2I94A

Nmr structure of recoverin bound to rhodopsin kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
182
Chain Sequence
ALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Recoverin
publication title Structural Basis for Calcium-induced Inhibition of Rhodopsin Kinase by Recoverin.
pubmed doi rcsb
source organism Bos taurus
total genus 45
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2i94A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2i94A01
2I7AA 2JWWA 2OPOA 3OHMB 4OKHA 4PHNA 1YURA 2ZKMX 1GGWA 1J7RA 3PM8A 4GAOA 2NCOA 4GBAA 1JF2A 1IG5A 3I5GC 1CFPA 1WDCB 1GQMA 2L2EA 4WQ2A 2K2FA 3WNXB 2KDHA 1RECA 2JTZA 1V1FA 2JPTA 1NX3A 1R6PA 1BODA 2JC2A 3PLFB 1N65A 3BOWA 4WRIA 3IF7A 1XVJA 1KFUL 3NSOA 1LVCD 1SCMB 3PN7B 1AUIB 1QTXA 4MRYA 3EK4A 1QLKA 4DCKA 1KFXS 3TS5B 5CSNA 1RFJA 1YX8A 4U8DA 2H61C 2K2AA 2KAVA 5CSIA 3O6BA 3KF9A 1DT7B 1EJ3A 2JTTA 3O2PA 1KQMC 2JNXA 1NYAA 1SNLA 1TNQA 3HX4A 1KK8B 2KQ6A 4CLNA 3EVVA 2ZN9A 2LMUA 5D7FA 4MBEA 3EK7A 1OOJA 4DS7A 2ZNDA 1AP4A 1F55A 1B1GA 1Y1UA 4PE1A 2Y4QA 2KI6C 4NDDA 2ZN8A 2E30A 1MQ1A 1PRWA 1OSAA 2CTNA 2IS9A 2K7OA 5B8IB 1SL9A 1MXLC 2LHIA 5AXIA 2MHHA 1S6IA 3LCPC 2DOQA 1IGVA 2KBIA 1KFXL 1NPQA 2LMVA 1DJYA 2KNEA 4L9MA 1SW8A 1SYMA 2L98A 1G8IA 1S6JA 3VRRA 4XYNA 1BG1A 2LVIA 2M49B 1N0YA 2E6WA 1BU3A 3EKHA 1SMGA 2OS8B 3OP0A 1NIWA 1PVAA 2AUCA 5HKYA 1S3PA 1FBVA 1F4QA 1YRUB 1ZFSA 2Y5IA 4ETOA 1F8HA 2AAOA 4AQJA 3FS7A 4GGNA 4I5LB 2L0PA 4PDZA 1BF5A 1K93D 1KK7Y 1TOPA 3EVUA 3JTDC 4C0KA 3I5FC 2PVBA 3AKAA 1DJZA 1PSRA 3CTNA 3VRPA 2KFGA 5G08A 4BY4A 1WRKA 3SG6A 1TNPA 1LINA 3C1VA 2H2KA 2Y1MA 1B9AA 2LUCA 3WHTB 1J1EA 4FTGA 1J7PA 1QX7A 3OB1B 1YVLA 1C7WA 3OX5A 5F6TA 1UHIA 3AKBA 4UPGA 1NP8A 2NZ0A 2Q4UA 4HRHA 1AK8A 2KI4B 1SR6B 3I5IC 5JOLA 1QV1A 4CFQA 1CFFA 1QXPA 4AOMA 5AFPA 3TZ1A 1UHNA 2CT9A 1A29A 1K9KA 2PMYA 1L2OB 1OZSA 4NQGA 3D0YA 1HQVA 2JULA 2SCPA 3M0WA 2KI6D 3NSLA 1K8UA 4PE7A 1EXRA 4C0JA 3H4SE 1J1DA 1MUXA 1N2DA 2BBMA 1S5GZ 4PALA 1KQMB 1K94A 1VRKA 4PHMA 3SG3A 4M2QA 1KSMA 1XFXO 4XJKB 1QX2A 1B8CA 4A4CA 3TUYC 2WOSA 4PCWA 1J7QA 1JWDA 1RROA 5ER4X 3SIBA 1OZOA 2GGZA 2KBMA 2CXJA 2G9BA 4QJ4B 1PULA 1WRZA 1PALA 1M31A 1ZUZA 3GOFA 2EC6C 1EG3A 1QASA 3EVRA 3QRXA 2L4HA 5ER5A 1S1EA 1TNXA 3KEVA 1NUBA 3BUWB 4YI9A 1KSOA 1KK7Z 4USLA 3SJSA 1S6CA 1NWDA 4MZKA 2BE4A 2JT0A 3PFVA 4PHJA 1NX2A 1DJGA 4MZLA 2WCFA 5HLOA 5CSFA 4PHKA 1QJTA 4YGDB 1XA5A 2CBLA 5CPVA 4F0ZB 4QJ3B 1QLSA 1J55A 2JU0A 1ALWA 5KU1A 3FWCA 2PASA 4YGEB 1OMDA 4ZCUA 1YTZC 3PALA 2V53A 1CFDA 2EGDA 1M45A 2PSRA 1IQ5A 2ZRTA 3A8RA 2RGIA 1IJ5A 1SCVA 2WNDA 1KQVA 1SPYA 1M63B 2JZIA 3ZWHA 4CIDA 2BCXA 4TNCA 3AAKA 4A4BA 4N1GA 2BCBA 1AVSA 1V1GA 1TCFA 1XFVO 2MLEC 1G4YR 4DIRA 1CLMA 3KPXA 4OVNF 3VRQA 3CGAA 2F8PA 4YGCB 1UHJA 1SRAA 4DUQA 1SBJA 4M2OA 3SG7A 1U5IB 2MAZA 1CNPA 1TCOB 3I5HB 1DJIA 1H8BA 1S5GY 3CR4X 4MSPA 2M7LA 1WDCC 1KWOB 3KHEA 3PATA 2NXQA 4E68A 2CNPA 2JXLA 1ZOTB 4R1EA 3DVMA 2LANA 2Q91A 1CDNA 3BQ3A 2OTGB 4HSZA 1H4BA 1FI5A 3DF0B 3EK8A 1FW4A 4MZJA 1DJXA 2P6BB 2QACA 2O5GA 3D10A 3K21A 3ZNIA 1NSHA 4I5JA 1XK4A 2COLB 1CMFA 3NSIA 3BUXB 1JF0A 2I94A 1IWQA 2JXCA 1SCMC 2L5XB 3PN7C 1K96A 1WY9A 2L50A 1DF0B 1TTXA 3NSKA 2PRUA 1C7VA 4YGAA 3CLNA 5HLVA 4I5NB 2ZNEA 1DMOA 1JC2A 2FCDA 2I18A 2BL0B 1C07A 1PK0D 1UURA 2TN4A 4N5XA 4P5OE 2KQYA 1R2UA 2M1KB 1KK8C 1GJYA 2L4IA 3WHUB 3DVEA 2LVVA 1BR4B 1SKTA 3IQOA 1ODBA 1LA3A 1DVIA 2LHLA 2WORA 4ORAB 1NCYA 3I5GB 3BUMB 1CB1A 1K9UA 1BLQA 4MEWA 3CS1A 1CLLA 1X02A 4JQ0D 5I2OA 4YGBB 2LP2A 2LC5A 2M7NA 1UHHA 2K0JA 2EHBA 3OB2B 5K89A 1G33A 2CCMA 2KOTA 1LA0A 3DVKA 4FQOA 4D1EA 1JFKA 1EL4A 1DJHA 4ICBA 2B1UA 2FJUB 2AMIA 1ZMZA 2F2PA 2MBXA 2F2OA 1D1OA 2O60A 1MHOA 3GK1A 1BOCA 1CDLA 1Y1AA 1F70A 5GQQC 2GV5A 1M39A 2ISDA 2Y1NA 4YRUA 1WLMA 3PSRA 4P2YB 5IBWA 4XJKA 1CM4A 1PVBA 4MN0A 5HKWA 1TRFA 2M1UA 4DRWA 1XK4C 4NDCA 3FIAA 3DVJA 2OS8C 3IQQA 4MLWA 4ZCVA 1A03A 2KYFA 5JJGA 1B8RA 1F4OA 1KFUS 1A75B 2GGMA 2JNFA 1IH0A 1QVIY 2F33A 2D8NA 3SG5A 3TDZA 1IQ3A 3BYAA 2LLSA 2BCAA 1YUSA 2M29A 5KSZA 1MF8B 1QIWA 1SL7A 3JVTC 3O4YA 1PSBA 1FPWA 5DKQA 1BMOA 2M8UA 2QPTA 3RLZA 1BJFA 4Q04A 1KCYA 1YRTB 1DTLA 3GK4X 1CTRA 2BBNA 3BXKA 2MA2A 4N1FA 1M46A 2JRFA 4C0LA 1IRJA 4CPVA 1MXEA 1XFWO 2MLFC 4ORCB 3VGOA 4MVFA 1QATA 5I2LA 1UHKA 1DGVA 4YBHB 2M97A 5HYDA 2KI4C 3BOWB 1QIVA 1SR6C 4QJ5B 4NDBA 1CMGA 2M0RA 1UP5A 1Y1XA 2A4JA 2SASA 4HREE 1L2OC 1BR1B 1AJ5A 3CR2A 1ALVA 1B47A 2LLUA 3OX6A 5PALA 1OQPA 1CDMA 1WLZA 3JTDB 1GGZA 1OMVA 2PALA 3I5FB 2LE9B 3MSEB 1W7JB 4PE0A 4ORBB 2FCEA 1RWYA 1TIZA 2BECA 2K7BA 2LCPA 1J7OA 1S36A 1YR5A 1W7IB 3CZTX 5DKNA 1FF1A 1L7ZA 5AANA 1F71A 1U5IA 3WXAA 1NX1A 1FI6A 1JSAA 1NCXA 1Y6WA 1YVHA 3E3RA 4GGFA 1RK9A 1F54A 2HF5A 5AEQA 4CFRA 1QS7A 3TDUA 2M3WA 1UWOA 1OE9B 2K7CA 1QVIZ 2ZFDA 3DF0A 1K95A 1SK6D 3I5IB 2HQ8A 1B7TY 2KGRA 1XYDA 1CM1A 1LKJA 2JOJA 2LUXA 5I2QA 2BKIB 3AAJA 1DGUA 3KO0A 2MRDA 1S26D 1B8LA 1QV0A 2F3ZA 2KHNA 3FWBA 2JT8A 4JWQA 1RTP1 5CSJA 1WRLA 3TDIA 3TS5C 1DF0A 2K8MB 3BUOB 5I8NA 5TNCA 1EG4A 1IKUA 1XFZO 2LM5A 4OV2A 4WQ3A 2WCBA 1Q80A 3TUYB 1JUOA 1CFCA 1XO5A 1OMRA 1K90D 2LVJA 3HCMA 3CR5X 3EKJA 2JQ6A 5DKRA 1NCZA 2KFHA 2KAXA 4OR9B 3LK0A 1YUTA 2WCEA 2BKHB 3GK2A 2HPSA 1E8AA 4GNKB 2EC6B 1A4PA 5HKZA 1BT6A 5AERA 2LVKA 4IL1A 1EH2A 1IJ6A 3O78A 2LAPA 2NCPA 1TNWA 1YX7A 1AJ4A 3DD4A 2MJWB 2R2IA 3A4UB 3JVTB 1QX5B 1ZACA 2K61A 3LL8B 1CLBA 2G2BA 1A2XA 4BY5A 4GUKA 3LLEA 4YI8A 2VRGA 2LMTA 2LV7A 3ICBA 1YUUA 2FOTA 2KSPA 3CWGA 3I5HC 4MRXA 4GGFC 1LXFC 4HRGA 4GPLB 3BUNB 1B4CA 2HQWA 1KWOC 2H61A 4I5KA 2I2RE 5KTYA 1TN4A 4OCIA 3RM1A 4M2PA 1CKKA 2JT3A 2LP3A 2LNKA 1K9PA 1Y0VH 1XFUO 2K7DA 2OTGC 1SY9A 1MR8A 1MWNA 4PE4A 2NLNA 3SG2A 2KYCA 5D69A 2HETA 5BPJA 2KFFA 1B7TZ 4GFTA 3NXAA 4AQIA 1K2HA 1SL8A 1XFYO 3D0YB 3SIAA 2KAYA 3VRNA 1AHRA 2L51A 4JPZB 5J3XA 1A75A 2BE6A 3F45A 1UUSA 2F3YA 1JBAA 1DJWA 3VROA 2KGBC 1HT9A 2M9GA 3SG4A 1CDPA 1NX0A 2ZRSA 1JFJA 3LK1A 5FYXA 1RJVA 2WC8A 2BL0C 2LLTA
chains in the Genus database with same CATH superfamily
2I7AA 2JWWA 2OPOA 3B88A 3OHMB 4OKHA 1T14A 4PHNA 1YURA 2ZKMX 1GGWA 1J7RA 3PM8A 4GAOA 4INWA 2NCOA 4GBAA 1JF2A 1IG5A 3I5GC 3IVTA 3OBVA 3PM2A 1WDCB 1CFPA 4INXA 1GQMA 3B7AA 2L2EA 4WQ2A 2K2FA 2ERBA 3WNXB 2KDHA 1RECA 2JTZA 1V1FA 2JPTA 5I94A 1NX3A 3NHIA 1R6PA 1BODA 2JC2A 3PLFB 1N65A 3BOWA 4WRIA 3IF7A 1XVJA 1KFUL 3NSOA 1LVCD 1SCMB 3OGNA 3PN7B 1AUIB 1QTXA 4MRYA 3FE8A 3EK4A 1QLKA 4DCKA 1KFXS 3TS5B 5CSNA 1RFJA 1YX8A 2QEBA 4U8DA 2H61C 2K2AA 2KAVA 5CSIA 3O6BA 3KF9A 1DT7B 1EJ3A 2JTTA 3O2PA 1KQMC 2JNXA 1NYAA 1SNLA 2P71A 1TNQA 3HX4A 1KK8B 2KQ6A 4CLNA 2FJYA 3EVVA 2ZN9A 2LMUA 5D7FA 4MBEA 3EK7A 1P28A 3B6XA 1OOJA 4DS7A 2ZNDA 1AP4A 1F55A 1B1GA 1Y1UA 4PE1A 2Y4QA 2KI6C 4NDDA 2ZN8A 2E30A 1MQ1A 1PRWA 1OSAA 1OOFA 2CTNA 2IS9A 2K7OA 5B8IB 1SL9A 1MXLC 2LHIA 5AXIA 2MHHA 1S6IA 3LCPC 2DOQA 1IGVA 2KBIA 1KFXL 1NPQA 2LMVA 1DJYA 2KNEA 4L9MA 3BJHA 3D74A 1SW8A 1SYMA 1LS8A 5FI7A 2L98A 1G8IA 1S6JA 3VRRA 4XYNA 1BG1A 2LVIA 2M49B 1N0YA 2E6WA 3BFHA 2WCMA 1BU3A 3EKHA 4PT1A 1SMGA 2OS8B 3OP0A 1NIWA 1PVAA 2AUCA 5HKYA 1S3PA 1FBVA 1F4QA 1YRUB 1ZFSA 2Y5IA 4ETOA 1F8HA 2AAOA 4AQJA 3FS7A 4GGNA 4I5LB 2L0PA 3SS5A 4PDZA 1BF5A 1K93D 1KK7Y 1OOGA 1TOPA 3EVUA 3JTDC 1QWVA 4C0KA 3I5FC 2PVBA 1TWOA 3AKAA 1DJZA 1GM0A 1PSRA 3CTNA 3D77A 2KPHA 2KFGA 3VRPA 5G08A 4BY4A 1WRKA 3O4XA 3SG6A 1TNPA 1LINA 3C1VA 2H2KA 2Y1MA 1B9AA 2LUCA 3WHTB 1J1EA 4FTGA 1J7PA 1QX7A 3OB1B 1YVLA 1C7WA 3OX5A 5F6TA 1UHIA 3AKBA 4UPGA 1NP8A 2NZ0A 2PYQA 2Q4UA 4HRHA 2KI4B 1AK8A 1SR6B 3S0GA 3I5IC 5DICA 1QV1A 5JOLA 4CFQA 1CFFA 3UO9A 1QXPA 4AOMA 5AFPA 2QEVA 1UHNA 3TZ1A 2CT9A 3CZ0A 1A29A 1K9KA 2PMYA 1L2OB 1OZSA 4NQGA 3D0YA 1HQVA 2JULA 2SCPA 3M0WA 2KI6D 3NSLA 1K8UA 4PE7A 1EXRA 4C0JA 3H4SE 1J1DA 1MUXA 1N2DA 2BBMA 1S5GZ 4PALA 1KQMB 1K94A 1VRKA 4PHMA 3Q8IA 3SG3A 4M2QA 1KSMA 1XFXO 4XJKB 1QX2A 1B8CA 4A4CA 3TUYC 2WOSA 4PCWA 1J7QA 1JWDA 1RROA 5ER4X 3SIBA 1OZOA 2GGZA 2KBMA 2CXJA 2G9BA 3DXLA 4QJ4B 1PULA 5HL1A 1WRZA 1PALA 1M31A 1ZUZA 3GOFA 1XFRA 2EC6C 1EG3A 3CZ2A 1QASA 3EVRA 3QRXA 2L4HA 3FE6A 5ER5A 1S1EA 1TNXA 1DELA 3KEVA 1NUBA 3BUWB 4YI9A 1KSOA 1KK7Z 4USLA 3SJSA 2GTEA 2L5YA 1S6CA 1NWDA 4MZKA 2BE4A 2JT0A 2WCJA 3PFVA 4PHJA 1NX2A 1DJGA 4MZLA 2WCFA 5HLOA 3BFBA 5CSFA 4PHKA 1QJTA 4YGDB 1XA5A 2CBLA 5CPVA 4F0ZB 4QJ3B 1QLSA 1J55A 2JU0A 1ALWA 5KU1A 3FWCA 2PASA 4YGEB 1OMDA 4ZCUA 1YTZC 3PALA 3CDNA 3R1OA 2V53A 1CFDA 2EGDA 1M45A 2PSRA 1IQ5A 2ZRTA 3A8RA 2RGIA 4JKTA 1IJ5A 1SCVA 3S0BA 2WNDA 1KQVA 1SPYA 1C3ZA 1M63B 2JZIA 4IJ7A 3ZWHA 3R1PA 4CIDA 1SSEB 2BCXA 4TNCA 3AAKA 4A4BA 4N1GA 2BCBA 1AVSA 1V1GA 1TCFA 1XFVO 2MLEC 1G4YR 4DIRA 1CLMA 3KPXA 4OVNF 3VRQA 3CGAA 2F8PA 4YGCB 1UHJA 1SRAA 4DUQA 1SBJA 4M2OA 3SG7A 1U5IB 2MAZA 3CABA 1TCOB 1CNPA 3I5HB 1DJIA 3R1VA 1H8BA 1S5GY 3CR4X 4MSPA 2M7LA 1WDCC 1KWOB 3KHEA 3PATA 2NXQA 4E68A 2CNPA 2JXLA 1ZOTB 4OZDA 4R1EA 3DVMA 2LANA 2Q91A 1CDNA 3BQ3A 2OTGB 4HSZA 1H4BA 1FI5A 3DF0B 3EK8A 1FW4A 1OW4A 3D78A 4MZJA 3DZTA 1DJXA 2P6BB 2QACA 2O5GA 3D10A 3K21A 3ZNIA 1NSHA 4I5JA 1XK4A 2BAPA 3S0AA 1DC1A 2COLB 1CMFA 3NSIA 3BUXB 1JF0A 2I94A 3S0DA 1IWQA 2JXCA 1SCMC 2L5XB 3PN7C 5FI2A 1K96A 1WY9A 2L50A 1DF0B 1TTXA 3NSKA 2PRUA 1C7VA 4YGAA 3CLNA 5HLVA 4I5NB 2PQLA 2ZNEA 1DMOA 1JC2A 2FCDA 2I18A 2BL0B 2QEOA 1C07A 1PK0D 1UURA 2TN4A 4N5XA 4P5OE 2KQYA 1R2UA 2M1KB 1KK8C 1GJYA 2L4IA 3L47A 3WHUB 3DVEA 2LVVA 1BR4B 1TUZA 1SKTA 3IQOA 1ODBA 1LA3A 1DVIA 2LHLA 2WORA 4ORAB 1NCYA 3CYZA 3BUMB 2JPOA 3I5GB 1CB1A 1K9UA 3NHTA 1BLQA 4MEWA 3CS1A 1CLLA 1X02A 3DY9A 4JQ0D 2K60A 2WCKA 4YGBB 5I2OA 2LP2A 2LC5A 2M7NA 1UHHA 2K0JA 2EHBA 3OB2B 5K89A 1G33A 2CCMA 2KOTA 4F7FA 1LA0A 3DVKA 4FQOA 4D1EA 1JFKA 1EL4A 1DJHA 4ICBA 3K1EA 2B1UA 2FJUB 2AMIA 1ZMZA 2F2PA 2MBXA 2F2OA 3VB1A 1D1OA 2O60A 1MHOA 3GK1A 1BOCA 3QMEA 5D3OA 1CDLA 1Y1AA 2WC6A 1F70A 5GQQC 2GV5A 1M39A 2ISDA 2Y1NA 1Z2CB 4YRUA 1WLMA 3PSRA 4P2YB 5IBWA 2WC5A 1DEKA 1CM4A 4XJKA 1PVBA 4MN0A 5HKWA 1TRFA 2M1UA 4DRWA 1XK4C 4NDCA 3FIAA 3DVJA 2OS8C 3IQQA 4MLWA 4ZCVA 1A03A 2KYFA 5JJGA 2WCLA 1B8RA 1F4OA 1KFUS 1A75B 2GGMA 2JNFA 3FE9A 1QVIY 1IH0A 3D75A 2F33A 2D8NA 3SG5A 3TDZA 2QDIA 1IQ3A 3BYAA 2LLSA 2BCAA 1YUSA 2M29A 5KSZA 1MF8B 1QIWA 3R72A 1SL7A 3JVTC 3O4YA 1PSBA 1FPWA 1IIOA 5DKQA 1BMOA 4JD9A 4KYNA 2M8UA 2QPTA 3RLZA 1BJFA 4Q04A 1KCYA 1YRTB 3RZSA 1DTLA 3GK4X 1CTRA 2BBNA 3BXKA 3S0FA 1OOIX 2MA2A 4N1FA 1M46A 2JRFA 4C0LA 1IRJA 4CPVA 1MXEA 1XFWO 2MLFC 4ORCB 3VGOA 1Z4HA 4MVFA 1QATA 5I2LA 1UHKA 3DYEA 1DGVA 4YBHB 2M97A 5HYDA 2KI4C 3BOWB 1QIVA 1SR6C 4QJ5B 4NDBA 1CMGA 2M0RA 1UP5A 1Y1XA 2A4JA 2SASA 4HREE 1L2OC 1BR1B 1AJ5A 3CR2A 1ALVA 1B47A 2LLUA 3OX6A 5PALA 1OQPA 3SS3A 1CDMA 1WLZA 3V2LA 3JTDB 1GGZA 1OMVA 2PALA 3I5FB 2LE9B 3MSEB 1W7JB 4PE0A 4ORBB 2FCEA 1RWYA 1TIZA 2BECA 2K7BA 2LCPA 1J7OA 1S36A 1YR5A 1W7IB 3CZTX 5DKNA 1FF1A 1L7ZA 3L4AA 5AANA 1F71A 1U5IA 3WXAA 3L4LA 1NX1A 1FI6A 1JSAA 1NCXA 1Y6WA 1YVHA 3E3RA 4GGFA 1RK9A 1F54A 2HF5A 3B86A 5AEQA 4CFRA 2YGUA 1QS7A 3TDUA 2M3WA 1UWOA 1OE9B 2K7CA 1QVIZ 2ZFDA 3N7HA 3DF0A 1K95A 1SK6D 3I5IB 2H8VA 2HQ8A 1B7TY 1TUJA 2KGRA 1XYDA 3UNWA 1CM1A 1LKJA 2JOJA 2LUXA 5I2QA 2BKIB 3AAJA 1DGUA 3KO0A 2MRDA 1S26D 1B8LA 1QV0A 2P70A 2F3ZA 2KHNA 3FWBA 2JT8A 4JWQA 1RTP1 5CSJA 1WRLA 3TDIA 3TS5C 1DF0A 2K8MB 3BUOB 5I8NA 5TNCA 1EG4A 1IKUA 1XFZO 3PJIA 2LM5A 4OV2A 4WQ3A 2WCHA 2WCBA 1Q80A 3TUYB 1JUOA 1CFCA 1XO5A 1OMRA 1K90D 2LVJA 3HCMA 1ORGA 5EL2A 3CR5X 1W9ZA 2JQ6A 3EKJA 5DKRA 1NCZA 2KFHA 2KLEA 2KAXA 3SS4A 4OR9B 3LK0A 1YUTA 2WCEA 2BKHB 3GK2A 2HPSA 2BNXA 1E8AA 3D76A 4GNKB 2EC6B 1A4PA 3NGVA 1BT6A 5HKZA 5AERA 2LVKA 4IL1A 3EG5B 1EH2A 1IJ6A 2KLDA 3O78A 2LAPA 2NCPA 1TNWA 1YX7A 1AJ4A 3DD4A 2MJWB 2R2IA 3A4UB 3JVTB 1QX5B 1ZACA 2K61A 3LL8B 1C3YA 2G2BA 1CLBA 1A2XA 4BY5A 4GUKA 3S0EA 3LLEA 4YI8A 2VRGA 2LMTA 2LV7A 3ICBA 4FQTA 1YUUA 2FOTA 2KSPA 3CWGA 3I5HC 4MRXA 1DQEA 4GGFC 1LXFC 4HRGA 4GPLB 3BUNB 1B4CA 2HQWA 1KWOC 2H61A 4I5KA 2I2RE 5KTYA 1TN4A 4OCIA 3RM1A 4M2PA 1CKKA 2JT3A 2LP3A 2LNKA 1K9PA 1Y0VH 1XFUO 2K7DA 2OTGC 1SY9A 1MR8A 1MWNA 2QEHA 4PE4A 2L2CA 3D73A 2NLNA 3SG2A 5FI6A 2KYCA 5D69A 2HETA 5BPJA 2KFFA 1B7TZ 4GFTA 3NXAA 4AQIA 1K2HA 1SL8A 1XFYO 3D0YB 3SIAA 2KAYA 3VRNA 3B87A 1AHRA 2L51A 4JPZB 5J3XA 1A75A 2BE6A 3F45A 1UUSA 2F3YA 1JBAA 1DJWA 3VROA 2KGBC 1HT9A 2M9GA 1OOHA 1CDPA 3SG4A 1NX0A 2ZRSA 1JFJA 3LK1A 3BFAA 5FYXA 1RJVA 2WC8A 2BL0C 2LLTA 3CZ1A
chains in the Genus database with same CATH topology
2I7AA 2JWWA 2OPOA 3OHMB 4OKHA 4PHNA 1YURA 2ZKMX 1GGWA 1J7RA 3PM8A 4GAOA 2NCOA 4GBAA 1JF2A 1IG5A 3I5GC 1CFPA 1WDCB 1GQMA 2L2EA 4WQ2A 2K2FA 3WNXB 2KDHA 1RECA 2JTZA 1V1FA 2JPTA 1NX3A 1R6PA 1BODA 2JC2A 3PLFB 1N65A 3BOWA 4WRIA 3IF7A 1XVJA 1KFUL 3NSOA 1LVCD 1SCMB 3PN7B 1AUIB 1QTXA 4MRYA 3EK4A 1QLKA 4DCKA 1KFXS 3TS5B 5CSNA 1RFJA 1YX8A 4U8DA 2H61C 2K2AA 2KAVA 5CSIA 3O6BA 3KF9A 1DT7B 1EJ3A 2JTTA 3O2PA 1KQMC 2JNXA 1NYAA 1SNLA 1TNQA 3HX4A 1KK8B 2KQ6A 4CLNA 3EVVA 2ZN9A 2LMUA 5D7FA 4MBEA 3EK7A 1OOJA 4DS7A 2ZNDA 1AP4A 1F55A 1B1GA 1Y1UA 4PE1A 2Y4QA 2KI6C 4NDDA 2ZN8A 2E30A 1MQ1A 1PRWA 1OSAA 2CTNA 2IS9A 2K7OA 5B8IB 1SL9A 1MXLC 2LHIA 5AXIA 2MHHA 1S6IA 3LCPC 2DOQA 1IGVA 2KBIA 1KFXL 1NPQA 2LMVA 1DJYA 2KNEA 4L9MA 1SW8A 1SYMA 2L98A 1G8IA 1S6JA 3VRRA 4XYNA 1BG1A 2LVIA 2M49B 1N0YA 2E6WA 1BU3A 3EKHA 1SMGA 2OS8B 3OP0A 1NIWA 1PVAA 2AUCA 5HKYA 1S3PA 1FBVA 1F4QA 1YRUB 1ZFSA 2Y5IA 4ETOA 1F8HA 2AAOA 4AQJA 3FS7A 4GGNA 4I5LB 2L0PA 4PDZA 1BF5A 1K93D 1KK7Y 1TOPA 3EVUA 3JTDC 4C0KA 3I5FC 2PVBA 3AKAA 1DJZA 1PSRA 3CTNA 3VRPA 2KFGA 5G08A 4BY4A 1WRKA 3SG6A 1TNPA 1LINA 3C1VA 2H2KA 2Y1MA 1B9AA 2LUCA 3WHTB 1J1EA 4FTGA 1J7PA 1QX7A 3OB1B 1YVLA 1C7WA 3OX5A 5F6TA 1UHIA 3AKBA 4UPGA 1NP8A 2NZ0A 2Q4UA 4HRHA 1AK8A 2KI4B 1SR6B 3I5IC 5JOLA 1QV1A 4CFQA 1CFFA 1QXPA 4AOMA 5AFPA 3TZ1A 1UHNA 2CT9A 1A29A 1K9KA 2PMYA 1L2OB 1OZSA 4NQGA 3D0YA 1HQVA 2JULA 2SCPA 3M0WA 2KI6D 3NSLA 1K8UA 4PE7A 1EXRA 4C0JA 3H4SE 1J1DA 1MUXA 1N2DA 2BBMA 1S5GZ 4PALA 1KQMB 1K94A 1VRKA 4PHMA 3SG3A 4M2QA 1KSMA 1XFXO 4XJKB 1QX2A 1B8CA 4A4CA 3TUYC 2WOSA 4PCWA 1J7QA 1JWDA 1RROA 5ER4X 3SIBA 1OZOA 2GGZA 2KBMA 2CXJA 2G9BA 4QJ4B 1PULA 1WRZA 1PALA 1M31A 1ZUZA 3GOFA 2EC6C 1EG3A 1QASA 3EVRA 3QRXA 2L4HA 5ER5A 1S1EA 1TNXA 3KEVA 1NUBA 3BUWB 4YI9A 1KSOA 1KK7Z 4USLA 3SJSA 1S6CA 1NWDA 4MZKA 2BE4A 2JT0A 3PFVA 4PHJA 1NX2A 1DJGA 4MZLA 2WCFA 5HLOA 5CSFA 4PHKA 1QJTA 4YGDB 1XA5A 2CBLA 5CPVA 4F0ZB 4QJ3B 1QLSA 1J55A 2JU0A 1ALWA 5KU1A 3FWCA 2PASA 4YGEB 1OMDA 4ZCUA 1YTZC 3PALA 2V53A 1CFDA 2EGDA 1M45A 2PSRA 1IQ5A 2ZRTA 3A8RA 2RGIA 1IJ5A 1SCVA 2WNDA 1KQVA 1SPYA 1M63B 2JZIA 3ZWHA 4CIDA 2BCXA 4TNCA 3AAKA 4A4BA 4N1GA 2BCBA 1AVSA 1V1GA 1TCFA 1XFVO 2MLEC 1G4YR 4DIRA 1CLMA 3KPXA 4OVNF 3VRQA 3CGAA 2F8PA 4YGCB 1UHJA 1SRAA 4DUQA 1SBJA 4M2OA 3SG7A 1U5IB 2MAZA 1CNPA 1TCOB 3I5HB 1DJIA 1H8BA 1S5GY 3CR4X 4MSPA 2M7LA 1WDCC 1KWOB 3KHEA 3PATA 2NXQA 4E68A 2CNPA 2JXLA 1ZOTB 4R1EA 3DVMA 2LANA 2Q91A 1CDNA 3BQ3A 2OTGB 4HSZA 1H4BA 1FI5A 3DF0B 3EK8A 1FW4A 4MZJA 1DJXA 2P6BB 2QACA 2O5GA 3D10A 3K21A 3ZNIA 1NSHA 4I5JA 1XK4A 2COLB 1CMFA 3NSIA 3BUXB 1JF0A 2I94A 1IWQA 2JXCA 1SCMC 2L5XB 3PN7C 1K96A 1WY9A 2L50A 1DF0B 1TTXA 3NSKA 2PRUA 1C7VA 4YGAA 3CLNA 5HLVA 4I5NB 2ZNEA 1DMOA 1JC2A 2FCDA 2I18A 2BL0B 1C07A 1PK0D 1UURA 2TN4A 4N5XA 4P5OE 2KQYA 1R2UA 2M1KB 1KK8C 1GJYA 2L4IA 3WHUB 3DVEA 2LVVA 1BR4B 1SKTA 3IQOA 1ODBA 1LA3A 1DVIA 2LHLA 2WORA 4ORAB 1NCYA 3I5GB 3BUMB 1CB1A 1K9UA 1BLQA 4MEWA 3CS1A 1CLLA 1X02A 4JQ0D 5I2OA 4YGBB 2LP2A 2LC5A 2M7NA 1UHHA 2K0JA 2EHBA 3OB2B 5K89A 1G33A 2CCMA 2KOTA 1LA0A 3DVKA 4FQOA 4D1EA 1JFKA 1EL4A 1DJHA 4ICBA 2B1UA 2FJUB 2AMIA 1ZMZA 2F2PA 2MBXA 2F2OA 1D1OA 2O60A 1MHOA 3GK1A 1BOCA 1CDLA 1Y1AA 1F70A 5GQQC 2GV5A 1M39A 2ISDA 2Y1NA 4YRUA 1WLMA 3PSRA 4P2YB 5IBWA 4XJKA 1CM4A 1PVBA 4MN0A 5HKWA 1TRFA 2M1UA 4DRWA 1XK4C 4NDCA 3FIAA 3DVJA 2OS8C 3IQQA 4MLWA 4ZCVA 1A03A 2KYFA 5JJGA 1B8RA 1F4OA 1KFUS 1A75B 2GGMA 2JNFA 1IH0A 1QVIY 2F33A 2D8NA 3SG5A 3TDZA 1IQ3A 3BYAA 2LLSA 2BCAA 1YUSA 2M29A 5KSZA 1MF8B 1QIWA 1SL7A 3JVTC 3O4YA 1PSBA 1FPWA 5DKQA 1BMOA 2M8UA 2QPTA 3RLZA 1BJFA 4Q04A 1KCYA 1YRTB 1DTLA 3GK4X 1CTRA 2BBNA 3BXKA 2MA2A 4N1FA 1M46A 2JRFA 4C0LA 1IRJA 4CPVA 1MXEA 1XFWO 2MLFC 4ORCB 3VGOA 4MVFA 1QATA 5I2LA 1UHKA 1DGVA 4YBHB 2M97A 5HYDA 2KI4C 3BOWB 1QIVA 1SR6C 4QJ5B 4NDBA 1CMGA 2M0RA 1UP5A 1Y1XA 2A4JA 2SASA 4HREE 1L2OC 1BR1B 1AJ5A 3CR2A 1ALVA 1B47A 2LLUA 3OX6A 5PALA 1OQPA 1CDMA 1WLZA 3JTDB 1GGZA 1OMVA 2PALA 3I5FB 2LE9B 3MSEB 1W7JB 4PE0A 4ORBB 2FCEA 1RWYA 1TIZA 2BECA 2K7BA 2LCPA 1J7OA 1S36A 1YR5A 1W7IB 3CZTX 5DKNA 1FF1A 1L7ZA 5AANA 1F71A 1U5IA 3WXAA 1NX1A 1FI6A 1JSAA 1NCXA 1Y6WA 1YVHA 3E3RA 4GGFA 1RK9A 1F54A 2HF5A 5AEQA 4CFRA 1QS7A 3TDUA 2M3WA 1UWOA 1OE9B 2K7CA 1QVIZ 2ZFDA 3DF0A 1K95A 1SK6D 3I5IB 2HQ8A 1B7TY 2KGRA 1XYDA 1CM1A 1LKJA 2JOJA 2LUXA 5I2QA 2BKIB 3AAJA 1DGUA 3KO0A 2MRDA 1S26D 1B8LA 1QV0A 2F3ZA 2KHNA 3FWBA 2JT8A 4JWQA 1RTP1 5CSJA 1WRLA 3TDIA 3TS5C 1DF0A 2K8MB 3BUOB 5I8NA 5TNCA 1EG4A 1IKUA 1XFZO 2LM5A 4OV2A 4WQ3A 2WCBA 1Q80A 3TUYB 1JUOA 1CFCA 1XO5A 1OMRA 1K90D 2LVJA 3HCMA 3CR5X 3EKJA 2JQ6A 5DKRA 1NCZA 2KFHA 2KAXA 4OR9B 3LK0A 1YUTA 2WCEA 2BKHB 3GK2A 2HPSA 1E8AA 4GNKB 2EC6B 1A4PA 5HKZA 1BT6A 5AERA 2LVKA 4IL1A 1EH2A 1IJ6A 3O78A 2LAPA 2NCPA 1TNWA 1YX7A 1AJ4A 3DD4A 2MJWB 2R2IA 3A4UB 3JVTB 1QX5B 1ZACA 2K61A 3LL8B 1CLBA 2G2BA 1A2XA 4BY5A 4GUKA 3LLEA 4YI8A 2VRGA 2LMTA 2LV7A 3ICBA 1YUUA 2FOTA 2KSPA 3CWGA 3I5HC 4MRXA 4GGFC 1LXFC 4HRGA 4GPLB 3BUNB 1B4CA 2HQWA 1KWOC 2H61A 4I5KA 2I2RE 5KTYA 1TN4A 4OCIA 3RM1A 4M2PA 1CKKA 2JT3A 2LP3A 2LNKA 1K9PA 1Y0VH 1XFUO 2K7DA 2OTGC 1SY9A 1MR8A 1MWNA 4PE4A 2NLNA 3SG2A 2KYCA 5D69A 2HETA 5BPJA 2KFFA 1B7TZ 4GFTA 3NXAA 4AQIA 1K2HA 1SL8A 1XFYO 3D0YB 3SIAA 2KAYA 3VRNA 1AHRA 2L51A 4JPZB 5J3XA 1A75A 2BE6A 3F45A 1UUSA 2F3YA 1JBAA 1DJWA 3VROA 2KGBC 1HT9A 2M9GA 3SG4A 1CDPA 1NX0A 2ZRSA 1JFJA 3LK1A 5FYXA 1RJVA 2WC8A 2BL0C 2LLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I7A A;  2JWW A;  2OPO A;  3OHM B;  4OKH A;  4PHN A;  1YUR A;  2ZKM X;  1GGW A;  1J7R A;  3PM8 A;  4GAO A;  2NCO A;  4GBA A;  1JF2 A;  1IG5 A;  3I5G C;  1CFP A;  1WDC B;  1GQM A;  2L2E A;  4WQ2 A;  2K2F A;  3WNX B;  2KDH A;  1REC A;  2JTZ A;  1V1F A;  2JPT A;  1NX3 A;  1R6P A;  1BOD A;  2JC2 A;  3PLF B;  1N65 A;  3BOW A;  4WRI A;  3IF7 A;  1XVJ A;  1KFU L;  3NSO A;  1LVC D;  1SCM B;  3PN7 B;  1AUI B;  1QTX A;  4MRY A;  3EK4 A;  1QLK A;  4DCK A;  1KFX S;  3TS5 B;  5CSN A;  1RFJ A;  1YX8 A;  4U8D A;  2H61 C;  2K2A A;  2KAV A;  5CSI A;  3O6B A;  3KF9 A;  1DT7 B;  1EJ3 A;  2JTT A;  3O2P A;  1KQM C;  2JNX A;  1NYA A;  1SNL A;  1TNQ A;  3HX4 A;  1KK8 B;  2KQ6 A;  4CLN A;  3EVV A;  2ZN9 A;  2LMU A;  5D7F A;  4MBE A;  3EK7 A;  1OOJ A;  4DS7 A;  2ZND A;  1AP4 A;  1F55 A;  1B1G A;  1Y1U A;  4PE1 A;  2Y4Q A;  2KI6 C;  4NDD A;  2ZN8 A;  2E30 A;  1MQ1 A;  1PRW A;  1OSA A;  2CTN A;  2IS9 A;  2K7O A;  5B8I B;  1SL9 A;  1MXL C;  2LHI A;  5AXI A;  2MHH A;  1S6I A;  3LCP C;  2DOQ A;  1IGV A;  2KBI A;  1KFX L;  1NPQ A;  2LMV A;  1DJY A;  2KNE A;  4L9M A;  1SW8 A;  1SYM A;  2L98 A;  1G8I A;  1S6J A;  3VRR A;  4XYN A;  1BG1 A;  2LVI A;  2M49 B;  1N0Y A;  2E6W A;  1BU3 A;  3EKH A;  1SMG A;  2OS8 B;  3OP0 A;  1NIW A;  1PVA A;  2AUC A;  5HKY A;  1S3P A;  1FBV A;  1F4Q A;  1YRU B;  1ZFS A;  2Y5I A;  4ETO A;  1F8H A;  2AAO A;  4AQJ A;  3FS7 A;  4GGN A;  4I5L B;  2L0P A;  4PDZ A;  1BF5 A;  1K93 D;  1KK7 Y;  1TOP A;  3EVU A;  3JTD C;  4C0K A;  3I5F C;  2PVB A;  3AKA A;  1DJZ A;  1PSR A;  3CTN A;  3VRP A;  2KFG A;  5G08 A;  4BY4 A;  1WRK A;  3SG6 A;  1TNP A;  1LIN A;  3C1V A;  2H2K A;  2Y1M A;  1B9A A;  2LUC A;  3WHT B;  1J1E A;  4FTG A;  1J7P A;  1QX7 A;  3OB1 B;  1YVL A;  1C7W A;  3OX5 A;  5F6T A;  1UHI A;  3AKB A;  4UPG A;  1NP8 A;  2NZ0 A;  2Q4U A;  4HRH A;  1AK8 A;  2KI4 B;  1SR6 B;  3I5I C;  5JOL A;  1QV1 A;  4CFQ A;  1CFF A;  1QXP A;  4AOM A;  5AFP A;  3TZ1 A;  1UHN A;  2CT9 A;  1A29 A;  1K9K A;  2PMY A;  1L2O B;  1OZS A;  4NQG A;  3D0Y A;  1HQV A;  2JUL A;  2SCP A;  3M0W A;  2KI6 D;  3NSL A;  1K8U A;  4PE7 A;  1EXR A;  4C0J A;  3H4S E;  1J1D A;  1MUX A;  1N2D A;  2BBM A;  1S5G Z;  4PAL A;  1KQM B;  1K94 A;  1VRK A;  4PHM A;  3SG3 A;  4M2Q A;  1KSM A;  1XFX O;  4XJK B;  1QX2 A;  1B8C A;  4A4C A;  3TUY C;  2WOS A;  4PCW A;  1J7Q A;  1JWD A;  1RRO A;  5ER4 X;  3SIB A;  1OZO A;  2GGZ A;  2KBM A;  2CXJ A;  2G9B A;  4QJ4 B;  1PUL A;  1WRZ A;  1PAL A;  1M31 A;  1ZUZ A;  3GOF A;  2EC6 C;  1EG3 A;  1QAS A;  3EVR A;  3QRX A;  2L4H A;  5ER5 A;  1S1E A;  1TNX A;  3KEV A;  1NUB A;  3BUW B;  4YI9 A;  1KSO A;  1KK7 Z;  4USL A;  3SJS A;  1S6C A;  1NWD A;  4MZK A;  2BE4 A;  2JT0 A;  3PFV A;  4PHJ A;  1NX2 A;  1DJG A;  4MZL A;  2WCF A;  5HLO A;  5CSF A;  4PHK A;  1QJT A;  4YGD B;  1XA5 A;  2CBL A;  5CPV A;  4F0Z B;  4QJ3 B;  1QLS A;  1J55 A;  2JU0 A;  1ALW A;  5KU1 A;  3FWC A;  2PAS A;  4YGE B;  1OMD A;  4ZCU A;  1YTZ C;  3PAL A;  2V53 A;  1CFD A;  2EGD A;  1M45 A;  2PSR A;  1IQ5 A;  2ZRT A;  3A8R A;  2RGI A;  1IJ5 A;  1SCV A;  2WND A;  1KQV A;  1SPY A;  1M63 B;  2JZI A;  3ZWH A;  4CID A;  2BCX A;  4TNC A;  3AAK A;  4A4B A;  4N1G A;  2BCB A;  1AVS A;  1V1G A;  1TCF A;  1XFV O;  2MLE C;  1G4Y R;  4DIR A;  1CLM A;  3KPX A;  4OVN F;  3VRQ A;  3CGA A;  2F8P A;  4YGC B;  1UHJ A;  1SRA A;  4DUQ A;  1SBJ A;  4M2O A;  3SG7 A;  1U5I B;  2MAZ A;  1CNP A;  1TCO B;  3I5H B;  1DJI A;  1H8B A;  1S5G Y;  3CR4 X;  4MSP A;  2M7L A;  1WDC C;  1KWO B;  3KHE A;  3PAT A;  2NXQ A;  4E68 A;  2CNP A;  2JXL A;  1ZOT B;  4R1E A;  3DVM A;  2LAN A;  2Q91 A;  1CDN A;  3BQ3 A;  2OTG B;  4HSZ A;  1H4B A;  1FI5 A;  3DF0 B;  3EK8 A;  1FW4 A;  4MZJ A;  1DJX A;  2P6B B;  2QAC A;  2O5G A;  3D10 A;  3K21 A;  3ZNI A;  1NSH A;  4I5J A;  1XK4 A;  2COL B;  1CMF A;  3NSI A;  3BUX B;  1JF0 A;  2I94 A;  1IWQ A;  2JXC A;  1SCM C;  2L5X B;  3PN7 C;  1K96 A;  1WY9 A;  2L50 A;  1DF0 B;  1TTX A;  3NSK A;  2PRU A;  1C7V A;  4YGA A;  3CLN A;  5HLV A;  4I5N B;  2ZNE A;  1DMO A;  1JC2 A;  2FCD A;  2I18 A;  2BL0 B;  1C07 A;  1PK0 D;  1UUR A;  2TN4 A;  4N5X A;  4P5O E;  2KQY A;  1R2U A;  2M1K B;  1KK8 C;  1GJY A;  2L4I A;  3WHU B;  3DVE A;  2LVV A;  1BR4 B;  1SKT A;  3IQO A;  1ODB A;  1LA3 A;  1DVI A;  2LHL A;  2WOR A;  4ORA B;  1NCY A;  3I5G B;  3BUM B;  1CB1 A;  1K9U A;  1BLQ A;  4MEW A;  3CS1 A;  1CLL A;  1X02 A;  4JQ0 D;  5I2O A;  4YGB B;  2LP2 A;  2LC5 A;  2M7N A;  1UHH A;  2K0J A;  2EHB A;  3OB2 B;  5K89 A;  1G33 A;  2CCM A;  2KOT A;  1LA0 A;  3DVK A;  4FQO A;  4D1E A;  1JFK A;  1EL4 A;  1DJH A;  4ICB A;  2B1U A;  2FJU B;  2AMI A;  1ZMZ A;  2F2P A;  2MBX A;  2F2O A;  1D1O A;  2O60 A;  1MHO A;  3GK1 A;  1BOC A;  1CDL A;  1Y1A A;  1F70 A;  5GQQ C;  2GV5 A;  1M39 A;  2ISD A;  2Y1N A;  4YRU A;  1WLM A;  3PSR A;  4P2Y B;  5IBW A;  4XJK A;  1CM4 A;  1PVB A;  4MN0 A;  5HKW A;  1TRF A;  2M1U A;  4DRW A;  1XK4 C;  4NDC A;  3FIA A;  3DVJ A;  2OS8 C;  3IQQ A;  4MLW A;  4ZCV A;  1A03 A;  2KYF A;  5JJG A;  1B8R A;  1F4O A;  1KFU S;  1A75 B;  2GGM A;  2JNF A;  1IH0 A;  1QVI Y;  2F33 A;  2D8N A;  3SG5 A;  3TDZ A;  1IQ3 A;  3BYA A;  2LLS A;  2BCA A;  1YUS A;  2M29 A;  5KSZ A;  1MF8 B;  1QIW A;  1SL7 A;  3JVT C;  3O4Y A;  1PSB A;  1FPW A;  5DKQ A;  1BMO A;  2M8U A;  2QPT A;  3RLZ A;  1BJF A;  4Q04 A;  1KCY A;  1YRT B;  1DTL A;  3GK4 X;  1CTR A;  2BBN A;  3BXK A;  2MA2 A;  4N1F A;  1M46 A;  2JRF A;  4C0L A;  1IRJ A;  4CPV A;  1MXE A;  1XFW O;  2MLF C;  4ORC B;  3VGO A;  4MVF A;  1QAT A;  5I2L A;  1UHK A;  1DGV A;  4YBH B;  2M97 A;  5HYD A;  2KI4 C;  3BOW B;  1QIV A;  1SR6 C;  4QJ5 B;  4NDB A;  1CMG A;  2M0R A;  1UP5 A;  1Y1X A;  2A4J A;  2SAS A;  4HRE E;  1L2O C;  1BR1 B;  1AJ5 A;  3CR2 A;  1ALV A;  1B47 A;  2LLU A;  3OX6 A;  5PAL A;  1OQP A;  1CDM A;  1WLZ A;  3JTD B;  1GGZ A;  1OMV A;  2PAL A;  3I5F B;  2LE9 B;  3MSE B;  1W7J B;  4PE0 A;  4ORB B;  2FCE A;  1RWY A;  1TIZ A;  2BEC A;  2K7B A;  2LCP A;  1J7O A;  1S36 A;  1YR5 A;  1W7I B;  3CZT X;  5DKN A;  1FF1 A;  1L7Z A;  5AAN A;  1F71 A;  1U5I A;  3WXA A;  1NX1 A;  1FI6 A;  1JSA A;  1NCX A;  1Y6W A;  1YVH A;  3E3R A;  4GGF A;  1RK9 A;  1F54 A;  2HF5 A;  5AEQ A;  4CFR A;  1QS7 A;  3TDU A;  2M3W A;  1UWO A;  1OE9 B;  2K7C A;  1QVI Z;  2ZFD A;  3DF0 A;  1K95 A;  1SK6 D;  3I5I B;  2HQ8 A;  1B7T Y;  2KGR A;  1XYD A;  1CM1 A;  1LKJ A;  2JOJ A;  2LUX A;  5I2Q A;  2BKI B;  3AAJ A;  1DGU A;  3KO0 A;  2MRD A;  1S26 D;  1B8L A;  1QV0 A;  2F3Z A;  2KHN A;  3FWB A;  2JT8 A;  4JWQ A;  1RTP 1;  5CSJ A;  1WRL A;  3TDI A;  3TS5 C;  1DF0 A;  2K8M B;  3BUO B;  5I8N A;  5TNC A;  1EG4 A;  1IKU A;  1XFZ O;  2LM5 A;  4OV2 A;  4WQ3 A;  2WCB A;  1Q80 A;  3TUY B;  1JUO A;  1CFC A;  1XO5 A;  1OMR A;  1K90 D;  2LVJ A;  3HCM A;  3CR5 X;  3EKJ A;  2JQ6 A;  5DKR A;  1NCZ A;  2KFH A;  2KAX A;  4OR9 B;  3LK0 A;  1YUT A;  2WCE A;  2BKH B;  3GK2 A;  2HPS A;  1E8A A;  4GNK B;  2EC6 B;  1A4P A;  5HKZ A;  1BT6 A;  5AER A;  2LVK A;  4IL1 A;  1EH2 A;  1IJ6 A;  3O78 A;  2LAP A;  2NCP A;  1TNW A;  1YX7 A;  1AJ4 A;  3DD4 A;  2MJW B;  2R2I A;  3A4U B;  3JVT B;  1QX5 B;  1ZAC A;  2K61 A;  3LL8 B;  1CLB A;  2G2B A;  1A2X A;  4BY5 A;  4GUK A;  3LLE A;  4YI8 A;  2VRG A;  2LMT A;  2LV7 A;  3ICB A;  1YUU A;  2FOT A;  2KSP A;  3CWG A;  3I5H C;  4MRX A;  4GGF C;  1LXF C;  4HRG A;  4GPL B;  3BUN B;  1B4C A;  2HQW A;  1KWO C;  2H61 A;  4I5K A;  2I2R E;  5KTY A;  1TN4 A;  4OCI A;  3RM1 A;  4M2P A;  1CKK A;  2JT3 A;  2LP3 A;  2LNK A;  1K9P A;  1Y0V H;  1XFU O;  2K7D A;  2OTG C;  1SY9 A;  1MR8 A;  1MWN A;  4PE4 A;  2NLN A;  3SG2 A;  2KYC A;  5D69 A;  2HET A;  5BPJ A;  2KFF A;  1B7T Z;  4GFT A;  3NXA A;  4AQI A;  1K2H A;  1SL8 A;  1XFY O;  3D0Y B;  3SIA A;  2KAY A;  3VRN A;  1AHR A;  2L51 A;  4JPZ B;  5J3X A;  1A75 A;  2BE6 A;  3F45 A;  1UUS A;  2F3Y A;  1JBA A;  1DJW A;  3VRO A;  2KGB C;  1HT9 A;  2M9G A;  3SG4 A;  1CDP A;  1NX0 A;  2ZRS A;  1JFJ A;  3LK1 A;  5FYX A;  1RJV A;  2WC8 A;  2BL0 C;  2LLT A; 
#chains in the Genus database with same CATH topology
 2I7A A;  2JWW A;  2OPO A;  3B88 A;  3OHM B;  4OKH A;  1T14 A;  4PHN A;  1YUR A;  2ZKM X;  1GGW A;  1J7R A;  3PM8 A;  4GAO A;  4INW A;  2NCO A;  4GBA A;  1JF2 A;  1IG5 A;  3I5G C;  3IVT A;  3OBV A;  3PM2 A;  1WDC B;  1CFP A;  4INX A;  1GQM A;  3B7A A;  2L2E A;  4WQ2 A;  2K2F A;  2ERB A;  3WNX B;  2KDH A;  1REC A;  2JTZ A;  1V1F A;  2JPT A;  5I94 A;  1NX3 A;  3NHI A;  1R6P A;  1BOD A;  2JC2 A;  3PLF B;  1N65 A;  3BOW A;  4WRI A;  3IF7 A;  1XVJ A;  1KFU L;  3NSO A;  1LVC D;  1SCM B;  3OGN A;  3PN7 B;  1AUI B;  1QTX A;  4MRY A;  3FE8 A;  3EK4 A;  1QLK A;  4DCK A;  1KFX S;  3TS5 B;  5CSN A;  1RFJ A;  1YX8 A;  2QEB A;  4U8D A;  2H61 C;  2K2A A;  2KAV A;  5CSI A;  3O6B A;  3KF9 A;  1DT7 B;  1EJ3 A;  2JTT A;  3O2P A;  1KQM C;  2JNX A;  1NYA A;  1SNL A;  2P71 A;  1TNQ A;  3HX4 A;  1KK8 B;  2KQ6 A;  4CLN A;  2FJY A;  3EVV A;  2ZN9 A;  2LMU A;  5D7F A;  4MBE A;  3EK7 A;  1P28 A;  3B6X A;  1OOJ A;  4DS7 A;  2ZND A;  1AP4 A;  1F55 A;  1B1G A;  1Y1U A;  4PE1 A;  2Y4Q A;  2KI6 C;  4NDD A;  2ZN8 A;  2E30 A;  1MQ1 A;  1PRW A;  1OSA A;  1OOF A;  2CTN A;  2IS9 A;  2K7O A;  5B8I B;  1SL9 A;  1MXL C;  2LHI A;  5AXI A;  2MHH A;  1S6I A;  3LCP C;  2DOQ A;  1IGV A;  2KBI A;  1KFX L;  1NPQ A;  2LMV A;  1DJY A;  2KNE A;  4L9M A;  3BJH A;  3D74 A;  1SW8 A;  1SYM A;  1LS8 A;  5FI7 A;  2L98 A;  1G8I A;  1S6J A;  3VRR A;  4XYN A;  1BG1 A;  2LVI A;  2M49 B;  1N0Y A;  2E6W A;  3BFH A;  2WCM A;  1BU3 A;  3EKH A;  4PT1 A;  1SMG A;  2OS8 B;  3OP0 A;  1NIW A;  1PVA A;  2AUC A;  5HKY A;  1S3P A;  1FBV A;  1F4Q A;  1YRU B;  1ZFS A;  2Y5I A;  4ETO A;  1F8H A;  2AAO A;  4AQJ A;  3FS7 A;  4GGN A;  4I5L B;  2L0P A;  3SS5 A;  4PDZ A;  1BF5 A;  1K93 D;  1KK7 Y;  1OOG A;  1TOP A;  3EVU A;  3JTD C;  1QWV A;  4C0K A;  3I5F C;  2PVB A;  1TWO A;  3AKA A;  1DJZ A;  1GM0 A;  1PSR A;  3CTN A;  3D77 A;  2KPH A;  2KFG A;  3VRP A;  5G08 A;  4BY4 A;  1WRK A;  3O4X A;  3SG6 A;  1TNP A;  1LIN A;  3C1V A;  2H2K A;  2Y1M A;  1B9A A;  2LUC A;  3WHT B;  1J1E A;  4FTG A;  1J7P A;  1QX7 A;  3OB1 B;  1YVL A;  1C7W A;  3OX5 A;  5F6T A;  1UHI A;  3AKB A;  4UPG A;  1NP8 A;  2NZ0 A;  2PYQ A;  2Q4U A;  4HRH A;  2KI4 B;  1AK8 A;  1SR6 B;  3S0G A;  3I5I C;  5DIC A;  1QV1 A;  5JOL A;  4CFQ A;  1CFF A;  3UO9 A;  1QXP A;  4AOM A;  5AFP A;  2QEV A;  1UHN A;  3TZ1 A;  2CT9 A;  3CZ0 A;  1A29 A;  1K9K A;  2PMY A;  1L2O B;  1OZS A;  4NQG A;  3D0Y A;  1HQV A;  2JUL A;  2SCP A;  3M0W A;  2KI6 D;  3NSL A;  1K8U A;  4PE7 A;  1EXR A;  4C0J A;  3H4S E;  1J1D A;  1MUX A;  1N2D A;  2BBM A;  1S5G Z;  4PAL A;  1KQM B;  1K94 A;  1VRK A;  4PHM A;  3Q8I A;  3SG3 A;  4M2Q A;  1KSM A;  1XFX O;  4XJK B;  1QX2 A;  1B8C A;  4A4C A;  3TUY C;  2WOS A;  4PCW A;  1J7Q A;  1JWD A;  1RRO A;  5ER4 X;  3SIB A;  1OZO A;  2GGZ A;  2KBM A;  2CXJ A;  2G9B A;  3DXL A;  4QJ4 B;  1PUL A;  5HL1 A;  1WRZ A;  1PAL A;  1M31 A;  1ZUZ A;  3GOF A;  1XFR A;  2EC6 C;  1EG3 A;  3CZ2 A;  1QAS A;  3EVR A;  3QRX A;  2L4H A;  3FE6 A;  5ER5 A;  1S1E A;  1TNX A;  1DEL A;  3KEV A;  1NUB A;  3BUW B;  4YI9 A;  1KSO A;  1KK7 Z;  4USL A;  3SJS A;  2GTE A;  2L5Y A;  1S6C A;  1NWD A;  4MZK A;  2BE4 A;  2JT0 A;  2WCJ A;  3PFV A;  4PHJ A;  1NX2 A;  1DJG A;  4MZL A;  2WCF A;  5HLO A;  3BFB A;  5CSF A;  4PHK A;  1QJT A;  4YGD B;  1XA5 A;  2CBL A;  5CPV A;  4F0Z B;  4QJ3 B;  1QLS A;  1J55 A;  2JU0 A;  1ALW A;  5KU1 A;  3FWC A;  2PAS A;  4YGE B;  1OMD A;  4ZCU A;  1YTZ C;  3PAL A;  3CDN A;  3R1O A;  2V53 A;  1CFD A;  2EGD A;  1M45 A;  2PSR A;  1IQ5 A;  2ZRT A;  3A8R A;  2RGI A;  4JKT A;  1IJ5 A;  1SCV A;  3S0B A;  2WND A;  1KQV A;  1SPY A;  1C3Z A;  1M63 B;  2JZI A;  4IJ7 A;  3ZWH A;  3R1P A;  4CID A;  1SSE B;  2BCX A;  4TNC A;  3AAK A;  4A4B A;  4N1G A;  2BCB A;  1AVS A;  1V1G A;  1TCF A;  1XFV O;  2MLE C;  1G4Y R;  4DIR A;  1CLM A;  3KPX A;  4OVN F;  3VRQ A;  3CGA A;  2F8P A;  4YGC B;  1UHJ A;  1SRA A;  4DUQ A;  1SBJ A;  4M2O A;  3SG7 A;  1U5I B;  2MAZ A;  3CAB A;  1TCO B;  1CNP A;  3I5H B;  1DJI A;  3R1V A;  1H8B A;  1S5G Y;  3CR4 X;  4MSP A;  2M7L A;  1WDC C;  1KWO B;  3KHE A;  3PAT A;  2NXQ A;  4E68 A;  2CNP A;  2JXL A;  1ZOT B;  4OZD A;  4R1E A;  3DVM A;  2LAN A;  2Q91 A;  1CDN A;  3BQ3 A;  2OTG B;  4HSZ A;  1H4B A;  1FI5 A;  3DF0 B;  3EK8 A;  1FW4 A;  1OW4 A;  3D78 A;  4MZJ A;  3DZT A;  1DJX A;  2P6B B;  2QAC A;  2O5G A;  3D10 A;  3K21 A;  3ZNI A;  1NSH A;  4I5J A;  1XK4 A;  2BAP A;  3S0A A;  1DC1 A;  2COL B;  1CMF A;  3NSI A;  3BUX B;  1JF0 A;  2I94 A;  3S0D A;  1IWQ A;  2JXC A;  1SCM C;  2L5X B;  3PN7 C;  5FI2 A;  1K96 A;  1WY9 A;  2L50 A;  1DF0 B;  1TTX A;  3NSK A;  2PRU A;  1C7V A;  4YGA A;  3CLN A;  5HLV A;  4I5N B;  2PQL A;  2ZNE A;  1DMO A;  1JC2 A;  2FCD A;  2I18 A;  2BL0 B;  2QEO A;  1C07 A;  1PK0 D;  1UUR A;  2TN4 A;  4N5X A;  4P5O E;  2KQY A;  1R2U A;  2M1K B;  1KK8 C;  1GJY A;  2L4I A;  3L47 A;  3WHU B;  3DVE A;  2LVV A;  1BR4 B;  1TUZ A;  1SKT A;  3IQO A;  1ODB A;  1LA3 A;  1DVI A;  2LHL A;  2WOR A;  4ORA B;  1NCY A;  3CYZ A;  3BUM B;  2JPO A;  3I5G B;  1CB1 A;  1K9U A;  3NHT A;  1BLQ A;  4MEW A;  3CS1 A;  1CLL A;  1X02 A;  3DY9 A;  4JQ0 D;  2K60 A;  2WCK A;  4YGB B;  5I2O A;  2LP2 A;  2LC5 A;  2M7N A;  1UHH A;  2K0J A;  2EHB A;  3OB2 B;  5K89 A;  1G33 A;  2CCM A;  2KOT A;  4F7F A;  1LA0 A;  3DVK A;  4FQO A;  4D1E A;  1JFK A;  1EL4 A;  1DJH A;  4ICB A;  3K1E A;  2B1U A;  2FJU B;  2AMI A;  1ZMZ A;  2F2P A;  2MBX A;  2F2O A;  3VB1 A;  1D1O A;  2O60 A;  1MHO A;  3GK1 A;  1BOC A;  3QME A;  5D3O A;  1CDL A;  1Y1A A;  2WC6 A;  1F70 A;  5GQQ C;  2GV5 A;  1M39 A;  2ISD A;  2Y1N A;  1Z2C B;  4YRU A;  1WLM A;  3PSR A;  4P2Y B;  5IBW A;  2WC5 A;  1DEK A;  1CM4 A;  4XJK A;  1PVB A;  4MN0 A;  5HKW A;  1TRF A;  2M1U A;  4DRW A;  1XK4 C;  4NDC A;  3FIA A;  3DVJ A;  2OS8 C;  3IQQ A;  4MLW A;  4ZCV A;  1A03 A;  2KYF A;  5JJG A;  2WCL A;  1B8R A;  1F4O A;  1KFU S;  1A75 B;  2GGM A;  2JNF A;  3FE9 A;  1QVI Y;  1IH0 A;  3D75 A;  2F33 A;  2D8N A;  3SG5 A;  3TDZ A;  2QDI A;  1IQ3 A;  3BYA A;  2LLS A;  2BCA A;  1YUS A;  2M29 A;  5KSZ A;  1MF8 B;  1QIW A;  3R72 A;  1SL7 A;  3JVT C;  3O4Y A;  1PSB A;  1FPW A;  1IIO A;  5DKQ A;  1BMO A;  4JD9 A;  4KYN A;  2M8U A;  2QPT A;  3RLZ A;  1BJF A;  4Q04 A;  1KCY A;  1YRT B;  3RZS A;  1DTL A;  3GK4 X;  1CTR A;  2BBN A;  3BXK A;  3S0F A;  1OOI X;  2MA2 A;  4N1F A;  1M46 A;  2JRF A;  4C0L A;  1IRJ A;  4CPV A;  1MXE A;  1XFW O;  2MLF C;  4ORC B;  3VGO A;  1Z4H A;  4MVF A;  1QAT A;  5I2L A;  1UHK A;  3DYE A;  1DGV A;  4YBH B;  2M97 A;  5HYD A;  2KI4 C;  3BOW B;  1QIV A;  1SR6 C;  4QJ5 B;  4NDB A;  1CMG A;  2M0R A;  1UP5 A;  1Y1X A;  2A4J A;  2SAS A;  4HRE E;  1L2O C;  1BR1 B;  1AJ5 A;  3CR2 A;  1ALV A;  1B47 A;  2LLU A;  3OX6 A;  5PAL A;  1OQP A;  3SS3 A;  1CDM A;  1WLZ A;  3V2L A;  3JTD B;  1GGZ A;  1OMV A;  2PAL A;  3I5F B;  2LE9 B;  3MSE B;  1W7J B;  4PE0 A;  4ORB B;  2FCE A;  1RWY A;  1TIZ A;  2BEC A;  2K7B A;  2LCP A;  1J7O A;  1S36 A;  1YR5 A;  1W7I B;  3CZT X;  5DKN A;  1FF1 A;  1L7Z A;  3L4A A;  5AAN A;  1F71 A;  1U5I A;  3WXA A;  3L4L A;  1NX1 A;  1FI6 A;  1JSA A;  1NCX A;  1Y6W A;  1YVH A;  3E3R A;  4GGF A;  1RK9 A;  1F54 A;  2HF5 A;  3B86 A;  5AEQ A;  4CFR A;  2YGU A;  1QS7 A;  3TDU A;  2M3W A;  1UWO A;  1OE9 B;  2K7C A;  1QVI Z;  2ZFD A;  3N7H A;  3DF0 A;  1K95 A;  1SK6 D;  3I5I B;  2H8V A;  2HQ8 A;  1B7T Y;  1TUJ A;  2KGR A;  1XYD A;  3UNW A;  1CM1 A;  1LKJ A;  2JOJ A;  2LUX A;  5I2Q A;  2BKI B;  3AAJ A;  1DGU A;  3KO0 A;  2MRD A;  1S26 D;  1B8L A;  1QV0 A;  2P70 A;  2F3Z A;  2KHN A;  3FWB A;  2JT8 A;  4JWQ A;  1RTP 1;  5CSJ A;  1WRL A;  3TDI A;  3TS5 C;  1DF0 A;  2K8M B;  3BUO B;  5I8N A;  5TNC A;  1EG4 A;  1IKU A;  1XFZ O;  3PJI A;  2LM5 A;  4OV2 A;  4WQ3 A;  2WCH A;  2WCB A;  1Q80 A;  3TUY B;  1JUO A;  1CFC A;  1XO5 A;  1OMR A;  1K90 D;  2LVJ A;  3HCM A;  1ORG A;  5EL2 A;  3CR5 X;  1W9Z A;  2JQ6 A;  3EKJ A;  5DKR A;  1NCZ A;  2KFH A;  2KLE A;  2KAX A;  3SS4 A;  4OR9 B;  3LK0 A;  1YUT A;  2WCE A;  2BKH B;  3GK2 A;  2HPS A;  2BNX A;  1E8A A;  3D76 A;  4GNK B;  2EC6 B;  1A4P A;  3NGV A;  1BT6 A;  5HKZ A;  5AER A;  2LVK A;  4IL1 A;  3EG5 B;  1EH2 A;  1IJ6 A;  2KLD A;  3O78 A;  2LAP A;  2NCP A;  1TNW A;  1YX7 A;  1AJ4 A;  3DD4 A;  2MJW B;  2R2I A;  3A4U B;  3JVT B;  1QX5 B;  1ZAC A;  2K61 A;  3LL8 B;  1C3Y A;  2G2B A;  1CLB A;  1A2X A;  4BY5 A;  4GUK A;  3S0E A;  3LLE A;  4YI8 A;  2VRG A;  2LMT A;  2LV7 A;  3ICB A;  4FQT A;  1YUU A;  2FOT A;  2KSP A;  3CWG A;  3I5H C;  4MRX A;  1DQE A;  4GGF C;  1LXF C;  4HRG A;  4GPL B;  3BUN B;  1B4C A;  2HQW A;  1KWO C;  2H61 A;  4I5K A;  2I2R E;  5KTY A;  1TN4 A;  4OCI A;  3RM1 A;  4M2P A;  1CKK A;  2JT3 A;  2LP3 A;  2LNK A;  1K9P A;  1Y0V H;  1XFU O;  2K7D A;  2OTG C;  1SY9 A;  1MR8 A;  1MWN A;  2QEH A;  4PE4 A;  2L2C A;  3D73 A;  2NLN A;  3SG2 A;  5FI6 A;  2KYC A;  5D69 A;  2HET A;  5BPJ A;  2KFF A;  1B7T Z;  4GFT A;  3NXA A;  4AQI A;  1K2H A;  1SL8 A;  1XFY O;  3D0Y B;  3SIA A;  2KAY A;  3VRN A;  3B87 A;  1AHR A;  2L51 A;  4JPZ B;  5J3X A;  1A75 A;  2BE6 A;  3F45 A;  1UUS A;  2F3Y A;  1JBA A;  1DJW A;  3VRO A;  2KGB C;  1HT9 A;  2M9G A;  1OOH A;  1CDP A;  3SG4 A;  1NX0 A;  2ZRS A;  1JFJ A;  3LK1 A;  3BFA A;  5FYX A;  1RJV A;  2WC8 A;  2BL0 C;  2LLT A;  3CZ1 A; 
#chains in the Genus database with same CATH homology
 2I7A A;  2JWW A;  2OPO A;  3OHM B;  4OKH A;  4PHN A;  1YUR A;  2ZKM X;  1GGW A;  1J7R A;  3PM8 A;  4GAO A;  2NCO A;  4GBA A;  1JF2 A;  1IG5 A;  3I5G C;  1CFP A;  1WDC B;  1GQM A;  2L2E A;  4WQ2 A;  2K2F A;  3WNX B;  2KDH A;  1REC A;  2JTZ A;  1V1F A;  2JPT A;  1NX3 A;  1R6P A;  1BOD A;  2JC2 A;  3PLF B;  1N65 A;  3BOW A;  4WRI A;  3IF7 A;  1XVJ A;  1KFU L;  3NSO A;  1LVC D;  1SCM B;  3PN7 B;  1AUI B;  1QTX A;  4MRY A;  3EK4 A;  1QLK A;  4DCK A;  1KFX S;  3TS5 B;  5CSN A;  1RFJ A;  1YX8 A;  4U8D A;  2H61 C;  2K2A A;  2KAV A;  5CSI A;  3O6B A;  3KF9 A;  1DT7 B;  1EJ3 A;  2JTT A;  3O2P A;  1KQM C;  2JNX A;  1NYA A;  1SNL A;  1TNQ A;  3HX4 A;  1KK8 B;  2KQ6 A;  4CLN A;  3EVV A;  2ZN9 A;  2LMU A;  5D7F A;  4MBE A;  3EK7 A;  1OOJ A;  4DS7 A;  2ZND A;  1AP4 A;  1F55 A;  1B1G A;  1Y1U A;  4PE1 A;  2Y4Q A;  2KI6 C;  4NDD A;  2ZN8 A;  2E30 A;  1MQ1 A;  1PRW A;  1OSA A;  2CTN A;  2IS9 A;  2K7O A;  5B8I B;  1SL9 A;  1MXL C;  2LHI A;  5AXI A;  2MHH A;  1S6I A;  3LCP C;  2DOQ A;  1IGV A;  2KBI A;  1KFX L;  1NPQ A;  2LMV A;  1DJY A;  2KNE A;  4L9M A;  1SW8 A;  1SYM A;  2L98 A;  1G8I A;  1S6J A;  3VRR A;  4XYN A;  1BG1 A;  2LVI A;  2M49 B;  1N0Y A;  2E6W A;  1BU3 A;  3EKH A;  1SMG A;  2OS8 B;  3OP0 A;  1NIW A;  1PVA A;  2AUC A;  5HKY A;  1S3P A;  1FBV A;  1F4Q A;  1YRU B;  1ZFS A;  2Y5I A;  4ETO A;  1F8H A;  2AAO A;  4AQJ A;  3FS7 A;  4GGN A;  4I5L B;  2L0P A;  4PDZ A;  1BF5 A;  1K93 D;  1KK7 Y;  1TOP A;  3EVU A;  3JTD C;  4C0K A;  3I5F C;  2PVB A;  3AKA A;  1DJZ A;  1PSR A;  3CTN A;  3VRP A;  2KFG A;  5G08 A;  4BY4 A;  1WRK A;  3SG6 A;  1TNP A;  1LIN A;  3C1V A;  2H2K A;  2Y1M A;  1B9A A;  2LUC A;  3WHT B;  1J1E A;  4FTG A;  1J7P A;  1QX7 A;  3OB1 B;  1YVL A;  1C7W A;  3OX5 A;  5F6T A;  1UHI A;  3AKB A;  4UPG A;  1NP8 A;  2NZ0 A;  2Q4U A;  4HRH A;  1AK8 A;  2KI4 B;  1SR6 B;  3I5I C;  5JOL A;  1QV1 A;  4CFQ A;  1CFF A;  1QXP A;  4AOM A;  5AFP A;  3TZ1 A;  1UHN A;  2CT9 A;  1A29 A;  1K9K A;  2PMY A;  1L2O B;  1OZS A;  4NQG A;  3D0Y A;  1HQV A;  2JUL A;  2SCP A;  3M0W A;  2KI6 D;  3NSL A;  1K8U A;  4PE7 A;  1EXR A;  4C0J A;  3H4S E;  1J1D A;  1MUX A;  1N2D A;  2BBM A;  1S5G Z;  4PAL A;  1KQM B;  1K94 A;  1VRK A;  4PHM A;  3SG3 A;  4M2Q A;  1KSM A;  1XFX O;  4XJK B;  1QX2 A;  1B8C A;  4A4C A;  3TUY C;  2WOS A;  4PCW A;  1J7Q A;  1JWD A;  1RRO A;  5ER4 X;  3SIB A;  1OZO A;  2GGZ A;  2KBM A;  2CXJ A;  2G9B A;  4QJ4 B;  1PUL A;  1WRZ A;  1PAL A;  1M31 A;  1ZUZ A;  3GOF A;  2EC6 C;  1EG3 A;  1QAS A;  3EVR A;  3QRX A;  2L4H A;  5ER5 A;  1S1E A;  1TNX A;  3KEV A;  1NUB A;  3BUW B;  4YI9 A;  1KSO A;  1KK7 Z;  4USL A;  3SJS A;  1S6C A;  1NWD A;  4MZK A;  2BE4 A;  2JT0 A;  3PFV A;  4PHJ A;  1NX2 A;  1DJG A;  4MZL A;  2WCF A;  5HLO A;  5CSF A;  4PHK A;  1QJT A;  4YGD B;  1XA5 A;  2CBL A;  5CPV A;  4F0Z B;  4QJ3 B;  1QLS A;  1J55 A;  2JU0 A;  1ALW A;  5KU1 A;  3FWC A;  2PAS A;  4YGE B;  1OMD A;  4ZCU A;  1YTZ C;  3PAL A;  2V53 A;  1CFD A;  2EGD A;  1M45 A;  2PSR A;  1IQ5 A;  2ZRT A;  3A8R A;  2RGI A;  1IJ5 A;  1SCV A;  2WND A;  1KQV A;  1SPY A;  1M63 B;  2JZI A;  3ZWH A;  4CID A;  2BCX A;  4TNC A;  3AAK A;  4A4B A;  4N1G A;  2BCB A;  1AVS A;  1V1G A;  1TCF A;  1XFV O;  2MLE C;  1G4Y R;  4DIR A;  1CLM A;  3KPX A;  4OVN F;  3VRQ A;  3CGA A;  2F8P A;  4YGC B;  1UHJ A;  1SRA A;  4DUQ A;  1SBJ A;  4M2O A;  3SG7 A;  1U5I B;  2MAZ A;  1CNP A;  1TCO B;  3I5H B;  1DJI A;  1H8B A;  1S5G Y;  3CR4 X;  4MSP A;  2M7L A;  1WDC C;  1KWO B;  3KHE A;  3PAT A;  2NXQ A;  4E68 A;  2CNP A;  2JXL A;  1ZOT B;  4R1E A;  3DVM A;  2LAN A;  2Q91 A;  1CDN A;  3BQ3 A;  2OTG B;  4HSZ A;  1H4B A;  1FI5 A;  3DF0 B;  3EK8 A;  1FW4 A;  4MZJ A;  1DJX A;  2P6B B;  2QAC A;  2O5G A;  3D10 A;  3K21 A;  3ZNI A;  1NSH A;  4I5J A;  1XK4 A;  2COL B;  1CMF A;  3NSI A;  3BUX B;  1JF0 A;  2I94 A;  1IWQ A;  2JXC A;  1SCM C;  2L5X B;  3PN7 C;  1K96 A;  1WY9 A;  2L50 A;  1DF0 B;  1TTX A;  3NSK A;  2PRU A;  1C7V A;  4YGA A;  3CLN A;  5HLV A;  4I5N B;  2ZNE A;  1DMO A;  1JC2 A;  2FCD A;  2I18 A;  2BL0 B;  1C07 A;  1PK0 D;  1UUR A;  2TN4 A;  4N5X A;  4P5O E;  2KQY A;  1R2U A;  2M1K B;  1KK8 C;  1GJY A;  2L4I A;  3WHU B;  3DVE A;  2LVV A;  1BR4 B;  1SKT A;  3IQO A;  1ODB A;  1LA3 A;  1DVI A;  2LHL A;  2WOR A;  4ORA B;  1NCY A;  3I5G B;  3BUM B;  1CB1 A;  1K9U A;  1BLQ A;  4MEW A;  3CS1 A;  1CLL A;  1X02 A;  4JQ0 D;  5I2O A;  4YGB B;  2LP2 A;  2LC5 A;  2M7N A;  1UHH A;  2K0J A;  2EHB A;  3OB2 B;  5K89 A;  1G33 A;  2CCM A;  2KOT A;  1LA0 A;  3DVK A;  4FQO A;  4D1E A;  1JFK A;  1EL4 A;  1DJH A;  4ICB A;  2B1U A;  2FJU B;  2AMI A;  1ZMZ A;  2F2P A;  2MBX A;  2F2O A;  1D1O A;  2O60 A;  1MHO A;  3GK1 A;  1BOC A;  1CDL A;  1Y1A A;  1F70 A;  5GQQ C;  2GV5 A;  1M39 A;  2ISD A;  2Y1N A;  4YRU A;  1WLM A;  3PSR A;  4P2Y B;  5IBW A;  4XJK A;  1CM4 A;  1PVB A;  4MN0 A;  5HKW A;  1TRF A;  2M1U A;  4DRW A;  1XK4 C;  4NDC A;  3FIA A;  3DVJ A;  2OS8 C;  3IQQ A;  4MLW A;  4ZCV A;  1A03 A;  2KYF A;  5JJG A;  1B8R A;  1F4O A;  1KFU S;  1A75 B;  2GGM A;  2JNF A;  1IH0 A;  1QVI Y;  2F33 A;  2D8N A;  3SG5 A;  3TDZ A;  1IQ3 A;  3BYA A;  2LLS A;  2BCA A;  1YUS A;  2M29 A;  5KSZ A;  1MF8 B;  1QIW A;  1SL7 A;  3JVT C;  3O4Y A;  1PSB A;  1FPW A;  5DKQ A;  1BMO A;  2M8U A;  2QPT A;  3RLZ A;  1BJF A;  4Q04 A;  1KCY A;  1YRT B;  1DTL A;  3GK4 X;  1CTR A;  2BBN A;  3BXK A;  2MA2 A;  4N1F A;  1M46 A;  2JRF A;  4C0L A;  1IRJ A;  4CPV A;  1MXE A;  1XFW O;  2MLF C;  4ORC B;  3VGO A;  4MVF A;  1QAT A;  5I2L A;  1UHK A;  1DGV A;  4YBH B;  2M97 A;  5HYD A;  2KI4 C;  3BOW B;  1QIV A;  1SR6 C;  4QJ5 B;  4NDB A;  1CMG A;  2M0R A;  1UP5 A;  1Y1X A;  2A4J A;  2SAS A;  4HRE E;  1L2O C;  1BR1 B;  1AJ5 A;  3CR2 A;  1ALV A;  1B47 A;  2LLU A;  3OX6 A;  5PAL A;  1OQP A;  1CDM A;  1WLZ A;  3JTD B;  1GGZ A;  1OMV A;  2PAL A;  3I5F B;  2LE9 B;  3MSE B;  1W7J B;  4PE0 A;  4ORB B;  2FCE A;  1RWY A;  1TIZ A;  2BEC A;  2K7B A;  2LCP A;  1J7O A;  1S36 A;  1YR5 A;  1W7I B;  3CZT X;  5DKN A;  1FF1 A;  1L7Z A;  5AAN A;  1F71 A;  1U5I A;  3WXA A;  1NX1 A;  1FI6 A;  1JSA A;  1NCX A;  1Y6W A;  1YVH A;  3E3R A;  4GGF A;  1RK9 A;  1F54 A;  2HF5 A;  5AEQ A;  4CFR A;  1QS7 A;  3TDU A;  2M3W A;  1UWO A;  1OE9 B;  2K7C A;  1QVI Z;  2ZFD A;  3DF0 A;  1K95 A;  1SK6 D;  3I5I B;  2HQ8 A;  1B7T Y;  2KGR A;  1XYD A;  1CM1 A;  1LKJ A;  2JOJ A;  2LUX A;  5I2Q A;  2BKI B;  3AAJ A;  1DGU A;  3KO0 A;  2MRD A;  1S26 D;  1B8L A;  1QV0 A;  2F3Z A;  2KHN A;  3FWB A;  2JT8 A;  4JWQ A;  1RTP 1;  5CSJ A;  1WRL A;  3TDI A;  3TS5 C;  1DF0 A;  2K8M B;  3BUO B;  5I8N A;  5TNC A;  1EG4 A;  1IKU A;  1XFZ O;  2LM5 A;  4OV2 A;  4WQ3 A;  2WCB A;  1Q80 A;  3TUY B;  1JUO A;  1CFC A;  1XO5 A;  1OMR A;  1K90 D;  2LVJ A;  3HCM A;  3CR5 X;  3EKJ A;  2JQ6 A;  5DKR A;  1NCZ A;  2KFH A;  2KAX A;  4OR9 B;  3LK0 A;  1YUT A;  2WCE A;  2BKH B;  3GK2 A;  2HPS A;  1E8A A;  4GNK B;  2EC6 B;  1A4P A;  5HKZ A;  1BT6 A;  5AER A;  2LVK A;  4IL1 A;  1EH2 A;  1IJ6 A;  3O78 A;  2LAP A;  2NCP A;  1TNW A;  1YX7 A;  1AJ4 A;  3DD4 A;  2MJW B;  2R2I A;  3A4U B;  3JVT B;  1QX5 B;  1ZAC A;  2K61 A;  3LL8 B;  1CLB A;  2G2B A;  1A2X A;  4BY5 A;  4GUK A;  3LLE A;  4YI8 A;  2VRG A;  2LMT A;  2LV7 A;  3ICB A;  1YUU A;  2FOT A;  2KSP A;  3CWG A;  3I5H C;  4MRX A;  4GGF C;  1LXF C;  4HRG A;  4GPL B;  3BUN B;  1B4C A;  2HQW A;  1KWO C;  2H61 A;  4I5K A;  2I2R E;  5KTY A;  1TN4 A;  4OCI A;  3RM1 A;  4M2P A;  1CKK A;  2JT3 A;  2LP3 A;  2LNK A;  1K9P A;  1Y0V H;  1XFU O;  2K7D A;  2OTG C;  1SY9 A;  1MR8 A;  1MWN A;  4PE4 A;  2NLN A;  3SG2 A;  2KYC A;  5D69 A;  2HET A;  5BPJ A;  2KFF A;  1B7T Z;  4GFT A;  3NXA A;  4AQI A;  1K2H A;  1SL8 A;  1XFY O;  3D0Y B;  3SIA A;  2KAY A;  3VRN A;  1AHR A;  2L51 A;  4JPZ B;  5J3X A;  1A75 A;  2BE6 A;  3F45 A;  1UUS A;  2F3Y A;  1JBA A;  1DJW A;  3VRO A;  2KGB C;  1HT9 A;  2M9G A;  3SG4 A;  1CDP A;  1NX0 A;  2ZRS A;  1JFJ A;  3LK1 A;  5FYX A;  1RJV A;  2WC8 A;  2BL0 C;  2LLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...