1ZACA

N-domain of troponin c from chicken skeletal muscle, nmr, minimized average structure
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN-C
publication title Low-temperature-induced structural changes in the Apo regulatory domain of skeletal muscle troponin C.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zacA00
1CLBA 4MZLA 1WDCB 1TCFA 3KF9A 3NXAA 1DT7B 2JRFA 1F71A 1SR6C 1CFPA 4I5JA 2K2AA 2NXQA 3GK2A 1MF8B 4XJKA 2K7BA 1K94A 4YGCB 1TN4A 1XFVO 1B8LA 1R2UA 1QXPA 4MBEA 1XK4C 1IH0A 4PE1A 2BL0C 4HRHA 2L50A 1NWDA 1ZOTB 4DS7A 1QX7A 3CR5X 4FQOA 2EC6C 4DRWA 1AK8A 2JC2A 1OZSA 4PCWA 1WY9A 2LLTA 3PATA 1KK8C 3RM1A 3NSIA 1DJYA 2LM5A 1CLMA 2F33A 1OMRA 4C0JA 4XYNA 2HQ8A 2V53A 1A75A 2KAVA 2GV5A 1C7VA 4MLWA 2ZNDA 3CS1A 5CSIA 3JTDB 1UHNA 1UHIA 4GUKA 1QATA 1V1GA 2QPTA 5F6TA 5GQQC 1B1GA 1DVIA 1UHHA 2KSPA 1RTP1 2LC5A 4GGNA 2MA2A 3OX5A 4ORAB 1X02A 2H61A 2D8NA 2L4HA 3O4YA 2F8PA 2K7CA 1OZOA 4QJ5B 1BT6A 2CTNA 1EL4A 4Q04A 1UUSA 2M8UA 5AFPA 2M1UA 3IQQA 1YVHA 4AQIA 5JJGA 3OX6A 4PHMA 1K95A 1LVCD 1QJTA 1PALA 3CTNA 5K89A 3VRQA 1M46A 2M49B 1KQMC 3O6BA 1B7TY 1B7TZ 2H2KA 3CWGA 3FIAA 1FI6A 1AUIB 3I5GC 1PRWA 3D0YA 2LUCA 2KGRA 1PVBA 1IWQA 2M7NA 1MQ1A 4PHNA 5G08A 1DJXA 1K96A 1OE9B 3EKHA 3LK0A 2OTGB 1AVSA 3VGOA 1IG5A 3DF0B 4PHJA 5CSFA 3CR2A 1AHRA 3DD4A 2BCBA 1WRLA 4USLA 4P5OE 1FI5A 4PALA 3QRXA 2F3YA 5ER5A 2K7DA 2HF5A 2WNDA 1ODBA 2P6BB 1BOCA 3H4SE 3OP0A 3TDUA 2Y5IA 1FF1A 3PFVA 5AANA 1H8BA 1Q80A 4A4CA 1ZMZA 4C0LA 3CZTX 4F0ZB 2PMYA 5B8IB 2KHNA 4NDCA 2EHBA 3GOFA 1C7WA 1K9UA 2NLNA 1RFJA 1SL8A 3HX4A 4MVFA 1KWOC 2CBLA 1S26D 2NCOA 2KFGA 2O60A 1IQ5A 2LVJA 1A03A 1DGUA 3SJSA 2LMUA 5BPJA 1HQVA 5CPVA 3CR4X 1K90D 1QASA 1QIWA 1FW4A 1XFYO 4YI8A 1YVLA 4WRIA 2B1UA 2ZRSA 1AJ4A 2Y1MA 1QX2A 1B9AA 5AEQA 1L2OC 2JT3A 2WOSA 1SYMA 2CNPA 1J7RA 2L2EA 1B47A 1LINA 2LLSA 1Y1XA 2RGIA 3LK1A 2SASA 2K0JA 5FYXA 2BKIB 3TUYC 2FCEA 1NSHA 2F2OA 2KAYA 2G2BA 1K8UA 2JU0A 1BJFA 4BY5A 2HETA 2F3ZA 4C0KA 2PSRA 3VRNA 1B8RA 1S1EA 1ZACA 2LMTA 3EK8A 2KBMA 1EJ3A 2KQYA 4OV2A 4JWQA 3TS5C 1J1EA 1SR6B 5JOLA 2R2IA 4PE0A 2JXLA 2M9GA 1EH2A 3SIBA 4GGFA 3I5IC 1YX7A 1JBAA 1BMOA 1YUUA 5AXIA 3WNXB 1S36A 2BKHB 2L4IA 4CIDA 1IJ5A 1Y0VH 3I5FB 2BL0B 4HSZA 2E30A 2VRGA 3KHEA 3SG6A 4GAOA 1IKUA 1SBJA 2EC6B 1W7IB 1OMVA 1IQ3A 1WDCC 4NDBA 2ZFDA 1H4BA 3SG5A 1VRKA 1WLMA 1KK8B 3PN7C 4JQ0D 3ZNIA 1SNLA 3EVUA 3SIAA 1S6CA 2BBNA 3O78A 1WRKA 2I7AA 1TNPA 5I2LA 1QLSA 1NCXA 3JVTC 3EK4A 1N0YA 1QTXA 2JOJA 2KYFA 2HQWA 1KFXL 1YRUB 3BOWB 1S6IA 1CDLA 5DKQA 2LVKA 4NDDA 5TNCA 2KYCA 1J1DA 1LXFC 3BOWA 2MHHA 1S3PA 4ZCVA 4N5XA 2PRUA 1XO5A 1K9KA 3GK1A 3WXAA 1TIZA 1F4OA 1B8CA 4GFTA 2M97A 1BODA 3FWBA 2MRDA 1TOPA 1PSRA 1SKTA 1OMDA 1NYAA 3JTDC 2KFFA 2I2RE 2WCEA 2H61C 2K7OA 1XVJA 1KQVA 2CT9A 2BECA 3I5GB 2M0RA 1NP8A 4YI9A 3EK7A 2GGZA 2KI4B 1D1OA 1U5IB 1DJIA 2GGMA 5CSNA 3D10A 3RLZA 2JT8A 2ZN9A 4AQJA 1J7OA 1K9PA 2MBXA 1LA0A 1CB1A 1CTRA 2I94A 3MSEB 1G8IA 1HT9A 1M63B 2KI6D 3E3RA 4YGDB 5HKZA 1GGZA 3C1VA 4I5LB 4M2QA 1NX0A 1DF0B 2LHLA 5KTYA 2KNEA 2CCMA 1QX5B 1G33A 3DF0A 2K8MB 1GGWA 2F2PA 3BUMB 4DCKA 2M1KB 1OSAA 1E8AA 2I18A 1YR5A 3DVMA 2OS8C 4MN0A 1ZFSA 1SY9A 2NZ0A 4WQ3A 3VRRA 1ZUZA 2BCXA 4NQGA 2M29A 2JNXA 1DTLA 1WRZA 2BE6A 1XFUO 1LKJA 1OQPA 2BE4A 2JZIA 1SRAA 1YTZC 5KSZA 2LCPA 3BXKA 4ORBB 2L5XB 1NX1A 3I5HC 4HRGA 3CLNA 5HYDA 1V1FA 4YBHB 4CFRA 1SPYA 4FTGA 2JPTA 1KFUS 1XYDA 4OVNF 4AOMA 4MRXA 1PSBA 4UPGA 4ETOA 4M2OA 1LA3A 3O2PA 2KBIA 5ER4X 4CFQA 1KFUL 1WLZA 1F8HA 3DVKA 5D69A 1EG4A 2AMIA 1SMGA 2JT0A 1N2DA 2Q4UA 4PE7A 3DVJA 1F55A 1YX8A 1DMOA 1QLKA 1SCMB 4ICBA 5CSJA 2Y4QA 1MUXA 3KO0A 2Y1NA 1BF5A 1SL9A 1L2OB 2L51A 2BBMA 5AERA 1JFJA 1AP4A 1YUSA 2KAXA 2WC8A 1A4PA 2JULA 4QJ4B 3TZ1A 4YRUA 1BG1A 2LV7A 1RECA 1QIVA 1CDNA 2K2FA 1UHKA 2ISDA 3TDZA 3WHTB 2LHIA 1RJVA 3KPXA 1PULA 1K2HA 1A2XA 1JF0A 5PALA 1UHJA 2FJUB 4GNKB 1NX3A 2JQ6A 1KCYA 2FCDA 2LNKA 4YGEB 3EVRA 4QJ3B 3TS5B 1NX2A 2LANA 5IBWA 2LAPA 3SG4A 1CMFA 1Y1UA 4GBAA 2L98A 1W7JB 1SL7A 1AJ5A 1FBVA 3I5IB 2TN4A 4I5KA 2LVIA 4MZJA 4GPLB 5D7FA 1S5GY 1S5GZ 3GK4X 3OHMB 4JPZB 1XK4A 3OB2B 3FS7A 3BYAA 4WQ2A 1MWNA 1SK6D 1YRTB 5HLOA 3AKBA 1N65A 1UWOA 1NCZA 4GGFC 3PSRA 4XJKB 4P2YB 3PN7B 1CFCA 2LMVA 3AKAA 1PK0D 1NIWA 1BLQA 2ZKMX 1K93D 4BY4A 1JUOA 1KFXS 1Y6WA 1BR4B 3ZWHA 1NUBA 1TNWA 1DJWA 3JVTB 3I5FC 1ALWA 2JWWA 3EKJA 1MXLC 3VROA 2E6WA 1DJZA 3FWCA 4E68A 1PVAA 4ORCB 4TNCA 3BUOB 1A75B 5I8NA 1F70A 1XFXO 1QV0A 1TRFA 3AAKA 3PALA 1UP5A 1RROA 3A4UB 1KQMB 1QS7A 1XA5A 3ICBA 1NPQA 3M0WA 3SG3A 2O5GA 1TCOB 2M3WA 2LP3A 4M2PA 4DUQA 3LL8B 1NCYA 1XFWO 2KOTA 1JSAA 2SCPA 5DKNA 2JNFA 1CFFA 1CFDA 1IJ6A 3IF7A 2COLB 2FOTA 2PASA 1RK9A 1FPWA 1U5IA 1CDMA 1G4YR 1M31A 1SCVA 3PLFB 3LLEA 3TDIA 1UURA 1IGVA 2ZNEA 1M39A 1YUTA 5HKYA 2JXCA 4MZKA 4R1EA 3EVVA 3D0YB 1TNQA 5DKRA 1DJHA 2QACA 3A8RA 1CM4A 4N1FA 1DF0A 3IQOA 4CLNA 2K61A 2KI4C 3BUNB 1GQMA 4YGBB 3LCPC 1F4QA 2OS8B 2LE9B 2BCAA 5I2OA 1BR1B 4HREE 3PM8A 2MLFC 3AAJA 1JWDA 1L7ZA 2DOQA 3NSKA 1SW8A 1B4CA 2OTGC 1YURA 5I2QA 2LLUA 3BUXB 3NSLA 2CXJA 4N1GA 1CNPA 3HCMA 4CPVA 3I5HB 3NSOA 4YGAA 2MJWB 2MLEC 1ALVA 5KU1A 2ZRTA 1KWOB 2KQ6A 2KFHA 3VRPA 2IS9A 1J55A 1TNXA 2G9BA 1DGVA 3F45A 2JTZA 1GJYA 4PDZA 1F54A 5HKWA 1KSMA 1MR8A 1IRJA 2Q91A 4OCIA 4DIRA 2OPOA 2PALA 2PVBA 2KDHA 2L0PA 1JFKA 1MHOA 1RWYA 2WCBA 3K21A 1CMGA 2A4JA 1CDPA 5J3XA 2AAOA 3BUWB 2LVVA 4PHKA 1KK7Z 1KK7Y 1JF2A 2EGDA 3OB1B 4MEWA 2MAZA 4OKHA 4ZCUA 5HLVA 1DJGA 4D1EA 1CM1A 1OOJA 3TUYB 2KI6C 1QVIZ 1QVIY 1J7PA 1XFZO 4L9MA 3KEVA 2NCPA 3CGAA 1CKKA 3DVEA 1JC2A 1CLLA 4A4BA 4MSPA 1S6JA 2HPSA 2M7LA 4U8DA 2LUXA 1SCMC 1BU3A 1KSOA 1A29A 1EXRA 4I5NB 4OR9B 3SG7A 3BQ3A 1MXEA 1C07A 1Y1AA 2JTTA 2WCFA 1R6PA 4PE4A 2WORA 4IL1A 2KGBC 2ZN8A 2LP2A 2AUCA 3SG2A 1M45A 1EG3A 1TTXA 3WHUB 1J7QA 1QV1A 4MRYA
chains in the Genus database with same CATH superfamily
1CLBA 4MZLA 1WDCB 1TCFA 3K1EA 3KF9A 3NXAA 1DT7B 2JRFA 1F71A 1SR6C 1CFPA 4I5JA 2KLDA 2K2AA 2NXQA 3GK2A 1MF8B 4XJKA 2K7BA 1K94A 4YGCB 1TN4A 1XFVO 1B8LA 1R2UA 1QXPA 4MBEA 1XK4C 1IH0A 4PE1A 1DQEA 1T14A 2BL0C 4HRHA 2L50A 3Q8IA 1NWDA 1ZOTB 4DS7A 2QEBA 1QX7A 3CR5X 1QWVA 4FQOA 2EC6C 3BFBA 4DRWA 1AK8A 3DY9A 2JC2A 1OZSA 4PCWA 1WY9A 3NHIA 2LLTA 3D73A 1KK8C 3PATA 3NSIA 3RM1A 1DJYA 2LM5A 1CLMA 2F33A 1OMRA 4C0JA 4XYNA 1ORGA 2HQ8A 2V53A 1A75A 2KAVA 3D78A 2GV5A 1C7VA 4MLWA 2ZNDA 3CS1A 5CSIA 1OW4A 3JTDB 1UHNA 1UHIA 4GUKA 1QATA 1V1GA 2QPTA 5D3OA 5F6TA 5GQQC 1B1GA 3CDNA 1DVIA 1IIOA 1UHHA 2KSPA 1RTP1 2LC5A 4GGNA 1OOHA 2MA2A 3OX5A 1DELA 3OGNA 4ORAB 1X02A 2H61A 2D8NA 4JKTA 2L4HA 3O4YA 2F8PA 2K7CA 1OZOA 4QJ5B 1BT6A 2CTNA 1EL4A 4Q04A 2WCHA 1UUSA 2M8UA 5AFPA 3N7HA 1W9ZA 2M1UA 3IQQA 1YVHA 4AQIA 5JJGA 3OX6A 4PHMA 1K95A 1LVCD 3S0DA 1QJTA 1PALA 3CTNA 5K89A 3VRQA 1M46A 2M49B 1KQMC 3O6BA 1B7TY 1B7TZ 2H2KA 3CWGA 3FIAA 1FI6A 1AUIB 3I5GC 1PRWA 3DZTA 3D0YA 2LUCA 2KGRA 1PVBA 1IWQA 2WCJA 2M7NA 1MQ1A 4PHNA 5G08A 1DJXA 2FJYA 1K96A 1OE9B 3EKHA 1SSEB 3B6XA 4INWA 1Z2CB 3LK0A 2OTGB 1AVSA 3VGOA 1IG5A 3DF0B 4PHJA 5CSFA 3CR2A 1AHRA 3DD4A 2BCBA 1WRLA 4USLA 4P5OE 1FI5A 2WC6A 4PALA 3QRXA 2F3YA 5ER5A 2YGUA 2K7DA 2HF5A 2WNDA 1ODBA 2P6BB 3D74A 1BOCA 3UNWA 3H4SE 3R72A 3OP0A 3TDUA 2Y5IA 1FF1A 3PFVA 4OZDA 5AANA 1H8BA 1Q80A 4A4CA 1ZMZA 4C0LA 3CZTX 4F0ZB 2PMYA 5B8IB 2KHNA 4NDCA 2EHBA 2WCKA 3GOFA 1C7WA 1K9UA 2NLNA 1C3YA 1OOFA 1RFJA 1SL8A 3HX4A 4MVFA 1KWOC 2CBLA 2QDIA 1S26D 2NCOA 3D76A 2KFGA 2O60A 1IQ5A 2LVJA 3R1PA 1A03A 1DGUA 3SJSA 2LMUA 5BPJA 1HQVA 3L47A 3CR4X 3R1VA 5CPVA 1K90D 1QASA 1QIWA 1FW4A 1XFYO 4YI8A 1YVLA 4WRIA 2B1UA 3SS3A 2ZRSA 1AJ4A 2Y1MA 1QX2A 1B9AA 5AEQA 1L2OC 2JT3A 2WOSA 1SYMA 2CNPA 4JD9A 1J7RA 2L2EA 1B47A 1LINA 2LLSA 3QMEA 1Y1XA 2RGIA 3LK1A 2SASA 2K0JA 5FYXA 2BKIB 3TUYC 2FCEA 3DXLA 1NSHA 2F2OA 2KAYA 2G2BA 1K8UA 2JU0A 1BJFA 4BY5A 2HETA 2F3ZA 4C0KA 2PSRA 3VRNA 1B8RA 1S1EA 1ZACA 2LMTA 3EK8A 2KBMA 1EJ3A 2KQYA 2L2CA 2WCLA 4OV2A 4JWQA 3TS5C 1J1EA 1SR6B 5JOLA 3EG5B 4F7FA 2R2IA 2KPHA 4PE0A 2JXLA 2M9GA 1EH2A 3RZSA 3SIBA 4GGFA 3I5IC 1YX7A 5HL1A 1JBAA 1BMOA 1YUUA 1XFRA 5AXIA 1S36A 3CZ0A 3WNXB 2BKHB 2L4IA 4CIDA 1IJ5A 1Y0VH 3I5FB 2BL0B 4HSZA 2E30A 2VRGA 3KHEA 3SG6A 4GAOA 1IKUA 1SBJA 2EC6B 1W7IB 1OMVA 1IQ3A 1WDCC 3IVTA 4NDBA 2ZFDA 1H4BA 3SG5A 1VRKA 1WLMA 1KK8B 3PN7C 2WCMA 4JQ0D 3ZNIA 3FE8A 1SNLA 3BJHA 3EVUA 3SIAA 1S6CA 2BBNA 3O78A 2BAPA 1WRKA 2I7AA 1TNPA 5I2LA 1QLSA 1NCXA 3JVTC 3EK4A 5EL2A 1N0YA 1QTXA 2JOJA 2KYFA 2HQWA 1TUJA 1KFXL 1YRUB 3BOWB 1S6IA 1CDLA 5DKQA 2LVKA 4NDDA 5TNCA 2KYCA 1J1DA 1LXFC 3BOWA 2MHHA 1S3PA 4ZCVA 4N5XA 3VB1A 2PRUA 1XO5A 1K9KA 3GK1A 3WXAA 3NHTA 1TIZA 1F4OA 1B8CA 1TUZA 2KLEA 2M97A 3FWBA 4GFTA 1BODA 2MRDA 1TOPA 1PSRA 1SKTA 1OMDA 1NYAA 3JTDC 2KFFA 2I2RE 2JPOA 2H61C 2WCEA 2K7OA 1XVJA 3FE6A 1KQVA 2CT9A 2BECA 3I5GB 2M0RA 1NP8A 4YI9A 3EK7A 2GGZA 2KI4B 1D1OA 1U5IB 1DJIA 2GGMA 2WC5A 5CSNA 3D10A 3RLZA 2JT8A 2ZN9A 4AQJA 1J7OA 1K9PA 2MBXA 1LA0A 1CB1A 1CTRA 2I94A 3MSEB 1G8IA 1HT9A 1M63B 2KI6D 3E3RA 4YGDB 5HKZA 1GGZA 3UO9A 3C1VA 1DEKA 4I5LB 4M2QA 1NX0A 1DF0B 2LHLA 2PYQA 5KTYA 2KNEA 2CCMA 1QX5B 2P70A 1TWOA 1G33A 3DF0A 3SS4A 2K8MB 1GGWA 2F2PA 3BUMB 4DCKA 2M1KB 1OSAA 1E8AA 2I18A 1YR5A 3DVMA 2OS8C 4MN0A 1ZFSA 1SY9A 2NZ0A 4WQ3A 3VRRA 1ZUZA 2BCXA 2H8VA 2M29A 4NQGA 2JNXA 1DTLA 1WRZA 2BE6A 1XFUO 1LKJA 1OQPA 2BE4A 2JZIA 1SRAA 1YTZC 3S0GA 5KSZA 2GTEA 2LCPA 3BXKA 4ORBB 2L5XB 1NX1A 3I5HC 4HRGA 3CLNA 5HYDA 3PM2A 1V1FA 4YBHB 4CFRA 1SPYA 4FTGA 2JPTA 1KFUS 1XYDA 4OVNF 4AOMA 4MRXA 1PSBA 4UPGA 4ETOA 4M2OA 1LA3A 1Z4HA 2QEHA 3O2PA 3S0FA 1P28A 2KBIA 5ER4X 4CFQA 1KFUL 1WLZA 1F8HA 3DVKA 5D69A 1EG4A 2AMIA 1SMGA 2JT0A 1N2DA 2Q4UA 2QEOA 3DVJA 4PE7A 1F55A 1YX8A 1DMOA 1QLKA 1SCMB 4ICBA 5CSJA 2Y4QA 1MUXA 3KO0A 2Y1NA 1BF5A 1SL9A 1L2OB 2L51A 2BBMA 5AERA 1JFJA 1AP4A 1YUSA 4IJ7A 2KAXA 2WC8A 1A4PA 2JULA 4QJ4B 3TZ1A 4YRUA 1BG1A 1C3ZA 2LV7A 1RECA 1QIVA 1CDNA 2K2FA 1UHKA 4INXA 4PT1A 2ISDA 3TDZA 3WHTB 1DC1A 3B88A 2LHIA 1RJVA 3KPXA 1PULA 3S0EA 1K2HA 1A2XA 1JF0A 5PALA 1UHJA 2FJUB 4GNKB 1NX3A 2JQ6A 1KCYA 2FCDA 2LNKA 4YGEB 3B7AA 3EVRA 4QJ3B 5FI6A 3TS5B 1NX2A 2LANA 5IBWA 2LAPA 3SG4A 1CMFA 1Y1UA 4GBAA 2L98A 4FQTA 1W7JB 1SL7A 1AJ5A 1FBVA 3I5IB 2TN4A 4I5KA 2LVIA 4MZJA 3CABA 4GPLB 5D7FA 1S5GY 1S5GZ 3GK4X 3OHMB 4JPZB 1XK4A 3OB2B 3FS7A 3BYAA 4WQ2A 1MWNA 1SK6D 1YRTB 5HLOA 3AKBA 1N65A 3L4AA 1UWOA 1NCZA 4GGFC 3PSRA 4XJKB 4P2YB 2P71A 3PN7B 1CFCA 2LMVA 3AKAA 1PK0D 1NIWA 3R1OA 1BLQA 2ZKMX 1K93D 4BY4A 1JUOA 1KFXS 1Y6WA 1BR4B 1OOGA 3SS5A 1NUBA 1TNWA 3ZWHA 1DJWA 3JVTB 3I5FC 1ALWA 2JWWA 2BNXA 3PJIA 3EKJA 1MXLC 2K60A 3VROA 2E6WA 1DJZA 3FWCA 4E68A 1PVAA 4ORCB 4TNCA 3BUOB 1A75B 5I8NA 1F70A 2L5YA 1XFXO 1QV0A 1TRFA 3AAKA 3PALA 3FE9A 1UP5A 5DICA 1RROA 3A4UB 1KQMB 1QS7A 1XA5A 3ICBA 1NPQA 3M0WA 3SG3A 2O5GA 1TCOB 2M3WA 2LP3A 4M2PA 5FI2A 4DUQA 3LL8B 1NCYA 1XFWO 3CZ1A 2KOTA 1JSAA 2SCPA 5DKNA 2JNFA 1CFFA 1CFDA 1IJ6A 3IF7A 2COLB 2FOTA 2PASA 1RK9A 3D75A 3B87A 1FPWA 1U5IA 1CDMA 1G4YR 1M31A 1SCVA 3PLFB 3LLEA 3TDIA 1UURA 1IGVA 2ZNEA 1M39A 1YUTA 5HKYA 2JXCA 4MZKA 4R1EA 3EVVA 1OOIX 3D0YB 1TNQA 3CZ2A 5DKRA 1DJHA 2QACA 3A8RA 1CM4A 2QEVA 1DF0A 4N1FA 3IQOA 4CLNA 2K61A 2KI4C 3BUNB 1GQMA 4YGBB 3L4LA 3LCPC 1F4QA 2OS8B 2LE9B 2BCAA 5I2OA 1BR1B 4HREE 3PM8A 2MLFC 3AAJA 1JWDA 1L7ZA 2DOQA 3D77A 3NSKA 1SW8A 1B4CA 3S0AA 2OTGC 1YURA 2PQLA 5I2QA 2LLUA 3BUXB 3NSLA 2CXJA 4N1GA 1CNPA 3HCMA 4CPVA 3I5HB 3NSOA 4YGAA 2MJWB 2MLEC 1ALVA 3DYEA 5KU1A 2ZRTA 1GM0A 1KWOB 1LS8A 2KQ6A 2KFHA 3VRPA 2IS9A 1J55A 1TNXA 2G9BA 1DGVA 3F45A 2JTZA 1GJYA 4PDZA 1F54A 5HKWA 1KSMA 1MR8A 1IRJA 2Q91A 4OCIA 4DIRA 5I94A 2OPOA 2PALA 2PVBA 2KDHA 3CYZA 2L0PA 1JFKA 1MHOA 1RWYA 2WCBA 3K21A 3OBVA 1CMGA 2A4JA 1CDPA 5J3XA 2AAOA 3BUWB 2LVVA 4PHKA 1KK7Z 1KK7Y 3V2LA 1JF2A 2EGDA 3OB1B 4MEWA 3S0BA 2MAZA 4OKHA 4ZCUA 5HLVA 1DJGA 3BFAA 4D1EA 1CM1A 1OOJA 3TUYB 2KI6C 1QVIZ 1QVIY 1J7PA 1XFZO 4L9MA 3KEVA 2NCPA 3CGAA 1CKKA 3BFHA 3DVEA 1JC2A 1CLLA 5FI7A 4A4BA 4MSPA 1S6JA 2HPSA 3NGVA 2M7LA 4U8DA 2LUXA 1SCMC 1BU3A 1KSOA 1A29A 1EXRA 4I5NB 4OR9B 3SG7A 3BQ3A 1MXEA 4KYNA 1C07A 1Y1AA 2JTTA 2WCFA 1R6PA 4PE4A 2WORA 4IL1A 2KGBC 2ERBA 3B86A 2ZN8A 2LP2A 2AUCA 3SG2A 1M45A 1EG3A 1TTXA 3WHUB 1J7QA 3O4XA 1QV1A 4MRYA
chains in the Genus database with same CATH topology
1CLBA 4MZLA 1WDCB 1TCFA 3KF9A 3NXAA 1DT7B 2JRFA 1F71A 1SR6C 1CFPA 4I5JA 2K2AA 2NXQA 3GK2A 1MF8B 4XJKA 2K7BA 1K94A 4YGCB 1TN4A 1XFVO 1B8LA 1R2UA 1QXPA 4MBEA 1XK4C 1IH0A 4PE1A 2BL0C 4HRHA 2L50A 1NWDA 1ZOTB 4DS7A 1QX7A 3CR5X 4FQOA 2EC6C 4DRWA 1AK8A 2JC2A 1OZSA 4PCWA 1WY9A 2LLTA 3PATA 1KK8C 3RM1A 3NSIA 1DJYA 2LM5A 1CLMA 2F33A 1OMRA 4C0JA 4XYNA 2HQ8A 2V53A 1A75A 2KAVA 2GV5A 1C7VA 4MLWA 2ZNDA 3CS1A 5CSIA 3JTDB 1UHNA 1UHIA 4GUKA 1QATA 1V1GA 2QPTA 5F6TA 5GQQC 1B1GA 1DVIA 1UHHA 2KSPA 1RTP1 2LC5A 4GGNA 2MA2A 3OX5A 4ORAB 1X02A 2H61A 2D8NA 2L4HA 3O4YA 2F8PA 2K7CA 1OZOA 4QJ5B 1BT6A 2CTNA 1EL4A 4Q04A 1UUSA 2M8UA 5AFPA 2M1UA 3IQQA 1YVHA 4AQIA 5JJGA 3OX6A 4PHMA 1K95A 1LVCD 1QJTA 1PALA 3CTNA 5K89A 3VRQA 1M46A 2M49B 1KQMC 3O6BA 1B7TY 1B7TZ 2H2KA 3CWGA 3FIAA 1FI6A 1AUIB 3I5GC 1PRWA 3D0YA 2LUCA 2KGRA 1PVBA 1IWQA 2M7NA 1MQ1A 4PHNA 5G08A 1DJXA 1K96A 1OE9B 3EKHA 3LK0A 2OTGB 1AVSA 3VGOA 1IG5A 3DF0B 4PHJA 5CSFA 3CR2A 1AHRA 3DD4A 2BCBA 1WRLA 4USLA 4P5OE 1FI5A 4PALA 3QRXA 2F3YA 5ER5A 2K7DA 2HF5A 2WNDA 1ODBA 2P6BB 1BOCA 3H4SE 3OP0A 3TDUA 2Y5IA 1FF1A 3PFVA 5AANA 1H8BA 1Q80A 4A4CA 1ZMZA 4C0LA 3CZTX 4F0ZB 2PMYA 5B8IB 2KHNA 4NDCA 2EHBA 3GOFA 1C7WA 1K9UA 2NLNA 1RFJA 1SL8A 3HX4A 4MVFA 1KWOC 2CBLA 1S26D 2NCOA 2KFGA 2O60A 1IQ5A 2LVJA 1A03A 1DGUA 3SJSA 2LMUA 5BPJA 1HQVA 5CPVA 3CR4X 1K90D 1QASA 1QIWA 1FW4A 1XFYO 4YI8A 1YVLA 4WRIA 2B1UA 2ZRSA 1AJ4A 2Y1MA 1QX2A 1B9AA 5AEQA 1L2OC 2JT3A 2WOSA 1SYMA 2CNPA 1J7RA 2L2EA 1B47A 1LINA 2LLSA 1Y1XA 2RGIA 3LK1A 2SASA 2K0JA 5FYXA 2BKIB 3TUYC 2FCEA 1NSHA 2F2OA 2KAYA 2G2BA 1K8UA 2JU0A 1BJFA 4BY5A 2HETA 2F3ZA 4C0KA 2PSRA 3VRNA 1B8RA 1S1EA 1ZACA 2LMTA 3EK8A 2KBMA 1EJ3A 2KQYA 4OV2A 4JWQA 3TS5C 1J1EA 1SR6B 5JOLA 2R2IA 4PE0A 2JXLA 2M9GA 1EH2A 3SIBA 4GGFA 3I5IC 1YX7A 1JBAA 1BMOA 1YUUA 5AXIA 3WNXB 1S36A 2BKHB 2L4IA 4CIDA 1IJ5A 1Y0VH 3I5FB 2BL0B 4HSZA 2E30A 2VRGA 3KHEA 3SG6A 4GAOA 1IKUA 1SBJA 2EC6B 1W7IB 1OMVA 1IQ3A 1WDCC 4NDBA 2ZFDA 1H4BA 3SG5A 1VRKA 1WLMA 1KK8B 3PN7C 4JQ0D 3ZNIA 1SNLA 3EVUA 3SIAA 1S6CA 2BBNA 3O78A 1WRKA 2I7AA 1TNPA 5I2LA 1QLSA 1NCXA 3JVTC 3EK4A 1N0YA 1QTXA 2JOJA 2KYFA 2HQWA 1KFXL 1YRUB 3BOWB 1S6IA 1CDLA 5DKQA 2LVKA 4NDDA 5TNCA 2KYCA 1J1DA 1LXFC 3BOWA 2MHHA 1S3PA 4ZCVA 4N5XA 2PRUA 1XO5A 1K9KA 3GK1A 3WXAA 1TIZA 1F4OA 1B8CA 4GFTA 2M97A 1BODA 3FWBA 2MRDA 1TOPA 1PSRA 1SKTA 1OMDA 1NYAA 3JTDC 2KFFA 2I2RE 2WCEA 2H61C 2K7OA 1XVJA 1KQVA 2CT9A 2BECA 3I5GB 2M0RA 1NP8A 4YI9A 3EK7A 2GGZA 2KI4B 1D1OA 1U5IB 1DJIA 2GGMA 5CSNA 3D10A 3RLZA 2JT8A 2ZN9A 4AQJA 1J7OA 1K9PA 2MBXA 1LA0A 1CB1A 1CTRA 2I94A 3MSEB 1G8IA 1HT9A 1M63B 2KI6D 3E3RA 4YGDB 5HKZA 1GGZA 3C1VA 4I5LB 4M2QA 1NX0A 1DF0B 2LHLA 5KTYA 2KNEA 2CCMA 1QX5B 1G33A 3DF0A 2K8MB 1GGWA 2F2PA 3BUMB 4DCKA 2M1KB 1OSAA 1E8AA 2I18A 1YR5A 3DVMA 2OS8C 4MN0A 1ZFSA 1SY9A 2NZ0A 4WQ3A 3VRRA 1ZUZA 2BCXA 4NQGA 2M29A 2JNXA 1DTLA 1WRZA 2BE6A 1XFUO 1LKJA 1OQPA 2BE4A 2JZIA 1SRAA 1YTZC 5KSZA 2LCPA 3BXKA 4ORBB 2L5XB 1NX1A 3I5HC 4HRGA 3CLNA 5HYDA 1V1FA 4YBHB 4CFRA 1SPYA 4FTGA 2JPTA 1KFUS 1XYDA 4OVNF 4AOMA 4MRXA 1PSBA 4UPGA 4ETOA 4M2OA 1LA3A 3O2PA 2KBIA 5ER4X 4CFQA 1KFUL 1WLZA 1F8HA 3DVKA 5D69A 1EG4A 2AMIA 1SMGA 2JT0A 1N2DA 2Q4UA 4PE7A 3DVJA 1F55A 1YX8A 1DMOA 1QLKA 1SCMB 4ICBA 5CSJA 2Y4QA 1MUXA 3KO0A 2Y1NA 1BF5A 1SL9A 1L2OB 2L51A 2BBMA 5AERA 1JFJA 1AP4A 1YUSA 2KAXA 2WC8A 1A4PA 2JULA 4QJ4B 3TZ1A 4YRUA 1BG1A 2LV7A 1RECA 1QIVA 1CDNA 2K2FA 1UHKA 2ISDA 3TDZA 3WHTB 2LHIA 1RJVA 3KPXA 1PULA 1K2HA 1A2XA 1JF0A 5PALA 1UHJA 2FJUB 4GNKB 1NX3A 2JQ6A 1KCYA 2FCDA 2LNKA 4YGEB 3EVRA 4QJ3B 3TS5B 1NX2A 2LANA 5IBWA 2LAPA 3SG4A 1CMFA 1Y1UA 4GBAA 2L98A 1W7JB 1SL7A 1AJ5A 1FBVA 3I5IB 2TN4A 4I5KA 2LVIA 4MZJA 4GPLB 5D7FA 1S5GY 1S5GZ 3GK4X 3OHMB 4JPZB 1XK4A 3OB2B 3FS7A 3BYAA 4WQ2A 1MWNA 1SK6D 1YRTB 5HLOA 3AKBA 1N65A 1UWOA 1NCZA 4GGFC 3PSRA 4XJKB 4P2YB 3PN7B 1CFCA 2LMVA 3AKAA 1PK0D 1NIWA 1BLQA 2ZKMX 1K93D 4BY4A 1JUOA 1KFXS 1Y6WA 1BR4B 3ZWHA 1NUBA 1TNWA 1DJWA 3JVTB 3I5FC 1ALWA 2JWWA 3EKJA 1MXLC 3VROA 2E6WA 1DJZA 3FWCA 4E68A 1PVAA 4ORCB 4TNCA 3BUOB 1A75B 5I8NA 1F70A 1XFXO 1QV0A 1TRFA 3AAKA 3PALA 1UP5A 1RROA 3A4UB 1KQMB 1QS7A 1XA5A 3ICBA 1NPQA 3M0WA 3SG3A 2O5GA 1TCOB 2M3WA 2LP3A 4M2PA 4DUQA 3LL8B 1NCYA 1XFWO 2KOTA 1JSAA 2SCPA 5DKNA 2JNFA 1CFFA 1CFDA 1IJ6A 3IF7A 2COLB 2FOTA 2PASA 1RK9A 1FPWA 1U5IA 1CDMA 1G4YR 1M31A 1SCVA 3PLFB 3LLEA 3TDIA 1UURA 1IGVA 2ZNEA 1M39A 1YUTA 5HKYA 2JXCA 4MZKA 4R1EA 3EVVA 3D0YB 1TNQA 5DKRA 1DJHA 2QACA 3A8RA 1CM4A 4N1FA 1DF0A 3IQOA 4CLNA 2K61A 2KI4C 3BUNB 1GQMA 4YGBB 3LCPC 1F4QA 2OS8B 2LE9B 2BCAA 5I2OA 1BR1B 4HREE 3PM8A 2MLFC 3AAJA 1JWDA 1L7ZA 2DOQA 3NSKA 1SW8A 1B4CA 2OTGC 1YURA 5I2QA 2LLUA 3BUXB 3NSLA 2CXJA 4N1GA 1CNPA 3HCMA 4CPVA 3I5HB 3NSOA 4YGAA 2MJWB 2MLEC 1ALVA 5KU1A 2ZRTA 1KWOB 2KQ6A 2KFHA 3VRPA 2IS9A 1J55A 1TNXA 2G9BA 1DGVA 3F45A 2JTZA 1GJYA 4PDZA 1F54A 5HKWA 1KSMA 1MR8A 1IRJA 2Q91A 4OCIA 4DIRA 2OPOA 2PALA 2PVBA 2KDHA 2L0PA 1JFKA 1MHOA 1RWYA 2WCBA 3K21A 1CMGA 2A4JA 1CDPA 5J3XA 2AAOA 3BUWB 2LVVA 4PHKA 1KK7Z 1KK7Y 1JF2A 2EGDA 3OB1B 4MEWA 2MAZA 4OKHA 4ZCUA 5HLVA 1DJGA 4D1EA 1CM1A 1OOJA 3TUYB 2KI6C 1QVIZ 1QVIY 1J7PA 1XFZO 4L9MA 3KEVA 2NCPA 3CGAA 1CKKA 3DVEA 1JC2A 1CLLA 4A4BA 4MSPA 1S6JA 2HPSA 2M7LA 4U8DA 2LUXA 1SCMC 1BU3A 1KSOA 1A29A 1EXRA 4I5NB 4OR9B 3SG7A 3BQ3A 1MXEA 1C07A 1Y1AA 2JTTA 2WCFA 1R6PA 4PE4A 2WORA 4IL1A 2KGBC 2ZN8A 2LP2A 2AUCA 3SG2A 1M45A 1EG3A 1TTXA 3WHUB 1J7QA 1QV1A 4MRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLB A;  4MZL A;  1WDC B;  1TCF A;  3KF9 A;  3NXA A;  1DT7 B;  2JRF A;  1F71 A;  1SR6 C;  1CFP A;  4I5J A;  2K2A A;  2NXQ A;  3GK2 A;  1MF8 B;  4XJK A;  2K7B A;  1K94 A;  4YGC B;  1TN4 A;  1XFV O;  1B8L A;  1R2U A;  1QXP A;  4MBE A;  1XK4 C;  1IH0 A;  4PE1 A;  2BL0 C;  4HRH A;  2L50 A;  1NWD A;  1ZOT B;  4DS7 A;  1QX7 A;  3CR5 X;  4FQO A;  2EC6 C;  4DRW A;  1AK8 A;  2JC2 A;  1OZS A;  4PCW A;  1WY9 A;  2LLT A;  3PAT A;  1KK8 C;  3RM1 A;  3NSI A;  1DJY A;  2LM5 A;  1CLM A;  2F33 A;  1OMR A;  4C0J A;  4XYN A;  2HQ8 A;  2V53 A;  1A75 A;  2KAV A;  2GV5 A;  1C7V A;  4MLW A;  2ZND A;  3CS1 A;  5CSI A;  3JTD B;  1UHN A;  1UHI A;  4GUK A;  1QAT A;  1V1G A;  2QPT A;  5F6T A;  5GQQ C;  1B1G A;  1DVI A;  1UHH A;  2KSP A;  1RTP 1;  2LC5 A;  4GGN A;  2MA2 A;  3OX5 A;  4ORA B;  1X02 A;  2H61 A;  2D8N A;  2L4H A;  3O4Y A;  2F8P A;  2K7C A;  1OZO A;  4QJ5 B;  1BT6 A;  2CTN A;  1EL4 A;  4Q04 A;  1UUS A;  2M8U A;  5AFP A;  2M1U A;  3IQQ A;  1YVH A;  4AQI A;  5JJG A;  3OX6 A;  4PHM A;  1K95 A;  1LVC D;  1QJT A;  1PAL A;  3CTN A;  5K89 A;  3VRQ A;  1M46 A;  2M49 B;  1KQM C;  3O6B A;  1B7T Y;  1B7T Z;  2H2K A;  3CWG A;  3FIA A;  1FI6 A;  1AUI B;  3I5G C;  1PRW A;  3D0Y A;  2LUC A;  2KGR A;  1PVB A;  1IWQ A;  2M7N A;  1MQ1 A;  4PHN A;  5G08 A;  1DJX A;  1K96 A;  1OE9 B;  3EKH A;  3LK0 A;  2OTG B;  1AVS A;  3VGO A;  1IG5 A;  3DF0 B;  4PHJ A;  5CSF A;  3CR2 A;  1AHR A;  3DD4 A;  2BCB A;  1WRL A;  4USL A;  4P5O E;  1FI5 A;  4PAL A;  3QRX A;  2F3Y A;  5ER5 A;  2K7D A;  2HF5 A;  2WND A;  1ODB A;  2P6B B;  1BOC A;  3H4S E;  3OP0 A;  3TDU A;  2Y5I A;  1FF1 A;  3PFV A;  5AAN A;  1H8B A;  1Q80 A;  4A4C A;  1ZMZ A;  4C0L A;  3CZT X;  4F0Z B;  2PMY A;  5B8I B;  2KHN A;  4NDC A;  2EHB A;  3GOF A;  1C7W A;  1K9U A;  2NLN A;  1RFJ A;  1SL8 A;  3HX4 A;  4MVF A;  1KWO C;  2CBL A;  1S26 D;  2NCO A;  2KFG A;  2O60 A;  1IQ5 A;  2LVJ A;  1A03 A;  1DGU A;  3SJS A;  2LMU A;  5BPJ A;  1HQV A;  5CPV A;  3CR4 X;  1K90 D;  1QAS A;  1QIW A;  1FW4 A;  1XFY O;  4YI8 A;  1YVL A;  4WRI A;  2B1U A;  2ZRS A;  1AJ4 A;  2Y1M A;  1QX2 A;  1B9A A;  5AEQ A;  1L2O C;  2JT3 A;  2WOS A;  1SYM A;  2CNP A;  1J7R A;  2L2E A;  1B47 A;  1LIN A;  2LLS A;  1Y1X A;  2RGI A;  3LK1 A;  2SAS A;  2K0J A;  5FYX A;  2BKI B;  3TUY C;  2FCE A;  1NSH A;  2F2O A;  2KAY A;  2G2B A;  1K8U A;  2JU0 A;  1BJF A;  4BY5 A;  2HET A;  2F3Z A;  4C0K A;  2PSR A;  3VRN A;  1B8R A;  1S1E A;  1ZAC A;  2LMT A;  3EK8 A;  2KBM A;  1EJ3 A;  2KQY A;  4OV2 A;  4JWQ A;  3TS5 C;  1J1E A;  1SR6 B;  5JOL A;  2R2I A;  4PE0 A;  2JXL A;  2M9G A;  1EH2 A;  3SIB A;  4GGF A;  3I5I C;  1YX7 A;  1JBA A;  1BMO A;  1YUU A;  5AXI A;  3WNX B;  1S36 A;  2BKH B;  2L4I A;  4CID A;  1IJ5 A;  1Y0V H;  3I5F B;  2BL0 B;  4HSZ A;  2E30 A;  2VRG A;  3KHE A;  3SG6 A;  4GAO A;  1IKU A;  1SBJ A;  2EC6 B;  1W7I B;  1OMV A;  1IQ3 A;  1WDC C;  4NDB A;  2ZFD A;  1H4B A;  3SG5 A;  1VRK A;  1WLM A;  1KK8 B;  3PN7 C;  4JQ0 D;  3ZNI A;  1SNL A;  3EVU A;  3SIA A;  1S6C A;  2BBN A;  3O78 A;  1WRK A;  2I7A A;  1TNP A;  5I2L A;  1QLS A;  1NCX A;  3JVT C;  3EK4 A;  1N0Y A;  1QTX A;  2JOJ A;  2KYF A;  2HQW A;  1KFX L;  1YRU B;  3BOW B;  1S6I A;  1CDL A;  5DKQ A;  2LVK A;  4NDD A;  5TNC A;  2KYC A;  1J1D A;  1LXF C;  3BOW A;  2MHH A;  1S3P A;  4ZCV A;  4N5X A;  2PRU A;  1XO5 A;  1K9K A;  3GK1 A;  3WXA A;  1TIZ A;  1F4O A;  1B8C A;  4GFT A;  2M97 A;  1BOD A;  3FWB A;  2MRD A;  1TOP A;  1PSR A;  1SKT A;  1OMD A;  1NYA A;  3JTD C;  2KFF A;  2I2R E;  2WCE A;  2H61 C;  2K7O A;  1XVJ A;  1KQV A;  2CT9 A;  2BEC A;  3I5G B;  2M0R A;  1NP8 A;  4YI9 A;  3EK7 A;  2GGZ A;  2KI4 B;  1D1O A;  1U5I B;  1DJI A;  2GGM A;  5CSN A;  3D10 A;  3RLZ A;  2JT8 A;  2ZN9 A;  4AQJ A;  1J7O A;  1K9P A;  2MBX A;  1LA0 A;  1CB1 A;  1CTR A;  2I94 A;  3MSE B;  1G8I A;  1HT9 A;  1M63 B;  2KI6 D;  3E3R A;  4YGD B;  5HKZ A;  1GGZ A;  3C1V A;  4I5L B;  4M2Q A;  1NX0 A;  1DF0 B;  2LHL A;  5KTY A;  2KNE A;  2CCM A;  1QX5 B;  1G33 A;  3DF0 A;  2K8M B;  1GGW A;  2F2P A;  3BUM B;  4DCK A;  2M1K B;  1OSA A;  1E8A A;  2I18 A;  1YR5 A;  3DVM A;  2OS8 C;  4MN0 A;  1ZFS A;  1SY9 A;  2NZ0 A;  4WQ3 A;  3VRR A;  1ZUZ A;  2BCX A;  4NQG A;  2M29 A;  2JNX A;  1DTL A;  1WRZ A;  2BE6 A;  1XFU O;  1LKJ A;  1OQP A;  2BE4 A;  2JZI A;  1SRA A;  1YTZ C;  5KSZ A;  2LCP A;  3BXK A;  4ORB B;  2L5X B;  1NX1 A;  3I5H C;  4HRG A;  3CLN A;  5HYD A;  1V1F A;  4YBH B;  4CFR A;  1SPY A;  4FTG A;  2JPT A;  1KFU S;  1XYD A;  4OVN F;  4AOM A;  4MRX A;  1PSB A;  4UPG A;  4ETO A;  4M2O A;  1LA3 A;  3O2P A;  2KBI A;  5ER4 X;  4CFQ A;  1KFU L;  1WLZ A;  1F8H A;  3DVK A;  5D69 A;  1EG4 A;  2AMI A;  1SMG A;  2JT0 A;  1N2D A;  2Q4U A;  4PE7 A;  3DVJ A;  1F55 A;  1YX8 A;  1DMO A;  1QLK A;  1SCM B;  4ICB A;  5CSJ A;  2Y4Q A;  1MUX A;  3KO0 A;  2Y1N A;  1BF5 A;  1SL9 A;  1L2O B;  2L51 A;  2BBM A;  5AER A;  1JFJ A;  1AP4 A;  1YUS A;  2KAX A;  2WC8 A;  1A4P A;  2JUL A;  4QJ4 B;  3TZ1 A;  4YRU A;  1BG1 A;  2LV7 A;  1REC A;  1QIV A;  1CDN A;  2K2F A;  1UHK A;  2ISD A;  3TDZ A;  3WHT B;  2LHI A;  1RJV A;  3KPX A;  1PUL A;  1K2H A;  1A2X A;  1JF0 A;  5PAL A;  1UHJ A;  2FJU B;  4GNK B;  1NX3 A;  2JQ6 A;  1KCY A;  2FCD A;  2LNK A;  4YGE B;  3EVR A;  4QJ3 B;  3TS5 B;  1NX2 A;  2LAN A;  5IBW A;  2LAP A;  3SG4 A;  1CMF A;  1Y1U A;  4GBA A;  2L98 A;  1W7J B;  1SL7 A;  1AJ5 A;  1FBV A;  3I5I B;  2TN4 A;  4I5K A;  2LVI A;  4MZJ A;  4GPL B;  5D7F A;  1S5G Y;  1S5G Z;  3GK4 X;  3OHM B;  4JPZ B;  1XK4 A;  3OB2 B;  3FS7 A;  3BYA A;  4WQ2 A;  1MWN A;  1SK6 D;  1YRT B;  5HLO A;  3AKB A;  1N65 A;  1UWO A;  1NCZ A;  4GGF C;  3PSR A;  4XJK B;  4P2Y B;  3PN7 B;  1CFC A;  2LMV A;  3AKA A;  1PK0 D;  1NIW A;  1BLQ A;  2ZKM X;  1K93 D;  4BY4 A;  1JUO A;  1KFX S;  1Y6W A;  1BR4 B;  3ZWH A;  1NUB A;  1TNW A;  1DJW A;  3JVT B;  3I5F C;  1ALW A;  2JWW A;  3EKJ A;  1MXL C;  3VRO A;  2E6W A;  1DJZ A;  3FWC A;  4E68 A;  1PVA A;  4ORC B;  4TNC A;  3BUO B;  1A75 B;  5I8N A;  1F70 A;  1XFX O;  1QV0 A;  1TRF A;  3AAK A;  3PAL A;  1UP5 A;  1RRO A;  3A4U B;  1KQM B;  1QS7 A;  1XA5 A;  3ICB A;  1NPQ A;  3M0W A;  3SG3 A;  2O5G A;  1TCO B;  2M3W A;  2LP3 A;  4M2P A;  4DUQ A;  3LL8 B;  1NCY A;  1XFW O;  2KOT A;  1JSA A;  2SCP A;  5DKN A;  2JNF A;  1CFF A;  1CFD A;  1IJ6 A;  3IF7 A;  2COL B;  2FOT A;  2PAS A;  1RK9 A;  1FPW A;  1U5I A;  1CDM A;  1G4Y R;  1M31 A;  1SCV A;  3PLF B;  3LLE A;  3TDI A;  1UUR A;  1IGV A;  2ZNE A;  1M39 A;  1YUT A;  5HKY A;  2JXC A;  4MZK A;  4R1E A;  3EVV A;  3D0Y B;  1TNQ A;  5DKR A;  1DJH A;  2QAC A;  3A8R A;  1CM4 A;  4N1F A;  1DF0 A;  3IQO A;  4CLN A;  2K61 A;  2KI4 C;  3BUN B;  1GQM A;  4YGB B;  3LCP C;  1F4Q A;  2OS8 B;  2LE9 B;  2BCA A;  5I2O A;  1BR1 B;  4HRE E;  3PM8 A;  2MLF C;  3AAJ A;  1JWD A;  1L7Z A;  2DOQ A;  3NSK A;  1SW8 A;  1B4C A;  2OTG C;  1YUR A;  5I2Q A;  2LLU A;  3BUX B;  3NSL A;  2CXJ A;  4N1G A;  1CNP A;  3HCM A;  4CPV A;  3I5H B;  3NSO A;  4YGA A;  2MJW B;  2MLE C;  1ALV A;  5KU1 A;  2ZRT A;  1KWO B;  2KQ6 A;  2KFH A;  3VRP A;  2IS9 A;  1J55 A;  1TNX A;  2G9B A;  1DGV A;  3F45 A;  2JTZ A;  1GJY A;  4PDZ A;  1F54 A;  5HKW A;  1KSM A;  1MR8 A;  1IRJ A;  2Q91 A;  4OCI A;  4DIR A;  2OPO A;  2PAL A;  2PVB A;  2KDH A;  2L0P A;  1JFK A;  1MHO A;  1RWY A;  2WCB A;  3K21 A;  1CMG A;  2A4J A;  1CDP A;  5J3X A;  2AAO A;  3BUW B;  2LVV A;  4PHK A;  1KK7 Z;  1KK7 Y;  1JF2 A;  2EGD A;  3OB1 B;  4MEW A;  2MAZ A;  4OKH A;  4ZCU A;  5HLV A;  1DJG A;  4D1E A;  1CM1 A;  1OOJ A;  3TUY B;  2KI6 C;  1QVI Z;  1QVI Y;  1J7P A;  1XFZ O;  4L9M A;  3KEV A;  2NCP A;  3CGA A;  1CKK A;  3DVE A;  1JC2 A;  1CLL A;  4A4B A;  4MSP A;  1S6J A;  2HPS A;  2M7L A;  4U8D A;  2LUX A;  1SCM C;  1BU3 A;  1KSO A;  1A29 A;  1EXR A;  4I5N B;  4OR9 B;  3SG7 A;  3BQ3 A;  1MXE A;  1C07 A;  1Y1A A;  2JTT A;  2WCF A;  1R6P A;  4PE4 A;  2WOR A;  4IL1 A;  2KGB C;  2ZN8 A;  2LP2 A;  2AUC A;  3SG2 A;  1M45 A;  1EG3 A;  1TTX A;  3WHU B;  1J7Q A;  1QV1 A;  4MRY A; 
#chains in the Genus database with same CATH topology
 1CLB A;  4MZL A;  1WDC B;  1TCF A;  3K1E A;  3KF9 A;  3NXA A;  1DT7 B;  2JRF A;  1F71 A;  1SR6 C;  1CFP A;  4I5J A;  2KLD A;  2K2A A;  2NXQ A;  3GK2 A;  1MF8 B;  4XJK A;  2K7B A;  1K94 A;  4YGC B;  1TN4 A;  1XFV O;  1B8L A;  1R2U A;  1QXP A;  4MBE A;  1XK4 C;  1IH0 A;  4PE1 A;  1DQE A;  1T14 A;  2BL0 C;  4HRH A;  2L50 A;  3Q8I A;  1NWD A;  1ZOT B;  4DS7 A;  2QEB A;  1QX7 A;  3CR5 X;  1QWV A;  4FQO A;  2EC6 C;  3BFB A;  4DRW A;  1AK8 A;  3DY9 A;  2JC2 A;  1OZS A;  4PCW A;  1WY9 A;  3NHI A;  2LLT A;  3D73 A;  1KK8 C;  3PAT A;  3NSI A;  3RM1 A;  1DJY A;  2LM5 A;  1CLM A;  2F33 A;  1OMR A;  4C0J A;  4XYN A;  1ORG A;  2HQ8 A;  2V53 A;  1A75 A;  2KAV A;  3D78 A;  2GV5 A;  1C7V A;  4MLW A;  2ZND A;  3CS1 A;  5CSI A;  1OW4 A;  3JTD B;  1UHN A;  1UHI A;  4GUK A;  1QAT A;  1V1G A;  2QPT A;  5D3O A;  5F6T A;  5GQQ C;  1B1G A;  3CDN A;  1DVI A;  1IIO A;  1UHH A;  2KSP A;  1RTP 1;  2LC5 A;  4GGN A;  1OOH A;  2MA2 A;  3OX5 A;  1DEL A;  3OGN A;  4ORA B;  1X02 A;  2H61 A;  2D8N A;  4JKT A;  2L4H A;  3O4Y A;  2F8P A;  2K7C A;  1OZO A;  4QJ5 B;  1BT6 A;  2CTN A;  1EL4 A;  4Q04 A;  2WCH A;  1UUS A;  2M8U A;  5AFP A;  3N7H A;  1W9Z A;  2M1U A;  3IQQ A;  1YVH A;  4AQI A;  5JJG A;  3OX6 A;  4PHM A;  1K95 A;  1LVC D;  3S0D A;  1QJT A;  1PAL A;  3CTN A;  5K89 A;  3VRQ A;  1M46 A;  2M49 B;  1KQM C;  3O6B A;  1B7T Y;  1B7T Z;  2H2K A;  3CWG A;  3FIA A;  1FI6 A;  1AUI B;  3I5G C;  1PRW A;  3DZT A;  3D0Y A;  2LUC A;  2KGR A;  1PVB A;  1IWQ A;  2WCJ A;  2M7N A;  1MQ1 A;  4PHN A;  5G08 A;  1DJX A;  2FJY A;  1K96 A;  1OE9 B;  3EKH A;  1SSE B;  3B6X A;  4INW A;  1Z2C B;  3LK0 A;  2OTG B;  1AVS A;  3VGO A;  1IG5 A;  3DF0 B;  4PHJ A;  5CSF A;  3CR2 A;  1AHR A;  3DD4 A;  2BCB A;  1WRL A;  4USL A;  4P5O E;  1FI5 A;  2WC6 A;  4PAL A;  3QRX A;  2F3Y A;  5ER5 A;  2YGU A;  2K7D A;  2HF5 A;  2WND A;  1ODB A;  2P6B B;  3D74 A;  1BOC A;  3UNW A;  3H4S E;  3R72 A;  3OP0 A;  3TDU A;  2Y5I A;  1FF1 A;  3PFV A;  4OZD A;  5AAN A;  1H8B A;  1Q80 A;  4A4C A;  1ZMZ A;  4C0L A;  3CZT X;  4F0Z B;  2PMY A;  5B8I B;  2KHN A;  4NDC A;  2EHB A;  2WCK A;  3GOF A;  1C7W A;  1K9U A;  2NLN A;  1C3Y A;  1OOF A;  1RFJ A;  1SL8 A;  3HX4 A;  4MVF A;  1KWO C;  2CBL A;  2QDI A;  1S26 D;  2NCO A;  3D76 A;  2KFG A;  2O60 A;  1IQ5 A;  2LVJ A;  3R1P A;  1A03 A;  1DGU A;  3SJS A;  2LMU A;  5BPJ A;  1HQV A;  3L47 A;  3CR4 X;  3R1V A;  5CPV A;  1K90 D;  1QAS A;  1QIW A;  1FW4 A;  1XFY O;  4YI8 A;  1YVL A;  4WRI A;  2B1U A;  3SS3 A;  2ZRS A;  1AJ4 A;  2Y1M A;  1QX2 A;  1B9A A;  5AEQ A;  1L2O C;  2JT3 A;  2WOS A;  1SYM A;  2CNP A;  4JD9 A;  1J7R A;  2L2E A;  1B47 A;  1LIN A;  2LLS A;  3QME A;  1Y1X A;  2RGI A;  3LK1 A;  2SAS A;  2K0J A;  5FYX A;  2BKI B;  3TUY C;  2FCE A;  3DXL A;  1NSH A;  2F2O A;  2KAY A;  2G2B A;  1K8U A;  2JU0 A;  1BJF A;  4BY5 A;  2HET A;  2F3Z A;  4C0K A;  2PSR A;  3VRN A;  1B8R A;  1S1E A;  1ZAC A;  2LMT A;  3EK8 A;  2KBM A;  1EJ3 A;  2KQY A;  2L2C A;  2WCL A;  4OV2 A;  4JWQ A;  3TS5 C;  1J1E A;  1SR6 B;  5JOL A;  3EG5 B;  4F7F A;  2R2I A;  2KPH A;  4PE0 A;  2JXL A;  2M9G A;  1EH2 A;  3RZS A;  3SIB A;  4GGF A;  3I5I C;  1YX7 A;  5HL1 A;  1JBA A;  1BMO A;  1YUU A;  1XFR A;  5AXI A;  1S36 A;  3CZ0 A;  3WNX B;  2BKH B;  2L4I A;  4CID A;  1IJ5 A;  1Y0V H;  3I5F B;  2BL0 B;  4HSZ A;  2E30 A;  2VRG A;  3KHE A;  3SG6 A;  4GAO A;  1IKU A;  1SBJ A;  2EC6 B;  1W7I B;  1OMV A;  1IQ3 A;  1WDC C;  3IVT A;  4NDB A;  2ZFD A;  1H4B A;  3SG5 A;  1VRK A;  1WLM A;  1KK8 B;  3PN7 C;  2WCM A;  4JQ0 D;  3ZNI A;  3FE8 A;  1SNL A;  3BJH A;  3EVU A;  3SIA A;  1S6C A;  2BBN A;  3O78 A;  2BAP A;  1WRK A;  2I7A A;  1TNP A;  5I2L A;  1QLS A;  1NCX A;  3JVT C;  3EK4 A;  5EL2 A;  1N0Y A;  1QTX A;  2JOJ A;  2KYF A;  2HQW A;  1TUJ A;  1KFX L;  1YRU B;  3BOW B;  1S6I A;  1CDL A;  5DKQ A;  2LVK A;  4NDD A;  5TNC A;  2KYC A;  1J1D A;  1LXF C;  3BOW A;  2MHH A;  1S3P A;  4ZCV A;  4N5X A;  3VB1 A;  2PRU A;  1XO5 A;  1K9K A;  3GK1 A;  3WXA A;  3NHT A;  1TIZ A;  1F4O A;  1B8C A;  1TUZ A;  2KLE A;  2M97 A;  3FWB A;  4GFT A;  1BOD A;  2MRD A;  1TOP A;  1PSR A;  1SKT A;  1OMD A;  1NYA A;  3JTD C;  2KFF A;  2I2R E;  2JPO A;  2H61 C;  2WCE A;  2K7O A;  1XVJ A;  3FE6 A;  1KQV A;  2CT9 A;  2BEC A;  3I5G B;  2M0R A;  1NP8 A;  4YI9 A;  3EK7 A;  2GGZ A;  2KI4 B;  1D1O A;  1U5I B;  1DJI A;  2GGM A;  2WC5 A;  5CSN A;  3D10 A;  3RLZ A;  2JT8 A;  2ZN9 A;  4AQJ A;  1J7O A;  1K9P A;  2MBX A;  1LA0 A;  1CB1 A;  1CTR A;  2I94 A;  3MSE B;  1G8I A;  1HT9 A;  1M63 B;  2KI6 D;  3E3R A;  4YGD B;  5HKZ A;  1GGZ A;  3UO9 A;  3C1V A;  1DEK A;  4I5L B;  4M2Q A;  1NX0 A;  1DF0 B;  2LHL A;  2PYQ A;  5KTY A;  2KNE A;  2CCM A;  1QX5 B;  2P70 A;  1TWO A;  1G33 A;  3DF0 A;  3SS4 A;  2K8M B;  1GGW A;  2F2P A;  3BUM B;  4DCK A;  2M1K B;  1OSA A;  1E8A A;  2I18 A;  1YR5 A;  3DVM A;  2OS8 C;  4MN0 A;  1ZFS A;  1SY9 A;  2NZ0 A;  4WQ3 A;  3VRR A;  1ZUZ A;  2BCX A;  2H8V A;  2M29 A;  4NQG A;  2JNX A;  1DTL A;  1WRZ A;  2BE6 A;  1XFU O;  1LKJ A;  1OQP A;  2BE4 A;  2JZI A;  1SRA A;  1YTZ C;  3S0G A;  5KSZ A;  2GTE A;  2LCP A;  3BXK A;  4ORB B;  2L5X B;  1NX1 A;  3I5H C;  4HRG A;  3CLN A;  5HYD A;  3PM2 A;  1V1F A;  4YBH B;  4CFR A;  1SPY A;  4FTG A;  2JPT A;  1KFU S;  1XYD A;  4OVN F;  4AOM A;  4MRX A;  1PSB A;  4UPG A;  4ETO A;  4M2O A;  1LA3 A;  1Z4H A;  2QEH A;  3O2P A;  3S0F A;  1P28 A;  2KBI A;  5ER4 X;  4CFQ A;  1KFU L;  1WLZ A;  1F8H A;  3DVK A;  5D69 A;  1EG4 A;  2AMI A;  1SMG A;  2JT0 A;  1N2D A;  2Q4U A;  2QEO A;  3DVJ A;  4PE7 A;  1F55 A;  1YX8 A;  1DMO A;  1QLK A;  1SCM B;  4ICB A;  5CSJ A;  2Y4Q A;  1MUX A;  3KO0 A;  2Y1N A;  1BF5 A;  1SL9 A;  1L2O B;  2L51 A;  2BBM A;  5AER A;  1JFJ A;  1AP4 A;  1YUS A;  4IJ7 A;  2KAX A;  2WC8 A;  1A4P A;  2JUL A;  4QJ4 B;  3TZ1 A;  4YRU A;  1BG1 A;  1C3Z A;  2LV7 A;  1REC A;  1QIV A;  1CDN A;  2K2F A;  1UHK A;  4INX A;  4PT1 A;  2ISD A;  3TDZ A;  3WHT B;  1DC1 A;  3B88 A;  2LHI A;  1RJV A;  3KPX A;  1PUL A;  3S0E A;  1K2H A;  1A2X A;  1JF0 A;  5PAL A;  1UHJ A;  2FJU B;  4GNK B;  1NX3 A;  2JQ6 A;  1KCY A;  2FCD A;  2LNK A;  4YGE B;  3B7A A;  3EVR A;  4QJ3 B;  5FI6 A;  3TS5 B;  1NX2 A;  2LAN A;  5IBW A;  2LAP A;  3SG4 A;  1CMF A;  1Y1U A;  4GBA A;  2L98 A;  4FQT A;  1W7J B;  1SL7 A;  1AJ5 A;  1FBV A;  3I5I B;  2TN4 A;  4I5K A;  2LVI A;  4MZJ A;  3CAB A;  4GPL B;  5D7F A;  1S5G Y;  1S5G Z;  3GK4 X;  3OHM B;  4JPZ B;  1XK4 A;  3OB2 B;  3FS7 A;  3BYA A;  4WQ2 A;  1MWN A;  1SK6 D;  1YRT B;  5HLO A;  3AKB A;  1N65 A;  3L4A A;  1UWO A;  1NCZ A;  4GGF C;  3PSR A;  4XJK B;  4P2Y B;  2P71 A;  3PN7 B;  1CFC A;  2LMV A;  3AKA A;  1PK0 D;  1NIW A;  3R1O A;  1BLQ A;  2ZKM X;  1K93 D;  4BY4 A;  1JUO A;  1KFX S;  1Y6W A;  1BR4 B;  1OOG A;  3SS5 A;  1NUB A;  1TNW A;  3ZWH A;  1DJW A;  3JVT B;  3I5F C;  1ALW A;  2JWW A;  2BNX A;  3PJI A;  3EKJ A;  1MXL C;  2K60 A;  3VRO A;  2E6W A;  1DJZ A;  3FWC A;  4E68 A;  1PVA A;  4ORC B;  4TNC A;  3BUO B;  1A75 B;  5I8N A;  1F70 A;  2L5Y A;  1XFX O;  1QV0 A;  1TRF A;  3AAK A;  3PAL A;  3FE9 A;  1UP5 A;  5DIC A;  1RRO A;  3A4U B;  1KQM B;  1QS7 A;  1XA5 A;  3ICB A;  1NPQ A;  3M0W A;  3SG3 A;  2O5G A;  1TCO B;  2M3W A;  2LP3 A;  4M2P A;  5FI2 A;  4DUQ A;  3LL8 B;  1NCY A;  1XFW O;  3CZ1 A;  2KOT A;  1JSA A;  2SCP A;  5DKN A;  2JNF A;  1CFF A;  1CFD A;  1IJ6 A;  3IF7 A;  2COL B;  2FOT A;  2PAS A;  1RK9 A;  3D75 A;  3B87 A;  1FPW A;  1U5I A;  1CDM A;  1G4Y R;  1M31 A;  1SCV A;  3PLF B;  3LLE A;  3TDI A;  1UUR A;  1IGV A;  2ZNE A;  1M39 A;  1YUT A;  5HKY A;  2JXC A;  4MZK A;  4R1E A;  3EVV A;  1OOI X;  3D0Y B;  1TNQ A;  3CZ2 A;  5DKR A;  1DJH A;  2QAC A;  3A8R A;  1CM4 A;  2QEV A;  1DF0 A;  4N1F A;  3IQO A;  4CLN A;  2K61 A;  2KI4 C;  3BUN B;  1GQM A;  4YGB B;  3L4L A;  3LCP C;  1F4Q A;  2OS8 B;  2LE9 B;  2BCA A;  5I2O A;  1BR1 B;  4HRE E;  3PM8 A;  2MLF C;  3AAJ A;  1JWD A;  1L7Z A;  2DOQ A;  3D77 A;  3NSK A;  1SW8 A;  1B4C A;  3S0A A;  2OTG C;  1YUR A;  2PQL A;  5I2Q A;  2LLU A;  3BUX B;  3NSL A;  2CXJ A;  4N1G A;  1CNP A;  3HCM A;  4CPV A;  3I5H B;  3NSO A;  4YGA A;  2MJW B;  2MLE C;  1ALV A;  3DYE A;  5KU1 A;  2ZRT A;  1GM0 A;  1KWO B;  1LS8 A;  2KQ6 A;  2KFH A;  3VRP A;  2IS9 A;  1J55 A;  1TNX A;  2G9B A;  1DGV A;  3F45 A;  2JTZ A;  1GJY A;  4PDZ A;  1F54 A;  5HKW A;  1KSM A;  1MR8 A;  1IRJ A;  2Q91 A;  4OCI A;  4DIR A;  5I94 A;  2OPO A;  2PAL A;  2PVB A;  2KDH A;  3CYZ A;  2L0P A;  1JFK A;  1MHO A;  1RWY A;  2WCB A;  3K21 A;  3OBV A;  1CMG A;  2A4J A;  1CDP A;  5J3X A;  2AAO A;  3BUW B;  2LVV A;  4PHK A;  1KK7 Z;  1KK7 Y;  3V2L A;  1JF2 A;  2EGD A;  3OB1 B;  4MEW A;  3S0B A;  2MAZ A;  4OKH A;  4ZCU A;  5HLV A;  1DJG A;  3BFA A;  4D1E A;  1CM1 A;  1OOJ A;  3TUY B;  2KI6 C;  1QVI Z;  1QVI Y;  1J7P A;  1XFZ O;  4L9M A;  3KEV A;  2NCP A;  3CGA A;  1CKK A;  3BFH A;  3DVE A;  1JC2 A;  1CLL A;  5FI7 A;  4A4B A;  4MSP A;  1S6J A;  2HPS A;  3NGV A;  2M7L A;  4U8D A;  2LUX A;  1SCM C;  1BU3 A;  1KSO A;  1A29 A;  1EXR A;  4I5N B;  4OR9 B;  3SG7 A;  3BQ3 A;  1MXE A;  4KYN A;  1C07 A;  1Y1A A;  2JTT A;  2WCF A;  1R6P A;  4PE4 A;  2WOR A;  4IL1 A;  2KGB C;  2ERB A;  3B86 A;  2ZN8 A;  2LP2 A;  2AUC A;  3SG2 A;  1M45 A;  1EG3 A;  1TTX A;  3WHU B;  1J7Q A;  3O4X A;  1QV1 A;  4MRY A; 
#chains in the Genus database with same CATH homology
 1CLB A;  4MZL A;  1WDC B;  1TCF A;  3KF9 A;  3NXA A;  1DT7 B;  2JRF A;  1F71 A;  1SR6 C;  1CFP A;  4I5J A;  2K2A A;  2NXQ A;  3GK2 A;  1MF8 B;  4XJK A;  2K7B A;  1K94 A;  4YGC B;  1TN4 A;  1XFV O;  1B8L A;  1R2U A;  1QXP A;  4MBE A;  1XK4 C;  1IH0 A;  4PE1 A;  2BL0 C;  4HRH A;  2L50 A;  1NWD A;  1ZOT B;  4DS7 A;  1QX7 A;  3CR5 X;  4FQO A;  2EC6 C;  4DRW A;  1AK8 A;  2JC2 A;  1OZS A;  4PCW A;  1WY9 A;  2LLT A;  3PAT A;  1KK8 C;  3RM1 A;  3NSI A;  1DJY A;  2LM5 A;  1CLM A;  2F33 A;  1OMR A;  4C0J A;  4XYN A;  2HQ8 A;  2V53 A;  1A75 A;  2KAV A;  2GV5 A;  1C7V A;  4MLW A;  2ZND A;  3CS1 A;  5CSI A;  3JTD B;  1UHN A;  1UHI A;  4GUK A;  1QAT A;  1V1G A;  2QPT A;  5F6T A;  5GQQ C;  1B1G A;  1DVI A;  1UHH A;  2KSP A;  1RTP 1;  2LC5 A;  4GGN A;  2MA2 A;  3OX5 A;  4ORA B;  1X02 A;  2H61 A;  2D8N A;  2L4H A;  3O4Y A;  2F8P A;  2K7C A;  1OZO A;  4QJ5 B;  1BT6 A;  2CTN A;  1EL4 A;  4Q04 A;  1UUS A;  2M8U A;  5AFP A;  2M1U A;  3IQQ A;  1YVH A;  4AQI A;  5JJG A;  3OX6 A;  4PHM A;  1K95 A;  1LVC D;  1QJT A;  1PAL A;  3CTN A;  5K89 A;  3VRQ A;  1M46 A;  2M49 B;  1KQM C;  3O6B A;  1B7T Y;  1B7T Z;  2H2K A;  3CWG A;  3FIA A;  1FI6 A;  1AUI B;  3I5G C;  1PRW A;  3D0Y A;  2LUC A;  2KGR A;  1PVB A;  1IWQ A;  2M7N A;  1MQ1 A;  4PHN A;  5G08 A;  1DJX A;  1K96 A;  1OE9 B;  3EKH A;  3LK0 A;  2OTG B;  1AVS A;  3VGO A;  1IG5 A;  3DF0 B;  4PHJ A;  5CSF A;  3CR2 A;  1AHR A;  3DD4 A;  2BCB A;  1WRL A;  4USL A;  4P5O E;  1FI5 A;  4PAL A;  3QRX A;  2F3Y A;  5ER5 A;  2K7D A;  2HF5 A;  2WND A;  1ODB A;  2P6B B;  1BOC A;  3H4S E;  3OP0 A;  3TDU A;  2Y5I A;  1FF1 A;  3PFV A;  5AAN A;  1H8B A;  1Q80 A;  4A4C A;  1ZMZ A;  4C0L A;  3CZT X;  4F0Z B;  2PMY A;  5B8I B;  2KHN A;  4NDC A;  2EHB A;  3GOF A;  1C7W A;  1K9U A;  2NLN A;  1RFJ A;  1SL8 A;  3HX4 A;  4MVF A;  1KWO C;  2CBL A;  1S26 D;  2NCO A;  2KFG A;  2O60 A;  1IQ5 A;  2LVJ A;  1A03 A;  1DGU A;  3SJS A;  2LMU A;  5BPJ A;  1HQV A;  5CPV A;  3CR4 X;  1K90 D;  1QAS A;  1QIW A;  1FW4 A;  1XFY O;  4YI8 A;  1YVL A;  4WRI A;  2B1U A;  2ZRS A;  1AJ4 A;  2Y1M A;  1QX2 A;  1B9A A;  5AEQ A;  1L2O C;  2JT3 A;  2WOS A;  1SYM A;  2CNP A;  1J7R A;  2L2E A;  1B47 A;  1LIN A;  2LLS A;  1Y1X A;  2RGI A;  3LK1 A;  2SAS A;  2K0J A;  5FYX A;  2BKI B;  3TUY C;  2FCE A;  1NSH A;  2F2O A;  2KAY A;  2G2B A;  1K8U A;  2JU0 A;  1BJF A;  4BY5 A;  2HET A;  2F3Z A;  4C0K A;  2PSR A;  3VRN A;  1B8R A;  1S1E A;  1ZAC A;  2LMT A;  3EK8 A;  2KBM A;  1EJ3 A;  2KQY A;  4OV2 A;  4JWQ A;  3TS5 C;  1J1E A;  1SR6 B;  5JOL A;  2R2I A;  4PE0 A;  2JXL A;  2M9G A;  1EH2 A;  3SIB A;  4GGF A;  3I5I C;  1YX7 A;  1JBA A;  1BMO A;  1YUU A;  5AXI A;  3WNX B;  1S36 A;  2BKH B;  2L4I A;  4CID A;  1IJ5 A;  1Y0V H;  3I5F B;  2BL0 B;  4HSZ A;  2E30 A;  2VRG A;  3KHE A;  3SG6 A;  4GAO A;  1IKU A;  1SBJ A;  2EC6 B;  1W7I B;  1OMV A;  1IQ3 A;  1WDC C;  4NDB A;  2ZFD A;  1H4B A;  3SG5 A;  1VRK A;  1WLM A;  1KK8 B;  3PN7 C;  4JQ0 D;  3ZNI A;  1SNL A;  3EVU A;  3SIA A;  1S6C A;  2BBN A;  3O78 A;  1WRK A;  2I7A A;  1TNP A;  5I2L A;  1QLS A;  1NCX A;  3JVT C;  3EK4 A;  1N0Y A;  1QTX A;  2JOJ A;  2KYF A;  2HQW A;  1KFX L;  1YRU B;  3BOW B;  1S6I A;  1CDL A;  5DKQ A;  2LVK A;  4NDD A;  5TNC A;  2KYC A;  1J1D A;  1LXF C;  3BOW A;  2MHH A;  1S3P A;  4ZCV A;  4N5X A;  2PRU A;  1XO5 A;  1K9K A;  3GK1 A;  3WXA A;  1TIZ A;  1F4O A;  1B8C A;  4GFT A;  2M97 A;  1BOD A;  3FWB A;  2MRD A;  1TOP A;  1PSR A;  1SKT A;  1OMD A;  1NYA A;  3JTD C;  2KFF A;  2I2R E;  2WCE A;  2H61 C;  2K7O A;  1XVJ A;  1KQV A;  2CT9 A;  2BEC A;  3I5G B;  2M0R A;  1NP8 A;  4YI9 A;  3EK7 A;  2GGZ A;  2KI4 B;  1D1O A;  1U5I B;  1DJI A;  2GGM A;  5CSN A;  3D10 A;  3RLZ A;  2JT8 A;  2ZN9 A;  4AQJ A;  1J7O A;  1K9P A;  2MBX A;  1LA0 A;  1CB1 A;  1CTR A;  2I94 A;  3MSE B;  1G8I A;  1HT9 A;  1M63 B;  2KI6 D;  3E3R A;  4YGD B;  5HKZ A;  1GGZ A;  3C1V A;  4I5L B;  4M2Q A;  1NX0 A;  1DF0 B;  2LHL A;  5KTY A;  2KNE A;  2CCM A;  1QX5 B;  1G33 A;  3DF0 A;  2K8M B;  1GGW A;  2F2P A;  3BUM B;  4DCK A;  2M1K B;  1OSA A;  1E8A A;  2I18 A;  1YR5 A;  3DVM A;  2OS8 C;  4MN0 A;  1ZFS A;  1SY9 A;  2NZ0 A;  4WQ3 A;  3VRR A;  1ZUZ A;  2BCX A;  4NQG A;  2M29 A;  2JNX A;  1DTL A;  1WRZ A;  2BE6 A;  1XFU O;  1LKJ A;  1OQP A;  2BE4 A;  2JZI A;  1SRA A;  1YTZ C;  5KSZ A;  2LCP A;  3BXK A;  4ORB B;  2L5X B;  1NX1 A;  3I5H C;  4HRG A;  3CLN A;  5HYD A;  1V1F A;  4YBH B;  4CFR A;  1SPY A;  4FTG A;  2JPT A;  1KFU S;  1XYD A;  4OVN F;  4AOM A;  4MRX A;  1PSB A;  4UPG A;  4ETO A;  4M2O A;  1LA3 A;  3O2P A;  2KBI A;  5ER4 X;  4CFQ A;  1KFU L;  1WLZ A;  1F8H A;  3DVK A;  5D69 A;  1EG4 A;  2AMI A;  1SMG A;  2JT0 A;  1N2D A;  2Q4U A;  4PE7 A;  3DVJ A;  1F55 A;  1YX8 A;  1DMO A;  1QLK A;  1SCM B;  4ICB A;  5CSJ A;  2Y4Q A;  1MUX A;  3KO0 A;  2Y1N A;  1BF5 A;  1SL9 A;  1L2O B;  2L51 A;  2BBM A;  5AER A;  1JFJ A;  1AP4 A;  1YUS A;  2KAX A;  2WC8 A;  1A4P A;  2JUL A;  4QJ4 B;  3TZ1 A;  4YRU A;  1BG1 A;  2LV7 A;  1REC A;  1QIV A;  1CDN A;  2K2F A;  1UHK A;  2ISD A;  3TDZ A;  3WHT B;  2LHI A;  1RJV A;  3KPX A;  1PUL A;  1K2H A;  1A2X A;  1JF0 A;  5PAL A;  1UHJ A;  2FJU B;  4GNK B;  1NX3 A;  2JQ6 A;  1KCY A;  2FCD A;  2LNK A;  4YGE B;  3EVR A;  4QJ3 B;  3TS5 B;  1NX2 A;  2LAN A;  5IBW A;  2LAP A;  3SG4 A;  1CMF A;  1Y1U A;  4GBA A;  2L98 A;  1W7J B;  1SL7 A;  1AJ5 A;  1FBV A;  3I5I B;  2TN4 A;  4I5K A;  2LVI A;  4MZJ A;  4GPL B;  5D7F A;  1S5G Y;  1S5G Z;  3GK4 X;  3OHM B;  4JPZ B;  1XK4 A;  3OB2 B;  3FS7 A;  3BYA A;  4WQ2 A;  1MWN A;  1SK6 D;  1YRT B;  5HLO A;  3AKB A;  1N65 A;  1UWO A;  1NCZ A;  4GGF C;  3PSR A;  4XJK B;  4P2Y B;  3PN7 B;  1CFC A;  2LMV A;  3AKA A;  1PK0 D;  1NIW A;  1BLQ A;  2ZKM X;  1K93 D;  4BY4 A;  1JUO A;  1KFX S;  1Y6W A;  1BR4 B;  3ZWH A;  1NUB A;  1TNW A;  1DJW A;  3JVT B;  3I5F C;  1ALW A;  2JWW A;  3EKJ A;  1MXL C;  3VRO A;  2E6W A;  1DJZ A;  3FWC A;  4E68 A;  1PVA A;  4ORC B;  4TNC A;  3BUO B;  1A75 B;  5I8N A;  1F70 A;  1XFX O;  1QV0 A;  1TRF A;  3AAK A;  3PAL A;  1UP5 A;  1RRO A;  3A4U B;  1KQM B;  1QS7 A;  1XA5 A;  3ICB A;  1NPQ A;  3M0W A;  3SG3 A;  2O5G A;  1TCO B;  2M3W A;  2LP3 A;  4M2P A;  4DUQ A;  3LL8 B;  1NCY A;  1XFW O;  2KOT A;  1JSA A;  2SCP A;  5DKN A;  2JNF A;  1CFF A;  1CFD A;  1IJ6 A;  3IF7 A;  2COL B;  2FOT A;  2PAS A;  1RK9 A;  1FPW A;  1U5I A;  1CDM A;  1G4Y R;  1M31 A;  1SCV A;  3PLF B;  3LLE A;  3TDI A;  1UUR A;  1IGV A;  2ZNE A;  1M39 A;  1YUT A;  5HKY A;  2JXC A;  4MZK A;  4R1E A;  3EVV A;  3D0Y B;  1TNQ A;  5DKR A;  1DJH A;  2QAC A;  3A8R A;  1CM4 A;  4N1F A;  1DF0 A;  3IQO A;  4CLN A;  2K61 A;  2KI4 C;  3BUN B;  1GQM A;  4YGB B;  3LCP C;  1F4Q A;  2OS8 B;  2LE9 B;  2BCA A;  5I2O A;  1BR1 B;  4HRE E;  3PM8 A;  2MLF C;  3AAJ A;  1JWD A;  1L7Z A;  2DOQ A;  3NSK A;  1SW8 A;  1B4C A;  2OTG C;  1YUR A;  5I2Q A;  2LLU A;  3BUX B;  3NSL A;  2CXJ A;  4N1G A;  1CNP A;  3HCM A;  4CPV A;  3I5H B;  3NSO A;  4YGA A;  2MJW B;  2MLE C;  1ALV A;  5KU1 A;  2ZRT A;  1KWO B;  2KQ6 A;  2KFH A;  3VRP A;  2IS9 A;  1J55 A;  1TNX A;  2G9B A;  1DGV A;  3F45 A;  2JTZ A;  1GJY A;  4PDZ A;  1F54 A;  5HKW A;  1KSM A;  1MR8 A;  1IRJ A;  2Q91 A;  4OCI A;  4DIR A;  2OPO A;  2PAL A;  2PVB A;  2KDH A;  2L0P A;  1JFK A;  1MHO A;  1RWY A;  2WCB A;  3K21 A;  1CMG A;  2A4J A;  1CDP A;  5J3X A;  2AAO A;  3BUW B;  2LVV A;  4PHK A;  1KK7 Z;  1KK7 Y;  1JF2 A;  2EGD A;  3OB1 B;  4MEW A;  2MAZ A;  4OKH A;  4ZCU A;  5HLV A;  1DJG A;  4D1E A;  1CM1 A;  1OOJ A;  3TUY B;  2KI6 C;  1QVI Z;  1QVI Y;  1J7P A;  1XFZ O;  4L9M A;  3KEV A;  2NCP A;  3CGA A;  1CKK A;  3DVE A;  1JC2 A;  1CLL A;  4A4B A;  4MSP A;  1S6J A;  2HPS A;  2M7L A;  4U8D A;  2LUX A;  1SCM C;  1BU3 A;  1KSO A;  1A29 A;  1EXR A;  4I5N B;  4OR9 B;  3SG7 A;  3BQ3 A;  1MXE A;  1C07 A;  1Y1A A;  2JTT A;  2WCF A;  1R6P A;  4PE4 A;  2WOR A;  4IL1 A;  2KGB C;  2ZN8 A;  2LP2 A;  2AUC A;  3SG2 A;  1M45 A;  1EG3 A;  1TTX A;  3WHU B;  1J7Q A;  1QV1 A;  4MRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...