2I94A

Nmr structure of recoverin bound to rhodopsin kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
182
Chain Sequence
b'ALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title Structural Basis for Calcium-induced Inhibition of Rhodopsin Kinase by Recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein binding
total genus 45
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2i94A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2i94A01
1L2OC 3IQOA 1AJ4A 3FS7A 5AFPA 1IWQA 2F33A 1AUIB 3VRRA 1VRKA 1F71A 2EGDA 1YVLA 1DTLA 1BODA 2VRGA 1BOCA 1B7TZ 2LHIA 1JFJA 1DJGA 1Y1AA 3NXAA 3EKHA 2D8NA 2MA2A 4XJKA 2NCPA 1EXRA 1A2XA 1S6JA 1WRLA 1YTZC 3CWGA 3LL8B 4YGEB 3RLZA 2I18A 3ZNIA 1BLQA 1OOJA 4PE1A 1K94A 2LVKA 3O2PA 3CLNA 1KSOA 2WORA 3M0WA 1WDCC 1TNQA 1K9UA 1WY9A 4JQ0D 2MBXA 2M97A 1CFPA 1NCYA 2BL0C 1KFUL 1B8CA 1NIWA 1FBVA 2O5GA 2BKHB 5KU1A 4UPGA 1L2OB 1M63B 1MR8A 4C0LA 2NXQA 1A4PA 2IS9A 4MEWA 3SG3A 2LC5A 1QX5B 2ZN8A 3NSIA 3TZ1A 1PVBA 2JULA 1ODBA 1BMOA 2F2PA 1UWOA 1ZUZA 1NX2A 1C7VA 1TIZA 2Y4QA 1LXFC 4MRYA 3SG7A 1C07A 1TOPA 1G33A 1SK6D 1N65A 4GUKA 3SIBA 1DJWA 4YGDB 1XVJA 2FCDA 3KF9A 1XFWO 3EK4A 2KYFA 1A29A 4ETOA 2Y1NA 5HKWA 1LKJA 3OB1B 1EH2A 3DVMA 1DJIA 2O60A 3BUWB 3PALA 1AVSA 1L7ZA 4BY4A 3MSEB 1QIWA 4ORBB 3KHEA 2BL0B 1TNPA 4YGCB 1KWOC 1QJTA 4GGNA 3TUYC 3PM8A 4CFQA 2WC8A 1KSMA 4PALA 3CZTX 1FPWA 1NX3A 2LUXA 3KPXA 3OB2B 2Y5IA 1J7OA 2BBMA 2ZNDA 4DS7A 1A03A 3SG2A 1A75A 1JBAA 1EG4A 1RFJA 2F3ZA 4GFTA 1DF0A 1QASA 2WOSA 1KQVA 4MZJA 2H61A 2ZKMX 4WRIA 2AAOA 1H8BA 2KNEA 3AKBA 2SCPA 1KK7Z 1Y1UA 2F3YA 2LAPA 2L51A 2LE9B 1JUOA 2NZ0A 1OSAA 2LLUA 2Q91A 4GGFC 2M3WA 1DF0B 2K2AA 2LUCA 1ALVA 1TTXA 1NP8A 4PHMA 5I8NA 1OQPA 2KFFA 3CR4X 1OMRA 2I94A 1QLKA 1S36A 2EC6C 4JPZB 4HRGA 3TUYB 1LA0A 1MWNA 1RTP1 1QVIZ 3NSLA 1CTRA 1NX1A 4E68A 1KCYA 1F4QA 1IJ5A 1DJYA 4TNCA 2KFGA 4OV2A 3I5GC 1RK9A 4M2PA 2ZRTA 3ZWHA 1KFXS 1R2UA 2LVJA 1UHJA 1Y0VH 2FOTA 4MLWA 3D0YB 5DKRA 4Q04A 1U5IA 2CT9A 1W7IB 1BG1A 1EG3A 1KFXL 1M39A 4P2YB 1QX2A 3VGOA 2V53A 4C0JA 2CTNA 1NYAA 3BUOB 2I7AA 4GNKB 2JT8A 3PSRA 1HQVA 1PK0D 1S5GZ 1YUTA 1K8UA 2GV5A 3AAJA 1IRJA 1QV1A 2BE4A 2G2BA 2KBIA 1SW8A 2KFHA 1KK8C 4MZLA 2HPSA 5AERA 2BE6A 3I5FC 3SJSA 1W7JB 2EHBA 2JWWA 2LANA 2LHLA 3D10A 3I5HC 4I5KA 4N5XA 1YURA 1SNLA 2ZNEA 4OKHA 2M7NA 2PALA 2SASA 2KDHA 1MQ1A 2PRUA 1SKTA 1PSRA 3I5GB 1J7PA 1B7TY 2GGMA 2JQ6A 2P6BB 2R2IA 4PE0A 2L4HA 1CFFA 1CM1A 3SIAA 4YBHB 5JJGA 3LK0A 2KGRA 3HCMA 3DVJA 4U8DA 1FI5A 1CM4A 2KAYA 1QLSA 2E6WA 5J3XA 1PULA 1PRWA 2MRDA 1V1FA 1ZMZA 3NSOA 2LNKA 5HKZA 5AEQA 2KQYA 1Y6WA 1KK8B 5KSZA 2JTTA 5GQQC 3PATA 1CDLA 2HQ8A 1BF5A 3E3RA 3I5FB 1J1DA 1UHKA 1BU3A 3I5HB 3DF0B 5D69A 1RWYA 1D1OA 1PVAA 3BUXB 4ORAB 2K7BA 2M8UA 1XO5A 4L9MA 1XYDA 5HLVA 2HQWA 2PSRA 1JF0A 2NCOA 2A4JA 3SG5A 2M0RA 1PALA 1IQ5A 2KOTA 1CDPA 1YR5A 1OZOA 4AOMA 3O4YA 1DJHA 1SBJA 3O78A 1UHNA 2L5XB 1PSBA 4MRXA 1J7RA 1YVHA 2JXLA 1WRZA 1SYMA 2BECA 3NSKA 4DIRA 4DUQA 2JTZA 3EK7A 4MBEA 2M9GA 3BXKA 1MHOA 4FQOA 4M2QA 1G8IA 1H4BA 5HLOA 2HETA 1S26D 2JZIA 2GGZA 5IBWA 4PE7A 1S1EA 5ER5A 5ER4X 5F6TA 1SL8A 3A8RA 4DRWA 1CB1A 1IG5A 5AANA 4AQIA 4PCWA 5DKNA 4PE4A 2WCBA 4IL1A 1NUBA 3CGAA 1MXEA 1CKKA 3GOFA 5CPVA 3EVRA 2JXCA 2B1UA 1M46A 1KK7Y 2FJUB 1QIVA 1XFYO 2JU0A 2K2FA 2TN4A 4A4CA 2Y1MA 4PDZA 1SL9A 1F4OA 2KYCA 1UUSA 3AKAA 4JWQA 3TS5C 4CLNA 2K7CA 5I2LA 5G08A 2M7LA 1RECA 4XYNA 3WXAA 3CTNA 1QVIY 2G9BA 2CBLA 2KAVA 1NCZA 1LVCD 1AK8A 1S3PA 1V1GA 4CFRA 3OX5A 2M49B 2JT0A 3EKJA 3D0YA 1HT9A 5JOLA 1UHHA 3CS1A 1XK4C 2LMVA 2BCXA 2LLSA 2NLNA 4YI9A 1FI6A 1EJ3A 4FTGA 3VRNA 4GPLB 1UHIA 3SG6A 2KI6C 3JVTC 1B4CA 2LP2A 4NQGA 1LA3A 2KSPA 3PFVA 1S5GY 2PVBA 2LM5A 2KI6D 1YUUA 1CNPA 1JFKA 1F8HA 1IGVA 2AMIA 1S6CA 2LV7A 1NCXA 2PASA 4GGFA 2AUCA 1B8LA 1RJVA 3BUMB 3K21A 5CSNA 2RGIA 2QACA 3FWBA 3IQQA 1SR6B 4YI8A 1XFXO 3TS5B 1K90D 3EVVA 3PLFB 1TNWA 4C0KA 2HF5A 3BQ3A 1SY9A 1OMVA 2K7DA 1KQMC 2K7OA 3DD4A 1RROA 4YRUA 3BUNB 2KAXA 2OPOA 3TDUA 5I2OA 1YX8A 1AJ5A 3BYAA 3FWCA 1B8RA 2KGBC 3JVTB 4OR9B 5DKQA 1YUSA 1DVIA 4ORCB 1MF8B 2JNXA 1E8AA 1ZOTB 4GAOA 1XFUO 3LCPC 2CCMA 5BPJA 3TDZA 4YGAA 4N1FA 1NSHA 2LVIA 3DF0A 1ZFSA 2BCAA 1FW4A 1Q80A 1OMDA 1R6PA 2KBMA 4NDCA 3EVUA 4MVFA 1KQMB 3HX4A 2M1KB 1J7QA 4OVNF 1IQ3A 1C7WA 4ZCUA 1SCVA 2L2EA 4WQ2A 1DT7B 1BR1B 3CR2A 3DVEA 1ZACA 3KO0A 3WHTB 2MHHA 3BOWB 4HRHA 1SRAA 1B47A 5KTYA 2DOQA 2OS8C 1J55A 4OCIA 2K0JA 5CSFA 2WCEA 3JTDC 2OTGC 4PHKA 1DGVA 1GGWA 1OE9B 1QATA 1UP5A 2QPTA 3OHMB 2CXJA 2L4IA 3I5IC 4A4BA 3A4UB 1UURA 3AAKA 2KI4C 1TNXA 5PALA 1GQMA 1K96A 1MUXA 5HKYA 1KFUS 1N2DA 1JWDA 4MZKA 4XJKB 1OZSA 1K93D 1K95A 3GK2A 3VRPA 2KQ6A 2WNDA 1ALWA 2CNPA 1F54A 2LCPA 1TCOB 2ISDA 2L0PA 3H4SE 4QJ3B 4M2OA 4HREE 4I5JA 4HSZA 4PHJA 1YX7A 3SG4A 2WCFA 3CR5X 2OS8B 3GK4X 3LK1A 1TRFA 3EK8A 1QTXA 3JTDB 2OTGB 1J1EA 4DCKA 4ICBA 2LP3A 1K2HA 3F45A 3I5IB 5FYXA 1M45A 1K9PA 1AHRA 2KI4B 1GGZA 1S6IA 1WDCB 1LINA 1WLZA 3DVKA 4WQ3A 3VRQA 1YRTB 2MLFC 1SCMC 4YGBB 2COLB 2E30A 2H61C 2MJWB 1SR6C 1BT6A 2L50A 1FF1A 5CSJA 1QS7A 5HYDA 1QX7A 1F70A 1TN4A 2JNFA 4D1EA 1F55A 4PHNA 1BR4B 4F0ZB 1MXLC 3TDIA 1CFCA 1SPYA 4GBAA 3VROA 1DMOA 1CLLA 1TCFA 2FCEA 1EL4A 1SMGA 2MLEC 4MSPA 2JOJA 1SL7A 1Y1XA 1N0YA 3ICBA 1CLMA 3GK1A 1JC2A 1DGUA 2BBNA 5CSIA 1GJYA 1IH0A 5TNCA 4QJ5B 3QRXA 5AXIA 1A75B 3LLEA 1QV0A 1AP4A 1BJFA 4R1EA 2H2KA 4USLA 3O6BA 3KEVA 1YRUB 1SCMB 1B1GA 2LMUA 2BKIB 4AQJA 1NPQA 3PN7C 4BY5A 1CMGA 1IJ6A 1KWOB 2K61A 2M1UA 1XK4A 1WRKA 4NDBA 5B8IB 2Q4UA 4N1GA 5I2QA 4CPVA 1DJXA 1CFDA 4MN0A 1CLBA 2ZN9A 4I5LB 1WLMA 2F2OA 2MAZA 1XFVO 2JRFA 2KHNA 2M29A 4QJ4B 1JSAA 3OX6A 4I5NB 4P5OE 4ZCVA 1NX0A 1B9AA 2L98A 2LMTA 4CIDA 1K9KA 2LVVA 1XA5A 2K8MB 1IKUA 2PMYA 1DJZA 1U5IB 1QXPA 3C1VA 1JF2A 2ZRSA 2LLTA 1NWDA 3OP0A 1M31A 1CDMA 2BCBA 2JC2A 3PN7B 3RM1A 2EC6B 1X02A 2JPTA 2JT3A 3FIAA 2I2RE 5D7FA 1XFZO 2ZFDA 3WNXB 2F8PA 3IF7A 3BOWA 1G4YR 1CMFA 1CDNA 5K89A 4NDDA 3WHUB
chains in the Genus database with same CATH superfamily
1L2OC 3IQOA 1AJ4A 3FS7A 5AFPA 1IWQA 2F33A 1AUIB 3VRRA 1VRKA 2PQLA 2EGDA 1YVLA 1DTLA 1BODA 1F71A 2VRGA 1BOCA 1B7TZ 2LHIA 1JFJA 1DJGA 1Y1AA 3NXAA 3EKHA 2D8NA 2MA2A 5I94A 4XJKA 2NCPA 1EXRA 1A2XA 1S6JA 1WRLA 1YTZC 3CWGA 3LL8B 4YGEB 3RLZA 2I18A 3ZNIA 1BLQA 1OOJA 4PE1A 3UNWA 1K94A 2LVKA 3O2PA 3CLNA 1KSOA 2WORA 3M0WA 1WDCC 1TNQA 2WCLA 1K9UA 1WY9A 4JQ0D 2MBXA 2M97A 1CFPA 1NCYA 2BL0C 5DICA 1KFUL 1B8CA 1NIWA 1FBVA 2O5GA 2BKHB 3B7AA 2QDIA 3UO9A 5KU1A 4UPGA 1L2OB 1M63B 1MR8A 2KLEA 2NXQA 1A4PA 2IS9A 4MEWA 3SG3A 2LC5A 1QX5B 2ZN8A 3NSIA 3R72A 3TZ1A 1PVBA 2JULA 1ODBA 1BMOA 2F2PA 1UWOA 1ZUZA 1NX2A 1C7VA 1TIZA 2Y4QA 1LXFC 4KYNA 4MRYA 3S0BA 1TOPA 3SG7A 1C07A 1G33A 1SK6D 1N65A 4GUKA 3SIBA 1DJWA 4YGDB 1XVJA 2FCDA 3KF9A 1DEKA 1XFWO 3EK4A 2KYFA 1A29A 4ETOA 2Y1NA 5HKWA 1LKJA 3OB1B 1EH2A 3DVMA 1DJIA 2O60A 3BUWB 3PALA 1AVSA 1L7ZA 4BY4A 3MSEB 1QIWA 4ORBB 5HL1A 1IIOA 3CZ0A 3KHEA 2BL0B 1DELA 1TNPA 4YGCB 1KWOC 1QJTA 3FE6A 4GGNA 3TUYC 3PM8A 3CZ2A 4CFQA 2WC8A 1KSMA 3BFBA 4PALA 3CZTX 3S0FA 1FPWA 1NX3A 2LUXA 3KPXA 3OB2B 2Y5IA 3OGNA 1J7OA 2BBMA 2ZNDA 4DS7A 3R1PA 1A03A 3SG2A 1A75A 1JBAA 1EG4A 1RFJA 3N7HA 2F3ZA 3PJIA 4GFTA 1DF0A 1QASA 2WOSA 1KQVA 4MZJA 2H61A 2ZKMX 4WRIA 1OOFA 2AAOA 1H8BA 2KNEA 3AKBA 2SCPA 1KK7Z 1Y1UA 2F3YA 2LAPA 2L51A 2LE9B 1JUOA 2NZ0A 1OSAA 2LLUA 2Q91A 4GGFC 2M3WA 1DF0B 2K2AA 2LUCA 1ALVA 1TTXA 3S0DA 1NP8A 4PHMA 5I8NA 1OQPA 2KFFA 3CR4X 1OMRA 2I94A 1QLKA 1S36A 2EC6C 4JPZB 4HRGA 3TUYB 3Q8IA 1LA0A 3CZ1A 1MWNA 1RTP1 1QVIZ 3NSLA 1CTRA 1NX1A 4E68A 1KCYA 1F4QA 1IJ5A 1DJYA 4TNCA 2KFGA 4OV2A 3I5GC 1RK9A 3DZTA 4M2PA 2ZRTA 1GM0A 3ZWHA 1KFXS 1R2UA 2LVJA 1UHJA 1Y0VH 2FOTA 4MLWA 3D0YB 5DKRA 4Q04A 1U5IA 2CT9A 1W7IB 1BG1A 1EG3A 1KFXL 1M39A 4P2YB 1QX2A 3VGOA 2V53A 4C0JA 2CTNA 1NYAA 3BUOB 2I7AA 4GNKB 2JT8A 3PSRA 1HQVA 1PK0D 1S5GZ 1YUTA 4C0LA 1K8UA 2GV5A 3AAJA 1IRJA 3S0AA 1QV1A 3NGVA 2BE4A 2G2BA 2KBIA 2QEOA 1SW8A 2KFHA 1KK8C 4MZLA 2HPSA 5AERA 2BE6A 3I5FC 3SJSA 1W7JB 2EHBA 2JWWA 2LANA 2LHLA 3D10A 3I5HC 4I5KA 4N5XA 1YURA 1SNLA 2ZNEA 5D3OA 4OKHA 2M7NA 3CYZA 3NHIA 2PALA 2SASA 2KDHA 1MQ1A 2PRUA 1ORGA 1SKTA 1PSRA 2WCHA 3I5GB 1B7TY 2GGMA 2JQ6A 2P6BB 2R2IA 4PE0A 2L4HA 1CFFA 1CM1A 3SIAA 4YBHB 5JJGA 3LK0A 2KGRA 3HCMA 3DVJA 4U8DA 1FI5A 1CM4A 2KAYA 1QLSA 2E6WA 5J3XA 1PULA 3BFAA 1PRWA 2MRDA 1V1FA 1ZMZA 3B87A 2LNKA 3NSOA 5HKZA 5AEQA 2KQYA 1Y6WA 1KK8B 5KSZA 2JTTA 3NHTA 5GQQC 3PATA 1CDLA 2HQ8A 1BF5A 3E3RA 3I5FB 1J1DA 1UHKA 1BU3A 3I5HB 3DF0B 5D69A 1RWYA 1D1OA 1PVAA 3BUXB 4ORAB 2K7BA 2M8UA 1XO5A 4L9MA 1XYDA 5HLVA 2HQWA 2PSRA 1JF0A 2NCOA 2A4JA 3SG5A 2M0RA 2YGUA 1PALA 1IQ5A 2KOTA 1CDPA 1YR5A 1OZOA 1J7PA 4AOMA 3O4YA 1DJHA 1SBJA 3O78A 1UHNA 2L5XB 1PSBA 4MRXA 1J7RA 1YVHA 2JXLA 1WRZA 1SYMA 2BECA 3D76A 3NSKA 4DIRA 2JTZA 4DUQA 4NDDA 3EK7A 3B86A 3L4LA 1TUZA 4MBEA 2M9GA 3BXKA 1MHOA 4FQOA 4M2QA 2WCMA 1G8IA 1H4BA 5HLOA 2HETA 1S26D 2JZIA 3EG5B 2GGZA 2FJYA 5IBWA 4PE7A 1S1EA 5ER5A 5ER4X 1DC1A 3B88A 5F6TA 1SL8A 4JKTA 3A8RA 3SS4A 4DRWA 1CB1A 1IG5A 5AANA 4AQIA 4PCWA 5DKNA 2WC6A 4PE4A 3D78A 2WCBA 4IL1A 1NUBA 2P70A 3CGAA 1MXEA 1C3YA 1CKKA 3GOFA 5CPVA 3EVRA 2JXCA 2B1UA 1M46A 1KK7Y 2FJUB 1QIVA 1XFYO 2JU0A 2K2FA 1QWVA 2TN4A 4A4CA 3D73A 2Y1MA 4PDZA 1SL9A 1F4OA 2KYCA 1UUSA 3AKAA 4JWQA 3TS5C 4CLNA 2K7CA 5I2LA 5G08A 2M7LA 1RECA 4XYNA 3WXAA 3CTNA 1QVIY 2G9BA 2CBLA 2KAVA 1NCZA 1LVCD 1AK8A 3R1OA 1S3PA 1V1GA 4CFRA 3L4AA 3OX5A 2M49B 2JT0A 3EKJA 3D0YA 1HT9A 5JOLA 1UHHA 3CS1A 1XK4C 2LMVA 2BCXA 1T14A 4IJ7A 2LLSA 2NLNA 4YI9A 1FI6A 1EJ3A 4FTGA 3VRNA 4GPLB 1UHIA 3SG6A 2KI6C 3JVTC 1B4CA 2LP2A 3V2LA 4NQGA 1LA3A 2KSPA 3PFVA 1S5GY 2PVBA 2LM5A 2KI6D 1YUUA 1CNPA 1JFKA 1F8HA 1IGVA 2AMIA 1S6CA 2LV7A 1NCXA 2PASA 4GGFA 2AUCA 1LS8A 1B8LA 3SS3A 1RJVA 3BUMB 3K21A 5CSNA 2RGIA 2QACA 3FWBA 3IQQA 1SR6B 4YI8A 3L47A 1XFXO 3TS5B 5FI7A 1K90D 3EVVA 3PLFB 1TNWA 2BNXA 4C0KA 2HF5A 3BQ3A 3K1EA 1SY9A 1OMVA 2K60A 2K7DA 1KQMC 3FE9A 2K7OA 3DD4A 1RROA 4YRUA 1C3ZA 3BUNB 2KAXA 2OPOA 3TDUA 5I2OA 1YX8A 1AJ5A 3BYAA 3FWCA 1B8RA 2KGBC 3JVTB 4OR9B 5DKQA 1YUSA 4PT1A 1DVIA 3DYEA 4ORCB 1MF8B 2JNXA 1E8AA 1ZOTB 4GAOA 1XFUO 3LCPC 2CCMA 5BPJA 2QEBA 3TDZA 2QEHA 4YGAA 4N1FA 1NSHA 2LVIA 3PM2A 2WCKA 3R1VA 3DF0A 1ZFSA 4INXA 1OOHA 2BCAA 1FW4A 1Q80A 1OMDA 1Z4HA 1R6PA 2KBMA 4NDCA 3EVUA 4MVFA 1KQMB 3HX4A 2M1KB 1J7QA 4OVNF 1IQ3A 1C7WA 2PYQA 1SCVA 1XFRA 4FQTA 4ZCUA 2L2EA 4WQ2A 1DT7B 1BR1B 3CR2A 3DVEA 1ZACA 3KO0A 3WHTB 2MHHA 3BOWB 4HRHA 1SRAA 1B47A 5KTYA 2DOQA 2H8VA 1J55A 2OS8C 4OCIA 2K0JA 5CSFA 2WCEA 5FI6A 3JTDC 2L5YA 2OTGC 1DGVA 4PHKA 1GGWA 1OE9B 1QATA 1UP5A 2QPTA 3OHMB 4OZDA 1TWOA 2CXJA 2L4IA 3I5IC 4A4BA 3A4UB 1UURA 3AAKA 2KI4C 1TNXA 5PALA 1GQMA 1K96A 1MUXA 5HKYA 1OOGA 1P28A 1KFUS 1N2DA 1JWDA 4MZKA 4XJKB 1OZSA 1K93D 1K95A 3GK2A 3O4XA 3VRPA 3B6XA 2KQ6A 2WNDA 2L2CA 1ALWA 2CNPA 1F54A 2LCPA 1TCOB 1OW4A 2ISDA 2L0PA 3CDNA 3H4SE 4QJ3B 4M2OA 1SSEB 2ERBA 3CABA 4HREE 3S0EA 4I5JA 1W9ZA 3D74A 4HSZA 4PHJA 1YX7A 3SG4A 2WCFA 3CR5X 2OS8B 3GK4X 3LK1A 1OOIX 3D77A 1TRFA 3EK8A 1QTXA 3JTDB 2OTGB 1J1EA 4DCKA 4ICBA 2LP3A 1K2HA 3F45A 3I5IB 5FYXA 3VB1A 1M45A 1K9PA 1AHRA 1DQEA 2KI4B 1Z2CB 3BFHA 1GGZA 1S6IA 1WDCB 2JPOA 1LINA 1WLZA 3DVKA 3IVTA 4WQ3A 3SS5A 1YRTB 2MLFC 1SCMC 4YGBB 3VRQA 2COLB 2E30A 1TUJA 2H61C 2MJWB 1SR6C 1BT6A 2L50A 1FF1A 5CSJA 1QS7A 2GTEA 5HYDA 1QX7A 1F70A 1TN4A 2JNFA 4D1EA 1F55A 2WC5A 4PHNA 1BR4B 4F0ZB 3FE8A 1MXLC 3TDIA 1CFCA 1SPYA 4GBAA 3VROA 1DMOA 1CLLA 1TCFA 2FCEA 1EL4A 1SMGA 2MLEC 4MSPA 2JOJA 1SL7A 1Y1XA 4INWA 1N0YA 3ICBA 1CLMA 3GK1A 1JC2A 1DGUA 2BBNA 5CSIA 1GJYA 1IH0A 5TNCA 4QJ5B 3OBVA 3QMEA 3QRXA 5AXIA 1A75B 3LLEA 1QV0A 1AP4A 1BJFA 2KLDA 4R1EA 2H2KA 4USLA 3O6BA 3KEVA 1YRUB 1SCMB 1B1GA 2LMUA 2BKIB 4AQJA 1NPQA 3PN7C 4BY5A 1CMGA 1IJ6A 1KWOB 5FI2A 2K61A 3D75A 2M1UA 2KPHA 1XK4A 1WRKA 4NDBA 5B8IB 2Q4UA 4N1GA 5I2QA 4CPVA 1DJXA 1CFDA 4MN0A 1CLBA 2ZN9A 4I5LB 1WLMA 2F2OA 2MAZA 1XFVO 2JRFA 2KHNA 2M29A 2P71A 3S0GA 4QJ4B 1JSAA 3OX6A 4I5NB 4P5OE 4ZCVA 1NX0A 3DXLA 1B9AA 2L98A 2LMTA 4CIDA 1K9KA 2LVVA 1XA5A 2K8MB 1IKUA 3RZSA 2PMYA 1DJZA 3BJHA 4F7FA 5EL2A 1U5IB 1QXPA 3C1VA 1JF2A 2ZRSA 2LLTA 1NWDA 3OP0A 1M31A 1CDMA 2BCBA 2JC2A 2WCJA 2QEVA 3PN7B 3RM1A 2BAPA 2EC6B 1X02A 2JPTA 2JT3A 3FIAA 2I2RE 5D7FA 1XFZO 2ZFDA 3WNXB 2F8PA 3IF7A 3BOWA 1G4YR 1CMFA 1CDNA 3DY9A 5K89A 4JD9A 3WHUB
chains in the Genus database with same CATH topology
1L2OC 3IQOA 1AJ4A 3FS7A 5AFPA 1IWQA 2F33A 1AUIB 3VRRA 1VRKA 1F71A 2EGDA 1YVLA 1DTLA 1BODA 2VRGA 1BOCA 1B7TZ 2LHIA 1JFJA 1DJGA 1Y1AA 3NXAA 3EKHA 2D8NA 2MA2A 4XJKA 2NCPA 1EXRA 1A2XA 1S6JA 1WRLA 1YTZC 3CWGA 3LL8B 4YGEB 3RLZA 2I18A 3ZNIA 1BLQA 1OOJA 4PE1A 1K94A 2LVKA 3O2PA 3CLNA 1KSOA 2WORA 3M0WA 1WDCC 1TNQA 1K9UA 1WY9A 4JQ0D 2MBXA 2M97A 1CFPA 1NCYA 2BL0C 1KFUL 1B8CA 1NIWA 1FBVA 2O5GA 2BKHB 5KU1A 4UPGA 1L2OB 1M63B 1MR8A 4C0LA 2NXQA 1A4PA 2IS9A 4MEWA 3SG3A 2LC5A 1QX5B 2ZN8A 3NSIA 3TZ1A 1PVBA 2JULA 1ODBA 1BMOA 2F2PA 1UWOA 1ZUZA 1NX2A 1C7VA 1TIZA 2Y4QA 1LXFC 4MRYA 3SG7A 1C07A 1TOPA 1G33A 1SK6D 1N65A 4GUKA 3SIBA 1DJWA 4YGDB 1XVJA 2FCDA 3KF9A 1XFWO 3EK4A 2KYFA 1A29A 4ETOA 2Y1NA 5HKWA 1LKJA 3OB1B 1EH2A 3DVMA 1DJIA 2O60A 3BUWB 3PALA 1AVSA 1L7ZA 4BY4A 3MSEB 1QIWA 4ORBB 3KHEA 2BL0B 1TNPA 4YGCB 1KWOC 1QJTA 4GGNA 3TUYC 3PM8A 4CFQA 2WC8A 1KSMA 4PALA 3CZTX 1FPWA 1NX3A 2LUXA 3KPXA 3OB2B 2Y5IA 1J7OA 2BBMA 2ZNDA 4DS7A 1A03A 3SG2A 1A75A 1JBAA 1EG4A 1RFJA 2F3ZA 4GFTA 1DF0A 1QASA 2WOSA 1KQVA 4MZJA 2H61A 2ZKMX 4WRIA 2AAOA 1H8BA 2KNEA 3AKBA 2SCPA 1KK7Z 1Y1UA 2F3YA 2LAPA 2L51A 2LE9B 1JUOA 2NZ0A 1OSAA 2LLUA 2Q91A 4GGFC 2M3WA 1DF0B 2K2AA 2LUCA 1ALVA 1TTXA 1NP8A 4PHMA 5I8NA 1OQPA 2KFFA 3CR4X 1OMRA 2I94A 1QLKA 1S36A 2EC6C 4JPZB 4HRGA 3TUYB 1LA0A 1MWNA 1RTP1 1QVIZ 3NSLA 1CTRA 1NX1A 4E68A 1KCYA 1F4QA 1IJ5A 1DJYA 4TNCA 2KFGA 4OV2A 3I5GC 1RK9A 4M2PA 2ZRTA 3ZWHA 1KFXS 1R2UA 2LVJA 1UHJA 1Y0VH 2FOTA 4MLWA 3D0YB 5DKRA 4Q04A 1U5IA 2CT9A 1W7IB 1BG1A 1EG3A 1KFXL 1M39A 4P2YB 1QX2A 3VGOA 2V53A 4C0JA 2CTNA 1NYAA 3BUOB 2I7AA 4GNKB 2JT8A 3PSRA 1HQVA 1PK0D 1S5GZ 1YUTA 1K8UA 2GV5A 3AAJA 1IRJA 1QV1A 2BE4A 2G2BA 2KBIA 1SW8A 2KFHA 1KK8C 4MZLA 2HPSA 5AERA 2BE6A 3I5FC 3SJSA 1W7JB 2EHBA 2JWWA 2LANA 2LHLA 3D10A 3I5HC 4I5KA 4N5XA 1YURA 1SNLA 2ZNEA 4OKHA 2M7NA 2PALA 2SASA 2KDHA 1MQ1A 2PRUA 1SKTA 1PSRA 3I5GB 1J7PA 1B7TY 2GGMA 2JQ6A 2P6BB 2R2IA 4PE0A 2L4HA 1CFFA 1CM1A 3SIAA 4YBHB 5JJGA 3LK0A 2KGRA 3HCMA 3DVJA 4U8DA 1FI5A 1CM4A 2KAYA 1QLSA 2E6WA 5J3XA 1PULA 1PRWA 2MRDA 1V1FA 1ZMZA 3NSOA 2LNKA 5HKZA 5AEQA 2KQYA 1Y6WA 1KK8B 5KSZA 2JTTA 5GQQC 3PATA 1CDLA 2HQ8A 1BF5A 3E3RA 3I5FB 1J1DA 1UHKA 1BU3A 3I5HB 3DF0B 5D69A 1RWYA 1D1OA 1PVAA 3BUXB 4ORAB 2K7BA 2M8UA 1XO5A 4L9MA 1XYDA 5HLVA 2HQWA 2PSRA 1JF0A 2NCOA 2A4JA 3SG5A 2M0RA 1PALA 1IQ5A 2KOTA 1CDPA 1YR5A 1OZOA 4AOMA 3O4YA 1DJHA 1SBJA 3O78A 1UHNA 2L5XB 1PSBA 4MRXA 1J7RA 1YVHA 2JXLA 1WRZA 1SYMA 2BECA 3NSKA 4DIRA 4DUQA 2JTZA 3EK7A 4MBEA 2M9GA 3BXKA 1MHOA 4FQOA 4M2QA 1G8IA 1H4BA 5HLOA 2HETA 1S26D 2JZIA 2GGZA 5IBWA 4PE7A 1S1EA 5ER5A 5ER4X 5F6TA 1SL8A 3A8RA 4DRWA 1CB1A 1IG5A 5AANA 4AQIA 4PCWA 5DKNA 4PE4A 2WCBA 4IL1A 1NUBA 3CGAA 1MXEA 1CKKA 3GOFA 5CPVA 3EVRA 2JXCA 2B1UA 1M46A 1KK7Y 2FJUB 1QIVA 1XFYO 2JU0A 2K2FA 2TN4A 4A4CA 2Y1MA 4PDZA 1SL9A 1F4OA 2KYCA 1UUSA 3AKAA 4JWQA 3TS5C 4CLNA 2K7CA 5I2LA 5G08A 2M7LA 1RECA 4XYNA 3WXAA 3CTNA 1QVIY 2G9BA 2CBLA 2KAVA 1NCZA 1LVCD 1AK8A 1S3PA 1V1GA 4CFRA 3OX5A 2M49B 2JT0A 3EKJA 3D0YA 1HT9A 5JOLA 1UHHA 3CS1A 1XK4C 2LMVA 2BCXA 2LLSA 2NLNA 4YI9A 1FI6A 1EJ3A 4FTGA 3VRNA 4GPLB 1UHIA 3SG6A 2KI6C 3JVTC 1B4CA 2LP2A 4NQGA 1LA3A 2KSPA 3PFVA 1S5GY 2PVBA 2LM5A 2KI6D 1YUUA 1CNPA 1JFKA 1F8HA 1IGVA 2AMIA 1S6CA 2LV7A 1NCXA 2PASA 4GGFA 2AUCA 1B8LA 1RJVA 3BUMB 3K21A 5CSNA 2RGIA 2QACA 3FWBA 3IQQA 1SR6B 4YI8A 1XFXO 3TS5B 1K90D 3EVVA 3PLFB 1TNWA 4C0KA 2HF5A 3BQ3A 1SY9A 1OMVA 2K7DA 1KQMC 2K7OA 3DD4A 1RROA 4YRUA 3BUNB 2KAXA 2OPOA 3TDUA 5I2OA 1YX8A 1AJ5A 3BYAA 3FWCA 1B8RA 2KGBC 3JVTB 4OR9B 5DKQA 1YUSA 1DVIA 4ORCB 1MF8B 2JNXA 1E8AA 1ZOTB 4GAOA 1XFUO 3LCPC 2CCMA 5BPJA 3TDZA 4YGAA 4N1FA 1NSHA 2LVIA 3DF0A 1ZFSA 2BCAA 1FW4A 1Q80A 1OMDA 1R6PA 2KBMA 4NDCA 3EVUA 4MVFA 1KQMB 3HX4A 2M1KB 1J7QA 4OVNF 1IQ3A 1C7WA 4ZCUA 1SCVA 2L2EA 4WQ2A 1DT7B 1BR1B 3CR2A 3DVEA 1ZACA 3KO0A 3WHTB 2MHHA 3BOWB 4HRHA 1SRAA 1B47A 5KTYA 2DOQA 2OS8C 1J55A 4OCIA 2K0JA 5CSFA 2WCEA 3JTDC 2OTGC 4PHKA 1DGVA 1GGWA 1OE9B 1QATA 1UP5A 2QPTA 3OHMB 2CXJA 2L4IA 3I5IC 4A4BA 3A4UB 1UURA 3AAKA 2KI4C 1TNXA 5PALA 1GQMA 1K96A 1MUXA 5HKYA 1KFUS 1N2DA 1JWDA 4MZKA 4XJKB 1OZSA 1K93D 1K95A 3GK2A 3VRPA 2KQ6A 2WNDA 1ALWA 2CNPA 1F54A 2LCPA 1TCOB 2ISDA 2L0PA 3H4SE 4QJ3B 4M2OA 4HREE 4I5JA 4HSZA 4PHJA 1YX7A 3SG4A 2WCFA 3CR5X 2OS8B 3GK4X 3LK1A 1TRFA 3EK8A 1QTXA 3JTDB 2OTGB 1J1EA 4DCKA 4ICBA 2LP3A 1K2HA 3F45A 3I5IB 5FYXA 1M45A 1K9PA 1AHRA 2KI4B 1GGZA 1S6IA 1WDCB 1LINA 1WLZA 3DVKA 4WQ3A 3VRQA 1YRTB 2MLFC 1SCMC 4YGBB 2COLB 2E30A 2H61C 2MJWB 1SR6C 1BT6A 2L50A 1FF1A 5CSJA 1QS7A 5HYDA 1QX7A 1F70A 1TN4A 2JNFA 4D1EA 1F55A 4PHNA 1BR4B 4F0ZB 1MXLC 3TDIA 1CFCA 1SPYA 4GBAA 3VROA 1DMOA 1CLLA 1TCFA 2FCEA 1EL4A 1SMGA 2MLEC 4MSPA 2JOJA 1SL7A 1Y1XA 1N0YA 3ICBA 1CLMA 3GK1A 1JC2A 1DGUA 2BBNA 5CSIA 1GJYA 1IH0A 5TNCA 4QJ5B 3QRXA 5AXIA 1A75B 3LLEA 1QV0A 1AP4A 1BJFA 4R1EA 2H2KA 4USLA 3O6BA 3KEVA 1YRUB 1SCMB 1B1GA 2LMUA 2BKIB 4AQJA 1NPQA 3PN7C 4BY5A 1CMGA 1IJ6A 1KWOB 2K61A 2M1UA 1XK4A 1WRKA 4NDBA 5B8IB 2Q4UA 4N1GA 5I2QA 4CPVA 1DJXA 1CFDA 4MN0A 1CLBA 2ZN9A 4I5LB 1WLMA 2F2OA 2MAZA 1XFVO 2JRFA 2KHNA 2M29A 4QJ4B 1JSAA 3OX6A 4I5NB 4P5OE 4ZCVA 1NX0A 1B9AA 2L98A 2LMTA 4CIDA 1K9KA 2LVVA 1XA5A 2K8MB 1IKUA 2PMYA 1DJZA 1U5IB 1QXPA 3C1VA 1JF2A 2ZRSA 2LLTA 1NWDA 3OP0A 1M31A 1CDMA 2BCBA 2JC2A 3PN7B 3RM1A 2EC6B 1X02A 2JPTA 2JT3A 3FIAA 2I2RE 5D7FA 1XFZO 2ZFDA 3WNXB 2F8PA 3IF7A 3BOWA 1G4YR 1CMFA 1CDNA 5K89A 4NDDA 3WHUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2O C;  3IQO A;  1AJ4 A;  3FS7 A;  5AFP A;  1IWQ A;  2F33 A;  1AUI B;  3VRR A;  1VRK A;  1F71 A;  2EGD A;  1YVL A;  1DTL A;  1BOD A;  2VRG A;  1BOC A;  1B7T Z;  2LHI A;  1JFJ A;  1DJG A;  1Y1A A;  3NXA A;  3EKH A;  2D8N A;  2MA2 A;  4XJK A;  2NCP A;  1EXR A;  1A2X A;  1S6J A;  1WRL A;  1YTZ C;  3CWG A;  3LL8 B;  4YGE B;  3RLZ A;  2I18 A;  3ZNI A;  1BLQ A;  1OOJ A;  4PE1 A;  1K94 A;  2LVK A;  3O2P A;  3CLN A;  1KSO A;  2WOR A;  3M0W A;  1WDC C;  1TNQ A;  1K9U A;  1WY9 A;  4JQ0 D;  2MBX A;  2M97 A;  1CFP A;  1NCY A;  2BL0 C;  1KFU L;  1B8C A;  1NIW A;  1FBV A;  2O5G A;  2BKH B;  5KU1 A;  4UPG A;  1L2O B;  1M63 B;  1MR8 A;  4C0L A;  2NXQ A;  1A4P A;  2IS9 A;  4MEW A;  3SG3 A;  2LC5 A;  1QX5 B;  2ZN8 A;  3NSI A;  3TZ1 A;  1PVB A;  2JUL A;  1ODB A;  1BMO A;  2F2P A;  1UWO A;  1ZUZ A;  1NX2 A;  1C7V A;  1TIZ A;  2Y4Q A;  1LXF C;  4MRY A;  3SG7 A;  1C07 A;  1TOP A;  1G33 A;  1SK6 D;  1N65 A;  4GUK A;  3SIB A;  1DJW A;  4YGD B;  1XVJ A;  2FCD A;  3KF9 A;  1XFW O;  3EK4 A;  2KYF A;  1A29 A;  4ETO A;  2Y1N A;  5HKW A;  1LKJ A;  3OB1 B;  1EH2 A;  3DVM A;  1DJI A;  2O60 A;  3BUW B;  3PAL A;  1AVS A;  1L7Z A;  4BY4 A;  3MSE B;  1QIW A;  4ORB B;  3KHE A;  2BL0 B;  1TNP A;  4YGC B;  1KWO C;  1QJT A;  4GGN A;  3TUY C;  3PM8 A;  4CFQ A;  2WC8 A;  1KSM A;  4PAL A;  3CZT X;  1FPW A;  1NX3 A;  2LUX A;  3KPX A;  3OB2 B;  2Y5I A;  1J7O A;  2BBM A;  2ZND A;  4DS7 A;  1A03 A;  3SG2 A;  1A75 A;  1JBA A;  1EG4 A;  1RFJ A;  2F3Z A;  4GFT A;  1DF0 A;  1QAS A;  2WOS A;  1KQV A;  4MZJ A;  2H61 A;  2ZKM X;  4WRI A;  2AAO A;  1H8B A;  2KNE A;  3AKB A;  2SCP A;  1KK7 Z;  1Y1U A;  2F3Y A;  2LAP A;  2L51 A;  2LE9 B;  1JUO A;  2NZ0 A;  1OSA A;  2LLU A;  2Q91 A;  4GGF C;  2M3W A;  1DF0 B;  2K2A A;  2LUC A;  1ALV A;  1TTX A;  1NP8 A;  4PHM A;  5I8N A;  1OQP A;  2KFF A;  3CR4 X;  1OMR A;  2I94 A;  1QLK A;  1S36 A;  2EC6 C;  4JPZ B;  4HRG A;  3TUY B;  1LA0 A;  1MWN A;  1RTP 1;  1QVI Z;  3NSL A;  1CTR A;  1NX1 A;  4E68 A;  1KCY A;  1F4Q A;  1IJ5 A;  1DJY A;  4TNC A;  2KFG A;  4OV2 A;  3I5G C;  1RK9 A;  4M2P A;  2ZRT A;  3ZWH A;  1KFX S;  1R2U A;  2LVJ A;  1UHJ A;  1Y0V H;  2FOT A;  4MLW A;  3D0Y B;  5DKR A;  4Q04 A;  1U5I A;  2CT9 A;  1W7I B;  1BG1 A;  1EG3 A;  1KFX L;  1M39 A;  4P2Y B;  1QX2 A;  3VGO A;  2V53 A;  4C0J A;  2CTN A;  1NYA A;  3BUO B;  2I7A A;  4GNK B;  2JT8 A;  3PSR A;  1HQV A;  1PK0 D;  1S5G Z;  1YUT A;  1K8U A;  2GV5 A;  3AAJ A;  1IRJ A;  1QV1 A;  2BE4 A;  2G2B A;  2KBI A;  1SW8 A;  2KFH A;  1KK8 C;  4MZL A;  2HPS A;  5AER A;  2BE6 A;  3I5F C;  3SJS A;  1W7J B;  2EHB A;  2JWW A;  2LAN A;  2LHL A;  3D10 A;  3I5H C;  4I5K A;  4N5X A;  1YUR A;  1SNL A;  2ZNE A;  4OKH A;  2M7N A;  2PAL A;  2SAS A;  2KDH A;  1MQ1 A;  2PRU A;  1SKT A;  1PSR A;  3I5G B;  1J7P A;  1B7T Y;  2GGM A;  2JQ6 A;  2P6B B;  2R2I A;  4PE0 A;  2L4H A;  1CFF A;  1CM1 A;  3SIA A;  4YBH B;  5JJG A;  3LK0 A;  2KGR A;  3HCM A;  3DVJ A;  4U8D A;  1FI5 A;  1CM4 A;  2KAY A;  1QLS A;  2E6W A;  5J3X A;  1PUL A;  1PRW A;  2MRD A;  1V1F A;  1ZMZ A;  3NSO A;  2LNK A;  5HKZ A;  5AEQ A;  2KQY A;  1Y6W A;  1KK8 B;  5KSZ A;  2JTT A;  5GQQ C;  3PAT A;  1CDL A;  2HQ8 A;  1BF5 A;  3E3R A;  3I5F B;  1J1D A;  1UHK A;  1BU3 A;  3I5H B;  3DF0 B;  5D69 A;  1RWY A;  1D1O A;  1PVA A;  3BUX B;  4ORA B;  2K7B A;  2M8U A;  1XO5 A;  4L9M A;  1XYD A;  5HLV A;  2HQW A;  2PSR A;  1JF0 A;  2NCO A;  2A4J A;  3SG5 A;  2M0R A;  1PAL A;  1IQ5 A;  2KOT A;  1CDP A;  1YR5 A;  1OZO A;  4AOM A;  3O4Y A;  1DJH A;  1SBJ A;  3O78 A;  1UHN A;  2L5X B;  1PSB A;  4MRX A;  1J7R A;  1YVH A;  2JXL A;  1WRZ A;  1SYM A;  2BEC A;  3NSK A;  4DIR A;  4DUQ A;  2JTZ A;  3EK7 A;  4MBE A;  2M9G A;  3BXK A;  1MHO A;  4FQO A;  4M2Q A;  1G8I A;  1H4B A;  5HLO A;  2HET A;  1S26 D;  2JZI A;  2GGZ A;  5IBW A;  4PE7 A;  1S1E A;  5ER5 A;  5ER4 X;  5F6T A;  1SL8 A;  3A8R A;  4DRW A;  1CB1 A;  1IG5 A;  5AAN A;  4AQI A;  4PCW A;  5DKN A;  4PE4 A;  2WCB A;  4IL1 A;  1NUB A;  3CGA A;  1MXE A;  1CKK A;  3GOF A;  5CPV A;  3EVR A;  2JXC A;  2B1U A;  1M46 A;  1KK7 Y;  2FJU B;  1QIV A;  1XFY O;  2JU0 A;  2K2F A;  2TN4 A;  4A4C A;  2Y1M A;  4PDZ A;  1SL9 A;  1F4O A;  2KYC A;  1UUS A;  3AKA A;  4JWQ A;  3TS5 C;  4CLN A;  2K7C A;  5I2L A;  5G08 A;  2M7L A;  1REC A;  4XYN A;  3WXA A;  3CTN A;  1QVI Y;  2G9B A;  2CBL A;  2KAV A;  1NCZ A;  1LVC D;  1AK8 A;  1S3P A;  1V1G A;  4CFR A;  3OX5 A;  2M49 B;  2JT0 A;  3EKJ A;  3D0Y A;  1HT9 A;  5JOL A;  1UHH A;  3CS1 A;  1XK4 C;  2LMV A;  2BCX A;  2LLS A;  2NLN A;  4YI9 A;  1FI6 A;  1EJ3 A;  4FTG A;  3VRN A;  4GPL B;  1UHI A;  3SG6 A;  2KI6 C;  3JVT C;  1B4C A;  2LP2 A;  4NQG A;  1LA3 A;  2KSP A;  3PFV A;  1S5G Y;  2PVB A;  2LM5 A;  2KI6 D;  1YUU A;  1CNP A;  1JFK A;  1F8H A;  1IGV A;  2AMI A;  1S6C A;  2LV7 A;  1NCX A;  2PAS A;  4GGF A;  2AUC A;  1B8L A;  1RJV A;  3BUM B;  3K21 A;  5CSN A;  2RGI A;  2QAC A;  3FWB A;  3IQQ A;  1SR6 B;  4YI8 A;  1XFX O;  3TS5 B;  1K90 D;  3EVV A;  3PLF B;  1TNW A;  4C0K A;  2HF5 A;  3BQ3 A;  1SY9 A;  1OMV A;  2K7D A;  1KQM C;  2K7O A;  3DD4 A;  1RRO A;  4YRU A;  3BUN B;  2KAX A;  2OPO A;  3TDU A;  5I2O A;  1YX8 A;  1AJ5 A;  3BYA A;  3FWC A;  1B8R A;  2KGB C;  3JVT B;  4OR9 B;  5DKQ A;  1YUS A;  1DVI A;  4ORC B;  1MF8 B;  2JNX A;  1E8A A;  1ZOT B;  4GAO A;  1XFU O;  3LCP C;  2CCM A;  5BPJ A;  3TDZ A;  4YGA A;  4N1F A;  1NSH A;  2LVI A;  3DF0 A;  1ZFS A;  2BCA A;  1FW4 A;  1Q80 A;  1OMD A;  1R6P A;  2KBM A;  4NDC A;  3EVU A;  4MVF A;  1KQM B;  3HX4 A;  2M1K B;  1J7Q A;  4OVN F;  1IQ3 A;  1C7W A;  4ZCU A;  1SCV A;  2L2E A;  4WQ2 A;  1DT7 B;  1BR1 B;  3CR2 A;  3DVE A;  1ZAC A;  3KO0 A;  3WHT B;  2MHH A;  3BOW B;  4HRH A;  1SRA A;  1B47 A;  5KTY A;  2DOQ A;  2OS8 C;  1J55 A;  4OCI A;  2K0J A;  5CSF A;  2WCE A;  3JTD C;  2OTG C;  4PHK A;  1DGV A;  1GGW A;  1OE9 B;  1QAT A;  1UP5 A;  2QPT A;  3OHM B;  2CXJ A;  2L4I A;  3I5I C;  4A4B A;  3A4U B;  1UUR A;  3AAK A;  2KI4 C;  1TNX A;  5PAL A;  1GQM A;  1K96 A;  1MUX A;  5HKY A;  1KFU S;  1N2D A;  1JWD A;  4MZK A;  4XJK B;  1OZS A;  1K93 D;  1K95 A;  3GK2 A;  3VRP A;  2KQ6 A;  2WND A;  1ALW A;  2CNP A;  1F54 A;  2LCP A;  1TCO B;  2ISD A;  2L0P A;  3H4S E;  4QJ3 B;  4M2O A;  4HRE E;  4I5J A;  4HSZ A;  4PHJ A;  1YX7 A;  3SG4 A;  2WCF A;  3CR5 X;  2OS8 B;  3GK4 X;  3LK1 A;  1TRF A;  3EK8 A;  1QTX A;  3JTD B;  2OTG B;  1J1E A;  4DCK A;  4ICB A;  2LP3 A;  1K2H A;  3F45 A;  3I5I B;  5FYX A;  1M45 A;  1K9P A;  1AHR A;  2KI4 B;  1GGZ A;  1S6I A;  1WDC B;  1LIN A;  1WLZ A;  3DVK A;  4WQ3 A;  3VRQ A;  1YRT B;  2MLF C;  1SCM C;  4YGB B;  2COL B;  2E30 A;  2H61 C;  2MJW B;  1SR6 C;  1BT6 A;  2L50 A;  1FF1 A;  5CSJ A;  1QS7 A;  5HYD A;  1QX7 A;  1F70 A;  1TN4 A;  2JNF A;  4D1E A;  1F55 A;  4PHN A;  1BR4 B;  4F0Z B;  1MXL C;  3TDI A;  1CFC A;  1SPY A;  4GBA A;  3VRO A;  1DMO A;  1CLL A;  1TCF A;  2FCE A;  1EL4 A;  1SMG A;  2MLE C;  4MSP A;  2JOJ A;  1SL7 A;  1Y1X A;  1N0Y A;  3ICB A;  1CLM A;  3GK1 A;  1JC2 A;  1DGU A;  2BBN A;  5CSI A;  1GJY A;  1IH0 A;  5TNC A;  4QJ5 B;  3QRX A;  5AXI A;  1A75 B;  3LLE A;  1QV0 A;  1AP4 A;  1BJF A;  4R1E A;  2H2K A;  4USL A;  3O6B A;  3KEV A;  1YRU B;  1SCM B;  1B1G A;  2LMU A;  2BKI B;  4AQJ A;  1NPQ A;  3PN7 C;  4BY5 A;  1CMG A;  1IJ6 A;  1KWO B;  2K61 A;  2M1U A;  1XK4 A;  1WRK A;  4NDB A;  5B8I B;  2Q4U A;  4N1G A;  5I2Q A;  4CPV A;  1DJX A;  1CFD A;  4MN0 A;  1CLB A;  2ZN9 A;  4I5L B;  1WLM A;  2F2O A;  2MAZ A;  1XFV O;  2JRF A;  2KHN A;  2M29 A;  4QJ4 B;  1JSA A;  3OX6 A;  4I5N B;  4P5O E;  4ZCV A;  1NX0 A;  1B9A A;  2L98 A;  2LMT A;  4CID A;  1K9K A;  2LVV A;  1XA5 A;  2K8M B;  1IKU A;  2PMY A;  1DJZ A;  1U5I B;  1QXP A;  3C1V A;  1JF2 A;  2ZRS A;  2LLT A;  1NWD A;  3OP0 A;  1M31 A;  1CDM A;  2BCB A;  2JC2 A;  3PN7 B;  3RM1 A;  2EC6 B;  1X02 A;  2JPT A;  2JT3 A;  3FIA A;  2I2R E;  5D7F A;  1XFZ O;  2ZFD A;  3WNX B;  2F8P A;  3IF7 A;  3BOW A;  1G4Y R;  1CMF A;  1CDN A;  5K89 A;  4NDD A;  3WHU B; 
#chains in the Genus database with same CATH topology
 1L2O C;  3IQO A;  1AJ4 A;  3FS7 A;  5AFP A;  1IWQ A;  2F33 A;  1AUI B;  3VRR A;  1VRK A;  2PQL A;  2EGD A;  1YVL A;  1DTL A;  1BOD A;  1F71 A;  2VRG A;  1BOC A;  1B7T Z;  2LHI A;  1JFJ A;  1DJG A;  1Y1A A;  3NXA A;  3EKH A;  2D8N A;  2MA2 A;  5I94 A;  4XJK A;  2NCP A;  1EXR A;  1A2X A;  1S6J A;  1WRL A;  1YTZ C;  3CWG A;  3LL8 B;  4YGE B;  3RLZ A;  2I18 A;  3ZNI A;  1BLQ A;  1OOJ A;  4PE1 A;  3UNW A;  1K94 A;  2LVK A;  3O2P A;  3CLN A;  1KSO A;  2WOR A;  3M0W A;  1WDC C;  1TNQ A;  2WCL A;  1K9U A;  1WY9 A;  4JQ0 D;  2MBX A;  2M97 A;  1CFP A;  1NCY A;  2BL0 C;  5DIC A;  1KFU L;  1B8C A;  1NIW A;  1FBV A;  2O5G A;  2BKH B;  3B7A A;  2QDI A;  3UO9 A;  5KU1 A;  4UPG A;  1L2O B;  1M63 B;  1MR8 A;  2KLE A;  2NXQ A;  1A4P A;  2IS9 A;  4MEW A;  3SG3 A;  2LC5 A;  1QX5 B;  2ZN8 A;  3NSI A;  3R72 A;  3TZ1 A;  1PVB A;  2JUL A;  1ODB A;  1BMO A;  2F2P A;  1UWO A;  1ZUZ A;  1NX2 A;  1C7V A;  1TIZ A;  2Y4Q A;  1LXF C;  4KYN A;  4MRY A;  3S0B A;  1TOP A;  3SG7 A;  1C07 A;  1G33 A;  1SK6 D;  1N65 A;  4GUK A;  3SIB A;  1DJW A;  4YGD B;  1XVJ A;  2FCD A;  3KF9 A;  1DEK A;  1XFW O;  3EK4 A;  2KYF A;  1A29 A;  4ETO A;  2Y1N A;  5HKW A;  1LKJ A;  3OB1 B;  1EH2 A;  3DVM A;  1DJI A;  2O60 A;  3BUW B;  3PAL A;  1AVS A;  1L7Z A;  4BY4 A;  3MSE B;  1QIW A;  4ORB B;  5HL1 A;  1IIO A;  3CZ0 A;  3KHE A;  2BL0 B;  1DEL A;  1TNP A;  4YGC B;  1KWO C;  1QJT A;  3FE6 A;  4GGN A;  3TUY C;  3PM8 A;  3CZ2 A;  4CFQ A;  2WC8 A;  1KSM A;  3BFB A;  4PAL A;  3CZT X;  3S0F A;  1FPW A;  1NX3 A;  2LUX A;  3KPX A;  3OB2 B;  2Y5I A;  3OGN A;  1J7O A;  2BBM A;  2ZND A;  4DS7 A;  3R1P A;  1A03 A;  3SG2 A;  1A75 A;  1JBA A;  1EG4 A;  1RFJ A;  3N7H A;  2F3Z A;  3PJI A;  4GFT A;  1DF0 A;  1QAS A;  2WOS A;  1KQV A;  4MZJ A;  2H61 A;  2ZKM X;  4WRI A;  1OOF A;  2AAO A;  1H8B A;  2KNE A;  3AKB A;  2SCP A;  1KK7 Z;  1Y1U A;  2F3Y A;  2LAP A;  2L51 A;  2LE9 B;  1JUO A;  2NZ0 A;  1OSA A;  2LLU A;  2Q91 A;  4GGF C;  2M3W A;  1DF0 B;  2K2A A;  2LUC A;  1ALV A;  1TTX A;  3S0D A;  1NP8 A;  4PHM A;  5I8N A;  1OQP A;  2KFF A;  3CR4 X;  1OMR A;  2I94 A;  1QLK A;  1S36 A;  2EC6 C;  4JPZ B;  4HRG A;  3TUY B;  3Q8I A;  1LA0 A;  3CZ1 A;  1MWN A;  1RTP 1;  1QVI Z;  3NSL A;  1CTR A;  1NX1 A;  4E68 A;  1KCY A;  1F4Q A;  1IJ5 A;  1DJY A;  4TNC A;  2KFG A;  4OV2 A;  3I5G C;  1RK9 A;  3DZT A;  4M2P A;  2ZRT A;  1GM0 A;  3ZWH A;  1KFX S;  1R2U A;  2LVJ A;  1UHJ A;  1Y0V H;  2FOT A;  4MLW A;  3D0Y B;  5DKR A;  4Q04 A;  1U5I A;  2CT9 A;  1W7I B;  1BG1 A;  1EG3 A;  1KFX L;  1M39 A;  4P2Y B;  1QX2 A;  3VGO A;  2V53 A;  4C0J A;  2CTN A;  1NYA A;  3BUO B;  2I7A A;  4GNK B;  2JT8 A;  3PSR A;  1HQV A;  1PK0 D;  1S5G Z;  1YUT A;  4C0L A;  1K8U A;  2GV5 A;  3AAJ A;  1IRJ A;  3S0A A;  1QV1 A;  3NGV A;  2BE4 A;  2G2B A;  2KBI A;  2QEO A;  1SW8 A;  2KFH A;  1KK8 C;  4MZL A;  2HPS A;  5AER A;  2BE6 A;  3I5F C;  3SJS A;  1W7J B;  2EHB A;  2JWW A;  2LAN A;  2LHL A;  3D10 A;  3I5H C;  4I5K A;  4N5X A;  1YUR A;  1SNL A;  2ZNE A;  5D3O A;  4OKH A;  2M7N A;  3CYZ A;  3NHI A;  2PAL A;  2SAS A;  2KDH A;  1MQ1 A;  2PRU A;  1ORG A;  1SKT A;  1PSR A;  2WCH A;  3I5G B;  1B7T Y;  2GGM A;  2JQ6 A;  2P6B B;  2R2I A;  4PE0 A;  2L4H A;  1CFF A;  1CM1 A;  3SIA A;  4YBH B;  5JJG A;  3LK0 A;  2KGR A;  3HCM A;  3DVJ A;  4U8D A;  1FI5 A;  1CM4 A;  2KAY A;  1QLS A;  2E6W A;  5J3X A;  1PUL A;  3BFA A;  1PRW A;  2MRD A;  1V1F A;  1ZMZ A;  3B87 A;  2LNK A;  3NSO A;  5HKZ A;  5AEQ A;  2KQY A;  1Y6W A;  1KK8 B;  5KSZ A;  2JTT A;  3NHT A;  5GQQ C;  3PAT A;  1CDL A;  2HQ8 A;  1BF5 A;  3E3R A;  3I5F B;  1J1D A;  1UHK A;  1BU3 A;  3I5H B;  3DF0 B;  5D69 A;  1RWY A;  1D1O A;  1PVA A;  3BUX B;  4ORA B;  2K7B A;  2M8U A;  1XO5 A;  4L9M A;  1XYD A;  5HLV A;  2HQW A;  2PSR A;  1JF0 A;  2NCO A;  2A4J A;  3SG5 A;  2M0R A;  2YGU A;  1PAL A;  1IQ5 A;  2KOT A;  1CDP A;  1YR5 A;  1OZO A;  1J7P A;  4AOM A;  3O4Y A;  1DJH A;  1SBJ A;  3O78 A;  1UHN A;  2L5X B;  1PSB A;  4MRX A;  1J7R A;  1YVH A;  2JXL A;  1WRZ A;  1SYM A;  2BEC A;  3D76 A;  3NSK A;  4DIR A;  2JTZ A;  4DUQ A;  4NDD A;  3EK7 A;  3B86 A;  3L4L A;  1TUZ A;  4MBE A;  2M9G A;  3BXK A;  1MHO A;  4FQO A;  4M2Q A;  2WCM A;  1G8I A;  1H4B A;  5HLO A;  2HET A;  1S26 D;  2JZI A;  3EG5 B;  2GGZ A;  2FJY A;  5IBW A;  4PE7 A;  1S1E A;  5ER5 A;  5ER4 X;  1DC1 A;  3B88 A;  5F6T A;  1SL8 A;  4JKT A;  3A8R A;  3SS4 A;  4DRW A;  1CB1 A;  1IG5 A;  5AAN A;  4AQI A;  4PCW A;  5DKN A;  2WC6 A;  4PE4 A;  3D78 A;  2WCB A;  4IL1 A;  1NUB A;  2P70 A;  3CGA A;  1MXE A;  1C3Y A;  1CKK A;  3GOF A;  5CPV A;  3EVR A;  2JXC A;  2B1U A;  1M46 A;  1KK7 Y;  2FJU B;  1QIV A;  1XFY O;  2JU0 A;  2K2F A;  1QWV A;  2TN4 A;  4A4C A;  3D73 A;  2Y1M A;  4PDZ A;  1SL9 A;  1F4O A;  2KYC A;  1UUS A;  3AKA A;  4JWQ A;  3TS5 C;  4CLN A;  2K7C A;  5I2L A;  5G08 A;  2M7L A;  1REC A;  4XYN A;  3WXA A;  3CTN A;  1QVI Y;  2G9B A;  2CBL A;  2KAV A;  1NCZ A;  1LVC D;  1AK8 A;  3R1O A;  1S3P A;  1V1G A;  4CFR A;  3L4A A;  3OX5 A;  2M49 B;  2JT0 A;  3EKJ A;  3D0Y A;  1HT9 A;  5JOL A;  1UHH A;  3CS1 A;  1XK4 C;  2LMV A;  2BCX A;  1T14 A;  4IJ7 A;  2LLS A;  2NLN A;  4YI9 A;  1FI6 A;  1EJ3 A;  4FTG A;  3VRN A;  4GPL B;  1UHI A;  3SG6 A;  2KI6 C;  3JVT C;  1B4C A;  2LP2 A;  3V2L A;  4NQG A;  1LA3 A;  2KSP A;  3PFV A;  1S5G Y;  2PVB A;  2LM5 A;  2KI6 D;  1YUU A;  1CNP A;  1JFK A;  1F8H A;  1IGV A;  2AMI A;  1S6C A;  2LV7 A;  1NCX A;  2PAS A;  4GGF A;  2AUC A;  1LS8 A;  1B8L A;  3SS3 A;  1RJV A;  3BUM B;  3K21 A;  5CSN A;  2RGI A;  2QAC A;  3FWB A;  3IQQ A;  1SR6 B;  4YI8 A;  3L47 A;  1XFX O;  3TS5 B;  5FI7 A;  1K90 D;  3EVV A;  3PLF B;  1TNW A;  2BNX A;  4C0K A;  2HF5 A;  3BQ3 A;  3K1E A;  1SY9 A;  1OMV A;  2K60 A;  2K7D A;  1KQM C;  3FE9 A;  2K7O A;  3DD4 A;  1RRO A;  4YRU A;  1C3Z A;  3BUN B;  2KAX A;  2OPO A;  3TDU A;  5I2O A;  1YX8 A;  1AJ5 A;  3BYA A;  3FWC A;  1B8R A;  2KGB C;  3JVT B;  4OR9 B;  5DKQ A;  1YUS A;  4PT1 A;  1DVI A;  3DYE A;  4ORC B;  1MF8 B;  2JNX A;  1E8A A;  1ZOT B;  4GAO A;  1XFU O;  3LCP C;  2CCM A;  5BPJ A;  2QEB A;  3TDZ A;  2QEH A;  4YGA A;  4N1F A;  1NSH A;  2LVI A;  3PM2 A;  2WCK A;  3R1V A;  3DF0 A;  1ZFS A;  4INX A;  1OOH A;  2BCA A;  1FW4 A;  1Q80 A;  1OMD A;  1Z4H A;  1R6P A;  2KBM A;  4NDC A;  3EVU A;  4MVF A;  1KQM B;  3HX4 A;  2M1K B;  1J7Q A;  4OVN F;  1IQ3 A;  1C7W A;  2PYQ A;  1SCV A;  1XFR A;  4FQT A;  4ZCU A;  2L2E A;  4WQ2 A;  1DT7 B;  1BR1 B;  3CR2 A;  3DVE A;  1ZAC A;  3KO0 A;  3WHT B;  2MHH A;  3BOW B;  4HRH A;  1SRA A;  1B47 A;  5KTY A;  2DOQ A;  2H8V A;  1J55 A;  2OS8 C;  4OCI A;  2K0J A;  5CSF A;  2WCE A;  5FI6 A;  3JTD C;  2L5Y A;  2OTG C;  1DGV A;  4PHK A;  1GGW A;  1OE9 B;  1QAT A;  1UP5 A;  2QPT A;  3OHM B;  4OZD A;  1TWO A;  2CXJ A;  2L4I A;  3I5I C;  4A4B A;  3A4U B;  1UUR A;  3AAK A;  2KI4 C;  1TNX A;  5PAL A;  1GQM A;  1K96 A;  1MUX A;  5HKY A;  1OOG A;  1P28 A;  1KFU S;  1N2D A;  1JWD A;  4MZK A;  4XJK B;  1OZS A;  1K93 D;  1K95 A;  3GK2 A;  3O4X A;  3VRP A;  3B6X A;  2KQ6 A;  2WND A;  2L2C A;  1ALW A;  2CNP A;  1F54 A;  2LCP A;  1TCO B;  1OW4 A;  2ISD A;  2L0P A;  3CDN A;  3H4S E;  4QJ3 B;  4M2O A;  1SSE B;  2ERB A;  3CAB A;  4HRE E;  3S0E A;  4I5J A;  1W9Z A;  3D74 A;  4HSZ A;  4PHJ A;  1YX7 A;  3SG4 A;  2WCF A;  3CR5 X;  2OS8 B;  3GK4 X;  3LK1 A;  1OOI X;  3D77 A;  1TRF A;  3EK8 A;  1QTX A;  3JTD B;  2OTG B;  1J1E A;  4DCK A;  4ICB A;  2LP3 A;  1K2H A;  3F45 A;  3I5I B;  5FYX A;  3VB1 A;  1M45 A;  1K9P A;  1AHR A;  1DQE A;  2KI4 B;  1Z2C B;  3BFH A;  1GGZ A;  1S6I A;  1WDC B;  2JPO A;  1LIN A;  1WLZ A;  3DVK A;  3IVT A;  4WQ3 A;  3SS5 A;  1YRT B;  2MLF C;  1SCM C;  4YGB B;  3VRQ A;  2COL B;  2E30 A;  1TUJ A;  2H61 C;  2MJW B;  1SR6 C;  1BT6 A;  2L50 A;  1FF1 A;  5CSJ A;  1QS7 A;  2GTE A;  5HYD A;  1QX7 A;  1F70 A;  1TN4 A;  2JNF A;  4D1E A;  1F55 A;  2WC5 A;  4PHN A;  1BR4 B;  4F0Z B;  3FE8 A;  1MXL C;  3TDI A;  1CFC A;  1SPY A;  4GBA A;  3VRO A;  1DMO A;  1CLL A;  1TCF A;  2FCE A;  1EL4 A;  1SMG A;  2MLE C;  4MSP A;  2JOJ A;  1SL7 A;  1Y1X A;  4INW A;  1N0Y A;  3ICB A;  1CLM A;  3GK1 A;  1JC2 A;  1DGU A;  2BBN A;  5CSI A;  1GJY A;  1IH0 A;  5TNC A;  4QJ5 B;  3OBV A;  3QME A;  3QRX A;  5AXI A;  1A75 B;  3LLE A;  1QV0 A;  1AP4 A;  1BJF A;  2KLD A;  4R1E A;  2H2K A;  4USL A;  3O6B A;  3KEV A;  1YRU B;  1SCM B;  1B1G A;  2LMU A;  2BKI B;  4AQJ A;  1NPQ A;  3PN7 C;  4BY5 A;  1CMG A;  1IJ6 A;  1KWO B;  5FI2 A;  2K61 A;  3D75 A;  2M1U A;  2KPH A;  1XK4 A;  1WRK A;  4NDB A;  5B8I B;  2Q4U A;  4N1G A;  5I2Q A;  4CPV A;  1DJX A;  1CFD A;  4MN0 A;  1CLB A;  2ZN9 A;  4I5L B;  1WLM A;  2F2O A;  2MAZ A;  1XFV O;  2JRF A;  2KHN A;  2M29 A;  2P71 A;  3S0G A;  4QJ4 B;  1JSA A;  3OX6 A;  4I5N B;  4P5O E;  4ZCV A;  1NX0 A;  3DXL A;  1B9A A;  2L98 A;  2LMT A;  4CID A;  1K9K A;  2LVV A;  1XA5 A;  2K8M B;  1IKU A;  3RZS A;  2PMY A;  1DJZ A;  3BJH A;  4F7F A;  5EL2 A;  1U5I B;  1QXP A;  3C1V A;  1JF2 A;  2ZRS A;  2LLT A;  1NWD A;  3OP0 A;  1M31 A;  1CDM A;  2BCB A;  2JC2 A;  2WCJ A;  2QEV A;  3PN7 B;  3RM1 A;  2BAP A;  2EC6 B;  1X02 A;  2JPT A;  2JT3 A;  3FIA A;  2I2R E;  5D7F A;  1XFZ O;  2ZFD A;  3WNX B;  2F8P A;  3IF7 A;  3BOW A;  1G4Y R;  1CMF A;  1CDN A;  3DY9 A;  5K89 A;  4JD9 A;  3WHU B; 
#chains in the Genus database with same CATH homology
 1L2O C;  3IQO A;  1AJ4 A;  3FS7 A;  5AFP A;  1IWQ A;  2F33 A;  1AUI B;  3VRR A;  1VRK A;  1F71 A;  2EGD A;  1YVL A;  1DTL A;  1BOD A;  2VRG A;  1BOC A;  1B7T Z;  2LHI A;  1JFJ A;  1DJG A;  1Y1A A;  3NXA A;  3EKH A;  2D8N A;  2MA2 A;  4XJK A;  2NCP A;  1EXR A;  1A2X A;  1S6J A;  1WRL A;  1YTZ C;  3CWG A;  3LL8 B;  4YGE B;  3RLZ A;  2I18 A;  3ZNI A;  1BLQ A;  1OOJ A;  4PE1 A;  1K94 A;  2LVK A;  3O2P A;  3CLN A;  1KSO A;  2WOR A;  3M0W A;  1WDC C;  1TNQ A;  1K9U A;  1WY9 A;  4JQ0 D;  2MBX A;  2M97 A;  1CFP A;  1NCY A;  2BL0 C;  1KFU L;  1B8C A;  1NIW A;  1FBV A;  2O5G A;  2BKH B;  5KU1 A;  4UPG A;  1L2O B;  1M63 B;  1MR8 A;  4C0L A;  2NXQ A;  1A4P A;  2IS9 A;  4MEW A;  3SG3 A;  2LC5 A;  1QX5 B;  2ZN8 A;  3NSI A;  3TZ1 A;  1PVB A;  2JUL A;  1ODB A;  1BMO A;  2F2P A;  1UWO A;  1ZUZ A;  1NX2 A;  1C7V A;  1TIZ A;  2Y4Q A;  1LXF C;  4MRY A;  3SG7 A;  1C07 A;  1TOP A;  1G33 A;  1SK6 D;  1N65 A;  4GUK A;  3SIB A;  1DJW A;  4YGD B;  1XVJ A;  2FCD A;  3KF9 A;  1XFW O;  3EK4 A;  2KYF A;  1A29 A;  4ETO A;  2Y1N A;  5HKW A;  1LKJ A;  3OB1 B;  1EH2 A;  3DVM A;  1DJI A;  2O60 A;  3BUW B;  3PAL A;  1AVS A;  1L7Z A;  4BY4 A;  3MSE B;  1QIW A;  4ORB B;  3KHE A;  2BL0 B;  1TNP A;  4YGC B;  1KWO C;  1QJT A;  4GGN A;  3TUY C;  3PM8 A;  4CFQ A;  2WC8 A;  1KSM A;  4PAL A;  3CZT X;  1FPW A;  1NX3 A;  2LUX A;  3KPX A;  3OB2 B;  2Y5I A;  1J7O A;  2BBM A;  2ZND A;  4DS7 A;  1A03 A;  3SG2 A;  1A75 A;  1JBA A;  1EG4 A;  1RFJ A;  2F3Z A;  4GFT A;  1DF0 A;  1QAS A;  2WOS A;  1KQV A;  4MZJ A;  2H61 A;  2ZKM X;  4WRI A;  2AAO A;  1H8B A;  2KNE A;  3AKB A;  2SCP A;  1KK7 Z;  1Y1U A;  2F3Y A;  2LAP A;  2L51 A;  2LE9 B;  1JUO A;  2NZ0 A;  1OSA A;  2LLU A;  2Q91 A;  4GGF C;  2M3W A;  1DF0 B;  2K2A A;  2LUC A;  1ALV A;  1TTX A;  1NP8 A;  4PHM A;  5I8N A;  1OQP A;  2KFF A;  3CR4 X;  1OMR A;  2I94 A;  1QLK A;  1S36 A;  2EC6 C;  4JPZ B;  4HRG A;  3TUY B;  1LA0 A;  1MWN A;  1RTP 1;  1QVI Z;  3NSL A;  1CTR A;  1NX1 A;  4E68 A;  1KCY A;  1F4Q A;  1IJ5 A;  1DJY A;  4TNC A;  2KFG A;  4OV2 A;  3I5G C;  1RK9 A;  4M2P A;  2ZRT A;  3ZWH A;  1KFX S;  1R2U A;  2LVJ A;  1UHJ A;  1Y0V H;  2FOT A;  4MLW A;  3D0Y B;  5DKR A;  4Q04 A;  1U5I A;  2CT9 A;  1W7I B;  1BG1 A;  1EG3 A;  1KFX L;  1M39 A;  4P2Y B;  1QX2 A;  3VGO A;  2V53 A;  4C0J A;  2CTN A;  1NYA A;  3BUO B;  2I7A A;  4GNK B;  2JT8 A;  3PSR A;  1HQV A;  1PK0 D;  1S5G Z;  1YUT A;  1K8U A;  2GV5 A;  3AAJ A;  1IRJ A;  1QV1 A;  2BE4 A;  2G2B A;  2KBI A;  1SW8 A;  2KFH A;  1KK8 C;  4MZL A;  2HPS A;  5AER A;  2BE6 A;  3I5F C;  3SJS A;  1W7J B;  2EHB A;  2JWW A;  2LAN A;  2LHL A;  3D10 A;  3I5H C;  4I5K A;  4N5X A;  1YUR A;  1SNL A;  2ZNE A;  4OKH A;  2M7N A;  2PAL A;  2SAS A;  2KDH A;  1MQ1 A;  2PRU A;  1SKT A;  1PSR A;  3I5G B;  1J7P A;  1B7T Y;  2GGM A;  2JQ6 A;  2P6B B;  2R2I A;  4PE0 A;  2L4H A;  1CFF A;  1CM1 A;  3SIA A;  4YBH B;  5JJG A;  3LK0 A;  2KGR A;  3HCM A;  3DVJ A;  4U8D A;  1FI5 A;  1CM4 A;  2KAY A;  1QLS A;  2E6W A;  5J3X A;  1PUL A;  1PRW A;  2MRD A;  1V1F A;  1ZMZ A;  3NSO A;  2LNK A;  5HKZ A;  5AEQ A;  2KQY A;  1Y6W A;  1KK8 B;  5KSZ A;  2JTT A;  5GQQ C;  3PAT A;  1CDL A;  2HQ8 A;  1BF5 A;  3E3R A;  3I5F B;  1J1D A;  1UHK A;  1BU3 A;  3I5H B;  3DF0 B;  5D69 A;  1RWY A;  1D1O A;  1PVA A;  3BUX B;  4ORA B;  2K7B A;  2M8U A;  1XO5 A;  4L9M A;  1XYD A;  5HLV A;  2HQW A;  2PSR A;  1JF0 A;  2NCO A;  2A4J A;  3SG5 A;  2M0R A;  1PAL A;  1IQ5 A;  2KOT A;  1CDP A;  1YR5 A;  1OZO A;  4AOM A;  3O4Y A;  1DJH A;  1SBJ A;  3O78 A;  1UHN A;  2L5X B;  1PSB A;  4MRX A;  1J7R A;  1YVH A;  2JXL A;  1WRZ A;  1SYM A;  2BEC A;  3NSK A;  4DIR A;  4DUQ A;  2JTZ A;  3EK7 A;  4MBE A;  2M9G A;  3BXK A;  1MHO A;  4FQO A;  4M2Q A;  1G8I A;  1H4B A;  5HLO A;  2HET A;  1S26 D;  2JZI A;  2GGZ A;  5IBW A;  4PE7 A;  1S1E A;  5ER5 A;  5ER4 X;  5F6T A;  1SL8 A;  3A8R A;  4DRW A;  1CB1 A;  1IG5 A;  5AAN A;  4AQI A;  4PCW A;  5DKN A;  4PE4 A;  2WCB A;  4IL1 A;  1NUB A;  3CGA A;  1MXE A;  1CKK A;  3GOF A;  5CPV A;  3EVR A;  2JXC A;  2B1U A;  1M46 A;  1KK7 Y;  2FJU B;  1QIV A;  1XFY O;  2JU0 A;  2K2F A;  2TN4 A;  4A4C A;  2Y1M A;  4PDZ A;  1SL9 A;  1F4O A;  2KYC A;  1UUS A;  3AKA A;  4JWQ A;  3TS5 C;  4CLN A;  2K7C A;  5I2L A;  5G08 A;  2M7L A;  1REC A;  4XYN A;  3WXA A;  3CTN A;  1QVI Y;  2G9B A;  2CBL A;  2KAV A;  1NCZ A;  1LVC D;  1AK8 A;  1S3P A;  1V1G A;  4CFR A;  3OX5 A;  2M49 B;  2JT0 A;  3EKJ A;  3D0Y A;  1HT9 A;  5JOL A;  1UHH A;  3CS1 A;  1XK4 C;  2LMV A;  2BCX A;  2LLS A;  2NLN A;  4YI9 A;  1FI6 A;  1EJ3 A;  4FTG A;  3VRN A;  4GPL B;  1UHI A;  3SG6 A;  2KI6 C;  3JVT C;  1B4C A;  2LP2 A;  4NQG A;  1LA3 A;  2KSP A;  3PFV A;  1S5G Y;  2PVB A;  2LM5 A;  2KI6 D;  1YUU A;  1CNP A;  1JFK A;  1F8H A;  1IGV A;  2AMI A;  1S6C A;  2LV7 A;  1NCX A;  2PAS A;  4GGF A;  2AUC A;  1B8L A;  1RJV A;  3BUM B;  3K21 A;  5CSN A;  2RGI A;  2QAC A;  3FWB A;  3IQQ A;  1SR6 B;  4YI8 A;  1XFX O;  3TS5 B;  1K90 D;  3EVV A;  3PLF B;  1TNW A;  4C0K A;  2HF5 A;  3BQ3 A;  1SY9 A;  1OMV A;  2K7D A;  1KQM C;  2K7O A;  3DD4 A;  1RRO A;  4YRU A;  3BUN B;  2KAX A;  2OPO A;  3TDU A;  5I2O A;  1YX8 A;  1AJ5 A;  3BYA A;  3FWC A;  1B8R A;  2KGB C;  3JVT B;  4OR9 B;  5DKQ A;  1YUS A;  1DVI A;  4ORC B;  1MF8 B;  2JNX A;  1E8A A;  1ZOT B;  4GAO A;  1XFU O;  3LCP C;  2CCM A;  5BPJ A;  3TDZ A;  4YGA A;  4N1F A;  1NSH A;  2LVI A;  3DF0 A;  1ZFS A;  2BCA A;  1FW4 A;  1Q80 A;  1OMD A;  1R6P A;  2KBM A;  4NDC A;  3EVU A;  4MVF A;  1KQM B;  3HX4 A;  2M1K B;  1J7Q A;  4OVN F;  1IQ3 A;  1C7W A;  4ZCU A;  1SCV A;  2L2E A;  4WQ2 A;  1DT7 B;  1BR1 B;  3CR2 A;  3DVE A;  1ZAC A;  3KO0 A;  3WHT B;  2MHH A;  3BOW B;  4HRH A;  1SRA A;  1B47 A;  5KTY A;  2DOQ A;  2OS8 C;  1J55 A;  4OCI A;  2K0J A;  5CSF A;  2WCE A;  3JTD C;  2OTG C;  4PHK A;  1DGV A;  1GGW A;  1OE9 B;  1QAT A;  1UP5 A;  2QPT A;  3OHM B;  2CXJ A;  2L4I A;  3I5I C;  4A4B A;  3A4U B;  1UUR A;  3AAK A;  2KI4 C;  1TNX A;  5PAL A;  1GQM A;  1K96 A;  1MUX A;  5HKY A;  1KFU S;  1N2D A;  1JWD A;  4MZK A;  4XJK B;  1OZS A;  1K93 D;  1K95 A;  3GK2 A;  3VRP A;  2KQ6 A;  2WND A;  1ALW A;  2CNP A;  1F54 A;  2LCP A;  1TCO B;  2ISD A;  2L0P A;  3H4S E;  4QJ3 B;  4M2O A;  4HRE E;  4I5J A;  4HSZ A;  4PHJ A;  1YX7 A;  3SG4 A;  2WCF A;  3CR5 X;  2OS8 B;  3GK4 X;  3LK1 A;  1TRF A;  3EK8 A;  1QTX A;  3JTD B;  2OTG B;  1J1E A;  4DCK A;  4ICB A;  2LP3 A;  1K2H A;  3F45 A;  3I5I B;  5FYX A;  1M45 A;  1K9P A;  1AHR A;  2KI4 B;  1GGZ A;  1S6I A;  1WDC B;  1LIN A;  1WLZ A;  3DVK A;  4WQ3 A;  3VRQ A;  1YRT B;  2MLF C;  1SCM C;  4YGB B;  2COL B;  2E30 A;  2H61 C;  2MJW B;  1SR6 C;  1BT6 A;  2L50 A;  1FF1 A;  5CSJ A;  1QS7 A;  5HYD A;  1QX7 A;  1F70 A;  1TN4 A;  2JNF A;  4D1E A;  1F55 A;  4PHN A;  1BR4 B;  4F0Z B;  1MXL C;  3TDI A;  1CFC A;  1SPY A;  4GBA A;  3VRO A;  1DMO A;  1CLL A;  1TCF A;  2FCE A;  1EL4 A;  1SMG A;  2MLE C;  4MSP A;  2JOJ A;  1SL7 A;  1Y1X A;  1N0Y A;  3ICB A;  1CLM A;  3GK1 A;  1JC2 A;  1DGU A;  2BBN A;  5CSI A;  1GJY A;  1IH0 A;  5TNC A;  4QJ5 B;  3QRX A;  5AXI A;  1A75 B;  3LLE A;  1QV0 A;  1AP4 A;  1BJF A;  4R1E A;  2H2K A;  4USL A;  3O6B A;  3KEV A;  1YRU B;  1SCM B;  1B1G A;  2LMU A;  2BKI B;  4AQJ A;  1NPQ A;  3PN7 C;  4BY5 A;  1CMG A;  1IJ6 A;  1KWO B;  2K61 A;  2M1U A;  1XK4 A;  1WRK A;  4NDB A;  5B8I B;  2Q4U A;  4N1G A;  5I2Q A;  4CPV A;  1DJX A;  1CFD A;  4MN0 A;  1CLB A;  2ZN9 A;  4I5L B;  1WLM A;  2F2O A;  2MAZ A;  1XFV O;  2JRF A;  2KHN A;  2M29 A;  4QJ4 B;  1JSA A;  3OX6 A;  4I5N B;  4P5O E;  4ZCV A;  1NX0 A;  1B9A A;  2L98 A;  2LMT A;  4CID A;  1K9K A;  2LVV A;  1XA5 A;  2K8M B;  1IKU A;  2PMY A;  1DJZ A;  1U5I B;  1QXP A;  3C1V A;  1JF2 A;  2ZRS A;  2LLT A;  1NWD A;  3OP0 A;  1M31 A;  1CDM A;  2BCB A;  2JC2 A;  3PN7 B;  3RM1 A;  2EC6 B;  1X02 A;  2JPT A;  2JT3 A;  3FIA A;  2I2R E;  5D7F A;  1XFZ O;  2ZFD A;  3WNX B;  2F8P A;  3IF7 A;  3BOW A;  1G4Y R;  1CMF A;  1CDN A;  5K89 A;  4NDD A;  3WHU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...