1ZACA

N-domain of troponin c from chicken skeletal muscle, nmr, minimized average structure
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding
molecule keywords TROPONIN-C
publication title Low-temperature-induced structural changes in the Apo regulatory domain of skeletal muscle troponin C.
pubmed doi rcsb
source organism Gallus gallus
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zacA00
1J7QA 1PSRA 3WNXB 2LCPA 3CLNA 1OSAA 2G9BA 4MZLA 5CSFA 3I5GC 2OPOA 2BL0B 1B9AA 1FW4A 2LMVA 2KAVA 3NSLA 2AMIA 3BUWB 1JWDA 1KWOB 1QLSA 3IQQA 4PHNA 1X02A 1B8LA 1SYMA 2BKIB 2LP3A 2ZRSA 3BUOB 3DVMA 1BMOA 1C7WA 2JTZA 1CFPA 2PMYA 2HQWA 1QJTA 1YTZC 1TNWA 4AQJA 1FI6A 3I5IB 1K90D 4IL1A 1S6CA 1H4BA 1F4QA 1KK7Y 1CB1A 3PALA 3BOWA 1IKUA 1PVBA 1V1FA 1UHKA 2M97A 2ZKMX 3BUXB 2M9GA 5ER4X 2LVJA 4CPVA 1CM1A 2K7OA 2SCPA 2KGBC 1KSMA 2CT9A 2KQYA 2PALA 2KDHA 1DGVA 3I5HC 1NCZA 1ZFSA 1BODA 1R6PA 2KOTA 1TTXA 2LC5A 5CPVA 1IQ3A 1XA5A 4OCIA 1SK6D 3EVUA 1OZOA 5KSZA 1KK8C 2K8MB 2LLUA 1NYAA 1CM4A 2F2PA 5IBWA 1ODBA 2BBNA 4M2OA 3IQOA 1U5IA 3TUYB 1YVHA 3SIAA 5JJGA 4ORBB 4UPGA 1H8BA 1SCMB 3BQ3A 1FPWA 1QIWA 3EK7A 4GGFC 1SL8A 5JOLA 3TS5C 2JT3A 2JTTA 1L2OC 4C0KA 2LHLA 3SIBA 3OX5A 3OHMB 1IQ5A 1B7TZ 2L0PA 1W7JB 3JVTC 4PDZA 1EH2A 2RGIA 4ETOA 1FI5A 1UHJA 1WLMA 4FTGA 3LK0A 1BLQA 3GK1A 1ZUZA 4MSPA 1EXRA 2JXCA 4MVFA 3AKAA 1QV1A 2MRDA 2AAOA 5ER5A 3VRNA 2LNKA 1HT9A 1CFDA 4GNKB 5AXIA 2H61C 1PK0D 3RM1A 1B8RA 4GGNA 3VRRA 2JNFA 3OB1B 3PN7C 1NSHA 4GGFA 1AJ5A 1A29A 3KPXA 4M2QA 1JSAA 5HLVA 2HPSA 1CTRA 4BY4A 2L51A 2K7CA 3KO0A 1B1GA 2EC6B 2GGZA 2KBMA 1DT7B 1FF1A 1BOCA 4HRHA 2KI6D 1QXPA 3CR2A 4PE4A 3CWGA 1LA3A 2JC2A 3PLFB 4HSZA 4WQ2A 2CNPA 2KAXA 2V53A 1S26D 3LCPC 2H61A 1QATA 1QLKA 4R1EA 1NX0A 4F0ZB 3PSRA 3EK8A 3CGAA 2LP2A 1TNXA 3NSOA 4MZKA 2E6WA 1RROA 3BUMB 2K7BA 4PHMA 2CBLA 2GGMA 2WCEA 3ICBA 2R2IA 1A75B 3TUYC 5F6TA 1LKJA 3TDIA 4C0JA 1SMGA 2B1UA 4ORCB 2EGDA 2JT0A 3AAKA 1TNQA 3EKJA 1B8CA 5GQQC 1OMDA 4DCKA 1J7OA 1SBJA 3EVVA 3EVRA 2Y1MA 4QJ3B 1UWOA 1K9KA 2JU0A 5G08A 1RTP1 1BR1B 3NXAA 2VRGA 1CDPA 2M3WA 2BKHB 1M46A 3CS1A 1AUIB 1KCYA 4OVNF 1L7ZA 1OE9B 4PE7A 1G33A 4GBAA 4N5XA 4Q04A 1JF2A 4CIDA 1KFXL 4NDDA 2D8NA 1KFUL 2OTGB 4XJKB 1NP8A 4JPZB 1LXFC 2ZFDA 2G2BA 1DJIA 3WXAA 3FIAA 3CR5X 5HKZA 2COLB 2IS9A 1RK9A 1QASA 5DKNA 3GK2A 2LHIA 1GQMA 1F4OA 2H2KA 1WRKA 3I5FC 3BUNB 4M2PA 1C07A 1UUSA 2KFHA 1CDMA 2LLSA 1AHRA 1XFWO 1NPQA 1K94A 1XVJA 3HX4A 2F3YA 1VRKA 2M8UA 2Y4QA 2LUXA 1GGWA 1CDNA 3H4SE 1J1EA 1E8AA 1MQ1A 1IH0A 2FCDA 1CMGA 1YX7A 1S1EA 3ZNIA 4N1FA 3OB2B 1TCOB 1DJHA 2I94A 3CTNA 2KSPA 1MXEA 1K95A 1QVIZ 4PE1A 1K8UA 2KI4B 4YGCB 4XYNA 1KQMC 1EJ3A 2OS8B 1CLLA 1MHOA 3JTDB 3GOFA 1IRJA 2AUCA 3HCMA 4YI8A 1KQVA 1AJ4A 1NWDA 1SPYA 2F3ZA 2JT8A 1XFXO 3KF9A 1HQVA 2MAZA 1TOPA 4ZCUA 3DF0B 5HYDA 1OQPA 3LL8B 1M63B 1WDCC 3TDZA 1XK4A 2SASA 3IF7A 1JC2A 1NCYA 2WNDA 4E68A 1S5GY 1V1GA 1K2HA 1YRTB 1A75A 2WCFA 5I2QA 2JZIA 2BL0C 2PASA 1CLBA 2WCBA 2OTGC 2KYFA 1UHHA 1DVIA 3PFVA 2DOQA 3K21A 1KWOC 1QS7A 2K61A 1SKTA 3O78A 1M31A 3SG6A 1DJXA 1SCVA 2BECA 4MEWA 4YGEB 1GGZA 1GJYA 1TCFA 3O2PA 4GAOA 4I5JA 1LA0A 3I5IC 2K2FA 2M29A 4NQGA 3CR4X 1SR6B 1SL7A 4A4CA 2Q4UA 2BCXA 1MXLC 4YRUA 2KAYA 5CSJA 1YURA 1ALWA 3WHUB 2NZ0A 2PVBA 3SG5A 3OP0A 1PRWA 4CFQA 2E30A 2L5XB 5TNCA 4D1EA 1AK8A 1S36A 2NCOA 1F8HA 1Y0VH 1XFZO 1PULA 4MBEA 4MRYA 4XJKA 4YGDB 2JWWA 3I5GB 1YR5A 2Y1NA 3F45A 4YGAA 1NIWA 5KU1A 1DGUA 1PALA 1Q80A 2GV5A 2QPTA 3EK4A 4OR9B 5K89A 1TNPA 3RLZA 1J55A 1NX2A 4DRWA 1Y1AA 2F33A 4OKHA 1OMVA 1JF0A 4ORAB 1DTLA 4PHJA 1W7IB 1BR4B 2A4JA 5FYXA 1IJ5A 1SRAA 1SCMC 3LK1A 3SG2A 3VGOA 2LMTA 2NLNA 5J3XA 1CKKA 3DD4A 2Q91A 1EL4A 3D10A 1K9PA 1IJ6A 2ZNDA 1EG4A 1G4YR 2JXLA 1SL9A 2KI6C 1DJZA 1RJVA 4WRIA 2L2EA 1OMRA 1CFCA 1K93D 3I5HB 4ZCVA 1B47A 2MLEC 3BYAA 1CNPA 2KFFA 4BY5A 3QRXA 5KTYA 1WRLA 3NSIA 1YVLA 1BJFA 1YUTA 2JQ6A 1PVAA 1Y1XA 2FCEA 1IGVA 3KHEA 3M0WA 1KK8B 1KK7Z 1YUUA 5CSIA 2LVIA 2CXJA 1TIZA 3VRQA 1DF0B 1SY9A 2WC8A 1MF8B 1CLMA 1SR6C 4OV2A 5BPJA 3VROA 1A4PA 1FBVA 3TS5B 2EC6C 1XFVO 2BBMA 1XFYO 3DF0A 1XYDA 3LLEA 2JPTA 2M1KB 2M1UA 4A4BA 5D7FA 3NSKA 1CFFA 4QJ4B 1N2DA 1TN4A 2K0JA 3JVTB 4I5LB 4N1GA 2JOJA 5AERA 1UP5A 1CMFA 2WOSA 5HKWA 2M49B 4JWQA 4CFRA 4TNCA 1MUXA 2PSRA 1JFJA 1ZACA 4NDBA 3TDUA 4DS7A 3FWCA 2KGRA 5HLOA 1JFKA 1Y6WA 3EKHA 4PCWA 2KHNA 2M0RA 1NCXA 1XK4C 1YX8A 2L4HA 2LM5A 1F71A 3OX6A 2MJWB 3PATA 3SJSA 2LAPA 3D0YB 4GFTA 3PN7B 2P6BB 3TZ1A 1QV0A 3A4UB 4PE0A 5I2LA 1UHIA 5B8IB 5AEQA 1S5GZ 1J7RA 4USLA 1S6JA 3FWBA 1XFUO 1K96A 1M39A 2L50A 2K7DA 4MN0A 2L4IA 1OOJA 1YRUB 4P2YB 4ICBA 1XO5A 2O60A 4JQ0D 5DKQA 2LUCA 1NUBA 1BG1A 1B4CA 2HQ8A 2LV7A 1S6IA 2I7AA 2BE4A 4YI9A 4PHKA 5I2OA 1IG5A 2MHHA 1F54A 3ZWHA 2KFGA 4CLNA 3DVEA 1QX7A 4YBHB 1BT6A 2FOTA 2PRUA 2LMUA 4FQOA 2MA2A 2HETA 1A2XA 4MLWA 2BE6A 2ISDA 2KQ6A 4WQ3A 2BCAA 1DMOA 1PSBA 1J7PA 3SG3A 1AVSA 1BU3A 1QVIY 4DUQA 1QIVA 1DJYA 3E3RA 3O4YA 4YGBB 3O6BA 2L98A 4PALA 4QJ5B 3C1VA 3BOWB 1KFXS 1UURA 4AOMA 2F2OA 2M7LA 2ZN9A 2ZN8A 5CSNA 1KFUS 1A03A 2LVKA 3DVJA 2JNXA 4DIRA 5HKYA 1SW8A 1NX3A 1DF0A 1TRFA 1B7TY 1N65A 2CCMA 5I8NA 4U8DA 2M7NA 1WLZA 2LLTA 4HREE 2LVVA 1J1DA 1F70A 1YUSA 1LINA 1M45A 1NX1A 1S3PA 1ZMZA 2KI4C 1SNLA 1MR8A 2O5GA 4GPLB 2OS8C 5DKRA 4P5OE 1BF5A 2MLFC 4L9MA 4GUKA 2FJUB 3JTDC 1DJWA 1KSOA 1EG3A 1RFJA 1U5IB 3I5FB 4I5NB 2I18A 1K9UA 5AANA 2JULA 3BXKA 2LE9B 4HRGA 1IWQA 1QX5B 2KNEA 1C7VA 3GK4X 2Y5IA 4NDCA 2EHBA 1ZOTB 1G8IA 3MSEB 2MBXA 3VRPA 5D69A 2LANA 1F55A 1RECA 3FS7A 1OZSA 3A8RA 3AAJA 3D0YA 3KEVA 3CZTX 1AP4A 1QX2A 1QTXA 3DVKA 2KYCA 1D1OA 1MWNA 2JRFA 2NXQA 3PM8A 1UHNA 2NCPA 4MZJA 1ALVA 1WRZA 2CTNA 2WORA 2ZNEA 3WHTB 2TN4A 1KQMB 1N0YA 2QACA 2ZRTA 1R2UA 1RWYA 4AQIA 4C0LA 2F8PA 1CDLA 1Y1UA 5PALA 5AFPA 1JUOA 3SG7A 4I5KA 1L2OB 1DJGA 2KBIA 4MRXA 3SG4A 1LVCD 1WY9A 1JBAA 2BCBA 2I2RE 1WDCB 2HF5A 2K2AA 3AKBA
chains in the Genus database with same CATH superfamily
1J7QA 1PSRA 3WNXB 2LCPA 3CLNA 1OSAA 2G9BA 4MZLA 5CSFA 3I5GC 2OPOA 2BL0B 1B9AA 1FW4A 2LMVA 2KAVA 3NSLA 2AMIA 3BUWB 1JWDA 1KWOB 1QLSA 3IQQA 4PHNA 1X02A 1B8LA 1SYMA 2BKIB 2LP3A 2ZRSA 3BUOB 3DVMA 1BMOA 1C7WA 2JTZA 1CFPA 2PQLA 2PMYA 2HQWA 2BAPA 1QJTA 1YTZC 3K1EA 1TNWA 4AQJA 1FI6A 3I5IB 1K90D 1OOIX 4IL1A 5FI6A 1S6CA 1H4BA 1F4QA 3DZTA 1KK7Y 4JKTA 1CB1A 3PALA 3BOWA 1IKUA 1PVBA 1V1FA 1UHKA 2M97A 2ZKMX 3BUXB 2M9GA 5ER4X 2LVJA 4CPVA 1CM1A 2K7OA 2SCPA 2KGBC 1KSMA 2CT9A 2KQYA 2PALA 2KDHA 1DGVA 1LS8A 3BFHA 3I5HC 1NCZA 1ZFSA 1DQEA 1BODA 1R6PA 2KOTA 1TTXA 2LC5A 5CPVA 1IQ3A 1XA5A 4OCIA 1SK6D 3EVUA 1OZOA 5KSZA 1KK8C 2K8MB 1Z2CB 2LLUA 1NYAA 3OGNA 1CM4A 2F2PA 5IBWA 1ODBA 2BBNA 4M2OA 3IQOA 1U5IA 3TUYB 1YVHA 3SIAA 5JJGA 4ORBB 4UPGA 1H8BA 1SCMB 3BQ3A 1FPWA 1QIWA 3EK7A 4GGFC 1SL8A 5JOLA 3TS5C 2JT3A 2JTTA 1L2OC 4C0KA 2LHLA 3SIBA 3OX5A 3OHMB 1IQ5A 1B7TZ 3L4AA 3SS5A 2L0PA 1W7JB 3JVTC 4PDZA 4KYNA 1EH2A 2RGIA 4ETOA 1FI5A 1UHJA 1WLMA 4FQTA 3LK0A 4FTGA 1BLQA 3GK1A 1ZUZA 4MSPA 1EXRA 2JXCA 4MVFA 3AKAA 1QV1A 2MRDA 2AAOA 5ER5A 3DY9A 2LNKA 1HT9A 1CFDA 1P28A 4GNKB 2H61C 1PK0D 5AXIA 3RM1A 1B8RA 4GGNA 4JD9A 3VRRA 4OZDA 2JNFA 3OB1B 3PN7C 2KLEA 1NSHA 4GGFA 1AJ5A 1A29A 3KPXA 4M2QA 3B86A 5HLVA 1JSAA 2HPSA 1CTRA 4BY4A 2L51A 2K7CA 3KO0A 1B1GA 3CZ2A 3L47A 2EC6B 2GGZA 2KBMA 1DT7B 1FF1A 1BOCA 4HRHA 2KI6D 1QXPA 3CR2A 4PE4A 3CWGA 1LA3A 2JC2A 3PLFB 4HSZA 4WQ2A 2CNPA 2KAXA 2V53A 1S26D 3LCPC 2H61A 1QATA 1QLKA 4R1EA 1NX0A 4F0ZB 3PSRA 3EK8A 3CGAA 2LP2A 1TNXA 3NSOA 4MZKA 2E6WA 3CZ1A 1RROA 3BUMB 2K7BA 4PHMA 2CBLA 2GGMA 3NHTA 2WCEA 3ICBA 1DEKA 2R2IA 1A75B 3TUYC 5F6TA 1LKJA 3TDIA 4C0JA 1SMGA 2B1UA 3CYZA 4ORCB 2EGDA 2JT0A 2H8VA 1TNQA 3AAKA 3EKJA 1B8CA 5GQQC 1OMDA 3N7HA 4DCKA 1J7OA 1SBJA 3EVVA 3EVRA 2Y1MA 4QJ3B 1UWOA 1K9KA 2JU0A 5G08A 4A4BA 1RTP1 1BR1B 3NXAA 2VRGA 1CDPA 2M3WA 2BKHB 1M46A 3CS1A 1AUIB 1KCYA 3DXLA 4OVNF 1L7ZA 1OE9B 4PE7A 1G33A 4GBAA 3S0BA 4N5XA 2FJYA 2L2CA 4Q04A 1JF2A 4CIDA 1KFXL 3PM2A 4NDDA 3D74A 2D8NA 1KFUL 2OTGB 4XJKB 1NP8A 4JPZB 2WC5A 4INXA 1LXFC 2ZFDA 2G2BA 1DJIA 3WXAA 3FIAA 3CR5X 5HKZA 5FI7A 2COLB 1Z4HA 2IS9A 1RK9A 1QASA 2QEVA 5DKNA 3GK2A 2LHIA 1GQMA 1F4OA 2H2KA 1WRKA 3I5FC 3BUNB 4M2PA 1C07A 1UUSA 2KFHA 3FE9A 1CDMA 2LLSA 1AHRA 1XFWO 2WCMA 1NPQA 1K94A 1XVJA 3HX4A 2F3YA 1VRKA 2K60A 2M8UA 2LUXA 2Y4QA 1CDNA 1GGWA 3H4SE 1J1EA 1E8AA 1MQ1A 1IH0A 3BFBA 2FCDA 1CMGA 1YX7A 1S1EA 3ZNIA 4N1FA 5D3OA 1TUZA 3OB2B 1TCOB 1DJHA 3EG5B 2I94A 3CTNA 2KSPA 1MXEA 2BNXA 1K95A 1QVIZ 4PE1A 1K8UA 2KI4B 3CZ0A 1TWOA 4YGCB 4XYNA 1KQMC 1EJ3A 2OS8B 1CLLA 2KLDA 1MHOA 3JTDB 3GOFA 1IRJA 2AUCA 3HCMA 4YI8A 1KQVA 1OOFA 1AJ4A 3D77A 1NWDA 1SPYA 2F3ZA 2JT8A 1XFXO 3KF9A 2JPOA 1HQVA 2MAZA 1DELA 1TOPA 4ZCUA 3DF0B 5HYDA 1OQPA 3LL8B 1M63B 1WDCC 3TDZA 1XK4A 2SASA 3IF7A 1JC2A 1NCYA 2WNDA 4E68A 1S5GY 1V1GA 1K2HA 1YRTB 1A75A 2WCFA 5I2QA 2JZIA 2BL0C 2PASA 1CLBA 2WCBA 2OTGC 2KYFA 2QEHA 3RZSA 1UHHA 1DVIA 3PFVA 2DOQA 2QEBA 3DYEA 3K21A 1KWOC 1QS7A 2K61A 1SKTA 3O78A 1M31A 3SG6A 1DJXA 1SCVA 2BECA 2L5YA 4MEWA 4YGEB 3D76A 1GGZA 1GJYA 1TCFA 3O2PA 4GAOA 4I5JA 1LA0A 3I5IC 2K2FA 2M29A 4NQGA 3CR4X 1SR6B 4PT1A 1SL7A 4A4CA 2Q4UA 2BCXA 1T14A 1TUJA 1MXLC 4YRUA 2KAYA 5CSJA 1YURA 1ALWA 3QMEA 3VB1A 3WHUB 2NZ0A 1OOGA 2PVBA 5EL2A 3SG5A 3OP0A 1PRWA 4CFQA 2E30A 2L5XB 3CABA 5TNCA 4D1EA 1AK8A 1S36A 2NCOA 1F8HA 1Y0VH 1XFZO 1PULA 4MBEA 4MRYA 4XJKA 4YGDB 2JWWA 3I5GB 1YR5A 2Y1NA 3F45A 4YGAA 1NIWA 5KU1A 1DGUA 1PALA 1Q80A 2GV5A 2QPTA 3EK4A 4OR9B 5K89A 1TNPA 3RLZA 1OW4A 1J55A 3BJHA 1NX2A 2QEOA 3B88A 4DRWA 1Y1AA 2F33A 4OKHA 1OMVA 1JF0A 4ORAB 1DTLA 4PHJA 1W7IB 1BR4B 2A4JA 5FYXA 1IJ5A 1SRAA 1SCMC 3LK1A 3R1OA 3SG2A 3VGOA 2LMTA 2NLNA 3OBVA 5J3XA 1ORGA 1CKKA 3DD4A 2Q91A 1EL4A 3D10A 1K9PA 1IJ6A 2ZNDA 1EG4A 1G4YR 2JXLA 3FE6A 4IJ7A 1SL9A 2KI6C 1DJZA 1RJVA 4WRIA 2L2EA 1OMRA 2GTEA 1CFCA 1K93D 3I5HB 4ZCVA 1B47A 2MLEC 3BYAA 1CNPA 2KFFA 4BY5A 3QRXA 5KTYA 1WRLA 3NSIA 1YVLA 1BJFA 1YUTA 2JQ6A 1OOHA 1PVAA 1Y1XA 3NHIA 2FCEA 3D78A 1IGVA 1XFRA 3KHEA 3B7AA 3M0WA 1KK8B 1KK7Z 1YUUA 3IVTA 5CSIA 2LVIA 3PJIA 2CXJA 2YGUA 1TIZA 3VRQA 1DF0B 1SY9A 2WC8A 1MF8B 1CLMA 1SR6C 4OV2A 2P70A 3VROA 1A4PA 5BPJA 1FBVA 3TS5B 2EC6C 1XFVO 2BBMA 1XFYO 3DF0A 1XYDA 3LLEA 2JPTA 2M1KB 2M1UA 5DICA 3UNWA 5D7FA 3NSKA 1CFFA 4QJ4B 1QWVA 3CDNA 1N2DA 1TN4A 2K0JA 3JVTB 4I5LB 4N1GA 2JOJA 5AERA 1UP5A 1CMFA 2WOSA 5HKWA 2M49B 4JWQA 4CFRA 4TNCA 1MUXA 2PSRA 3D73A 3R1VA 1ZACA 1JFJA 4NDBA 3TDUA 4DS7A 2WCHA 3FWCA 2KGRA 5I94A 5HLOA 1JFKA 1Y6WA 2WCLA 3EKHA 4PCWA 2KHNA 2M0RA 1NCXA 1XK4C 1YX8A 2L4HA 2LM5A 3D75A 1F71A 3OX6A 1C3ZA 2MJWB 3PATA 3SJSA 2LAPA 3D0YB 4GFTA 3PN7B 2P6BB 3TZ1A 1QV0A 3A4UB 4PE0A 5I2LA 1UHIA 5B8IB 3NGVA 4F7FA 5AEQA 1S5GZ 1J7RA 4USLA 1S6JA 3FWBA 1XFUO 1K96A 1M39A 3VRNA 2L50A 3SS4A 2K7DA 4MN0A 2L4IA 1OOJA 1YRUB 4P2YB 4ICBA 1XO5A 2O60A 2ERBA 4JQ0D 5DKQA 2LUCA 1NUBA 1BG1A 1B4CA 2HQ8A 2LV7A 5HL1A 1S6IA 1DC1A 2I7AA 2PYQA 2BE4A 4YI9A 4PHKA 5I2OA 1IG5A 5FI2A 2MHHA 1F54A 3ZWHA 2KFGA 4CLNA 3DVEA 1QX7A 4YBHB 1BT6A 2FOTA 2PRUA 2WC6A 2LMUA 4FQOA 3UO9A 3Q8IA 2MA2A 2HETA 1A2XA 3FE8A 4MLWA 2BE6A 2ISDA 2KQ6A 3B87A 2BCAA 4WQ3A 1DMOA 1PSBA 1J7PA 3SG3A 1AVSA 1BU3A 1QVIY 4DUQA 1QIVA 1DJYA 3E3RA 3O4YA 4YGBB 3O6BA 2L98A 4PALA 4QJ5B 3C1VA 3BOWB 1KFXS 1UURA 1SSEB 4AOMA 2F2OA 2M7LA 2ZN9A 2ZN8A 3S0EA 5CSNA 1KFUS 1A03A 2LVKA 3DVJA 2JNXA 4DIRA 3B6XA 5HKYA 1SW8A 1NX3A 1DF0A 1TRFA 1B7TY 3S0GA 1N65A 2CCMA 3L4LA 4U8DA 5I8NA 2M7NA 1WLZA 2LLTA 4HREE 2LVVA 1J1DA 1F70A 1YUSA 1LINA 1M45A 1NX1A 1S3PA 1ZMZA 2KI4C 1SNLA 1IIOA 1MR8A 2O5GA 4GPLB 2OS8C 5DKRA 4P5OE 3S0FA 2MLFC 1BF5A 4L9MA 4GUKA 2FJUB 3JTDC 2WCJA 1DJWA 1KSOA 3R1PA 3S0AA 1EG3A 1RFJA 1U5IB 3I5FB 4I5NB 2I18A 1K9UA 3S0DA 2P71A 5AANA 2JULA 2KPHA 3BXKA 2LE9B 2QDIA 4HRGA 1IWQA 1QX5B 2KNEA 1C7VA 3GK4X 2Y5IA 4NDCA 2EHBA 1ZOTB 1G8IA 3MSEB 2MBXA 3VRPA 5D69A 2LANA 1F55A 1RECA 3FS7A 1OZSA 3A8RA 3AAJA 3D0YA 1W9ZA 3R72A 3KEVA 3O4XA 3CZTX 1AP4A 1QX2A 1QTXA 3DVKA 2KYCA 1D1OA 1MWNA 2JRFA 2NXQA 3PM8A 4INWA 3BFAA 1UHNA 2NCPA 4MZJA 1ALVA 1WRZA 2CTNA 2WORA 2ZNEA 3WHTB 2TN4A 1KQMB 1N0YA 2QACA 2ZRTA 1R2UA 1RWYA 4AQIA 4C0LA 2F8PA 1CDLA 3SS3A 1Y1UA 5PALA 5AFPA 1JUOA 3SG7A 2WCKA 4I5KA 1L2OB 1DJGA 2KBIA 1C3YA 4MRXA 3V2LA 3SG4A 1LVCD 1WY9A 1JBAA 1GM0A 2BCBA 2I2RE 1WDCB 2HF5A 2K2AA 3AKBA
chains in the Genus database with same CATH topology
1J7QA 1PSRA 3WNXB 2LCPA 3CLNA 1OSAA 2G9BA 4MZLA 5CSFA 3I5GC 2OPOA 2BL0B 1B9AA 1FW4A 2LMVA 2KAVA 3NSLA 2AMIA 3BUWB 1JWDA 1KWOB 1QLSA 3IQQA 4PHNA 1X02A 1B8LA 1SYMA 2BKIB 2LP3A 2ZRSA 3BUOB 3DVMA 1BMOA 1C7WA 2JTZA 1CFPA 2PMYA 2HQWA 1QJTA 1YTZC 1TNWA 4AQJA 1FI6A 3I5IB 1K90D 4IL1A 1S6CA 1H4BA 1F4QA 1KK7Y 1CB1A 3PALA 3BOWA 1IKUA 1PVBA 1V1FA 1UHKA 2M97A 2ZKMX 3BUXB 2M9GA 5ER4X 2LVJA 4CPVA 1CM1A 2K7OA 2SCPA 2KGBC 1KSMA 2CT9A 2KQYA 2PALA 2KDHA 1DGVA 3I5HC 1NCZA 1ZFSA 1BODA 1R6PA 2KOTA 1TTXA 2LC5A 5CPVA 1IQ3A 1XA5A 4OCIA 1SK6D 3EVUA 1OZOA 5KSZA 1KK8C 2K8MB 2LLUA 1NYAA 1CM4A 2F2PA 5IBWA 1ODBA 2BBNA 4M2OA 3IQOA 1U5IA 3TUYB 1YVHA 3SIAA 5JJGA 4ORBB 4UPGA 1H8BA 1SCMB 3BQ3A 1FPWA 1QIWA 3EK7A 4GGFC 1SL8A 5JOLA 3TS5C 2JT3A 2JTTA 1L2OC 4C0KA 2LHLA 3SIBA 3OX5A 3OHMB 1IQ5A 1B7TZ 2L0PA 1W7JB 3JVTC 4PDZA 1EH2A 2RGIA 4ETOA 1FI5A 1UHJA 1WLMA 4FTGA 3LK0A 1BLQA 3GK1A 1ZUZA 4MSPA 1EXRA 2JXCA 4MVFA 3AKAA 1QV1A 2MRDA 2AAOA 5ER5A 3VRNA 2LNKA 1HT9A 1CFDA 4GNKB 5AXIA 2H61C 1PK0D 3RM1A 1B8RA 4GGNA 3VRRA 2JNFA 3OB1B 3PN7C 1NSHA 4GGFA 1AJ5A 1A29A 3KPXA 4M2QA 1JSAA 5HLVA 2HPSA 1CTRA 4BY4A 2L51A 2K7CA 3KO0A 1B1GA 2EC6B 2GGZA 2KBMA 1DT7B 1FF1A 1BOCA 4HRHA 2KI6D 1QXPA 3CR2A 4PE4A 3CWGA 1LA3A 2JC2A 3PLFB 4HSZA 4WQ2A 2CNPA 2KAXA 2V53A 1S26D 3LCPC 2H61A 1QATA 1QLKA 4R1EA 1NX0A 4F0ZB 3PSRA 3EK8A 3CGAA 2LP2A 1TNXA 3NSOA 4MZKA 2E6WA 1RROA 3BUMB 2K7BA 4PHMA 2CBLA 2GGMA 2WCEA 3ICBA 2R2IA 1A75B 3TUYC 5F6TA 1LKJA 3TDIA 4C0JA 1SMGA 2B1UA 4ORCB 2EGDA 2JT0A 3AAKA 1TNQA 3EKJA 1B8CA 5GQQC 1OMDA 4DCKA 1J7OA 1SBJA 3EVVA 3EVRA 2Y1MA 4QJ3B 1UWOA 1K9KA 2JU0A 5G08A 1RTP1 1BR1B 3NXAA 2VRGA 1CDPA 2M3WA 2BKHB 1M46A 3CS1A 1AUIB 1KCYA 4OVNF 1L7ZA 1OE9B 4PE7A 1G33A 4GBAA 4N5XA 4Q04A 1JF2A 4CIDA 1KFXL 4NDDA 2D8NA 1KFUL 2OTGB 4XJKB 1NP8A 4JPZB 1LXFC 2ZFDA 2G2BA 1DJIA 3WXAA 3FIAA 3CR5X 5HKZA 2COLB 2IS9A 1RK9A 1QASA 5DKNA 3GK2A 2LHIA 1GQMA 1F4OA 2H2KA 1WRKA 3I5FC 3BUNB 4M2PA 1C07A 1UUSA 2KFHA 1CDMA 2LLSA 1AHRA 1XFWO 1NPQA 1K94A 1XVJA 3HX4A 2F3YA 1VRKA 2M8UA 2Y4QA 2LUXA 1GGWA 1CDNA 3H4SE 1J1EA 1E8AA 1MQ1A 1IH0A 2FCDA 1CMGA 1YX7A 1S1EA 3ZNIA 4N1FA 3OB2B 1TCOB 1DJHA 2I94A 3CTNA 2KSPA 1MXEA 1K95A 1QVIZ 4PE1A 1K8UA 2KI4B 4YGCB 4XYNA 1KQMC 1EJ3A 2OS8B 1CLLA 1MHOA 3JTDB 3GOFA 1IRJA 2AUCA 3HCMA 4YI8A 1KQVA 1AJ4A 1NWDA 1SPYA 2F3ZA 2JT8A 1XFXO 3KF9A 1HQVA 2MAZA 1TOPA 4ZCUA 3DF0B 5HYDA 1OQPA 3LL8B 1M63B 1WDCC 3TDZA 1XK4A 2SASA 3IF7A 1JC2A 1NCYA 2WNDA 4E68A 1S5GY 1V1GA 1K2HA 1YRTB 1A75A 2WCFA 5I2QA 2JZIA 2BL0C 2PASA 1CLBA 2WCBA 2OTGC 2KYFA 1UHHA 1DVIA 3PFVA 2DOQA 3K21A 1KWOC 1QS7A 2K61A 1SKTA 3O78A 1M31A 3SG6A 1DJXA 1SCVA 2BECA 4MEWA 4YGEB 1GGZA 1GJYA 1TCFA 3O2PA 4GAOA 4I5JA 1LA0A 3I5IC 2K2FA 2M29A 4NQGA 3CR4X 1SR6B 1SL7A 4A4CA 2Q4UA 2BCXA 1MXLC 4YRUA 2KAYA 5CSJA 1YURA 1ALWA 3WHUB 2NZ0A 2PVBA 3SG5A 3OP0A 1PRWA 4CFQA 2E30A 2L5XB 5TNCA 4D1EA 1AK8A 1S36A 2NCOA 1F8HA 1Y0VH 1XFZO 1PULA 4MBEA 4MRYA 4XJKA 4YGDB 2JWWA 3I5GB 1YR5A 2Y1NA 3F45A 4YGAA 1NIWA 5KU1A 1DGUA 1PALA 1Q80A 2GV5A 2QPTA 3EK4A 4OR9B 5K89A 1TNPA 3RLZA 1J55A 1NX2A 4DRWA 1Y1AA 2F33A 4OKHA 1OMVA 1JF0A 4ORAB 1DTLA 4PHJA 1W7IB 1BR4B 2A4JA 5FYXA 1IJ5A 1SRAA 1SCMC 3LK1A 3SG2A 3VGOA 2LMTA 2NLNA 5J3XA 1CKKA 3DD4A 2Q91A 1EL4A 3D10A 1K9PA 1IJ6A 2ZNDA 1EG4A 1G4YR 2JXLA 1SL9A 2KI6C 1DJZA 1RJVA 4WRIA 2L2EA 1OMRA 1CFCA 1K93D 3I5HB 4ZCVA 1B47A 2MLEC 3BYAA 1CNPA 2KFFA 4BY5A 3QRXA 5KTYA 1WRLA 3NSIA 1YVLA 1BJFA 1YUTA 2JQ6A 1PVAA 1Y1XA 2FCEA 1IGVA 3KHEA 3M0WA 1KK8B 1KK7Z 1YUUA 5CSIA 2LVIA 2CXJA 1TIZA 3VRQA 1DF0B 1SY9A 2WC8A 1MF8B 1CLMA 1SR6C 4OV2A 5BPJA 3VROA 1A4PA 1FBVA 3TS5B 2EC6C 1XFVO 2BBMA 1XFYO 3DF0A 1XYDA 3LLEA 2JPTA 2M1KB 2M1UA 4A4BA 5D7FA 3NSKA 1CFFA 4QJ4B 1N2DA 1TN4A 2K0JA 3JVTB 4I5LB 4N1GA 2JOJA 5AERA 1UP5A 1CMFA 2WOSA 5HKWA 2M49B 4JWQA 4CFRA 4TNCA 1MUXA 2PSRA 1JFJA 1ZACA 4NDBA 3TDUA 4DS7A 3FWCA 2KGRA 5HLOA 1JFKA 1Y6WA 3EKHA 4PCWA 2KHNA 2M0RA 1NCXA 1XK4C 1YX8A 2L4HA 2LM5A 1F71A 3OX6A 2MJWB 3PATA 3SJSA 2LAPA 3D0YB 4GFTA 3PN7B 2P6BB 3TZ1A 1QV0A 3A4UB 4PE0A 5I2LA 1UHIA 5B8IB 5AEQA 1S5GZ 1J7RA 4USLA 1S6JA 3FWBA 1XFUO 1K96A 1M39A 2L50A 2K7DA 4MN0A 2L4IA 1OOJA 1YRUB 4P2YB 4ICBA 1XO5A 2O60A 4JQ0D 5DKQA 2LUCA 1NUBA 1BG1A 1B4CA 2HQ8A 2LV7A 1S6IA 2I7AA 2BE4A 4YI9A 4PHKA 5I2OA 1IG5A 2MHHA 1F54A 3ZWHA 2KFGA 4CLNA 3DVEA 1QX7A 4YBHB 1BT6A 2FOTA 2PRUA 2LMUA 4FQOA 2MA2A 2HETA 1A2XA 4MLWA 2BE6A 2ISDA 2KQ6A 4WQ3A 2BCAA 1DMOA 1PSBA 1J7PA 3SG3A 1AVSA 1BU3A 1QVIY 4DUQA 1QIVA 1DJYA 3E3RA 3O4YA 4YGBB 3O6BA 2L98A 4PALA 4QJ5B 3C1VA 3BOWB 1KFXS 1UURA 4AOMA 2F2OA 2M7LA 2ZN9A 2ZN8A 5CSNA 1KFUS 1A03A 2LVKA 3DVJA 2JNXA 4DIRA 5HKYA 1SW8A 1NX3A 1DF0A 1TRFA 1B7TY 1N65A 2CCMA 5I8NA 4U8DA 2M7NA 1WLZA 2LLTA 4HREE 2LVVA 1J1DA 1F70A 1YUSA 1LINA 1M45A 1NX1A 1S3PA 1ZMZA 2KI4C 1SNLA 1MR8A 2O5GA 4GPLB 2OS8C 5DKRA 4P5OE 1BF5A 2MLFC 4L9MA 4GUKA 2FJUB 3JTDC 1DJWA 1KSOA 1EG3A 1RFJA 1U5IB 3I5FB 4I5NB 2I18A 1K9UA 5AANA 2JULA 3BXKA 2LE9B 4HRGA 1IWQA 1QX5B 2KNEA 1C7VA 3GK4X 2Y5IA 4NDCA 2EHBA 1ZOTB 1G8IA 3MSEB 2MBXA 3VRPA 5D69A 2LANA 1F55A 1RECA 3FS7A 1OZSA 3A8RA 3AAJA 3D0YA 3KEVA 3CZTX 1AP4A 1QX2A 1QTXA 3DVKA 2KYCA 1D1OA 1MWNA 2JRFA 2NXQA 3PM8A 1UHNA 2NCPA 4MZJA 1ALVA 1WRZA 2CTNA 2WORA 2ZNEA 3WHTB 2TN4A 1KQMB 1N0YA 2QACA 2ZRTA 1R2UA 1RWYA 4AQIA 4C0LA 2F8PA 1CDLA 1Y1UA 5PALA 5AFPA 1JUOA 3SG7A 4I5KA 1L2OB 1DJGA 2KBIA 4MRXA 3SG4A 1LVCD 1WY9A 1JBAA 2BCBA 2I2RE 1WDCB 2HF5A 2K2AA 3AKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7Q A;  1PSR A;  3WNX B;  2LCP A;  3CLN A;  1OSA A;  2G9B A;  4MZL A;  5CSF A;  3I5G C;  2OPO A;  2BL0 B;  1B9A A;  1FW4 A;  2LMV A;  2KAV A;  3NSL A;  2AMI A;  3BUW B;  1JWD A;  1KWO B;  1QLS A;  3IQQ A;  4PHN A;  1X02 A;  1B8L A;  1SYM A;  2BKI B;  2LP3 A;  2ZRS A;  3BUO B;  3DVM A;  1BMO A;  1C7W A;  2JTZ A;  1CFP A;  2PMY A;  2HQW A;  1QJT A;  1YTZ C;  1TNW A;  4AQJ A;  1FI6 A;  3I5I B;  1K90 D;  4IL1 A;  1S6C A;  1H4B A;  1F4Q A;  1KK7 Y;  1CB1 A;  3PAL A;  3BOW A;  1IKU A;  1PVB A;  1V1F A;  1UHK A;  2M97 A;  2ZKM X;  3BUX B;  2M9G A;  5ER4 X;  2LVJ A;  4CPV A;  1CM1 A;  2K7O A;  2SCP A;  2KGB C;  1KSM A;  2CT9 A;  2KQY A;  2PAL A;  2KDH A;  1DGV A;  3I5H C;  1NCZ A;  1ZFS A;  1BOD A;  1R6P A;  2KOT A;  1TTX A;  2LC5 A;  5CPV A;  1IQ3 A;  1XA5 A;  4OCI A;  1SK6 D;  3EVU A;  1OZO A;  5KSZ A;  1KK8 C;  2K8M B;  2LLU A;  1NYA A;  1CM4 A;  2F2P A;  5IBW A;  1ODB A;  2BBN A;  4M2O A;  3IQO A;  1U5I A;  3TUY B;  1YVH A;  3SIA A;  5JJG A;  4ORB B;  4UPG A;  1H8B A;  1SCM B;  3BQ3 A;  1FPW A;  1QIW A;  3EK7 A;  4GGF C;  1SL8 A;  5JOL A;  3TS5 C;  2JT3 A;  2JTT A;  1L2O C;  4C0K A;  2LHL A;  3SIB A;  3OX5 A;  3OHM B;  1IQ5 A;  1B7T Z;  2L0P A;  1W7J B;  3JVT C;  4PDZ A;  1EH2 A;  2RGI A;  4ETO A;  1FI5 A;  1UHJ A;  1WLM A;  4FTG A;  3LK0 A;  1BLQ A;  3GK1 A;  1ZUZ A;  4MSP A;  1EXR A;  2JXC A;  4MVF A;  3AKA A;  1QV1 A;  2MRD A;  2AAO A;  5ER5 A;  3VRN A;  2LNK A;  1HT9 A;  1CFD A;  4GNK B;  5AXI A;  2H61 C;  1PK0 D;  3RM1 A;  1B8R A;  4GGN A;  3VRR A;  2JNF A;  3OB1 B;  3PN7 C;  1NSH A;  4GGF A;  1AJ5 A;  1A29 A;  3KPX A;  4M2Q A;  1JSA A;  5HLV A;  2HPS A;  1CTR A;  4BY4 A;  2L51 A;  2K7C A;  3KO0 A;  1B1G A;  2EC6 B;  2GGZ A;  2KBM A;  1DT7 B;  1FF1 A;  1BOC A;  4HRH A;  2KI6 D;  1QXP A;  3CR2 A;  4PE4 A;  3CWG A;  1LA3 A;  2JC2 A;  3PLF B;  4HSZ A;  4WQ2 A;  2CNP A;  2KAX A;  2V53 A;  1S26 D;  3LCP C;  2H61 A;  1QAT A;  1QLK A;  4R1E A;  1NX0 A;  4F0Z B;  3PSR A;  3EK8 A;  3CGA A;  2LP2 A;  1TNX A;  3NSO A;  4MZK A;  2E6W A;  1RRO A;  3BUM B;  2K7B A;  4PHM A;  2CBL A;  2GGM A;  2WCE A;  3ICB A;  2R2I A;  1A75 B;  3TUY C;  5F6T A;  1LKJ A;  3TDI A;  4C0J A;  1SMG A;  2B1U A;  4ORC B;  2EGD A;  2JT0 A;  3AAK A;  1TNQ A;  3EKJ A;  1B8C A;  5GQQ C;  1OMD A;  4DCK A;  1J7O A;  1SBJ A;  3EVV A;  3EVR A;  2Y1M A;  4QJ3 B;  1UWO A;  1K9K A;  2JU0 A;  5G08 A;  1RTP 1;  1BR1 B;  3NXA A;  2VRG A;  1CDP A;  2M3W A;  2BKH B;  1M46 A;  3CS1 A;  1AUI B;  1KCY A;  4OVN F;  1L7Z A;  1OE9 B;  4PE7 A;  1G33 A;  4GBA A;  4N5X A;  4Q04 A;  1JF2 A;  4CID A;  1KFX L;  4NDD A;  2D8N A;  1KFU L;  2OTG B;  4XJK B;  1NP8 A;  4JPZ B;  1LXF C;  2ZFD A;  2G2B A;  1DJI A;  3WXA A;  3FIA A;  3CR5 X;  5HKZ A;  2COL B;  2IS9 A;  1RK9 A;  1QAS A;  5DKN A;  3GK2 A;  2LHI A;  1GQM A;  1F4O A;  2H2K A;  1WRK A;  3I5F C;  3BUN B;  4M2P A;  1C07 A;  1UUS A;  2KFH A;  1CDM A;  2LLS A;  1AHR A;  1XFW O;  1NPQ A;  1K94 A;  1XVJ A;  3HX4 A;  2F3Y A;  1VRK A;  2M8U A;  2Y4Q A;  2LUX A;  1GGW A;  1CDN A;  3H4S E;  1J1E A;  1E8A A;  1MQ1 A;  1IH0 A;  2FCD A;  1CMG A;  1YX7 A;  1S1E A;  3ZNI A;  4N1F A;  3OB2 B;  1TCO B;  1DJH A;  2I94 A;  3CTN A;  2KSP A;  1MXE A;  1K95 A;  1QVI Z;  4PE1 A;  1K8U A;  2KI4 B;  4YGC B;  4XYN A;  1KQM C;  1EJ3 A;  2OS8 B;  1CLL A;  1MHO A;  3JTD B;  3GOF A;  1IRJ A;  2AUC A;  3HCM A;  4YI8 A;  1KQV A;  1AJ4 A;  1NWD A;  1SPY A;  2F3Z A;  2JT8 A;  1XFX O;  3KF9 A;  1HQV A;  2MAZ A;  1TOP A;  4ZCU A;  3DF0 B;  5HYD A;  1OQP A;  3LL8 B;  1M63 B;  1WDC C;  3TDZ A;  1XK4 A;  2SAS A;  3IF7 A;  1JC2 A;  1NCY A;  2WND A;  4E68 A;  1S5G Y;  1V1G A;  1K2H A;  1YRT B;  1A75 A;  2WCF A;  5I2Q A;  2JZI A;  2BL0 C;  2PAS A;  1CLB A;  2WCB A;  2OTG C;  2KYF A;  1UHH A;  1DVI A;  3PFV A;  2DOQ A;  3K21 A;  1KWO C;  1QS7 A;  2K61 A;  1SKT A;  3O78 A;  1M31 A;  3SG6 A;  1DJX A;  1SCV A;  2BEC A;  4MEW A;  4YGE B;  1GGZ A;  1GJY A;  1TCF A;  3O2P A;  4GAO A;  4I5J A;  1LA0 A;  3I5I C;  2K2F A;  2M29 A;  4NQG A;  3CR4 X;  1SR6 B;  1SL7 A;  4A4C A;  2Q4U A;  2BCX A;  1MXL C;  4YRU A;  2KAY A;  5CSJ A;  1YUR A;  1ALW A;  3WHU B;  2NZ0 A;  2PVB A;  3SG5 A;  3OP0 A;  1PRW A;  4CFQ A;  2E30 A;  2L5X B;  5TNC A;  4D1E A;  1AK8 A;  1S36 A;  2NCO A;  1F8H A;  1Y0V H;  1XFZ O;  1PUL A;  4MBE A;  4MRY A;  4XJK A;  4YGD B;  2JWW A;  3I5G B;  1YR5 A;  2Y1N A;  3F45 A;  4YGA A;  1NIW A;  5KU1 A;  1DGU A;  1PAL A;  1Q80 A;  2GV5 A;  2QPT A;  3EK4 A;  4OR9 B;  5K89 A;  1TNP A;  3RLZ A;  1J55 A;  1NX2 A;  4DRW A;  1Y1A A;  2F33 A;  4OKH A;  1OMV A;  1JF0 A;  4ORA B;  1DTL A;  4PHJ A;  1W7I B;  1BR4 B;  2A4J A;  5FYX A;  1IJ5 A;  1SRA A;  1SCM C;  3LK1 A;  3SG2 A;  3VGO A;  2LMT A;  2NLN A;  5J3X A;  1CKK A;  3DD4 A;  2Q91 A;  1EL4 A;  3D10 A;  1K9P A;  1IJ6 A;  2ZND A;  1EG4 A;  1G4Y R;  2JXL A;  1SL9 A;  2KI6 C;  1DJZ A;  1RJV A;  4WRI A;  2L2E A;  1OMR A;  1CFC A;  1K93 D;  3I5H B;  4ZCV A;  1B47 A;  2MLE C;  3BYA A;  1CNP A;  2KFF A;  4BY5 A;  3QRX A;  5KTY A;  1WRL A;  3NSI A;  1YVL A;  1BJF A;  1YUT A;  2JQ6 A;  1PVA A;  1Y1X A;  2FCE A;  1IGV A;  3KHE A;  3M0W A;  1KK8 B;  1KK7 Z;  1YUU A;  5CSI A;  2LVI A;  2CXJ A;  1TIZ A;  3VRQ A;  1DF0 B;  1SY9 A;  2WC8 A;  1MF8 B;  1CLM A;  1SR6 C;  4OV2 A;  5BPJ A;  3VRO A;  1A4P A;  1FBV A;  3TS5 B;  2EC6 C;  1XFV O;  2BBM A;  1XFY O;  3DF0 A;  1XYD A;  3LLE A;  2JPT A;  2M1K B;  2M1U A;  4A4B A;  5D7F A;  3NSK A;  1CFF A;  4QJ4 B;  1N2D A;  1TN4 A;  2K0J A;  3JVT B;  4I5L B;  4N1G A;  2JOJ A;  5AER A;  1UP5 A;  1CMF A;  2WOS A;  5HKW A;  2M49 B;  4JWQ A;  4CFR A;  4TNC A;  1MUX A;  2PSR A;  1JFJ A;  1ZAC A;  4NDB A;  3TDU A;  4DS7 A;  3FWC A;  2KGR A;  5HLO A;  1JFK A;  1Y6W A;  3EKH A;  4PCW A;  2KHN A;  2M0R A;  1NCX A;  1XK4 C;  1YX8 A;  2L4H A;  2LM5 A;  1F71 A;  3OX6 A;  2MJW B;  3PAT A;  3SJS A;  2LAP A;  3D0Y B;  4GFT A;  3PN7 B;  2P6B B;  3TZ1 A;  1QV0 A;  3A4U B;  4PE0 A;  5I2L A;  1UHI A;  5B8I B;  5AEQ A;  1S5G Z;  1J7R A;  4USL A;  1S6J A;  3FWB A;  1XFU O;  1K96 A;  1M39 A;  2L50 A;  2K7D A;  4MN0 A;  2L4I A;  1OOJ A;  1YRU B;  4P2Y B;  4ICB A;  1XO5 A;  2O60 A;  4JQ0 D;  5DKQ A;  2LUC A;  1NUB A;  1BG1 A;  1B4C A;  2HQ8 A;  2LV7 A;  1S6I A;  2I7A A;  2BE4 A;  4YI9 A;  4PHK A;  5I2O A;  1IG5 A;  2MHH A;  1F54 A;  3ZWH A;  2KFG A;  4CLN A;  3DVE A;  1QX7 A;  4YBH B;  1BT6 A;  2FOT A;  2PRU A;  2LMU A;  4FQO A;  2MA2 A;  2HET A;  1A2X A;  4MLW A;  2BE6 A;  2ISD A;  2KQ6 A;  4WQ3 A;  2BCA A;  1DMO A;  1PSB A;  1J7P A;  3SG3 A;  1AVS A;  1BU3 A;  1QVI Y;  4DUQ A;  1QIV A;  1DJY A;  3E3R A;  3O4Y A;  4YGB B;  3O6B A;  2L98 A;  4PAL A;  4QJ5 B;  3C1V A;  3BOW B;  1KFX S;  1UUR A;  4AOM A;  2F2O A;  2M7L A;  2ZN9 A;  2ZN8 A;  5CSN A;  1KFU S;  1A03 A;  2LVK A;  3DVJ A;  2JNX A;  4DIR A;  5HKY A;  1SW8 A;  1NX3 A;  1DF0 A;  1TRF A;  1B7T Y;  1N65 A;  2CCM A;  5I8N A;  4U8D A;  2M7N A;  1WLZ A;  2LLT A;  4HRE E;  2LVV A;  1J1D A;  1F70 A;  1YUS A;  1LIN A;  1M45 A;  1NX1 A;  1S3P A;  1ZMZ A;  2KI4 C;  1SNL A;  1MR8 A;  2O5G A;  4GPL B;  2OS8 C;  5DKR A;  4P5O E;  1BF5 A;  2MLF C;  4L9M A;  4GUK A;  2FJU B;  3JTD C;  1DJW A;  1KSO A;  1EG3 A;  1RFJ A;  1U5I B;  3I5F B;  4I5N B;  2I18 A;  1K9U A;  5AAN A;  2JUL A;  3BXK A;  2LE9 B;  4HRG A;  1IWQ A;  1QX5 B;  2KNE A;  1C7V A;  3GK4 X;  2Y5I A;  4NDC A;  2EHB A;  1ZOT B;  1G8I A;  3MSE B;  2MBX A;  3VRP A;  5D69 A;  2LAN A;  1F55 A;  1REC A;  3FS7 A;  1OZS A;  3A8R A;  3AAJ A;  3D0Y A;  3KEV A;  3CZT X;  1AP4 A;  1QX2 A;  1QTX A;  3DVK A;  2KYC A;  1D1O A;  1MWN A;  2JRF A;  2NXQ A;  3PM8 A;  1UHN A;  2NCP A;  4MZJ A;  1ALV A;  1WRZ A;  2CTN A;  2WOR A;  2ZNE A;  3WHT B;  2TN4 A;  1KQM B;  1N0Y A;  2QAC A;  2ZRT A;  1R2U A;  1RWY A;  4AQI A;  4C0L A;  2F8P A;  1CDL A;  1Y1U A;  5PAL A;  5AFP A;  1JUO A;  3SG7 A;  4I5K A;  1L2O B;  1DJG A;  2KBI A;  4MRX A;  3SG4 A;  1LVC D;  1WY9 A;  1JBA A;  2BCB A;  2I2R E;  1WDC B;  2HF5 A;  2K2A A;  3AKB A; 
#chains in the Genus database with same CATH topology
 1J7Q A;  1PSR A;  3WNX B;  2LCP A;  3CLN A;  1OSA A;  2G9B A;  4MZL A;  5CSF A;  3I5G C;  2OPO A;  2BL0 B;  1B9A A;  1FW4 A;  2LMV A;  2KAV A;  3NSL A;  2AMI A;  3BUW B;  1JWD A;  1KWO B;  1QLS A;  3IQQ A;  4PHN A;  1X02 A;  1B8L A;  1SYM A;  2BKI B;  2LP3 A;  2ZRS A;  3BUO B;  3DVM A;  1BMO A;  1C7W A;  2JTZ A;  1CFP A;  2PQL A;  2PMY A;  2HQW A;  2BAP A;  1QJT A;  1YTZ C;  3K1E A;  1TNW A;  4AQJ A;  1FI6 A;  3I5I B;  1K90 D;  1OOI X;  4IL1 A;  5FI6 A;  1S6C A;  1H4B A;  1F4Q A;  3DZT A;  1KK7 Y;  4JKT A;  1CB1 A;  3PAL A;  3BOW A;  1IKU A;  1PVB A;  1V1F A;  1UHK A;  2M97 A;  2ZKM X;  3BUX B;  2M9G A;  5ER4 X;  2LVJ A;  4CPV A;  1CM1 A;  2K7O A;  2SCP A;  2KGB C;  1KSM A;  2CT9 A;  2KQY A;  2PAL A;  2KDH A;  1DGV A;  1LS8 A;  3BFH A;  3I5H C;  1NCZ A;  1ZFS A;  1DQE A;  1BOD A;  1R6P A;  2KOT A;  1TTX A;  2LC5 A;  5CPV A;  1IQ3 A;  1XA5 A;  4OCI A;  1SK6 D;  3EVU A;  1OZO A;  5KSZ A;  1KK8 C;  2K8M B;  1Z2C B;  2LLU A;  1NYA A;  3OGN A;  1CM4 A;  2F2P A;  5IBW A;  1ODB A;  2BBN A;  4M2O A;  3IQO A;  1U5I A;  3TUY B;  1YVH A;  3SIA A;  5JJG A;  4ORB B;  4UPG A;  1H8B A;  1SCM B;  3BQ3 A;  1FPW A;  1QIW A;  3EK7 A;  4GGF C;  1SL8 A;  5JOL A;  3TS5 C;  2JT3 A;  2JTT A;  1L2O C;  4C0K A;  2LHL A;  3SIB A;  3OX5 A;  3OHM B;  1IQ5 A;  1B7T Z;  3L4A A;  3SS5 A;  2L0P A;  1W7J B;  3JVT C;  4PDZ A;  4KYN A;  1EH2 A;  2RGI A;  4ETO A;  1FI5 A;  1UHJ A;  1WLM A;  4FQT A;  3LK0 A;  4FTG A;  1BLQ A;  3GK1 A;  1ZUZ A;  4MSP A;  1EXR A;  2JXC A;  4MVF A;  3AKA A;  1QV1 A;  2MRD A;  2AAO A;  5ER5 A;  3DY9 A;  2LNK A;  1HT9 A;  1CFD A;  1P28 A;  4GNK B;  2H61 C;  1PK0 D;  5AXI A;  3RM1 A;  1B8R A;  4GGN A;  4JD9 A;  3VRR A;  4OZD A;  2JNF A;  3OB1 B;  3PN7 C;  2KLE A;  1NSH A;  4GGF A;  1AJ5 A;  1A29 A;  3KPX A;  4M2Q A;  3B86 A;  5HLV A;  1JSA A;  2HPS A;  1CTR A;  4BY4 A;  2L51 A;  2K7C A;  3KO0 A;  1B1G A;  3CZ2 A;  3L47 A;  2EC6 B;  2GGZ A;  2KBM A;  1DT7 B;  1FF1 A;  1BOC A;  4HRH A;  2KI6 D;  1QXP A;  3CR2 A;  4PE4 A;  3CWG A;  1LA3 A;  2JC2 A;  3PLF B;  4HSZ A;  4WQ2 A;  2CNP A;  2KAX A;  2V53 A;  1S26 D;  3LCP C;  2H61 A;  1QAT A;  1QLK A;  4R1E A;  1NX0 A;  4F0Z B;  3PSR A;  3EK8 A;  3CGA A;  2LP2 A;  1TNX A;  3NSO A;  4MZK A;  2E6W A;  3CZ1 A;  1RRO A;  3BUM B;  2K7B A;  4PHM A;  2CBL A;  2GGM A;  3NHT A;  2WCE A;  3ICB A;  1DEK A;  2R2I A;  1A75 B;  3TUY C;  5F6T A;  1LKJ A;  3TDI A;  4C0J A;  1SMG A;  2B1U A;  3CYZ A;  4ORC B;  2EGD A;  2JT0 A;  2H8V A;  1TNQ A;  3AAK A;  3EKJ A;  1B8C A;  5GQQ C;  1OMD A;  3N7H A;  4DCK A;  1J7O A;  1SBJ A;  3EVV A;  3EVR A;  2Y1M A;  4QJ3 B;  1UWO A;  1K9K A;  2JU0 A;  5G08 A;  4A4B A;  1RTP 1;  1BR1 B;  3NXA A;  2VRG A;  1CDP A;  2M3W A;  2BKH B;  1M46 A;  3CS1 A;  1AUI B;  1KCY A;  3DXL A;  4OVN F;  1L7Z A;  1OE9 B;  4PE7 A;  1G33 A;  4GBA A;  3S0B A;  4N5X A;  2FJY A;  2L2C A;  4Q04 A;  1JF2 A;  4CID A;  1KFX L;  3PM2 A;  4NDD A;  3D74 A;  2D8N A;  1KFU L;  2OTG B;  4XJK B;  1NP8 A;  4JPZ B;  2WC5 A;  4INX A;  1LXF C;  2ZFD A;  2G2B A;  1DJI A;  3WXA A;  3FIA A;  3CR5 X;  5HKZ A;  5FI7 A;  2COL B;  1Z4H A;  2IS9 A;  1RK9 A;  1QAS A;  2QEV A;  5DKN A;  3GK2 A;  2LHI A;  1GQM A;  1F4O A;  2H2K A;  1WRK A;  3I5F C;  3BUN B;  4M2P A;  1C07 A;  1UUS A;  2KFH A;  3FE9 A;  1CDM A;  2LLS A;  1AHR A;  1XFW O;  2WCM A;  1NPQ A;  1K94 A;  1XVJ A;  3HX4 A;  2F3Y A;  1VRK A;  2K60 A;  2M8U A;  2LUX A;  2Y4Q A;  1CDN A;  1GGW A;  3H4S E;  1J1E A;  1E8A A;  1MQ1 A;  1IH0 A;  3BFB A;  2FCD A;  1CMG A;  1YX7 A;  1S1E A;  3ZNI A;  4N1F A;  5D3O A;  1TUZ A;  3OB2 B;  1TCO B;  1DJH A;  3EG5 B;  2I94 A;  3CTN A;  2KSP A;  1MXE A;  2BNX A;  1K95 A;  1QVI Z;  4PE1 A;  1K8U A;  2KI4 B;  3CZ0 A;  1TWO A;  4YGC B;  4XYN A;  1KQM C;  1EJ3 A;  2OS8 B;  1CLL A;  2KLD A;  1MHO A;  3JTD B;  3GOF A;  1IRJ A;  2AUC A;  3HCM A;  4YI8 A;  1KQV A;  1OOF A;  1AJ4 A;  3D77 A;  1NWD A;  1SPY A;  2F3Z A;  2JT8 A;  1XFX O;  3KF9 A;  2JPO A;  1HQV A;  2MAZ A;  1DEL A;  1TOP A;  4ZCU A;  3DF0 B;  5HYD A;  1OQP A;  3LL8 B;  1M63 B;  1WDC C;  3TDZ A;  1XK4 A;  2SAS A;  3IF7 A;  1JC2 A;  1NCY A;  2WND A;  4E68 A;  1S5G Y;  1V1G A;  1K2H A;  1YRT B;  1A75 A;  2WCF A;  5I2Q A;  2JZI A;  2BL0 C;  2PAS A;  1CLB A;  2WCB A;  2OTG C;  2KYF A;  2QEH A;  3RZS A;  1UHH A;  1DVI A;  3PFV A;  2DOQ A;  2QEB A;  3DYE A;  3K21 A;  1KWO C;  1QS7 A;  2K61 A;  1SKT A;  3O78 A;  1M31 A;  3SG6 A;  1DJX A;  1SCV A;  2BEC A;  2L5Y A;  4MEW A;  4YGE B;  3D76 A;  1GGZ A;  1GJY A;  1TCF A;  3O2P A;  4GAO A;  4I5J A;  1LA0 A;  3I5I C;  2K2F A;  2M29 A;  4NQG A;  3CR4 X;  1SR6 B;  4PT1 A;  1SL7 A;  4A4C A;  2Q4U A;  2BCX A;  1T14 A;  1TUJ A;  1MXL C;  4YRU A;  2KAY A;  5CSJ A;  1YUR A;  1ALW A;  3QME A;  3VB1 A;  3WHU B;  2NZ0 A;  1OOG A;  2PVB A;  5EL2 A;  3SG5 A;  3OP0 A;  1PRW A;  4CFQ A;  2E30 A;  2L5X B;  3CAB A;  5TNC A;  4D1E A;  1AK8 A;  1S36 A;  2NCO A;  1F8H A;  1Y0V H;  1XFZ O;  1PUL A;  4MBE A;  4MRY A;  4XJK A;  4YGD B;  2JWW A;  3I5G B;  1YR5 A;  2Y1N A;  3F45 A;  4YGA A;  1NIW A;  5KU1 A;  1DGU A;  1PAL A;  1Q80 A;  2GV5 A;  2QPT A;  3EK4 A;  4OR9 B;  5K89 A;  1TNP A;  3RLZ A;  1OW4 A;  1J55 A;  3BJH A;  1NX2 A;  2QEO A;  3B88 A;  4DRW A;  1Y1A A;  2F33 A;  4OKH A;  1OMV A;  1JF0 A;  4ORA B;  1DTL A;  4PHJ A;  1W7I B;  1BR4 B;  2A4J A;  5FYX A;  1IJ5 A;  1SRA A;  1SCM C;  3LK1 A;  3R1O A;  3SG2 A;  3VGO A;  2LMT A;  2NLN A;  3OBV A;  5J3X A;  1ORG A;  1CKK A;  3DD4 A;  2Q91 A;  1EL4 A;  3D10 A;  1K9P A;  1IJ6 A;  2ZND A;  1EG4 A;  1G4Y R;  2JXL A;  3FE6 A;  4IJ7 A;  1SL9 A;  2KI6 C;  1DJZ A;  1RJV A;  4WRI A;  2L2E A;  1OMR A;  2GTE A;  1CFC A;  1K93 D;  3I5H B;  4ZCV A;  1B47 A;  2MLE C;  3BYA A;  1CNP A;  2KFF A;  4BY5 A;  3QRX A;  5KTY A;  1WRL A;  3NSI A;  1YVL A;  1BJF A;  1YUT A;  2JQ6 A;  1OOH A;  1PVA A;  1Y1X A;  3NHI A;  2FCE A;  3D78 A;  1IGV A;  1XFR A;  3KHE A;  3B7A A;  3M0W A;  1KK8 B;  1KK7 Z;  1YUU A;  3IVT A;  5CSI A;  2LVI A;  3PJI A;  2CXJ A;  2YGU A;  1TIZ A;  3VRQ A;  1DF0 B;  1SY9 A;  2WC8 A;  1MF8 B;  1CLM A;  1SR6 C;  4OV2 A;  2P70 A;  3VRO A;  1A4P A;  5BPJ A;  1FBV A;  3TS5 B;  2EC6 C;  1XFV O;  2BBM A;  1XFY O;  3DF0 A;  1XYD A;  3LLE A;  2JPT A;  2M1K B;  2M1U A;  5DIC A;  3UNW A;  5D7F A;  3NSK A;  1CFF A;  4QJ4 B;  1QWV A;  3CDN A;  1N2D A;  1TN4 A;  2K0J A;  3JVT B;  4I5L B;  4N1G A;  2JOJ A;  5AER A;  1UP5 A;  1CMF A;  2WOS A;  5HKW A;  2M49 B;  4JWQ A;  4CFR A;  4TNC A;  1MUX A;  2PSR A;  3D73 A;  3R1V A;  1ZAC A;  1JFJ A;  4NDB A;  3TDU A;  4DS7 A;  2WCH A;  3FWC A;  2KGR A;  5I94 A;  5HLO A;  1JFK A;  1Y6W A;  2WCL A;  3EKH A;  4PCW A;  2KHN A;  2M0R A;  1NCX A;  1XK4 C;  1YX8 A;  2L4H A;  2LM5 A;  3D75 A;  1F71 A;  3OX6 A;  1C3Z A;  2MJW B;  3PAT A;  3SJS A;  2LAP A;  3D0Y B;  4GFT A;  3PN7 B;  2P6B B;  3TZ1 A;  1QV0 A;  3A4U B;  4PE0 A;  5I2L A;  1UHI A;  5B8I B;  3NGV A;  4F7F A;  5AEQ A;  1S5G Z;  1J7R A;  4USL A;  1S6J A;  3FWB A;  1XFU O;  1K96 A;  1M39 A;  3VRN A;  2L50 A;  3SS4 A;  2K7D A;  4MN0 A;  2L4I A;  1OOJ A;  1YRU B;  4P2Y B;  4ICB A;  1XO5 A;  2O60 A;  2ERB A;  4JQ0 D;  5DKQ A;  2LUC A;  1NUB A;  1BG1 A;  1B4C A;  2HQ8 A;  2LV7 A;  5HL1 A;  1S6I A;  1DC1 A;  2I7A A;  2PYQ A;  2BE4 A;  4YI9 A;  4PHK A;  5I2O A;  1IG5 A;  5FI2 A;  2MHH A;  1F54 A;  3ZWH A;  2KFG A;  4CLN A;  3DVE A;  1QX7 A;  4YBH B;  1BT6 A;  2FOT A;  2PRU A;  2WC6 A;  2LMU A;  4FQO A;  3UO9 A;  3Q8I A;  2MA2 A;  2HET A;  1A2X A;  3FE8 A;  4MLW A;  2BE6 A;  2ISD A;  2KQ6 A;  3B87 A;  2BCA A;  4WQ3 A;  1DMO A;  1PSB A;  1J7P A;  3SG3 A;  1AVS A;  1BU3 A;  1QVI Y;  4DUQ A;  1QIV A;  1DJY A;  3E3R A;  3O4Y A;  4YGB B;  3O6B A;  2L98 A;  4PAL A;  4QJ5 B;  3C1V A;  3BOW B;  1KFX S;  1UUR A;  1SSE B;  4AOM A;  2F2O A;  2M7L A;  2ZN9 A;  2ZN8 A;  3S0E A;  5CSN A;  1KFU S;  1A03 A;  2LVK A;  3DVJ A;  2JNX A;  4DIR A;  3B6X A;  5HKY A;  1SW8 A;  1NX3 A;  1DF0 A;  1TRF A;  1B7T Y;  3S0G A;  1N65 A;  2CCM A;  3L4L A;  4U8D A;  5I8N A;  2M7N A;  1WLZ A;  2LLT A;  4HRE E;  2LVV A;  1J1D A;  1F70 A;  1YUS A;  1LIN A;  1M45 A;  1NX1 A;  1S3P A;  1ZMZ A;  2KI4 C;  1SNL A;  1IIO A;  1MR8 A;  2O5G A;  4GPL B;  2OS8 C;  5DKR A;  4P5O E;  3S0F A;  2MLF C;  1BF5 A;  4L9M A;  4GUK A;  2FJU B;  3JTD C;  2WCJ A;  1DJW A;  1KSO A;  3R1P A;  3S0A A;  1EG3 A;  1RFJ A;  1U5I B;  3I5F B;  4I5N B;  2I18 A;  1K9U A;  3S0D A;  2P71 A;  5AAN A;  2JUL A;  2KPH A;  3BXK A;  2LE9 B;  2QDI A;  4HRG A;  1IWQ A;  1QX5 B;  2KNE A;  1C7V A;  3GK4 X;  2Y5I A;  4NDC A;  2EHB A;  1ZOT B;  1G8I A;  3MSE B;  2MBX A;  3VRP A;  5D69 A;  2LAN A;  1F55 A;  1REC A;  3FS7 A;  1OZS A;  3A8R A;  3AAJ A;  3D0Y A;  1W9Z A;  3R72 A;  3KEV A;  3O4X A;  3CZT X;  1AP4 A;  1QX2 A;  1QTX A;  3DVK A;  2KYC A;  1D1O A;  1MWN A;  2JRF A;  2NXQ A;  3PM8 A;  4INW A;  3BFA A;  1UHN A;  2NCP A;  4MZJ A;  1ALV A;  1WRZ A;  2CTN A;  2WOR A;  2ZNE A;  3WHT B;  2TN4 A;  1KQM B;  1N0Y A;  2QAC A;  2ZRT A;  1R2U A;  1RWY A;  4AQI A;  4C0L A;  2F8P A;  1CDL A;  3SS3 A;  1Y1U A;  5PAL A;  5AFP A;  1JUO A;  3SG7 A;  2WCK A;  4I5K A;  1L2O B;  1DJG A;  2KBI A;  1C3Y A;  4MRX A;  3V2L A;  3SG4 A;  1LVC D;  1WY9 A;  1JBA A;  1GM0 A;  2BCB A;  2I2R E;  1WDC B;  2HF5 A;  2K2A A;  3AKB A; 
#chains in the Genus database with same CATH homology
 1J7Q A;  1PSR A;  3WNX B;  2LCP A;  3CLN A;  1OSA A;  2G9B A;  4MZL A;  5CSF A;  3I5G C;  2OPO A;  2BL0 B;  1B9A A;  1FW4 A;  2LMV A;  2KAV A;  3NSL A;  2AMI A;  3BUW B;  1JWD A;  1KWO B;  1QLS A;  3IQQ A;  4PHN A;  1X02 A;  1B8L A;  1SYM A;  2BKI B;  2LP3 A;  2ZRS A;  3BUO B;  3DVM A;  1BMO A;  1C7W A;  2JTZ A;  1CFP A;  2PMY A;  2HQW A;  1QJT A;  1YTZ C;  1TNW A;  4AQJ A;  1FI6 A;  3I5I B;  1K90 D;  4IL1 A;  1S6C A;  1H4B A;  1F4Q A;  1KK7 Y;  1CB1 A;  3PAL A;  3BOW A;  1IKU A;  1PVB A;  1V1F A;  1UHK A;  2M97 A;  2ZKM X;  3BUX B;  2M9G A;  5ER4 X;  2LVJ A;  4CPV A;  1CM1 A;  2K7O A;  2SCP A;  2KGB C;  1KSM A;  2CT9 A;  2KQY A;  2PAL A;  2KDH A;  1DGV A;  3I5H C;  1NCZ A;  1ZFS A;  1BOD A;  1R6P A;  2KOT A;  1TTX A;  2LC5 A;  5CPV A;  1IQ3 A;  1XA5 A;  4OCI A;  1SK6 D;  3EVU A;  1OZO A;  5KSZ A;  1KK8 C;  2K8M B;  2LLU A;  1NYA A;  1CM4 A;  2F2P A;  5IBW A;  1ODB A;  2BBN A;  4M2O A;  3IQO A;  1U5I A;  3TUY B;  1YVH A;  3SIA A;  5JJG A;  4ORB B;  4UPG A;  1H8B A;  1SCM B;  3BQ3 A;  1FPW A;  1QIW A;  3EK7 A;  4GGF C;  1SL8 A;  5JOL A;  3TS5 C;  2JT3 A;  2JTT A;  1L2O C;  4C0K A;  2LHL A;  3SIB A;  3OX5 A;  3OHM B;  1IQ5 A;  1B7T Z;  2L0P A;  1W7J B;  3JVT C;  4PDZ A;  1EH2 A;  2RGI A;  4ETO A;  1FI5 A;  1UHJ A;  1WLM A;  4FTG A;  3LK0 A;  1BLQ A;  3GK1 A;  1ZUZ A;  4MSP A;  1EXR A;  2JXC A;  4MVF A;  3AKA A;  1QV1 A;  2MRD A;  2AAO A;  5ER5 A;  3VRN A;  2LNK A;  1HT9 A;  1CFD A;  4GNK B;  5AXI A;  2H61 C;  1PK0 D;  3RM1 A;  1B8R A;  4GGN A;  3VRR A;  2JNF A;  3OB1 B;  3PN7 C;  1NSH A;  4GGF A;  1AJ5 A;  1A29 A;  3KPX A;  4M2Q A;  1JSA A;  5HLV A;  2HPS A;  1CTR A;  4BY4 A;  2L51 A;  2K7C A;  3KO0 A;  1B1G A;  2EC6 B;  2GGZ A;  2KBM A;  1DT7 B;  1FF1 A;  1BOC A;  4HRH A;  2KI6 D;  1QXP A;  3CR2 A;  4PE4 A;  3CWG A;  1LA3 A;  2JC2 A;  3PLF B;  4HSZ A;  4WQ2 A;  2CNP A;  2KAX A;  2V53 A;  1S26 D;  3LCP C;  2H61 A;  1QAT A;  1QLK A;  4R1E A;  1NX0 A;  4F0Z B;  3PSR A;  3EK8 A;  3CGA A;  2LP2 A;  1TNX A;  3NSO A;  4MZK A;  2E6W A;  1RRO A;  3BUM B;  2K7B A;  4PHM A;  2CBL A;  2GGM A;  2WCE A;  3ICB A;  2R2I A;  1A75 B;  3TUY C;  5F6T A;  1LKJ A;  3TDI A;  4C0J A;  1SMG A;  2B1U A;  4ORC B;  2EGD A;  2JT0 A;  3AAK A;  1TNQ A;  3EKJ A;  1B8C A;  5GQQ C;  1OMD A;  4DCK A;  1J7O A;  1SBJ A;  3EVV A;  3EVR A;  2Y1M A;  4QJ3 B;  1UWO A;  1K9K A;  2JU0 A;  5G08 A;  1RTP 1;  1BR1 B;  3NXA A;  2VRG A;  1CDP A;  2M3W A;  2BKH B;  1M46 A;  3CS1 A;  1AUI B;  1KCY A;  4OVN F;  1L7Z A;  1OE9 B;  4PE7 A;  1G33 A;  4GBA A;  4N5X A;  4Q04 A;  1JF2 A;  4CID A;  1KFX L;  4NDD A;  2D8N A;  1KFU L;  2OTG B;  4XJK B;  1NP8 A;  4JPZ B;  1LXF C;  2ZFD A;  2G2B A;  1DJI A;  3WXA A;  3FIA A;  3CR5 X;  5HKZ A;  2COL B;  2IS9 A;  1RK9 A;  1QAS A;  5DKN A;  3GK2 A;  2LHI A;  1GQM A;  1F4O A;  2H2K A;  1WRK A;  3I5F C;  3BUN B;  4M2P A;  1C07 A;  1UUS A;  2KFH A;  1CDM A;  2LLS A;  1AHR A;  1XFW O;  1NPQ A;  1K94 A;  1XVJ A;  3HX4 A;  2F3Y A;  1VRK A;  2M8U A;  2Y4Q A;  2LUX A;  1GGW A;  1CDN A;  3H4S E;  1J1E A;  1E8A A;  1MQ1 A;  1IH0 A;  2FCD A;  1CMG A;  1YX7 A;  1S1E A;  3ZNI A;  4N1F A;  3OB2 B;  1TCO B;  1DJH A;  2I94 A;  3CTN A;  2KSP A;  1MXE A;  1K95 A;  1QVI Z;  4PE1 A;  1K8U A;  2KI4 B;  4YGC B;  4XYN A;  1KQM C;  1EJ3 A;  2OS8 B;  1CLL A;  1MHO A;  3JTD B;  3GOF A;  1IRJ A;  2AUC A;  3HCM A;  4YI8 A;  1KQV A;  1AJ4 A;  1NWD A;  1SPY A;  2F3Z A;  2JT8 A;  1XFX O;  3KF9 A;  1HQV A;  2MAZ A;  1TOP A;  4ZCU A;  3DF0 B;  5HYD A;  1OQP A;  3LL8 B;  1M63 B;  1WDC C;  3TDZ A;  1XK4 A;  2SAS A;  3IF7 A;  1JC2 A;  1NCY A;  2WND A;  4E68 A;  1S5G Y;  1V1G A;  1K2H A;  1YRT B;  1A75 A;  2WCF A;  5I2Q A;  2JZI A;  2BL0 C;  2PAS A;  1CLB A;  2WCB A;  2OTG C;  2KYF A;  1UHH A;  1DVI A;  3PFV A;  2DOQ A;  3K21 A;  1KWO C;  1QS7 A;  2K61 A;  1SKT A;  3O78 A;  1M31 A;  3SG6 A;  1DJX A;  1SCV A;  2BEC A;  4MEW A;  4YGE B;  1GGZ A;  1GJY A;  1TCF A;  3O2P A;  4GAO A;  4I5J A;  1LA0 A;  3I5I C;  2K2F A;  2M29 A;  4NQG A;  3CR4 X;  1SR6 B;  1SL7 A;  4A4C A;  2Q4U A;  2BCX A;  1MXL C;  4YRU A;  2KAY A;  5CSJ A;  1YUR A;  1ALW A;  3WHU B;  2NZ0 A;  2PVB A;  3SG5 A;  3OP0 A;  1PRW A;  4CFQ A;  2E30 A;  2L5X B;  5TNC A;  4D1E A;  1AK8 A;  1S36 A;  2NCO A;  1F8H A;  1Y0V H;  1XFZ O;  1PUL A;  4MBE A;  4MRY A;  4XJK A;  4YGD B;  2JWW A;  3I5G B;  1YR5 A;  2Y1N A;  3F45 A;  4YGA A;  1NIW A;  5KU1 A;  1DGU A;  1PAL A;  1Q80 A;  2GV5 A;  2QPT A;  3EK4 A;  4OR9 B;  5K89 A;  1TNP A;  3RLZ A;  1J55 A;  1NX2 A;  4DRW A;  1Y1A A;  2F33 A;  4OKH A;  1OMV A;  1JF0 A;  4ORA B;  1DTL A;  4PHJ A;  1W7I B;  1BR4 B;  2A4J A;  5FYX A;  1IJ5 A;  1SRA A;  1SCM C;  3LK1 A;  3SG2 A;  3VGO A;  2LMT A;  2NLN A;  5J3X A;  1CKK A;  3DD4 A;  2Q91 A;  1EL4 A;  3D10 A;  1K9P A;  1IJ6 A;  2ZND A;  1EG4 A;  1G4Y R;  2JXL A;  1SL9 A;  2KI6 C;  1DJZ A;  1RJV A;  4WRI A;  2L2E A;  1OMR A;  1CFC A;  1K93 D;  3I5H B;  4ZCV A;  1B47 A;  2MLE C;  3BYA A;  1CNP A;  2KFF A;  4BY5 A;  3QRX A;  5KTY A;  1WRL A;  3NSI A;  1YVL A;  1BJF A;  1YUT A;  2JQ6 A;  1PVA A;  1Y1X A;  2FCE A;  1IGV A;  3KHE A;  3M0W A;  1KK8 B;  1KK7 Z;  1YUU A;  5CSI A;  2LVI A;  2CXJ A;  1TIZ A;  3VRQ A;  1DF0 B;  1SY9 A;  2WC8 A;  1MF8 B;  1CLM A;  1SR6 C;  4OV2 A;  5BPJ A;  3VRO A;  1A4P A;  1FBV A;  3TS5 B;  2EC6 C;  1XFV O;  2BBM A;  1XFY O;  3DF0 A;  1XYD A;  3LLE A;  2JPT A;  2M1K B;  2M1U A;  4A4B A;  5D7F A;  3NSK A;  1CFF A;  4QJ4 B;  1N2D A;  1TN4 A;  2K0J A;  3JVT B;  4I5L B;  4N1G A;  2JOJ A;  5AER A;  1UP5 A;  1CMF A;  2WOS A;  5HKW A;  2M49 B;  4JWQ A;  4CFR A;  4TNC A;  1MUX A;  2PSR A;  1JFJ A;  1ZAC A;  4NDB A;  3TDU A;  4DS7 A;  3FWC A;  2KGR A;  5HLO A;  1JFK A;  1Y6W A;  3EKH A;  4PCW A;  2KHN A;  2M0R A;  1NCX A;  1XK4 C;  1YX8 A;  2L4H A;  2LM5 A;  1F71 A;  3OX6 A;  2MJW B;  3PAT A;  3SJS A;  2LAP A;  3D0Y B;  4GFT A;  3PN7 B;  2P6B B;  3TZ1 A;  1QV0 A;  3A4U B;  4PE0 A;  5I2L A;  1UHI A;  5B8I B;  5AEQ A;  1S5G Z;  1J7R A;  4USL A;  1S6J A;  3FWB A;  1XFU O;  1K96 A;  1M39 A;  2L50 A;  2K7D A;  4MN0 A;  2L4I A;  1OOJ A;  1YRU B;  4P2Y B;  4ICB A;  1XO5 A;  2O60 A;  4JQ0 D;  5DKQ A;  2LUC A;  1NUB A;  1BG1 A;  1B4C A;  2HQ8 A;  2LV7 A;  1S6I A;  2I7A A;  2BE4 A;  4YI9 A;  4PHK A;  5I2O A;  1IG5 A;  2MHH A;  1F54 A;  3ZWH A;  2KFG A;  4CLN A;  3DVE A;  1QX7 A;  4YBH B;  1BT6 A;  2FOT A;  2PRU A;  2LMU A;  4FQO A;  2MA2 A;  2HET A;  1A2X A;  4MLW A;  2BE6 A;  2ISD A;  2KQ6 A;  4WQ3 A;  2BCA A;  1DMO A;  1PSB A;  1J7P A;  3SG3 A;  1AVS A;  1BU3 A;  1QVI Y;  4DUQ A;  1QIV A;  1DJY A;  3E3R A;  3O4Y A;  4YGB B;  3O6B A;  2L98 A;  4PAL A;  4QJ5 B;  3C1V A;  3BOW B;  1KFX S;  1UUR A;  4AOM A;  2F2O A;  2M7L A;  2ZN9 A;  2ZN8 A;  5CSN A;  1KFU S;  1A03 A;  2LVK A;  3DVJ A;  2JNX A;  4DIR A;  5HKY A;  1SW8 A;  1NX3 A;  1DF0 A;  1TRF A;  1B7T Y;  1N65 A;  2CCM A;  5I8N A;  4U8D A;  2M7N A;  1WLZ A;  2LLT A;  4HRE E;  2LVV A;  1J1D A;  1F70 A;  1YUS A;  1LIN A;  1M45 A;  1NX1 A;  1S3P A;  1ZMZ A;  2KI4 C;  1SNL A;  1MR8 A;  2O5G A;  4GPL B;  2OS8 C;  5DKR A;  4P5O E;  1BF5 A;  2MLF C;  4L9M A;  4GUK A;  2FJU B;  3JTD C;  1DJW A;  1KSO A;  1EG3 A;  1RFJ A;  1U5I B;  3I5F B;  4I5N B;  2I18 A;  1K9U A;  5AAN A;  2JUL A;  3BXK A;  2LE9 B;  4HRG A;  1IWQ A;  1QX5 B;  2KNE A;  1C7V A;  3GK4 X;  2Y5I A;  4NDC A;  2EHB A;  1ZOT B;  1G8I A;  3MSE B;  2MBX A;  3VRP A;  5D69 A;  2LAN A;  1F55 A;  1REC A;  3FS7 A;  1OZS A;  3A8R A;  3AAJ A;  3D0Y A;  3KEV A;  3CZT X;  1AP4 A;  1QX2 A;  1QTX A;  3DVK A;  2KYC A;  1D1O A;  1MWN A;  2JRF A;  2NXQ A;  3PM8 A;  1UHN A;  2NCP A;  4MZJ A;  1ALV A;  1WRZ A;  2CTN A;  2WOR A;  2ZNE A;  3WHT B;  2TN4 A;  1KQM B;  1N0Y A;  2QAC A;  2ZRT A;  1R2U A;  1RWY A;  4AQI A;  4C0L A;  2F8P A;  1CDL A;  1Y1U A;  5PAL A;  5AFP A;  1JUO A;  3SG7 A;  4I5K A;  1L2O B;  1DJG A;  2KBI A;  4MRX A;  3SG4 A;  1LVC D;  1WY9 A;  1JBA A;  2BCB A;  2I2R E;  1WDC B;  2HF5 A;  2K2A A;  3AKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...