1ZACA

N-domain of troponin c from chicken skeletal muscle, nmr, minimized average structure
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN-C
publication title Low-temperature-induced structural changes in the Apo regulatory domain of skeletal muscle troponin C.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zacA00
1S26D 2ZNDA 4YGBB 1RK9A 1YUTA 1TCOB 1S3PA 4PHJA 1LVCD 4MZJA 5I2QA 3ZNIA 1AUIB 5I2LA 1PVAA 1BR1B 3IF7A 4QJ4B 2RGIA 4NQGA 2BECA 3SJSA 1RJVA 1CDLA 1YX7A 1MHOA 2Y4QA 5B8IB 1B7TZ 2L5XB 2LLTA 2D8NA 2ISDA 4HRHA 1NX1A 2JXCA 4TNCA 1CDNA 1XK4C 2PASA 4GGNA 5HLOA 2M3WA 2LAPA 2ZN9A 3VGOA 1DF0A 4DRWA 1J7PA 1WRZA 2KHNA 5CSJA 1CM1A 4YRUA 3LLEA 4Q04A 3SG4A 1QX5B 1M39A 3CR4X 1IGVA 5G08A 4MSPA 1DF0B 2HF5A 2MRDA 3I5FC 4WQ2A 1KQMC 1KWOC 2LVJA 1TOPA 3KEVA 1KCYA 1CLLA 2LUXA 3EKJA 1FW4A 2KQYA 3IQOA 3PLFB 3OB2B 1K96A 1J1EA 2I94A 1ZOTB 2OS8B 1NX3A 1SR6C 1IJ5A 2JULA 1KFXS 1EL4A 2H2KA 2JT3A 1KQVA 3RM1A 1MXLC 5JJGA 5D7FA 1Y1XA 4HRGA 4XYNA 1XFVO 1SYMA 2LE9B 2KGBC 2F3ZA 2E6WA 2KAXA 3EKHA 5ER5A 2KFGA 2MHHA 3SG5A 4PE7A 1A03A 1QVIY 3TUYB 3DD4A 1L2OB 4M2PA 1B4CA 2G2BA 1KFUL 1OMDA 4AQIA 3TZ1A 2B1UA 1DJHA 2OTGC 1LINA 4ORCB 3TS5B 2BKIB 1ALVA 4BY4A 1NCYA 1YUUA 3NSOA 3FS7A 1F4QA 1W7IB 1YR5A 1KK8B 3C1VA 1AJ4A 4ORBB 2FJUB 2JC2A 1MR8A 1BR4B 5F6TA 2Y1NA 1CMFA 1DJGA 2LLSA 1NUBA 1RWYA 1DJYA 1NYAA 1BJFA 1PULA 4MRYA 4F0ZB 2M97A 3CTNA 1K9UA 1ODBA 1Y0VH 2HQWA 2GGMA 1V1GA 1QVIZ 2COLB 1GGZA 4JPZB 4MZLA 2KGRA 1F54A 4ICBA 1CLMA 1L7ZA 2BCBA 3FWBA 3CR5X 3JVTB 2ZKMX 2KI4B 2IS9A 1CDPA 3H4SE 3PALA 4GAOA 2L4HA 1EJ3A 1KSOA 2ZRSA 1CFDA 1SY9A 1AP4A 2LHIA 2PVBA 3DVKA 4MLWA 1YRUB 1TCFA 4PE0A 5CSIA 1A29A 2JTZA 2K7BA 4C0KA 2LMTA 4DCKA 4ZCVA 2LVIA 2BL0C 4GNKB 4MRXA 1G4YR 4YGDB 3SG2A 4AOMA 3PATA 4OR9B 1QASA 1R6PA 2K2FA 1K90D 2LV7A 4YI9A 1Q80A 1XFWO 1NX2A 1C07A 1NPQA 1ZMZA 5DKQA 1NIWA 2ZN8A 1B7TY 1SK6D 4FQOA 4WQ3A 1YURA 2NXQA 2BCXA 4UPGA 1NCXA 4YGAA 1JFJA 2L0PA 2JOJA 4L9MA 3NXAA 1WDCC 1KQMB 1KWOB 2O5GA 4I5NB 3PSRA 1HT9A 1BG1A 1JSAA 1CDMA 1UUSA 3DVEA 1IWQA 1K94A 1KFUS 2KDHA 3NSLA 1Y1AA 1HQVA 1V1FA 4JWQA 4OKHA 4A4CA 2K7DA 1A75A 2CT9A 1J7QA 2M1KB 4OV2A 1XFZO 3JTDB 5AANA 1NSHA 2I18A 2LMVA 4PDZA 1BF5A 1CB1A 1A75B 1SCMB 3BYAA 1K8UA 2HETA 3VROA 3VRPA 2EGDA 3I5GC 1NX0A 2M7LA 3WHUB 4ETOA 5K89A 1ZACA 4I5LB 1CFCA 2K7OA 2MJWB 2TN4A 1NWDA 1SMGA 4YBHB 2P6BB 2KI6C 1X02A 1N0YA 3D0YA 3BUWB 3I5HC 2WCBA 2LP2A 2KBIA 2KYFA 2K8MB 2LANA 3HX4A 3TDZA 4C0LA 1OMRA 2JXLA 1EH2A 1QATA 1UURA 4CPVA 3D0YB 2KAVA 4N5XA 2M9GA 3LK0A 1B47A 1TRFA 1S36A 2ZFDA 3WXAA 2F2PA 3EVRA 1AK8A 2KAYA 4M2OA 1B8RA 3PN7C 1QJTA 3I5IB 1DT7B 2NCOA 1DGUA 3GK1A 4USLA 4HSZA 1BT6A 1ZUZA 4PHNA 2EHBA 1TTXA 1M63B 1C7WA 1WRKA 1BOCA 1NP8A 4XJKA 4GGFC 1JC2A 2L51A 5ER4X 3A4UB 3VRQA 2SASA 1IJ6A 3D10A 2LMUA 4I5KA 1H8BA 1QV1A 1UHHA 2M0RA 1F70A 2MA2A 4PE1A 4XJKB 2KQ6A 1MWNA 2F33A 2Y1MA 1SL7A 1YTZC 3FWCA 5AERA 3CWGA 1MXEA 3OB1B 4PHKA 2OPOA 1F4OA 3SG6A 1H4BA 2E30A 3CGAA 3OHMB 1S6JA 1AJ5A 2LCPA 3PM8A 3EK8A 2KSPA 3E3RA 2EC6B 2F8PA 2MBXA 2MLFC 2ZNEA 1IQ3A 1E8AA 1DJWA 2AMIA 2CBLA 2JTTA 2NCPA 2MAZA 2NLNA 1IH0A 4ORAB 4GBAA 3BUOB 1EG4A 1XFUO 5HYDA 1FPWA 4MN0A 4FTGA 1DVIA 2LNKA 4MBEA 3QRXA 5J3XA 1QIWA 4GPLB 4QJ5B 2L50A 3LL8B 2WCFA 2WNDA 3AAKA 2LHLA 1CFPA 2MLEC 5CSNA 4AQJA 1OE9B 1TN4A 2NZ0A 3BUMB 1CFFA 2I7AA 1YVHA 2JRFA 2Q4UA 1G33A 1SL8A 1VRKA 4N1GA 1FI6A 4IL1A 4MEWA 5HKYA 1XA5A 1XK4A 2PALA 2OS8C 3O4YA 2G9BA 1FBVA 1IG5A 1PVBA 3CLNA 2WCEA 1SNLA 2JT0A 2JPTA 3EK4A 2L98A 1IQ5A 1OZSA 1XFYO 1DJXA 2KBMA 5BPJA 2F3YA 5DKNA 1CTRA 2K0JA 2JNFA 5HLVA 1EXRA 2CTNA 1N2DA 4P2YB 2KFHA 4NDBA 2PSRA 3TUYC 2K2AA 1L2OC 2QPTA 1PSRA 3I5FB 1K93D 2JQ6A 4DIRA 1RROA 3AAJA 1GGWA 5HKZA 1IKUA 1U5IA 2BE4A 3BOWA 3KPXA 5PALA 1XYDA 1F71A 3TS5C 2M7NA 1TNWA 3BUNB 4GUKA 2FCEA 2AAOA 5HKWA 2M29A 1DGVA 1SR6B 1TIZA 1WLZA 4D1EA 1YX8A 1F8HA 1KK8C 4P5OE 1U5IB 3BOWB 3BXKA 1J1DA 2PRUA 4A4BA 1FF1A 4CLNA 3A8RA 1QV0A 1OSAA 3DVMA 1MUXA 4OVNF 1WRLA 5AXIA 2BBNA 1XFXO 5CSFA 1BLQA 5I2OA 1S5GY 2BE6A 2L4IA 2WOSA 2K61A 4CFRA 3SIBA 2GV5A 1UHNA 4R1EA 1TNQA 1QX7A 2JZIA 3VRRA 4WRIA 3GK2A 1ZFSA 3RLZA 4CFQA 3JVTC 1UP5A 5I8NA 2KI4C 2F2OA 1JF2A 2OTGB 3O6BA 4NDDA 1C7VA 2LVVA 1OMVA 3K21A 1SBJA 3NSIA 4U8DA 4YI8A 1UHIA 2K7CA 2R2IA 1PALA 3BUXB 2M1UA 1PK0D 1KK7Z 2M49B 1LXFC 2FOTA 4HREE 2HPSA 1R2UA 3NSKA 1WLMA 1NCZA 2LUCA 1Y1UA 1ALWA 2Y5IA 1QX2A 1S5GZ 2KYCA 1N65A 2CXJA 2KFFA 2KOTA 1S1EA 5AFPA 3CR2A 2LVKA 3PFVA 3CZTX 3AKBA 1TNPA 1FI5A 5IBWA 2KNEA 2O60A 1CNPA 3EVUA 3EVVA 3WNXB 2H61C 5TNCA 1LKJA 4YGEB 1EG3A 2GGZA 2KI6D 1A4PA 1DJIA 1QLKA 1YVLA 3OX6A 2L2EA 1M31A 3OX5A 2VRGA 1OQPA 5CPVA 2BL0B 4PHMA 3TDIA 1QLSA 2PMYA 3JTDC 1JUOA 2JU0A 3SG3A 3IQQA 4YGCB 2JT8A 3BQ3A 3ZWHA 4CIDA 2DOQA 3MSEB 1CKKA 2LC5A 3DVJA 1SCMC 1JBAA 1JWDA 1XVJA 2BCAA 1K2HA 1K9PA 4E68A 2BBMA 1DTLA 1QXPA 2ZRTA 1WY9A 1LA0A 5JOLA 1PSBA 3CS1A 3LCPC 4PE4A 1BU3A 1Y6WA 2I2RE 2LM5A 2V53A 2BKHB 4DUQA 1WDCB 1CMGA 1GJYA 1KSMA 2JWWA 3O2PA 3FIAA 2LP3A 3SG7A 2M8UA 1OZOA 1YRTB 4PALA 4N1FA 4ZCUA 3OP0A 1CLBA 1S6CA 1SW8A 1CM4A 1QS7A 3DF0A 4M2QA 4MVFA 4JQ0D 1BODA 1W7JB 2QACA 3VRNA 1TNXA 1RTP1 3GOFA 1A2XA 2WORA 4OCIA 3GK4X 1UHJA 1M46A 1K9KA 2SCPA 3DF0B 3HCMA 1RECA 3ICBA 1B8LA 3I5IC 1JFKA 3TDUA 1XO5A 1YUSA 4NDCA 3I5GB 1J7RA 3LK1A 4PCWA 1G8IA 1B8CA 4BY5A 3WHTB 1B9AA 5GQQC 2Q91A 4C0JA 2HQ8A 1SCVA 1K95A 1UHKA 3I5HB 1B1GA 4MZKA 2A4JA 5DKRA 1J7OA 2CCMA 2LLUA 1DMOA 1SL9A 2JNXA 3AKAA 1DJZA 1KFXL 1SRAA 1RFJA 4GFTA 1F55A 3KO0A 1BMOA 1J55A 4QJ3B 1D1OA 3EK7A 2EC6C 1QTXA 3O78A 4GGFA 5AEQA 1QIVA 3SIAA 3PN7B 4DS7A 1S6IA 1MF8B 1KK7Y 2H61A 3F45A 3KF9A 1SKTA 1UWOA 3KHEA 5D69A 1GQMA 1M45A 1MQ1A 1IRJA 5KSZA 5KTYA 1SPYA 1AHRA 1JF0A 1LA3A 4I5JA 2FCDA 1AVSA 1OOJA 5FYXA 2CNPA 5KU1A 2WC8A 2AUCA 3M0WA 1PRWA
chains in the Genus database with same CATH superfamily
1S26D 2ZNDA 3BFHA 4YGBB 1RK9A 1YUTA 1TCOB 2PQLA 1S3PA 4PHJA 3D78A 1LVCD 4MZJA 5I2QA 3ZNIA 1AUIB 5I2LA 1PVAA 1BR1B 2QEHA 3IF7A 2RGIA 4NQGA 4QJ4B 2BECA 3SJSA 1RJVA 1CDLA 1YX7A 1MHOA 2Y4QA 5B8IB 1B7TZ 2L5XB 2LLTA 2D8NA 2ISDA 4HRHA 1NX1A 2JXCA 1OW4A 4TNCA 1XK4C 1CDNA 2PASA 4GGNA 5HLOA 2M3WA 2LAPA 2ZN9A 3VGOA 1DF0A 4DRWA 1W9ZA 1J7PA 1WRZA 2KHNA 3O4XA 5CSJA 1CM1A 4YRUA 3LLEA 4Q04A 3SG4A 1QX5B 2L2CA 1M39A 3CR4X 1IGVA 5G08A 4MSPA 2P70A 1DF0B 2HF5A 2MRDA 3I5FC 3DZTA 2YGUA 1KQMC 1KWOC 2LVJA 4WQ2A 2JPOA 1SSEB 1TOPA 3KEVA 1KCYA 1CLLA 2LUXA 3EKJA 1FW4A 2KQYA 3IQOA 3PLFB 3OB2B 1K96A 3D76A 1J1EA 2I94A 1ZOTB 2OS8B 1NX3A 1SR6C 1IJ5A 2JULA 1KFXS 1EL4A 2H2KA 2JT3A 1KQVA 3RM1A 1MXLC 5JJGA 5D7FA 1OOFA 1Y1XA 4HRGA 4XYNA 1XFVO 1SYMA 2LE9B 2KGBC 2F3ZA 2E6WA 2KAXA 3EKHA 3FE9A 2KFGA 2MHHA 5ER5A 3RZSA 3SG5A 4PE7A 1A03A 1QVIY 3TUYB 3DD4A 1L2OB 4M2PA 1B4CA 2G2BA 1KFUL 3DXLA 1OMDA 4AQIA 3TZ1A 2B1UA 1DJHA 2OTGC 1LINA 4ORCB 3TS5B 3NGVA 2BKIB 1ALVA 3SS4A 1NCYA 4BY4A 1YUUA 3NSOA 3FS7A 1F4QA 1W7IB 1YR5A 1KK8B 3C1VA 1AJ4A 4ORBB 2FJUB 2JC2A 1MR8A 1BR4B 5F6TA 2Y1NA 1CMFA 1DJGA 2LLSA 1NUBA 1RWYA 2QEBA 1OOHA 1DJYA 1NYAA 1BJFA 1PULA 3FE8A 4MRYA 4F0ZB 2M97A 3CTNA 1K9UA 5FI7A 4JKTA 1ODBA 1Y0VH 2HQWA 2GGMA 1V1GA 1QVIZ 2COLB 2WCKA 1GGZA 4JPZB 4MZLA 2KGRA 1F54A 4ICBA 1CLMA 1L7ZA 2BCBA 3FWBA 3CR5X 3S0BA 3JVTB 2ZKMX 2KI4B 2IS9A 1CDPA 3H4SE 3PALA 4GAOA 1C3YA 2L4HA 1EJ3A 1KSOA 2ZRSA 1CFDA 1SY9A 1AP4A 2LHIA 2PVBA 3DVKA 4MLWA 1YRUB 3L4LA 1TCFA 4PE0A 5CSIA 3VB1A 1A29A 2JTZA 2K7BA 4C0KA 2LMTA 4DCKA 4ZCVA 2LVIA 2BL0C 4GNKB 4MRXA 1G4YR 4YGDB 3SG2A 4AOMA 3PATA 4OR9B 3OGNA 1QASA 1R6PA 2K2FA 1K90D 2LV7A 4YI9A 1GM0A 1Q80A 1XFWO 1NX2A 1C07A 1NPQA 1ZMZA 5DKQA 1NIWA 2ZN8A 1B7TY 1SK6D 4FQOA 4WQ3A 1YURA 2NXQA 2BCXA 4UPGA 5HL1A 1NCXA 4YGAA 1JFJA 2L0PA 2JOJA 4L9MA 3NXAA 1WDCC 1KQMB 1KWOB 2O5GA 4I5NB 3PSRA 1HT9A 1BG1A 1JSAA 1CDMA 3BFBA 1UUSA 3DVEA 3OBVA 1IWQA 1K94A 1KFUS 2KDHA 3NSLA 1Y1AA 1HQVA 1V1FA 4JWQA 4OKHA 4A4CA 2K7DA 1Z4HA 1A75A 2CT9A 3B88A 1J7QA 2M1KB 4OV2A 3UO9A 1XFZO 3JTDB 5AANA 1NSHA 2I18A 2LMVA 1QWVA 3NHTA 4PDZA 1BF5A 1CB1A 1A75B 1SCMB 3BYAA 1K8UA 2HETA 3VROA 3VRPA 2EGDA 3I5GC 1NX0A 2M7LA 2WC5A 3WHUB 4ETOA 3Q8IA 5K89A 1ZACA 4I5LB 1CFCA 2K7OA 2MJWB 2TN4A 1NWDA 1SMGA 2QEOA 2P6BB 2KI6C 4YBHB 1X02A 1N0YA 3D0YA 3BUWB 3I5HC 2WCBA 2LP2A 2KBIA 2KPHA 2K8MB 2KYFA 2LANA 3HX4A 3TDZA 4C0LA 1OMRA 2JXLA 1EH2A 1QATA 1UURA 4CPVA 3D77A 3D0YB 2KAVA 4N5XA 2M9GA 3LK0A 1B47A 2WCLA 1TRFA 1S36A 2ZFDA 3WXAA 2F2PA 3EVRA 1AK8A 2KAYA 4M2OA 1B8RA 3L47A 3PN7C 1QJTA 3I5IB 1DT7B 2NCOA 1DGUA 3GK1A 4USLA 4HSZA 1BT6A 1ZUZA 4PHNA 2EHBA 1TTXA 1M63B 1C7WA 1WRKA 1BOCA 1NP8A 4XJKA 4GGFC 1JC2A 2L51A 3EG5B 5ER4X 3A4UB 3VRQA 2SASA 1IJ6A 3D10A 1XFRA 2LMUA 4I5KA 3S0FA 1H8BA 1QV1A 1UHHA 2M0RA 1F70A 2MA2A 4PE1A 4XJKB 2KQ6A 1MWNA 2F33A 2Y1MA 1SL7A 1YTZC 3FWCA 5AERA 3CWGA 1MXEA 3OB1B 4PHKA 2WCMA 2OPOA 1F4OA 4KYNA 3SG6A 1H4BA 2E30A 3CGAA 3OHMB 1S6JA 1AJ5A 2LCPA 3PM8A 3EK8A 2KSPA 3E3RA 2EC6B 2F8PA 2MBXA 2MLFC 2ZNEA 1IQ3A 1E8AA 1DJWA 2AMIA 2CBLA 2JTTA 2NCPA 2MAZA 2NLNA 3R72A 3NHIA 1IH0A 4ORAB 4GBAA 3BUOB 1EG4A 1XFUO 5HYDA 1FPWA 4MN0A 4FTGA 1DVIA 2LNKA 2WCHA 4MBEA 3QRXA 5J3XA 1QIWA 3IVTA 4GPLB 3V2LA 4QJ5B 1IIOA 2L50A 3LL8B 2WCFA 2WNDA 3AAKA 2LHLA 3PJIA 1CFPA 2MLEC 3CDNA 5CSNA 4AQJA 1LS8A 1OE9B 1TN4A 2NZ0A 3BUMB 1CFFA 2I7AA 1YVHA 2JRFA 2Q4UA 1G33A 1SL8A 1VRKA 4N1GA 1FI6A 4IL1A 1TUJA 4MEWA 5HKYA 1XA5A 1XK4A 2PALA 2OS8C 3O4YA 2G9BA 1FBVA 1IG5A 1PVBA 3CLNA 2WCEA 1TWOA 1SNLA 2JT0A 2JPTA 3EK4A 2L98A 1IQ5A 1OZSA 1XFYO 1DJXA 2KBMA 5BPJA 2F3YA 3B87A 5DKNA 1CTRA 2K0JA 2JNFA 5HLVA 1EXRA 2CTNA 1N2DA 4P2YB 2KFHA 4NDBA 2K60A 2PSRA 3S0AA 2K2AA 1L2OC 2QPTA 3TUYC 1PSRA 3S0DA 3R1VA 3I5FB 1DQEA 1K93D 2JQ6A 2QDIA 4DIRA 1RROA 3AAJA 1GGWA 5HKZA 1IKUA 1U5IA 2BE4A 3BOWA 3KPXA 2FJYA 1XYDA 5PALA 1F71A 3TS5C 2M7NA 1TNWA 3BUNB 4GUKA 2FCEA 2AAOA 5HKWA 1ORGA 2M29A 1DGVA 1TUZA 3BJHA 1SR6B 1TIZA 1WLZA 2WCJA 1YX8A 3D74A 4D1EA 1KK8C 1F8HA 4P5OE 1U5IB 3BOWB 3BXKA 1J1DA 2PRUA 4A4BA 1FF1A 4CLNA 3A8RA 1QV0A 3N7HA 4OZDA 1OSAA 2L5YA 1MUXA 3DVMA 4OVNF 1WRLA 5AXIA 2BBNA 1XFXO 5CSFA 1BLQA 5I2OA 1S5GY 2BE6A 2L4IA 1P28A 2WOSA 2K61A 3S0EA 4CFRA 3SIBA 2GV5A 4INWA 1UHNA 4R1EA 1TNQA 1QX7A 2JZIA 3VRRA 4WRIA 3GK2A 1ZFSA 3RLZA 4CFQA 3JVTC 1UP5A 5I8NA 2KI4C 2F2OA 1JF2A 2OTGB 3O6BA 4NDDA 1C7VA 4PT1A 2LVVA 1OMVA 3K21A 4F7FA 1SBJA 3NSIA 4U8DA 4YI8A 1UHIA 2K7CA 2QEVA 2R2IA 5DICA 3D75A 1PALA 3BUXB 3PM2A 2M1UA 1PK0D 3BFAA 1KK7Z 2M49B 1LXFC 2FOTA 4HREE 2HPSA 1R2UA 3NSKA 1WLMA 4FQTA 1NCZA 3S0GA 2LUCA 2P71A 1OOGA 1Y1UA 1ALWA 2Y5IA 1QX2A 1DELA 1S5GZ 2KYCA 1N65A 2CXJA 2KFFA 2KOTA 1S1EA 5AFPA 3CR2A 2LVKA 2PYQA 3SS5A 3PFVA 3CZTX 3AKBA 1TNPA 3FE6A 3CYZA 1FI5A 3CABA 5IBWA 2KNEA 2O60A 5D3OA 1DC1A 1CNPA 3EVUA 3EVVA 3WNXB 2H61C 5TNCA 1LKJA 4YGEB 1EG3A 2GGZA 2KI6D 1A4PA 1DJIA 1QLKA 1YVLA 3B6XA 3OX6A 2L2EA 1M31A 3OX5A 1OOIX 2VRGA 1OQPA 5CPVA 2BL0B 4PHMA 3TDIA 1QLSA 2PMYA 3JTDC 1JUOA 2JU0A 3B86A 3SG3A 3IQQA 2GTEA 4YGCB 2JT8A 3BQ3A 3ZWHA 4CIDA 2DOQA 3MSEB 1CKKA 2LC5A 3DVJA 1SCMC 1JBAA 1JWDA 1XVJA 2BCAA 5EL2A 1K2HA 1K9PA 4E68A 1Z2CB 2BBMA 1DTLA 1QXPA 2ZRTA 1WY9A 1LA0A 5JOLA 1PSBA 3CS1A 3LCPC 4PE4A 1BU3A 1Y6WA 2I2RE 2LM5A 2V53A 2BKHB 4INXA 1WDCB 4DUQA 1CMGA 1GJYA 1KSMA 1T14A 2JWWA 3O2PA 3FIAA 2LP3A 3R1OA 3SG7A 2M8UA 1OZOA 1YRTB 4PALA 4N1FA 4ZCUA 5FI6A 3OP0A 1CLBA 1S6CA 1DEKA 1SW8A 1CM4A 1QS7A 3DF0A 4M2QA 4MVFA 3CZ1A 4JQ0D 1BODA 1W7JB 5I94A 2QACA 3VRNA 1TNXA 1RTP1 3GOFA 1A2XA 2BAPA 2WORA 4OCIA 3GK4X 1UHJA 1M46A 1K9KA 2SCPA 3DF0B 3HCMA 1RECA 3ICBA 1B8LA 1C3ZA 3I5IC 1JFKA 3TDUA 2KLEA 1XO5A 1YUSA 3QMEA 4NDCA 3I5GB 1J7RA 3LK1A 3DYEA 4PCWA 1G8IA 1B8CA 4BY5A 3WHTB 1B9AA 5GQQC 2Q91A 4C0JA 2HQ8A 1SCVA 3R1PA 1K95A 3B7AA 2KLDA 3K1EA 1UHKA 3I5HB 1B1GA 4MZKA 2ERBA 2A4JA 5DKRA 2BNXA 1J7OA 2CCMA 2LLUA 1DMOA 1SL9A 3DY9A 2JNXA 3AKAA 1DJZA 1KFXL 1SRAA 1RFJA 4GFTA 5FI2A 1F55A 3KO0A 1BMOA 1J55A 3L4AA 4IJ7A 4QJ3B 1D1OA 3EK7A 3CZ0A 2EC6C 1QTXA 3O78A 4GGFA 5AEQA 1QIVA 3SIAA 3PN7B 4DS7A 3UNWA 1S6IA 1MF8B 3D73A 1KK7Y 2H61A 3F45A 3KF9A 1SKTA 1UWOA 3KHEA 2WC6A 5D69A 1GQMA 1M45A 1MQ1A 1IRJA 5KSZA 5KTYA 1SPYA 3SS3A 3CZ2A 2H8VA 1AHRA 1JF0A 1LA3A 4I5JA 2FCDA 1AVSA 4JD9A 1OOJA 5FYXA 2CNPA 5KU1A 2WC8A 2AUCA 3M0WA 1PRWA
chains in the Genus database with same CATH topology
1S26D 2ZNDA 4YGBB 1RK9A 1YUTA 1TCOB 1S3PA 4PHJA 1LVCD 4MZJA 5I2QA 3ZNIA 1AUIB 5I2LA 1PVAA 1BR1B 3IF7A 4QJ4B 2RGIA 4NQGA 2BECA 3SJSA 1RJVA 1CDLA 1YX7A 1MHOA 2Y4QA 5B8IB 1B7TZ 2L5XB 2LLTA 2D8NA 2ISDA 4HRHA 1NX1A 2JXCA 4TNCA 1CDNA 1XK4C 2PASA 4GGNA 5HLOA 2M3WA 2LAPA 2ZN9A 3VGOA 1DF0A 4DRWA 1J7PA 1WRZA 2KHNA 5CSJA 1CM1A 4YRUA 3LLEA 4Q04A 3SG4A 1QX5B 1M39A 3CR4X 1IGVA 5G08A 4MSPA 1DF0B 2HF5A 2MRDA 3I5FC 4WQ2A 1KQMC 1KWOC 2LVJA 1TOPA 3KEVA 1KCYA 1CLLA 2LUXA 3EKJA 1FW4A 2KQYA 3IQOA 3PLFB 3OB2B 1K96A 1J1EA 2I94A 1ZOTB 2OS8B 1NX3A 1SR6C 1IJ5A 2JULA 1KFXS 1EL4A 2H2KA 2JT3A 1KQVA 3RM1A 1MXLC 5JJGA 5D7FA 1Y1XA 4HRGA 4XYNA 1XFVO 1SYMA 2LE9B 2KGBC 2F3ZA 2E6WA 2KAXA 3EKHA 5ER5A 2KFGA 2MHHA 3SG5A 4PE7A 1A03A 1QVIY 3TUYB 3DD4A 1L2OB 4M2PA 1B4CA 2G2BA 1KFUL 1OMDA 4AQIA 3TZ1A 2B1UA 1DJHA 2OTGC 1LINA 4ORCB 3TS5B 2BKIB 1ALVA 4BY4A 1NCYA 1YUUA 3NSOA 3FS7A 1F4QA 1W7IB 1YR5A 1KK8B 3C1VA 1AJ4A 4ORBB 2FJUB 2JC2A 1MR8A 1BR4B 5F6TA 2Y1NA 1CMFA 1DJGA 2LLSA 1NUBA 1RWYA 1DJYA 1NYAA 1BJFA 1PULA 4MRYA 4F0ZB 2M97A 3CTNA 1K9UA 1ODBA 1Y0VH 2HQWA 2GGMA 1V1GA 1QVIZ 2COLB 1GGZA 4JPZB 4MZLA 2KGRA 1F54A 4ICBA 1CLMA 1L7ZA 2BCBA 3FWBA 3CR5X 3JVTB 2ZKMX 2KI4B 2IS9A 1CDPA 3H4SE 3PALA 4GAOA 2L4HA 1EJ3A 1KSOA 2ZRSA 1CFDA 1SY9A 1AP4A 2LHIA 2PVBA 3DVKA 4MLWA 1YRUB 1TCFA 4PE0A 5CSIA 1A29A 2JTZA 2K7BA 4C0KA 2LMTA 4DCKA 4ZCVA 2LVIA 2BL0C 4GNKB 4MRXA 1G4YR 4YGDB 3SG2A 4AOMA 3PATA 4OR9B 1QASA 1R6PA 2K2FA 1K90D 2LV7A 4YI9A 1Q80A 1XFWO 1NX2A 1C07A 1NPQA 1ZMZA 5DKQA 1NIWA 2ZN8A 1B7TY 1SK6D 4FQOA 4WQ3A 1YURA 2NXQA 2BCXA 4UPGA 1NCXA 4YGAA 1JFJA 2L0PA 2JOJA 4L9MA 3NXAA 1WDCC 1KQMB 1KWOB 2O5GA 4I5NB 3PSRA 1HT9A 1BG1A 1JSAA 1CDMA 1UUSA 3DVEA 1IWQA 1K94A 1KFUS 2KDHA 3NSLA 1Y1AA 1HQVA 1V1FA 4JWQA 4OKHA 4A4CA 2K7DA 1A75A 2CT9A 1J7QA 2M1KB 4OV2A 1XFZO 3JTDB 5AANA 1NSHA 2I18A 2LMVA 4PDZA 1BF5A 1CB1A 1A75B 1SCMB 3BYAA 1K8UA 2HETA 3VROA 3VRPA 2EGDA 3I5GC 1NX0A 2M7LA 3WHUB 4ETOA 5K89A 1ZACA 4I5LB 1CFCA 2K7OA 2MJWB 2TN4A 1NWDA 1SMGA 4YBHB 2P6BB 2KI6C 1X02A 1N0YA 3D0YA 3BUWB 3I5HC 2WCBA 2LP2A 2KBIA 2KYFA 2K8MB 2LANA 3HX4A 3TDZA 4C0LA 1OMRA 2JXLA 1EH2A 1QATA 1UURA 4CPVA 3D0YB 2KAVA 4N5XA 2M9GA 3LK0A 1B47A 1TRFA 1S36A 2ZFDA 3WXAA 2F2PA 3EVRA 1AK8A 2KAYA 4M2OA 1B8RA 3PN7C 1QJTA 3I5IB 1DT7B 2NCOA 1DGUA 3GK1A 4USLA 4HSZA 1BT6A 1ZUZA 4PHNA 2EHBA 1TTXA 1M63B 1C7WA 1WRKA 1BOCA 1NP8A 4XJKA 4GGFC 1JC2A 2L51A 5ER4X 3A4UB 3VRQA 2SASA 1IJ6A 3D10A 2LMUA 4I5KA 1H8BA 1QV1A 1UHHA 2M0RA 1F70A 2MA2A 4PE1A 4XJKB 2KQ6A 1MWNA 2F33A 2Y1MA 1SL7A 1YTZC 3FWCA 5AERA 3CWGA 1MXEA 3OB1B 4PHKA 2OPOA 1F4OA 3SG6A 1H4BA 2E30A 3CGAA 3OHMB 1S6JA 1AJ5A 2LCPA 3PM8A 3EK8A 2KSPA 3E3RA 2EC6B 2F8PA 2MBXA 2MLFC 2ZNEA 1IQ3A 1E8AA 1DJWA 2AMIA 2CBLA 2JTTA 2NCPA 2MAZA 2NLNA 1IH0A 4ORAB 4GBAA 3BUOB 1EG4A 1XFUO 5HYDA 1FPWA 4MN0A 4FTGA 1DVIA 2LNKA 4MBEA 3QRXA 5J3XA 1QIWA 4GPLB 4QJ5B 2L50A 3LL8B 2WCFA 2WNDA 3AAKA 2LHLA 1CFPA 2MLEC 5CSNA 4AQJA 1OE9B 1TN4A 2NZ0A 3BUMB 1CFFA 2I7AA 1YVHA 2JRFA 2Q4UA 1G33A 1SL8A 1VRKA 4N1GA 1FI6A 4IL1A 4MEWA 5HKYA 1XA5A 1XK4A 2PALA 2OS8C 3O4YA 2G9BA 1FBVA 1IG5A 1PVBA 3CLNA 2WCEA 1SNLA 2JT0A 2JPTA 3EK4A 2L98A 1IQ5A 1OZSA 1XFYO 1DJXA 2KBMA 5BPJA 2F3YA 5DKNA 1CTRA 2K0JA 2JNFA 5HLVA 1EXRA 2CTNA 1N2DA 4P2YB 2KFHA 4NDBA 2PSRA 3TUYC 2K2AA 1L2OC 2QPTA 1PSRA 3I5FB 1K93D 2JQ6A 4DIRA 1RROA 3AAJA 1GGWA 5HKZA 1IKUA 1U5IA 2BE4A 3BOWA 3KPXA 5PALA 1XYDA 1F71A 3TS5C 2M7NA 1TNWA 3BUNB 4GUKA 2FCEA 2AAOA 5HKWA 2M29A 1DGVA 1SR6B 1TIZA 1WLZA 4D1EA 1YX8A 1F8HA 1KK8C 4P5OE 1U5IB 3BOWB 3BXKA 1J1DA 2PRUA 4A4BA 1FF1A 4CLNA 3A8RA 1QV0A 1OSAA 3DVMA 1MUXA 4OVNF 1WRLA 5AXIA 2BBNA 1XFXO 5CSFA 1BLQA 5I2OA 1S5GY 2BE6A 2L4IA 2WOSA 2K61A 4CFRA 3SIBA 2GV5A 1UHNA 4R1EA 1TNQA 1QX7A 2JZIA 3VRRA 4WRIA 3GK2A 1ZFSA 3RLZA 4CFQA 3JVTC 1UP5A 5I8NA 2KI4C 2F2OA 1JF2A 2OTGB 3O6BA 4NDDA 1C7VA 2LVVA 1OMVA 3K21A 1SBJA 3NSIA 4U8DA 4YI8A 1UHIA 2K7CA 2R2IA 1PALA 3BUXB 2M1UA 1PK0D 1KK7Z 2M49B 1LXFC 2FOTA 4HREE 2HPSA 1R2UA 3NSKA 1WLMA 1NCZA 2LUCA 1Y1UA 1ALWA 2Y5IA 1QX2A 1S5GZ 2KYCA 1N65A 2CXJA 2KFFA 2KOTA 1S1EA 5AFPA 3CR2A 2LVKA 3PFVA 3CZTX 3AKBA 1TNPA 1FI5A 5IBWA 2KNEA 2O60A 1CNPA 3EVUA 3EVVA 3WNXB 2H61C 5TNCA 1LKJA 4YGEB 1EG3A 2GGZA 2KI6D 1A4PA 1DJIA 1QLKA 1YVLA 3OX6A 2L2EA 1M31A 3OX5A 2VRGA 1OQPA 5CPVA 2BL0B 4PHMA 3TDIA 1QLSA 2PMYA 3JTDC 1JUOA 2JU0A 3SG3A 3IQQA 4YGCB 2JT8A 3BQ3A 3ZWHA 4CIDA 2DOQA 3MSEB 1CKKA 2LC5A 3DVJA 1SCMC 1JBAA 1JWDA 1XVJA 2BCAA 1K2HA 1K9PA 4E68A 2BBMA 1DTLA 1QXPA 2ZRTA 1WY9A 1LA0A 5JOLA 1PSBA 3CS1A 3LCPC 4PE4A 1BU3A 1Y6WA 2I2RE 2LM5A 2V53A 2BKHB 4DUQA 1WDCB 1CMGA 1GJYA 1KSMA 2JWWA 3O2PA 3FIAA 2LP3A 3SG7A 2M8UA 1OZOA 1YRTB 4PALA 4N1FA 4ZCUA 3OP0A 1CLBA 1S6CA 1SW8A 1CM4A 1QS7A 3DF0A 4M2QA 4MVFA 4JQ0D 1BODA 1W7JB 2QACA 3VRNA 1TNXA 1RTP1 3GOFA 1A2XA 2WORA 4OCIA 3GK4X 1UHJA 1M46A 1K9KA 2SCPA 3DF0B 3HCMA 1RECA 3ICBA 1B8LA 3I5IC 1JFKA 3TDUA 1XO5A 1YUSA 4NDCA 3I5GB 1J7RA 3LK1A 4PCWA 1G8IA 1B8CA 4BY5A 3WHTB 1B9AA 5GQQC 2Q91A 4C0JA 2HQ8A 1SCVA 1K95A 1UHKA 3I5HB 1B1GA 4MZKA 2A4JA 5DKRA 1J7OA 2CCMA 2LLUA 1DMOA 1SL9A 2JNXA 3AKAA 1DJZA 1KFXL 1SRAA 1RFJA 4GFTA 1F55A 3KO0A 1BMOA 1J55A 4QJ3B 1D1OA 3EK7A 2EC6C 1QTXA 3O78A 4GGFA 5AEQA 1QIVA 3SIAA 3PN7B 4DS7A 1S6IA 1MF8B 1KK7Y 2H61A 3F45A 3KF9A 1SKTA 1UWOA 3KHEA 5D69A 1GQMA 1M45A 1MQ1A 1IRJA 5KSZA 5KTYA 1SPYA 1AHRA 1JF0A 1LA3A 4I5JA 2FCDA 1AVSA 1OOJA 5FYXA 2CNPA 5KU1A 2WC8A 2AUCA 3M0WA 1PRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S26 D;  2ZND A;  4YGB B;  1RK9 A;  1YUT A;  1TCO B;  1S3P A;  4PHJ A;  1LVC D;  4MZJ A;  5I2Q A;  3ZNI A;  1AUI B;  5I2L A;  1PVA A;  1BR1 B;  3IF7 A;  4QJ4 B;  2RGI A;  4NQG A;  2BEC A;  3SJS A;  1RJV A;  1CDL A;  1YX7 A;  1MHO A;  2Y4Q A;  5B8I B;  1B7T Z;  2L5X B;  2LLT A;  2D8N A;  2ISD A;  4HRH A;  1NX1 A;  2JXC A;  4TNC A;  1CDN A;  1XK4 C;  2PAS A;  4GGN A;  5HLO A;  2M3W A;  2LAP A;  2ZN9 A;  3VGO A;  1DF0 A;  4DRW A;  1J7P A;  1WRZ A;  2KHN A;  5CSJ A;  1CM1 A;  4YRU A;  3LLE A;  4Q04 A;  3SG4 A;  1QX5 B;  1M39 A;  3CR4 X;  1IGV A;  5G08 A;  4MSP A;  1DF0 B;  2HF5 A;  2MRD A;  3I5F C;  4WQ2 A;  1KQM C;  1KWO C;  2LVJ A;  1TOP A;  3KEV A;  1KCY A;  1CLL A;  2LUX A;  3EKJ A;  1FW4 A;  2KQY A;  3IQO A;  3PLF B;  3OB2 B;  1K96 A;  1J1E A;  2I94 A;  1ZOT B;  2OS8 B;  1NX3 A;  1SR6 C;  1IJ5 A;  2JUL A;  1KFX S;  1EL4 A;  2H2K A;  2JT3 A;  1KQV A;  3RM1 A;  1MXL C;  5JJG A;  5D7F A;  1Y1X A;  4HRG A;  4XYN A;  1XFV O;  1SYM A;  2LE9 B;  2KGB C;  2F3Z A;  2E6W A;  2KAX A;  3EKH A;  5ER5 A;  2KFG A;  2MHH A;  3SG5 A;  4PE7 A;  1A03 A;  1QVI Y;  3TUY B;  3DD4 A;  1L2O B;  4M2P A;  1B4C A;  2G2B A;  1KFU L;  1OMD A;  4AQI A;  3TZ1 A;  2B1U A;  1DJH A;  2OTG C;  1LIN A;  4ORC B;  3TS5 B;  2BKI B;  1ALV A;  4BY4 A;  1NCY A;  1YUU A;  3NSO A;  3FS7 A;  1F4Q A;  1W7I B;  1YR5 A;  1KK8 B;  3C1V A;  1AJ4 A;  4ORB B;  2FJU B;  2JC2 A;  1MR8 A;  1BR4 B;  5F6T A;  2Y1N A;  1CMF A;  1DJG A;  2LLS A;  1NUB A;  1RWY A;  1DJY A;  1NYA A;  1BJF A;  1PUL A;  4MRY A;  4F0Z B;  2M97 A;  3CTN A;  1K9U A;  1ODB A;  1Y0V H;  2HQW A;  2GGM A;  1V1G A;  1QVI Z;  2COL B;  1GGZ A;  4JPZ B;  4MZL A;  2KGR A;  1F54 A;  4ICB A;  1CLM A;  1L7Z A;  2BCB A;  3FWB A;  3CR5 X;  3JVT B;  2ZKM X;  2KI4 B;  2IS9 A;  1CDP A;  3H4S E;  3PAL A;  4GAO A;  2L4H A;  1EJ3 A;  1KSO A;  2ZRS A;  1CFD A;  1SY9 A;  1AP4 A;  2LHI A;  2PVB A;  3DVK A;  4MLW A;  1YRU B;  1TCF A;  4PE0 A;  5CSI A;  1A29 A;  2JTZ A;  2K7B A;  4C0K A;  2LMT A;  4DCK A;  4ZCV A;  2LVI A;  2BL0 C;  4GNK B;  4MRX A;  1G4Y R;  4YGD B;  3SG2 A;  4AOM A;  3PAT A;  4OR9 B;  1QAS A;  1R6P A;  2K2F A;  1K90 D;  2LV7 A;  4YI9 A;  1Q80 A;  1XFW O;  1NX2 A;  1C07 A;  1NPQ A;  1ZMZ A;  5DKQ A;  1NIW A;  2ZN8 A;  1B7T Y;  1SK6 D;  4FQO A;  4WQ3 A;  1YUR A;  2NXQ A;  2BCX A;  4UPG A;  1NCX A;  4YGA A;  1JFJ A;  2L0P A;  2JOJ A;  4L9M A;  3NXA A;  1WDC C;  1KQM B;  1KWO B;  2O5G A;  4I5N B;  3PSR A;  1HT9 A;  1BG1 A;  1JSA A;  1CDM A;  1UUS A;  3DVE A;  1IWQ A;  1K94 A;  1KFU S;  2KDH A;  3NSL A;  1Y1A A;  1HQV A;  1V1F A;  4JWQ A;  4OKH A;  4A4C A;  2K7D A;  1A75 A;  2CT9 A;  1J7Q A;  2M1K B;  4OV2 A;  1XFZ O;  3JTD B;  5AAN A;  1NSH A;  2I18 A;  2LMV A;  4PDZ A;  1BF5 A;  1CB1 A;  1A75 B;  1SCM B;  3BYA A;  1K8U A;  2HET A;  3VRO A;  3VRP A;  2EGD A;  3I5G C;  1NX0 A;  2M7L A;  3WHU B;  4ETO A;  5K89 A;  1ZAC A;  4I5L B;  1CFC A;  2K7O A;  2MJW B;  2TN4 A;  1NWD A;  1SMG A;  4YBH B;  2P6B B;  2KI6 C;  1X02 A;  1N0Y A;  3D0Y A;  3BUW B;  3I5H C;  2WCB A;  2LP2 A;  2KBI A;  2KYF A;  2K8M B;  2LAN A;  3HX4 A;  3TDZ A;  4C0L A;  1OMR A;  2JXL A;  1EH2 A;  1QAT A;  1UUR A;  4CPV A;  3D0Y B;  2KAV A;  4N5X A;  2M9G A;  3LK0 A;  1B47 A;  1TRF A;  1S36 A;  2ZFD A;  3WXA A;  2F2P A;  3EVR A;  1AK8 A;  2KAY A;  4M2O A;  1B8R A;  3PN7 C;  1QJT A;  3I5I B;  1DT7 B;  2NCO A;  1DGU A;  3GK1 A;  4USL A;  4HSZ A;  1BT6 A;  1ZUZ A;  4PHN A;  2EHB A;  1TTX A;  1M63 B;  1C7W A;  1WRK A;  1BOC A;  1NP8 A;  4XJK A;  4GGF C;  1JC2 A;  2L51 A;  5ER4 X;  3A4U B;  3VRQ A;  2SAS A;  1IJ6 A;  3D10 A;  2LMU A;  4I5K A;  1H8B A;  1QV1 A;  1UHH A;  2M0R A;  1F70 A;  2MA2 A;  4PE1 A;  4XJK B;  2KQ6 A;  1MWN A;  2F33 A;  2Y1M A;  1SL7 A;  1YTZ C;  3FWC A;  5AER A;  3CWG A;  1MXE A;  3OB1 B;  4PHK A;  2OPO A;  1F4O A;  3SG6 A;  1H4B A;  2E30 A;  3CGA A;  3OHM B;  1S6J A;  1AJ5 A;  2LCP A;  3PM8 A;  3EK8 A;  2KSP A;  3E3R A;  2EC6 B;  2F8P A;  2MBX A;  2MLF C;  2ZNE A;  1IQ3 A;  1E8A A;  1DJW A;  2AMI A;  2CBL A;  2JTT A;  2NCP A;  2MAZ A;  2NLN A;  1IH0 A;  4ORA B;  4GBA A;  3BUO B;  1EG4 A;  1XFU O;  5HYD A;  1FPW A;  4MN0 A;  4FTG A;  1DVI A;  2LNK A;  4MBE A;  3QRX A;  5J3X A;  1QIW A;  4GPL B;  4QJ5 B;  2L50 A;  3LL8 B;  2WCF A;  2WND A;  3AAK A;  2LHL A;  1CFP A;  2MLE C;  5CSN A;  4AQJ A;  1OE9 B;  1TN4 A;  2NZ0 A;  3BUM B;  1CFF A;  2I7A A;  1YVH A;  2JRF A;  2Q4U A;  1G33 A;  1SL8 A;  1VRK A;  4N1G A;  1FI6 A;  4IL1 A;  4MEW A;  5HKY A;  1XA5 A;  1XK4 A;  2PAL A;  2OS8 C;  3O4Y A;  2G9B A;  1FBV A;  1IG5 A;  1PVB A;  3CLN A;  2WCE A;  1SNL A;  2JT0 A;  2JPT A;  3EK4 A;  2L98 A;  1IQ5 A;  1OZS A;  1XFY O;  1DJX A;  2KBM A;  5BPJ A;  2F3Y A;  5DKN A;  1CTR A;  2K0J A;  2JNF A;  5HLV A;  1EXR A;  2CTN A;  1N2D A;  4P2Y B;  2KFH A;  4NDB A;  2PSR A;  3TUY C;  2K2A A;  1L2O C;  2QPT A;  1PSR A;  3I5F B;  1K93 D;  2JQ6 A;  4DIR A;  1RRO A;  3AAJ A;  1GGW A;  5HKZ A;  1IKU A;  1U5I A;  2BE4 A;  3BOW A;  3KPX A;  5PAL A;  1XYD A;  1F71 A;  3TS5 C;  2M7N A;  1TNW A;  3BUN B;  4GUK A;  2FCE A;  2AAO A;  5HKW A;  2M29 A;  1DGV A;  1SR6 B;  1TIZ A;  1WLZ A;  4D1E A;  1YX8 A;  1F8H A;  1KK8 C;  4P5O E;  1U5I B;  3BOW B;  3BXK A;  1J1D A;  2PRU A;  4A4B A;  1FF1 A;  4CLN A;  3A8R A;  1QV0 A;  1OSA A;  3DVM A;  1MUX A;  4OVN F;  1WRL A;  5AXI A;  2BBN A;  1XFX O;  5CSF A;  1BLQ A;  5I2O A;  1S5G Y;  2BE6 A;  2L4I A;  2WOS A;  2K61 A;  4CFR A;  3SIB A;  2GV5 A;  1UHN A;  4R1E A;  1TNQ A;  1QX7 A;  2JZI A;  3VRR A;  4WRI A;  3GK2 A;  1ZFS A;  3RLZ A;  4CFQ A;  3JVT C;  1UP5 A;  5I8N A;  2KI4 C;  2F2O A;  1JF2 A;  2OTG B;  3O6B A;  4NDD A;  1C7V A;  2LVV A;  1OMV A;  3K21 A;  1SBJ A;  3NSI A;  4U8D A;  4YI8 A;  1UHI A;  2K7C A;  2R2I A;  1PAL A;  3BUX B;  2M1U A;  1PK0 D;  1KK7 Z;  2M49 B;  1LXF C;  2FOT A;  4HRE E;  2HPS A;  1R2U A;  3NSK A;  1WLM A;  1NCZ A;  2LUC A;  1Y1U A;  1ALW A;  2Y5I A;  1QX2 A;  1S5G Z;  2KYC A;  1N65 A;  2CXJ A;  2KFF A;  2KOT A;  1S1E A;  5AFP A;  3CR2 A;  2LVK A;  3PFV A;  3CZT X;  3AKB A;  1TNP A;  1FI5 A;  5IBW A;  2KNE A;  2O60 A;  1CNP A;  3EVU A;  3EVV A;  3WNX B;  2H61 C;  5TNC A;  1LKJ A;  4YGE B;  1EG3 A;  2GGZ A;  2KI6 D;  1A4P A;  1DJI A;  1QLK A;  1YVL A;  3OX6 A;  2L2E A;  1M31 A;  3OX5 A;  2VRG A;  1OQP A;  5CPV A;  2BL0 B;  4PHM A;  3TDI A;  1QLS A;  2PMY A;  3JTD C;  1JUO A;  2JU0 A;  3SG3 A;  3IQQ A;  4YGC B;  2JT8 A;  3BQ3 A;  3ZWH A;  4CID A;  2DOQ A;  3MSE B;  1CKK A;  2LC5 A;  3DVJ A;  1SCM C;  1JBA A;  1JWD A;  1XVJ A;  2BCA A;  1K2H A;  1K9P A;  4E68 A;  2BBM A;  1DTL A;  1QXP A;  2ZRT A;  1WY9 A;  1LA0 A;  5JOL A;  1PSB A;  3CS1 A;  3LCP C;  4PE4 A;  1BU3 A;  1Y6W A;  2I2R E;  2LM5 A;  2V53 A;  2BKH B;  4DUQ A;  1WDC B;  1CMG A;  1GJY A;  1KSM A;  2JWW A;  3O2P A;  3FIA A;  2LP3 A;  3SG7 A;  2M8U A;  1OZO A;  1YRT B;  4PAL A;  4N1F A;  4ZCU A;  3OP0 A;  1CLB A;  1S6C A;  1SW8 A;  1CM4 A;  1QS7 A;  3DF0 A;  4M2Q A;  4MVF A;  4JQ0 D;  1BOD A;  1W7J B;  2QAC A;  3VRN A;  1TNX A;  1RTP 1;  3GOF A;  1A2X A;  2WOR A;  4OCI A;  3GK4 X;  1UHJ A;  1M46 A;  1K9K A;  2SCP A;  3DF0 B;  3HCM A;  1REC A;  3ICB A;  1B8L A;  3I5I C;  1JFK A;  3TDU A;  1XO5 A;  1YUS A;  4NDC A;  3I5G B;  1J7R A;  3LK1 A;  4PCW A;  1G8I A;  1B8C A;  4BY5 A;  3WHT B;  1B9A A;  5GQQ C;  2Q91 A;  4C0J A;  2HQ8 A;  1SCV A;  1K95 A;  1UHK A;  3I5H B;  1B1G A;  4MZK A;  2A4J A;  5DKR A;  1J7O A;  2CCM A;  2LLU A;  1DMO A;  1SL9 A;  2JNX A;  3AKA A;  1DJZ A;  1KFX L;  1SRA A;  1RFJ A;  4GFT A;  1F55 A;  3KO0 A;  1BMO A;  1J55 A;  4QJ3 B;  1D1O A;  3EK7 A;  2EC6 C;  1QTX A;  3O78 A;  4GGF A;  5AEQ A;  1QIV A;  3SIA A;  3PN7 B;  4DS7 A;  1S6I A;  1MF8 B;  1KK7 Y;  2H61 A;  3F45 A;  3KF9 A;  1SKT A;  1UWO A;  3KHE A;  5D69 A;  1GQM A;  1M45 A;  1MQ1 A;  1IRJ A;  5KSZ A;  5KTY A;  1SPY A;  1AHR A;  1JF0 A;  1LA3 A;  4I5J A;  2FCD A;  1AVS A;  1OOJ A;  5FYX A;  2CNP A;  5KU1 A;  2WC8 A;  2AUC A;  3M0W A;  1PRW A; 
#chains in the Genus database with same CATH topology
 1S26 D;  2ZND A;  3BFH A;  4YGB B;  1RK9 A;  1YUT A;  1TCO B;  2PQL A;  1S3P A;  4PHJ A;  3D78 A;  1LVC D;  4MZJ A;  5I2Q A;  3ZNI A;  1AUI B;  5I2L A;  1PVA A;  1BR1 B;  2QEH A;  3IF7 A;  2RGI A;  4NQG A;  4QJ4 B;  2BEC A;  3SJS A;  1RJV A;  1CDL A;  1YX7 A;  1MHO A;  2Y4Q A;  5B8I B;  1B7T Z;  2L5X B;  2LLT A;  2D8N A;  2ISD A;  4HRH A;  1NX1 A;  2JXC A;  1OW4 A;  4TNC A;  1XK4 C;  1CDN A;  2PAS A;  4GGN A;  5HLO A;  2M3W A;  2LAP A;  2ZN9 A;  3VGO A;  1DF0 A;  4DRW A;  1W9Z A;  1J7P A;  1WRZ A;  2KHN A;  3O4X A;  5CSJ A;  1CM1 A;  4YRU A;  3LLE A;  4Q04 A;  3SG4 A;  1QX5 B;  2L2C A;  1M39 A;  3CR4 X;  1IGV A;  5G08 A;  4MSP A;  2P70 A;  1DF0 B;  2HF5 A;  2MRD A;  3I5F C;  3DZT A;  2YGU A;  1KQM C;  1KWO C;  2LVJ A;  4WQ2 A;  2JPO A;  1SSE B;  1TOP A;  3KEV A;  1KCY A;  1CLL A;  2LUX A;  3EKJ A;  1FW4 A;  2KQY A;  3IQO A;  3PLF B;  3OB2 B;  1K96 A;  3D76 A;  1J1E A;  2I94 A;  1ZOT B;  2OS8 B;  1NX3 A;  1SR6 C;  1IJ5 A;  2JUL A;  1KFX S;  1EL4 A;  2H2K A;  2JT3 A;  1KQV A;  3RM1 A;  1MXL C;  5JJG A;  5D7F A;  1OOF A;  1Y1X A;  4HRG A;  4XYN A;  1XFV O;  1SYM A;  2LE9 B;  2KGB C;  2F3Z A;  2E6W A;  2KAX A;  3EKH A;  3FE9 A;  2KFG A;  2MHH A;  5ER5 A;  3RZS A;  3SG5 A;  4PE7 A;  1A03 A;  1QVI Y;  3TUY B;  3DD4 A;  1L2O B;  4M2P A;  1B4C A;  2G2B A;  1KFU L;  3DXL A;  1OMD A;  4AQI A;  3TZ1 A;  2B1U A;  1DJH A;  2OTG C;  1LIN A;  4ORC B;  3TS5 B;  3NGV A;  2BKI B;  1ALV A;  3SS4 A;  1NCY A;  4BY4 A;  1YUU A;  3NSO A;  3FS7 A;  1F4Q A;  1W7I B;  1YR5 A;  1KK8 B;  3C1V A;  1AJ4 A;  4ORB B;  2FJU B;  2JC2 A;  1MR8 A;  1BR4 B;  5F6T A;  2Y1N A;  1CMF A;  1DJG A;  2LLS A;  1NUB A;  1RWY A;  2QEB A;  1OOH A;  1DJY A;  1NYA A;  1BJF A;  1PUL A;  3FE8 A;  4MRY A;  4F0Z B;  2M97 A;  3CTN A;  1K9U A;  5FI7 A;  4JKT A;  1ODB A;  1Y0V H;  2HQW A;  2GGM A;  1V1G A;  1QVI Z;  2COL B;  2WCK A;  1GGZ A;  4JPZ B;  4MZL A;  2KGR A;  1F54 A;  4ICB A;  1CLM A;  1L7Z A;  2BCB A;  3FWB A;  3CR5 X;  3S0B A;  3JVT B;  2ZKM X;  2KI4 B;  2IS9 A;  1CDP A;  3H4S E;  3PAL A;  4GAO A;  1C3Y A;  2L4H A;  1EJ3 A;  1KSO A;  2ZRS A;  1CFD A;  1SY9 A;  1AP4 A;  2LHI A;  2PVB A;  3DVK A;  4MLW A;  1YRU B;  3L4L A;  1TCF A;  4PE0 A;  5CSI A;  3VB1 A;  1A29 A;  2JTZ A;  2K7B A;  4C0K A;  2LMT A;  4DCK A;  4ZCV A;  2LVI A;  2BL0 C;  4GNK B;  4MRX A;  1G4Y R;  4YGD B;  3SG2 A;  4AOM A;  3PAT A;  4OR9 B;  3OGN A;  1QAS A;  1R6P A;  2K2F A;  1K90 D;  2LV7 A;  4YI9 A;  1GM0 A;  1Q80 A;  1XFW O;  1NX2 A;  1C07 A;  1NPQ A;  1ZMZ A;  5DKQ A;  1NIW A;  2ZN8 A;  1B7T Y;  1SK6 D;  4FQO A;  4WQ3 A;  1YUR A;  2NXQ A;  2BCX A;  4UPG A;  5HL1 A;  1NCX A;  4YGA A;  1JFJ A;  2L0P A;  2JOJ A;  4L9M A;  3NXA A;  1WDC C;  1KQM B;  1KWO B;  2O5G A;  4I5N B;  3PSR A;  1HT9 A;  1BG1 A;  1JSA A;  1CDM A;  3BFB A;  1UUS A;  3DVE A;  3OBV A;  1IWQ A;  1K94 A;  1KFU S;  2KDH A;  3NSL A;  1Y1A A;  1HQV A;  1V1F A;  4JWQ A;  4OKH A;  4A4C A;  2K7D A;  1Z4H A;  1A75 A;  2CT9 A;  3B88 A;  1J7Q A;  2M1K B;  4OV2 A;  3UO9 A;  1XFZ O;  3JTD B;  5AAN A;  1NSH A;  2I18 A;  2LMV A;  1QWV A;  3NHT A;  4PDZ A;  1BF5 A;  1CB1 A;  1A75 B;  1SCM B;  3BYA A;  1K8U A;  2HET A;  3VRO A;  3VRP A;  2EGD A;  3I5G C;  1NX0 A;  2M7L A;  2WC5 A;  3WHU B;  4ETO A;  3Q8I A;  5K89 A;  1ZAC A;  4I5L B;  1CFC A;  2K7O A;  2MJW B;  2TN4 A;  1NWD A;  1SMG A;  2QEO A;  2P6B B;  2KI6 C;  4YBH B;  1X02 A;  1N0Y A;  3D0Y A;  3BUW B;  3I5H C;  2WCB A;  2LP2 A;  2KBI A;  2KPH A;  2K8M B;  2KYF A;  2LAN A;  3HX4 A;  3TDZ A;  4C0L A;  1OMR A;  2JXL A;  1EH2 A;  1QAT A;  1UUR A;  4CPV A;  3D77 A;  3D0Y B;  2KAV A;  4N5X A;  2M9G A;  3LK0 A;  1B47 A;  2WCL A;  1TRF A;  1S36 A;  2ZFD A;  3WXA A;  2F2P A;  3EVR A;  1AK8 A;  2KAY A;  4M2O A;  1B8R A;  3L47 A;  3PN7 C;  1QJT A;  3I5I B;  1DT7 B;  2NCO A;  1DGU A;  3GK1 A;  4USL A;  4HSZ A;  1BT6 A;  1ZUZ A;  4PHN A;  2EHB A;  1TTX A;  1M63 B;  1C7W A;  1WRK A;  1BOC A;  1NP8 A;  4XJK A;  4GGF C;  1JC2 A;  2L51 A;  3EG5 B;  5ER4 X;  3A4U B;  3VRQ A;  2SAS A;  1IJ6 A;  3D10 A;  1XFR A;  2LMU A;  4I5K A;  3S0F A;  1H8B A;  1QV1 A;  1UHH A;  2M0R A;  1F70 A;  2MA2 A;  4PE1 A;  4XJK B;  2KQ6 A;  1MWN A;  2F33 A;  2Y1M A;  1SL7 A;  1YTZ C;  3FWC A;  5AER A;  3CWG A;  1MXE A;  3OB1 B;  4PHK A;  2WCM A;  2OPO A;  1F4O A;  4KYN A;  3SG6 A;  1H4B A;  2E30 A;  3CGA A;  3OHM B;  1S6J A;  1AJ5 A;  2LCP A;  3PM8 A;  3EK8 A;  2KSP A;  3E3R A;  2EC6 B;  2F8P A;  2MBX A;  2MLF C;  2ZNE A;  1IQ3 A;  1E8A A;  1DJW A;  2AMI A;  2CBL A;  2JTT A;  2NCP A;  2MAZ A;  2NLN A;  3R72 A;  3NHI A;  1IH0 A;  4ORA B;  4GBA A;  3BUO B;  1EG4 A;  1XFU O;  5HYD A;  1FPW A;  4MN0 A;  4FTG A;  1DVI A;  2LNK A;  2WCH A;  4MBE A;  3QRX A;  5J3X A;  1QIW A;  3IVT A;  4GPL B;  3V2L A;  4QJ5 B;  1IIO A;  2L50 A;  3LL8 B;  2WCF A;  2WND A;  3AAK A;  2LHL A;  3PJI A;  1CFP A;  2MLE C;  3CDN A;  5CSN A;  4AQJ A;  1LS8 A;  1OE9 B;  1TN4 A;  2NZ0 A;  3BUM B;  1CFF A;  2I7A A;  1YVH A;  2JRF A;  2Q4U A;  1G33 A;  1SL8 A;  1VRK A;  4N1G A;  1FI6 A;  4IL1 A;  1TUJ A;  4MEW A;  5HKY A;  1XA5 A;  1XK4 A;  2PAL A;  2OS8 C;  3O4Y A;  2G9B A;  1FBV A;  1IG5 A;  1PVB A;  3CLN A;  2WCE A;  1TWO A;  1SNL A;  2JT0 A;  2JPT A;  3EK4 A;  2L98 A;  1IQ5 A;  1OZS A;  1XFY O;  1DJX A;  2KBM A;  5BPJ A;  2F3Y A;  3B87 A;  5DKN A;  1CTR A;  2K0J A;  2JNF A;  5HLV A;  1EXR A;  2CTN A;  1N2D A;  4P2Y B;  2KFH A;  4NDB A;  2K60 A;  2PSR A;  3S0A A;  2K2A A;  1L2O C;  2QPT A;  3TUY C;  1PSR A;  3S0D A;  3R1V A;  3I5F B;  1DQE A;  1K93 D;  2JQ6 A;  2QDI A;  4DIR A;  1RRO A;  3AAJ A;  1GGW A;  5HKZ A;  1IKU A;  1U5I A;  2BE4 A;  3BOW A;  3KPX A;  2FJY A;  1XYD A;  5PAL A;  1F71 A;  3TS5 C;  2M7N A;  1TNW A;  3BUN B;  4GUK A;  2FCE A;  2AAO A;  5HKW A;  1ORG A;  2M29 A;  1DGV A;  1TUZ A;  3BJH A;  1SR6 B;  1TIZ A;  1WLZ A;  2WCJ A;  1YX8 A;  3D74 A;  4D1E A;  1KK8 C;  1F8H A;  4P5O E;  1U5I B;  3BOW B;  3BXK A;  1J1D A;  2PRU A;  4A4B A;  1FF1 A;  4CLN A;  3A8R A;  1QV0 A;  3N7H A;  4OZD A;  1OSA A;  2L5Y A;  1MUX A;  3DVM A;  4OVN F;  1WRL A;  5AXI A;  2BBN A;  1XFX O;  5CSF A;  1BLQ A;  5I2O A;  1S5G Y;  2BE6 A;  2L4I A;  1P28 A;  2WOS A;  2K61 A;  3S0E A;  4CFR A;  3SIB A;  2GV5 A;  4INW A;  1UHN A;  4R1E A;  1TNQ A;  1QX7 A;  2JZI A;  3VRR A;  4WRI A;  3GK2 A;  1ZFS A;  3RLZ A;  4CFQ A;  3JVT C;  1UP5 A;  5I8N A;  2KI4 C;  2F2O A;  1JF2 A;  2OTG B;  3O6B A;  4NDD A;  1C7V A;  4PT1 A;  2LVV A;  1OMV A;  3K21 A;  4F7F A;  1SBJ A;  3NSI A;  4U8D A;  4YI8 A;  1UHI A;  2K7C A;  2QEV A;  2R2I A;  5DIC A;  3D75 A;  1PAL A;  3BUX B;  3PM2 A;  2M1U A;  1PK0 D;  3BFA A;  1KK7 Z;  2M49 B;  1LXF C;  2FOT A;  4HRE E;  2HPS A;  1R2U A;  3NSK A;  1WLM A;  4FQT A;  1NCZ A;  3S0G A;  2LUC A;  2P71 A;  1OOG A;  1Y1U A;  1ALW A;  2Y5I A;  1QX2 A;  1DEL A;  1S5G Z;  2KYC A;  1N65 A;  2CXJ A;  2KFF A;  2KOT A;  1S1E A;  5AFP A;  3CR2 A;  2LVK A;  2PYQ A;  3SS5 A;  3PFV A;  3CZT X;  3AKB A;  1TNP A;  3FE6 A;  3CYZ A;  1FI5 A;  3CAB A;  5IBW A;  2KNE A;  2O60 A;  5D3O A;  1DC1 A;  1CNP A;  3EVU A;  3EVV A;  3WNX B;  2H61 C;  5TNC A;  1LKJ A;  4YGE B;  1EG3 A;  2GGZ A;  2KI6 D;  1A4P A;  1DJI A;  1QLK A;  1YVL A;  3B6X A;  3OX6 A;  2L2E A;  1M31 A;  3OX5 A;  1OOI X;  2VRG A;  1OQP A;  5CPV A;  2BL0 B;  4PHM A;  3TDI A;  1QLS A;  2PMY A;  3JTD C;  1JUO A;  2JU0 A;  3B86 A;  3SG3 A;  3IQQ A;  2GTE A;  4YGC B;  2JT8 A;  3BQ3 A;  3ZWH A;  4CID A;  2DOQ A;  3MSE B;  1CKK A;  2LC5 A;  3DVJ A;  1SCM C;  1JBA A;  1JWD A;  1XVJ A;  2BCA A;  5EL2 A;  1K2H A;  1K9P A;  4E68 A;  1Z2C B;  2BBM A;  1DTL A;  1QXP A;  2ZRT A;  1WY9 A;  1LA0 A;  5JOL A;  1PSB A;  3CS1 A;  3LCP C;  4PE4 A;  1BU3 A;  1Y6W A;  2I2R E;  2LM5 A;  2V53 A;  2BKH B;  4INX A;  1WDC B;  4DUQ A;  1CMG A;  1GJY A;  1KSM A;  1T14 A;  2JWW A;  3O2P A;  3FIA A;  2LP3 A;  3R1O A;  3SG7 A;  2M8U A;  1OZO A;  1YRT B;  4PAL A;  4N1F A;  4ZCU A;  5FI6 A;  3OP0 A;  1CLB A;  1S6C A;  1DEK A;  1SW8 A;  1CM4 A;  1QS7 A;  3DF0 A;  4M2Q A;  4MVF A;  3CZ1 A;  4JQ0 D;  1BOD A;  1W7J B;  5I94 A;  2QAC A;  3VRN A;  1TNX A;  1RTP 1;  3GOF A;  1A2X A;  2BAP A;  2WOR A;  4OCI A;  3GK4 X;  1UHJ A;  1M46 A;  1K9K A;  2SCP A;  3DF0 B;  3HCM A;  1REC A;  3ICB A;  1B8L A;  1C3Z A;  3I5I C;  1JFK A;  3TDU A;  2KLE A;  1XO5 A;  1YUS A;  3QME A;  4NDC A;  3I5G B;  1J7R A;  3LK1 A;  3DYE A;  4PCW A;  1G8I A;  1B8C A;  4BY5 A;  3WHT B;  1B9A A;  5GQQ C;  2Q91 A;  4C0J A;  2HQ8 A;  1SCV A;  3R1P A;  1K95 A;  3B7A A;  2KLD A;  3K1E A;  1UHK A;  3I5H B;  1B1G A;  4MZK A;  2ERB A;  2A4J A;  5DKR A;  2BNX A;  1J7O A;  2CCM A;  2LLU A;  1DMO A;  1SL9 A;  3DY9 A;  2JNX A;  3AKA A;  1DJZ A;  1KFX L;  1SRA A;  1RFJ A;  4GFT A;  5FI2 A;  1F55 A;  3KO0 A;  1BMO A;  1J55 A;  3L4A A;  4IJ7 A;  4QJ3 B;  1D1O A;  3EK7 A;  3CZ0 A;  2EC6 C;  1QTX A;  3O78 A;  4GGF A;  5AEQ A;  1QIV A;  3SIA A;  3PN7 B;  4DS7 A;  3UNW A;  1S6I A;  1MF8 B;  3D73 A;  1KK7 Y;  2H61 A;  3F45 A;  3KF9 A;  1SKT A;  1UWO A;  3KHE A;  2WC6 A;  5D69 A;  1GQM A;  1M45 A;  1MQ1 A;  1IRJ A;  5KSZ A;  5KTY A;  1SPY A;  3SS3 A;  3CZ2 A;  2H8V A;  1AHR A;  1JF0 A;  1LA3 A;  4I5J A;  2FCD A;  1AVS A;  4JD9 A;  1OOJ A;  5FYX A;  2CNP A;  5KU1 A;  2WC8 A;  2AUC A;  3M0W A;  1PRW A; 
#chains in the Genus database with same CATH homology
 1S26 D;  2ZND A;  4YGB B;  1RK9 A;  1YUT A;  1TCO B;  1S3P A;  4PHJ A;  1LVC D;  4MZJ A;  5I2Q A;  3ZNI A;  1AUI B;  5I2L A;  1PVA A;  1BR1 B;  3IF7 A;  4QJ4 B;  2RGI A;  4NQG A;  2BEC A;  3SJS A;  1RJV A;  1CDL A;  1YX7 A;  1MHO A;  2Y4Q A;  5B8I B;  1B7T Z;  2L5X B;  2LLT A;  2D8N A;  2ISD A;  4HRH A;  1NX1 A;  2JXC A;  4TNC A;  1CDN A;  1XK4 C;  2PAS A;  4GGN A;  5HLO A;  2M3W A;  2LAP A;  2ZN9 A;  3VGO A;  1DF0 A;  4DRW A;  1J7P A;  1WRZ A;  2KHN A;  5CSJ A;  1CM1 A;  4YRU A;  3LLE A;  4Q04 A;  3SG4 A;  1QX5 B;  1M39 A;  3CR4 X;  1IGV A;  5G08 A;  4MSP A;  1DF0 B;  2HF5 A;  2MRD A;  3I5F C;  4WQ2 A;  1KQM C;  1KWO C;  2LVJ A;  1TOP A;  3KEV A;  1KCY A;  1CLL A;  2LUX A;  3EKJ A;  1FW4 A;  2KQY A;  3IQO A;  3PLF B;  3OB2 B;  1K96 A;  1J1E A;  2I94 A;  1ZOT B;  2OS8 B;  1NX3 A;  1SR6 C;  1IJ5 A;  2JUL A;  1KFX S;  1EL4 A;  2H2K A;  2JT3 A;  1KQV A;  3RM1 A;  1MXL C;  5JJG A;  5D7F A;  1Y1X A;  4HRG A;  4XYN A;  1XFV O;  1SYM A;  2LE9 B;  2KGB C;  2F3Z A;  2E6W A;  2KAX A;  3EKH A;  5ER5 A;  2KFG A;  2MHH A;  3SG5 A;  4PE7 A;  1A03 A;  1QVI Y;  3TUY B;  3DD4 A;  1L2O B;  4M2P A;  1B4C A;  2G2B A;  1KFU L;  1OMD A;  4AQI A;  3TZ1 A;  2B1U A;  1DJH A;  2OTG C;  1LIN A;  4ORC B;  3TS5 B;  2BKI B;  1ALV A;  4BY4 A;  1NCY A;  1YUU A;  3NSO A;  3FS7 A;  1F4Q A;  1W7I B;  1YR5 A;  1KK8 B;  3C1V A;  1AJ4 A;  4ORB B;  2FJU B;  2JC2 A;  1MR8 A;  1BR4 B;  5F6T A;  2Y1N A;  1CMF A;  1DJG A;  2LLS A;  1NUB A;  1RWY A;  1DJY A;  1NYA A;  1BJF A;  1PUL A;  4MRY A;  4F0Z B;  2M97 A;  3CTN A;  1K9U A;  1ODB A;  1Y0V H;  2HQW A;  2GGM A;  1V1G A;  1QVI Z;  2COL B;  1GGZ A;  4JPZ B;  4MZL A;  2KGR A;  1F54 A;  4ICB A;  1CLM A;  1L7Z A;  2BCB A;  3FWB A;  3CR5 X;  3JVT B;  2ZKM X;  2KI4 B;  2IS9 A;  1CDP A;  3H4S E;  3PAL A;  4GAO A;  2L4H A;  1EJ3 A;  1KSO A;  2ZRS A;  1CFD A;  1SY9 A;  1AP4 A;  2LHI A;  2PVB A;  3DVK A;  4MLW A;  1YRU B;  1TCF A;  4PE0 A;  5CSI A;  1A29 A;  2JTZ A;  2K7B A;  4C0K A;  2LMT A;  4DCK A;  4ZCV A;  2LVI A;  2BL0 C;  4GNK B;  4MRX A;  1G4Y R;  4YGD B;  3SG2 A;  4AOM A;  3PAT A;  4OR9 B;  1QAS A;  1R6P A;  2K2F A;  1K90 D;  2LV7 A;  4YI9 A;  1Q80 A;  1XFW O;  1NX2 A;  1C07 A;  1NPQ A;  1ZMZ A;  5DKQ A;  1NIW A;  2ZN8 A;  1B7T Y;  1SK6 D;  4FQO A;  4WQ3 A;  1YUR A;  2NXQ A;  2BCX A;  4UPG A;  1NCX A;  4YGA A;  1JFJ A;  2L0P A;  2JOJ A;  4L9M A;  3NXA A;  1WDC C;  1KQM B;  1KWO B;  2O5G A;  4I5N B;  3PSR A;  1HT9 A;  1BG1 A;  1JSA A;  1CDM A;  1UUS A;  3DVE A;  1IWQ A;  1K94 A;  1KFU S;  2KDH A;  3NSL A;  1Y1A A;  1HQV A;  1V1F A;  4JWQ A;  4OKH A;  4A4C A;  2K7D A;  1A75 A;  2CT9 A;  1J7Q A;  2M1K B;  4OV2 A;  1XFZ O;  3JTD B;  5AAN A;  1NSH A;  2I18 A;  2LMV A;  4PDZ A;  1BF5 A;  1CB1 A;  1A75 B;  1SCM B;  3BYA A;  1K8U A;  2HET A;  3VRO A;  3VRP A;  2EGD A;  3I5G C;  1NX0 A;  2M7L A;  3WHU B;  4ETO A;  5K89 A;  1ZAC A;  4I5L B;  1CFC A;  2K7O A;  2MJW B;  2TN4 A;  1NWD A;  1SMG A;  4YBH B;  2P6B B;  2KI6 C;  1X02 A;  1N0Y A;  3D0Y A;  3BUW B;  3I5H C;  2WCB A;  2LP2 A;  2KBI A;  2KYF A;  2K8M B;  2LAN A;  3HX4 A;  3TDZ A;  4C0L A;  1OMR A;  2JXL A;  1EH2 A;  1QAT A;  1UUR A;  4CPV A;  3D0Y B;  2KAV A;  4N5X A;  2M9G A;  3LK0 A;  1B47 A;  1TRF A;  1S36 A;  2ZFD A;  3WXA A;  2F2P A;  3EVR A;  1AK8 A;  2KAY A;  4M2O A;  1B8R A;  3PN7 C;  1QJT A;  3I5I B;  1DT7 B;  2NCO A;  1DGU A;  3GK1 A;  4USL A;  4HSZ A;  1BT6 A;  1ZUZ A;  4PHN A;  2EHB A;  1TTX A;  1M63 B;  1C7W A;  1WRK A;  1BOC A;  1NP8 A;  4XJK A;  4GGF C;  1JC2 A;  2L51 A;  5ER4 X;  3A4U B;  3VRQ A;  2SAS A;  1IJ6 A;  3D10 A;  2LMU A;  4I5K A;  1H8B A;  1QV1 A;  1UHH A;  2M0R A;  1F70 A;  2MA2 A;  4PE1 A;  4XJK B;  2KQ6 A;  1MWN A;  2F33 A;  2Y1M A;  1SL7 A;  1YTZ C;  3FWC A;  5AER A;  3CWG A;  1MXE A;  3OB1 B;  4PHK A;  2OPO A;  1F4O A;  3SG6 A;  1H4B A;  2E30 A;  3CGA A;  3OHM B;  1S6J A;  1AJ5 A;  2LCP A;  3PM8 A;  3EK8 A;  2KSP A;  3E3R A;  2EC6 B;  2F8P A;  2MBX A;  2MLF C;  2ZNE A;  1IQ3 A;  1E8A A;  1DJW A;  2AMI A;  2CBL A;  2JTT A;  2NCP A;  2MAZ A;  2NLN A;  1IH0 A;  4ORA B;  4GBA A;  3BUO B;  1EG4 A;  1XFU O;  5HYD A;  1FPW A;  4MN0 A;  4FTG A;  1DVI A;  2LNK A;  4MBE A;  3QRX A;  5J3X A;  1QIW A;  4GPL B;  4QJ5 B;  2L50 A;  3LL8 B;  2WCF A;  2WND A;  3AAK A;  2LHL A;  1CFP A;  2MLE C;  5CSN A;  4AQJ A;  1OE9 B;  1TN4 A;  2NZ0 A;  3BUM B;  1CFF A;  2I7A A;  1YVH A;  2JRF A;  2Q4U A;  1G33 A;  1SL8 A;  1VRK A;  4N1G A;  1FI6 A;  4IL1 A;  4MEW A;  5HKY A;  1XA5 A;  1XK4 A;  2PAL A;  2OS8 C;  3O4Y A;  2G9B A;  1FBV A;  1IG5 A;  1PVB A;  3CLN A;  2WCE A;  1SNL A;  2JT0 A;  2JPT A;  3EK4 A;  2L98 A;  1IQ5 A;  1OZS A;  1XFY O;  1DJX A;  2KBM A;  5BPJ A;  2F3Y A;  5DKN A;  1CTR A;  2K0J A;  2JNF A;  5HLV A;  1EXR A;  2CTN A;  1N2D A;  4P2Y B;  2KFH A;  4NDB A;  2PSR A;  3TUY C;  2K2A A;  1L2O C;  2QPT A;  1PSR A;  3I5F B;  1K93 D;  2JQ6 A;  4DIR A;  1RRO A;  3AAJ A;  1GGW A;  5HKZ A;  1IKU A;  1U5I A;  2BE4 A;  3BOW A;  3KPX A;  5PAL A;  1XYD A;  1F71 A;  3TS5 C;  2M7N A;  1TNW A;  3BUN B;  4GUK A;  2FCE A;  2AAO A;  5HKW A;  2M29 A;  1DGV A;  1SR6 B;  1TIZ A;  1WLZ A;  4D1E A;  1YX8 A;  1F8H A;  1KK8 C;  4P5O E;  1U5I B;  3BOW B;  3BXK A;  1J1D A;  2PRU A;  4A4B A;  1FF1 A;  4CLN A;  3A8R A;  1QV0 A;  1OSA A;  3DVM A;  1MUX A;  4OVN F;  1WRL A;  5AXI A;  2BBN A;  1XFX O;  5CSF A;  1BLQ A;  5I2O A;  1S5G Y;  2BE6 A;  2L4I A;  2WOS A;  2K61 A;  4CFR A;  3SIB A;  2GV5 A;  1UHN A;  4R1E A;  1TNQ A;  1QX7 A;  2JZI A;  3VRR A;  4WRI A;  3GK2 A;  1ZFS A;  3RLZ A;  4CFQ A;  3JVT C;  1UP5 A;  5I8N A;  2KI4 C;  2F2O A;  1JF2 A;  2OTG B;  3O6B A;  4NDD A;  1C7V A;  2LVV A;  1OMV A;  3K21 A;  1SBJ A;  3NSI A;  4U8D A;  4YI8 A;  1UHI A;  2K7C A;  2R2I A;  1PAL A;  3BUX B;  2M1U A;  1PK0 D;  1KK7 Z;  2M49 B;  1LXF C;  2FOT A;  4HRE E;  2HPS A;  1R2U A;  3NSK A;  1WLM A;  1NCZ A;  2LUC A;  1Y1U A;  1ALW A;  2Y5I A;  1QX2 A;  1S5G Z;  2KYC A;  1N65 A;  2CXJ A;  2KFF A;  2KOT A;  1S1E A;  5AFP A;  3CR2 A;  2LVK A;  3PFV A;  3CZT X;  3AKB A;  1TNP A;  1FI5 A;  5IBW A;  2KNE A;  2O60 A;  1CNP A;  3EVU A;  3EVV A;  3WNX B;  2H61 C;  5TNC A;  1LKJ A;  4YGE B;  1EG3 A;  2GGZ A;  2KI6 D;  1A4P A;  1DJI A;  1QLK A;  1YVL A;  3OX6 A;  2L2E A;  1M31 A;  3OX5 A;  2VRG A;  1OQP A;  5CPV A;  2BL0 B;  4PHM A;  3TDI A;  1QLS A;  2PMY A;  3JTD C;  1JUO A;  2JU0 A;  3SG3 A;  3IQQ A;  4YGC B;  2JT8 A;  3BQ3 A;  3ZWH A;  4CID A;  2DOQ A;  3MSE B;  1CKK A;  2LC5 A;  3DVJ A;  1SCM C;  1JBA A;  1JWD A;  1XVJ A;  2BCA A;  1K2H A;  1K9P A;  4E68 A;  2BBM A;  1DTL A;  1QXP A;  2ZRT A;  1WY9 A;  1LA0 A;  5JOL A;  1PSB A;  3CS1 A;  3LCP C;  4PE4 A;  1BU3 A;  1Y6W A;  2I2R E;  2LM5 A;  2V53 A;  2BKH B;  4DUQ A;  1WDC B;  1CMG A;  1GJY A;  1KSM A;  2JWW A;  3O2P A;  3FIA A;  2LP3 A;  3SG7 A;  2M8U A;  1OZO A;  1YRT B;  4PAL A;  4N1F A;  4ZCU A;  3OP0 A;  1CLB A;  1S6C A;  1SW8 A;  1CM4 A;  1QS7 A;  3DF0 A;  4M2Q A;  4MVF A;  4JQ0 D;  1BOD A;  1W7J B;  2QAC A;  3VRN A;  1TNX A;  1RTP 1;  3GOF A;  1A2X A;  2WOR A;  4OCI A;  3GK4 X;  1UHJ A;  1M46 A;  1K9K A;  2SCP A;  3DF0 B;  3HCM A;  1REC A;  3ICB A;  1B8L A;  3I5I C;  1JFK A;  3TDU A;  1XO5 A;  1YUS A;  4NDC A;  3I5G B;  1J7R A;  3LK1 A;  4PCW A;  1G8I A;  1B8C A;  4BY5 A;  3WHT B;  1B9A A;  5GQQ C;  2Q91 A;  4C0J A;  2HQ8 A;  1SCV A;  1K95 A;  1UHK A;  3I5H B;  1B1G A;  4MZK A;  2A4J A;  5DKR A;  1J7O A;  2CCM A;  2LLU A;  1DMO A;  1SL9 A;  2JNX A;  3AKA A;  1DJZ A;  1KFX L;  1SRA A;  1RFJ A;  4GFT A;  1F55 A;  3KO0 A;  1BMO A;  1J55 A;  4QJ3 B;  1D1O A;  3EK7 A;  2EC6 C;  1QTX A;  3O78 A;  4GGF A;  5AEQ A;  1QIV A;  3SIA A;  3PN7 B;  4DS7 A;  1S6I A;  1MF8 B;  1KK7 Y;  2H61 A;  3F45 A;  3KF9 A;  1SKT A;  1UWO A;  3KHE A;  5D69 A;  1GQM A;  1M45 A;  1MQ1 A;  1IRJ A;  5KSZ A;  5KTY A;  1SPY A;  1AHR A;  1JF0 A;  1LA3 A;  4I5J A;  2FCD A;  1AVS A;  1OOJ A;  5FYX A;  2CNP A;  5KU1 A;  2WC8 A;  2AUC A;  3M0W A;  1PRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...