1ZACA

N-domain of troponin c from chicken skeletal muscle, nmr, minimized average structure
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
b'ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN-C
publication title Low-temperature-induced structural changes in the Apo regulatory domain of skeletal muscle troponin C.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zacA00
2HPSA 4OR9B 2K7CA 2KAYA 4OKHA 2M97A 1XFVO 2O5GA 1KK8B 1M39A 1OQPA 1WRZA 2LUXA 2PSRA 4GBAA 1QATA 4NDCA 1IQ3A 1W7JB 3QRXA 2L4IA 1S36A 1K2HA 4YGEB 1KSOA 3OB1B 1M45A 4YI8A 1K9PA 2Y5IA 1X02A 3OP0A 3EVRA 3LCPC 1AK8A 3I5HB 5I2LA 1RJVA 3NSKA 1MWNA 1IH0A 5CSJA 1BT6A 1NX3A 1LVCD 1UHIA 4E68A 1HQVA 3FWBA 2I18A 3AAKA 1YUUA 1IGVA 2ZN9A 5DKRA 5CPVA 4UPGA 4XJKA 2LVJA 3I5IB 1DTLA 1DF0B 1A75B 1J1EA 3SG5A 5JOLA 2OPOA 1FBVA 1GGWA 1F70A 3WXAA 3TDZA 1IKUA 3O2PA 5HKWA 5TNCA 1QV1A 3BYAA 1EH2A 1JUOA 3TDUA 2CT9A 2JT0A 4C0JA 1J7QA 2OS8B 1MXLC 1IQ5A 1EXRA 4C0LA 3JVTC 1EL4A 1S6IA 4OVNF 3SIAA 4NQGA 2LANA 4HREE 1ZFSA 4YGBB 5I2QA 1NCZA 2BCAA 4L9MA 1DMOA 2QPTA 4PE0A 1RK9A 1DJGA 1ZMZA 1RFJA 4OCIA 2FCDA 2LUCA 3IF7A 1QXPA 1BMOA 3TDIA 2FJUB 3EK4A 1V1GA 1MXEA 4R1EA 4GGNA 4ETOA 5AERA 2WCEA 2LE9B 3I5GC 4BY5A 1QVIY 2LAPA 4A4BA 1OOJA 3VROA 4JPZB 4NDBA 1B8RA 1M31A 2JC2A 1BJFA 1SY9A 1WRLA 1XK4A 5HKYA 1TNQA 1ALWA 3DVKA 2L50A 1KFUL 1CM4A 2COLB 3OX5A 3DF0B 1UHHA 1S3PA 1GJYA 2JRFA 3BOWB 1SBJA 3WHTB 1AVSA 2V53A 1S26D 1Y6WA 4GUKA 2ZRSA 2JNFA 4MBEA 1FW4A 1BF5A 4GGFC 4FQOA 1A03A 5DKNA 4QJ5B 1J7OA 1F71A 3KF9A 1PK0D 4GAOA 1CFPA 4M2OA 3O78A 4MZJA 4AQJA 1NSHA 1KFXL 1FI6A 1MHOA 1TN4A 1LINA 1QLKA 2NXQA 3LLEA 1M46A 4P5OE 1ALVA 2BKIB 1PALA 3EK7A 1WDCC 4D1EA 1CKKA 3DVMA 2KYCA 1SL8A 1J55A 3D10A 1U5IB 2CBLA 1TNWA 2L51A 4GFTA 3WHUB 1F8HA 3CR4X 4PHNA 4MVFA 4PHJA 5B8IB 2KHNA 1EG4A 1TOPA 2CTNA 2NZ0A 3K21A 2M49B 4CLNA 5AANA 1IJ6A 1Y0VH 2SCPA 2JT8A 2LP2A 1MR8A 1YRTB 2K7DA 1ZACA 2MRDA 3BXKA 3ZNIA 2L4HA 2KI6D 2BCXA 2LM5A 1OZOA 5IBWA 3WNXB 1XVJA 4MRYA 4CFRA 1AJ5A 2H61C 1XFYO 2K7BA 5KTYA 2JWWA 3BUWB 3BUOB 3I5IC 3CGAA 1UP5A 2KYFA 4N1FA 1JWDA 1IRJA 2B1UA 1J1DA 4XYNA 4QJ4B 2A4JA 3M0WA 2F3YA 1DVIA 1AP4A 1C7VA 4MRXA 4NDDA 1K9KA 5D7FA 3KHEA 2WC8A 1H4BA 2LMVA 4WQ2A 3H4SE 1FF1A 3DD4A 2OS8C 1A4PA 4PE7A 1B4CA 2MA2A 3EKHA 2L2EA 2CCMA 1G8IA 3VRPA 2PRUA 2GGZA 1OSAA 3GK4X 1YVHA 2M3WA 4PALA 4ZCUA 1PVBA 1S5GY 1J7PA 1TIZA 2BECA 1XFUO 4I5NB 5D69A 3NSLA 3IQOA 2BE4A 3CS1A 2O60A 1S6JA 3AKAA 1JF0A 1XFWO 3RM1A 1YVLA 1SK6D 1OZSA 2Q4UA 2KGRA 1W7IB 2ZRTA 2I7AA 2KI4B 2KOTA 5ER5A 2D8NA 3SG6A 5CSIA 1BOCA 2EHBA 1M63B 1S1EA 2MJWB 1DJHA 1UHJA 2TN4A 1QTXA 4QJ3B 3BUXB 2PASA 1A29A 1NCYA 2HETA 2AUCA 4PE4A 1SNLA 2BKHB 3FWCA 3OB2B 1F54A 4GPLB 2K2AA 3ICBA 1CNPA 4IL1A 3CWGA 5KU1A 2WORA 3BQ3A 2BBMA 2MAZA 1DJWA 1AUIB 2KQ6A 1QS7A 1TNXA 1N0YA 1NCXA 1JFJA 3KPXA 1CDMA 2LMTA 2NCPA 1GQMA 3ZWHA 1PULA 4P2YB 4YGDB 5HLVA 5J3XA 2F2OA 1LA3A 1CM1A 3BUNB 3HX4A 2OTGC 2RGIA 3OHMB 4DS7A 1NX0A 2ZN8A 3VRNA 2BL0C 3F45A 1RWYA 1CLBA 2H61A 2BCBA 2IS9A 2MHHA 3TUYC 1F55A 4AOMA 1A75A 1LKJA 4MSPA 1A2XA 2QACA 2WCBA 4I5JA 2MLEC 4U8DA 2LLSA 1Y1UA 1Y1XA 1DJIA 1PSBA 2CXJA 2WCFA 1DT7B 2K61A 1IG5A 1C07A 1BG1A 1JF2A 1NUBA 1UHKA 2FOTA 3I5FC 1DGVA 2JPTA 2KFGA 2KI6C 3O4YA 1D1OA 1TRFA 2FCEA 3TS5C 2F2PA 3A8RA 1OMVA 2OTGB 4AQIA 1QIVA 1K95A 1NX1A 2VRGA 1N2DA 1TTXA 1VRKA 4ZCVA 3CR2A 2BL0B 2BBNA 1CLLA 3D0YB 3PLFB 3TUYB 1CMGA 4YBHB 2Q91A 1B9AA 1NPQA 2CNPA 3SIBA 2P6BB 1KQMB 5BPJA 1YX8A 1BU3A 2KDHA 1L7ZA 2KGBC 4PCWA 4DRWA 1JC2A 3EK8A 2LLUA 4MZKA 1BLQA 2JU0A 2JTZA 1TCOB 3I5FB 2LC5A 3KEVA 1V1FA 3C1VA 4PDZA 3FIAA 1YUTA 3PFVA 1EJ3A 1IJ5A 2AAOA 3TS5B 2JT3A 2M9GA 2G9BA 1AJ4A 3RLZA 2LCPA 3DF0A 5ER4X 4DCKA 5DKQA 4XJKB 4ORAB 4A4CA 4I5KA 3BOWA 5AEQA 3LK0A 4PHKA 4DIRA 3EKJA 5G08A 2GGMA 2JXLA 2K0JA 2Y4QA 1QVIZ 2HF5A 1K8UA 1B7TY 4M2QA 2JNXA 4MLWA 4JWQA 2KI4C 1LXFC 1XFZO 3VRRA 3FS7A 2KFHA 1SCVA 2K7OA 1SPYA 2KNEA 1WRKA 5K89A 2LLTA 2ZNEA 3OX6A 1GGZA 1NIWA 1SMGA 1XK4C 3CR5X 3PM8A 2KAVA 1KWOB 2MLFC 1G33A 1QJTA 4PE1A 2M7NA 1QX2A 1BR4B 3IQQA 2MBXA 3NSOA 1U5IA 4HRGA 5GQQC 4YRUA 1CDPA 3SG2A 4BY4A 2EGDA 1Y1AA 1HT9A 1N65A 1OMRA 3JTDC 1SKTA 1SL9A 1EG3A 4I5LB 3SG7A 1UUSA 1BR1B 2M0RA 2KBMA 3NSIA 1KSMA 2LHIA 1L2OB 1NP8A 1ODBA 1MF8B 1QX7A 4GGFA 1DJXA 1B8CA 1QV0A 3CLNA 1YX7A 2SASA 2EC6B 2Y1MA 3PN7B 3GK1A 2PALA 3PATA 4HSZA 4WQ3A 1XA5A 3SG3A 5PALA 4CIDA 2R2IA 1MUXA 2JULA 1SYMA 1KFUS 1UHNA 3SJSA 2L0PA 4YGAA 2E6WA 1YRUB 4MEWA 2LVIA 1RECA 1NYAA 1QX5B 3CTNA 1UURA 2BE6A 3D0YA 1WLZA 2AMIA 3JTDB 1AHRA 1QIWA 1F4QA 2ISDA 5CSFA 1PRWA 2ZFDA 3VGOA 3PALA 3GK2A 3NXAA 4USLA 3KO0A 5AXIA 3SG4A 4MZLA 1Q80A 2LP3A 2M8UA 1SR6C 3O6BA 1NX2A 1CMFA 1DJYA 1KK7Y 1K93D 1KFXS 1IWQA 4YGCB 1B47A 2GV5A 2JQ6A 2PMYA 1YURA 2KSPA 2ZNDA 4CPVA 5HKZA 2PVBA 1MQ1A 2NCOA 3LK1A 4F0ZB 3DVJA 1JBAA 1CTRA 2JZIA 1RTP1 1DF0A 1XO5A 2F8PA 1KQMC 4FTGA 1B7TZ 4N1GA 2KAXA 2M1UA 5F6TA 1KCYA 1YUSA 4C0KA 1YTZC 3LL8B 1CFCA 4ORBB 1CB1A 2LMUA 2HQWA 1QASA 5KSZA 1J7RA 1E8AA 1F4OA 2LVKA 1DJZA 1SR6B 4CFQA 4HRHA 1TNPA 2G2BA 1CFDA 1SW8A 2I2RE 2LVVA 3JVTB 1S5GZ 2M29A 1UWOA 5FYXA 3A4UB 1BODA 1SCMC 4WRIA 1CDLA 1ZOTB 2WOSA 4YI9A 1CDNA 2I94A 3AAJA 1R2UA 1OMDA 4GNKB 2K8MB 3TZ1A 1QLSA 4PHMA 3HCMA 3PSRA 1WLMA 2DOQA 2ZKMX 4N5XA 2L5XB 1JSAA 3GOFA 1FI5A 2HQ8A 2LHLA 1K9UA 3DVEA 1K90D 1RROA 2KFFA 1OE9B 3I5GB 1NWDA 5JJGA 4TNCA 2LV7A 1CFFA 1JFKA 3BUMB 1DGUA 2E30A 2Y1NA 5I8NA 1LA0A 2KBIA 4JQ0D 2L98A 1XFXO 2LNKA 1KWOC 4M2PA 2JTTA 1S6CA 4DUQA 1SCMB 1KK8C 3MSEB 1WY9A 5CSNA 1PSRA 1PVAA 3AKBA 3CZTX 3EVUA 2JOJA 1B1GA 1FPWA 1K96A 5HLOA 1CLMA 5AFPA 1XYDA 2H2KA 1L2OC 2M1KB 2M7LA 1B8LA 1KK7Z 1SL7A 2JXCA 2F33A 4ICBA 4Q04A 3VRQA 5I2OA 3I5HC 1KQVA 2NLNA 2K2FA 2WNDA 1H8BA 2EC6C 1ZUZA 4MN0A 1G4YR 1C7WA 3PN7C 2F3ZA 1SRAA 3E3RA 1R6PA 4ORCB 3EVVA 5HYDA 1K94A 1TCFA 1YR5A 2KQYA 1WDCB 4OV2A
chains in the Genus database with same CATH superfamily
2HPSA 4OR9B 2K7CA 2KAYA 4OKHA 2M97A 1XFVO 2O5GA 1KK8B 1M39A 1OQPA 1TUZA 1WRZA 2LUXA 2PSRA 4GBAA 1QATA 4NDCA 1IQ3A 1W7JB 3QRXA 2L4IA 1S36A 1K2HA 4YGEB 1KSOA 3OB1B 5HL1A 1M45A 4YI8A 1K9PA 2Y5IA 3NHIA 1X02A 3OP0A 3EVRA 3LCPC 1AK8A 3I5HB 5I2LA 1RJVA 3UNWA 3NSKA 1MWNA 3DYEA 2QEVA 1IH0A 5CSJA 1BT6A 1NX3A 1LVCD 1UHIA 3PJIA 3BFBA 4E68A 1HQVA 3FWBA 2I18A 3AAKA 1YUUA 1IGVA 1SSEB 2ZN9A 5CPVA 5DKRA 2QEOA 3L4LA 4UPGA 2PYQA 4XJKA 2LVJA 3I5IB 1DTLA 1DF0B 1A75B 1J1EA 3SG5A 5JOLA 2OPOA 1FBVA 1GGWA 1C3ZA 1F70A 3WXAA 3TDZA 1IKUA 3O2PA 5HKWA 5TNCA 1QV1A 3BYAA 1EH2A 1JUOA 3TDUA 4JD9A 1OOIX 2CT9A 2JT0A 4C0JA 1J7QA 2OS8B 5FI2A 1MXLC 1IQ5A 1EXRA 4C0LA 3JVTC 1EL4A 1S6IA 4OVNF 3SIAA 4NQGA 2LANA 4HREE 1ZFSA 3B7AA 4YGBB 5I2QA 1NCZA 2BCAA 3CDNA 4L9MA 1DMOA 3CZ2A 2QPTA 3QMEA 4PE0A 1RK9A 1DJGA 1ZMZA 1RFJA 4OCIA 2FCDA 3D77A 2LUCA 3IF7A 3RZSA 1QXPA 1BMOA 3DY9A 3TDIA 2FJUB 3EK4A 1OW4A 1V1GA 2BAPA 1MXEA 4R1EA 1XFRA 4GGNA 4ETOA 5AERA 2WCEA 2LE9B 3I5GC 3CYZA 4BY5A 1QVIY 2LAPA 4A4BA 1OOJA 3VROA 4JPZB 3B6XA 4NDBA 1B8RA 3SS4A 5FI7A 1M31A 2JC2A 1BJFA 1SY9A 1WRLA 3VB1A 1XK4A 1DELA 5HKYA 1TNQA 1ALWA 3DVKA 2L50A 3EG5B 1KFUL 1CM4A 2COLB 3OX5A 3DF0B 1UHHA 1S3PA 1GJYA 2JRFA 3BOWB 1SBJA 3WHTB 1AVSA 2V53A 3D75A 1S26D 1Y6WA 4GUKA 2ZRSA 2JNFA 3D74A 4MBEA 1FW4A 1BF5A 1GM0A 4GGFC 4FQOA 1A03A 5DKNA 4QJ5B 1J7OA 1F71A 3KF9A 3SS5A 1PK0D 4GAOA 1CFPA 4M2OA 3O78A 4MZJA 4AQJA 1NSHA 1KFXL 1FI6A 1MHOA 1TN4A 1LINA 1QLKA 2L5YA 2NXQA 1M46A 3LLEA 4P5OE 1ALVA 2L2CA 2BKIB 1PALA 3EK7A 1WDCC 4D1EA 1CKKA 3DVMA 2KYCA 1SL8A 1J55A 3D10A 1U5IB 2CBLA 1TNWA 2L51A 4GFTA 3WHUB 1F8HA 3CR4X 2WC5A 4PHNA 4MVFA 4PHJA 1Z4HA 2QEHA 5B8IB 2KHNA 1EG4A 1TOPA 2CTNA 2NZ0A 3K21A 2M49B 4CLNA 5AANA 1IJ6A 1Y0VH 2SCPA 2JT8A 2LP2A 3L47A 2FJYA 1MR8A 1YRTB 2K7DA 1ZACA 2MRDA 3BXKA 3ZNIA 2L4HA 1P28A 2BCXA 2KI6D 2LM5A 1OZOA 3SS3A 5IBWA 3WNXB 1XVJA 4MRYA 4CFRA 1AJ5A 2H61C 1XFYO 2K7BA 2WCMA 2JWWA 5KTYA 3BUWB 3BUOB 3I5IC 4IJ7A 3CGAA 1UP5A 2KYFA 4N1FA 1DC1A 1IRJA 1JWDA 2B1UA 1J1DA 4XYNA 5D3OA 4QJ4B 3S0FA 2A4JA 3M0WA 2F3YA 1DVIA 1AP4A 1C7VA 4MRXA 4NDDA 1K9KA 5D7FA 3KHEA 2WC8A 3R1OA 1H4BA 2LMVA 4WQ2A 3S0GA 3H4SE 3D76A 1FF1A 3IVTA 3DD4A 2OS8C 1ORGA 3S0DA 1A4PA 4PE7A 1B4CA 2MA2A 3B88A 3D73A 2GTEA 3EKHA 2L2EA 2CCMA 1G8IA 3VRPA 2PRUA 2GGZA 1OSAA 3GK4X 1YVHA 2M3WA 4PALA 4ZCUA 1PVBA 1S5GY 1J7PA 1TIZA 2BECA 1XFUO 4I5NB 5D69A 3NSLA 3IQOA 4INXA 2BE4A 3CS1A 2O60A 1S6JA 3AKAA 1JF0A 1XFWO 3RM1A 1IIOA 1YVLA 1SK6D 1OZSA 2Q4UA 2KGRA 1W7IB 2ZRTA 3B86A 2I7AA 2KI4B 2KOTA 5ER5A 2D8NA 3SG6A 5CSIA 1OOHA 1BOCA 2EHBA 1M63B 1S1EA 2MJWB 1DJHA 1UHJA 5DICA 2TN4A 1QTXA 4QJ3B 3BUXB 2PASA 1A29A 1NCYA 2HETA 2AUCA 4PE4A 1SNLA 2BKHB 3FWCA 3OB2B 1F54A 4GPLB 2K2AA 3ICBA 1CNPA 4IL1A 3CWGA 5KU1A 2WORA 3L4AA 3BQ3A 2BBMA 2MAZA 1DJWA 1AUIB 2KQ6A 4KYNA 1QS7A 1TNXA 1N0YA 2JPOA 1NCXA 1JFJA 3KPXA 1CDMA 2LMTA 2NCPA 1GQMA 2PQLA 3ZWHA 1PULA 4P2YB 4YGDB 5HLVA 5J3XA 2F2OA 1LA3A 1CM1A 3FE9A 3BUNB 3HX4A 3R1PA 2OTGC 2RGIA 3OHMB 4DS7A 1NX0A 2ZN8A 3VRNA 2BL0C 3F45A 1RWYA 1CLBA 2H61A 2BCBA 2IS9A 2MHHA 3TUYC 1DEKA 1F55A 4AOMA 1A75A 1LKJA 4MSPA 1A2XA 2QDIA 3PM2A 2QACA 2WCBA 4I5JA 2MLEC 4U8DA 2LLSA 1Y1UA 1Y1XA 3DXLA 1DJIA 1PSBA 3OGNA 2CXJA 2WCFA 1DT7B 2K61A 1IG5A 1C07A 1BG1A 1JF2A 1NUBA 1OOGA 1UHKA 2FOTA 3I5FC 2P71A 1DGVA 2JPTA 2KFGA 2KI6C 2WCKA 3O4YA 1TRFA 1D1OA 2FCEA 3TS5C 1QWVA 2F2PA 1DQEA 3A8RA 1OMVA 2OTGB 4AQIA 4OZDA 1QIVA 1K95A 1NX1A 2VRGA 1N2DA 1TTXA 1VRKA 4ZCVA 3CR2A 2BL0B 2BBNA 1CLLA 3D0YB 3PLFB 3TUYB 1CMGA 4YBHB 2Q91A 1B9AA 1NPQA 2CNPA 3SIBA 2P6BB 1KQMB 5BPJA 1YX8A 1BU3A 2KDHA 1L7ZA 2KGBC 3S0EA 4F7FA 4PCWA 4DRWA 1JC2A 3EK8A 2LLUA 4MZKA 1BLQA 2JU0A 2ERBA 3NGVA 2JTZA 1TCOB 3I5FB 2LC5A 3KEVA 1V1FA 3C1VA 4PDZA 3FIAA 1YUTA 3PFVA 1EJ3A 1IJ5A 2AAOA 3TS5B 2JT3A 2M9GA 3OBVA 2G9BA 1AJ4A 3RLZA 2LCPA 3DF0A 3R1VA 5ER4X 4DCKA 5DKQA 4XJKB 4ORAB 4A4CA 3CZ1A 4I5KA 3BOWA 5AEQA 3LK0A 4PHKA 3N7HA 4DIRA 3EKJA 3S0AA 5G08A 2GGMA 2JXLA 2K0JA 2Y4QA 1QVIZ 2HF5A 1K8UA 1B7TY 4M2QA 2JNXA 4MLWA 4JWQA 2KI4C 1LXFC 1XFZO 3VRRA 3FS7A 2KFHA 1SCVA 2K7OA 1SPYA 2KNEA 3UO9A 1WRKA 5K89A 2LLTA 2ZNEA 2WC6A 3OX6A 1GGZA 1NIWA 1SMGA 1XK4C 3CR5X 3PM8A 3K1EA 1T14A 1Z2CB 2KAVA 1KWOB 2MLFC 1G33A 1QJTA 4PE1A 2M7NA 1QX2A 1BR4B 3IQQA 2MBXA 3NSOA 1U5IA 4HRGA 5GQQC 4YRUA 1CDPA 3SG2A 4BY4A 2EGDA 1Y1AA 1HT9A 1N65A 1OMRA 1C3YA 2P70A 3JTDC 1SKTA 1SL9A 1EG3A 2QEBA 4I5LB 3SG7A 1UUSA 1BR1B 2M0RA 2KBMA 3NSIA 1KSMA 2LHIA 1L2OB 1NP8A 1ODBA 3NHTA 1MF8B 1QX7A 4GGFA 1DJXA 1B8CA 4INWA 1QV0A 3CLNA 1YX7A 2KPHA 2SASA 2EC6B 2Y1MA 3PN7B 3GK1A 2PALA 2YGUA 3B87A 3CZ0A 1XA5A 3PATA 4HSZA 4WQ3A 5PALA 2R2IA 1MUXA 4CIDA 2JULA 1SYMA 1KFUS 1UHNA 3SJSA 2L0PA 3Q8IA 4YGAA 2E6WA 1YRUB 4MEWA 2LVIA 1RECA 1NYAA 1QX5B 3CTNA 1UURA 2BE6A 3D0YA 1WLZA 2AMIA 3BFAA 1AHRA 3JTDB 1QIWA 1F4QA 2KLEA 2ISDA 5CSFA 1PRWA 1OOFA 2ZFDA 3VGOA 3PALA 3GK2A 3NXAA 4USLA 2BNXA 3KO0A 5AXIA 3SG4A 4MZLA 1Q80A 2LP3A 2M8UA 1SR6C 3O6BA 3FE8A 1NX2A 1CMFA 1DJYA 1KK7Y 1K93D 2WCJA 1KFXS 1IWQA 4YGCB 1B47A 2GV5A 5EL2A 3O4XA 2JQ6A 2PMYA 1YURA 2H8VA 2KSPA 2ZNDA 4FQTA 3D78A 3BJHA 4CPVA 5HKZA 2PVBA 3FE6A 1MQ1A 2NCOA 3LK1A 4F0ZB 3DVJA 1JBAA 1CTRA 2JZIA 1RTP1 1DF0A 1XO5A 2F8PA 1KQMC 4FTGA 1B7TZ 4N1GA 2KAXA 3R72A 2M1UA 5F6TA 1KCYA 1YUSA 4C0KA 1YTZC 3LL8B 1CFCA 4ORBB 3V2LA 1CB1A 2LMUA 2HQWA 1QASA 5KSZA 1J7RA 1E8AA 1F4OA 2LVKA 1DJZA 1SR6B 3S0BA 4CFQA 4HRHA 1TNPA 2G2BA 1CFDA 1SW8A 2I2RE 2LVVA 3JVTB 1S5GZ 2M29A 1UWOA 5FYXA 3A4UB 1BODA 1SCMC 2WCLA 4WRIA 1CDLA 1ZOTB 2WOSA 4YI9A 4PT1A 1CDNA 1LS8A 2I94A 3AAJA 1R2UA 1OMDA 4GNKB 2K8MB 3TZ1A 1QLSA 4PHMA 3HCMA 3PSRA 1WLMA 2DOQA 2ZKMX 4N5XA 2L5XB 1JSAA 3GOFA 1FI5A 2KLDA 2HQ8A 2LHLA 1W9ZA 1K9UA 2K60A 3DVEA 1K90D 1RROA 2KFFA 1OE9B 3I5GB 1NWDA 5JJGA 4TNCA 2LV7A 1CFFA 1JFKA 1TUJA 3BUMB 1DGUA 2E30A 2Y1NA 5I8NA 1LA0A 2KBIA 4JQ0D 2L98A 1XFXO 2LNKA 1KWOC 4M2PA 2JTTA 5I94A 1S6CA 2WCHA 4DUQA 3SG3A 1SCMB 1KK8C 3MSEB 1WY9A 5CSNA 1PSRA 1PVAA 3AKBA 3CZTX 3EVUA 2JOJA 1B1GA 1FPWA 1K96A 5HLOA 1CLMA 3DZTA 5AFPA 1XYDA 4JKTA 1TWOA 2H2KA 1L2OC 2M1KB 3BFHA 1B8LA 1KK7Z 1SL7A 2JXCA 2M7LA 2F33A 4ICBA 4Q04A 5FI6A 3VRQA 3CABA 5I2OA 3I5HC 1KQVA 2NLNA 2K2FA 2WNDA 1H8BA 2EC6C 1ZUZA 4MN0A 1G4YR 1C7WA 3PN7C 2F3ZA 1SRAA 3E3RA 1R6PA 4ORCB 3EVVA 5HYDA 1K94A 1TCFA 1YR5A 2KQYA 1WDCB 4OV2A
chains in the Genus database with same CATH topology
2HPSA 4OR9B 2K7CA 2KAYA 4OKHA 2M97A 1XFVO 2O5GA 1KK8B 1M39A 1OQPA 1WRZA 2LUXA 2PSRA 4GBAA 1QATA 4NDCA 1IQ3A 1W7JB 3QRXA 2L4IA 1S36A 1K2HA 4YGEB 1KSOA 3OB1B 1M45A 4YI8A 1K9PA 2Y5IA 1X02A 3OP0A 3EVRA 3LCPC 1AK8A 3I5HB 5I2LA 1RJVA 3NSKA 1MWNA 1IH0A 5CSJA 1BT6A 1NX3A 1LVCD 1UHIA 4E68A 1HQVA 3FWBA 2I18A 3AAKA 1YUUA 1IGVA 2ZN9A 5DKRA 5CPVA 4UPGA 4XJKA 2LVJA 3I5IB 1DTLA 1DF0B 1A75B 1J1EA 3SG5A 5JOLA 2OPOA 1FBVA 1GGWA 1F70A 3WXAA 3TDZA 1IKUA 3O2PA 5HKWA 5TNCA 1QV1A 3BYAA 1EH2A 1JUOA 3TDUA 2CT9A 2JT0A 4C0JA 1J7QA 2OS8B 1MXLC 1IQ5A 1EXRA 4C0LA 3JVTC 1EL4A 1S6IA 4OVNF 3SIAA 4NQGA 2LANA 4HREE 1ZFSA 4YGBB 5I2QA 1NCZA 2BCAA 4L9MA 1DMOA 2QPTA 4PE0A 1RK9A 1DJGA 1ZMZA 1RFJA 4OCIA 2FCDA 2LUCA 3IF7A 1QXPA 1BMOA 3TDIA 2FJUB 3EK4A 1V1GA 1MXEA 4R1EA 4GGNA 4ETOA 5AERA 2WCEA 2LE9B 3I5GC 4BY5A 1QVIY 2LAPA 4A4BA 1OOJA 3VROA 4JPZB 4NDBA 1B8RA 1M31A 2JC2A 1BJFA 1SY9A 1WRLA 1XK4A 5HKYA 1TNQA 1ALWA 3DVKA 2L50A 1KFUL 1CM4A 2COLB 3OX5A 3DF0B 1UHHA 1S3PA 1GJYA 2JRFA 3BOWB 1SBJA 3WHTB 1AVSA 2V53A 1S26D 1Y6WA 4GUKA 2ZRSA 2JNFA 4MBEA 1FW4A 1BF5A 4GGFC 4FQOA 1A03A 5DKNA 4QJ5B 1J7OA 1F71A 3KF9A 1PK0D 4GAOA 1CFPA 4M2OA 3O78A 4MZJA 4AQJA 1NSHA 1KFXL 1FI6A 1MHOA 1TN4A 1LINA 1QLKA 2NXQA 3LLEA 1M46A 4P5OE 1ALVA 2BKIB 1PALA 3EK7A 1WDCC 4D1EA 1CKKA 3DVMA 2KYCA 1SL8A 1J55A 3D10A 1U5IB 2CBLA 1TNWA 2L51A 4GFTA 3WHUB 1F8HA 3CR4X 4PHNA 4MVFA 4PHJA 5B8IB 2KHNA 1EG4A 1TOPA 2CTNA 2NZ0A 3K21A 2M49B 4CLNA 5AANA 1IJ6A 1Y0VH 2SCPA 2JT8A 2LP2A 1MR8A 1YRTB 2K7DA 1ZACA 2MRDA 3BXKA 3ZNIA 2L4HA 2KI6D 2BCXA 2LM5A 1OZOA 5IBWA 3WNXB 1XVJA 4MRYA 4CFRA 1AJ5A 2H61C 1XFYO 2K7BA 5KTYA 2JWWA 3BUWB 3BUOB 3I5IC 3CGAA 1UP5A 2KYFA 4N1FA 1JWDA 1IRJA 2B1UA 1J1DA 4XYNA 4QJ4B 2A4JA 3M0WA 2F3YA 1DVIA 1AP4A 1C7VA 4MRXA 4NDDA 1K9KA 5D7FA 3KHEA 2WC8A 1H4BA 2LMVA 4WQ2A 3H4SE 1FF1A 3DD4A 2OS8C 1A4PA 4PE7A 1B4CA 2MA2A 3EKHA 2L2EA 2CCMA 1G8IA 3VRPA 2PRUA 2GGZA 1OSAA 3GK4X 1YVHA 2M3WA 4PALA 4ZCUA 1PVBA 1S5GY 1J7PA 1TIZA 2BECA 1XFUO 4I5NB 5D69A 3NSLA 3IQOA 2BE4A 3CS1A 2O60A 1S6JA 3AKAA 1JF0A 1XFWO 3RM1A 1YVLA 1SK6D 1OZSA 2Q4UA 2KGRA 1W7IB 2ZRTA 2I7AA 2KI4B 2KOTA 5ER5A 2D8NA 3SG6A 5CSIA 1BOCA 2EHBA 1M63B 1S1EA 2MJWB 1DJHA 1UHJA 2TN4A 1QTXA 4QJ3B 3BUXB 2PASA 1A29A 1NCYA 2HETA 2AUCA 4PE4A 1SNLA 2BKHB 3FWCA 3OB2B 1F54A 4GPLB 2K2AA 3ICBA 1CNPA 4IL1A 3CWGA 5KU1A 2WORA 3BQ3A 2BBMA 2MAZA 1DJWA 1AUIB 2KQ6A 1QS7A 1TNXA 1N0YA 1NCXA 1JFJA 3KPXA 1CDMA 2LMTA 2NCPA 1GQMA 3ZWHA 1PULA 4P2YB 4YGDB 5HLVA 5J3XA 2F2OA 1LA3A 1CM1A 3BUNB 3HX4A 2OTGC 2RGIA 3OHMB 4DS7A 1NX0A 2ZN8A 3VRNA 2BL0C 3F45A 1RWYA 1CLBA 2H61A 2BCBA 2IS9A 2MHHA 3TUYC 1F55A 4AOMA 1A75A 1LKJA 4MSPA 1A2XA 2QACA 2WCBA 4I5JA 2MLEC 4U8DA 2LLSA 1Y1UA 1Y1XA 1DJIA 1PSBA 2CXJA 2WCFA 1DT7B 2K61A 1IG5A 1C07A 1BG1A 1JF2A 1NUBA 1UHKA 2FOTA 3I5FC 1DGVA 2JPTA 2KFGA 2KI6C 3O4YA 1D1OA 1TRFA 2FCEA 3TS5C 2F2PA 3A8RA 1OMVA 2OTGB 4AQIA 1QIVA 1K95A 1NX1A 2VRGA 1N2DA 1TTXA 1VRKA 4ZCVA 3CR2A 2BL0B 2BBNA 1CLLA 3D0YB 3PLFB 3TUYB 1CMGA 4YBHB 2Q91A 1B9AA 1NPQA 2CNPA 3SIBA 2P6BB 1KQMB 5BPJA 1YX8A 1BU3A 2KDHA 1L7ZA 2KGBC 4PCWA 4DRWA 1JC2A 3EK8A 2LLUA 4MZKA 1BLQA 2JU0A 2JTZA 1TCOB 3I5FB 2LC5A 3KEVA 1V1FA 3C1VA 4PDZA 3FIAA 1YUTA 3PFVA 1EJ3A 1IJ5A 2AAOA 3TS5B 2JT3A 2M9GA 2G9BA 1AJ4A 3RLZA 2LCPA 3DF0A 5ER4X 4DCKA 5DKQA 4XJKB 4ORAB 4A4CA 4I5KA 3BOWA 5AEQA 3LK0A 4PHKA 4DIRA 3EKJA 5G08A 2GGMA 2JXLA 2K0JA 2Y4QA 1QVIZ 2HF5A 1K8UA 1B7TY 4M2QA 2JNXA 4MLWA 4JWQA 2KI4C 1LXFC 1XFZO 3VRRA 3FS7A 2KFHA 1SCVA 2K7OA 1SPYA 2KNEA 1WRKA 5K89A 2LLTA 2ZNEA 3OX6A 1GGZA 1NIWA 1SMGA 1XK4C 3CR5X 3PM8A 2KAVA 1KWOB 2MLFC 1G33A 1QJTA 4PE1A 2M7NA 1QX2A 1BR4B 3IQQA 2MBXA 3NSOA 1U5IA 4HRGA 5GQQC 4YRUA 1CDPA 3SG2A 4BY4A 2EGDA 1Y1AA 1HT9A 1N65A 1OMRA 3JTDC 1SKTA 1SL9A 1EG3A 4I5LB 3SG7A 1UUSA 1BR1B 2M0RA 2KBMA 3NSIA 1KSMA 2LHIA 1L2OB 1NP8A 1ODBA 1MF8B 1QX7A 4GGFA 1DJXA 1B8CA 1QV0A 3CLNA 1YX7A 2SASA 2EC6B 2Y1MA 3PN7B 3GK1A 2PALA 3PATA 4HSZA 4WQ3A 1XA5A 3SG3A 5PALA 4CIDA 2R2IA 1MUXA 2JULA 1SYMA 1KFUS 1UHNA 3SJSA 2L0PA 4YGAA 2E6WA 1YRUB 4MEWA 2LVIA 1RECA 1NYAA 1QX5B 3CTNA 1UURA 2BE6A 3D0YA 1WLZA 2AMIA 3JTDB 1AHRA 1QIWA 1F4QA 2ISDA 5CSFA 1PRWA 2ZFDA 3VGOA 3PALA 3GK2A 3NXAA 4USLA 3KO0A 5AXIA 3SG4A 4MZLA 1Q80A 2LP3A 2M8UA 1SR6C 3O6BA 1NX2A 1CMFA 1DJYA 1KK7Y 1K93D 1KFXS 1IWQA 4YGCB 1B47A 2GV5A 2JQ6A 2PMYA 1YURA 2KSPA 2ZNDA 4CPVA 5HKZA 2PVBA 1MQ1A 2NCOA 3LK1A 4F0ZB 3DVJA 1JBAA 1CTRA 2JZIA 1RTP1 1DF0A 1XO5A 2F8PA 1KQMC 4FTGA 1B7TZ 4N1GA 2KAXA 2M1UA 5F6TA 1KCYA 1YUSA 4C0KA 1YTZC 3LL8B 1CFCA 4ORBB 1CB1A 2LMUA 2HQWA 1QASA 5KSZA 1J7RA 1E8AA 1F4OA 2LVKA 1DJZA 1SR6B 4CFQA 4HRHA 1TNPA 2G2BA 1CFDA 1SW8A 2I2RE 2LVVA 3JVTB 1S5GZ 2M29A 1UWOA 5FYXA 3A4UB 1BODA 1SCMC 4WRIA 1CDLA 1ZOTB 2WOSA 4YI9A 1CDNA 2I94A 3AAJA 1R2UA 1OMDA 4GNKB 2K8MB 3TZ1A 1QLSA 4PHMA 3HCMA 3PSRA 1WLMA 2DOQA 2ZKMX 4N5XA 2L5XB 1JSAA 3GOFA 1FI5A 2HQ8A 2LHLA 1K9UA 3DVEA 1K90D 1RROA 2KFFA 1OE9B 3I5GB 1NWDA 5JJGA 4TNCA 2LV7A 1CFFA 1JFKA 3BUMB 1DGUA 2E30A 2Y1NA 5I8NA 1LA0A 2KBIA 4JQ0D 2L98A 1XFXO 2LNKA 1KWOC 4M2PA 2JTTA 1S6CA 4DUQA 1SCMB 1KK8C 3MSEB 1WY9A 5CSNA 1PSRA 1PVAA 3AKBA 3CZTX 3EVUA 2JOJA 1B1GA 1FPWA 1K96A 5HLOA 1CLMA 5AFPA 1XYDA 2H2KA 1L2OC 2M1KB 2M7LA 1B8LA 1KK7Z 1SL7A 2JXCA 2F33A 4ICBA 4Q04A 3VRQA 5I2OA 3I5HC 1KQVA 2NLNA 2K2FA 2WNDA 1H8BA 2EC6C 1ZUZA 4MN0A 1G4YR 1C7WA 3PN7C 2F3ZA 1SRAA 3E3RA 1R6PA 4ORCB 3EVVA 5HYDA 1K94A 1TCFA 1YR5A 2KQYA 1WDCB 4OV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPS A;  4OR9 B;  2K7C A;  2KAY A;  4OKH A;  2M97 A;  1XFV O;  2O5G A;  1KK8 B;  1M39 A;  1OQP A;  1WRZ A;  2LUX A;  2PSR A;  4GBA A;  1QAT A;  4NDC A;  1IQ3 A;  1W7J B;  3QRX A;  2L4I A;  1S36 A;  1K2H A;  4YGE B;  1KSO A;  3OB1 B;  1M45 A;  4YI8 A;  1K9P A;  2Y5I A;  1X02 A;  3OP0 A;  3EVR A;  3LCP C;  1AK8 A;  3I5H B;  5I2L A;  1RJV A;  3NSK A;  1MWN A;  1IH0 A;  5CSJ A;  1BT6 A;  1NX3 A;  1LVC D;  1UHI A;  4E68 A;  1HQV A;  3FWB A;  2I18 A;  3AAK A;  1YUU A;  1IGV A;  2ZN9 A;  5DKR A;  5CPV A;  4UPG A;  4XJK A;  2LVJ A;  3I5I B;  1DTL A;  1DF0 B;  1A75 B;  1J1E A;  3SG5 A;  5JOL A;  2OPO A;  1FBV A;  1GGW A;  1F70 A;  3WXA A;  3TDZ A;  1IKU A;  3O2P A;  5HKW A;  5TNC A;  1QV1 A;  3BYA A;  1EH2 A;  1JUO A;  3TDU A;  2CT9 A;  2JT0 A;  4C0J A;  1J7Q A;  2OS8 B;  1MXL C;  1IQ5 A;  1EXR A;  4C0L A;  3JVT C;  1EL4 A;  1S6I A;  4OVN F;  3SIA A;  4NQG A;  2LAN A;  4HRE E;  1ZFS A;  4YGB B;  5I2Q A;  1NCZ A;  2BCA A;  4L9M A;  1DMO A;  2QPT A;  4PE0 A;  1RK9 A;  1DJG A;  1ZMZ A;  1RFJ A;  4OCI A;  2FCD A;  2LUC A;  3IF7 A;  1QXP A;  1BMO A;  3TDI A;  2FJU B;  3EK4 A;  1V1G A;  1MXE A;  4R1E A;  4GGN A;  4ETO A;  5AER A;  2WCE A;  2LE9 B;  3I5G C;  4BY5 A;  1QVI Y;  2LAP A;  4A4B A;  1OOJ A;  3VRO A;  4JPZ B;  4NDB A;  1B8R A;  1M31 A;  2JC2 A;  1BJF A;  1SY9 A;  1WRL A;  1XK4 A;  5HKY A;  1TNQ A;  1ALW A;  3DVK A;  2L50 A;  1KFU L;  1CM4 A;  2COL B;  3OX5 A;  3DF0 B;  1UHH A;  1S3P A;  1GJY A;  2JRF A;  3BOW B;  1SBJ A;  3WHT B;  1AVS A;  2V53 A;  1S26 D;  1Y6W A;  4GUK A;  2ZRS A;  2JNF A;  4MBE A;  1FW4 A;  1BF5 A;  4GGF C;  4FQO A;  1A03 A;  5DKN A;  4QJ5 B;  1J7O A;  1F71 A;  3KF9 A;  1PK0 D;  4GAO A;  1CFP A;  4M2O A;  3O78 A;  4MZJ A;  4AQJ A;  1NSH A;  1KFX L;  1FI6 A;  1MHO A;  1TN4 A;  1LIN A;  1QLK A;  2NXQ A;  3LLE A;  1M46 A;  4P5O E;  1ALV A;  2BKI B;  1PAL A;  3EK7 A;  1WDC C;  4D1E A;  1CKK A;  3DVM A;  2KYC A;  1SL8 A;  1J55 A;  3D10 A;  1U5I B;  2CBL A;  1TNW A;  2L51 A;  4GFT A;  3WHU B;  1F8H A;  3CR4 X;  4PHN A;  4MVF A;  4PHJ A;  5B8I B;  2KHN A;  1EG4 A;  1TOP A;  2CTN A;  2NZ0 A;  3K21 A;  2M49 B;  4CLN A;  5AAN A;  1IJ6 A;  1Y0V H;  2SCP A;  2JT8 A;  2LP2 A;  1MR8 A;  1YRT B;  2K7D A;  1ZAC A;  2MRD A;  3BXK A;  3ZNI A;  2L4H A;  2KI6 D;  2BCX A;  2LM5 A;  1OZO A;  5IBW A;  3WNX B;  1XVJ A;  4MRY A;  4CFR A;  1AJ5 A;  2H61 C;  1XFY O;  2K7B A;  5KTY A;  2JWW A;  3BUW B;  3BUO B;  3I5I C;  3CGA A;  1UP5 A;  2KYF A;  4N1F A;  1JWD A;  1IRJ A;  2B1U A;  1J1D A;  4XYN A;  4QJ4 B;  2A4J A;  3M0W A;  2F3Y A;  1DVI A;  1AP4 A;  1C7V A;  4MRX A;  4NDD A;  1K9K A;  5D7F A;  3KHE A;  2WC8 A;  1H4B A;  2LMV A;  4WQ2 A;  3H4S E;  1FF1 A;  3DD4 A;  2OS8 C;  1A4P A;  4PE7 A;  1B4C A;  2MA2 A;  3EKH A;  2L2E A;  2CCM A;  1G8I A;  3VRP A;  2PRU A;  2GGZ A;  1OSA A;  3GK4 X;  1YVH A;  2M3W A;  4PAL A;  4ZCU A;  1PVB A;  1S5G Y;  1J7P A;  1TIZ A;  2BEC A;  1XFU O;  4I5N B;  5D69 A;  3NSL A;  3IQO A;  2BE4 A;  3CS1 A;  2O60 A;  1S6J A;  3AKA A;  1JF0 A;  1XFW O;  3RM1 A;  1YVL A;  1SK6 D;  1OZS A;  2Q4U A;  2KGR A;  1W7I B;  2ZRT A;  2I7A A;  2KI4 B;  2KOT A;  5ER5 A;  2D8N A;  3SG6 A;  5CSI A;  1BOC A;  2EHB A;  1M63 B;  1S1E A;  2MJW B;  1DJH A;  1UHJ A;  2TN4 A;  1QTX A;  4QJ3 B;  3BUX B;  2PAS A;  1A29 A;  1NCY A;  2HET A;  2AUC A;  4PE4 A;  1SNL A;  2BKH B;  3FWC A;  3OB2 B;  1F54 A;  4GPL B;  2K2A A;  3ICB A;  1CNP A;  4IL1 A;  3CWG A;  5KU1 A;  2WOR A;  3BQ3 A;  2BBM A;  2MAZ A;  1DJW A;  1AUI B;  2KQ6 A;  1QS7 A;  1TNX A;  1N0Y A;  1NCX A;  1JFJ A;  3KPX A;  1CDM A;  2LMT A;  2NCP A;  1GQM A;  3ZWH A;  1PUL A;  4P2Y B;  4YGD B;  5HLV A;  5J3X A;  2F2O A;  1LA3 A;  1CM1 A;  3BUN B;  3HX4 A;  2OTG C;  2RGI A;  3OHM B;  4DS7 A;  1NX0 A;  2ZN8 A;  3VRN A;  2BL0 C;  3F45 A;  1RWY A;  1CLB A;  2H61 A;  2BCB A;  2IS9 A;  2MHH A;  3TUY C;  1F55 A;  4AOM A;  1A75 A;  1LKJ A;  4MSP A;  1A2X A;  2QAC A;  2WCB A;  4I5J A;  2MLE C;  4U8D A;  2LLS A;  1Y1U A;  1Y1X A;  1DJI A;  1PSB A;  2CXJ A;  2WCF A;  1DT7 B;  2K61 A;  1IG5 A;  1C07 A;  1BG1 A;  1JF2 A;  1NUB A;  1UHK A;  2FOT A;  3I5F C;  1DGV A;  2JPT A;  2KFG A;  2KI6 C;  3O4Y A;  1D1O A;  1TRF A;  2FCE A;  3TS5 C;  2F2P A;  3A8R A;  1OMV A;  2OTG B;  4AQI A;  1QIV A;  1K95 A;  1NX1 A;  2VRG A;  1N2D A;  1TTX A;  1VRK A;  4ZCV A;  3CR2 A;  2BL0 B;  2BBN A;  1CLL A;  3D0Y B;  3PLF B;  3TUY B;  1CMG A;  4YBH B;  2Q91 A;  1B9A A;  1NPQ A;  2CNP A;  3SIB A;  2P6B B;  1KQM B;  5BPJ A;  1YX8 A;  1BU3 A;  2KDH A;  1L7Z A;  2KGB C;  4PCW A;  4DRW A;  1JC2 A;  3EK8 A;  2LLU A;  4MZK A;  1BLQ A;  2JU0 A;  2JTZ A;  1TCO B;  3I5F B;  2LC5 A;  3KEV A;  1V1F A;  3C1V A;  4PDZ A;  3FIA A;  1YUT A;  3PFV A;  1EJ3 A;  1IJ5 A;  2AAO A;  3TS5 B;  2JT3 A;  2M9G A;  2G9B A;  1AJ4 A;  3RLZ A;  2LCP A;  3DF0 A;  5ER4 X;  4DCK A;  5DKQ A;  4XJK B;  4ORA B;  4A4C A;  4I5K A;  3BOW A;  5AEQ A;  3LK0 A;  4PHK A;  4DIR A;  3EKJ A;  5G08 A;  2GGM A;  2JXL A;  2K0J A;  2Y4Q A;  1QVI Z;  2HF5 A;  1K8U A;  1B7T Y;  4M2Q A;  2JNX A;  4MLW A;  4JWQ A;  2KI4 C;  1LXF C;  1XFZ O;  3VRR A;  3FS7 A;  2KFH A;  1SCV A;  2K7O A;  1SPY A;  2KNE A;  1WRK A;  5K89 A;  2LLT A;  2ZNE A;  3OX6 A;  1GGZ A;  1NIW A;  1SMG A;  1XK4 C;  3CR5 X;  3PM8 A;  2KAV A;  1KWO B;  2MLF C;  1G33 A;  1QJT A;  4PE1 A;  2M7N A;  1QX2 A;  1BR4 B;  3IQQ A;  2MBX A;  3NSO A;  1U5I A;  4HRG A;  5GQQ C;  4YRU A;  1CDP A;  3SG2 A;  4BY4 A;  2EGD A;  1Y1A A;  1HT9 A;  1N65 A;  1OMR A;  3JTD C;  1SKT A;  1SL9 A;  1EG3 A;  4I5L B;  3SG7 A;  1UUS A;  1BR1 B;  2M0R A;  2KBM A;  3NSI A;  1KSM A;  2LHI A;  1L2O B;  1NP8 A;  1ODB A;  1MF8 B;  1QX7 A;  4GGF A;  1DJX A;  1B8C A;  1QV0 A;  3CLN A;  1YX7 A;  2SAS A;  2EC6 B;  2Y1M A;  3PN7 B;  3GK1 A;  2PAL A;  3PAT A;  4HSZ A;  4WQ3 A;  1XA5 A;  3SG3 A;  5PAL A;  4CID A;  2R2I A;  1MUX A;  2JUL A;  1SYM A;  1KFU S;  1UHN A;  3SJS A;  2L0P A;  4YGA A;  2E6W A;  1YRU B;  4MEW A;  2LVI A;  1REC A;  1NYA A;  1QX5 B;  3CTN A;  1UUR A;  2BE6 A;  3D0Y A;  1WLZ A;  2AMI A;  3JTD B;  1AHR A;  1QIW A;  1F4Q A;  2ISD A;  5CSF A;  1PRW A;  2ZFD A;  3VGO A;  3PAL A;  3GK2 A;  3NXA A;  4USL A;  3KO0 A;  5AXI A;  3SG4 A;  4MZL A;  1Q80 A;  2LP3 A;  2M8U A;  1SR6 C;  3O6B A;  1NX2 A;  1CMF A;  1DJY A;  1KK7 Y;  1K93 D;  1KFX S;  1IWQ A;  4YGC B;  1B47 A;  2GV5 A;  2JQ6 A;  2PMY A;  1YUR A;  2KSP A;  2ZND A;  4CPV A;  5HKZ A;  2PVB A;  1MQ1 A;  2NCO A;  3LK1 A;  4F0Z B;  3DVJ A;  1JBA A;  1CTR A;  2JZI A;  1RTP 1;  1DF0 A;  1XO5 A;  2F8P A;  1KQM C;  4FTG A;  1B7T Z;  4N1G A;  2KAX A;  2M1U A;  5F6T A;  1KCY A;  1YUS A;  4C0K A;  1YTZ C;  3LL8 B;  1CFC A;  4ORB B;  1CB1 A;  2LMU A;  2HQW A;  1QAS A;  5KSZ A;  1J7R A;  1E8A A;  1F4O A;  2LVK A;  1DJZ A;  1SR6 B;  4CFQ A;  4HRH A;  1TNP A;  2G2B A;  1CFD A;  1SW8 A;  2I2R E;  2LVV A;  3JVT B;  1S5G Z;  2M29 A;  1UWO A;  5FYX A;  3A4U B;  1BOD A;  1SCM C;  4WRI A;  1CDL A;  1ZOT B;  2WOS A;  4YI9 A;  1CDN A;  2I94 A;  3AAJ A;  1R2U A;  1OMD A;  4GNK B;  2K8M B;  3TZ1 A;  1QLS A;  4PHM A;  3HCM A;  3PSR A;  1WLM A;  2DOQ A;  2ZKM X;  4N5X A;  2L5X B;  1JSA A;  3GOF A;  1FI5 A;  2HQ8 A;  2LHL A;  1K9U A;  3DVE A;  1K90 D;  1RRO A;  2KFF A;  1OE9 B;  3I5G B;  1NWD A;  5JJG A;  4TNC A;  2LV7 A;  1CFF A;  1JFK A;  3BUM B;  1DGU A;  2E30 A;  2Y1N A;  5I8N A;  1LA0 A;  2KBI A;  4JQ0 D;  2L98 A;  1XFX O;  2LNK A;  1KWO C;  4M2P A;  2JTT A;  1S6C A;  4DUQ A;  1SCM B;  1KK8 C;  3MSE B;  1WY9 A;  5CSN A;  1PSR A;  1PVA A;  3AKB A;  3CZT X;  3EVU A;  2JOJ A;  1B1G A;  1FPW A;  1K96 A;  5HLO A;  1CLM A;  5AFP A;  1XYD A;  2H2K A;  1L2O C;  2M1K B;  2M7L A;  1B8L A;  1KK7 Z;  1SL7 A;  2JXC A;  2F33 A;  4ICB A;  4Q04 A;  3VRQ A;  5I2O A;  3I5H C;  1KQV A;  2NLN A;  2K2F A;  2WND A;  1H8B A;  2EC6 C;  1ZUZ A;  4MN0 A;  1G4Y R;  1C7W A;  3PN7 C;  2F3Z A;  1SRA A;  3E3R A;  1R6P A;  4ORC B;  3EVV A;  5HYD A;  1K94 A;  1TCF A;  1YR5 A;  2KQY A;  1WDC B;  4OV2 A; 
#chains in the Genus database with same CATH topology
 2HPS A;  4OR9 B;  2K7C A;  2KAY A;  4OKH A;  2M97 A;  1XFV O;  2O5G A;  1KK8 B;  1M39 A;  1OQP A;  1TUZ A;  1WRZ A;  2LUX A;  2PSR A;  4GBA A;  1QAT A;  4NDC A;  1IQ3 A;  1W7J B;  3QRX A;  2L4I A;  1S36 A;  1K2H A;  4YGE B;  1KSO A;  3OB1 B;  5HL1 A;  1M45 A;  4YI8 A;  1K9P A;  2Y5I A;  3NHI A;  1X02 A;  3OP0 A;  3EVR A;  3LCP C;  1AK8 A;  3I5H B;  5I2L A;  1RJV A;  3UNW A;  3NSK A;  1MWN A;  3DYE A;  2QEV A;  1IH0 A;  5CSJ A;  1BT6 A;  1NX3 A;  1LVC D;  1UHI A;  3PJI A;  3BFB A;  4E68 A;  1HQV A;  3FWB A;  2I18 A;  3AAK A;  1YUU A;  1IGV A;  1SSE B;  2ZN9 A;  5CPV A;  5DKR A;  2QEO A;  3L4L A;  4UPG A;  2PYQ A;  4XJK A;  2LVJ A;  3I5I B;  1DTL A;  1DF0 B;  1A75 B;  1J1E A;  3SG5 A;  5JOL A;  2OPO A;  1FBV A;  1GGW A;  1C3Z A;  1F70 A;  3WXA A;  3TDZ A;  1IKU A;  3O2P A;  5HKW A;  5TNC A;  1QV1 A;  3BYA A;  1EH2 A;  1JUO A;  3TDU A;  4JD9 A;  1OOI X;  2CT9 A;  2JT0 A;  4C0J A;  1J7Q A;  2OS8 B;  5FI2 A;  1MXL C;  1IQ5 A;  1EXR A;  4C0L A;  3JVT C;  1EL4 A;  1S6I A;  4OVN F;  3SIA A;  4NQG A;  2LAN A;  4HRE E;  1ZFS A;  3B7A A;  4YGB B;  5I2Q A;  1NCZ A;  2BCA A;  3CDN A;  4L9M A;  1DMO A;  3CZ2 A;  2QPT A;  3QME A;  4PE0 A;  1RK9 A;  1DJG A;  1ZMZ A;  1RFJ A;  4OCI A;  2FCD A;  3D77 A;  2LUC A;  3IF7 A;  3RZS A;  1QXP A;  1BMO A;  3DY9 A;  3TDI A;  2FJU B;  3EK4 A;  1OW4 A;  1V1G A;  2BAP A;  1MXE A;  4R1E A;  1XFR A;  4GGN A;  4ETO A;  5AER A;  2WCE A;  2LE9 B;  3I5G C;  3CYZ A;  4BY5 A;  1QVI Y;  2LAP A;  4A4B A;  1OOJ A;  3VRO A;  4JPZ B;  3B6X A;  4NDB A;  1B8R A;  3SS4 A;  5FI7 A;  1M31 A;  2JC2 A;  1BJF A;  1SY9 A;  1WRL A;  3VB1 A;  1XK4 A;  1DEL A;  5HKY A;  1TNQ A;  1ALW A;  3DVK A;  2L50 A;  3EG5 B;  1KFU L;  1CM4 A;  2COL B;  3OX5 A;  3DF0 B;  1UHH A;  1S3P A;  1GJY A;  2JRF A;  3BOW B;  1SBJ A;  3WHT B;  1AVS A;  2V53 A;  3D75 A;  1S26 D;  1Y6W A;  4GUK A;  2ZRS A;  2JNF A;  3D74 A;  4MBE A;  1FW4 A;  1BF5 A;  1GM0 A;  4GGF C;  4FQO A;  1A03 A;  5DKN A;  4QJ5 B;  1J7O A;  1F71 A;  3KF9 A;  3SS5 A;  1PK0 D;  4GAO A;  1CFP A;  4M2O A;  3O78 A;  4MZJ A;  4AQJ A;  1NSH A;  1KFX L;  1FI6 A;  1MHO A;  1TN4 A;  1LIN A;  1QLK A;  2L5Y A;  2NXQ A;  1M46 A;  3LLE A;  4P5O E;  1ALV A;  2L2C A;  2BKI B;  1PAL A;  3EK7 A;  1WDC C;  4D1E A;  1CKK A;  3DVM A;  2KYC A;  1SL8 A;  1J55 A;  3D10 A;  1U5I B;  2CBL A;  1TNW A;  2L51 A;  4GFT A;  3WHU B;  1F8H A;  3CR4 X;  2WC5 A;  4PHN A;  4MVF A;  4PHJ A;  1Z4H A;  2QEH A;  5B8I B;  2KHN A;  1EG4 A;  1TOP A;  2CTN A;  2NZ0 A;  3K21 A;  2M49 B;  4CLN A;  5AAN A;  1IJ6 A;  1Y0V H;  2SCP A;  2JT8 A;  2LP2 A;  3L47 A;  2FJY A;  1MR8 A;  1YRT B;  2K7D A;  1ZAC A;  2MRD A;  3BXK A;  3ZNI A;  2L4H A;  1P28 A;  2BCX A;  2KI6 D;  2LM5 A;  1OZO A;  3SS3 A;  5IBW A;  3WNX B;  1XVJ A;  4MRY A;  4CFR A;  1AJ5 A;  2H61 C;  1XFY O;  2K7B A;  2WCM A;  2JWW A;  5KTY A;  3BUW B;  3BUO B;  3I5I C;  4IJ7 A;  3CGA A;  1UP5 A;  2KYF A;  4N1F A;  1DC1 A;  1IRJ A;  1JWD A;  2B1U A;  1J1D A;  4XYN A;  5D3O A;  4QJ4 B;  3S0F A;  2A4J A;  3M0W A;  2F3Y A;  1DVI A;  1AP4 A;  1C7V A;  4MRX A;  4NDD A;  1K9K A;  5D7F A;  3KHE A;  2WC8 A;  3R1O A;  1H4B A;  2LMV A;  4WQ2 A;  3S0G A;  3H4S E;  3D76 A;  1FF1 A;  3IVT A;  3DD4 A;  2OS8 C;  1ORG A;  3S0D A;  1A4P A;  4PE7 A;  1B4C A;  2MA2 A;  3B88 A;  3D73 A;  2GTE A;  3EKH A;  2L2E A;  2CCM A;  1G8I A;  3VRP A;  2PRU A;  2GGZ A;  1OSA A;  3GK4 X;  1YVH A;  2M3W A;  4PAL A;  4ZCU A;  1PVB A;  1S5G Y;  1J7P A;  1TIZ A;  2BEC A;  1XFU O;  4I5N B;  5D69 A;  3NSL A;  3IQO A;  4INX A;  2BE4 A;  3CS1 A;  2O60 A;  1S6J A;  3AKA A;  1JF0 A;  1XFW O;  3RM1 A;  1IIO A;  1YVL A;  1SK6 D;  1OZS A;  2Q4U A;  2KGR A;  1W7I B;  2ZRT A;  3B86 A;  2I7A A;  2KI4 B;  2KOT A;  5ER5 A;  2D8N A;  3SG6 A;  5CSI A;  1OOH A;  1BOC A;  2EHB A;  1M63 B;  1S1E A;  2MJW B;  1DJH A;  1UHJ A;  5DIC A;  2TN4 A;  1QTX A;  4QJ3 B;  3BUX B;  2PAS A;  1A29 A;  1NCY A;  2HET A;  2AUC A;  4PE4 A;  1SNL A;  2BKH B;  3FWC A;  3OB2 B;  1F54 A;  4GPL B;  2K2A A;  3ICB A;  1CNP A;  4IL1 A;  3CWG A;  5KU1 A;  2WOR A;  3L4A A;  3BQ3 A;  2BBM A;  2MAZ A;  1DJW A;  1AUI B;  2KQ6 A;  4KYN A;  1QS7 A;  1TNX A;  1N0Y A;  2JPO A;  1NCX A;  1JFJ A;  3KPX A;  1CDM A;  2LMT A;  2NCP A;  1GQM A;  2PQL A;  3ZWH A;  1PUL A;  4P2Y B;  4YGD B;  5HLV A;  5J3X A;  2F2O A;  1LA3 A;  1CM1 A;  3FE9 A;  3BUN B;  3HX4 A;  3R1P A;  2OTG C;  2RGI A;  3OHM B;  4DS7 A;  1NX0 A;  2ZN8 A;  3VRN A;  2BL0 C;  3F45 A;  1RWY A;  1CLB A;  2H61 A;  2BCB A;  2IS9 A;  2MHH A;  3TUY C;  1DEK A;  1F55 A;  4AOM A;  1A75 A;  1LKJ A;  4MSP A;  1A2X A;  2QDI A;  3PM2 A;  2QAC A;  2WCB A;  4I5J A;  2MLE C;  4U8D A;  2LLS A;  1Y1U A;  1Y1X A;  3DXL A;  1DJI A;  1PSB A;  3OGN A;  2CXJ A;  2WCF A;  1DT7 B;  2K61 A;  1IG5 A;  1C07 A;  1BG1 A;  1JF2 A;  1NUB A;  1OOG A;  1UHK A;  2FOT A;  3I5F C;  2P71 A;  1DGV A;  2JPT A;  2KFG A;  2KI6 C;  2WCK A;  3O4Y A;  1TRF A;  1D1O A;  2FCE A;  3TS5 C;  1QWV A;  2F2P A;  1DQE A;  3A8R A;  1OMV A;  2OTG B;  4AQI A;  4OZD A;  1QIV A;  1K95 A;  1NX1 A;  2VRG A;  1N2D A;  1TTX A;  1VRK A;  4ZCV A;  3CR2 A;  2BL0 B;  2BBN A;  1CLL A;  3D0Y B;  3PLF B;  3TUY B;  1CMG A;  4YBH B;  2Q91 A;  1B9A A;  1NPQ A;  2CNP A;  3SIB A;  2P6B B;  1KQM B;  5BPJ A;  1YX8 A;  1BU3 A;  2KDH A;  1L7Z A;  2KGB C;  3S0E A;  4F7F A;  4PCW A;  4DRW A;  1JC2 A;  3EK8 A;  2LLU A;  4MZK A;  1BLQ A;  2JU0 A;  2ERB A;  3NGV A;  2JTZ A;  1TCO B;  3I5F B;  2LC5 A;  3KEV A;  1V1F A;  3C1V A;  4PDZ A;  3FIA A;  1YUT A;  3PFV A;  1EJ3 A;  1IJ5 A;  2AAO A;  3TS5 B;  2JT3 A;  2M9G A;  3OBV A;  2G9B A;  1AJ4 A;  3RLZ A;  2LCP A;  3DF0 A;  3R1V A;  5ER4 X;  4DCK A;  5DKQ A;  4XJK B;  4ORA B;  4A4C A;  3CZ1 A;  4I5K A;  3BOW A;  5AEQ A;  3LK0 A;  4PHK A;  3N7H A;  4DIR A;  3EKJ A;  3S0A A;  5G08 A;  2GGM A;  2JXL A;  2K0J A;  2Y4Q A;  1QVI Z;  2HF5 A;  1K8U A;  1B7T Y;  4M2Q A;  2JNX A;  4MLW A;  4JWQ A;  2KI4 C;  1LXF C;  1XFZ O;  3VRR A;  3FS7 A;  2KFH A;  1SCV A;  2K7O A;  1SPY A;  2KNE A;  3UO9 A;  1WRK A;  5K89 A;  2LLT A;  2ZNE A;  2WC6 A;  3OX6 A;  1GGZ A;  1NIW A;  1SMG A;  1XK4 C;  3CR5 X;  3PM8 A;  3K1E A;  1T14 A;  1Z2C B;  2KAV A;  1KWO B;  2MLF C;  1G33 A;  1QJT A;  4PE1 A;  2M7N A;  1QX2 A;  1BR4 B;  3IQQ A;  2MBX A;  3NSO A;  1U5I A;  4HRG A;  5GQQ C;  4YRU A;  1CDP A;  3SG2 A;  4BY4 A;  2EGD A;  1Y1A A;  1HT9 A;  1N65 A;  1OMR A;  1C3Y A;  2P70 A;  3JTD C;  1SKT A;  1SL9 A;  1EG3 A;  2QEB A;  4I5L B;  3SG7 A;  1UUS A;  1BR1 B;  2M0R A;  2KBM A;  3NSI A;  1KSM A;  2LHI A;  1L2O B;  1NP8 A;  1ODB A;  3NHT A;  1MF8 B;  1QX7 A;  4GGF A;  1DJX A;  1B8C A;  4INW A;  1QV0 A;  3CLN A;  1YX7 A;  2KPH A;  2SAS A;  2EC6 B;  2Y1M A;  3PN7 B;  3GK1 A;  2PAL A;  2YGU A;  3B87 A;  3CZ0 A;  1XA5 A;  3PAT A;  4HSZ A;  4WQ3 A;  5PAL A;  2R2I A;  1MUX A;  4CID A;  2JUL A;  1SYM A;  1KFU S;  1UHN A;  3SJS A;  2L0P A;  3Q8I A;  4YGA A;  2E6W A;  1YRU B;  4MEW A;  2LVI A;  1REC A;  1NYA A;  1QX5 B;  3CTN A;  1UUR A;  2BE6 A;  3D0Y A;  1WLZ A;  2AMI A;  3BFA A;  1AHR A;  3JTD B;  1QIW A;  1F4Q A;  2KLE A;  2ISD A;  5CSF A;  1PRW A;  1OOF A;  2ZFD A;  3VGO A;  3PAL A;  3GK2 A;  3NXA A;  4USL A;  2BNX A;  3KO0 A;  5AXI A;  3SG4 A;  4MZL A;  1Q80 A;  2LP3 A;  2M8U A;  1SR6 C;  3O6B A;  3FE8 A;  1NX2 A;  1CMF A;  1DJY A;  1KK7 Y;  1K93 D;  2WCJ A;  1KFX S;  1IWQ A;  4YGC B;  1B47 A;  2GV5 A;  5EL2 A;  3O4X A;  2JQ6 A;  2PMY A;  1YUR A;  2H8V A;  2KSP A;  2ZND A;  4FQT A;  3D78 A;  3BJH A;  4CPV A;  5HKZ A;  2PVB A;  3FE6 A;  1MQ1 A;  2NCO A;  3LK1 A;  4F0Z B;  3DVJ A;  1JBA A;  1CTR A;  2JZI A;  1RTP 1;  1DF0 A;  1XO5 A;  2F8P A;  1KQM C;  4FTG A;  1B7T Z;  4N1G A;  2KAX A;  3R72 A;  2M1U A;  5F6T A;  1KCY A;  1YUS A;  4C0K A;  1YTZ C;  3LL8 B;  1CFC A;  4ORB B;  3V2L A;  1CB1 A;  2LMU A;  2HQW A;  1QAS A;  5KSZ A;  1J7R A;  1E8A A;  1F4O A;  2LVK A;  1DJZ A;  1SR6 B;  3S0B A;  4CFQ A;  4HRH A;  1TNP A;  2G2B A;  1CFD A;  1SW8 A;  2I2R E;  2LVV A;  3JVT B;  1S5G Z;  2M29 A;  1UWO A;  5FYX A;  3A4U B;  1BOD A;  1SCM C;  2WCL A;  4WRI A;  1CDL A;  1ZOT B;  2WOS A;  4YI9 A;  4PT1 A;  1CDN A;  1LS8 A;  2I94 A;  3AAJ A;  1R2U A;  1OMD A;  4GNK B;  2K8M B;  3TZ1 A;  1QLS A;  4PHM A;  3HCM A;  3PSR A;  1WLM A;  2DOQ A;  2ZKM X;  4N5X A;  2L5X B;  1JSA A;  3GOF A;  1FI5 A;  2KLD A;  2HQ8 A;  2LHL A;  1W9Z A;  1K9U A;  2K60 A;  3DVE A;  1K90 D;  1RRO A;  2KFF A;  1OE9 B;  3I5G B;  1NWD A;  5JJG A;  4TNC A;  2LV7 A;  1CFF A;  1JFK A;  1TUJ A;  3BUM B;  1DGU A;  2E30 A;  2Y1N A;  5I8N A;  1LA0 A;  2KBI A;  4JQ0 D;  2L98 A;  1XFX O;  2LNK A;  1KWO C;  4M2P A;  2JTT A;  5I94 A;  1S6C A;  2WCH A;  4DUQ A;  3SG3 A;  1SCM B;  1KK8 C;  3MSE B;  1WY9 A;  5CSN A;  1PSR A;  1PVA A;  3AKB A;  3CZT X;  3EVU A;  2JOJ A;  1B1G A;  1FPW A;  1K96 A;  5HLO A;  1CLM A;  3DZT A;  5AFP A;  1XYD A;  4JKT A;  1TWO A;  2H2K A;  1L2O C;  2M1K B;  3BFH A;  1B8L A;  1KK7 Z;  1SL7 A;  2JXC A;  2M7L A;  2F33 A;  4ICB A;  4Q04 A;  5FI6 A;  3VRQ A;  3CAB A;  5I2O A;  3I5H C;  1KQV A;  2NLN A;  2K2F A;  2WND A;  1H8B A;  2EC6 C;  1ZUZ A;  4MN0 A;  1G4Y R;  1C7W A;  3PN7 C;  2F3Z A;  1SRA A;  3E3R A;  1R6P A;  4ORC B;  3EVV A;  5HYD A;  1K94 A;  1TCF A;  1YR5 A;  2KQY A;  1WDC B;  4OV2 A; 
#chains in the Genus database with same CATH homology
 2HPS A;  4OR9 B;  2K7C A;  2KAY A;  4OKH A;  2M97 A;  1XFV O;  2O5G A;  1KK8 B;  1M39 A;  1OQP A;  1WRZ A;  2LUX A;  2PSR A;  4GBA A;  1QAT A;  4NDC A;  1IQ3 A;  1W7J B;  3QRX A;  2L4I A;  1S36 A;  1K2H A;  4YGE B;  1KSO A;  3OB1 B;  1M45 A;  4YI8 A;  1K9P A;  2Y5I A;  1X02 A;  3OP0 A;  3EVR A;  3LCP C;  1AK8 A;  3I5H B;  5I2L A;  1RJV A;  3NSK A;  1MWN A;  1IH0 A;  5CSJ A;  1BT6 A;  1NX3 A;  1LVC D;  1UHI A;  4E68 A;  1HQV A;  3FWB A;  2I18 A;  3AAK A;  1YUU A;  1IGV A;  2ZN9 A;  5DKR A;  5CPV A;  4UPG A;  4XJK A;  2LVJ A;  3I5I B;  1DTL A;  1DF0 B;  1A75 B;  1J1E A;  3SG5 A;  5JOL A;  2OPO A;  1FBV A;  1GGW A;  1F70 A;  3WXA A;  3TDZ A;  1IKU A;  3O2P A;  5HKW A;  5TNC A;  1QV1 A;  3BYA A;  1EH2 A;  1JUO A;  3TDU A;  2CT9 A;  2JT0 A;  4C0J A;  1J7Q A;  2OS8 B;  1MXL C;  1IQ5 A;  1EXR A;  4C0L A;  3JVT C;  1EL4 A;  1S6I A;  4OVN F;  3SIA A;  4NQG A;  2LAN A;  4HRE E;  1ZFS A;  4YGB B;  5I2Q A;  1NCZ A;  2BCA A;  4L9M A;  1DMO A;  2QPT A;  4PE0 A;  1RK9 A;  1DJG A;  1ZMZ A;  1RFJ A;  4OCI A;  2FCD A;  2LUC A;  3IF7 A;  1QXP A;  1BMO A;  3TDI A;  2FJU B;  3EK4 A;  1V1G A;  1MXE A;  4R1E A;  4GGN A;  4ETO A;  5AER A;  2WCE A;  2LE9 B;  3I5G C;  4BY5 A;  1QVI Y;  2LAP A;  4A4B A;  1OOJ A;  3VRO A;  4JPZ B;  4NDB A;  1B8R A;  1M31 A;  2JC2 A;  1BJF A;  1SY9 A;  1WRL A;  1XK4 A;  5HKY A;  1TNQ A;  1ALW A;  3DVK A;  2L50 A;  1KFU L;  1CM4 A;  2COL B;  3OX5 A;  3DF0 B;  1UHH A;  1S3P A;  1GJY A;  2JRF A;  3BOW B;  1SBJ A;  3WHT B;  1AVS A;  2V53 A;  1S26 D;  1Y6W A;  4GUK A;  2ZRS A;  2JNF A;  4MBE A;  1FW4 A;  1BF5 A;  4GGF C;  4FQO A;  1A03 A;  5DKN A;  4QJ5 B;  1J7O A;  1F71 A;  3KF9 A;  1PK0 D;  4GAO A;  1CFP A;  4M2O A;  3O78 A;  4MZJ A;  4AQJ A;  1NSH A;  1KFX L;  1FI6 A;  1MHO A;  1TN4 A;  1LIN A;  1QLK A;  2NXQ A;  3LLE A;  1M46 A;  4P5O E;  1ALV A;  2BKI B;  1PAL A;  3EK7 A;  1WDC C;  4D1E A;  1CKK A;  3DVM A;  2KYC A;  1SL8 A;  1J55 A;  3D10 A;  1U5I B;  2CBL A;  1TNW A;  2L51 A;  4GFT A;  3WHU B;  1F8H A;  3CR4 X;  4PHN A;  4MVF A;  4PHJ A;  5B8I B;  2KHN A;  1EG4 A;  1TOP A;  2CTN A;  2NZ0 A;  3K21 A;  2M49 B;  4CLN A;  5AAN A;  1IJ6 A;  1Y0V H;  2SCP A;  2JT8 A;  2LP2 A;  1MR8 A;  1YRT B;  2K7D A;  1ZAC A;  2MRD A;  3BXK A;  3ZNI A;  2L4H A;  2KI6 D;  2BCX A;  2LM5 A;  1OZO A;  5IBW A;  3WNX B;  1XVJ A;  4MRY A;  4CFR A;  1AJ5 A;  2H61 C;  1XFY O;  2K7B A;  5KTY A;  2JWW A;  3BUW B;  3BUO B;  3I5I C;  3CGA A;  1UP5 A;  2KYF A;  4N1F A;  1JWD A;  1IRJ A;  2B1U A;  1J1D A;  4XYN A;  4QJ4 B;  2A4J A;  3M0W A;  2F3Y A;  1DVI A;  1AP4 A;  1C7V A;  4MRX A;  4NDD A;  1K9K A;  5D7F A;  3KHE A;  2WC8 A;  1H4B A;  2LMV A;  4WQ2 A;  3H4S E;  1FF1 A;  3DD4 A;  2OS8 C;  1A4P A;  4PE7 A;  1B4C A;  2MA2 A;  3EKH A;  2L2E A;  2CCM A;  1G8I A;  3VRP A;  2PRU A;  2GGZ A;  1OSA A;  3GK4 X;  1YVH A;  2M3W A;  4PAL A;  4ZCU A;  1PVB A;  1S5G Y;  1J7P A;  1TIZ A;  2BEC A;  1XFU O;  4I5N B;  5D69 A;  3NSL A;  3IQO A;  2BE4 A;  3CS1 A;  2O60 A;  1S6J A;  3AKA A;  1JF0 A;  1XFW O;  3RM1 A;  1YVL A;  1SK6 D;  1OZS A;  2Q4U A;  2KGR A;  1W7I B;  2ZRT A;  2I7A A;  2KI4 B;  2KOT A;  5ER5 A;  2D8N A;  3SG6 A;  5CSI A;  1BOC A;  2EHB A;  1M63 B;  1S1E A;  2MJW B;  1DJH A;  1UHJ A;  2TN4 A;  1QTX A;  4QJ3 B;  3BUX B;  2PAS A;  1A29 A;  1NCY A;  2HET A;  2AUC A;  4PE4 A;  1SNL A;  2BKH B;  3FWC A;  3OB2 B;  1F54 A;  4GPL B;  2K2A A;  3ICB A;  1CNP A;  4IL1 A;  3CWG A;  5KU1 A;  2WOR A;  3BQ3 A;  2BBM A;  2MAZ A;  1DJW A;  1AUI B;  2KQ6 A;  1QS7 A;  1TNX A;  1N0Y A;  1NCX A;  1JFJ A;  3KPX A;  1CDM A;  2LMT A;  2NCP A;  1GQM A;  3ZWH A;  1PUL A;  4P2Y B;  4YGD B;  5HLV A;  5J3X A;  2F2O A;  1LA3 A;  1CM1 A;  3BUN B;  3HX4 A;  2OTG C;  2RGI A;  3OHM B;  4DS7 A;  1NX0 A;  2ZN8 A;  3VRN A;  2BL0 C;  3F45 A;  1RWY A;  1CLB A;  2H61 A;  2BCB A;  2IS9 A;  2MHH A;  3TUY C;  1F55 A;  4AOM A;  1A75 A;  1LKJ A;  4MSP A;  1A2X A;  2QAC A;  2WCB A;  4I5J A;  2MLE C;  4U8D A;  2LLS A;  1Y1U A;  1Y1X A;  1DJI A;  1PSB A;  2CXJ A;  2WCF A;  1DT7 B;  2K61 A;  1IG5 A;  1C07 A;  1BG1 A;  1JF2 A;  1NUB A;  1UHK A;  2FOT A;  3I5F C;  1DGV A;  2JPT A;  2KFG A;  2KI6 C;  3O4Y A;  1D1O A;  1TRF A;  2FCE A;  3TS5 C;  2F2P A;  3A8R A;  1OMV A;  2OTG B;  4AQI A;  1QIV A;  1K95 A;  1NX1 A;  2VRG A;  1N2D A;  1TTX A;  1VRK A;  4ZCV A;  3CR2 A;  2BL0 B;  2BBN A;  1CLL A;  3D0Y B;  3PLF B;  3TUY B;  1CMG A;  4YBH B;  2Q91 A;  1B9A A;  1NPQ A;  2CNP A;  3SIB A;  2P6B B;  1KQM B;  5BPJ A;  1YX8 A;  1BU3 A;  2KDH A;  1L7Z A;  2KGB C;  4PCW A;  4DRW A;  1JC2 A;  3EK8 A;  2LLU A;  4MZK A;  1BLQ A;  2JU0 A;  2JTZ A;  1TCO B;  3I5F B;  2LC5 A;  3KEV A;  1V1F A;  3C1V A;  4PDZ A;  3FIA A;  1YUT A;  3PFV A;  1EJ3 A;  1IJ5 A;  2AAO A;  3TS5 B;  2JT3 A;  2M9G A;  2G9B A;  1AJ4 A;  3RLZ A;  2LCP A;  3DF0 A;  5ER4 X;  4DCK A;  5DKQ A;  4XJK B;  4ORA B;  4A4C A;  4I5K A;  3BOW A;  5AEQ A;  3LK0 A;  4PHK A;  4DIR A;  3EKJ A;  5G08 A;  2GGM A;  2JXL A;  2K0J A;  2Y4Q A;  1QVI Z;  2HF5 A;  1K8U A;  1B7T Y;  4M2Q A;  2JNX A;  4MLW A;  4JWQ A;  2KI4 C;  1LXF C;  1XFZ O;  3VRR A;  3FS7 A;  2KFH A;  1SCV A;  2K7O A;  1SPY A;  2KNE A;  1WRK A;  5K89 A;  2LLT A;  2ZNE A;  3OX6 A;  1GGZ A;  1NIW A;  1SMG A;  1XK4 C;  3CR5 X;  3PM8 A;  2KAV A;  1KWO B;  2MLF C;  1G33 A;  1QJT A;  4PE1 A;  2M7N A;  1QX2 A;  1BR4 B;  3IQQ A;  2MBX A;  3NSO A;  1U5I A;  4HRG A;  5GQQ C;  4YRU A;  1CDP A;  3SG2 A;  4BY4 A;  2EGD A;  1Y1A A;  1HT9 A;  1N65 A;  1OMR A;  3JTD C;  1SKT A;  1SL9 A;  1EG3 A;  4I5L B;  3SG7 A;  1UUS A;  1BR1 B;  2M0R A;  2KBM A;  3NSI A;  1KSM A;  2LHI A;  1L2O B;  1NP8 A;  1ODB A;  1MF8 B;  1QX7 A;  4GGF A;  1DJX A;  1B8C A;  1QV0 A;  3CLN A;  1YX7 A;  2SAS A;  2EC6 B;  2Y1M A;  3PN7 B;  3GK1 A;  2PAL A;  3PAT A;  4HSZ A;  4WQ3 A;  1XA5 A;  3SG3 A;  5PAL A;  4CID A;  2R2I A;  1MUX A;  2JUL A;  1SYM A;  1KFU S;  1UHN A;  3SJS A;  2L0P A;  4YGA A;  2E6W A;  1YRU B;  4MEW A;  2LVI A;  1REC A;  1NYA A;  1QX5 B;  3CTN A;  1UUR A;  2BE6 A;  3D0Y A;  1WLZ A;  2AMI A;  3JTD B;  1AHR A;  1QIW A;  1F4Q A;  2ISD A;  5CSF A;  1PRW A;  2ZFD A;  3VGO A;  3PAL A;  3GK2 A;  3NXA A;  4USL A;  3KO0 A;  5AXI A;  3SG4 A;  4MZL A;  1Q80 A;  2LP3 A;  2M8U A;  1SR6 C;  3O6B A;  1NX2 A;  1CMF A;  1DJY A;  1KK7 Y;  1K93 D;  1KFX S;  1IWQ A;  4YGC B;  1B47 A;  2GV5 A;  2JQ6 A;  2PMY A;  1YUR A;  2KSP A;  2ZND A;  4CPV A;  5HKZ A;  2PVB A;  1MQ1 A;  2NCO A;  3LK1 A;  4F0Z B;  3DVJ A;  1JBA A;  1CTR A;  2JZI A;  1RTP 1;  1DF0 A;  1XO5 A;  2F8P A;  1KQM C;  4FTG A;  1B7T Z;  4N1G A;  2KAX A;  2M1U A;  5F6T A;  1KCY A;  1YUS A;  4C0K A;  1YTZ C;  3LL8 B;  1CFC A;  4ORB B;  1CB1 A;  2LMU A;  2HQW A;  1QAS A;  5KSZ A;  1J7R A;  1E8A A;  1F4O A;  2LVK A;  1DJZ A;  1SR6 B;  4CFQ A;  4HRH A;  1TNP A;  2G2B A;  1CFD A;  1SW8 A;  2I2R E;  2LVV A;  3JVT B;  1S5G Z;  2M29 A;  1UWO A;  5FYX A;  3A4U B;  1BOD A;  1SCM C;  4WRI A;  1CDL A;  1ZOT B;  2WOS A;  4YI9 A;  1CDN A;  2I94 A;  3AAJ A;  1R2U A;  1OMD A;  4GNK B;  2K8M B;  3TZ1 A;  1QLS A;  4PHM A;  3HCM A;  3PSR A;  1WLM A;  2DOQ A;  2ZKM X;  4N5X A;  2L5X B;  1JSA A;  3GOF A;  1FI5 A;  2HQ8 A;  2LHL A;  1K9U A;  3DVE A;  1K90 D;  1RRO A;  2KFF A;  1OE9 B;  3I5G B;  1NWD A;  5JJG A;  4TNC A;  2LV7 A;  1CFF A;  1JFK A;  3BUM B;  1DGU A;  2E30 A;  2Y1N A;  5I8N A;  1LA0 A;  2KBI A;  4JQ0 D;  2L98 A;  1XFX O;  2LNK A;  1KWO C;  4M2P A;  2JTT A;  1S6C A;  4DUQ A;  1SCM B;  1KK8 C;  3MSE B;  1WY9 A;  5CSN A;  1PSR A;  1PVA A;  3AKB A;  3CZT X;  3EVU A;  2JOJ A;  1B1G A;  1FPW A;  1K96 A;  5HLO A;  1CLM A;  5AFP A;  1XYD A;  2H2K A;  1L2O C;  2M1K B;  2M7L A;  1B8L A;  1KK7 Z;  1SL7 A;  2JXC A;  2F33 A;  4ICB A;  4Q04 A;  3VRQ A;  5I2O A;  3I5H C;  1KQV A;  2NLN A;  2K2F A;  2WND A;  1H8B A;  2EC6 C;  1ZUZ A;  4MN0 A;  1G4Y R;  1C7W A;  3PN7 C;  2F3Z A;  1SRA A;  3E3R A;  1R6P A;  4ORC B;  3EVV A;  5HYD A;  1K94 A;  1TCF A;  1YR5 A;  2KQY A;  1WDC B;  4OV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...