3QRXA

Chlamydomonas reinhardtii centrin bound to melittin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
VGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKMGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure, molecular dynamics, and energetics of centrin-melittin complex.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Metal binding protein/toxin
molecule keywords Centrin
total genus 49
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3qrxA02
1WLZA 1W7JB 3VGOA 3VRQA 1R2UA 3K21A 1K95A 1GJYA 1BMOA 2R2IA 1SK6D 2KSPA 3OP0A 1S6CA 1BLQA 1N2DA 1XFVO 1M45A 4MSPA 4YGCB 1MHOA 2FCDA 1SR6C 4OR9B 1WRZA 3NSLA 1QVIY 2LP2A 4OCIA 2HQWA 1OSAA 1S3PA 3EKJA 2NCOA 5K89A 5ER5A 2COLB 1NUBA 2BL0B 2Q4UA 2MAZA 1WY9A 2BBMA 5CSJA 5HKZA 2DOQA 3VRPA 1FI6A 2F2OA 1B7TZ 1WDCB 3E3RA 1RK9A 1PRWA 3OX5A 1A2XA 2M49B 1CFFA 1MQ1A 2K61A 2PALA 1DJWA 2JRFA 4I5JA 4AQIA 2K7BA 1KFXL 2KAVA 4PE7A 4GNKB 1TN4A 4ORAB 4WRIA 4FQOA 3PM8A 3EVVA 1CFPA 3CGAA 4A4CA 4XYNA 2OPOA 3JVTB 4CPVA 4M2PA 1A75B 3SG2A 2KNEA 1IG5A 2Y1MA 2F3ZA 3BOWB 3BUXB 3O78A 4USLA 1QVIZ 1ZOTB 3WHUB 2JT3A 4GPLB 1CM1A 1YX8A 2LVIA 1Y0VH 2E6WA 3PATA 1DJHA 4MLWA 1DMOA 1ZUZA 3QRXA 2LANA 3CR4X 4U8DA 5I8NA 1C7WA 3H4SE 2M97A 3FS7A 2BL0C 1KSOA 1OQPA 2ZFDA 2CNPA 4YGDB 5HLOA 1C7VA 1AVSA 1IQ5A 1QJTA 1GQMA 1NSHA 1JWDA 1AJ4A 1CLMA 2K7CA 1NP8A 1RJVA 3EK7A 1L2OB 3IQQA 5ER4X 3I5FB 1XK4A 2LV7A 1OZOA 4PE1A 1SY9A 1NCZA 4C0JA 1AP4A 3BUOB 2MHHA 1K96A 3ZWHA 1B47A 1B8RA 1OZSA 2L50A 1J55A 3I5IB 1BF5A 1D1OA 1XFXO 3SG6A 1WRKA 1QXPA 2MJWB 1YUSA 1S6JA 3AAKA 3TDUA 2ZKMX 3LLEA 4A4BA 1W7IB 2JTZA 2KHNA 3F45A 2JPTA 2K8MB 1TOPA 4PE4A 3VRNA 1NIWA 1CLBA 1IWQA 1S5GY 1U5IB 1YRTB 2FCEA 4PHMA 2OS8B 5DKRA 1KQMB 1CTRA 2JQ6A 2HF5A 2K7DA 2H61A 1SMGA 2LHIA 1S26D 2KFGA 1IKUA 1AK8A 4MRYA 1YTZC 4NDDA 5CSFA 4TNCA 1QIVA 3O4YA 2LLTA 2LLUA 2KGBC 4GBAA 1B4CA 1K9PA 1QASA 2KI6D 1B1GA 1G33A 1CDLA 2FJUB 3BOWA 1L2OC 3DVKA 2GGMA 3CWGA 4E68A 1B8LA 1OMDA 2GGZA 4CLNA 3SG5A 1JC2A 1GGZA 4CIDA 3AAJA 1Y1UA 1YVHA 3JTDB 1DGUA 2L4IA 1FPWA 1B9AA 2SASA 4GFTA 2LAPA 2KFHA 2KGRA 1F8HA 5D69A 2ZRSA 4M2OA 3TS5B 3DVEA 1JBAA 1CM4A 1TNPA 2CCMA 1KQVA 1XFUO 1DJGA 4N1GA 1ALWA 3BUMB 4CFQA 1K8UA 1RTP1 2LVVA 2MRDA 2NXQA 2LE9B 1IJ5A 2EGDA 3KPXA 1SL9A 2OTGC 3O6BA 3TZ1A 1S1EA 4C0LA 1EG4A 1F71A 1UHIA 4MEWA 4QJ5B 1QS7A 4GUKA 3D10A 3GOFA 3NXAA 4MZJA 4N5XA 1BU3A 5G08A 1J7PA 1MXLC 5BPJA 1NX0A 1CDMA 2KBMA 2JOJA 2K7OA 2PSRA 2K0JA 4FTGA 1L7ZA 2KI6C 4BY5A 3O2PA 3I5FC 1MUXA 1UHNA 3TUYC 1UHKA 1NCYA 4PHJA 2JTTA 4GGFA 1S6IA 2M1UA 5HKYA 2B1UA 3KHEA 3LCPC 1OE9B 3TS5C 1JUOA 1K94A 1HT9A 2HQ8A 1BT6A 1MWNA 4IL1A 1CLLA 1F4QA 3AKBA 4I5NB 3KEVA 3TDIA 2PVBA 1A75A 1DF0B 1CKKA 3DVJA 1VRKA 1FBVA 4XJKB 1UWOA 3OB2B 1QLKA 2SCPA 1KQMC 4YI9A 1CNPA 1KFUS 1PSBA 3VRRA 2OTGB 1CDNA 3WHTB 1SCMB 5D7FA 5HKWA 5AXIA 2AMIA 5AFPA 3BXKA 1PVAA 2QACA 5I2QA 1M31A 2CTNA 2ZRTA 4JPZB 1K90D 3HX4A 1E8AA 1UHJA 4DCKA 4MBEA 1OMVA 2JULA 1SBJA 2LM5A 2LUXA 1V1FA 1XVJA 5AERA 2KAXA 2MLEC 3TUYB 4GGFC 2BE4A 1BJFA 2KI4C 3C1VA 1BR1B 1YUTA 2KFFA 1Y6WA 2L51A 2LNKA 2KI4B 1QV0A 2L98A 4NQGA 1YURA 2KDHA 2ZNEA 2PRUA 2M29A 4HRGA 1JF0A 4JWQA 4MVFA 3M0WA 3RLZA 2V53A 2WCEA 2G9BA 4PHKA 3PFVA 1IJ6A 4DRWA 1RROA 3SIAA 2MLFC 4ICBA 3PN7C 1CMGA 3CR2A 4P2YB 2PMYA 2JNFA 4YGEB 1XA5A 5GQQC 2L4HA 4HREE 2WORA 3DF0B 3LK1A 5CPVA 2A4JA 2CBLA 2OS8C 5KU1A 4C0KA 3WNXB 1DJZA 1M63B 5PALA 4DS7A 1PALA 2JZIA 3PSRA 4MZKA 4OVNF 4PCWA 5J3XA 1KWOC 1UUSA 1J7OA 1LVCD 1DF0A 1SR6B 2HETA 2LMVA 1A4PA 4PDZA 4ETOA 3CS1A 3A4UB 1XO5A 4ORBB 2KQ6A 4GAOA 1AJ5A 2ZN9A 2L2EA 1SYMA 1BR4B 2M0RA 3BQ3A 2F2PA 2G2BA 1TTXA 3DF0A 2NZ0A 1BOCA 5I2LA 2CT9A 2M9GA 1H8BA 2I94A 1WLMA 5TNCA 3TDZA 1AHRA 2H2KA 1TIZA 2LC5A 4WQ2A 1SPYA 1EG3A 2WNDA 2AAOA 1RECA 1LKJA 1PSRA 1QX5B 1J1DA 3PN7B 3KF9A 3EK4A 5CSNA 3SJSA 3CR5X 4JQ0D 5HLVA 3KO0A 2LMTA 4ZCVA 1XFZO 1SCMC 2AUCA 2NCPA 1KWOB 1NX3A 4HSZA 2M8UA 3OHMB 4MN0A 4BY4A 1S5GZ 5KTYA 1YRUB 4PALA 2CXJA 3NSOA 1BG1A 1U5IA 2NLNA 1PVBA 1QV1A 1K9UA 3I5GB 1YR5A 1DTLA 3CTNA 1BODA 1ODBA 2M7NA 4R1EA 1CMFA 1QATA 1PK0D 4OV2A 2Q91A 2BCXA 1F4OA 1RFJA 2LUCA 1NYAA 2KBIA 1K93D 2TN4A 2LP3A 2M7LA 2O5GA 1V1GA 2PASA 2H61C 1DGVA 1KSMA 2WCBA 1M46A 1ZMZA 1UHHA 1CFDA 3AKAA 4PE0A 2JXCA 1EH2A 2F33A 2LCPA 3I5IC 3FIAA 4PHNA 1F55A 1C07A 1ZFSA 1ALVA 3RM1A 1J7QA 1PULA 3JVTC 2FOTA 1IRJA 3A8RA 2LVKA 2Y1NA 1KK8B 3BYAA 1F70A 1RWYA 4AQJA 2I18A 1DT7B 1EJ3A 1KK8C 1DVIA 3OX6A 3CLNA 1S36A 3D0YB 2P6BB 2JU0A 1EL4A 2EC6C 2K2FA 2KAYA 1EXRA 1K9KA 3PALA 1N0YA 1SL7A 2EC6B 3EKHA 1TNXA 3EVRA 1JFJA 1SL8A 1MXEA 4MZLA 1G8IA 1LA0A 1CFCA 3BUWB 5DKQA 2KYFA 4HRHA 2ISDA 3JTDC 1KFUL 1NWDA 4CFRA 1G4YR 4YI8A 4DUQA 2BE6A 1LA3A 2F3YA 3HCMA 4NDBA 2GV5A 3I5HB 2JWWA 1B7TY 4QJ3B 1TCOB 2JT0A 2HPSA 2QPTA 1DJYA 2WCFA 5FYXA 2MBXA 3EK8A 2L0PA 1CDPA 1Y1AA 1YUUA 3WXAA 3GK2A 5KSZA 1DJXA 5I2OA 2F8PA 1SRAA 2L5XB 4L9MA 1TCFA 1FI5A 1B8CA 2BKHB 1TNWA 3IF7A 2I2RE 2JC2A 2RGIA 1A03A 4NDCA 2LMUA 1JFKA 2EHBA 2K2AA 3I5GC 5B8IB 4OKHA 3OB1B 1UURA 3PLFB 2MA2A 1XK4C 1XYDA 3SG3A 1QIWA 2KQYA 1GGWA 3CZTX 1JF2A 3SIBA 4I5KA 1NX2A 2BKIB 2ZN8A 3NSKA 5AANA 5AEQA 3SG4A 2JXLA 3DVMA 4AOMA 4MRXA 2BECA 2BBNA 4ORCB 3I5HC 4YRUA 5F6TA 1K2HA 5IBWA 4Q04A 1UP5A 3ZNIA 1KK7Z 1SKTA 1KCYA 1NX1A 3ICBA 1J1EA 1IQ3A 1CB1A 4P5OE 1JSAA 1SCVA 1XFWO 1Y1XA 2WC8A 5JJGA 4D1EA 4UPGA 3GK4X 1YVLA 1QTXA 3EVUA 2O60A 2LHLA 4GGNA 1OMRA 1IGVA 2WOSA 3IQOA 1YX7A 2E30A 3LL8B 1ZACA 1MF8B 1LINA 1XFYO 1X02A 1FW4A 3LK0A 2VRGA 4M2QA 1MR8A 1M39A 2JT8A 2M3WA 2M1KB 2I7AA 4WQ3A 1FF1A 2IS9A 4QJ4B 1N65A 2Y4QA 1HQVA 5CSIA 5DKNA 3VROA 4N1FA 1F54A 1A29A 1KK7Y 4I5LB 4YGAA 2LLSA 2Y5IA 4XJKA 1IH0A 1NCXA 1QLSA 1SW8A 2KOTA 3MSEB 2ZNDA 3FWCA 2BCBA 3BUNB 4F0ZB 4ZCUA 1DJIA 1WRLA 1OOJA 1QX2A 1R6PA 1TRFA 1WDCC 2BCAA 4YBHB 2JNXA 2LVJA 1LXFC 1TNQA 2D8NA 1H4BA 1QX7A 1Q80A 4YGBB 2KYCA 3SG7A 3GK1A 3D0YA 1NPQA 5JOLA 5HYDA 3NSIA 1SNLA 4DIRA 3DD4A 3FWBA 1KFXS 1J7RA 1AUIB
chains in the Genus database with same CATH superfamily
1WLZA 1W7JB 3VGOA 3VRQA 1R2UA 3NHTA 2WCLA 3K21A 1K95A 1GJYA 1BMOA 2R2IA 1SK6D 2KSPA 3OP0A 1S6CA 1BLQA 1N2DA 1XFVO 1M45A 4MSPA 3FE6A 4YGCB 1MHOA 2FCDA 1SR6C 4OR9B 3R1PA 1WRZA 3NSLA 1QVIY 2LP2A 4OCIA 2HQWA 1OSAA 1S3PA 3EKJA 2NCOA 5K89A 5ER5A 2COLB 1NUBA 1TWOA 2BL0B 2Q4UA 2MAZA 2WC5A 1WY9A 2BBMA 5CSJA 5HKZA 2DOQA 3B88A 3VRPA 1FI6A 3SS4A 2F2OA 1B7TZ 1WDCB 3E3RA 1IIOA 1RK9A 1PRWA 3OX5A 1A2XA 2M49B 2WCMA 1MQ1A 2K61A 2PALA 3EG5B 1DJWA 2JRFA 4I5JA 4AQIA 2K7BA 1KFXL 2KAVA 4PE7A 4GNKB 1TN4A 4ORAB 4WRIA 4FQOA 3PM8A 3EVVA 3R1OA 1CFPA 3CGAA 4A4CA 4F7FA 4XYNA 2OPOA 3JVTB 4CPVA 4M2PA 1A75B 3SG2A 2KNEA 1IG5A 2Y1MA 2F3ZA 3BOWB 3BUXB 3O78A 4USLA 1QVIZ 1ZOTB 5FI2A 3WHUB 2JT3A 4GPLB 1CM1A 1YX8A 2LVIA 1Y0VH 2E6WA 3PATA 1DJHA 4MLWA 1DMOA 1ZUZA 3QRXA 2LANA 3CR4X 4U8DA 5I8NA 1C7WA 3H4SE 2M97A 3FS7A 3S0FA 2BL0C 1KSOA 1OQPA 2ZFDA 2CNPA 4YGDB 5HLOA 1C7VA 1AVSA 1IQ5A 1QJTA 1GQMA 1NSHA 1JWDA 3FE9A 1AJ4A 1CLMA 2K7CA 1NP8A 1RJVA 3EK7A 1L2OB 3IQQA 5FI7A 1T14A 5ER4X 3I5FB 1XK4A 2LV7A 1OZOA 4PE1A 1SY9A 1NCZA 4C0JA 3B86A 2KPHA 1AP4A 3BUOB 2MHHA 1K96A 3ZWHA 1OOIX 1B47A 1B8RA 1OZSA 2L50A 1J55A 3I5IB 1BF5A 1D1OA 3S0DA 1XFXO 3SG6A 1WRKA 1QXPA 2MJWB 1YUSA 1S6JA 3AAKA 3TDUA 3SS3A 2ZKMX 3LLEA 3DY9A 1ORGA 4A4BA 4IJ7A 1W7IB 2JTZA 2KHNA 3F45A 2JPTA 2K8MB 1TOPA 4PE4A 3VRNA 1NIWA 1CLBA 1IWQA 1S5GY 1U5IB 1YRTB 2FCEA 4PHMA 2OS8B 5DKRA 1KQMB 1CTRA 2JQ6A 2HF5A 2K7DA 2H61A 2P71A 1JFJA 1SMGA 2LHIA 1S26D 2KFGA 1IKUA 1AK8A 3OGNA 4MRYA 1YTZC 4NDDA 5CSFA 4TNCA 3D74A 1QIVA 3O4YA 2LLTA 2P70A 2LLUA 3NGVA 2WCHA 2KGBC 3BFAA 4GBAA 1B4CA 1K9PA 1QASA 2KI6D 1B1GA 1G33A 1CDLA 3D77A 1OOFA 2FJUB 3BOWA 1L2OC 3DVKA 2GGMA 3CWGA 4E68A 3CDNA 1B8LA 1OMDA 2GGZA 4CLNA 1OOGA 3SG5A 1JC2A 1GGZA 4CIDA 3AAJA 1Y1UA 1YVHA 5DICA 3JTDB 1DGUA 2L4IA 1FPWA 1B9AA 2SASA 4GFTA 2LAPA 2KFHA 2KGRA 1F8HA 5D69A 2ZRSA 4M2OA 3TS5B 3DVEA 1JBAA 1CM4A 1TNPA 2CCMA 1KQVA 1XFUO 1DJGA 4N1GA 1ALWA 3BUMB 4CFQA 1K8UA 1RTP1 3V2LA 3L4LA 2LVVA 2MRDA 2NXQA 2LE9B 1IJ5A 2EGDA 3KPXA 1SL9A 2OTGC 3O6BA 3TZ1A 1S1EA 4C0LA 1EG4A 1F71A 1UHIA 4MEWA 3O4XA 4QJ5B 1QS7A 4GUKA 3D10A 3GOFA 3NXAA 3PJIA 4MZJA 4N5XA 1BU3A 5G08A 1J7PA 2BNXA 1MXLC 5BPJA 1NX0A 1CDMA 1DEKA 2KBMA 2JOJA 2K7OA 2PSRA 2K0JA 4FTGA 1L7ZA 2KI6C 4BY5A 3O2PA 3I5FC 1MUXA 1UHNA 3TUYC 1UHKA 1NCYA 2BAPA 4PHJA 2JTTA 4GGFA 3K1EA 1S6IA 2M1UA 5HKYA 2B1UA 3KHEA 3LCPC 1OE9B 3TS5C 1JUOA 1K94A 1HT9A 2HQ8A 1OOHA 3S0GA 1BT6A 1MWNA 4IL1A 1P28A 1CLLA 1F4QA 3AKBA 4I5NB 3KEVA 3TDIA 2PVBA 1A75A 1DF0B 1CKKA 3DVJA 3B6XA 1VRKA 3DYEA 1FBVA 4XJKB 1UWOA 3OB2B 1QLKA 2SCPA 1KQMC 4YI9A 1CNPA 3PM2A 1KFUS 1PSBA 3VRRA 2OTGB 1CDNA 3WHTB 1SCMB 5D7FA 5HKWA 2KLEA 5AXIA 2AMIA 5AFPA 3BXKA 1PVAA 2QACA 5I2QA 1M31A 2CTNA 2ZRTA 4JPZB 1C3ZA 1K90D 3R1VA 1W9ZA 1E8AA 1UHJA 3HX4A 2KLDA 4MBEA 2WCKA 1OMVA 4DCKA 2JULA 2QEVA 1SBJA 2LM5A 2LUXA 3BJHA 1V1FA 1XVJA 5AERA 2KAXA 2MLEC 3CZ0A 3TUYB 4GGFC 2BE4A 1BJFA 3D76A 1Z2CB 2KI4C 2PYQA 1BR1B 1YUTA 3C1VA 2KFFA 1Y6WA 2L51A 2LNKA 3NHIA 2KI4B 1QV0A 2L98A 3D73A 1YURA 2KDHA 2ZNEA 4NQGA 2PRUA 2M29A 4HRGA 1JF0A 4JWQA 4MVFA 3M0WA 3RLZA 2V53A 2WCEA 2G9BA 4PHKA 3PFVA 1IJ6A 4DRWA 1RROA 3SIAA 2MLFC 4ICBA 3PN7C 1CMGA 3CR2A 4P2YB 2PMYA 2JNFA 4YGEB 1XA5A 5GQQC 2L4HA 4HREE 2WORA 3DF0B 3LK1A 5CPVA 2A4JA 2CBLA 2OS8C 5KU1A 4C0KA 3WNXB 1DJZA 1M63B 5PALA 4DS7A 1PALA 2JZIA 3PSRA 4MZKA 4OVNF 4PCWA 3S0BA 2WCJA 5J3XA 1KWOC 1UUSA 1SSEB 1J7OA 1LVCD 2JPOA 1DF0A 1SR6B 2HETA 2FJYA 2LMVA 1A4PA 4PDZA 4ETOA 3CS1A 3A4UB 1XO5A 4ORBB 2KQ6A 4GAOA 1AJ5A 3R72A 3CABA 2ZN9A 3BFBA 2L2EA 1SYMA 1BR4B 2M0RA 3BQ3A 2F2PA 2G2BA 2K60A 1TTXA 3DF0A 2NZ0A 1BOCA 5I2LA 2CT9A 3B87A 2M9GA 1H8BA 2I94A 1WLMA 5TNCA 3TDZA 1AHRA 2H2KA 1TIZA 3OBVA 1Z4HA 2LC5A 3Q8IA 1SPYA 4WQ2A 5HL1A 3S0AA 1EG3A 2WNDA 5D3OA 1DELA 2AAOA 1RECA 3FE8A 2YGUA 1LKJA 1PSRA 1QX5B 1J1DA 4INWA 3PN7B 3KF9A 3EK4A 5CSNA 3SJSA 3CR5X 4JQ0D 5HLVA 3KO0A 2LMTA 4ZCVA 1XFZO 1SCMC 2AUCA 1QWVA 2NCPA 1KWOB 2L2CA 1NX3A 4HSZA 2M8UA 3OHMB 1TUJA 4MN0A 4BY4A 1S5GZ 5KTYA 1YRUB 4PALA 2CXJA 3NSOA 1BG1A 1U5IA 2NLNA 1PVBA 1QV1A 1K9UA 4JKTA 3I5GB 1YR5A 1DTLA 1CFFA 3CTNA 1BODA 1ODBA 2WC6A 3L4AA 2M7NA 4R1EA 1CMFA 1QATA 1PK0D 3RZSA 3UNWA 4OV2A 2QDIA 2Q91A 2BCXA 1F4OA 1RFJA 2LUCA 5EL2A 5I94A 1NYAA 2KBIA 1K93D 2TN4A 2LP3A 2M7LA 2O5GA 1V1GA 2PASA 2H61C 1DGVA 1KSMA 2WCBA 1M46A 1ZMZA 3CYZA 1UHHA 1CFDA 3CZ1A 3AKAA 3CZ2A 4PE0A 2JXCA 1EH2A 2F33A 2LCPA 3I5IC 3FIAA 4PHNA 1F55A 1C07A 1LS8A 1ZFSA 1GM0A 1ALVA 3RM1A 1J7QA 1PULA 3JVTC 2FOTA 1IRJA 3A8RA 2LVKA 2Y1NA 1KK8B 3BFHA 3BYAA 4PT1A 1F70A 1RWYA 4AQJA 3S0EA 2I18A 1DT7B 1EJ3A 1KK8C 1DVIA 3OX6A 3CLNA 1S36A 3D0YB 2P6BB 2JU0A 2PQLA 1EL4A 2EC6C 2K2FA 3N7HA 2KAYA 1EXRA 1K9KA 3PALA 1N0YA 1SL7A 2EC6B 3EKHA 1TNXA 3EVRA 3VB1A 1SL8A 1MXEA 4MZLA 1G8IA 1LA0A 1CFCA 3BUWB 5DKQA 3D78A 2KYFA 4HRHA 2ISDA 3JTDC 1KFUL 1OW4A 1NWDA 4CFRA 1G4YR 4YI8A 4DUQA 2BE6A 1LA3A 2F3YA 3HCMA 4NDBA 2GV5A 3I5HB 2JWWA 1B7TY 4QJ3B 1TCOB 2JT0A 2QEOA 2HPSA 2QPTA 3L47A 1DJYA 2WCFA 5FYXA 2MBXA 3EK8A 2L0PA 1CDPA 1Y1AA 1YUUA 3WXAA 3GK2A 4JD9A 5KSZA 1DJXA 5I2OA 2F8PA 1SRAA 2L5XB 4L9MA 1TCFA 1FI5A 1B8CA 2BKHB 1TNWA 3IF7A 2I2RE 2JC2A 2RGIA 1A03A 4NDCA 2LMUA 2QEBA 1JFKA 2EHBA 2K2AA 3I5GC 5B8IB 4OKHA 3OB1B 1UURA 3PLFB 2MA2A 1XK4C 1XYDA 3SG3A 1QIWA 1TUZA 3D75A 4INXA 2H8VA 2KQYA 1GGWA 3CZTX 1JF2A 3SIBA 4I5KA 1NX2A 2BKIB 2ZN8A 3NSKA 5AANA 5AEQA 3SG4A 2JXLA 3DVMA 4AOMA 4MRXA 4KYNA 2BECA 2BBNA 4ORCB 3I5HC 4YRUA 5F6TA 1K2HA 4FQTA 4Q04A 5IBWA 1UP5A 3ZNIA 1KK7Z 1SKTA 1KCYA 1NX1A 3B7AA 1J1EA 3ICBA 1IQ3A 1CB1A 4P5OE 1JSAA 1SCVA 1XFWO 1Y1XA 2WC8A 5JJGA 4D1EA 4UPGA 3GK4X 2ERBA 1YVLA 1QTXA 3EVUA 2O60A 2LHLA 4GGNA 1OMRA 2QEHA 1IGVA 2WOSA 3IQOA 1YX7A 2E30A 3LL8B 1ZACA 3DXLA 1MF8B 1LINA 1XFYO 1X02A 1FW4A 3LK0A 2VRGA 3IVTA 3QMEA 1MR8A 4M2QA 1M39A 5FI6A 3UO9A 1DC1A 2JT8A 2M3WA 2M1KB 2I7AA 4WQ3A 1FF1A 2IS9A 4QJ4B 1N65A 2Y4QA 1HQVA 5CSIA 5DKNA 3VROA 4N1FA 1F54A 1A29A 1KK7Y 1XFRA 4I5LB 4YGAA 2LLSA 2Y5IA 4XJKA 1IH0A 1NCXA 1QLSA 2L5YA 1SW8A 2KOTA 3DZTA 3MSEB 2ZNDA 3FWCA 2BCBA 3BUNB 4F0ZB 1DQEA 1DJIA 1WRLA 1OOJA 1QX2A 1R6PA 1TRFA 1WDCC 2BCAA 4ZCUA 4YBHB 2JNXA 2LVJA 4OZDA 1C3YA 1LXFC 1TNQA 3SS5A 2D8NA 1H4BA 1QX7A 1Q80A 4YGBB 2KYCA 3SG7A 3GK1A 3D0YA 1NPQA 5JOLA 5HYDA 2GTEA 3NSIA 1SNLA 4DIRA 3DD4A 3FWBA 1KFXS 1J7RA 1AUIB
chains in the Genus database with same CATH topology
1WLZA 1W7JB 3VGOA 3VRQA 1R2UA 3K21A 1K95A 1GJYA 1BMOA 2R2IA 1SK6D 2KSPA 3OP0A 1S6CA 1BLQA 1N2DA 1XFVO 1M45A 4MSPA 4YGCB 1MHOA 2FCDA 1SR6C 4OR9B 1WRZA 3NSLA 1QVIY 2LP2A 4OCIA 2HQWA 1OSAA 1S3PA 3EKJA 2NCOA 5K89A 5ER5A 2COLB 1NUBA 2BL0B 2Q4UA 2MAZA 1WY9A 2BBMA 5CSJA 5HKZA 2DOQA 3VRPA 1FI6A 2F2OA 1B7TZ 1WDCB 3E3RA 1RK9A 1PRWA 3OX5A 1A2XA 2M49B 1CFFA 1MQ1A 2K61A 2PALA 1DJWA 2JRFA 4I5JA 4AQIA 2K7BA 1KFXL 2KAVA 4PE7A 4GNKB 1TN4A 4ORAB 4WRIA 4FQOA 3PM8A 3EVVA 1CFPA 3CGAA 4A4CA 4XYNA 2OPOA 3JVTB 4CPVA 4M2PA 1A75B 3SG2A 2KNEA 1IG5A 2Y1MA 2F3ZA 3BOWB 3BUXB 3O78A 4USLA 1QVIZ 1ZOTB 3WHUB 2JT3A 4GPLB 1CM1A 1YX8A 2LVIA 1Y0VH 2E6WA 3PATA 1DJHA 4MLWA 1DMOA 1ZUZA 3QRXA 2LANA 3CR4X 4U8DA 5I8NA 1C7WA 3H4SE 2M97A 3FS7A 2BL0C 1KSOA 1OQPA 2ZFDA 2CNPA 4YGDB 5HLOA 1C7VA 1AVSA 1IQ5A 1QJTA 1GQMA 1NSHA 1JWDA 1AJ4A 1CLMA 2K7CA 1NP8A 1RJVA 3EK7A 1L2OB 3IQQA 5ER4X 3I5FB 1XK4A 2LV7A 1OZOA 4PE1A 1SY9A 1NCZA 4C0JA 1AP4A 3BUOB 2MHHA 1K96A 3ZWHA 1B47A 1B8RA 1OZSA 2L50A 1J55A 3I5IB 1BF5A 1D1OA 1XFXO 3SG6A 1WRKA 1QXPA 2MJWB 1YUSA 1S6JA 3AAKA 3TDUA 2ZKMX 3LLEA 4A4BA 1W7IB 2JTZA 2KHNA 3F45A 2JPTA 2K8MB 1TOPA 4PE4A 3VRNA 1NIWA 1CLBA 1IWQA 1S5GY 1U5IB 1YRTB 2FCEA 4PHMA 2OS8B 5DKRA 1KQMB 1CTRA 2JQ6A 2HF5A 2K7DA 2H61A 1SMGA 2LHIA 1S26D 2KFGA 1IKUA 1AK8A 4MRYA 1YTZC 4NDDA 5CSFA 4TNCA 1QIVA 3O4YA 2LLTA 2LLUA 2KGBC 4GBAA 1B4CA 1K9PA 1QASA 2KI6D 1B1GA 1G33A 1CDLA 2FJUB 3BOWA 1L2OC 3DVKA 2GGMA 3CWGA 4E68A 1B8LA 1OMDA 2GGZA 4CLNA 3SG5A 1JC2A 1GGZA 4CIDA 3AAJA 1Y1UA 1YVHA 3JTDB 1DGUA 2L4IA 1FPWA 1B9AA 2SASA 4GFTA 2LAPA 2KFHA 2KGRA 1F8HA 5D69A 2ZRSA 4M2OA 3TS5B 3DVEA 1JBAA 1CM4A 1TNPA 2CCMA 1KQVA 1XFUO 1DJGA 4N1GA 1ALWA 3BUMB 4CFQA 1K8UA 1RTP1 2LVVA 2MRDA 2NXQA 2LE9B 1IJ5A 2EGDA 3KPXA 1SL9A 2OTGC 3O6BA 3TZ1A 1S1EA 4C0LA 1EG4A 1F71A 1UHIA 4MEWA 4QJ5B 1QS7A 4GUKA 3D10A 3GOFA 3NXAA 4MZJA 4N5XA 1BU3A 5G08A 1J7PA 1MXLC 5BPJA 1NX0A 1CDMA 2KBMA 2JOJA 2K7OA 2PSRA 2K0JA 4FTGA 1L7ZA 2KI6C 4BY5A 3O2PA 3I5FC 1MUXA 1UHNA 3TUYC 1UHKA 1NCYA 4PHJA 2JTTA 4GGFA 1S6IA 2M1UA 5HKYA 2B1UA 3KHEA 3LCPC 1OE9B 3TS5C 1JUOA 1K94A 1HT9A 2HQ8A 1BT6A 1MWNA 4IL1A 1CLLA 1F4QA 3AKBA 4I5NB 3KEVA 3TDIA 2PVBA 1A75A 1DF0B 1CKKA 3DVJA 1VRKA 1FBVA 4XJKB 1UWOA 3OB2B 1QLKA 2SCPA 1KQMC 4YI9A 1CNPA 1KFUS 1PSBA 3VRRA 2OTGB 1CDNA 3WHTB 1SCMB 5D7FA 5HKWA 5AXIA 2AMIA 5AFPA 3BXKA 1PVAA 2QACA 5I2QA 1M31A 2CTNA 2ZRTA 4JPZB 1K90D 3HX4A 1E8AA 1UHJA 4DCKA 4MBEA 1OMVA 2JULA 1SBJA 2LM5A 2LUXA 1V1FA 1XVJA 5AERA 2KAXA 2MLEC 3TUYB 4GGFC 2BE4A 1BJFA 2KI4C 3C1VA 1BR1B 1YUTA 2KFFA 1Y6WA 2L51A 2LNKA 2KI4B 1QV0A 2L98A 4NQGA 1YURA 2KDHA 2ZNEA 2PRUA 2M29A 4HRGA 1JF0A 4JWQA 4MVFA 3M0WA 3RLZA 2V53A 2WCEA 2G9BA 4PHKA 3PFVA 1IJ6A 4DRWA 1RROA 3SIAA 2MLFC 4ICBA 3PN7C 1CMGA 3CR2A 4P2YB 2PMYA 2JNFA 4YGEB 1XA5A 5GQQC 2L4HA 4HREE 2WORA 3DF0B 3LK1A 5CPVA 2A4JA 2CBLA 2OS8C 5KU1A 4C0KA 3WNXB 1DJZA 1M63B 5PALA 4DS7A 1PALA 2JZIA 3PSRA 4MZKA 4OVNF 4PCWA 5J3XA 1KWOC 1UUSA 1J7OA 1LVCD 1DF0A 1SR6B 2HETA 2LMVA 1A4PA 4PDZA 4ETOA 3CS1A 3A4UB 1XO5A 4ORBB 2KQ6A 4GAOA 1AJ5A 2ZN9A 2L2EA 1SYMA 1BR4B 2M0RA 3BQ3A 2F2PA 2G2BA 1TTXA 3DF0A 2NZ0A 1BOCA 5I2LA 2CT9A 2M9GA 1H8BA 2I94A 1WLMA 5TNCA 3TDZA 1AHRA 2H2KA 1TIZA 2LC5A 4WQ2A 1SPYA 1EG3A 2WNDA 2AAOA 1RECA 1LKJA 1PSRA 1QX5B 1J1DA 3PN7B 3KF9A 3EK4A 5CSNA 3SJSA 3CR5X 4JQ0D 5HLVA 3KO0A 2LMTA 4ZCVA 1XFZO 1SCMC 2AUCA 2NCPA 1KWOB 1NX3A 4HSZA 2M8UA 3OHMB 4MN0A 4BY4A 1S5GZ 5KTYA 1YRUB 4PALA 2CXJA 3NSOA 1BG1A 1U5IA 2NLNA 1PVBA 1QV1A 1K9UA 3I5GB 1YR5A 1DTLA 3CTNA 1BODA 1ODBA 2M7NA 4R1EA 1CMFA 1QATA 1PK0D 4OV2A 2Q91A 2BCXA 1F4OA 1RFJA 2LUCA 1NYAA 2KBIA 1K93D 2TN4A 2LP3A 2M7LA 2O5GA 1V1GA 2PASA 2H61C 1DGVA 1KSMA 2WCBA 1M46A 1ZMZA 1UHHA 1CFDA 3AKAA 4PE0A 2JXCA 1EH2A 2F33A 2LCPA 3I5IC 3FIAA 4PHNA 1F55A 1C07A 1ZFSA 1ALVA 3RM1A 1J7QA 1PULA 3JVTC 2FOTA 1IRJA 3A8RA 2LVKA 2Y1NA 1KK8B 3BYAA 1F70A 1RWYA 4AQJA 2I18A 1DT7B 1EJ3A 1KK8C 1DVIA 3OX6A 3CLNA 1S36A 3D0YB 2P6BB 2JU0A 1EL4A 2EC6C 2K2FA 2KAYA 1EXRA 1K9KA 3PALA 1N0YA 1SL7A 2EC6B 3EKHA 1TNXA 3EVRA 1JFJA 1SL8A 1MXEA 4MZLA 1G8IA 1LA0A 1CFCA 3BUWB 5DKQA 2KYFA 4HRHA 2ISDA 3JTDC 1KFUL 1NWDA 4CFRA 1G4YR 4YI8A 4DUQA 2BE6A 1LA3A 2F3YA 3HCMA 4NDBA 2GV5A 3I5HB 2JWWA 1B7TY 4QJ3B 1TCOB 2JT0A 2HPSA 2QPTA 1DJYA 2WCFA 5FYXA 2MBXA 3EK8A 2L0PA 1CDPA 1Y1AA 1YUUA 3WXAA 3GK2A 5KSZA 1DJXA 5I2OA 2F8PA 1SRAA 2L5XB 4L9MA 1TCFA 1FI5A 1B8CA 2BKHB 1TNWA 3IF7A 2I2RE 2JC2A 2RGIA 1A03A 4NDCA 2LMUA 1JFKA 2EHBA 2K2AA 3I5GC 5B8IB 4OKHA 3OB1B 1UURA 3PLFB 2MA2A 1XK4C 1XYDA 3SG3A 1QIWA 2KQYA 1GGWA 3CZTX 1JF2A 3SIBA 4I5KA 1NX2A 2BKIB 2ZN8A 3NSKA 5AANA 5AEQA 3SG4A 2JXLA 3DVMA 4AOMA 4MRXA 2BECA 2BBNA 4ORCB 3I5HC 4YRUA 5F6TA 1K2HA 5IBWA 4Q04A 1UP5A 3ZNIA 1KK7Z 1SKTA 1KCYA 1NX1A 3ICBA 1J1EA 1IQ3A 1CB1A 4P5OE 1JSAA 1SCVA 1XFWO 1Y1XA 2WC8A 5JJGA 4D1EA 4UPGA 3GK4X 1YVLA 1QTXA 3EVUA 2O60A 2LHLA 4GGNA 1OMRA 1IGVA 2WOSA 3IQOA 1YX7A 2E30A 3LL8B 1ZACA 1MF8B 1LINA 1XFYO 1X02A 1FW4A 3LK0A 2VRGA 4M2QA 1MR8A 1M39A 2JT8A 2M3WA 2M1KB 2I7AA 4WQ3A 1FF1A 2IS9A 4QJ4B 1N65A 2Y4QA 1HQVA 5CSIA 5DKNA 3VROA 4N1FA 1F54A 1A29A 1KK7Y 4I5LB 4YGAA 2LLSA 2Y5IA 4XJKA 1IH0A 1NCXA 1QLSA 1SW8A 2KOTA 3MSEB 2ZNDA 3FWCA 2BCBA 3BUNB 4F0ZB 4ZCUA 1DJIA 1WRLA 1OOJA 1QX2A 1R6PA 1TRFA 1WDCC 2BCAA 4YBHB 2JNXA 2LVJA 1LXFC 1TNQA 2D8NA 1H4BA 1QX7A 1Q80A 4YGBB 2KYCA 3SG7A 3GK1A 3D0YA 1NPQA 5JOLA 5HYDA 3NSIA 1SNLA 4DIRA 3DD4A 3FWBA 1KFXS 1J7RA 1AUIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLZ A;  1W7J B;  3VGO A;  3VRQ A;  1R2U A;  3K21 A;  1K95 A;  1GJY A;  1BMO A;  2R2I A;  1SK6 D;  2KSP A;  3OP0 A;  1S6C A;  1BLQ A;  1N2D A;  1XFV O;  1M45 A;  4MSP A;  4YGC B;  1MHO A;  2FCD A;  1SR6 C;  4OR9 B;  1WRZ A;  3NSL A;  1QVI Y;  2LP2 A;  4OCI A;  2HQW A;  1OSA A;  1S3P A;  3EKJ A;  2NCO A;  5K89 A;  5ER5 A;  2COL B;  1NUB A;  2BL0 B;  2Q4U A;  2MAZ A;  1WY9 A;  2BBM A;  5CSJ A;  5HKZ A;  2DOQ A;  3VRP A;  1FI6 A;  2F2O A;  1B7T Z;  1WDC B;  3E3R A;  1RK9 A;  1PRW A;  3OX5 A;  1A2X A;  2M49 B;  1CFF A;  1MQ1 A;  2K61 A;  2PAL A;  1DJW A;  2JRF A;  4I5J A;  4AQI A;  2K7B A;  1KFX L;  2KAV A;  4PE7 A;  4GNK B;  1TN4 A;  4ORA B;  4WRI A;  4FQO A;  3PM8 A;  3EVV A;  1CFP A;  3CGA A;  4A4C A;  4XYN A;  2OPO A;  3JVT B;  4CPV A;  4M2P A;  1A75 B;  3SG2 A;  2KNE A;  1IG5 A;  2Y1M A;  2F3Z A;  3BOW B;  3BUX B;  3O78 A;  4USL A;  1QVI Z;  1ZOT B;  3WHU B;  2JT3 A;  4GPL B;  1CM1 A;  1YX8 A;  2LVI A;  1Y0V H;  2E6W A;  3PAT A;  1DJH A;  4MLW A;  1DMO A;  1ZUZ A;  3QRX A;  2LAN A;  3CR4 X;  4U8D A;  5I8N A;  1C7W A;  3H4S E;  2M97 A;  3FS7 A;  2BL0 C;  1KSO A;  1OQP A;  2ZFD A;  2CNP A;  4YGD B;  5HLO A;  1C7V A;  1AVS A;  1IQ5 A;  1QJT A;  1GQM A;  1NSH A;  1JWD A;  1AJ4 A;  1CLM A;  2K7C A;  1NP8 A;  1RJV A;  3EK7 A;  1L2O B;  3IQQ A;  5ER4 X;  3I5F B;  1XK4 A;  2LV7 A;  1OZO A;  4PE1 A;  1SY9 A;  1NCZ A;  4C0J A;  1AP4 A;  3BUO B;  2MHH A;  1K96 A;  3ZWH A;  1B47 A;  1B8R A;  1OZS A;  2L50 A;  1J55 A;  3I5I B;  1BF5 A;  1D1O A;  1XFX O;  3SG6 A;  1WRK A;  1QXP A;  2MJW B;  1YUS A;  1S6J A;  3AAK A;  3TDU A;  2ZKM X;  3LLE A;  4A4B A;  1W7I B;  2JTZ A;  2KHN A;  3F45 A;  2JPT A;  2K8M B;  1TOP A;  4PE4 A;  3VRN A;  1NIW A;  1CLB A;  1IWQ A;  1S5G Y;  1U5I B;  1YRT B;  2FCE A;  4PHM A;  2OS8 B;  5DKR A;  1KQM B;  1CTR A;  2JQ6 A;  2HF5 A;  2K7D A;  2H61 A;  1SMG A;  2LHI A;  1S26 D;  2KFG A;  1IKU A;  1AK8 A;  4MRY A;  1YTZ C;  4NDD A;  5CSF A;  4TNC A;  1QIV A;  3O4Y A;  2LLT A;  2LLU A;  2KGB C;  4GBA A;  1B4C A;  1K9P A;  1QAS A;  2KI6 D;  1B1G A;  1G33 A;  1CDL A;  2FJU B;  3BOW A;  1L2O C;  3DVK A;  2GGM A;  3CWG A;  4E68 A;  1B8L A;  1OMD A;  2GGZ A;  4CLN A;  3SG5 A;  1JC2 A;  1GGZ A;  4CID A;  3AAJ A;  1Y1U A;  1YVH A;  3JTD B;  1DGU A;  2L4I A;  1FPW A;  1B9A A;  2SAS A;  4GFT A;  2LAP A;  2KFH A;  2KGR A;  1F8H A;  5D69 A;  2ZRS A;  4M2O A;  3TS5 B;  3DVE A;  1JBA A;  1CM4 A;  1TNP A;  2CCM A;  1KQV A;  1XFU O;  1DJG A;  4N1G A;  1ALW A;  3BUM B;  4CFQ A;  1K8U A;  1RTP 1;  2LVV A;  2MRD A;  2NXQ A;  2LE9 B;  1IJ5 A;  2EGD A;  3KPX A;  1SL9 A;  2OTG C;  3O6B A;  3TZ1 A;  1S1E A;  4C0L A;  1EG4 A;  1F71 A;  1UHI A;  4MEW A;  4QJ5 B;  1QS7 A;  4GUK A;  3D10 A;  3GOF A;  3NXA A;  4MZJ A;  4N5X A;  1BU3 A;  5G08 A;  1J7P A;  1MXL C;  5BPJ A;  1NX0 A;  1CDM A;  2KBM A;  2JOJ A;  2K7O A;  2PSR A;  2K0J A;  4FTG A;  1L7Z A;  2KI6 C;  4BY5 A;  3O2P A;  3I5F C;  1MUX A;  1UHN A;  3TUY C;  1UHK A;  1NCY A;  4PHJ A;  2JTT A;  4GGF A;  1S6I A;  2M1U A;  5HKY A;  2B1U A;  3KHE A;  3LCP C;  1OE9 B;  3TS5 C;  1JUO A;  1K94 A;  1HT9 A;  2HQ8 A;  1BT6 A;  1MWN A;  4IL1 A;  1CLL A;  1F4Q A;  3AKB A;  4I5N B;  3KEV A;  3TDI A;  2PVB A;  1A75 A;  1DF0 B;  1CKK A;  3DVJ A;  1VRK A;  1FBV A;  4XJK B;  1UWO A;  3OB2 B;  1QLK A;  2SCP A;  1KQM C;  4YI9 A;  1CNP A;  1KFU S;  1PSB A;  3VRR A;  2OTG B;  1CDN A;  3WHT B;  1SCM B;  5D7F A;  5HKW A;  5AXI A;  2AMI A;  5AFP A;  3BXK A;  1PVA A;  2QAC A;  5I2Q A;  1M31 A;  2CTN A;  2ZRT A;  4JPZ B;  1K90 D;  3HX4 A;  1E8A A;  1UHJ A;  4DCK A;  4MBE A;  1OMV A;  2JUL A;  1SBJ A;  2LM5 A;  2LUX A;  1V1F A;  1XVJ A;  5AER A;  2KAX A;  2MLE C;  3TUY B;  4GGF C;  2BE4 A;  1BJF A;  2KI4 C;  3C1V A;  1BR1 B;  1YUT A;  2KFF A;  1Y6W A;  2L51 A;  2LNK A;  2KI4 B;  1QV0 A;  2L98 A;  4NQG A;  1YUR A;  2KDH A;  2ZNE A;  2PRU A;  2M29 A;  4HRG A;  1JF0 A;  4JWQ A;  4MVF A;  3M0W A;  3RLZ A;  2V53 A;  2WCE A;  2G9B A;  4PHK A;  3PFV A;  1IJ6 A;  4DRW A;  1RRO A;  3SIA A;  2MLF C;  4ICB A;  3PN7 C;  1CMG A;  3CR2 A;  4P2Y B;  2PMY A;  2JNF A;  4YGE B;  1XA5 A;  5GQQ C;  2L4H A;  4HRE E;  2WOR A;  3DF0 B;  3LK1 A;  5CPV A;  2A4J A;  2CBL A;  2OS8 C;  5KU1 A;  4C0K A;  3WNX B;  1DJZ A;  1M63 B;  5PAL A;  4DS7 A;  1PAL A;  2JZI A;  3PSR A;  4MZK A;  4OVN F;  4PCW A;  5J3X A;  1KWO C;  1UUS A;  1J7O A;  1LVC D;  1DF0 A;  1SR6 B;  2HET A;  2LMV A;  1A4P A;  4PDZ A;  4ETO A;  3CS1 A;  3A4U B;  1XO5 A;  4ORB B;  2KQ6 A;  4GAO A;  1AJ5 A;  2ZN9 A;  2L2E A;  1SYM A;  1BR4 B;  2M0R A;  3BQ3 A;  2F2P A;  2G2B A;  1TTX A;  3DF0 A;  2NZ0 A;  1BOC A;  5I2L A;  2CT9 A;  2M9G A;  1H8B A;  2I94 A;  1WLM A;  5TNC A;  3TDZ A;  1AHR A;  2H2K A;  1TIZ A;  2LC5 A;  4WQ2 A;  1SPY A;  1EG3 A;  2WND A;  2AAO A;  1REC A;  1LKJ A;  1PSR A;  1QX5 B;  1J1D A;  3PN7 B;  3KF9 A;  3EK4 A;  5CSN A;  3SJS A;  3CR5 X;  4JQ0 D;  5HLV A;  3KO0 A;  2LMT A;  4ZCV A;  1XFZ O;  1SCM C;  2AUC A;  2NCP A;  1KWO B;  1NX3 A;  4HSZ A;  2M8U A;  3OHM B;  4MN0 A;  4BY4 A;  1S5G Z;  5KTY A;  1YRU B;  4PAL A;  2CXJ A;  3NSO A;  1BG1 A;  1U5I A;  2NLN A;  1PVB A;  1QV1 A;  1K9U A;  3I5G B;  1YR5 A;  1DTL A;  3CTN A;  1BOD A;  1ODB A;  2M7N A;  4R1E A;  1CMF A;  1QAT A;  1PK0 D;  4OV2 A;  2Q91 A;  2BCX A;  1F4O A;  1RFJ A;  2LUC A;  1NYA A;  2KBI A;  1K93 D;  2TN4 A;  2LP3 A;  2M7L A;  2O5G A;  1V1G A;  2PAS A;  2H61 C;  1DGV A;  1KSM A;  2WCB A;  1M46 A;  1ZMZ A;  1UHH A;  1CFD A;  3AKA A;  4PE0 A;  2JXC A;  1EH2 A;  2F33 A;  2LCP A;  3I5I C;  3FIA A;  4PHN A;  1F55 A;  1C07 A;  1ZFS A;  1ALV A;  3RM1 A;  1J7Q A;  1PUL A;  3JVT C;  2FOT A;  1IRJ A;  3A8R A;  2LVK A;  2Y1N A;  1KK8 B;  3BYA A;  1F70 A;  1RWY A;  4AQJ A;  2I18 A;  1DT7 B;  1EJ3 A;  1KK8 C;  1DVI A;  3OX6 A;  3CLN A;  1S36 A;  3D0Y B;  2P6B B;  2JU0 A;  1EL4 A;  2EC6 C;  2K2F A;  2KAY A;  1EXR A;  1K9K A;  3PAL A;  1N0Y A;  1SL7 A;  2EC6 B;  3EKH A;  1TNX A;  3EVR A;  1JFJ A;  1SL8 A;  1MXE A;  4MZL A;  1G8I A;  1LA0 A;  1CFC A;  3BUW B;  5DKQ A;  2KYF A;  4HRH A;  2ISD A;  3JTD C;  1KFU L;  1NWD A;  4CFR A;  1G4Y R;  4YI8 A;  4DUQ A;  2BE6 A;  1LA3 A;  2F3Y A;  3HCM A;  4NDB A;  2GV5 A;  3I5H B;  2JWW A;  1B7T Y;  4QJ3 B;  1TCO B;  2JT0 A;  2HPS A;  2QPT A;  1DJY A;  2WCF A;  5FYX A;  2MBX A;  3EK8 A;  2L0P A;  1CDP A;  1Y1A A;  1YUU A;  3WXA A;  3GK2 A;  5KSZ A;  1DJX A;  5I2O A;  2F8P A;  1SRA A;  2L5X B;  4L9M A;  1TCF A;  1FI5 A;  1B8C A;  2BKH B;  1TNW A;  3IF7 A;  2I2R E;  2JC2 A;  2RGI A;  1A03 A;  4NDC A;  2LMU A;  1JFK A;  2EHB A;  2K2A A;  3I5G C;  5B8I B;  4OKH A;  3OB1 B;  1UUR A;  3PLF B;  2MA2 A;  1XK4 C;  1XYD A;  3SG3 A;  1QIW A;  2KQY A;  1GGW A;  3CZT X;  1JF2 A;  3SIB A;  4I5K A;  1NX2 A;  2BKI B;  2ZN8 A;  3NSK A;  5AAN A;  5AEQ A;  3SG4 A;  2JXL A;  3DVM A;  4AOM A;  4MRX A;  2BEC A;  2BBN A;  4ORC B;  3I5H C;  4YRU A;  5F6T A;  1K2H A;  5IBW A;  4Q04 A;  1UP5 A;  3ZNI A;  1KK7 Z;  1SKT A;  1KCY A;  1NX1 A;  3ICB A;  1J1E A;  1IQ3 A;  1CB1 A;  4P5O E;  1JSA A;  1SCV A;  1XFW O;  1Y1X A;  2WC8 A;  5JJG A;  4D1E A;  4UPG A;  3GK4 X;  1YVL A;  1QTX A;  3EVU A;  2O60 A;  2LHL A;  4GGN A;  1OMR A;  1IGV A;  2WOS A;  3IQO A;  1YX7 A;  2E30 A;  3LL8 B;  1ZAC A;  1MF8 B;  1LIN A;  1XFY O;  1X02 A;  1FW4 A;  3LK0 A;  2VRG A;  4M2Q A;  1MR8 A;  1M39 A;  2JT8 A;  2M3W A;  2M1K B;  2I7A A;  4WQ3 A;  1FF1 A;  2IS9 A;  4QJ4 B;  1N65 A;  2Y4Q A;  1HQV A;  5CSI A;  5DKN A;  3VRO A;  4N1F A;  1F54 A;  1A29 A;  1KK7 Y;  4I5L B;  4YGA A;  2LLS A;  2Y5I A;  4XJK A;  1IH0 A;  1NCX A;  1QLS A;  1SW8 A;  2KOT A;  3MSE B;  2ZND A;  3FWC A;  2BCB A;  3BUN B;  4F0Z B;  4ZCU A;  1DJI A;  1WRL A;  1OOJ A;  1QX2 A;  1R6P A;  1TRF A;  1WDC C;  2BCA A;  4YBH B;  2JNX A;  2LVJ A;  1LXF C;  1TNQ A;  2D8N A;  1H4B A;  1QX7 A;  1Q80 A;  4YGB B;  2KYC A;  3SG7 A;  3GK1 A;  3D0Y A;  1NPQ A;  5JOL A;  5HYD A;  3NSI A;  1SNL A;  4DIR A;  3DD4 A;  3FWB A;  1KFX S;  1J7R A;  1AUI B; 
#chains in the Genus database with same CATH topology
 1WLZ A;  1W7J B;  3VGO A;  3VRQ A;  1R2U A;  3NHT A;  2WCL A;  3K21 A;  1K95 A;  1GJY A;  1BMO A;  2R2I A;  1SK6 D;  2KSP A;  3OP0 A;  1S6C A;  1BLQ A;  1N2D A;  1XFV O;  1M45 A;  4MSP A;  3FE6 A;  4YGC B;  1MHO A;  2FCD A;  1SR6 C;  4OR9 B;  3R1P A;  1WRZ A;  3NSL A;  1QVI Y;  2LP2 A;  4OCI A;  2HQW A;  1OSA A;  1S3P A;  3EKJ A;  2NCO A;  5K89 A;  5ER5 A;  2COL B;  1NUB A;  1TWO A;  2BL0 B;  2Q4U A;  2MAZ A;  2WC5 A;  1WY9 A;  2BBM A;  5CSJ A;  5HKZ A;  2DOQ A;  3B88 A;  3VRP A;  1FI6 A;  3SS4 A;  2F2O A;  1B7T Z;  1WDC B;  3E3R A;  1IIO A;  1RK9 A;  1PRW A;  3OX5 A;  1A2X A;  2M49 B;  2WCM A;  1MQ1 A;  2K61 A;  2PAL A;  3EG5 B;  1DJW A;  2JRF A;  4I5J A;  4AQI A;  2K7B A;  1KFX L;  2KAV A;  4PE7 A;  4GNK B;  1TN4 A;  4ORA B;  4WRI A;  4FQO A;  3PM8 A;  3EVV A;  3R1O A;  1CFP A;  3CGA A;  4A4C A;  4F7F A;  4XYN A;  2OPO A;  3JVT B;  4CPV A;  4M2P A;  1A75 B;  3SG2 A;  2KNE A;  1IG5 A;  2Y1M A;  2F3Z A;  3BOW B;  3BUX B;  3O78 A;  4USL A;  1QVI Z;  1ZOT B;  5FI2 A;  3WHU B;  2JT3 A;  4GPL B;  1CM1 A;  1YX8 A;  2LVI A;  1Y0V H;  2E6W A;  3PAT A;  1DJH A;  4MLW A;  1DMO A;  1ZUZ A;  3QRX A;  2LAN A;  3CR4 X;  4U8D A;  5I8N A;  1C7W A;  3H4S E;  2M97 A;  3FS7 A;  3S0F A;  2BL0 C;  1KSO A;  1OQP A;  2ZFD A;  2CNP A;  4YGD B;  5HLO A;  1C7V A;  1AVS A;  1IQ5 A;  1QJT A;  1GQM A;  1NSH A;  1JWD A;  3FE9 A;  1AJ4 A;  1CLM A;  2K7C A;  1NP8 A;  1RJV A;  3EK7 A;  1L2O B;  3IQQ A;  5FI7 A;  1T14 A;  5ER4 X;  3I5F B;  1XK4 A;  2LV7 A;  1OZO A;  4PE1 A;  1SY9 A;  1NCZ A;  4C0J A;  3B86 A;  2KPH A;  1AP4 A;  3BUO B;  2MHH A;  1K96 A;  3ZWH A;  1OOI X;  1B47 A;  1B8R A;  1OZS A;  2L50 A;  1J55 A;  3I5I B;  1BF5 A;  1D1O A;  3S0D A;  1XFX O;  3SG6 A;  1WRK A;  1QXP A;  2MJW B;  1YUS A;  1S6J A;  3AAK A;  3TDU A;  3SS3 A;  2ZKM X;  3LLE A;  3DY9 A;  1ORG A;  4A4B A;  4IJ7 A;  1W7I B;  2JTZ A;  2KHN A;  3F45 A;  2JPT A;  2K8M B;  1TOP A;  4PE4 A;  3VRN A;  1NIW A;  1CLB A;  1IWQ A;  1S5G Y;  1U5I B;  1YRT B;  2FCE A;  4PHM A;  2OS8 B;  5DKR A;  1KQM B;  1CTR A;  2JQ6 A;  2HF5 A;  2K7D A;  2H61 A;  2P71 A;  1JFJ A;  1SMG A;  2LHI A;  1S26 D;  2KFG A;  1IKU A;  1AK8 A;  3OGN A;  4MRY A;  1YTZ C;  4NDD A;  5CSF A;  4TNC A;  3D74 A;  1QIV A;  3O4Y A;  2LLT A;  2P70 A;  2LLU A;  3NGV A;  2WCH A;  2KGB C;  3BFA A;  4GBA A;  1B4C A;  1K9P A;  1QAS A;  2KI6 D;  1B1G A;  1G33 A;  1CDL A;  3D77 A;  1OOF A;  2FJU B;  3BOW A;  1L2O C;  3DVK A;  2GGM A;  3CWG A;  4E68 A;  3CDN A;  1B8L A;  1OMD A;  2GGZ A;  4CLN A;  1OOG A;  3SG5 A;  1JC2 A;  1GGZ A;  4CID A;  3AAJ A;  1Y1U A;  1YVH A;  5DIC A;  3JTD B;  1DGU A;  2L4I A;  1FPW A;  1B9A A;  2SAS A;  4GFT A;  2LAP A;  2KFH A;  2KGR A;  1F8H A;  5D69 A;  2ZRS A;  4M2O A;  3TS5 B;  3DVE A;  1JBA A;  1CM4 A;  1TNP A;  2CCM A;  1KQV A;  1XFU O;  1DJG A;  4N1G A;  1ALW A;  3BUM B;  4CFQ A;  1K8U A;  1RTP 1;  3V2L A;  3L4L A;  2LVV A;  2MRD A;  2NXQ A;  2LE9 B;  1IJ5 A;  2EGD A;  3KPX A;  1SL9 A;  2OTG C;  3O6B A;  3TZ1 A;  1S1E A;  4C0L A;  1EG4 A;  1F71 A;  1UHI A;  4MEW A;  3O4X A;  4QJ5 B;  1QS7 A;  4GUK A;  3D10 A;  3GOF A;  3NXA A;  3PJI A;  4MZJ A;  4N5X A;  1BU3 A;  5G08 A;  1J7P A;  2BNX A;  1MXL C;  5BPJ A;  1NX0 A;  1CDM A;  1DEK A;  2KBM A;  2JOJ A;  2K7O A;  2PSR A;  2K0J A;  4FTG A;  1L7Z A;  2KI6 C;  4BY5 A;  3O2P A;  3I5F C;  1MUX A;  1UHN A;  3TUY C;  1UHK A;  1NCY A;  2BAP A;  4PHJ A;  2JTT A;  4GGF A;  3K1E A;  1S6I A;  2M1U A;  5HKY A;  2B1U A;  3KHE A;  3LCP C;  1OE9 B;  3TS5 C;  1JUO A;  1K94 A;  1HT9 A;  2HQ8 A;  1OOH A;  3S0G A;  1BT6 A;  1MWN A;  4IL1 A;  1P28 A;  1CLL A;  1F4Q A;  3AKB A;  4I5N B;  3KEV A;  3TDI A;  2PVB A;  1A75 A;  1DF0 B;  1CKK A;  3DVJ A;  3B6X A;  1VRK A;  3DYE A;  1FBV A;  4XJK B;  1UWO A;  3OB2 B;  1QLK A;  2SCP A;  1KQM C;  4YI9 A;  1CNP A;  3PM2 A;  1KFU S;  1PSB A;  3VRR A;  2OTG B;  1CDN A;  3WHT B;  1SCM B;  5D7F A;  5HKW A;  2KLE A;  5AXI A;  2AMI A;  5AFP A;  3BXK A;  1PVA A;  2QAC A;  5I2Q A;  1M31 A;  2CTN A;  2ZRT A;  4JPZ B;  1C3Z A;  1K90 D;  3R1V A;  1W9Z A;  1E8A A;  1UHJ A;  3HX4 A;  2KLD A;  4MBE A;  2WCK A;  1OMV A;  4DCK A;  2JUL A;  2QEV A;  1SBJ A;  2LM5 A;  2LUX A;  3BJH A;  1V1F A;  1XVJ A;  5AER A;  2KAX A;  2MLE C;  3CZ0 A;  3TUY B;  4GGF C;  2BE4 A;  1BJF A;  3D76 A;  1Z2C B;  2KI4 C;  2PYQ A;  1BR1 B;  1YUT A;  3C1V A;  2KFF A;  1Y6W A;  2L51 A;  2LNK A;  3NHI A;  2KI4 B;  1QV0 A;  2L98 A;  3D73 A;  1YUR A;  2KDH A;  2ZNE A;  4NQG A;  2PRU A;  2M29 A;  4HRG A;  1JF0 A;  4JWQ A;  4MVF A;  3M0W A;  3RLZ A;  2V53 A;  2WCE A;  2G9B A;  4PHK A;  3PFV A;  1IJ6 A;  4DRW A;  1RRO A;  3SIA A;  2MLF C;  4ICB A;  3PN7 C;  1CMG A;  3CR2 A;  4P2Y B;  2PMY A;  2JNF A;  4YGE B;  1XA5 A;  5GQQ C;  2L4H A;  4HRE E;  2WOR A;  3DF0 B;  3LK1 A;  5CPV A;  2A4J A;  2CBL A;  2OS8 C;  5KU1 A;  4C0K A;  3WNX B;  1DJZ A;  1M63 B;  5PAL A;  4DS7 A;  1PAL A;  2JZI A;  3PSR A;  4MZK A;  4OVN F;  4PCW A;  3S0B A;  2WCJ A;  5J3X A;  1KWO C;  1UUS A;  1SSE B;  1J7O A;  1LVC D;  2JPO A;  1DF0 A;  1SR6 B;  2HET A;  2FJY A;  2LMV A;  1A4P A;  4PDZ A;  4ETO A;  3CS1 A;  3A4U B;  1XO5 A;  4ORB B;  2KQ6 A;  4GAO A;  1AJ5 A;  3R72 A;  3CAB A;  2ZN9 A;  3BFB A;  2L2E A;  1SYM A;  1BR4 B;  2M0R A;  3BQ3 A;  2F2P A;  2G2B A;  2K60 A;  1TTX A;  3DF0 A;  2NZ0 A;  1BOC A;  5I2L A;  2CT9 A;  3B87 A;  2M9G A;  1H8B A;  2I94 A;  1WLM A;  5TNC A;  3TDZ A;  1AHR A;  2H2K A;  1TIZ A;  3OBV A;  1Z4H A;  2LC5 A;  3Q8I A;  1SPY A;  4WQ2 A;  5HL1 A;  3S0A A;  1EG3 A;  2WND A;  5D3O A;  1DEL A;  2AAO A;  1REC A;  3FE8 A;  2YGU A;  1LKJ A;  1PSR A;  1QX5 B;  1J1D A;  4INW A;  3PN7 B;  3KF9 A;  3EK4 A;  5CSN A;  3SJS A;  3CR5 X;  4JQ0 D;  5HLV A;  3KO0 A;  2LMT A;  4ZCV A;  1XFZ O;  1SCM C;  2AUC A;  1QWV A;  2NCP A;  1KWO B;  2L2C A;  1NX3 A;  4HSZ A;  2M8U A;  3OHM B;  1TUJ A;  4MN0 A;  4BY4 A;  1S5G Z;  5KTY A;  1YRU B;  4PAL A;  2CXJ A;  3NSO A;  1BG1 A;  1U5I A;  2NLN A;  1PVB A;  1QV1 A;  1K9U A;  4JKT A;  3I5G B;  1YR5 A;  1DTL A;  1CFF A;  3CTN A;  1BOD A;  1ODB A;  2WC6 A;  3L4A A;  2M7N A;  4R1E A;  1CMF A;  1QAT A;  1PK0 D;  3RZS A;  3UNW A;  4OV2 A;  2QDI A;  2Q91 A;  2BCX A;  1F4O A;  1RFJ A;  2LUC A;  5EL2 A;  5I94 A;  1NYA A;  2KBI A;  1K93 D;  2TN4 A;  2LP3 A;  2M7L A;  2O5G A;  1V1G A;  2PAS A;  2H61 C;  1DGV A;  1KSM A;  2WCB A;  1M46 A;  1ZMZ A;  3CYZ A;  1UHH A;  1CFD A;  3CZ1 A;  3AKA A;  3CZ2 A;  4PE0 A;  2JXC A;  1EH2 A;  2F33 A;  2LCP A;  3I5I C;  3FIA A;  4PHN A;  1F55 A;  1C07 A;  1LS8 A;  1ZFS A;  1GM0 A;  1ALV A;  3RM1 A;  1J7Q A;  1PUL A;  3JVT C;  2FOT A;  1IRJ A;  3A8R A;  2LVK A;  2Y1N A;  1KK8 B;  3BFH A;  3BYA A;  4PT1 A;  1F70 A;  1RWY A;  4AQJ A;  3S0E A;  2I18 A;  1DT7 B;  1EJ3 A;  1KK8 C;  1DVI A;  3OX6 A;  3CLN A;  1S36 A;  3D0Y B;  2P6B B;  2JU0 A;  2PQL A;  1EL4 A;  2EC6 C;  2K2F A;  3N7H A;  2KAY A;  1EXR A;  1K9K A;  3PAL A;  1N0Y A;  1SL7 A;  2EC6 B;  3EKH A;  1TNX A;  3EVR A;  3VB1 A;  1SL8 A;  1MXE A;  4MZL A;  1G8I A;  1LA0 A;  1CFC A;  3BUW B;  5DKQ A;  3D78 A;  2KYF A;  4HRH A;  2ISD A;  3JTD C;  1KFU L;  1OW4 A;  1NWD A;  4CFR A;  1G4Y R;  4YI8 A;  4DUQ A;  2BE6 A;  1LA3 A;  2F3Y A;  3HCM A;  4NDB A;  2GV5 A;  3I5H B;  2JWW A;  1B7T Y;  4QJ3 B;  1TCO B;  2JT0 A;  2QEO A;  2HPS A;  2QPT A;  3L47 A;  1DJY A;  2WCF A;  5FYX A;  2MBX A;  3EK8 A;  2L0P A;  1CDP A;  1Y1A A;  1YUU A;  3WXA A;  3GK2 A;  4JD9 A;  5KSZ A;  1DJX A;  5I2O A;  2F8P A;  1SRA A;  2L5X B;  4L9M A;  1TCF A;  1FI5 A;  1B8C A;  2BKH B;  1TNW A;  3IF7 A;  2I2R E;  2JC2 A;  2RGI A;  1A03 A;  4NDC A;  2LMU A;  2QEB A;  1JFK A;  2EHB A;  2K2A A;  3I5G C;  5B8I B;  4OKH A;  3OB1 B;  1UUR A;  3PLF B;  2MA2 A;  1XK4 C;  1XYD A;  3SG3 A;  1QIW A;  1TUZ A;  3D75 A;  4INX A;  2H8V A;  2KQY A;  1GGW A;  3CZT X;  1JF2 A;  3SIB A;  4I5K A;  1NX2 A;  2BKI B;  2ZN8 A;  3NSK A;  5AAN A;  5AEQ A;  3SG4 A;  2JXL A;  3DVM A;  4AOM A;  4MRX A;  4KYN A;  2BEC A;  2BBN A;  4ORC B;  3I5H C;  4YRU A;  5F6T A;  1K2H A;  4FQT A;  4Q04 A;  5IBW A;  1UP5 A;  3ZNI A;  1KK7 Z;  1SKT A;  1KCY A;  1NX1 A;  3B7A A;  1J1E A;  3ICB A;  1IQ3 A;  1CB1 A;  4P5O E;  1JSA A;  1SCV A;  1XFW O;  1Y1X A;  2WC8 A;  5JJG A;  4D1E A;  4UPG A;  3GK4 X;  2ERB A;  1YVL A;  1QTX A;  3EVU A;  2O60 A;  2LHL A;  4GGN A;  1OMR A;  2QEH A;  1IGV A;  2WOS A;  3IQO A;  1YX7 A;  2E30 A;  3LL8 B;  1ZAC A;  3DXL A;  1MF8 B;  1LIN A;  1XFY O;  1X02 A;  1FW4 A;  3LK0 A;  2VRG A;  3IVT A;  3QME A;  1MR8 A;  4M2Q A;  1M39 A;  5FI6 A;  3UO9 A;  1DC1 A;  2JT8 A;  2M3W A;  2M1K B;  2I7A A;  4WQ3 A;  1FF1 A;  2IS9 A;  4QJ4 B;  1N65 A;  2Y4Q A;  1HQV A;  5CSI A;  5DKN A;  3VRO A;  4N1F A;  1F54 A;  1A29 A;  1KK7 Y;  1XFR A;  4I5L B;  4YGA A;  2LLS A;  2Y5I A;  4XJK A;  1IH0 A;  1NCX A;  1QLS A;  2L5Y A;  1SW8 A;  2KOT A;  3DZT A;  3MSE B;  2ZND A;  3FWC A;  2BCB A;  3BUN B;  4F0Z B;  1DQE A;  1DJI A;  1WRL A;  1OOJ A;  1QX2 A;  1R6P A;  1TRF A;  1WDC C;  2BCA A;  4ZCU A;  4YBH B;  2JNX A;  2LVJ A;  4OZD A;  1C3Y A;  1LXF C;  1TNQ A;  3SS5 A;  2D8N A;  1H4B A;  1QX7 A;  1Q80 A;  4YGB B;  2KYC A;  3SG7 A;  3GK1 A;  3D0Y A;  1NPQ A;  5JOL A;  5HYD A;  2GTE A;  3NSI A;  1SNL A;  4DIR A;  3DD4 A;  3FWB A;  1KFX S;  1J7R A;  1AUI B; 
#chains in the Genus database with same CATH homology
 1WLZ A;  1W7J B;  3VGO A;  3VRQ A;  1R2U A;  3K21 A;  1K95 A;  1GJY A;  1BMO A;  2R2I A;  1SK6 D;  2KSP A;  3OP0 A;  1S6C A;  1BLQ A;  1N2D A;  1XFV O;  1M45 A;  4MSP A;  4YGC B;  1MHO A;  2FCD A;  1SR6 C;  4OR9 B;  1WRZ A;  3NSL A;  1QVI Y;  2LP2 A;  4OCI A;  2HQW A;  1OSA A;  1S3P A;  3EKJ A;  2NCO A;  5K89 A;  5ER5 A;  2COL B;  1NUB A;  2BL0 B;  2Q4U A;  2MAZ A;  1WY9 A;  2BBM A;  5CSJ A;  5HKZ A;  2DOQ A;  3VRP A;  1FI6 A;  2F2O A;  1B7T Z;  1WDC B;  3E3R A;  1RK9 A;  1PRW A;  3OX5 A;  1A2X A;  2M49 B;  1CFF A;  1MQ1 A;  2K61 A;  2PAL A;  1DJW A;  2JRF A;  4I5J A;  4AQI A;  2K7B A;  1KFX L;  2KAV A;  4PE7 A;  4GNK B;  1TN4 A;  4ORA B;  4WRI A;  4FQO A;  3PM8 A;  3EVV A;  1CFP A;  3CGA A;  4A4C A;  4XYN A;  2OPO A;  3JVT B;  4CPV A;  4M2P A;  1A75 B;  3SG2 A;  2KNE A;  1IG5 A;  2Y1M A;  2F3Z A;  3BOW B;  3BUX B;  3O78 A;  4USL A;  1QVI Z;  1ZOT B;  3WHU B;  2JT3 A;  4GPL B;  1CM1 A;  1YX8 A;  2LVI A;  1Y0V H;  2E6W A;  3PAT A;  1DJH A;  4MLW A;  1DMO A;  1ZUZ A;  3QRX A;  2LAN A;  3CR4 X;  4U8D A;  5I8N A;  1C7W A;  3H4S E;  2M97 A;  3FS7 A;  2BL0 C;  1KSO A;  1OQP A;  2ZFD A;  2CNP A;  4YGD B;  5HLO A;  1C7V A;  1AVS A;  1IQ5 A;  1QJT A;  1GQM A;  1NSH A;  1JWD A;  1AJ4 A;  1CLM A;  2K7C A;  1NP8 A;  1RJV A;  3EK7 A;  1L2O B;  3IQQ A;  5ER4 X;  3I5F B;  1XK4 A;  2LV7 A;  1OZO A;  4PE1 A;  1SY9 A;  1NCZ A;  4C0J A;  1AP4 A;  3BUO B;  2MHH A;  1K96 A;  3ZWH A;  1B47 A;  1B8R A;  1OZS A;  2L50 A;  1J55 A;  3I5I B;  1BF5 A;  1D1O A;  1XFX O;  3SG6 A;  1WRK A;  1QXP A;  2MJW B;  1YUS A;  1S6J A;  3AAK A;  3TDU A;  2ZKM X;  3LLE A;  4A4B A;  1W7I B;  2JTZ A;  2KHN A;  3F45 A;  2JPT A;  2K8M B;  1TOP A;  4PE4 A;  3VRN A;  1NIW A;  1CLB A;  1IWQ A;  1S5G Y;  1U5I B;  1YRT B;  2FCE A;  4PHM A;  2OS8 B;  5DKR A;  1KQM B;  1CTR A;  2JQ6 A;  2HF5 A;  2K7D A;  2H61 A;  1SMG A;  2LHI A;  1S26 D;  2KFG A;  1IKU A;  1AK8 A;  4MRY A;  1YTZ C;  4NDD A;  5CSF A;  4TNC A;  1QIV A;  3O4Y A;  2LLT A;  2LLU A;  2KGB C;  4GBA A;  1B4C A;  1K9P A;  1QAS A;  2KI6 D;  1B1G A;  1G33 A;  1CDL A;  2FJU B;  3BOW A;  1L2O C;  3DVK A;  2GGM A;  3CWG A;  4E68 A;  1B8L A;  1OMD A;  2GGZ A;  4CLN A;  3SG5 A;  1JC2 A;  1GGZ A;  4CID A;  3AAJ A;  1Y1U A;  1YVH A;  3JTD B;  1DGU A;  2L4I A;  1FPW A;  1B9A A;  2SAS A;  4GFT A;  2LAP A;  2KFH A;  2KGR A;  1F8H A;  5D69 A;  2ZRS A;  4M2O A;  3TS5 B;  3DVE A;  1JBA A;  1CM4 A;  1TNP A;  2CCM A;  1KQV A;  1XFU O;  1DJG A;  4N1G A;  1ALW A;  3BUM B;  4CFQ A;  1K8U A;  1RTP 1;  2LVV A;  2MRD A;  2NXQ A;  2LE9 B;  1IJ5 A;  2EGD A;  3KPX A;  1SL9 A;  2OTG C;  3O6B A;  3TZ1 A;  1S1E A;  4C0L A;  1EG4 A;  1F71 A;  1UHI A;  4MEW A;  4QJ5 B;  1QS7 A;  4GUK A;  3D10 A;  3GOF A;  3NXA A;  4MZJ A;  4N5X A;  1BU3 A;  5G08 A;  1J7P A;  1MXL C;  5BPJ A;  1NX0 A;  1CDM A;  2KBM A;  2JOJ A;  2K7O A;  2PSR A;  2K0J A;  4FTG A;  1L7Z A;  2KI6 C;  4BY5 A;  3O2P A;  3I5F C;  1MUX A;  1UHN A;  3TUY C;  1UHK A;  1NCY A;  4PHJ A;  2JTT A;  4GGF A;  1S6I A;  2M1U A;  5HKY A;  2B1U A;  3KHE A;  3LCP C;  1OE9 B;  3TS5 C;  1JUO A;  1K94 A;  1HT9 A;  2HQ8 A;  1BT6 A;  1MWN A;  4IL1 A;  1CLL A;  1F4Q A;  3AKB A;  4I5N B;  3KEV A;  3TDI A;  2PVB A;  1A75 A;  1DF0 B;  1CKK A;  3DVJ A;  1VRK A;  1FBV A;  4XJK B;  1UWO A;  3OB2 B;  1QLK A;  2SCP A;  1KQM C;  4YI9 A;  1CNP A;  1KFU S;  1PSB A;  3VRR A;  2OTG B;  1CDN A;  3WHT B;  1SCM B;  5D7F A;  5HKW A;  5AXI A;  2AMI A;  5AFP A;  3BXK A;  1PVA A;  2QAC A;  5I2Q A;  1M31 A;  2CTN A;  2ZRT A;  4JPZ B;  1K90 D;  3HX4 A;  1E8A A;  1UHJ A;  4DCK A;  4MBE A;  1OMV A;  2JUL A;  1SBJ A;  2LM5 A;  2LUX A;  1V1F A;  1XVJ A;  5AER A;  2KAX A;  2MLE C;  3TUY B;  4GGF C;  2BE4 A;  1BJF A;  2KI4 C;  3C1V A;  1BR1 B;  1YUT A;  2KFF A;  1Y6W A;  2L51 A;  2LNK A;  2KI4 B;  1QV0 A;  2L98 A;  4NQG A;  1YUR A;  2KDH A;  2ZNE A;  2PRU A;  2M29 A;  4HRG A;  1JF0 A;  4JWQ A;  4MVF A;  3M0W A;  3RLZ A;  2V53 A;  2WCE A;  2G9B A;  4PHK A;  3PFV A;  1IJ6 A;  4DRW A;  1RRO A;  3SIA A;  2MLF C;  4ICB A;  3PN7 C;  1CMG A;  3CR2 A;  4P2Y B;  2PMY A;  2JNF A;  4YGE B;  1XA5 A;  5GQQ C;  2L4H A;  4HRE E;  2WOR A;  3DF0 B;  3LK1 A;  5CPV A;  2A4J A;  2CBL A;  2OS8 C;  5KU1 A;  4C0K A;  3WNX B;  1DJZ A;  1M63 B;  5PAL A;  4DS7 A;  1PAL A;  2JZI A;  3PSR A;  4MZK A;  4OVN F;  4PCW A;  5J3X A;  1KWO C;  1UUS A;  1J7O A;  1LVC D;  1DF0 A;  1SR6 B;  2HET A;  2LMV A;  1A4P A;  4PDZ A;  4ETO A;  3CS1 A;  3A4U B;  1XO5 A;  4ORB B;  2KQ6 A;  4GAO A;  1AJ5 A;  2ZN9 A;  2L2E A;  1SYM A;  1BR4 B;  2M0R A;  3BQ3 A;  2F2P A;  2G2B A;  1TTX A;  3DF0 A;  2NZ0 A;  1BOC A;  5I2L A;  2CT9 A;  2M9G A;  1H8B A;  2I94 A;  1WLM A;  5TNC A;  3TDZ A;  1AHR A;  2H2K A;  1TIZ A;  2LC5 A;  4WQ2 A;  1SPY A;  1EG3 A;  2WND A;  2AAO A;  1REC A;  1LKJ A;  1PSR A;  1QX5 B;  1J1D A;  3PN7 B;  3KF9 A;  3EK4 A;  5CSN A;  3SJS A;  3CR5 X;  4JQ0 D;  5HLV A;  3KO0 A;  2LMT A;  4ZCV A;  1XFZ O;  1SCM C;  2AUC A;  2NCP A;  1KWO B;  1NX3 A;  4HSZ A;  2M8U A;  3OHM B;  4MN0 A;  4BY4 A;  1S5G Z;  5KTY A;  1YRU B;  4PAL A;  2CXJ A;  3NSO A;  1BG1 A;  1U5I A;  2NLN A;  1PVB A;  1QV1 A;  1K9U A;  3I5G B;  1YR5 A;  1DTL A;  3CTN A;  1BOD A;  1ODB A;  2M7N A;  4R1E A;  1CMF A;  1QAT A;  1PK0 D;  4OV2 A;  2Q91 A;  2BCX A;  1F4O A;  1RFJ A;  2LUC A;  1NYA A;  2KBI A;  1K93 D;  2TN4 A;  2LP3 A;  2M7L A;  2O5G A;  1V1G A;  2PAS A;  2H61 C;  1DGV A;  1KSM A;  2WCB A;  1M46 A;  1ZMZ A;  1UHH A;  1CFD A;  3AKA A;  4PE0 A;  2JXC A;  1EH2 A;  2F33 A;  2LCP A;  3I5I C;  3FIA A;  4PHN A;  1F55 A;  1C07 A;  1ZFS A;  1ALV A;  3RM1 A;  1J7Q A;  1PUL A;  3JVT C;  2FOT A;  1IRJ A;  3A8R A;  2LVK A;  2Y1N A;  1KK8 B;  3BYA A;  1F70 A;  1RWY A;  4AQJ A;  2I18 A;  1DT7 B;  1EJ3 A;  1KK8 C;  1DVI A;  3OX6 A;  3CLN A;  1S36 A;  3D0Y B;  2P6B B;  2JU0 A;  1EL4 A;  2EC6 C;  2K2F A;  2KAY A;  1EXR A;  1K9K A;  3PAL A;  1N0Y A;  1SL7 A;  2EC6 B;  3EKH A;  1TNX A;  3EVR A;  1JFJ A;  1SL8 A;  1MXE A;  4MZL A;  1G8I A;  1LA0 A;  1CFC A;  3BUW B;  5DKQ A;  2KYF A;  4HRH A;  2ISD A;  3JTD C;  1KFU L;  1NWD A;  4CFR A;  1G4Y R;  4YI8 A;  4DUQ A;  2BE6 A;  1LA3 A;  2F3Y A;  3HCM A;  4NDB A;  2GV5 A;  3I5H B;  2JWW A;  1B7T Y;  4QJ3 B;  1TCO B;  2JT0 A;  2HPS A;  2QPT A;  1DJY A;  2WCF A;  5FYX A;  2MBX A;  3EK8 A;  2L0P A;  1CDP A;  1Y1A A;  1YUU A;  3WXA A;  3GK2 A;  5KSZ A;  1DJX A;  5I2O A;  2F8P A;  1SRA A;  2L5X B;  4L9M A;  1TCF A;  1FI5 A;  1B8C A;  2BKH B;  1TNW A;  3IF7 A;  2I2R E;  2JC2 A;  2RGI A;  1A03 A;  4NDC A;  2LMU A;  1JFK A;  2EHB A;  2K2A A;  3I5G C;  5B8I B;  4OKH A;  3OB1 B;  1UUR A;  3PLF B;  2MA2 A;  1XK4 C;  1XYD A;  3SG3 A;  1QIW A;  2KQY A;  1GGW A;  3CZT X;  1JF2 A;  3SIB A;  4I5K A;  1NX2 A;  2BKI B;  2ZN8 A;  3NSK A;  5AAN A;  5AEQ A;  3SG4 A;  2JXL A;  3DVM A;  4AOM A;  4MRX A;  2BEC A;  2BBN A;  4ORC B;  3I5H C;  4YRU A;  5F6T A;  1K2H A;  5IBW A;  4Q04 A;  1UP5 A;  3ZNI A;  1KK7 Z;  1SKT A;  1KCY A;  1NX1 A;  3ICB A;  1J1E A;  1IQ3 A;  1CB1 A;  4P5O E;  1JSA A;  1SCV A;  1XFW O;  1Y1X A;  2WC8 A;  5JJG A;  4D1E A;  4UPG A;  3GK4 X;  1YVL A;  1QTX A;  3EVU A;  2O60 A;  2LHL A;  4GGN A;  1OMR A;  1IGV A;  2WOS A;  3IQO A;  1YX7 A;  2E30 A;  3LL8 B;  1ZAC A;  1MF8 B;  1LIN A;  1XFY O;  1X02 A;  1FW4 A;  3LK0 A;  2VRG A;  4M2Q A;  1MR8 A;  1M39 A;  2JT8 A;  2M3W A;  2M1K B;  2I7A A;  4WQ3 A;  1FF1 A;  2IS9 A;  4QJ4 B;  1N65 A;  2Y4Q A;  1HQV A;  5CSI A;  5DKN A;  3VRO A;  4N1F A;  1F54 A;  1A29 A;  1KK7 Y;  4I5L B;  4YGA A;  2LLS A;  2Y5I A;  4XJK A;  1IH0 A;  1NCX A;  1QLS A;  1SW8 A;  2KOT A;  3MSE B;  2ZND A;  3FWC A;  2BCB A;  3BUN B;  4F0Z B;  4ZCU A;  1DJI A;  1WRL A;  1OOJ A;  1QX2 A;  1R6P A;  1TRF A;  1WDC C;  2BCA A;  4YBH B;  2JNX A;  2LVJ A;  1LXF C;  1TNQ A;  2D8N A;  1H4B A;  1QX7 A;  1Q80 A;  4YGB B;  2KYC A;  3SG7 A;  3GK1 A;  3D0Y A;  1NPQ A;  5JOL A;  5HYD A;  3NSI A;  1SNL A;  4DIR A;  3DD4 A;  3FWB A;  1KFX S;  1J7R A;  1AUI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...