2I94A

Nmr structure of recoverin bound to rhodopsin kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
182
Chain Sequence
ALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title Structural Basis for Calcium-induced Inhibition of Rhodopsin Kinase by Recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein binding
total genus 45
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2i94A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2i94A01
2R2IA 4NQGA 1B1GA 2QACA 2LP3A 2E6WA 1QX2A 4OVNF 1CM1A 3O6BA 1K9UA 1YURA 2I2RE 3KHEA 1WRKA 1AUIB 1E8AA 5CPVA 1YX7A 1RTP1 2F33A 4UPGA 5I2OA 3BOWA 1KK8C 1B47A 1YRTB 3I5FB 4C0LA 4ORAB 1PRWA 3BUOB 2ZKMX 1KWOB 2JU0A 2HF5A 2MRDA 1A4PA 2KAYA 1SMGA 1LVCD 1X02A 2LUXA 2CT9A 4YI9A 2LMUA 5GQQC 3H4SE 1J7RA 4FTGA 1BOCA 1SRAA 1CLBA 4A4CA 1QATA 1S3PA 1SCMC 1CDMA 1UWOA 5AANA 3VGOA 4HREE 5JJGA 1SL9A 1CDLA 2EC6B 2M7NA 3EK8A 5J3XA 2K0JA 2CTNA 4I5JA 4MRXA 1F54A 1M39A 4GGFC 3SG6A 1YVLA 1OSAA 4E68A 4PE4A 5CSFA 1Y1UA 1S6IA 1PALA 2K2AA 1YTZC 1DJIA 3TDIA 3PALA 5AXIA 4YGEB 1DJHA 3IQOA 4OKHA 2FJUB 4N1FA 1RWYA 2GV5A 5IBWA 2JT3A 4QJ4B 1NUBA 2KSPA 4C0KA 2I94A 4GAOA 4TNCA 2GGZA 1CLLA 1DJGA 1JFJA 2K61A 1NPQA 3NSIA 2LV7A 2LMVA 3TUYB 2PMYA 4DIRA 1F70A 2MHHA 1G8IA 3HX4A 4IL1A 1L2OC 1OMVA 1V1FA 2M8UA 1KQMB 1B8RA 3CS1A 3SIBA 1KSOA 2FCEA 2MJWB 1DJWA 4L9MA 1BLQA 1JC2A 4NDDA 1BU3A 1VRKA 1K2HA 2JNXA 1HQVA 1J1DA 1K93D 3WHTB 1QLSA 3SG3A 1PVAA 3LK0A 1DF0A 3AAKA 3I5HB 3DVKA 1RFJA 1K94A 2KI4C 4DRWA 1UHNA 1NX1A 2LE9B 3RM1A 1CTRA 2JT8A 3IQQA 1CFFA 5DKRA 3OB1B 1CB1A 4WQ3A 2JZIA 2MLFC 2K7CA 4BY4A 2BCXA 3JVTC 3O4YA 3SJSA 4N1GA 1DMOA 5F6TA 2F8PA 1S1EA 4NDCA 1YUSA 1NYAA 1QIVA 2LCPA 3FS7A 2I7AA 3BOWB 3D10A 4P5OE 2BL0B 2K7BA 1ALVA 1TIZA 2M1KB 2KQYA 2JWWA 2JOJA 1SPYA 1QTXA 1FI5A 2OS8C 3BUMB 3PATA 1L7ZA 1U5IA 5ER4X 3WHUB 1SBJA 1CMFA 1WDCC 1YUUA 1RJVA 3I5GB 5BPJA 1CNPA 1NSHA 2LUCA 2M29A 5D69A 2LM5A 1AP4A 1W7IB 3OB2B 4MEWA 1NX0A 2IS9A 1UHHA 4XJKA 3KEVA 2WCEA 2HQWA 2LMTA 2NLNA 1F4OA 5JOLA 2LLSA 2PSRA 3TDZA 2KAXA 2PRUA 4XYNA 3I5IB 1N0YA 4N5XA 1B8CA 3IF7A 3AKBA 3TS5B 1H8BA 3EKJA 1QV1A 2L98A 5HKZA 1J7QA 2M1UA 1Y6WA 2TN4A 3BUWB 1ZMZA 2CNPA 2JRFA 1XK4A 4PHJA 2L4HA 1JFKA 1AHRA 2BECA 1YX8A 1NCYA 2P6BB 2A4JA 1TTXA 1QASA 1GQMA 2KBIA 1J1EA 4OCIA 4YGDB 1KSMA 2BKHB 4MLWA 1LA3A 1MR8A 4CIDA 2CXJA 1JWDA 1UP5A 1N2DA 1K9KA 5HLVA 3KF9A 1FI6A 2KFHA 3BYAA 1DGUA 3A4UB 2KDHA 1NX3A 1AJ5A 2BCBA 1CDPA 1F4QA 2BKIB 1OOJA 2L0PA 2KGRA 1OQPA 4Q04A 2JPTA 3ICBA 2BE6A 2GGMA 1CMGA 1DF0B 1FBVA 3EVRA 2WCFA 4YRUA 3A8RA 3CZTX 1UUSA 2O60A 2M49B 5ER5A 4JQ0D 4AQIA 5DKNA 1AK8A 1BJFA 1PSBA 2M0RA 2D8NA 1XFUO 2K2FA 3DVMA 4GFTA 1ALWA 3ZNIA 4GBAA 1JUOA 1V1GA 4MZLA 1IQ5A 1QS7A 2LANA 2WCBA 3I5FC 1TN4A 2WC8A 4PCWA 1KWOC 1TOPA 3CTNA 1RROA 1TNQA 2JTTA 1IJ6A 3CGAA 1LKJA 1IGVA 1XYDA 2BBMA 1QVIY 3JTDB 1B7TY 3EK7A 1YRUB 1XFYO 2E30A 4HRHA 1M31A 1SR6B 1U5IB 2MLEC 1QLKA 2EC6C 2PVBA 2Y5IA 2NXQA 1YR5A 2JNFA 1PSRA 1ZFSA 3F45A 1OMRA 1XFZO 3KPXA 1OMDA 3EK4A 5I2LA 2BBNA 2RGIA 4FQOA 2Q4UA 4YGBB 1R6PA 2OTGB 5I2QA 1MWNA 4XJKB 3MSEB 2KBMA 4MN0A 1KCYA 3RLZA 4MSPA 1SL8A 4YI8A 4CPVA 1CDNA 4ORCB 1NX2A 5HYDA 2F3YA 3D0YA 5PALA 1WLZA 1IH0A 1KFXL 4JWQA 2ZN9A 1EJ3A 1JF2A 1QIWA 2EGDA 3GK4X 1NWDA 2AMIA 2LVKA 3PM8A 5FYXA 1UHIA 2LHLA 4PE1A 1A03A 3TUYC 1FW4A 1J7OA 1QVIZ 2F2PA 3DD4A 1J7PA 1PK0D 1B7TZ 2DOQA 2H61C 3DF0A 3PSRA 1BR4B 2OPOA 1SR6C 2PASA 4AQJA 2I18A 1SYMA 1KQMC 2FCDA 1WLMA 1IQ3A 1B8LA 1OE9B 1CFPA 1QV0A 1A2XA 2LNKA 2HPSA 2WORA 2ZFDA 4P2YB 2M97A 4PE7A 4PDZA 5K89A 2JXLA 1C7WA 4DCKA 1HT9A 3CR2A 1F71A 1TCFA 1K9PA 3PLFB 3PN7B 3I5HC 1SL7A 3FWCA 1MHOA 4CFQA 5AFPA 2SASA 2NZ0A 1IG5A 2M3WA 3SIAA 2MBXA 1ODBA 1SK6D 2JULA 3FIAA 1DJZA 2LVVA 3WNXB 2LVJA 1DT7B 3AAJA 1OZSA 1KK8B 3K21A 1H4BA 1Y1XA 1NCZA 3GOFA 5HKYA 4ETOA 2NCOA 2FOTA 2G2BA 1SNLA 4HSZA 4MBEA 1J55A 2LLTA 2LAPA 4AOMA 1TNXA 3OHMB 4OV2A 1IWQA 2WOSA 1BT6A 1K90D 2COLB 2LLUA 3LCPC 4ZCVA 1XO5A 2BL0C 1WRLA 3DVEA 1BF5A 1SCMB 2HETA 3EVVA 1WRZA 4WQ2A 1B4CA 2B1UA 1IKUA 3PFVA 3VRPA 4WRIA 2H2KA 4PE0A 1XVJA 1QX5B 2Y1NA 4GNKB 4HRGA 4ZCUA 2BE4A 1YVHA 3CLNA 4I5NB 2F3ZA 1ZACA 1ZUZA 3E3RA 5TNCA 4CFRA 5KTYA 1JSAA 2CCMA 3I5GC 2SCPA 3PN7C 2PALA 4I5LB 2M7LA 1M45A 1M46A 2KGBC 3NSOA 4MZKA 3CR4X 2KQ6A 4M2OA 1RK9A 1QJTA 3LL8B 3M0WA 4U8DA 2JXCA 1UURA 1GGZA 2KYFA 1EH2A 1S36A 1SCVA 1ZOTB 1MQ1A 2Y1MA 3I5IC 1JF0A 1XFXO 2MA2A 3O78A 3TS5C 1S5GZ 4D1EA 4A4BA 3D0YB 1A75A 2AAOA 2LHIA 1AVSA 4MVFA 3LK1A 5D7FA 2KHNA 4YGAA 1L2OB 1IRJA 1EXRA 1PVBA 1MXLC 3ZWHA 5KSZA 1TNPA 3VROA 1Y0VH 3GK1A 2KOTA 1S6JA 3QRXA 1XFWO 1NCXA 2JT0A 4NDBA 1TNWA 2NCPA 3TDUA 2Q91A 1AJ4A 3DF0B 3OX6A 1F55A 5CSNA 1Q80A 1OZOA 4GGFA 4R1EA 3GK2A 4PHKA 5HKWA 2KI4B 1UHJA 2LVIA 4MRYA 1GJYA 1G33A 3VRNA 1DVIA 1BODA 2ISDA 3TZ1A 4GPLB 4DS7A 1YUTA 3C1VA 1SY9A 1F8HA 2VRGA 1K8UA 2KFGA 1C07A 2JTZA 3JVTB 5AEQA 1CFDA 1PULA 2L50A 2ZNDA 4MZJA 2O5GA 5I8NA 1EG3A 1MXEA 1NIWA 2ZRTA 2CBLA 3AKAA 4ORBB 3OX5A 1QXPA 1TRFA 2ZRSA 4PHMA 1XA5A 1MF8B 1LINA 2BCAA 4ICBA 4OR9B 5AERA 1IJ5A 2L4IA 1DJYA 1DJXA 4PHNA 2OS8B 4C0JA 1KK7Y 2M9GA 1C7VA 2F2OA 2WNDA 3CWGA 2G9BA 2L2EA 3NXAA 1K95A 1A29A 1WDCB 1R2UA 1LA0A 5G08A 5KU1A 1GGWA 2LP2A 2QPTA 4BY5A 1KFUL 3JTDC 5CSJA 1DGVA 1UHKA 1S26D 3LLEA 2AUCA 1LXFC 4PALA 2HQ8A 1SW8A 4QJ3B 1D1OA 1NP8A 3EVUA 3DVJA 4GUKA 1K96A 2MAZA 2Y4QA 3SG4A 2KAVA 3WXAA 1BMOA 4USLA 3FWBA 5HLOA 2L5XB 3BUNB 1RECA 1XFVO 2K8MB 2OTGC 2KFFA 1EL4A 1CLMA 3EKHA 3OP0A 3BXKA 2ZNEA 3CR5X 1N65A 1WY9A 4YGCB 2V53A 3NSKA 2JQ6A 2L51A 2KYCA 4DUQA 3VRQA 4CLNA 3HCMA 1M63B 1BR1B 5DKQA 1MUXA 1QX7A 1CFCA 3BUXB 2KNEA 3SG2A 1S6CA 2H61A 1KFXS 1KK7Z 1SKTA 1W7JB 4I5KA 1CKKA 2K7OA 1A75B 3O2PA 1S5GY 3SG5A 5B8IB 1FPWA 1XK4C 1B9AA 1CM4A 4GGNA 1TCOB 2EHBA 4M2PA 2JC2A 1KFUS 5CSIA 4F0ZB 2ZN8A 3VRRA 2K7DA 3KO0A 4JPZB 1FF1A 1KQVA 3NSLA 2KI6D 4M2QA 1BG1A 3SG7A 4YBHB 4QJ5B 2KI6C 2LC5A 1EG4A 3BQ3A 1JBAA 1Y1AA 1DTLA 1G4YR
chains in the Genus database with same CATH superfamily
2R2IA 4NQGA 3SS3A 3NGVA 1B1GA 2QACA 3N7HA 2LP3A 2E6WA 1QX2A 4OVNF 3CZ0A 1CM1A 3O6BA 1K9UA 1YURA 2I2RE 3KHEA 1WRKA 1AUIB 1E8AA 5CPVA 1YX7A 1RTP1 2F33A 4UPGA 4INXA 5I2OA 3BOWA 1KK8C 1B47A 1YRTB 3EG5B 3I5FB 4C0LA 4ORAB 1PRWA 3BUOB 1Z2CB 2ZKMX 1KWOB 2JU0A 2HF5A 2MRDA 1A4PA 2KAYA 1SMGA 1LVCD 1X02A 2LUXA 2CT9A 3PM2A 2LMUA 4YI9A 5GQQC 3H4SE 1J7RA 4FTGA 1DEKA 3QMEA 1BOCA 3DY9A 1SRAA 1CLBA 4A4CA 1QATA 1S3PA 1SCMC 1CDMA 1UWOA 5AANA 3VGOA 1GM0A 4HREE 5JJGA 1SL9A 1CDLA 2EC6B 2M7NA 3EK8A 5J3XA 2K0JA 2CTNA 4I5JA 4MRXA 1F54A 1M39A 4GGFC 3SG6A 1YVLA 1OSAA 4E68A 4PE4A 2JPOA 5CSFA 1Y1UA 1S6IA 1PALA 2K2AA 1YTZC 3BFHA 1DJIA 3TDIA 3L4AA 3PALA 5AXIA 4YGEB 1DJHA 3IQOA 4OKHA 2FJUB 4N1FA 1RWYA 2GV5A 5IBWA 2JT3A 2H8VA 2PQLA 4QJ4B 1NUBA 3RZSA 2KSPA 4C0KA 2I94A 4GAOA 4TNCA 1XFRA 1CLLA 1DJGA 2GGZA 1JFJA 2K61A 1NPQA 3NSIA 2LV7A 2LMVA 3TUYB 2PMYA 4DIRA 1C3YA 3R1VA 1F70A 2MHHA 1G8IA 3HX4A 4IL1A 1L2OC 1OMVA 1V1FA 2M8UA 1KQMB 1DC1A 1B8RA 3CS1A 5DICA 3SIBA 1KSOA 2FCEA 2MJWB 1DJWA 4L9MA 1BLQA 1JC2A 4NDDA 1BU3A 1VRKA 1K2HA 2JNXA 1HQVA 1J1DA 3R1PA 1K93D 3WHTB 1QLSA 3SG3A 1PVAA 3LK0A 2WCKA 1DF0A 3AAKA 3I5HB 3DVKA 1RFJA 1K94A 2KI4C 3R1OA 4DRWA 1UHNA 1NX1A 5FI6A 2LE9B 3O4XA 1CTRA 2JT8A 3IQQA 3RM1A 1CFFA 5DKRA 3OB1B 1CB1A 4WQ3A 2JZIA 2MLFC 2K7CA 3IVTA 2QDIA 4BY4A 2BCXA 3JVTC 3O4YA 3SJSA 4N1GA 1DMOA 5F6TA 2F8PA 1S1EA 1OOGA 4NDCA 1YUSA 1NYAA 1QIVA 2LCPA 3FS7A 2I7AA 3BOWB 3D10A 4P5OE 3D75A 2BL0B 2K7BA 1ALVA 1TIZA 2M1KB 2KQYA 2JWWA 2JOJA 1SPYA 3CABA 1QTXA 1FI5A 2OS8C 3BUMB 3PATA 3B6XA 1L7ZA 1U5IA 5ER4X 3WHUB 1SBJA 1CMFA 1WDCC 1YUUA 1RJVA 3I5GB 5BPJA 1CNPA 1NSHA 1T14A 2LUCA 2M29A 5D69A 2LM5A 1AP4A 1W7IB 2KPHA 3OB2B 4MEWA 3B87A 1NX0A 1C3ZA 1UHHA 2IS9A 4XJKA 3KEVA 2WCEA 2HQWA 2LMTA 2NLNA 1F4OA 4KYNA 5JOLA 2LLSA 2PSRA 3TDZA 2KAXA 2PRUA 4XYNA 3I5IB 1N0YA 3S0DA 4N5XA 1B8CA 3IF7A 3AKBA 3TS5B 1H8BA 3EKJA 1QV1A 2L98A 5HKZA 4F7FA 1J7QA 2M1UA 1Y6WA 2TN4A 3BUWB 3S0EA 1ZMZA 2CNPA 2WCLA 2JRFA 1XK4A 4PHJA 2L4HA 1JFKA 1AHRA 2BECA 1YX8A 1NCYA 2P6BB 3CZ2A 2A4JA 1TTXA 1QASA 1GQMA 2KBIA 1J1EA 4OCIA 4YGDB 1DQEA 1TWOA 1KSMA 2BKHB 4MLWA 1LA3A 3BFBA 1MR8A 4CIDA 2CXJA 3R72A 1JWDA 1UP5A 1N2DA 1K9KA 3PJIA 5HLVA 3KF9A 1FI6A 2KFHA 3BYAA 1DGUA 3A4UB 2KDHA 1NX3A 1AJ5A 2BCBA 1CDPA 1F4QA 1LS8A 2BKIB 1OOJA 2L0PA 4JD9A 2KGRA 1OQPA 4Q04A 2JPTA 3ICBA 2WC5A 2BE6A 2GGMA 1CMGA 1DF0B 1FBVA 3EVRA 2WCFA 4YRUA 3A8RA 3CZTX 1TUJA 1UUSA 2O60A 2M49B 5ER5A 4JQ0D 4AQIA 3D73A 5DKNA 1AK8A 1BJFA 1PSBA 2M0RA 2D8NA 1XFUO 2K2FA 3DVMA 4GFTA 1ALWA 3ZNIA 4GBAA 1JUOA 1V1GA 4MZLA 1IQ5A 1QS7A 2LANA 2WCBA 3I5FC 1TN4A 2WC8A 4PCWA 5D3OA 3OGNA 1KWOC 1DELA 1TOPA 3CTNA 1RROA 1TNQA 2JTTA 1IJ6A 4FQTA 3CGAA 2BAPA 1LKJA 1IGVA 1XYDA 2BBMA 1QVIY 3JTDB 2GTEA 1B7TY 3B86A 3EK7A 1YRUB 3CZ1A 1XFYO 2FJYA 2E30A 4HRHA 1M31A 1SR6B 1U5IB 2MLEC 5I94A 1QLKA 3FE8A 2EC6C 2PVBA 2Y5IA 2NXQA 1OW4A 1YR5A 2JNFA 1PSRA 1ZFSA 3D78A 3K1EA 3F45A 1OMRA 1XFZO 3KPXA 1OMDA 4JKTA 3EK4A 5I2LA 5HL1A 2BBNA 2RGIA 4FQOA 3DYEA 2Q4UA 4YGBB 1R6PA 2OTGB 5I2QA 2QEBA 1MWNA 4XJKB 3B7AA 2KBMA 3MSEB 4MN0A 1KCYA 3RLZA 4MSPA 1SL8A 4YI8A 4CPVA 1CDNA 4ORCB 1NX2A 1SSEB 2F3YA 5HYDA 3D0YA 5PALA 1WLZA 2WC6A 1IH0A 1KFXL 4JWQA 2ZN9A 1EJ3A 1JF2A 1QIWA 2EGDA 3GK4X 1NWDA 2AMIA 2LVKA 3PM8A 3NHIA 5FYXA 1UHIA 5FI2A 2LHLA 4PE1A 1A03A 3TUYC 1FW4A 1J7OA 1QVIZ 2F2PA 3DD4A 1J7PA 1PK0D 1B7TZ 2DOQA 2H61C 3DF0A 3PSRA 1BR4B 2OPOA 1SR6C 2PASA 4INWA 4AQJA 2I18A 1SYMA 1KQMC 2FCDA 1WLMA 1IQ3A 1B8LA 1OE9B 3SS5A 1CFPA 1QV0A 1A2XA 2LNKA 2HPSA 2WORA 2ZFDA 4P2YB 2M97A 4PE7A 4PDZA 5K89A 2JXLA 3S0AA 1C7WA 4DCKA 1HT9A 3CR2A 1F71A 1TCFA 1K9PA 3PLFB 3PN7B 3I5HC 1ORGA 1SL7A 1MHOA 3FWCA 4CFQA 5AFPA 1OOIX 2SASA 2NZ0A 1IG5A 2M3WA 3D74A 3SIAA 2MBXA 2KLDA 1ODBA 1SK6D 2JULA 3FIAA 1DJZA 2LVVA 3WNXB 2LVJA 1DT7B 3AAJA 1OZSA 1KK8B 1TUZA 3K21A 1H4BA 1Y1XA 1NCZA 3GOFA 5HKYA 4ETOA 2NCOA 1IIOA 2FOTA 2G2BA 1SNLA 2K60A 4HSZA 4MBEA 1J55A 2LLTA 2LAPA 4AOMA 1TNXA 3OHMB 4OV2A 2BNXA 1IWQA 2WOSA 1BT6A 1K90D 2COLB 2LLUA 3L47A 3LCPC 4ZCVA 1XO5A 2BL0C 1WRLA 2L2CA 3DVEA 2QEHA 1SCMB 2HETA 1BF5A 3EVVA 1WRZA 4WQ2A 1B4CA 2B1UA 1IKUA 2WCJA 3PFVA 3VRPA 3BFAA 4WRIA 2H2KA 4PE0A 4IJ7A 1XVJA 1QX5B 2Y1NA 4GNKB 4HRGA 4ZCUA 1OOFA 1W9ZA 1YVHA 2BE4A 2F3ZA 1ZACA 1ZUZA 3CLNA 3DXLA 3E3RA 4I5NB 4CFRA 5KTYA 2CCMA 1JSAA 3I5GC 2SCPA 3PN7C 2PALA 4I5LB 2M7LA 1M45A 1M46A 2KGBC 3CDNA 3NSOA 4MZKA 3CR4X 2KQ6A 3CYZA 1RK9A 4M2OA 1QJTA 3LL8B 3M0WA 4U8DA 5EL2A 2JXCA 1UURA 1GGZA 3UNWA 2KYFA 1EH2A 1S36A 4OZDA 1SCVA 1ZOTB 1MQ1A 2Y1MA 3I5IC 1JF0A 3DZTA 1XFXO 2MA2A 3O78A 3TS5C 1S5GZ 4D1EA 4A4BA 3D0YB 1A75A 2AAOA 2LHIA 1AVSA 4MVFA 3LK1A 5D7FA 2KHNA 4YGAA 2KLEA 1L2OB 2YGUA 1IRJA 1EXRA 1PVBA 1MXLC 3ZWHA 5KSZA 1TNPA 2QEOA 3VROA 1Y0VH 3GK1A 2KOTA 1S6JA 2L5YA 3QRXA 1XFWO 3S0FA 1NCXA 2JT0A 4NDBA 1QWVA 1TNWA 2NCPA 3TDUA 2Q91A 1AJ4A 3DF0B 3OX6A 1F55A 5CSNA 1Q80A 1OZOA 4GGFA 4R1EA 3GK2A 2WCHA 4PHKA 5HKWA 2KI4B 1UHJA 3D76A 2LVIA 4MRYA 1GJYA 1G33A 3VRNA 1DVIA 1BODA 2ISDA 3TZ1A 4GPLB 4DS7A 1YUTA 3C1VA 1SY9A 1F8HA 2VRGA 1K8UA 4PT1A 2KFGA 1C07A 2JTZA 3JVTB 5AEQA 1CFDA 1PULA 2L50A 2ZNDA 4MZJA 2O5GA 5I8NA 1EG3A 1MXEA 1NIWA 2ZRTA 2CBLA 3AKAA 4ORBB 3OX5A 1QXPA 2P70A 1TRFA 2ZRSA 5FI7A 3Q8IA 4PHMA 1XA5A 1MF8B 1LINA 2BCAA 4ICBA 4OR9B 5AERA 1IJ5A 2L4IA 1OOHA 1Z4HA 1DJYA 1DJXA 4PHNA 2OS8B 4C0JA 1KK7Y 2M9GA 1C7VA 2F2OA 5TNCA 2WNDA 3CWGA 2G9BA 2L2EA 3NXAA 1K95A 1A29A 2ERBA 1WDCB 1R2UA 1LA0A 3FE9A 5G08A 5KU1A 2LP2A 1GGWA 2QPTA 4BY5A 1KFUL 3JTDC 5CSJA 1DGVA 1UHKA 2P71A 1S26D 3LLEA 2AUCA 1LXFC 4PALA 2HQ8A 1SW8A 4QJ3B 1D1OA 1NP8A 3EVUA 3DVJA 3SS4A 4GUKA 1K96A 2MAZA 3NHTA 2Y4QA 3SG4A 2KAVA 3WXAA 1BMOA 4USLA 3FWBA 5HLOA 2L5XB 3V2LA 3BUNB 1RECA 1XFVO 2K8MB 2OTGC 3S0BA 2KFFA 1EL4A 1CLMA 3EKHA 2PYQA 3BXKA 2ZNEA 3CR5X 1N65A 1WY9A 3OP0A 2V53A 3NSKA 4YGCB 2JQ6A 2L51A 2KYCA 4DUQA 2WCMA 3VRQA 4CLNA 3HCMA 1M63B 1BR1B 3UO9A 3VB1A 5DKQA 1MUXA 1QX7A 1CFCA 3BUXB 2KNEA 3SG2A 1S6CA 2H61A 1KFXS 1KK7Z 1P28A 1SKTA 1W7JB 4I5KA 1CKKA 2K7OA 1A75B 3O2PA 1S5GY 3SG5A 5B8IB 3D77A 1FPWA 1XK4C 1B9AA 1CM4A 4GGNA 1TCOB 2EHBA 4M2PA 2JC2A 1KFUS 5CSIA 2QEVA 2ZN8A 3VRRA 2K7DA 3BJHA 3KO0A 4JPZB 4F0ZB 1FF1A 1KQVA 3NSLA 2KI6D 3B88A 4M2QA 1BG1A 3SG7A 4YBHB 4QJ5B 2KI6C 2LC5A 1EG4A 3BQ3A 3S0GA 3L4LA 1JBAA 3FE6A 1Y1AA 3OBVA 1DTLA 1G4YR
chains in the Genus database with same CATH topology
2R2IA 4NQGA 1B1GA 2QACA 2LP3A 2E6WA 1QX2A 4OVNF 1CM1A 3O6BA 1K9UA 1YURA 2I2RE 3KHEA 1WRKA 1AUIB 1E8AA 5CPVA 1YX7A 1RTP1 2F33A 4UPGA 5I2OA 3BOWA 1KK8C 1B47A 1YRTB 3I5FB 4C0LA 4ORAB 1PRWA 3BUOB 2ZKMX 1KWOB 2JU0A 2HF5A 2MRDA 1A4PA 2KAYA 1SMGA 1LVCD 1X02A 2LUXA 2CT9A 4YI9A 2LMUA 5GQQC 3H4SE 1J7RA 4FTGA 1BOCA 1SRAA 1CLBA 4A4CA 1QATA 1S3PA 1SCMC 1CDMA 1UWOA 5AANA 3VGOA 4HREE 5JJGA 1SL9A 1CDLA 2EC6B 2M7NA 3EK8A 5J3XA 2K0JA 2CTNA 4I5JA 4MRXA 1F54A 1M39A 4GGFC 3SG6A 1YVLA 1OSAA 4E68A 4PE4A 5CSFA 1Y1UA 1S6IA 1PALA 2K2AA 1YTZC 1DJIA 3TDIA 3PALA 5AXIA 4YGEB 1DJHA 3IQOA 4OKHA 2FJUB 4N1FA 1RWYA 2GV5A 5IBWA 2JT3A 4QJ4B 1NUBA 2KSPA 4C0KA 2I94A 4GAOA 4TNCA 2GGZA 1CLLA 1DJGA 1JFJA 2K61A 1NPQA 3NSIA 2LV7A 2LMVA 3TUYB 2PMYA 4DIRA 1F70A 2MHHA 1G8IA 3HX4A 4IL1A 1L2OC 1OMVA 1V1FA 2M8UA 1KQMB 1B8RA 3CS1A 3SIBA 1KSOA 2FCEA 2MJWB 1DJWA 4L9MA 1BLQA 1JC2A 4NDDA 1BU3A 1VRKA 1K2HA 2JNXA 1HQVA 1J1DA 1K93D 3WHTB 1QLSA 3SG3A 1PVAA 3LK0A 1DF0A 3AAKA 3I5HB 3DVKA 1RFJA 1K94A 2KI4C 4DRWA 1UHNA 1NX1A 2LE9B 3RM1A 1CTRA 2JT8A 3IQQA 1CFFA 5DKRA 3OB1B 1CB1A 4WQ3A 2JZIA 2MLFC 2K7CA 4BY4A 2BCXA 3JVTC 3O4YA 3SJSA 4N1GA 1DMOA 5F6TA 2F8PA 1S1EA 4NDCA 1YUSA 1NYAA 1QIVA 2LCPA 3FS7A 2I7AA 3BOWB 3D10A 4P5OE 2BL0B 2K7BA 1ALVA 1TIZA 2M1KB 2KQYA 2JWWA 2JOJA 1SPYA 1QTXA 1FI5A 2OS8C 3BUMB 3PATA 1L7ZA 1U5IA 5ER4X 3WHUB 1SBJA 1CMFA 1WDCC 1YUUA 1RJVA 3I5GB 5BPJA 1CNPA 1NSHA 2LUCA 2M29A 5D69A 2LM5A 1AP4A 1W7IB 3OB2B 4MEWA 1NX0A 2IS9A 1UHHA 4XJKA 3KEVA 2WCEA 2HQWA 2LMTA 2NLNA 1F4OA 5JOLA 2LLSA 2PSRA 3TDZA 2KAXA 2PRUA 4XYNA 3I5IB 1N0YA 4N5XA 1B8CA 3IF7A 3AKBA 3TS5B 1H8BA 3EKJA 1QV1A 2L98A 5HKZA 1J7QA 2M1UA 1Y6WA 2TN4A 3BUWB 1ZMZA 2CNPA 2JRFA 1XK4A 4PHJA 2L4HA 1JFKA 1AHRA 2BECA 1YX8A 1NCYA 2P6BB 2A4JA 1TTXA 1QASA 1GQMA 2KBIA 1J1EA 4OCIA 4YGDB 1KSMA 2BKHB 4MLWA 1LA3A 1MR8A 4CIDA 2CXJA 1JWDA 1UP5A 1N2DA 1K9KA 5HLVA 3KF9A 1FI6A 2KFHA 3BYAA 1DGUA 3A4UB 2KDHA 1NX3A 1AJ5A 2BCBA 1CDPA 1F4QA 2BKIB 1OOJA 2L0PA 2KGRA 1OQPA 4Q04A 2JPTA 3ICBA 2BE6A 2GGMA 1CMGA 1DF0B 1FBVA 3EVRA 2WCFA 4YRUA 3A8RA 3CZTX 1UUSA 2O60A 2M49B 5ER5A 4JQ0D 4AQIA 5DKNA 1AK8A 1BJFA 1PSBA 2M0RA 2D8NA 1XFUO 2K2FA 3DVMA 4GFTA 1ALWA 3ZNIA 4GBAA 1JUOA 1V1GA 4MZLA 1IQ5A 1QS7A 2LANA 2WCBA 3I5FC 1TN4A 2WC8A 4PCWA 1KWOC 1TOPA 3CTNA 1RROA 1TNQA 2JTTA 1IJ6A 3CGAA 1LKJA 1IGVA 1XYDA 2BBMA 1QVIY 3JTDB 1B7TY 3EK7A 1YRUB 1XFYO 2E30A 4HRHA 1M31A 1SR6B 1U5IB 2MLEC 1QLKA 2EC6C 2PVBA 2Y5IA 2NXQA 1YR5A 2JNFA 1PSRA 1ZFSA 3F45A 1OMRA 1XFZO 3KPXA 1OMDA 3EK4A 5I2LA 2BBNA 2RGIA 4FQOA 2Q4UA 4YGBB 1R6PA 2OTGB 5I2QA 1MWNA 4XJKB 3MSEB 2KBMA 4MN0A 1KCYA 3RLZA 4MSPA 1SL8A 4YI8A 4CPVA 1CDNA 4ORCB 1NX2A 5HYDA 2F3YA 3D0YA 5PALA 1WLZA 1IH0A 1KFXL 4JWQA 2ZN9A 1EJ3A 1JF2A 1QIWA 2EGDA 3GK4X 1NWDA 2AMIA 2LVKA 3PM8A 5FYXA 1UHIA 2LHLA 4PE1A 1A03A 3TUYC 1FW4A 1J7OA 1QVIZ 2F2PA 3DD4A 1J7PA 1PK0D 1B7TZ 2DOQA 2H61C 3DF0A 3PSRA 1BR4B 2OPOA 1SR6C 2PASA 4AQJA 2I18A 1SYMA 1KQMC 2FCDA 1WLMA 1IQ3A 1B8LA 1OE9B 1CFPA 1QV0A 1A2XA 2LNKA 2HPSA 2WORA 2ZFDA 4P2YB 2M97A 4PE7A 4PDZA 5K89A 2JXLA 1C7WA 4DCKA 1HT9A 3CR2A 1F71A 1TCFA 1K9PA 3PLFB 3PN7B 3I5HC 1SL7A 3FWCA 1MHOA 4CFQA 5AFPA 2SASA 2NZ0A 1IG5A 2M3WA 3SIAA 2MBXA 1ODBA 1SK6D 2JULA 3FIAA 1DJZA 2LVVA 3WNXB 2LVJA 1DT7B 3AAJA 1OZSA 1KK8B 3K21A 1H4BA 1Y1XA 1NCZA 3GOFA 5HKYA 4ETOA 2NCOA 2FOTA 2G2BA 1SNLA 4HSZA 4MBEA 1J55A 2LLTA 2LAPA 4AOMA 1TNXA 3OHMB 4OV2A 1IWQA 2WOSA 1BT6A 1K90D 2COLB 2LLUA 3LCPC 4ZCVA 1XO5A 2BL0C 1WRLA 3DVEA 1BF5A 1SCMB 2HETA 3EVVA 1WRZA 4WQ2A 1B4CA 2B1UA 1IKUA 3PFVA 3VRPA 4WRIA 2H2KA 4PE0A 1XVJA 1QX5B 2Y1NA 4GNKB 4HRGA 4ZCUA 2BE4A 1YVHA 3CLNA 4I5NB 2F3ZA 1ZACA 1ZUZA 3E3RA 5TNCA 4CFRA 5KTYA 1JSAA 2CCMA 3I5GC 2SCPA 3PN7C 2PALA 4I5LB 2M7LA 1M45A 1M46A 2KGBC 3NSOA 4MZKA 3CR4X 2KQ6A 4M2OA 1RK9A 1QJTA 3LL8B 3M0WA 4U8DA 2JXCA 1UURA 1GGZA 2KYFA 1EH2A 1S36A 1SCVA 1ZOTB 1MQ1A 2Y1MA 3I5IC 1JF0A 1XFXO 2MA2A 3O78A 3TS5C 1S5GZ 4D1EA 4A4BA 3D0YB 1A75A 2AAOA 2LHIA 1AVSA 4MVFA 3LK1A 5D7FA 2KHNA 4YGAA 1L2OB 1IRJA 1EXRA 1PVBA 1MXLC 3ZWHA 5KSZA 1TNPA 3VROA 1Y0VH 3GK1A 2KOTA 1S6JA 3QRXA 1XFWO 1NCXA 2JT0A 4NDBA 1TNWA 2NCPA 3TDUA 2Q91A 1AJ4A 3DF0B 3OX6A 1F55A 5CSNA 1Q80A 1OZOA 4GGFA 4R1EA 3GK2A 4PHKA 5HKWA 2KI4B 1UHJA 2LVIA 4MRYA 1GJYA 1G33A 3VRNA 1DVIA 1BODA 2ISDA 3TZ1A 4GPLB 4DS7A 1YUTA 3C1VA 1SY9A 1F8HA 2VRGA 1K8UA 2KFGA 1C07A 2JTZA 3JVTB 5AEQA 1CFDA 1PULA 2L50A 2ZNDA 4MZJA 2O5GA 5I8NA 1EG3A 1MXEA 1NIWA 2ZRTA 2CBLA 3AKAA 4ORBB 3OX5A 1QXPA 1TRFA 2ZRSA 4PHMA 1XA5A 1MF8B 1LINA 2BCAA 4ICBA 4OR9B 5AERA 1IJ5A 2L4IA 1DJYA 1DJXA 4PHNA 2OS8B 4C0JA 1KK7Y 2M9GA 1C7VA 2F2OA 2WNDA 3CWGA 2G9BA 2L2EA 3NXAA 1K95A 1A29A 1WDCB 1R2UA 1LA0A 5G08A 5KU1A 1GGWA 2LP2A 2QPTA 4BY5A 1KFUL 3JTDC 5CSJA 1DGVA 1UHKA 1S26D 3LLEA 2AUCA 1LXFC 4PALA 2HQ8A 1SW8A 4QJ3B 1D1OA 1NP8A 3EVUA 3DVJA 4GUKA 1K96A 2MAZA 2Y4QA 3SG4A 2KAVA 3WXAA 1BMOA 4USLA 3FWBA 5HLOA 2L5XB 3BUNB 1RECA 1XFVO 2K8MB 2OTGC 2KFFA 1EL4A 1CLMA 3EKHA 3OP0A 3BXKA 2ZNEA 3CR5X 1N65A 1WY9A 4YGCB 2V53A 3NSKA 2JQ6A 2L51A 2KYCA 4DUQA 3VRQA 4CLNA 3HCMA 1M63B 1BR1B 5DKQA 1MUXA 1QX7A 1CFCA 3BUXB 2KNEA 3SG2A 1S6CA 2H61A 1KFXS 1KK7Z 1SKTA 1W7JB 4I5KA 1CKKA 2K7OA 1A75B 3O2PA 1S5GY 3SG5A 5B8IB 1FPWA 1XK4C 1B9AA 1CM4A 4GGNA 1TCOB 2EHBA 4M2PA 2JC2A 1KFUS 5CSIA 4F0ZB 2ZN8A 3VRRA 2K7DA 3KO0A 4JPZB 1FF1A 1KQVA 3NSLA 2KI6D 4M2QA 1BG1A 3SG7A 4YBHB 4QJ5B 2KI6C 2LC5A 1EG4A 3BQ3A 1JBAA 1Y1AA 1DTLA 1G4YR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2I A;  4NQG A;  1B1G A;  2QAC A;  2LP3 A;  2E6W A;  1QX2 A;  4OVN F;  1CM1 A;  3O6B A;  1K9U A;  1YUR A;  2I2R E;  3KHE A;  1WRK A;  1AUI B;  1E8A A;  5CPV A;  1YX7 A;  1RTP 1;  2F33 A;  4UPG A;  5I2O A;  3BOW A;  1KK8 C;  1B47 A;  1YRT B;  3I5F B;  4C0L A;  4ORA B;  1PRW A;  3BUO B;  2ZKM X;  1KWO B;  2JU0 A;  2HF5 A;  2MRD A;  1A4P A;  2KAY A;  1SMG A;  1LVC D;  1X02 A;  2LUX A;  2CT9 A;  4YI9 A;  2LMU A;  5GQQ C;  3H4S E;  1J7R A;  4FTG A;  1BOC A;  1SRA A;  1CLB A;  4A4C A;  1QAT A;  1S3P A;  1SCM C;  1CDM A;  1UWO A;  5AAN A;  3VGO A;  4HRE E;  5JJG A;  1SL9 A;  1CDL A;  2EC6 B;  2M7N A;  3EK8 A;  5J3X A;  2K0J A;  2CTN A;  4I5J A;  4MRX A;  1F54 A;  1M39 A;  4GGF C;  3SG6 A;  1YVL A;  1OSA A;  4E68 A;  4PE4 A;  5CSF A;  1Y1U A;  1S6I A;  1PAL A;  2K2A A;  1YTZ C;  1DJI A;  3TDI A;  3PAL A;  5AXI A;  4YGE B;  1DJH A;  3IQO A;  4OKH A;  2FJU B;  4N1F A;  1RWY A;  2GV5 A;  5IBW A;  2JT3 A;  4QJ4 B;  1NUB A;  2KSP A;  4C0K A;  2I94 A;  4GAO A;  4TNC A;  2GGZ A;  1CLL A;  1DJG A;  1JFJ A;  2K61 A;  1NPQ A;  3NSI A;  2LV7 A;  2LMV A;  3TUY B;  2PMY A;  4DIR A;  1F70 A;  2MHH A;  1G8I A;  3HX4 A;  4IL1 A;  1L2O C;  1OMV A;  1V1F A;  2M8U A;  1KQM B;  1B8R A;  3CS1 A;  3SIB A;  1KSO A;  2FCE A;  2MJW B;  1DJW A;  4L9M A;  1BLQ A;  1JC2 A;  4NDD A;  1BU3 A;  1VRK A;  1K2H A;  2JNX A;  1HQV A;  1J1D A;  1K93 D;  3WHT B;  1QLS A;  3SG3 A;  1PVA A;  3LK0 A;  1DF0 A;  3AAK A;  3I5H B;  3DVK A;  1RFJ A;  1K94 A;  2KI4 C;  4DRW A;  1UHN A;  1NX1 A;  2LE9 B;  3RM1 A;  1CTR A;  2JT8 A;  3IQQ A;  1CFF A;  5DKR A;  3OB1 B;  1CB1 A;  4WQ3 A;  2JZI A;  2MLF C;  2K7C A;  4BY4 A;  2BCX A;  3JVT C;  3O4Y A;  3SJS A;  4N1G A;  1DMO A;  5F6T A;  2F8P A;  1S1E A;  4NDC A;  1YUS A;  1NYA A;  1QIV A;  2LCP A;  3FS7 A;  2I7A A;  3BOW B;  3D10 A;  4P5O E;  2BL0 B;  2K7B A;  1ALV A;  1TIZ A;  2M1K B;  2KQY A;  2JWW A;  2JOJ A;  1SPY A;  1QTX A;  1FI5 A;  2OS8 C;  3BUM B;  3PAT A;  1L7Z A;  1U5I A;  5ER4 X;  3WHU B;  1SBJ A;  1CMF A;  1WDC C;  1YUU A;  1RJV A;  3I5G B;  5BPJ A;  1CNP A;  1NSH A;  2LUC A;  2M29 A;  5D69 A;  2LM5 A;  1AP4 A;  1W7I B;  3OB2 B;  4MEW A;  1NX0 A;  2IS9 A;  1UHH A;  4XJK A;  3KEV A;  2WCE A;  2HQW A;  2LMT A;  2NLN A;  1F4O A;  5JOL A;  2LLS A;  2PSR A;  3TDZ A;  2KAX A;  2PRU A;  4XYN A;  3I5I B;  1N0Y A;  4N5X A;  1B8C A;  3IF7 A;  3AKB A;  3TS5 B;  1H8B A;  3EKJ A;  1QV1 A;  2L98 A;  5HKZ A;  1J7Q A;  2M1U A;  1Y6W A;  2TN4 A;  3BUW B;  1ZMZ A;  2CNP A;  2JRF A;  1XK4 A;  4PHJ A;  2L4H A;  1JFK A;  1AHR A;  2BEC A;  1YX8 A;  1NCY A;  2P6B B;  2A4J A;  1TTX A;  1QAS A;  1GQM A;  2KBI A;  1J1E A;  4OCI A;  4YGD B;  1KSM A;  2BKH B;  4MLW A;  1LA3 A;  1MR8 A;  4CID A;  2CXJ A;  1JWD A;  1UP5 A;  1N2D A;  1K9K A;  5HLV A;  3KF9 A;  1FI6 A;  2KFH A;  3BYA A;  1DGU A;  3A4U B;  2KDH A;  1NX3 A;  1AJ5 A;  2BCB A;  1CDP A;  1F4Q A;  2BKI B;  1OOJ A;  2L0P A;  2KGR A;  1OQP A;  4Q04 A;  2JPT A;  3ICB A;  2BE6 A;  2GGM A;  1CMG A;  1DF0 B;  1FBV A;  3EVR A;  2WCF A;  4YRU A;  3A8R A;  3CZT X;  1UUS A;  2O60 A;  2M49 B;  5ER5 A;  4JQ0 D;  4AQI A;  5DKN A;  1AK8 A;  1BJF A;  1PSB A;  2M0R A;  2D8N A;  1XFU O;  2K2F A;  3DVM A;  4GFT A;  1ALW A;  3ZNI A;  4GBA A;  1JUO A;  1V1G A;  4MZL A;  1IQ5 A;  1QS7 A;  2LAN A;  2WCB A;  3I5F C;  1TN4 A;  2WC8 A;  4PCW A;  1KWO C;  1TOP A;  3CTN A;  1RRO A;  1TNQ A;  2JTT A;  1IJ6 A;  3CGA A;  1LKJ A;  1IGV A;  1XYD A;  2BBM A;  1QVI Y;  3JTD B;  1B7T Y;  3EK7 A;  1YRU B;  1XFY O;  2E30 A;  4HRH A;  1M31 A;  1SR6 B;  1U5I B;  2MLE C;  1QLK A;  2EC6 C;  2PVB A;  2Y5I A;  2NXQ A;  1YR5 A;  2JNF A;  1PSR A;  1ZFS A;  3F45 A;  1OMR A;  1XFZ O;  3KPX A;  1OMD A;  3EK4 A;  5I2L A;  2BBN A;  2RGI A;  4FQO A;  2Q4U A;  4YGB B;  1R6P A;  2OTG B;  5I2Q A;  1MWN A;  4XJK B;  3MSE B;  2KBM A;  4MN0 A;  1KCY A;  3RLZ A;  4MSP A;  1SL8 A;  4YI8 A;  4CPV A;  1CDN A;  4ORC B;  1NX2 A;  5HYD A;  2F3Y A;  3D0Y A;  5PAL A;  1WLZ A;  1IH0 A;  1KFX L;  4JWQ A;  2ZN9 A;  1EJ3 A;  1JF2 A;  1QIW A;  2EGD A;  3GK4 X;  1NWD A;  2AMI A;  2LVK A;  3PM8 A;  5FYX A;  1UHI A;  2LHL A;  4PE1 A;  1A03 A;  3TUY C;  1FW4 A;  1J7O A;  1QVI Z;  2F2P A;  3DD4 A;  1J7P A;  1PK0 D;  1B7T Z;  2DOQ A;  2H61 C;  3DF0 A;  3PSR A;  1BR4 B;  2OPO A;  1SR6 C;  2PAS A;  4AQJ A;  2I18 A;  1SYM A;  1KQM C;  2FCD A;  1WLM A;  1IQ3 A;  1B8L A;  1OE9 B;  1CFP A;  1QV0 A;  1A2X A;  2LNK A;  2HPS A;  2WOR A;  2ZFD A;  4P2Y B;  2M97 A;  4PE7 A;  4PDZ A;  5K89 A;  2JXL A;  1C7W A;  4DCK A;  1HT9 A;  3CR2 A;  1F71 A;  1TCF A;  1K9P A;  3PLF B;  3PN7 B;  3I5H C;  1SL7 A;  3FWC A;  1MHO A;  4CFQ A;  5AFP A;  2SAS A;  2NZ0 A;  1IG5 A;  2M3W A;  3SIA A;  2MBX A;  1ODB A;  1SK6 D;  2JUL A;  3FIA A;  1DJZ A;  2LVV A;  3WNX B;  2LVJ A;  1DT7 B;  3AAJ A;  1OZS A;  1KK8 B;  3K21 A;  1H4B A;  1Y1X A;  1NCZ A;  3GOF A;  5HKY A;  4ETO A;  2NCO A;  2FOT A;  2G2B A;  1SNL A;  4HSZ A;  4MBE A;  1J55 A;  2LLT A;  2LAP A;  4AOM A;  1TNX A;  3OHM B;  4OV2 A;  1IWQ A;  2WOS A;  1BT6 A;  1K90 D;  2COL B;  2LLU A;  3LCP C;  4ZCV A;  1XO5 A;  2BL0 C;  1WRL A;  3DVE A;  1BF5 A;  1SCM B;  2HET A;  3EVV A;  1WRZ A;  4WQ2 A;  1B4C A;  2B1U A;  1IKU A;  3PFV A;  3VRP A;  4WRI A;  2H2K A;  4PE0 A;  1XVJ A;  1QX5 B;  2Y1N A;  4GNK B;  4HRG A;  4ZCU A;  2BE4 A;  1YVH A;  3CLN A;  4I5N B;  2F3Z A;  1ZAC A;  1ZUZ A;  3E3R A;  5TNC A;  4CFR A;  5KTY A;  1JSA A;  2CCM A;  3I5G C;  2SCP A;  3PN7 C;  2PAL A;  4I5L B;  2M7L A;  1M45 A;  1M46 A;  2KGB C;  3NSO A;  4MZK A;  3CR4 X;  2KQ6 A;  4M2O A;  1RK9 A;  1QJT A;  3LL8 B;  3M0W A;  4U8D A;  2JXC A;  1UUR A;  1GGZ A;  2KYF A;  1EH2 A;  1S36 A;  1SCV A;  1ZOT B;  1MQ1 A;  2Y1M A;  3I5I C;  1JF0 A;  1XFX O;  2MA2 A;  3O78 A;  3TS5 C;  1S5G Z;  4D1E A;  4A4B A;  3D0Y B;  1A75 A;  2AAO A;  2LHI A;  1AVS A;  4MVF A;  3LK1 A;  5D7F A;  2KHN A;  4YGA A;  1L2O B;  1IRJ A;  1EXR A;  1PVB A;  1MXL C;  3ZWH A;  5KSZ A;  1TNP A;  3VRO A;  1Y0V H;  3GK1 A;  2KOT A;  1S6J A;  3QRX A;  1XFW O;  1NCX A;  2JT0 A;  4NDB A;  1TNW A;  2NCP A;  3TDU A;  2Q91 A;  1AJ4 A;  3DF0 B;  3OX6 A;  1F55 A;  5CSN A;  1Q80 A;  1OZO A;  4GGF A;  4R1E A;  3GK2 A;  4PHK A;  5HKW A;  2KI4 B;  1UHJ A;  2LVI A;  4MRY A;  1GJY A;  1G33 A;  3VRN A;  1DVI A;  1BOD A;  2ISD A;  3TZ1 A;  4GPL B;  4DS7 A;  1YUT A;  3C1V A;  1SY9 A;  1F8H A;  2VRG A;  1K8U A;  2KFG A;  1C07 A;  2JTZ A;  3JVT B;  5AEQ A;  1CFD A;  1PUL A;  2L50 A;  2ZND A;  4MZJ A;  2O5G A;  5I8N A;  1EG3 A;  1MXE A;  1NIW A;  2ZRT A;  2CBL A;  3AKA A;  4ORB B;  3OX5 A;  1QXP A;  1TRF A;  2ZRS A;  4PHM A;  1XA5 A;  1MF8 B;  1LIN A;  2BCA A;  4ICB A;  4OR9 B;  5AER A;  1IJ5 A;  2L4I A;  1DJY A;  1DJX A;  4PHN A;  2OS8 B;  4C0J A;  1KK7 Y;  2M9G A;  1C7V A;  2F2O A;  2WND A;  3CWG A;  2G9B A;  2L2E A;  3NXA A;  1K95 A;  1A29 A;  1WDC B;  1R2U A;  1LA0 A;  5G08 A;  5KU1 A;  1GGW A;  2LP2 A;  2QPT A;  4BY5 A;  1KFU L;  3JTD C;  5CSJ A;  1DGV A;  1UHK A;  1S26 D;  3LLE A;  2AUC A;  1LXF C;  4PAL A;  2HQ8 A;  1SW8 A;  4QJ3 B;  1D1O A;  1NP8 A;  3EVU A;  3DVJ A;  4GUK A;  1K96 A;  2MAZ A;  2Y4Q A;  3SG4 A;  2KAV A;  3WXA A;  1BMO A;  4USL A;  3FWB A;  5HLO A;  2L5X B;  3BUN B;  1REC A;  1XFV O;  2K8M B;  2OTG C;  2KFF A;  1EL4 A;  1CLM A;  3EKH A;  3OP0 A;  3BXK A;  2ZNE A;  3CR5 X;  1N65 A;  1WY9 A;  4YGC B;  2V53 A;  3NSK A;  2JQ6 A;  2L51 A;  2KYC A;  4DUQ A;  3VRQ A;  4CLN A;  3HCM A;  1M63 B;  1BR1 B;  5DKQ A;  1MUX A;  1QX7 A;  1CFC A;  3BUX B;  2KNE A;  3SG2 A;  1S6C A;  2H61 A;  1KFX S;  1KK7 Z;  1SKT A;  1W7J B;  4I5K A;  1CKK A;  2K7O A;  1A75 B;  3O2P A;  1S5G Y;  3SG5 A;  5B8I B;  1FPW A;  1XK4 C;  1B9A A;  1CM4 A;  4GGN A;  1TCO B;  2EHB A;  4M2P A;  2JC2 A;  1KFU S;  5CSI A;  4F0Z B;  2ZN8 A;  3VRR A;  2K7D A;  3KO0 A;  4JPZ B;  1FF1 A;  1KQV A;  3NSL A;  2KI6 D;  4M2Q A;  1BG1 A;  3SG7 A;  4YBH B;  4QJ5 B;  2KI6 C;  2LC5 A;  1EG4 A;  3BQ3 A;  1JBA A;  1Y1A A;  1DTL A;  1G4Y R; 
#chains in the Genus database with same CATH topology
 2R2I A;  4NQG A;  3SS3 A;  3NGV A;  1B1G A;  2QAC A;  3N7H A;  2LP3 A;  2E6W A;  1QX2 A;  4OVN F;  3CZ0 A;  1CM1 A;  3O6B A;  1K9U A;  1YUR A;  2I2R E;  3KHE A;  1WRK A;  1AUI B;  1E8A A;  5CPV A;  1YX7 A;  1RTP 1;  2F33 A;  4UPG A;  4INX A;  5I2O A;  3BOW A;  1KK8 C;  1B47 A;  1YRT B;  3EG5 B;  3I5F B;  4C0L A;  4ORA B;  1PRW A;  3BUO B;  1Z2C B;  2ZKM X;  1KWO B;  2JU0 A;  2HF5 A;  2MRD A;  1A4P A;  2KAY A;  1SMG A;  1LVC D;  1X02 A;  2LUX A;  2CT9 A;  3PM2 A;  2LMU A;  4YI9 A;  5GQQ C;  3H4S E;  1J7R A;  4FTG A;  1DEK A;  3QME A;  1BOC A;  3DY9 A;  1SRA A;  1CLB A;  4A4C A;  1QAT A;  1S3P A;  1SCM C;  1CDM A;  1UWO A;  5AAN A;  3VGO A;  1GM0 A;  4HRE E;  5JJG A;  1SL9 A;  1CDL A;  2EC6 B;  2M7N A;  3EK8 A;  5J3X A;  2K0J A;  2CTN A;  4I5J A;  4MRX A;  1F54 A;  1M39 A;  4GGF C;  3SG6 A;  1YVL A;  1OSA A;  4E68 A;  4PE4 A;  2JPO A;  5CSF A;  1Y1U A;  1S6I A;  1PAL A;  2K2A A;  1YTZ C;  3BFH A;  1DJI A;  3TDI A;  3L4A A;  3PAL A;  5AXI A;  4YGE B;  1DJH A;  3IQO A;  4OKH A;  2FJU B;  4N1F A;  1RWY A;  2GV5 A;  5IBW A;  2JT3 A;  2H8V A;  2PQL A;  4QJ4 B;  1NUB A;  3RZS A;  2KSP A;  4C0K A;  2I94 A;  4GAO A;  4TNC A;  1XFR A;  1CLL A;  1DJG A;  2GGZ A;  1JFJ A;  2K61 A;  1NPQ A;  3NSI A;  2LV7 A;  2LMV A;  3TUY B;  2PMY A;  4DIR A;  1C3Y A;  3R1V A;  1F70 A;  2MHH A;  1G8I A;  3HX4 A;  4IL1 A;  1L2O C;  1OMV A;  1V1F A;  2M8U A;  1KQM B;  1DC1 A;  1B8R A;  3CS1 A;  5DIC A;  3SIB A;  1KSO A;  2FCE A;  2MJW B;  1DJW A;  4L9M A;  1BLQ A;  1JC2 A;  4NDD A;  1BU3 A;  1VRK A;  1K2H A;  2JNX A;  1HQV A;  1J1D A;  3R1P A;  1K93 D;  3WHT B;  1QLS A;  3SG3 A;  1PVA A;  3LK0 A;  2WCK A;  1DF0 A;  3AAK A;  3I5H B;  3DVK A;  1RFJ A;  1K94 A;  2KI4 C;  3R1O A;  4DRW A;  1UHN A;  1NX1 A;  5FI6 A;  2LE9 B;  3O4X A;  1CTR A;  2JT8 A;  3IQQ A;  3RM1 A;  1CFF A;  5DKR A;  3OB1 B;  1CB1 A;  4WQ3 A;  2JZI A;  2MLF C;  2K7C A;  3IVT A;  2QDI A;  4BY4 A;  2BCX A;  3JVT C;  3O4Y A;  3SJS A;  4N1G A;  1DMO A;  5F6T A;  2F8P A;  1S1E A;  1OOG A;  4NDC A;  1YUS A;  1NYA A;  1QIV A;  2LCP A;  3FS7 A;  2I7A A;  3BOW B;  3D10 A;  4P5O E;  3D75 A;  2BL0 B;  2K7B A;  1ALV A;  1TIZ A;  2M1K B;  2KQY A;  2JWW A;  2JOJ A;  1SPY A;  3CAB A;  1QTX A;  1FI5 A;  2OS8 C;  3BUM B;  3PAT A;  3B6X A;  1L7Z A;  1U5I A;  5ER4 X;  3WHU B;  1SBJ A;  1CMF A;  1WDC C;  1YUU A;  1RJV A;  3I5G B;  5BPJ A;  1CNP A;  1NSH A;  1T14 A;  2LUC A;  2M29 A;  5D69 A;  2LM5 A;  1AP4 A;  1W7I B;  2KPH A;  3OB2 B;  4MEW A;  3B87 A;  1NX0 A;  1C3Z A;  1UHH A;  2IS9 A;  4XJK A;  3KEV A;  2WCE A;  2HQW A;  2LMT A;  2NLN A;  1F4O A;  4KYN A;  5JOL A;  2LLS A;  2PSR A;  3TDZ A;  2KAX A;  2PRU A;  4XYN A;  3I5I B;  1N0Y A;  3S0D A;  4N5X A;  1B8C A;  3IF7 A;  3AKB A;  3TS5 B;  1H8B A;  3EKJ A;  1QV1 A;  2L98 A;  5HKZ A;  4F7F A;  1J7Q A;  2M1U A;  1Y6W A;  2TN4 A;  3BUW B;  3S0E A;  1ZMZ A;  2CNP A;  2WCL A;  2JRF A;  1XK4 A;  4PHJ A;  2L4H A;  1JFK A;  1AHR A;  2BEC A;  1YX8 A;  1NCY A;  2P6B B;  3CZ2 A;  2A4J A;  1TTX A;  1QAS A;  1GQM A;  2KBI A;  1J1E A;  4OCI A;  4YGD B;  1DQE A;  1TWO A;  1KSM A;  2BKH B;  4MLW A;  1LA3 A;  3BFB A;  1MR8 A;  4CID A;  2CXJ A;  3R72 A;  1JWD A;  1UP5 A;  1N2D A;  1K9K A;  3PJI A;  5HLV A;  3KF9 A;  1FI6 A;  2KFH A;  3BYA A;  1DGU A;  3A4U B;  2KDH A;  1NX3 A;  1AJ5 A;  2BCB A;  1CDP A;  1F4Q A;  1LS8 A;  2BKI B;  1OOJ A;  2L0P A;  4JD9 A;  2KGR A;  1OQP A;  4Q04 A;  2JPT A;  3ICB A;  2WC5 A;  2BE6 A;  2GGM A;  1CMG A;  1DF0 B;  1FBV A;  3EVR A;  2WCF A;  4YRU A;  3A8R A;  3CZT X;  1TUJ A;  1UUS A;  2O60 A;  2M49 B;  5ER5 A;  4JQ0 D;  4AQI A;  3D73 A;  5DKN A;  1AK8 A;  1BJF A;  1PSB A;  2M0R A;  2D8N A;  1XFU O;  2K2F A;  3DVM A;  4GFT A;  1ALW A;  3ZNI A;  4GBA A;  1JUO A;  1V1G A;  4MZL A;  1IQ5 A;  1QS7 A;  2LAN A;  2WCB A;  3I5F C;  1TN4 A;  2WC8 A;  4PCW A;  5D3O A;  3OGN A;  1KWO C;  1DEL A;  1TOP A;  3CTN A;  1RRO A;  1TNQ A;  2JTT A;  1IJ6 A;  4FQT A;  3CGA A;  2BAP A;  1LKJ A;  1IGV A;  1XYD A;  2BBM A;  1QVI Y;  3JTD B;  2GTE A;  1B7T Y;  3B86 A;  3EK7 A;  1YRU B;  3CZ1 A;  1XFY O;  2FJY A;  2E30 A;  4HRH A;  1M31 A;  1SR6 B;  1U5I B;  2MLE C;  5I94 A;  1QLK A;  3FE8 A;  2EC6 C;  2PVB A;  2Y5I A;  2NXQ A;  1OW4 A;  1YR5 A;  2JNF A;  1PSR A;  1ZFS A;  3D78 A;  3K1E A;  3F45 A;  1OMR A;  1XFZ O;  3KPX A;  1OMD A;  4JKT A;  3EK4 A;  5I2L A;  5HL1 A;  2BBN A;  2RGI A;  4FQO A;  3DYE A;  2Q4U A;  4YGB B;  1R6P A;  2OTG B;  5I2Q A;  2QEB A;  1MWN A;  4XJK B;  3B7A A;  2KBM A;  3MSE B;  4MN0 A;  1KCY A;  3RLZ A;  4MSP A;  1SL8 A;  4YI8 A;  4CPV A;  1CDN A;  4ORC B;  1NX2 A;  1SSE B;  2F3Y A;  5HYD A;  3D0Y A;  5PAL A;  1WLZ A;  2WC6 A;  1IH0 A;  1KFX L;  4JWQ A;  2ZN9 A;  1EJ3 A;  1JF2 A;  1QIW A;  2EGD A;  3GK4 X;  1NWD A;  2AMI A;  2LVK A;  3PM8 A;  3NHI A;  5FYX A;  1UHI A;  5FI2 A;  2LHL A;  4PE1 A;  1A03 A;  3TUY C;  1FW4 A;  1J7O A;  1QVI Z;  2F2P A;  3DD4 A;  1J7P A;  1PK0 D;  1B7T Z;  2DOQ A;  2H61 C;  3DF0 A;  3PSR A;  1BR4 B;  2OPO A;  1SR6 C;  2PAS A;  4INW A;  4AQJ A;  2I18 A;  1SYM A;  1KQM C;  2FCD A;  1WLM A;  1IQ3 A;  1B8L A;  1OE9 B;  3SS5 A;  1CFP A;  1QV0 A;  1A2X A;  2LNK A;  2HPS A;  2WOR A;  2ZFD A;  4P2Y B;  2M97 A;  4PE7 A;  4PDZ A;  5K89 A;  2JXL A;  3S0A A;  1C7W A;  4DCK A;  1HT9 A;  3CR2 A;  1F71 A;  1TCF A;  1K9P A;  3PLF B;  3PN7 B;  3I5H C;  1ORG A;  1SL7 A;  1MHO A;  3FWC A;  4CFQ A;  5AFP A;  1OOI X;  2SAS A;  2NZ0 A;  1IG5 A;  2M3W A;  3D74 A;  3SIA A;  2MBX A;  2KLD A;  1ODB A;  1SK6 D;  2JUL A;  3FIA A;  1DJZ A;  2LVV A;  3WNX B;  2LVJ A;  1DT7 B;  3AAJ A;  1OZS A;  1KK8 B;  1TUZ A;  3K21 A;  1H4B A;  1Y1X A;  1NCZ A;  3GOF A;  5HKY A;  4ETO A;  2NCO A;  1IIO A;  2FOT A;  2G2B A;  1SNL A;  2K60 A;  4HSZ A;  4MBE A;  1J55 A;  2LLT A;  2LAP A;  4AOM A;  1TNX A;  3OHM B;  4OV2 A;  2BNX A;  1IWQ A;  2WOS A;  1BT6 A;  1K90 D;  2COL B;  2LLU A;  3L47 A;  3LCP C;  4ZCV A;  1XO5 A;  2BL0 C;  1WRL A;  2L2C A;  3DVE A;  2QEH A;  1SCM B;  2HET A;  1BF5 A;  3EVV A;  1WRZ A;  4WQ2 A;  1B4C A;  2B1U A;  1IKU A;  2WCJ A;  3PFV A;  3VRP A;  3BFA A;  4WRI A;  2H2K A;  4PE0 A;  4IJ7 A;  1XVJ A;  1QX5 B;  2Y1N A;  4GNK B;  4HRG A;  4ZCU A;  1OOF A;  1W9Z A;  1YVH A;  2BE4 A;  2F3Z A;  1ZAC A;  1ZUZ A;  3CLN A;  3DXL A;  3E3R A;  4I5N B;  4CFR A;  5KTY A;  2CCM A;  1JSA A;  3I5G C;  2SCP A;  3PN7 C;  2PAL A;  4I5L B;  2M7L A;  1M45 A;  1M46 A;  2KGB C;  3CDN A;  3NSO A;  4MZK A;  3CR4 X;  2KQ6 A;  3CYZ A;  1RK9 A;  4M2O A;  1QJT A;  3LL8 B;  3M0W A;  4U8D A;  5EL2 A;  2JXC A;  1UUR A;  1GGZ A;  3UNW A;  2KYF A;  1EH2 A;  1S36 A;  4OZD A;  1SCV A;  1ZOT B;  1MQ1 A;  2Y1M A;  3I5I C;  1JF0 A;  3DZT A;  1XFX O;  2MA2 A;  3O78 A;  3TS5 C;  1S5G Z;  4D1E A;  4A4B A;  3D0Y B;  1A75 A;  2AAO A;  2LHI A;  1AVS A;  4MVF A;  3LK1 A;  5D7F A;  2KHN A;  4YGA A;  2KLE A;  1L2O B;  2YGU A;  1IRJ A;  1EXR A;  1PVB A;  1MXL C;  3ZWH A;  5KSZ A;  1TNP A;  2QEO A;  3VRO A;  1Y0V H;  3GK1 A;  2KOT A;  1S6J A;  2L5Y A;  3QRX A;  1XFW O;  3S0F A;  1NCX A;  2JT0 A;  4NDB A;  1QWV A;  1TNW A;  2NCP A;  3TDU A;  2Q91 A;  1AJ4 A;  3DF0 B;  3OX6 A;  1F55 A;  5CSN A;  1Q80 A;  1OZO A;  4GGF A;  4R1E A;  3GK2 A;  2WCH A;  4PHK A;  5HKW A;  2KI4 B;  1UHJ A;  3D76 A;  2LVI A;  4MRY A;  1GJY A;  1G33 A;  3VRN A;  1DVI A;  1BOD A;  2ISD A;  3TZ1 A;  4GPL B;  4DS7 A;  1YUT A;  3C1V A;  1SY9 A;  1F8H A;  2VRG A;  1K8U A;  4PT1 A;  2KFG A;  1C07 A;  2JTZ A;  3JVT B;  5AEQ A;  1CFD A;  1PUL A;  2L50 A;  2ZND A;  4MZJ A;  2O5G A;  5I8N A;  1EG3 A;  1MXE A;  1NIW A;  2ZRT A;  2CBL A;  3AKA A;  4ORB B;  3OX5 A;  1QXP A;  2P70 A;  1TRF A;  2ZRS A;  5FI7 A;  3Q8I A;  4PHM A;  1XA5 A;  1MF8 B;  1LIN A;  2BCA A;  4ICB A;  4OR9 B;  5AER A;  1IJ5 A;  2L4I A;  1OOH A;  1Z4H A;  1DJY A;  1DJX A;  4PHN A;  2OS8 B;  4C0J A;  1KK7 Y;  2M9G A;  1C7V A;  2F2O A;  5TNC A;  2WND A;  3CWG A;  2G9B A;  2L2E A;  3NXA A;  1K95 A;  1A29 A;  2ERB A;  1WDC B;  1R2U A;  1LA0 A;  3FE9 A;  5G08 A;  5KU1 A;  2LP2 A;  1GGW A;  2QPT A;  4BY5 A;  1KFU L;  3JTD C;  5CSJ A;  1DGV A;  1UHK A;  2P71 A;  1S26 D;  3LLE A;  2AUC A;  1LXF C;  4PAL A;  2HQ8 A;  1SW8 A;  4QJ3 B;  1D1O A;  1NP8 A;  3EVU A;  3DVJ A;  3SS4 A;  4GUK A;  1K96 A;  2MAZ A;  3NHT A;  2Y4Q A;  3SG4 A;  2KAV A;  3WXA A;  1BMO A;  4USL A;  3FWB A;  5HLO A;  2L5X B;  3V2L A;  3BUN B;  1REC A;  1XFV O;  2K8M B;  2OTG C;  3S0B A;  2KFF A;  1EL4 A;  1CLM A;  3EKH A;  2PYQ A;  3BXK A;  2ZNE A;  3CR5 X;  1N65 A;  1WY9 A;  3OP0 A;  2V53 A;  3NSK A;  4YGC B;  2JQ6 A;  2L51 A;  2KYC A;  4DUQ A;  2WCM A;  3VRQ A;  4CLN A;  3HCM A;  1M63 B;  1BR1 B;  3UO9 A;  3VB1 A;  5DKQ A;  1MUX A;  1QX7 A;  1CFC A;  3BUX B;  2KNE A;  3SG2 A;  1S6C A;  2H61 A;  1KFX S;  1KK7 Z;  1P28 A;  1SKT A;  1W7J B;  4I5K A;  1CKK A;  2K7O A;  1A75 B;  3O2P A;  1S5G Y;  3SG5 A;  5B8I B;  3D77 A;  1FPW A;  1XK4 C;  1B9A A;  1CM4 A;  4GGN A;  1TCO B;  2EHB A;  4M2P A;  2JC2 A;  1KFU S;  5CSI A;  2QEV A;  2ZN8 A;  3VRR A;  2K7D A;  3BJH A;  3KO0 A;  4JPZ B;  4F0Z B;  1FF1 A;  1KQV A;  3NSL A;  2KI6 D;  3B88 A;  4M2Q A;  1BG1 A;  3SG7 A;  4YBH B;  4QJ5 B;  2KI6 C;  2LC5 A;  1EG4 A;  3BQ3 A;  3S0G A;  3L4L A;  1JBA A;  3FE6 A;  1Y1A A;  3OBV A;  1DTL A;  1G4Y R; 
#chains in the Genus database with same CATH homology
 2R2I A;  4NQG A;  1B1G A;  2QAC A;  2LP3 A;  2E6W A;  1QX2 A;  4OVN F;  1CM1 A;  3O6B A;  1K9U A;  1YUR A;  2I2R E;  3KHE A;  1WRK A;  1AUI B;  1E8A A;  5CPV A;  1YX7 A;  1RTP 1;  2F33 A;  4UPG A;  5I2O A;  3BOW A;  1KK8 C;  1B47 A;  1YRT B;  3I5F B;  4C0L A;  4ORA B;  1PRW A;  3BUO B;  2ZKM X;  1KWO B;  2JU0 A;  2HF5 A;  2MRD A;  1A4P A;  2KAY A;  1SMG A;  1LVC D;  1X02 A;  2LUX A;  2CT9 A;  4YI9 A;  2LMU A;  5GQQ C;  3H4S E;  1J7R A;  4FTG A;  1BOC A;  1SRA A;  1CLB A;  4A4C A;  1QAT A;  1S3P A;  1SCM C;  1CDM A;  1UWO A;  5AAN A;  3VGO A;  4HRE E;  5JJG A;  1SL9 A;  1CDL A;  2EC6 B;  2M7N A;  3EK8 A;  5J3X A;  2K0J A;  2CTN A;  4I5J A;  4MRX A;  1F54 A;  1M39 A;  4GGF C;  3SG6 A;  1YVL A;  1OSA A;  4E68 A;  4PE4 A;  5CSF A;  1Y1U A;  1S6I A;  1PAL A;  2K2A A;  1YTZ C;  1DJI A;  3TDI A;  3PAL A;  5AXI A;  4YGE B;  1DJH A;  3IQO A;  4OKH A;  2FJU B;  4N1F A;  1RWY A;  2GV5 A;  5IBW A;  2JT3 A;  4QJ4 B;  1NUB A;  2KSP A;  4C0K A;  2I94 A;  4GAO A;  4TNC A;  2GGZ A;  1CLL A;  1DJG A;  1JFJ A;  2K61 A;  1NPQ A;  3NSI A;  2LV7 A;  2LMV A;  3TUY B;  2PMY A;  4DIR A;  1F70 A;  2MHH A;  1G8I A;  3HX4 A;  4IL1 A;  1L2O C;  1OMV A;  1V1F A;  2M8U A;  1KQM B;  1B8R A;  3CS1 A;  3SIB A;  1KSO A;  2FCE A;  2MJW B;  1DJW A;  4L9M A;  1BLQ A;  1JC2 A;  4NDD A;  1BU3 A;  1VRK A;  1K2H A;  2JNX A;  1HQV A;  1J1D A;  1K93 D;  3WHT B;  1QLS A;  3SG3 A;  1PVA A;  3LK0 A;  1DF0 A;  3AAK A;  3I5H B;  3DVK A;  1RFJ A;  1K94 A;  2KI4 C;  4DRW A;  1UHN A;  1NX1 A;  2LE9 B;  3RM1 A;  1CTR A;  2JT8 A;  3IQQ A;  1CFF A;  5DKR A;  3OB1 B;  1CB1 A;  4WQ3 A;  2JZI A;  2MLF C;  2K7C A;  4BY4 A;  2BCX A;  3JVT C;  3O4Y A;  3SJS A;  4N1G A;  1DMO A;  5F6T A;  2F8P A;  1S1E A;  4NDC A;  1YUS A;  1NYA A;  1QIV A;  2LCP A;  3FS7 A;  2I7A A;  3BOW B;  3D10 A;  4P5O E;  2BL0 B;  2K7B A;  1ALV A;  1TIZ A;  2M1K B;  2KQY A;  2JWW A;  2JOJ A;  1SPY A;  1QTX A;  1FI5 A;  2OS8 C;  3BUM B;  3PAT A;  1L7Z A;  1U5I A;  5ER4 X;  3WHU B;  1SBJ A;  1CMF A;  1WDC C;  1YUU A;  1RJV A;  3I5G B;  5BPJ A;  1CNP A;  1NSH A;  2LUC A;  2M29 A;  5D69 A;  2LM5 A;  1AP4 A;  1W7I B;  3OB2 B;  4MEW A;  1NX0 A;  2IS9 A;  1UHH A;  4XJK A;  3KEV A;  2WCE A;  2HQW A;  2LMT A;  2NLN A;  1F4O A;  5JOL A;  2LLS A;  2PSR A;  3TDZ A;  2KAX A;  2PRU A;  4XYN A;  3I5I B;  1N0Y A;  4N5X A;  1B8C A;  3IF7 A;  3AKB A;  3TS5 B;  1H8B A;  3EKJ A;  1QV1 A;  2L98 A;  5HKZ A;  1J7Q A;  2M1U A;  1Y6W A;  2TN4 A;  3BUW B;  1ZMZ A;  2CNP A;  2JRF A;  1XK4 A;  4PHJ A;  2L4H A;  1JFK A;  1AHR A;  2BEC A;  1YX8 A;  1NCY A;  2P6B B;  2A4J A;  1TTX A;  1QAS A;  1GQM A;  2KBI A;  1J1E A;  4OCI A;  4YGD B;  1KSM A;  2BKH B;  4MLW A;  1LA3 A;  1MR8 A;  4CID A;  2CXJ A;  1JWD A;  1UP5 A;  1N2D A;  1K9K A;  5HLV A;  3KF9 A;  1FI6 A;  2KFH A;  3BYA A;  1DGU A;  3A4U B;  2KDH A;  1NX3 A;  1AJ5 A;  2BCB A;  1CDP A;  1F4Q A;  2BKI B;  1OOJ A;  2L0P A;  2KGR A;  1OQP A;  4Q04 A;  2JPT A;  3ICB A;  2BE6 A;  2GGM A;  1CMG A;  1DF0 B;  1FBV A;  3EVR A;  2WCF A;  4YRU A;  3A8R A;  3CZT X;  1UUS A;  2O60 A;  2M49 B;  5ER5 A;  4JQ0 D;  4AQI A;  5DKN A;  1AK8 A;  1BJF A;  1PSB A;  2M0R A;  2D8N A;  1XFU O;  2K2F A;  3DVM A;  4GFT A;  1ALW A;  3ZNI A;  4GBA A;  1JUO A;  1V1G A;  4MZL A;  1IQ5 A;  1QS7 A;  2LAN A;  2WCB A;  3I5F C;  1TN4 A;  2WC8 A;  4PCW A;  1KWO C;  1TOP A;  3CTN A;  1RRO A;  1TNQ A;  2JTT A;  1IJ6 A;  3CGA A;  1LKJ A;  1IGV A;  1XYD A;  2BBM A;  1QVI Y;  3JTD B;  1B7T Y;  3EK7 A;  1YRU B;  1XFY O;  2E30 A;  4HRH A;  1M31 A;  1SR6 B;  1U5I B;  2MLE C;  1QLK A;  2EC6 C;  2PVB A;  2Y5I A;  2NXQ A;  1YR5 A;  2JNF A;  1PSR A;  1ZFS A;  3F45 A;  1OMR A;  1XFZ O;  3KPX A;  1OMD A;  3EK4 A;  5I2L A;  2BBN A;  2RGI A;  4FQO A;  2Q4U A;  4YGB B;  1R6P A;  2OTG B;  5I2Q A;  1MWN A;  4XJK B;  3MSE B;  2KBM A;  4MN0 A;  1KCY A;  3RLZ A;  4MSP A;  1SL8 A;  4YI8 A;  4CPV A;  1CDN A;  4ORC B;  1NX2 A;  5HYD A;  2F3Y A;  3D0Y A;  5PAL A;  1WLZ A;  1IH0 A;  1KFX L;  4JWQ A;  2ZN9 A;  1EJ3 A;  1JF2 A;  1QIW A;  2EGD A;  3GK4 X;  1NWD A;  2AMI A;  2LVK A;  3PM8 A;  5FYX A;  1UHI A;  2LHL A;  4PE1 A;  1A03 A;  3TUY C;  1FW4 A;  1J7O A;  1QVI Z;  2F2P A;  3DD4 A;  1J7P A;  1PK0 D;  1B7T Z;  2DOQ A;  2H61 C;  3DF0 A;  3PSR A;  1BR4 B;  2OPO A;  1SR6 C;  2PAS A;  4AQJ A;  2I18 A;  1SYM A;  1KQM C;  2FCD A;  1WLM A;  1IQ3 A;  1B8L A;  1OE9 B;  1CFP A;  1QV0 A;  1A2X A;  2LNK A;  2HPS A;  2WOR A;  2ZFD A;  4P2Y B;  2M97 A;  4PE7 A;  4PDZ A;  5K89 A;  2JXL A;  1C7W A;  4DCK A;  1HT9 A;  3CR2 A;  1F71 A;  1TCF A;  1K9P A;  3PLF B;  3PN7 B;  3I5H C;  1SL7 A;  3FWC A;  1MHO A;  4CFQ A;  5AFP A;  2SAS A;  2NZ0 A;  1IG5 A;  2M3W A;  3SIA A;  2MBX A;  1ODB A;  1SK6 D;  2JUL A;  3FIA A;  1DJZ A;  2LVV A;  3WNX B;  2LVJ A;  1DT7 B;  3AAJ A;  1OZS A;  1KK8 B;  3K21 A;  1H4B A;  1Y1X A;  1NCZ A;  3GOF A;  5HKY A;  4ETO A;  2NCO A;  2FOT A;  2G2B A;  1SNL A;  4HSZ A;  4MBE A;  1J55 A;  2LLT A;  2LAP A;  4AOM A;  1TNX A;  3OHM B;  4OV2 A;  1IWQ A;  2WOS A;  1BT6 A;  1K90 D;  2COL B;  2LLU A;  3LCP C;  4ZCV A;  1XO5 A;  2BL0 C;  1WRL A;  3DVE A;  1BF5 A;  1SCM B;  2HET A;  3EVV A;  1WRZ A;  4WQ2 A;  1B4C A;  2B1U A;  1IKU A;  3PFV A;  3VRP A;  4WRI A;  2H2K A;  4PE0 A;  1XVJ A;  1QX5 B;  2Y1N A;  4GNK B;  4HRG A;  4ZCU A;  2BE4 A;  1YVH A;  3CLN A;  4I5N B;  2F3Z A;  1ZAC A;  1ZUZ A;  3E3R A;  5TNC A;  4CFR A;  5KTY A;  1JSA A;  2CCM A;  3I5G C;  2SCP A;  3PN7 C;  2PAL A;  4I5L B;  2M7L A;  1M45 A;  1M46 A;  2KGB C;  3NSO A;  4MZK A;  3CR4 X;  2KQ6 A;  4M2O A;  1RK9 A;  1QJT A;  3LL8 B;  3M0W A;  4U8D A;  2JXC A;  1UUR A;  1GGZ A;  2KYF A;  1EH2 A;  1S36 A;  1SCV A;  1ZOT B;  1MQ1 A;  2Y1M A;  3I5I C;  1JF0 A;  1XFX O;  2MA2 A;  3O78 A;  3TS5 C;  1S5G Z;  4D1E A;  4A4B A;  3D0Y B;  1A75 A;  2AAO A;  2LHI A;  1AVS A;  4MVF A;  3LK1 A;  5D7F A;  2KHN A;  4YGA A;  1L2O B;  1IRJ A;  1EXR A;  1PVB A;  1MXL C;  3ZWH A;  5KSZ A;  1TNP A;  3VRO A;  1Y0V H;  3GK1 A;  2KOT A;  1S6J A;  3QRX A;  1XFW O;  1NCX A;  2JT0 A;  4NDB A;  1TNW A;  2NCP A;  3TDU A;  2Q91 A;  1AJ4 A;  3DF0 B;  3OX6 A;  1F55 A;  5CSN A;  1Q80 A;  1OZO A;  4GGF A;  4R1E A;  3GK2 A;  4PHK A;  5HKW A;  2KI4 B;  1UHJ A;  2LVI A;  4MRY A;  1GJY A;  1G33 A;  3VRN A;  1DVI A;  1BOD A;  2ISD A;  3TZ1 A;  4GPL B;  4DS7 A;  1YUT A;  3C1V A;  1SY9 A;  1F8H A;  2VRG A;  1K8U A;  2KFG A;  1C07 A;  2JTZ A;  3JVT B;  5AEQ A;  1CFD A;  1PUL A;  2L50 A;  2ZND A;  4MZJ A;  2O5G A;  5I8N A;  1EG3 A;  1MXE A;  1NIW A;  2ZRT A;  2CBL A;  3AKA A;  4ORB B;  3OX5 A;  1QXP A;  1TRF A;  2ZRS A;  4PHM A;  1XA5 A;  1MF8 B;  1LIN A;  2BCA A;  4ICB A;  4OR9 B;  5AER A;  1IJ5 A;  2L4I A;  1DJY A;  1DJX A;  4PHN A;  2OS8 B;  4C0J A;  1KK7 Y;  2M9G A;  1C7V A;  2F2O A;  2WND A;  3CWG A;  2G9B A;  2L2E A;  3NXA A;  1K95 A;  1A29 A;  1WDC B;  1R2U A;  1LA0 A;  5G08 A;  5KU1 A;  1GGW A;  2LP2 A;  2QPT A;  4BY5 A;  1KFU L;  3JTD C;  5CSJ A;  1DGV A;  1UHK A;  1S26 D;  3LLE A;  2AUC A;  1LXF C;  4PAL A;  2HQ8 A;  1SW8 A;  4QJ3 B;  1D1O A;  1NP8 A;  3EVU A;  3DVJ A;  4GUK A;  1K96 A;  2MAZ A;  2Y4Q A;  3SG4 A;  2KAV A;  3WXA A;  1BMO A;  4USL A;  3FWB A;  5HLO A;  2L5X B;  3BUN B;  1REC A;  1XFV O;  2K8M B;  2OTG C;  2KFF A;  1EL4 A;  1CLM A;  3EKH A;  3OP0 A;  3BXK A;  2ZNE A;  3CR5 X;  1N65 A;  1WY9 A;  4YGC B;  2V53 A;  3NSK A;  2JQ6 A;  2L51 A;  2KYC A;  4DUQ A;  3VRQ A;  4CLN A;  3HCM A;  1M63 B;  1BR1 B;  5DKQ A;  1MUX A;  1QX7 A;  1CFC A;  3BUX B;  2KNE A;  3SG2 A;  1S6C A;  2H61 A;  1KFX S;  1KK7 Z;  1SKT A;  1W7J B;  4I5K A;  1CKK A;  2K7O A;  1A75 B;  3O2P A;  1S5G Y;  3SG5 A;  5B8I B;  1FPW A;  1XK4 C;  1B9A A;  1CM4 A;  4GGN A;  1TCO B;  2EHB A;  4M2P A;  2JC2 A;  1KFU S;  5CSI A;  4F0Z B;  2ZN8 A;  3VRR A;  2K7D A;  3KO0 A;  4JPZ B;  1FF1 A;  1KQV A;  3NSL A;  2KI6 D;  4M2Q A;  1BG1 A;  3SG7 A;  4YBH B;  4QJ5 B;  2KI6 C;  2LC5 A;  1EG4 A;  3BQ3 A;  1JBA A;  1Y1A A;  1DTL A;  1G4Y R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...