A;  1DMO A;  2Y1N A;  4MRX A;  1XFX O;  1EXR A;  2JTZ A;  3BUO B;  1IKU A;  3TZ1 A;  1G4Y R;  4QJ4 B;  1CLM A;  1J7P A;  1CM4 A;  3EK7 A;  1S6J A;  2M1K B;  4CID A;  1A4P A;  2JT0 A;  5IBW A;  1ZFS A;  4M2Q A;  1XK4 A;  1GGW A;  1B4C A;  1NX0 A;  2K8M B;  4YGC B;  1CLB A;  2B1U A;  3IQO A;  2WND A;  3TUY B;  1CDP A;  4YI9 A;  1MF8 B;  3BUX B;  4C0L A;  1KSO A;  3TDU A;  4XJK B;  2LMV A;  2M97 A;  1OMV A;  2KI4 B;  3KF9 A;  4MRY A;  1AJ4 A;  5F6T A;  2BE6 A;  3VRO A;  3AKB A;  4MEW A;  4BY4 A;  1BOC A;  4MLW A;  3NXA A;  3D10 A;  1A03 A;  1B8L A;  1S36 A;  4MZL A;  1YUT A;  2M1U A;  1F8H A;  2LLT A;  5CPV A;  1IH0 A;  3IQQ A;  1NP8 A;  2JNF A;  2L2E A;  2LHL A;  2LLS A;  4JQ0 D;  5FYX A;  3CR4 X;  1FI5 A;  3O4Y A;  3EVU A;  5KSZ A;  2LCP A;  1SKT A;  2KFH A;  3FWB A;  1W7I B;  4MZJ A;  4NDD A;  2KQY A;  4OR9 B;  4PDZ A;  1EH2 A;  3OX6 A;  2BCX A;  1RRO A;  1FF1 A;  1CNP A;  4M2P A;  1WDC B;  3QRX A;  2M7L A;  1RK9 A;  4M2O A;  1OOJ A;  1TOP A;  2JUL A;  4MVF A;  4ORC B;  1K93 D;  5B8I B;  3GK1 A;  4OV2 A;  1QV0 A;  4WRI A;  1ZOT B;  1BOD A;  1YVL A;  1SK6 D;  1S26 D;  1MHO A;  1YUR A;  2ZNE A;  4CPV A;  3PFV A;  1B7T Z;  4ICB A;  1K9U A;  1NX3 A;  4NQG A;  2M29 A;  2BBM A;  1BR1 B;  1YX7 A;  1DF0 A;  2KDH A;  2Y5I A;  2PRU A;  2SAS A;  1LIN A;  4IL1 A;  2LVK A;  2E30 A;  2L4I A;  1KWO C;  3SG7 A;  2BL0 B;  1UHI A;  1YUU A;  4FTG A;  1TNQ A;  3SIB A;  1Y1U A;  5DKR A;  1ZAC A;  1K2H A;  1S5G Z;  1IQ5 A;  1IQ3 A;  1Y6W A;  2AMI A;  1XFY O;  1KFX S;  1HT9 A;  1KQM C;  3PAT A;  2PAS A;  1PUL A;  4GAO A;  1JF2 A;  2M3W A;  4C0J A;  2SCP A;  2ZN9 A;  1IGV A;  1XO5 A;  1C7V A;  3OB2 B;  1OZO A;  1KFU L;  1U5I B;  2I7A A;  3A8R A;  1TCO B;  2KFF A;  1PSB A;  1PVB A;  4C0K A;  3JTD B;  1UWO A;  3FS7 A;  1JF0 A;  1UHN A;  2P6B B;  1B47 A;  1EJ3 A;  3A4U B;  3EVR A;  2OS8 C;  4GUK A;  1L2O B;  5I2L A;  3OP0 A;  3E3R A;  3ZNI A;  3GK4 X;  2L51 A;  1NX1 A;  5D7F A;  1S6C A;  1WY9 A;  5AXI A;  1UUR A;  2K7O A;  2HET A;  2M0R A;  3HCM A;  4I5J A;  4PCW A;  1KK8 B;  2F2P A;  1KQM B;  1YUS A;  1MXL C;  2Y1M A;  3BOW B;  5ER5 A;  1YVH A;  4DUQ A;  4WQ2 A;  5HKY A;  3M0W A;  4YI8 A;  4YBH B;  3PN7 B;  2JTT A;  4PAL A;  1JSA A;  3TDI A;  2WCB A;  1CM1 A;  2OPO A;  1YX8 A;  1FW4 A;  4I5L B;  2LAP A;  5KTY A;  3SG2 A;  5ER4 X;  5BPJ A;  4YGB B;  5JOL A;  2DOQ A;  1J7R A;  3PM8 A;  3TUY C;  2CBL A;  3BUM B;  4PE4 A;  1RFJ A;  2JU0 A;  2KI4 C;  4PHM A;  3WHT B;  4GGF C;  2HQ8 A;  1OMD A;  3FWC A;  2BBN A;  3NSL A;  1QX5 B;  4PHK A;  1RTP 1;  5CSF A;  1Q80 A;  2KGB C;  1SW8 A;  1DJH A;  1BG1 A;  1D1O A;  3I5H B;  2M9G A;  1AJ5 A;  1JFK A;  1X02 A;  1H8B A;  4ETO A;  2KGR A;  3SG5 A;  2KAV A;  1ZUZ A;  2GGZ A;  3PSR A;  2OTG C;  1F4Q A;  4HRE E;  2JT3 A;  2LP3 A;  2ZRT A;  1WRL A;  3ICB A;  1LA3 A;  5I8N A;  3EVV A;  3CR5 X;  1FI6 A;  4PE1 A;  2KSP A;  1TNW A;  2PAL A;  3SG6 A;  3BQ3 A;  1SBJ A;  4R1E A;  1DJZ A;  1WDC C;  2A4J A;  2EC6 B;  2EHB A;  3I5G B;  1OE9 B;  1EL4 A;  1MUX A;  1LA0 A;  1TNP A;  2BCB A;  2LVV A;  4I5K A;  4BY5 A;  1F55 A;  1K9K A;  4N1F A;  2JZI A;  2LUC A;  3AAK A;  1SPY A;  1L7Z A;  1QX7 A;  1SL9 A;  3NSK A;  1REC A;  2LC5 A;  2OTG B;  1AUI B;  2I2R E;  2K7D A;  1WRZ A;  1K96 A;  3DVE A;  1M63 B;  2BE4 A;  1AK8 A;  1LVC D;  4HRH A;  2F8P A;  3BUN B;  3EK8 A;  3RM1 A;  5HKW A;  4USL A;  2CXJ A;  4PE7 A;  1PK0 D;  2NZ0 A;  3FIA A;  4ORA B;  1QX2 A;  2I94 A;  2QPT A;  2H61 A;  2BL0 C;  2JC2 A;  3EKH A;  1EG3 A;  3KHE A;  2AAO A;  3LK0 A;  1B1G A;  1CFF A;  1R6P A;  3CLN A;  1CFD A;  3C1V A;  3I5F B;  3BUW B;  1IRJ A;  1PRW A;  4I5N B;  1DF0 B;  3WNX B;  2KQ6 A;  3WHU B;  3O78 A;  1BJF A;  1VRK A;  2KI6 D; 
#chains in the Genus database with same CATH topology
 3CGA A;  1SMG A;  1XFV O;  2WOR A;  3B88 A;  4PCW A;  2WCL A;  1LKJ A;  5HLO A;  2KBI A;  5AAN A;  4YRU A;  4OVN F;  3R1P A;  1BF5 A;  2JQ6 A;  1AHR A;  2ZRS A;  1S1E A;  1QLK A;  2MA2 A;  1CB1 A;  4P2Y B;  2ZFD A;  1R2U A;  3BFA A;  3LLE A;  3DF0 A;  5AEQ A;  4GBA A;  3JTD C;  1UP5 A;  1ODB A;  1SL7 A;  1M45 A;  1G33 A;  1V1G A;  1SYM A;  4JPZ B;  3VRR A;  3PAL A;  4DS7 A;  2MLF C;  1L2O C;  1NWD A;  4OKH A;  5PAL A;  3KPX A;  3AAJ A;  5TNC A;  4CFQ A;  4UPG A;  1OMR A;  2CT9 A;  1M46 A;  5CSI A;  3KO0 A;  2LMT A;  1RJV A;  1NIW A;  1MWN A;  1KK8 C;  2FOT A;  3IVT A;  1NCZ A;  1AP4 A;  4GGN A;  2LE9 B;  4N1G A;  1KCY A;  2F2O A;  1XA5 A;  1UHJ A;  2KAX A;  3NHT A;  3PN7 C;  2JXL A;  2CTN A;  4XYN A;  1Z4H A;  2O5G A;  5G08 A;  2P70 A;  5FI2 A;  2V53 A;  1N65 A;  2MBX A;  3V2L A;  1C07 A;  1SL8 A;  1S6I A;  3CS1 A;  5GQQ C;  2H2K A;  2MJW B;  2M7N A;  3K21 A;  3SG4 A;  1GJY A;  3B6X A;  3GK2 A;  5K89 A;  2L4H A;  3AKA A;  1JFJ A;  1UHH A;  1FBV A;  2PSR A;  1IJ6 A;  2CCM A;  2KAY A;  1F54 A;  1OZS A;  1CDL A;  1J1D A;  3S0A A;  2QAC A;  3CZT X;  4L9M A;  2BAP A;  4F0Z B;  2PMY A;  3D76 A;  1XK4 C;  2K2F A;  1BU3 A;  2Q91 A;  1Y1X A;  1YR5 A;  2QEV A;  5HYD A;  1A75 B;  1BR4 B;  3I5H C;  1N0Y A;  4MSP A;  4ORB B;  1QAT A;  1B8R A;  1KFX L;  1J55 A;  2KFG A;  4CFR A;  1QVI Y;  1PSR A;  5CSN A;  1KSM A;  4DIR A;  2NLN A;  5DKQ A;  1JUO A;  2AUC A;  1SCV A;  2G2B A;  4FQO A;  4ZCV A;  3WXA A;  3LCP C;  3EG5 B;  1SY9 A;  2MHH A;  1W9Z A;  2BCA A;  4NDB A;  4A4C A;  1QWV A;  2LV7 A;  4CLN A;  4GPL B;  3JVT B;  2LM5 A;  1K90 D;  1WLZ A;  2KPH A;  3PLF B;  1NYA A;  1B8C A;  1XFU O;  4PE0 A;  1CTR A;  1IG5 A;  1NX2 A;  3CAB A;  3FE9 A;  1J7Q A;  5I2Q A;  1A75 A;  1GGZ A;  2JT8 A;  2LUX A;  1NCX A;  1QV1 A;  3I5G C;  2EC6 C;  3RLZ A;  3S0D A;  1N2D A;  1TNX A;  2LLU A;  1QLS A;  2M8U A;  1DTL A;  3D78 A;  1XFZ O;  2WCE A;  1SCM B;  3SJS A;  3TDZ A;  1TN4 A;  2TN4 A;  1BLQ A;  1E8A A;  2Q4U A;  1DJW A;  1QIW A;  4AQJ A;  2K0J A;  2HQW A;  3BXK A;  3OHM B;  4AOM A;  3BYA A;  1TTX A;  2WOS A;  1DJX A;  2WC8 A;  3O2P A;  4MBE A;  3SS3 A;  3CTN A;  5AFP A;  4GFT A;  1V1F A;  1K9P A;  1QJT A;  5D69 A;  5EL2 A;  5AER A;  1DGV A;  2BEC A;  1CLL A;  2LNK A;  3DVM A;  2K61 A;  4JWQ A;  4MZK A;  2I18 A;  3D73 A;  1CMF A;  3SIA A;  1A29 A;  2KYF A;  3D0Y B;  5JJG A;  1IJ5 A;  1M39 A;  3TS5 C;  1LXF C;  3VRP A;  3SS4 A;  2QDI A;  1MXE A;  2ISD A;  2IS9 A;  2K7C A;  3CWG A;  3DVK A;  2MLE C;  2GV5 A;  3L47 A;  3SG3 A;  5KU1 A;  1KQV A;  2JOJ A;  1CDN A;  3I5F C;  1UUS A;  1ALW A;  4MN0 A;  1FPW A;  2PVB A;  3CDN A;  3O6B A;  1G8I A;  1KK7 Y;  3D0Y A;  5FI7 A;  1TUJ A;  2WC6 A;  3I5I B;  1NCY A;  1DJI A;  1YRT B;  4N5X A;  3DXL A;  2KOT A;  1Y1A A;  1TRF A;  2LVJ A;  4PT1 A;  3MSE B;  3VGO A;  1CKK A;  2JWW A;  2MAZ A;  5DKN A;  2FJY A;  2BKH B;  3TS5 B;  1CMG A;  3H4S E;  2KBM A;  3EK4 A;  1KK7 Z;  3GOF A;  4U8D A;  3LK1 A;  3R1O A;  2PYQ A;  2FCE A;  1LS8 A;  1UHK A;  1C7W A;  2M49 B;  3DF0 B;  4AQI A;  1JWD A;  1W7J B;  2KHN A;  1QIV A;  1DT7 B;  4XJK A;  2CNP A;  2KNE A;  1XVJ A;  2L50 A;  2LAN A;  2LHI A;  2R2I A;  5CSJ A;  2FJU B;  3EKJ A;  2D8N A;  2ZND A;  4GGF A;  4YGE B;  1NSH A;  3NGV A;  4D1E A;  4HRG A;  4P5O E;  1K94 A;  4YGA A;  1OW4 A;  4QJ3 B;  1B7T Y;  1ALV A;  1K8U A;  3VRN A;  3D74 A;  3KEV A;  3NSI A;  4WQ3 A;  1DGU A;  3NSO A;  2MRD A;  1F71 A;  2JXC A;  2L0P A;  2O60 A;  1IWQ A;  1F4O A;  1RWY A;  1OOF A;  2WCK A;  3DVJ A;  1QTX A;  1KFU S;  1CDM A;  2JRF A;  4PHJ A;  4DCK A;  5DIC A;  3IF7 A;  1DJY A;  1YRU B;  2L5X B;  4YGD B;  1S5G Y;  3HX4 A;  2HF5 A;  3SS5 A;  1XFW O;  4TNC A;  3CR2 A;  1AVS A;  4OCI A;  1PAL A;  5HKZ A;  3QME A;  1J7O A;  1NPQ A;  1JBA A;  1HQV A;  2NCP A;  3PM2 A;  1J1E A;  1XFR A;  1QAS A;  1TCF A;  2EGD A;  3JVT C;  1YTZ C;  5D3O A;  1DVI A;  2F3Y A;  4PHN A;  1QS7 A;  1B9A A;  3OBV A;  4DRW A;  2COL B;  1ZMZ A;  1BMO A;  3LL8 B;  2FCD A;  1PVA A;  2KI6 C;  1DJG A;  2Y4Q A;  1SR6 C;  1SCM C;  1OSA A;  2KYC A;  2JPT A;  2NCO A;  1F70 A;  2QEO A;  2ZKM X;  2GGM A;  3DD4 A;  3CZ0 A;  1DC1 A;  1GQM A;  1WRK A;  1SRA A;  5HLV A;  2ZN8 A;  1OQP A;  3Q8I A;  2VRG A;  4E68 A;  1CFP A;  3S0G A;  1H4B A;  2LMU A;  1S3P A;  1KWO B;  2LVI A;  2JNX A;  4Q04 A;  1MQ1 A;  1U5I A;  1WLM A;  4GNK B;  3OX5 A;  1BT6 A;  4IJ7 A;  1Z2C B;  2L98 A;  2WCF A;  5J3X A;  1QVI Z;  1EG4 A;  2K7B A;  1SR6 B;  2BKI B;  4I5J A;  2LP2 A;  1A2X A;  1C3Y A;  1M31 A;  3F45 A;  1XYD A;  3OB1 B;  3I5I C;  5I2O A;  2G9B A;  2NXQ A;  2YGU A;  2H61 C;  1QXP A;  3OGN A;  2WC5 A;  3UNW A;  2HPS A;  2L5Y A;  1TIZ A;  2E6W A;  2F33 A;  3BOW A;  2RGI A;  1MR8 A;  2F3Z A;  4NDC A;  1JC2 A;  2OS8 B;  3CYZ A;  3S0E A;  3VRQ A;  4QJ5 B;  1NUB A;  3CZ2 A;  4A4B A;  1CFC A;  1SNL A;  3DYE A;  3FE6 A;  3ZWH A;  1Y0V H;  2WCH A;  4HSZ A;  2K2A A;  1K95 A;  3D75 A;  4ZCU A;  1P28 A;  1DMO A;  2WCM A;  2Y1N A;  4MRX A;  1XFX O;  1EXR A;  2JTZ A;  3BUO B;  1IKU A;  3TZ1 A;  1G4Y R;  4QJ4 B;  1CLM A;  4INW A;  1J7P A;  1CM4 A;  3EK7 A;  3FE8 A;  1S6J A;  2M1K B;  1DEK A;  4CID A;  1A4P A;  2JT0 A;  5IBW A;  1OOG A;  1ZFS A;  4M2Q A;  1XK4 A;  3R1V A;  1GGW A;  2BNX A;  1B4C A;  1NX0 A;  2K8M B;  4YGC B;  1CLB A;  2B1U A;  3IQO A;  2WND A;  3L4L A;  3TUY B;  1CDP A;  4YI9 A;  1MF8 B;  2L2C A;  3BUX B;  1KSO A;  3TDU A;  4XJK B;  2LMV A;  4C0L A;  2M97 A;  1OMV A;  2KI4 B;  3KF9 A;  4MRY A;  1AJ4 A;  2ERB A;  5F6T A;  2BE6 A;  3VRO A;  3AKB A;  4MEW A;  4BY4 A;  1BOC A;  4MLW A;  4JKT A;  3NXA A;  3D10 A;  1A03 A;  5I94 A;  1B8L A;  1S36 A;  1TWO A;  1SSE B;  4MZL A;  4OZD A;  1YUT A;  2M1U A;  1F8H A;  2LLT A;  5CPV A;  1IH0 A;  2WCJ A;  3IQQ A;  1NP8 A;  2JNF A;  2L2E A;  2LHL A;  2LLS A;  4JQ0 D;  5FYX A;  3CR4 X;  1FI5 A;  3O4Y A;  3EVU A;  5KSZ A;  2LCP A;  1SKT A;  2KFH A;  3FWB A;  1W7I B;  4MZJ A;  4NDD A;  2KQY A;  4OR9 B;  4PDZ A;  1EH2 A;  3OX6 A;  2BCX A;  1RRO A;  1FF1 A;  1CNP A;  4M2P A;  1WDC B;  3QRX A;  2M7L A;  1RK9 A;  4M2O A;  1OOJ A;  1TOP A;  2JUL A;  4MVF A;  4ORC B;  1K93 D;  3O4X A;  3PJI A;  5B8I B;  2H8V A;  3GK1 A;  4OV2 A;  1QV0 A;  4WRI A;  1ZOT B;  1BOD A;  1YVL A;  1SK6 D;  1S26 D;  1MHO A;  1YUR A;  2ZNE A;  3S0B A;  4CPV A;  3S0F A;  3PFV A;  1B7T Z;  1GM0 A;  4ICB A;  1K9U A;  1NX3 A;  4NQG A;  2M29 A;  2BBM A;  1BR1 B;  1YX7 A;  1DF0 A;  2KDH A;  2Y5I A;  2PRU A;  2SAS A;  1LIN A;  4IL1 A;  1IIO A;  2LVK A;  3BFH A;  2E30 A;  2L4I A;  4KYN A;  1KWO C;  3SG7 A;  2BL0 B;  1UHI A;  1YUU A;  4FTG A;  1TNQ A;  3SIB A;  1Y1U A;  5DKR A;  1ZAC A;  1K2H A;  2JPO A;  1S5G Z;  1IQ5 A;  1IQ3 A;  1Y6W A;  2AMI A;  1XFY O;  1KFX S;  1HT9 A;  1KQM C;  3PAT A;  1OOI X;  2PAS A;  1PUL A;  4GAO A;  2KLE A;  1JF2 A;  2M3W A;  4C0J A;  1C3Z A;  2SCP A;  2ZN9 A;  1IGV A;  1XO5 A;  3BFB A;  1C7V A;  3OB2 B;  1OZO A;  1KFU L;  3R72 A;  1U5I B;  2I7A A;  3A8R A;  1TCO B;  2KFF A;  3B7A A;  2QEH A;  1PSB A;  1PVB A;  4C0K A;  3JTD B;  3UO9 A;  1UWO A;  3FS7 A;  1JF0 A;  1UHN A;  2P6B B;  1B47 A;  1EJ3 A;  3A4U B;  3EVR A;  2OS8 C;  4GUK A;  1DQE A;  1L2O B;  5I2L A;  3OP0 A;  3E3R A;  3ZNI A;  3GK4 X;  2L51 A;  1NX1 A;  4INX A;  5D7F A;  5FI6 A;  1S6C A;  1WY9 A;  5AXI A;  1UUR A;  2K7O A;  2HET A;  2M0R A;  3HCM A;  2GTE A;  3B87 A;  1KK8 B;  2F2P A;  1KQM B;  1YUS A;  1MXL C;  2Y1M A;  3BOW B;  5ER5 A;  1YVH A;  4DUQ A;  4WQ2 A;  5HKY A;  3M0W A;  4YI8 A;  4YBH B;  3PN7 B;  2JTT A;  4PAL A;  1JSA A;  3TDI A;  2WCB A;  1CM1 A;  2OPO A;  2KLD A;  1YX8 A;  1FW4 A;  3N7H A;  4I5L B;  2K60 A;  2LAP A;  5KTY A;  3SG2 A;  5ER4 X;  5BPJ A;  4YGB B;  2QEB A;  5JOL A;  2DOQ A;  1J7R A;  3PM8 A;  3TUY C;  1T14 A;  2CBL A;  3BUM B;  4PE4 A;  1RFJ A;  2JU0 A;  2KI4 C;  4PHM A;  3WHT B;  4GGF C;  2HQ8 A;  1OMD A;  3CZ1 A;  1DEL A;  2BBN A;  3FWC A;  3D77 A;  1QX5 B;  3NSL A;  1RTP 1;  4PHK A;  1Q80 A;  5CSF A;  2KGB C;  1SW8 A;  1DJH A;  1BG1 A;  1D1O A;  3I5H B;  2M9G A;  1AJ5 A;  1JFK A;  1X02 A;  1H8B A;  4ETO A;  2KGR A;  3SG5 A;  2KAV A;  1ZUZ A;  2GGZ A;  3PSR A;  2OTG C;  1F4Q A;  4HRE E;  2JT3 A;  2LP3 A;  2ZRT A;  1WRL A;  3ICB A;  1LA3 A;  5I8N A;  3EVV A;  3CR5 X;  2PQL A;  1FI6 A;  3DY9 A;  2KSP A;  4PE1 A;  4F7F A;  5HL1 A;  1TNW A;  2PAL A;  3SG6 A;  3BQ3 A;  1SBJ A;  4R1E A;  1DJZ A;  1WDC C;  2A4J A;  2EC6 B;  2EHB A;  3I5G B;  4FQT A;  1OOH A;  1OE9 B;  1EL4 A;  1MUX A;  1LA0 A;  1TNP A;  2BCB A;  2LVV A;  4I5K A;  3NHI A;  4BY5 A;  1F55 A;  1K9K A;  4N1F A;  2JZI A;  1ORG A;  3DZT A;  2LUC A;  3AAK A;  1SPY A;  1L7Z A;  1QX7 A;  1SL9 A;  3NSK A;  1REC A;  2LC5 A;  2OTG B;  2P71 A;  1AUI B;  2I2R E;  2K7D A;  1WRZ A;  3B86 A;  1K96 A;  3K1E A;  3DVE A;  1M63 B;  2BE4 A;  1AK8 A;  1LVC D;  4JD9 A;  4HRH A;  2F8P A;  3BUN B;  3EK8 A;  3RM1 A;  5HKW A;  4USL A;  2CXJ A;  3L4A A;  1TUZ A;  4PE7 A;  1PK0 D;  2NZ0 A;  3BJH A;  3FIA A;  1QX2 A;  4ORA B;  2I94 A;  2QPT A;  2H61 A;  2BL0 C;  2JC2 A;  3EKH A;  1EG3 A;  3KHE A;  2AAO A;  3LK0 A;  3RZS A;  1B1G A;  1CFF A;  1R6P A;  3CLN A;  1CFD A;  3C1V A;  3I5F B;  3VB1 A;  3BUW B;  1IRJ A;  1PRW A;  4I5N B;  1DF0 B;  3WNX B;  2KQ6 A;  3WHU B;  3O78 A;  1BJF A;  1VRK A;  2KI6 D; 
#chains in the Genus database with same CATH homology
 3CGA A;  1SMG A;  1XFV O;  2WOR A;  1LKJ A;  5HLO A;  2KBI A;  5AAN A;  4YRU A;  4OVN F;  1BF5 A;  2JQ6 A;  1AHR A;  2ZRS A;  1S1E A;  1QLK A;  2MA2 A;  1CB1 A;  4P2Y B;  2ZFD A;  1R2U A;  3LLE A;  5AEQ A;  3DF0 A;  4GBA A;  3JTD C;  1UP5 A;  1ODB A;  1SL7 A;  1M45 A;  1G33 A;  1V1G A;  1SYM A;  4JPZ B;  3VRR A;  3PAL A;  4DS7 A;  2MLF C;  1L2O C;  1NWD A;  4OKH A;  5PAL A;  3KPX A;  3AAJ A;  5TNC A;  4CFQ A;  4UPG A;  1OMR A;  2CT9 A;  1M46 A;  5CSI A;  3KO0 A;  2LMT A;  1RJV A;  1NIW A;  1MWN A;  1KK8 C;  2FOT A;  1NCZ A;  1AP4 A;  4GGN A;  2LE9 B;  4N1G A;  1KCY A;  2F2O A;  1XA5 A;  1UHJ A;  2KAX A;  3PN7 C;  2JXL A;  2CTN A;  4XYN A;  2O5G A;  5G08 A;  2MBX A;  2V53 A;  1N65 A;  1C07 A;  1SL8 A;  1S6I A;  3CS1 A;  5GQQ C;  2H2K A;  2MJW B;  2M7N A;  3K21 A;  3SG4 A;  1GJY A;  3GK2 A;  5K89 A;  2L4H A;  3AKA A;  1JFJ A;  1UHH A;  1FBV A;  2PSR A;  1IJ6 A;  2CCM A;  2KAY A;  1F54 A;  1OZS A;  1CDL A;  1J1D A;  2QAC A;  3CZT X;  4L9M A;  4F0Z B;  2PMY A;  1XK4 C;  2K2F A;  1BU3 A;  2Q91 A;  1Y1X A;  1YR5 A;  5HYD A;  1A75 B;  1BR4 B;  3I5H C;  1N0Y A;  4MSP A;  4ORB B;  1QAT A;  1B8R A;  1KFX L;  1J55 A;  2KFG A;  4CFR A;  1QVI Y;  1PSR A;  5CSN A;  1KSM A;  4DIR A;  2NLN A;  5DKQ A;  1JUO A;  2AUC A;  1SCV A;  2G2B A;  4FQO A;  4ZCV A;  3WXA A;  3LCP C;  1SY9 A;  2MHH A;  2BCA A;  4NDB A;  4A4C A;  2LV7 A;  4CLN A;  4GPL B;  3JVT B;  2LM5 A;  1K90 D;  1WLZ A;  3PLF B;  1NYA A;  1B8C A;  1XFU O;  4PE0 A;  1CTR A;  1IG5 A;  1NX2 A;  1J7Q A;  5I2Q A;  1A75 A;  1GGZ A;  2JT8 A;  2LUX A;  1NCX A;  1QV1 A;  3I5G C;  2EC6 C;  3RLZ A;  1N2D A;  1TNX A;  2LLU A;  1QLS A;  2M8U A;  1DTL A;  1XFZ O;  2WCE A;  1SCM B;  3SJS A;  3TDZ A;  1TN4 A;  2TN4 A;  1BLQ A;  1E8A A;  2Q4U A;  1DJW A;  1QIW A;  4AQJ A;  2K0J A;  2HQW A;  3BXK A;  3OHM B;  4AOM A;  3BYA A;  1TTX A;  2WOS A;  1DJX A;  2WC8 A;  3O2P A;  4MBE A;  3CTN A;  5AFP A;  4GFT A;  1V1F A;  1K9P A;  1QJT A;  5D69 A;  5AER A;  1DGV A;  2BEC A;  1CLL A;  2LNK A;  3DVM A;  2K61 A;  4JWQ A;  4MZK A;  2I18 A;  1CMF A;  3SIA A;  1A29 A;  2KYF A;  3D0Y B;  5JJG A;  1IJ5 A;  1M39 A;  3TS5 C;  1LXF C;  3VRP A;  1MXE A;  2ISD A;  2IS9 A;  2K7C A;  3CWG A;  3DVK A;  2MLE C;  2GV5 A;  3SG3 A;  5KU1 A;  1KQV A;  2JOJ A;  1CDN A;  3I5F C;  1UUS A;  1ALW A;  4MN0 A;  1FPW A;  2PVB A;  3O6B A;  1G8I A;  1KK7 Y;  3D0Y A;  3I5I B;  1NCY A;  1DJI A;  1YRT B;  4N5X A;  2KOT A;  1Y1A A;  1TRF A;  2LVJ A;  3MSE B;  3VGO A;  1CKK A;  2JWW A;  2MAZ A;  5DKN A;  2BKH B;  3TS5 B;  1CMG A;  3H4S E;  2KBM A;  3EK4 A;  1KK7 Z;  3GOF A;  4U8D A;  3LK1 A;  2FCE A;  1UHK A;  1C7W A;  2M49 B;  3DF0 B;  4AQI A;  1JWD A;  1W7J B;  2KHN A;  1QIV A;  1DT7 B;  4XJK A;  2CNP A;  2KNE A;  1XVJ A;  2L50 A;  2LAN A;  2LHI A;  2R2I A;  5CSJ A;  2FJU B;  3EKJ A;  2D8N A;  2ZND A;  4GGF A;  4YGE B;  1NSH A;  4D1E A;  4HRG A;  4P5O E;  1K94 A;  4YGA A;  4QJ3 B;  1B7T Y;  1ALV A;  1K8U A;  3VRN A;  3KEV A;  3NSI A;  4WQ3 A;  1DGU A;  3NSO A;  2MRD A;  1F71 A;  2JXC A;  2L0P A;  2O60 A;  1IWQ A;  1F4O A;  1RWY A;  3DVJ A;  1QTX A;  1KFU S;  1CDM A;  2JRF A;  4PHJ A;  4DCK A;  3IF7 A;  1DJY A;  1YRU B;  2L5X B;  4YGD B;  1S5G Y;  3HX4 A;  2HF5 A;  1XFW O;  4TNC A;  3CR2 A;  1AVS A;  4OCI A;  1PAL A;  5HKZ A;  1J7O A;  1NPQ A;  1JBA A;  1HQV A;  2NCP A;  1J1E A;  1QAS A;  1TCF A;  3JVT C;  2EGD A;  1YTZ C;  1DVI A;  2F3Y A;  4PHN A;  1QS7 A;  1B9A A;  4DRW A;  2COL B;  1ZMZ A;  1BMO A;  3LL8 B;  2FCD A;  1PVA A;  2KI6 C;  1DJG A;  2Y4Q A;  1SR6 C;  1SCM C;  1OSA A;  2KYC A;  2JPT A;  2NCO A;  1F70 A;  2ZKM X;  2GGM A;  3DD4 A;  1GQM A;  1WRK A;  1SRA A;  5HLV A;  2ZN8 A;  1OQP A;  2VRG A;  4E68 A;  1CFP A;  1H4B A;  2LMU A;  1S3P A;  1KWO B;  2LVI A;  2JNX A;  4Q04 A;  1MQ1 A;  1U5I A;  1WLM A;  4GNK B;  3OX5 A;  1BT6 A;  2L98 A;  2WCF A;  5J3X A;  1QVI Z;  1EG4 A;  2K7B A;  1SR6 B;  2BKI B;  2LP2 A;  1A2X A;  1M31 A;  3F45 A;  1XYD A;  3OB1 B;  3I5I C;  5I2O A;  2G9B A;  2NXQ A;  2H61 C;  1QXP A;  2HPS A;  1TIZ A;  2E6W A;  2F33 A;  3BOW A;  2RGI A;  1MR8 A;  2F3Z A;  4NDC A;  1JC2 A;  2OS8 B;  3VRQ A;  4QJ5 B;  1NUB A;  4A4B A;  1CFC A;  1SNL A;  3ZWH A;  1Y0V H;  4HSZ A;  2K2A A;  1K95 A;  4ZCU A;  1DMO A;  2Y1N A;  4MRX A;  1XFX O;  1EXR A;  2JTZ A;  3BUO B;  1IKU A;  3TZ1 A;  1G4Y R;  4QJ4 B;  1CLM A;  1J7P A;  1CM4 A;  3EK7 A;  1S6J A;  2M1K B;  4CID A;  1A4P A;  2JT0 A;  5IBW A;  1ZFS A;  4M2Q A;  1XK4 A;  1GGW A;  1B4C A;  1NX0 A;  2K8M B;  4YGC B;  1CLB A;  2B1U A;  3IQO A;  2WND A;  3TUY B;  1CDP A;  4YI9 A;  1MF8 B;  3BUX B;  4C0L A;  1KSO A;  3TDU A;  4XJK B;  2LMV A;  2M97 A;  1OMV A;  2KI4 B;  3KF9 A;  4MRY A;  1AJ4 A;  5F6T A;  2BE6 A;  3VRO A;  3AKB A;  4MEW A;  4BY4 A;  1BOC A;  4MLW A;  3NXA A;  3D10 A;  1A03 A;  1B8L A;  1S36 A;  4MZL A;  1YUT A;  2M1U A;  1F8H A;  2LLT A;  5CPV A;  1IH0 A;  3IQQ A;  1NP8 A;  2JNF A;  2L2E A;  2LHL A;  2LLS A;  4JQ0 D;  5FYX A;  3CR4 X;  1FI5 A;  3O4Y A;  3EVU A;  5KSZ A;  2LCP A;  1SKT A;  2KFH A;  3FWB A;  1W7I B;  4MZJ A;  4NDD A;  2KQY A;  4OR9 B;  4PDZ A;  1EH2 A;  3OX6 A;  2BCX A;  1RRO A;  1FF1 A;  1CNP A;  4M2P A;  1WDC B;  3QRX A;  2M7L A;  1RK9 A;  4M2O A;  1OOJ A;  1TOP A;  2JUL A;  4MVF A;  4ORC B;  1K93 D;  5B8I B;  3GK1 A;  4OV2 A;  1QV0 A;  4WRI A;  1ZOT B;  1BOD A;  1YVL A;  1SK6 D;  1S26 D;  1MHO A;  1YUR A;  2ZNE A;  4CPV A;  3PFV A;  1B7T Z;  4ICB A;  1K9U A;  1NX3 A;  4NQG A;  2M29 A;  2BBM A;  1BR1 B;  1YX7 A;  1DF0 A;  2KDH A;  2Y5I A;  2PRU A;  2SAS A;  1LIN A;  4IL1 A;  2LVK A;  2E30 A;  2L4I A;  1KWO C;  3SG7 A;  2BL0 B;  1UHI A;  1YUU A;  4FTG A;  1TNQ A;  3SIB A;  1Y1U A;  5DKR A;  1ZAC A;  1K2H A;  1S5G Z;  1IQ5 A;  1IQ3 A;  1Y6W A;  2AMI A;  1XFY O;  1KFX S;  1HT9 A;  1KQM C;  3PAT A;  2PAS A;  1PUL A;  4GAO A;  1JF2 A;  2M3W A;  4C0J A;  2SCP A;  2ZN9 A;  1IGV A;  1XO5 A;  1C7V A;  3OB2 B;  1OZO A;  1KFU L;  1U5I B;  2I7A A;  3A8R A;  1TCO B;  2KFF A;  1PSB A;  1PVB A;  4C0K A;  3JTD B;  1UWO A;  3FS7 A;  1JF0 A;  1UHN A;  2P6B B;  1B47 A;  1EJ3 A;  3A4U B;  3EVR A;  2OS8 C;  4GUK A;  1L2O B;  5I2L A;  3OP0 A;  3E3R A;  3ZNI A;  3GK4 X;  2L51 A;  1NX1 A;  5D7F A;  1S6C A;  1WY9 A;  5AXI A;  1UUR A;  2K7O A;  2HET A;  2M0R A;  3HCM A;  4I5J A;  4PCW A;  1KK8 B;  2F2P A;  1KQM B;  1YUS A;  1MXL C;  2Y1M A;  3BOW B;  5ER5 A;  1YVH A;  4DUQ A;  4WQ2 A;  5HKY A;  3M0W A;  4YI8 A;  4YBH B;  3PN7 B;  2JTT A;  4PAL A;  1JSA A;  3TDI A;  2WCB A;  1CM1 A;  2OPO A;  1YX8 A;  1FW4 A;  4I5L B;  2LAP A;  5KTY A;  3SG2 A;  5ER4 X;  5BPJ A;  4YGB B;  5JOL A;  2DOQ A;  1J7R A;  3PM8 A;  3TUY C;  2CBL A;  3BUM B;  4PE4 A;  1RFJ A;  2JU0 A;  2KI4 C;  4PHM A;  3WHT B;  4GGF C;  2HQ8 A;  1OMD A;  3FWC A;  2BBN A;  3NSL A;  1QX5 B;  4PHK A;  1RTP 1;  5CSF A;  1Q80 A;  2KGB C;  1SW8 A;  1DJH A;  1BG1 A;  1D1O A;  3I5H B;  2M9G A;  1AJ5 A;  1JFK A;  1X02 A;  1H8B A;  4ETO A;  2KGR A;  3SG5 A;  2KAV A;  1ZUZ A;  2GGZ A;  3PSR A;  2OTG C;  1F4Q A;  4HRE E;  2JT3 A;  2LP3 A;  2ZRT A;  1WRL A;  3ICB A;  1LA3 A;  5I8N A;  3EVV A;  3CR5 X;  1FI6 A;  4PE1 A;  2KSP A;  1TNW A;  2PAL A;  3SG6 A;  3BQ3 A;  1SBJ A;  4R1E A;  1DJZ A;  1WDC C;  2A4J A;  2EC6 B;  2EHB A;  3I5G B;  1OE9 B;  1EL4 A;  1MUX A;  1LA0 A;  1TNP A;  2BCB A;  2LVV A;  4I5K A;  4BY5 A;  1F55 A;  1K9K A;  4N1F A;  2JZI A;  2LUC A;  3AAK A;  1SPY A;  1L7Z A;  1QX7 A;  1SL9 A;  3NSK A;  1REC A;  2LC5 A;  2OTG B;  1AUI B;  2I2R E;  2K7D A;  1WRZ A;  1K96 A;  3DVE A;  1M63 B;  2BE4 A;  1AK8 A;  1LVC D;  4HRH A;  2F8P A;  3BUN B;  3EK8 A;  3RM1 A;  5HKW A;  4USL A;  2CXJ A;  4PE7 A;  1PK0 D;  2NZ0 A;  3FIA A;  4ORA B;  1QX2 A;  2I94 A;  2QPT A;  2H61 A;  2BL0 C;  2JC2 A;  3EKH A;  1EG3 A;  3KHE A;  2AAO A;  3LK0 A;  1B1G A;  1CFF A;  1R6P A;  3CLN A;  1CFD A;  3C1V A;  3I5F B;  3BUW B;  1IRJ A;  1PRW A;  4I5N B;  1DF0 B;  3WNX B;  2KQ6 A;  3WHU B;  3O78 A;  1BJF A;  1VRK A;  2KI6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...