3QRXA

Chlamydomonas reinhardtii centrin bound to melittin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
VGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKMGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure, molecular dynamics, and energetics of centrin-melittin complex.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Metal binding protein/toxin
molecule keywords Centrin
total genus 49
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3qrxA02
4UPGA 2JNXA 3JTDC 1KK8B 2HF5A 3EK7A 4ICBA 1E8AA 4USLA 1J7QA 1S5GY 1Y1AA 4NDDA 3TS5C 3TS5B 4CFRA 4YGEB 1K9KA 1C07A 1IKUA 2LVKA 3AKAA 1MWNA 3PN7C 1PRWA 2KFHA 2L5XB 1QLSA 4NDCA 1EH2A 2MJWB 1B8CA 4ORCB 1WY9A 1JC2A 2VRGA 3EVRA 1JF0A 2L98A 2LVIA 2NZ0A 3CR2A 1MF8B 4GNKB 1EXRA 1YUUA 1FF1A 1WRLA 2KFGA 1GGZA 1M31A 1MR8A 2Y1NA 3DF0A 1KK8C 4TNCA 2KSPA 1VRKA 2LC5A 4OKHA 1LXFC 1BU3A 4HSZA 1TIZA 1LA3A 3I5FC 1FBVA 2K7BA 1B9AA 2LVJA 3SG5A 4E68A 1N0YA 5PALA 1DJHA 2JULA 2OS8C 3DVJA 1SRAA 1NSHA 5DKNA 2FCDA 1NX2A 1QTXA 1B8RA 2GGZA 1PK0D 2I18A 2K7DA 3FWCA 5AANA 3IQQA 3JTDB 2LLTA 1KFXL 1L2OC 4MZJA 2GV5A 5HKWA 1QX2A 4MEWA 5D7FA 3SG4A 2Y5IA 5AERA 1TOPA 3DVMA 2JTTA 4XJKB 2AAOA 4A4CA 1DTLA 2LMTA 1CDMA 1QJTA 1RROA 4JPZB 3OX5A 1K2HA 3D0YB 1OMDA 1AVSA 4PALA 1SK6D 2KAXA 2LLUA 2LP2A 2G9BA 1D1OA 1NCZA 2V53A 3A4UB 3JVTC 4ZCVA 1X02A 4L9MA 2OS8B 1XVJA 3K21A 1IRJA 2PSRA 1PSBA 1KSMA 3PATA 3TDZA 4XYNA 5KU1A 1DF0B 4C0LA 1QIVA 2JT3A 2JWWA 3KHEA 2OPOA 5BPJA 5CSJA 5HLVA 1NPQA 4MBEA 1WRZA 3D10A 2LHLA 2LLSA 1S36A 1CNPA 1ZMZA 1KFUS 3ZWHA 2F3YA 4MRYA 3RM1A 2I2RE 2HETA 1SYMA 1CKKA 1L2OB 2LE9B 1IQ5A 1IG5A 4PE1A 3I5GB 3LCPC 1SNLA 1PULA 2KYCA 2BKIB 4AQIA 2KGBC 2JRFA 5HLOA 2JPTA 5HKZA 1DJGA 1F71A 1MUXA 3BOWA 3WXAA 1G4YR 1ALWA 2JZIA 3E3RA 1H4BA 2PASA 1NCXA 4GGFC 2K61A 2A4JA 3CS1A 2KYFA 1B7TY 2KNEA 5HKYA 3CWGA 5ER5A 1A75A 1BMOA 3JVTB 4A4BA 1WDCC 1OMVA 1F8HA 1TNWA 3NSOA 1BODA 1DMOA 1K9UA 1AHRA 2JC2A 2KDHA 2M0RA 1KK7Z 2PMYA 3TDIA 2O60A 1V1GA 4NDBA 1CFPA 1J7PA 4CPVA 1QX5B 1S1EA 4NQGA 3EKJA 1IH0A 4GFTA 3PN7B 4D1EA 2Q4UA 1B4CA 3NSIA 2KAYA 1GQMA 2M3WA 2LCPA 2CT9A 1TCOB 2F2PA 2K2FA 1B8LA 3DF0B 2CTNA 1XK4C 3PLFB 4PHJA 1S6JA 4F0ZB 3BUMB 2F2OA 1DT7B 1NX3A 1EG3A 3CR4X 3EK8A 3M0WA 1QS7A 2FJUB 2RGIA 1YURA 1ALVA 2K7OA 2KBMA 2ZRTA 1OZSA 2JOJA 1M45A 2PALA 2BCBA 3IF7A 1UP5A 1AJ4A 1WDCB 3DVKA 1IJ6A 1XFWO 2ZFDA 1B1GA 1MXLC 5ER4X 1A4PA 1UHIA 4CIDA 5I2OA 3AAKA 1BJFA 1KFUL 4Q04A 1XO5A 3A8RA 3GK2A 4I5KA 3AKBA 4GAOA 3SG2A 1LA0A 1SW8A 2KQYA 3MSEB 1NUBA 4C0JA 1UHKA 1XK4A 2L4IA 3GK1A 2LMUA 4FQOA 2ZN8A 1AK8A 2BE4A 3FIAA 1S6IA 1K96A 2LUCA 2NXQA 1V1FA 4DRWA 1DVIA 1YUSA 2CCMA 2M1KB 2EGDA 4AQJA 1S26D 2LV7A 1TNXA 2M29A 1K93D 3QRXA 1MQ1A 1CFFA 1TRFA 3VRRA 1PALA 2FOTA 4MRXA 3SG7A 3RLZA 3TDUA 3PFVA 4GGFA 3CTNA 1OQPA 1U5IB 1LVCD 4MSPA 1C7WA 1BR4B 1J55A 1AUIB 1BT6A 5JJGA 1KWOB 2MLFC 1BR1B 1Y1XA 1TNPA 2BL0C 3I5HC 4CFQA 1JFKA 1SR6C 2KBIA 2BBNA 1DJYA 3I5GC 2KGRA 2B1UA 3VROA 3BUXB 2CBLA 2AMIA 1N65A 2JTZA 1CFDA 1SKTA 2WC8A 1OSAA 1QLKA 4YBHB 1CMGA 1LINA 1RECA 1ZACA 3EKHA 4AOMA 2BE6A 1QASA 3FWBA 3CLNA 3KF9A 2JQ6A 1UWOA 5K89A 1MXEA 1SPYA 3SG6A 3GK4X 4BY5A 4GGNA 1DF0A 2K0JA 1GGWA 2MLEC 4PE7A 1CFCA 1TTXA 4MN0A 3AAJA 1ZOTB 2LM5A 5DKRA 2Y1MA 4GUKA 4MLWA 1QVIZ 3OHMB 1J1DA 1OE9B 2ZKMX 1QV1A 1KK7Y 5IBWA 4P5OE 1KFXS 2NCOA 4M2OA 1ODBA 1DGUA 2NCPA 2IS9A 2L50A 3EVUA 1N2DA 2I94A 1K95A 1QV0A 1DJWA 5GQQC 4CLNA 2HPSA 3CR5X 4N5XA 1TNQA 2JU0A 2PVBA 1JUOA 5G08A 2MBXA 2F8PA 1YVLA 4IL1A 3WNXB 1J1EA 2KI6D 2TN4A 3HX4A 4WRIA 1BF5A 3GOFA 1SY9A 1R6PA 4YI8A 1B47A 1WLZA 1FW4A 2LMVA 5CSNA 1W7IB 2E6WA 1YR5A 3NXAA 1UHHA 1NX0A 2K2AA 1L7ZA 2COLB 2D8NA 1TCFA 4ORAB 2BECA 2JT8A 3CZTX 3EK4A 4R1EA 1JSAA 3BUNB 3VRPA 2HQ8A 5CPVA 4OR9B 1QATA 3ICBA 2BCAA 5FYXA 3I5HB 1F54A 3I5IC 4MZKA 1UHNA 2QPTA 5I2LA 1F70A 4QJ5B 2M1UA 5TNCA 4DIRA 4OV2A 1JBAA 3TZ1A 1SCMC 2H61A 1NX1A 4QJ4B 3PALA 3VRNA 1H8BA 1YVHA 2KHNA 1ZFSA 2HQWA 2ZNDA 4PHMA 1K94A 1KWOC 4YGDB 4DS7A 4HRHA 2M49B 2L51A 1SR6B 2LANA 2OTGB 2M97A 4ORBB 2DOQA 1SCVA 5JOLA 2LP3A 4JWQA 1YX8A 1IGVA 1Y1UA 1JWDA 4YRUA 1DGVA 1EG4A 1KQVA 1OZOA 1CM1A 3WHUB 3ZNIA 2LVVA 1BLQA 1M39A 2PRUA 1K8UA 2MAZA 3PM8A 4MZLA 2O5GA 1UURA 1DJZA 2WOSA 2LUXA 5HYDA 1G8IA 1NYAA 1OMRA 1SCMB 4PE4A 1F4OA 1KSOA 3C1VA 3LK0A 2M7NA 2ISDA 4WQ2A 1KQMC 1SBJA 4BY4A 1KQMB 2KI6C 2M8UA 3BUWB 1RFJA 2SCPA 3KPXA 2Q91A 1GJYA 1K90D 2H2KA 2BCXA 3I5FB 1PSRA 4I5NB 3VRQA 5B8IB 2E30A 3OX6A 2L2EA 1CLLA 2EC6C 1BOCA 2CXJA 1PVBA 1W7JB 3TUYC 1A2XA 1HT9A 3BQ3A 5AXIA 2SASA 1S3PA 1IQ3A 1CDNA 4OCIA 2F3ZA 1NIWA 2KOTA 3NSKA 2F33A 4YGCB 2QACA 4QJ3B 1A03A 3PSRA 3NSLA 1NP8A 5I8NA 2GGMA 4PCWA 4P2YB 3KEVA 4N1GA 2WCEA 4HREE 1CDPA 1M63B 1S5GZ 1G33A 4DCKA 1XFYO 1J7RA 2JXCA 2BL0B 3I5IB 5F6TA 1DJXA 1YX7A 1F4QA 1U5IA 2G2BA 1Y0VH 3OP0A 2EHBA 2EC6B 3BYAA 1RTP1 1XA5A 1MHOA 5D69A 2MRDA 1F55A 4MVFA 1JF2A 1FPWA 1AP4A 2WNDA 1YUTA 4PHNA 3O2PA 1QX7A 2BKHB 2KFFA 1UUSA 3KO0A 3OB1B 1CLBA 2FCEA 4YGAA 2ZRSA 1XFXO 1C7VA 3HCMA 1FI5A 3DVEA 2K7CA 4YI9A 1QVIY 1YRUB 2H61C 2MA2A 1PVAA 3LK1A 3BXKA 3TUYB 1FI6A 1IJ5A 1S6CA 4XJKA 3IQOA 2MHHA 1OOJA 2WORA 2L0PA 1SMGA 5KSZA 1WLMA 1RJVA 1XFUO 2P6BB 2JT0A 3D0YA 2WCFA 2LAPA 1YTZC 1LKJA 1J7OA 4GPLB 2KAVA 4C0KA 3VGOA 3EVVA 1RK9A 2ZN9A 3H4SE 4FTGA 4OVNF 3LLEA 1AJ5A 1Q80A 5AEQA 4M2QA 3WHTB 2M9GA 2M7LA 3SJSA 1IWQA 1XYDA 1NCYA 1QXPA 1XFZO 1CTRA 1UHJA 5J3XA 5AFPA 2JXLA 1CLMA 4N1FA 2CNPA 4ETOA 1RWYA 4ZCUA 1M46A 4JQ0D 4PHKA 2L4HA 1JFJA 1XFVO 2BBMA 1SL7A 5KTYA 4I5JA 5CSIA 4I5LB 5DKQA 2KI4C 1CM4A 1R2UA 3BUOB 2NLNA 3DD4A 3F45A 3LL8B 1K9PA 3O4YA 2ZNEA 2LNKA 1CDLA 4GBAA 3SIBA 5I2QA 4U8DA 3FS7A 1A29A 1SL9A 1Y6WA 2I7AA 2R2IA 1NWDA 4HRGA 1TN4A 1A75B 1EJ3A 1B7TZ 3O6BA 1QIWA 1WRKA 1CMFA 1SL8A 4M2PA 5CSFA 3SG3A 4PDZA 2LHIA 1KCYA 2OTGC 2AUCA 2WCBA 4PE0A 3CGAA 1BG1A 3BOWB 1HQVA 4DUQA 4WQ3A 1CB1A 2JNFA 3O78A 3OB2B 4YGBB 3SIAA 2K8MB 2Y4QA 1DJIA 1EL4A 2KQ6A 2KI4B 1YRTB 1ZUZA
chains in the Genus database with same CATH superfamily
4UPGA 2JNXA 5EL2A 3JTDC 1KK8B 2HF5A 3EK7A 4ICBA 1E8AA 4USLA 1J7QA 1DELA 1S5GY 1Y1AA 4NDDA 3TS5C 3TS5B 4CFRA 4INWA 4YGEB 1K9KA 1C07A 1IKUA 2LVKA 3AKAA 1MWNA 3PN7C 1PRWA 2KFHA 2L5XB 1QLSA 4NDCA 1EH2A 2MJWB 1B8CA 4ORCB 1WY9A 1JC2A 2VRGA 3EVRA 1JF0A 2L98A 2LVIA 2NZ0A 3CR2A 1MF8B 4GNKB 3V2LA 1EXRA 1YUUA 1FF1A 1OOFA 1WRLA 1GGZA 1M31A 2KFGA 1MR8A 3CABA 2Y1NA 3DF0A 1KK8C 4TNCA 1GM0A 2KSPA 1VRKA 2LC5A 4IJ7A 4OKHA 1LXFC 1BU3A 4HSZA 1TIZA 1LA3A 3I5FC 3FE6A 1FBVA 2K7BA 1B9AA 2LVJA 3SG5A 4E68A 1N0YA 5PALA 1DJHA 2JULA 2OS8C 3L47A 3DVJA 1SRAA 1NSHA 5DKNA 2FCDA 1NX2A 1QTXA 1B8RA 4JKTA 2GGZA 1PK0D 2I18A 2K7DA 3FWCA 5AANA 3IQQA 3JTDB 2LLTA 1KFXL 1L2OC 4MZJA 2GV5A 5HKWA 1QX2A 4MEWA 5D7FA 3SG4A 2Y5IA 5AERA 3PM2A 1C3ZA 1TOPA 3DVMA 2JTTA 4XJKB 2AAOA 4A4CA 1DTLA 1OOGA 3L4LA 3DXLA 2LMTA 2PQLA 1CDMA 1QJTA 3BFHA 1RROA 4JPZB 3OX5A 1K2HA 3CZ2A 3D0YB 1OMDA 1AVSA 4PALA 1SK6D 2KAXA 2LLUA 2LP2A 2G9BA 1D1OA 1NCZA 2BAPA 2V53A 3A4UB 3JVTC 4ZCVA 2FJYA 1X02A 4L9MA 2OS8B 2H8VA 1XVJA 3K21A 1IRJA 2PSRA 1PSBA 2P71A 1KSMA 3PATA 3TDZA 4XYNA 1ORGA 5KU1A 1DF0B 4C0LA 1QIVA 2JT3A 2JWWA 3KHEA 3FE9A 2OPOA 5BPJA 5CSJA 3BFBA 1NPQA 5HLVA 4MBEA 1WRZA 3D10A 2LHLA 2LLSA 1S36A 1CNPA 1ZMZA 1KFUS 3ZWHA 2F3YA 4MRYA 3RM1A 2I2RE 2HETA 1SYMA 1CKKA 1L2OB 2LE9B 1IQ5A 1IG5A 3EG5B 4PE1A 3I5GB 3LCPC 1SNLA 1PULA 1P28A 2BKIB 2KYCA 3DYEA 2KGBC 2ERBA 4AQIA 2JRFA 5HLOA 2JPTA 5HKZA 1DJGA 1F71A 1MUXA 3BOWA 4JD9A 3WXAA 1G4YR 1ALWA 2JZIA 3E3RA 1H4BA 2PASA 1NCXA 4GGFC 2K61A 2A4JA 3CZ0A 2KQ6A 3CS1A 2KYFA 1B7TY 2KNEA 5HKYA 3CWGA 5ER5A 1A75A 1BMOA 3JVTB 4A4BA 1WDCC 1Z4HA 1OMVA 1F8HA 1TNWA 3NSOA 1BODA 1DMOA 1K9UA 1AHRA 2JC2A 2KDHA 2M0RA 1KK7Z 2PMYA 4FQTA 3TDIA 4OZDA 3S0FA 2O60A 1V1GA 4NDBA 1CFPA 1J7PA 4CPVA 3B86A 1QX5B 1S1EA 4NQGA 3EKJA 1IH0A 4GFTA 5FI7A 2YGUA 3PN7B 4D1EA 2Q4UA 1B4CA 3NSIA 2KAYA 3NHTA 1GQMA 2M3WA 2LCPA 2CT9A 1TCOB 2F2PA 2K2FA 1B8LA 3DF0B 2CTNA 3IVTA 1XK4C 3PLFB 4PHJA 3CYZA 1S6JA 4F0ZB 3BUMB 2F2OA 1DT7B 1NX3A 1EG3A 5D3OA 3CR4X 3EK8A 3M0WA 1QS7A 2FJUB 2RGIA 1YURA 1ALVA 2K7OA 2KBMA 2ZRTA 1OZSA 2JOJA 1M45A 2PALA 2BCBA 3IF7A 1UP5A 2BNXA 3R72A 1AJ4A 1LS8A 1WDCB 1IJ6A 1XFWO 2ZFDA 3DVKA 1B1GA 1MXLC 5ER4X 1A4PA 1UHIA 4CIDA 5I2OA 3SS3A 3AAKA 1BJFA 1KFUL 4Q04A 1XO5A 3A8RA 3GK2A 4I5KA 3AKBA 4GAOA 3SG2A 1LA0A 1SW8A 2KQYA 3MSEB 3OGNA 1IIOA 1NUBA 4C0JA 4KYNA 1UHKA 1XK4A 2L4IA 3GK1A 2LMUA 4FQOA 2ZN8A 1AK8A 2BE4A 3FIAA 1S6IA 1K96A 2LUCA 2NXQA 2WCHA 1V1FA 4DRWA 1DVIA 1YUSA 2CCMA 2M1KB 3PJIA 2EGDA 1OOHA 2GTEA 4AQJA 3CZ1A 1S26D 2LV7A 1TNXA 2M29A 1K93D 3QRXA 1MQ1A 3R1VA 1CFFA 3FE8A 2WCJA 1TRFA 1Z2CB 3VRRA 1PALA 2FOTA 4MRXA 3SG7A 2L2CA 3RLZA 3TDUA 3PFVA 4GGFA 3CTNA 1OQPA 1U5IB 1LVCD 4MSPA 1C7WA 1BR4B 1J55A 1AUIB 3DY9A 1BT6A 5JJGA 1KWOB 2MLFC 1BR1B 1Y1XA 1TNPA 2BL0C 3I5HC 4CFQA 1JFKA 1SR6C 2KBIA 2BBNA 1DJYA 3I5GC 2KGRA 3D78A 2B1UA 3VROA 3BUXB 2CBLA 2AMIA 1N65A 2JTZA 1CFDA 1SKTA 2WC8A 1OSAA 1QLKA 4YBHB 1CMGA 3S0GA 3B7AA 1LINA 1RECA 1ZACA 3EKHA 4AOMA 2BE6A 1QASA 3FWBA 2WC5A 3CLNA 3KF9A 2JQ6A 1UWOA 2JPOA 1XFRA 5K89A 1MXEA 1SPYA 3SG6A 3GK4X 4BY5A 4GGNA 1DF0A 2K0JA 1GGWA 2MLEC 4PE7A 4INXA 1CFCA 1TTXA 4MN0A 3AAJA 1ZOTB 2LM5A 5DKRA 2Y1MA 4GUKA 4MLWA 1QVIZ 3OHMB 1J1DA 1OE9B 2ZKMX 1QV1A 1KK7Y 1TUJA 3D75A 5IBWA 4P5OE 1KFXS 2NCOA 4M2OA 3RZSA 2KLEA 1OW4A 1ODBA 1DGUA 2NCPA 2IS9A 2L50A 3EVUA 1N2DA 2I94A 1K95A 1QV0A 1DJWA 5GQQC 4CLNA 2HPSA 3CR5X 4N5XA 1TNQA 2JU0A 2PVBA 1JUOA 5G08A 2MBXA 2F8PA 1YVLA 3BFAA 4IL1A 3WNXB 1J1EA 2KI6D 2TN4A 3HX4A 4WRIA 1BF5A 3GOFA 1SY9A 1R6PA 4YI8A 1B47A 1WLZA 1FW4A 2LMVA 5CSNA 3OBVA 1W7IB 2E6WA 1YR5A 3NXAA 1UHHA 1NX0A 2K2AA 3SS4A 2QEHA 1L7ZA 2K60A 2COLB 3NHIA 2D8NA 1TCFA 4ORAB 1QWVA 2BECA 2JT8A 3CZTX 3EK4A 4R1EA 1JSAA 3BUNB 3VRPA 2HQ8A 5CPVA 4OR9B 1QATA 3O4XA 3ICBA 2BCAA 3CDNA 3Q8IA 5FYXA 3I5HB 1F54A 3D73A 3I5IC 4MZKA 1UHNA 2QPTA 5DICA 5I2LA 1F70A 4QJ5B 2M1UA 5TNCA 4DIRA 4OV2A 1JBAA 5FI6A 3TZ1A 1SCMC 2H61A 3R1PA 4F7FA 1NX1A 4QJ4B 3PALA 3VRNA 1H8BA 1YVHA 1DEKA 2KHNA 1ZFSA 2HQWA 2ZNDA 4PHMA 3S0EA 1K94A 1KWOC 4YGDB 4DS7A 4HRHA 2M49B 2L51A 1SR6B 2LANA 2OTGB 2M97A 4ORBB 2DOQA 1SCVA 5JOLA 2LP3A 4JWQA 1YX8A 2KPHA 3QMEA 3R1OA 3DZTA 1IGVA 1Y1UA 1JWDA 4YRUA 1DGVA 1EG4A 1KQVA 1OZOA 1CM1A 3WHUB 3ZNIA 3K1EA 3S0AA 2LVVA 1BLQA 1M39A 2PRUA 1K8UA 2MAZA 3B87A 3PM8A 4MZLA 2O5GA 1UURA 3BJHA 1DJZA 1SSEB 2LUXA 2QEVA 1G8IA 1NYAA 2WOSA 5HYDA 1OMRA 3D77A 1SCMB 4PE4A 1F4OA 1KSOA 3C1VA 3LK0A 2M7NA 2ISDA 4WQ2A 1KQMC 1SBJA 4BY4A 1KQMB 2KI6C 2M8UA 1DC1A 3BUWB 2QEBA 1RFJA 2SCPA 3KPXA 2Q91A 1GJYA 1K90D 2H2KA 2BCXA 3I5FB 1PSRA 4I5NB 3VRQA 5B8IB 2E30A 3OX6A 2L2EA 1CLLA 2EC6C 2WC6A 4PT1A 1BOCA 2CXJA 1PVBA 1W7JB 3TUYC 1A2XA 1HT9A 3BQ3A 5AXIA 2WCLA 2SASA 1S3PA 1IQ3A 1CDNA 4OCIA 2KLDA 2F3ZA 1NIWA 2KOTA 3NSKA 2F33A 4YGCB 2QACA 4QJ3B 1TWOA 1A03A 1C3YA 3PSRA 3NSLA 1NP8A 5I8NA 2GGMA 4PCWA 4P2YB 3KEVA 4N1GA 2WCEA 4HREE 1CDPA 1M63B 1S5GZ 1G33A 4DCKA 1XFYO 1J7RA 2JXCA 2BL0B 3I5IB 5F6TA 1DJXA 1YX7A 1F4QA 1U5IA 2G2BA 1Y0VH 3L4AA 2EHBA 3OP0A 1T14A 2EC6B 3SS5A 3BYAA 1RTP1 2P70A 1XA5A 1MHOA 5D69A 2MRDA 1F55A 4MVFA 1JF2A 1FPWA 1AP4A 2WNDA 1YUTA 4PHNA 3O2PA 1QX7A 2BKHB 2KFFA 2QEOA 1UUSA 3KO0A 3OB1B 1CLBA 2FCEA 4YGAA 2ZRSA 1XFXO 1C7VA 3HCMA 1FI5A 3DVEA 2K7CA 4YI9A 1QVIY 1YRUB 2H61C 2MA2A 1PVAA 3LK1A 1TUZA 3BXKA 3TUYB 1IJ5A 1FI6A 1S6CA 4XJKA 3IQOA 2MHHA 1OOJA 2WORA 2L0PA 3D76A 1SMGA 5KSZA 1WLMA 1RJVA 1XFUO 2P6BB 2JT0A 3D0YA 2WCFA 2LAPA 3N7HA 1YTZC 1LKJA 1J7OA 4GPLB 2KAVA 4C0KA 3VGOA 1DQEA 3EVVA 2PYQA 1RK9A 2ZN9A 3S0DA 3H4SE 4FTGA 4OVNF 3LLEA 1AJ5A 1Q80A 5AEQA 4M2QA 3WHTB 2M9GA 2WCKA 2M7LA 3SJSA 1IWQA 1XYDA 1NCYA 1QXPA 1XFZO 1CTRA 1UHJA 5J3XA 5AFPA 2JXLA 1CLMA 4N1FA 2CNPA 4ETOA 3B6XA 1RWYA 4ZCUA 1M46A 4JQ0D 4PHKA 2L4HA 1JFJA 1XFVO 2BBMA 1SL7A 5KTYA 4I5JA 5CSIA 4I5LB 5DKQA 2KI4C 1CM4A 1R2UA 3BUOB 2NLNA 3DD4A 3F45A 3LL8B 1K9PA 3O4YA 5HL1A 2ZNEA 2LNKA 1CDLA 4GBAA 3SIBA 5I2QA 4U8DA 3FS7A 1A29A 1SL9A 5FI2A 5I94A 1Y6WA 2I7AA 2R2IA 1NWDA 4HRGA 1TN4A 1A75B 1EJ3A 1B7TZ 3O6BA 1QIWA 1WRKA 1CMFA 1SL8A 4M2PA 3D74A 5CSFA 3S0BA 3SG3A 3UO9A 3VB1A 4PDZA 2LHIA 1KCYA 2OTGC 2QDIA 2AUCA 2WCBA 3B88A 2WCMA 4PE0A 3CGAA 1BG1A 3BOWB 1HQVA 4DUQA 4WQ3A 1CB1A 2JNFA 3O78A 3OB2B 4YGBB 3SIAA 2K8MB 2Y4QA 2L5YA 3NGVA 1DJIA 3UNWA 1EL4A 1W9ZA 2KI4B 1OOIX 1YRTB 1ZUZA
chains in the Genus database with same CATH topology
4UPGA 2JNXA 3JTDC 1KK8B 2HF5A 3EK7A 4ICBA 1E8AA 4USLA 1J7QA 1S5GY 1Y1AA 4NDDA 3TS5C 3TS5B 4CFRA 4YGEB 1K9KA 1C07A 1IKUA 2LVKA 3AKAA 1MWNA 3PN7C 1PRWA 2KFHA 2L5XB 1QLSA 4NDCA 1EH2A 2MJWB 1B8CA 4ORCB 1WY9A 1JC2A 2VRGA 3EVRA 1JF0A 2L98A 2LVIA 2NZ0A 3CR2A 1MF8B 4GNKB 1EXRA 1YUUA 1FF1A 1WRLA 2KFGA 1GGZA 1M31A 1MR8A 2Y1NA 3DF0A 1KK8C 4TNCA 2KSPA 1VRKA 2LC5A 4OKHA 1LXFC 1BU3A 4HSZA 1TIZA 1LA3A 3I5FC 1FBVA 2K7BA 1B9AA 2LVJA 3SG5A 4E68A 1N0YA 5PALA 1DJHA 2JULA 2OS8C 3DVJA 1SRAA 1NSHA 5DKNA 2FCDA 1NX2A 1QTXA 1B8RA 2GGZA 1PK0D 2I18A 2K7DA 3FWCA 5AANA 3IQQA 3JTDB 2LLTA 1KFXL 1L2OC 4MZJA 2GV5A 5HKWA 1QX2A 4MEWA 5D7FA 3SG4A 2Y5IA 5AERA 1TOPA 3DVMA 2JTTA 4XJKB 2AAOA 4A4CA 1DTLA 2LMTA 1CDMA 1QJTA 1RROA 4JPZB 3OX5A 1K2HA 3D0YB 1OMDA 1AVSA 4PALA 1SK6D 2KAXA 2LLUA 2LP2A 2G9BA 1D1OA 1NCZA 2V53A 3A4UB 3JVTC 4ZCVA 1X02A 4L9MA 2OS8B 1XVJA 3K21A 1IRJA 2PSRA 1PSBA 1KSMA 3PATA 3TDZA 4XYNA 5KU1A 1DF0B 4C0LA 1QIVA 2JT3A 2JWWA 3KHEA 2OPOA 5BPJA 5CSJA 5HLVA 1NPQA 4MBEA 1WRZA 3D10A 2LHLA 2LLSA 1S36A 1CNPA 1ZMZA 1KFUS 3ZWHA 2F3YA 4MRYA 3RM1A 2I2RE 2HETA 1SYMA 1CKKA 1L2OB 2LE9B 1IQ5A 1IG5A 4PE1A 3I5GB 3LCPC 1SNLA 1PULA 2KYCA 2BKIB 4AQIA 2KGBC 2JRFA 5HLOA 2JPTA 5HKZA 1DJGA 1F71A 1MUXA 3BOWA 3WXAA 1G4YR 1ALWA 2JZIA 3E3RA 1H4BA 2PASA 1NCXA 4GGFC 2K61A 2A4JA 3CS1A 2KYFA 1B7TY 2KNEA 5HKYA 3CWGA 5ER5A 1A75A 1BMOA 3JVTB 4A4BA 1WDCC 1OMVA 1F8HA 1TNWA 3NSOA 1BODA 1DMOA 1K9UA 1AHRA 2JC2A 2KDHA 2M0RA 1KK7Z 2PMYA 3TDIA 2O60A 1V1GA 4NDBA 1CFPA 1J7PA 4CPVA 1QX5B 1S1EA 4NQGA 3EKJA 1IH0A 4GFTA 3PN7B 4D1EA 2Q4UA 1B4CA 3NSIA 2KAYA 1GQMA 2M3WA 2LCPA 2CT9A 1TCOB 2F2PA 2K2FA 1B8LA 3DF0B 2CTNA 1XK4C 3PLFB 4PHJA 1S6JA 4F0ZB 3BUMB 2F2OA 1DT7B 1NX3A 1EG3A 3CR4X 3EK8A 3M0WA 1QS7A 2FJUB 2RGIA 1YURA 1ALVA 2K7OA 2KBMA 2ZRTA 1OZSA 2JOJA 1M45A 2PALA 2BCBA 3IF7A 1UP5A 1AJ4A 1WDCB 3DVKA 1IJ6A 1XFWO 2ZFDA 1B1GA 1MXLC 5ER4X 1A4PA 1UHIA 4CIDA 5I2OA 3AAKA 1BJFA 1KFUL 4Q04A 1XO5A 3A8RA 3GK2A 4I5KA 3AKBA 4GAOA 3SG2A 1LA0A 1SW8A 2KQYA 3MSEB 1NUBA 4C0JA 1UHKA 1XK4A 2L4IA 3GK1A 2LMUA 4FQOA 2ZN8A 1AK8A 2BE4A 3FIAA 1S6IA 1K96A 2LUCA 2NXQA 1V1FA 4DRWA 1DVIA 1YUSA 2CCMA 2M1KB 2EGDA 4AQJA 1S26D 2LV7A 1TNXA 2M29A 1K93D 3QRXA 1MQ1A 1CFFA 1TRFA 3VRRA 1PALA 2FOTA 4MRXA 3SG7A 3RLZA 3TDUA 3PFVA 4GGFA 3CTNA 1OQPA 1U5IB 1LVCD 4MSPA 1C7WA 1BR4B 1J55A 1AUIB 1BT6A 5JJGA 1KWOB 2MLFC 1BR1B 1Y1XA 1TNPA 2BL0C 3I5HC 4CFQA 1JFKA 1SR6C 2KBIA 2BBNA 1DJYA 3I5GC 2KGRA 2B1UA 3VROA 3BUXB 2CBLA 2AMIA 1N65A 2JTZA 1CFDA 1SKTA 2WC8A 1OSAA 1QLKA 4YBHB 1CMGA 1LINA 1RECA 1ZACA 3EKHA 4AOMA 2BE6A 1QASA 3FWBA 3CLNA 3KF9A 2JQ6A 1UWOA 5K89A 1MXEA 1SPYA 3SG6A 3GK4X 4BY5A 4GGNA 1DF0A 2K0JA 1GGWA 2MLEC 4PE7A 1CFCA 1TTXA 4MN0A 3AAJA 1ZOTB 2LM5A 5DKRA 2Y1MA 4GUKA 4MLWA 1QVIZ 3OHMB 1J1DA 1OE9B 2ZKMX 1QV1A 1KK7Y 5IBWA 4P5OE 1KFXS 2NCOA 4M2OA 1ODBA 1DGUA 2NCPA 2IS9A 2L50A 3EVUA 1N2DA 2I94A 1K95A 1QV0A 1DJWA 5GQQC 4CLNA 2HPSA 3CR5X 4N5XA 1TNQA 2JU0A 2PVBA 1JUOA 5G08A 2MBXA 2F8PA 1YVLA 4IL1A 3WNXB 1J1EA 2KI6D 2TN4A 3HX4A 4WRIA 1BF5A 3GOFA 1SY9A 1R6PA 4YI8A 1B47A 1WLZA 1FW4A 2LMVA 5CSNA 1W7IB 2E6WA 1YR5A 3NXAA 1UHHA 1NX0A 2K2AA 1L7ZA 2COLB 2D8NA 1TCFA 4ORAB 2BECA 2JT8A 3CZTX 3EK4A 4R1EA 1JSAA 3BUNB 3VRPA 2HQ8A 5CPVA 4OR9B 1QATA 3ICBA 2BCAA 5FYXA 3I5HB 1F54A 3I5IC 4MZKA 1UHNA 2QPTA 5I2LA 1F70A 4QJ5B 2M1UA 5TNCA 4DIRA 4OV2A 1JBAA 3TZ1A 1SCMC 2H61A 1NX1A 4QJ4B 3PALA 3VRNA 1H8BA 1YVHA 2KHNA 1ZFSA 2HQWA 2ZNDA 4PHMA 1K94A 1KWOC 4YGDB 4DS7A 4HRHA 2M49B 2L51A 1SR6B 2LANA 2OTGB 2M97A 4ORBB 2DOQA 1SCVA 5JOLA 2LP3A 4JWQA 1YX8A 1IGVA 1Y1UA 1JWDA 4YRUA 1DGVA 1EG4A 1KQVA 1OZOA 1CM1A 3WHUB 3ZNIA 2LVVA 1BLQA 1M39A 2PRUA 1K8UA 2MAZA 3PM8A 4MZLA 2O5GA 1UURA 1DJZA 2WOSA 2LUXA 5HYDA 1G8IA 1NYAA 1OMRA 1SCMB 4PE4A 1F4OA 1KSOA 3C1VA 3LK0A 2M7NA 2ISDA 4WQ2A 1KQMC 1SBJA 4BY4A 1KQMB 2KI6C 2M8UA 3BUWB 1RFJA 2SCPA 3KPXA 2Q91A 1GJYA 1K90D 2H2KA 2BCXA 3I5FB 1PSRA 4I5NB 3VRQA 5B8IB 2E30A 3OX6A 2L2EA 1CLLA 2EC6C 1BOCA 2CXJA 1PVBA 1W7JB 3TUYC 1A2XA 1HT9A 3BQ3A 5AXIA 2SASA 1S3PA 1IQ3A 1CDNA 4OCIA 2F3ZA 1NIWA 2KOTA 3NSKA 2F33A 4YGCB 2QACA 4QJ3B 1A03A 3PSRA 3NSLA 1NP8A 5I8NA 2GGMA 4PCWA 4P2YB 3KEVA 4N1GA 2WCEA 4HREE 1CDPA 1M63B 1S5GZ 1G33A 4DCKA 1XFYO 1J7RA 2JXCA 2BL0B 3I5IB 5F6TA 1DJXA 1YX7A 1F4QA 1U5IA 2G2BA 1Y0VH 3OP0A 2EHBA 2EC6B 3BYAA 1RTP1 1XA5A 1MHOA 5D69A 2MRDA 1F55A 4MVFA 1JF2A 1FPWA 1AP4A 2WNDA 1YUTA 4PHNA 3O2PA 1QX7A 2BKHB 2KFFA 1UUSA 3KO0A 3OB1B 1CLBA 2FCEA 4YGAA 2ZRSA 1XFXO 1C7VA 3HCMA 1FI5A 3DVEA 2K7CA 4YI9A 1QVIY 1YRUB 2H61C 2MA2A 1PVAA 3LK1A 3BXKA 3TUYB 1FI6A 1IJ5A 1S6CA 4XJKA 3IQOA 2MHHA 1OOJA 2WORA 2L0PA 1SMGA 5KSZA 1WLMA 1RJVA 1XFUO 2P6BB 2JT0A 3D0YA 2WCFA 2LAPA 1YTZC 1LKJA 1J7OA 4GPLB 2KAVA 4C0KA 3VGOA 3EVVA 1RK9A 2ZN9A 3H4SE 4FTGA 4OVNF 3LLEA 1AJ5A 1Q80A 5AEQA 4M2QA 3WHTB 2M9GA 2M7LA 3SJSA 1IWQA 1XYDA 1NCYA 1QXPA 1XFZO 1CTRA 1UHJA 5J3XA 5AFPA 2JXLA 1CLMA 4N1FA 2CNPA 4ETOA 1RWYA 4ZCUA 1M46A 4JQ0D 4PHKA 2L4HA 1JFJA 1XFVO 2BBMA 1SL7A 5KTYA 4I5JA 5CSIA 4I5LB 5DKQA 2KI4C 1CM4A 1R2UA 3BUOB 2NLNA 3DD4A 3F45A 3LL8B 1K9PA 3O4YA 2ZNEA 2LNKA 1CDLA 4GBAA 3SIBA 5I2QA 4U8DA 3FS7A 1A29A 1SL9A 1Y6WA 2I7AA 2R2IA 1NWDA 4HRGA 1TN4A 1A75B 1EJ3A 1B7TZ 3O6BA 1QIWA 1WRKA 1CMFA 1SL8A 4M2PA 5CSFA 3SG3A 4PDZA 2LHIA 1KCYA 2OTGC 2AUCA 2WCBA 4PE0A 3CGAA 1BG1A 3BOWB 1HQVA 4DUQA 4WQ3A 1CB1A 2JNFA 3O78A 3OB2B 4YGBB 3SIAA 2K8MB 2Y4QA 1DJIA 1EL4A 2KQ6A 2KI4B 1YRTB 1ZUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UPG A;  2JNX A;  3JTD C;  1KK8 B;  2HF5 A;  3EK7 A;  4ICB A;  1E8A A;  4USL A;  1J7Q A;  1S5G Y;  1Y1A A;  4NDD A;  3TS5 C;  3TS5 B;  4CFR A;  4YGE B;  1K9K A;  1C07 A;  1IKU A;  2LVK A;  3AKA A;  1MWN A;  3PN7 C;  1PRW A;  2KFH A;  2L5X B;  1QLS A;  4NDC A;  1EH2 A;  2MJW B;  1B8C A;  4ORC B;  1WY9 A;  1JC2 A;  2VRG A;  3EVR A;  1JF0 A;  2L98 A;  2LVI A;  2NZ0 A;  3CR2 A;  1MF8 B;  4GNK B;  1EXR A;  1YUU A;  1FF1 A;  1WRL A;  2KFG A;  1GGZ A;  1M31 A;  1MR8 A;  2Y1N A;  3DF0 A;  1KK8 C;  4TNC A;  2KSP A;  1VRK A;  2LC5 A;  4OKH A;  1LXF C;  1BU3 A;  4HSZ A;  1TIZ A;  1LA3 A;  3I5F C;  1FBV A;  2K7B A;  1B9A A;  2LVJ A;  3SG5 A;  4E68 A;  1N0Y A;  5PAL A;  1DJH A;  2JUL A;  2OS8 C;  3DVJ A;  1SRA A;  1NSH A;  5DKN A;  2FCD A;  1NX2 A;  1QTX A;  1B8R A;  2GGZ A;  1PK0 D;  2I18 A;  2K7D A;  3FWC A;  5AAN A;  3IQQ A;  3JTD B;  2LLT A;  1KFX L;  1L2O C;  4MZJ A;  2GV5 A;  5HKW A;  1QX2 A;  4MEW A;  5D7F A;  3SG4 A;  2Y5I A;  5AER A;  1TOP A;  3DVM A;  2JTT A;  4XJK B;  2AAO A;  4A4C A;  1DTL A;  2LMT A;  1CDM A;  1QJT A;  1RRO A;  4JPZ B;  3OX5 A;  1K2H A;  3D0Y B;  1OMD A;  1AVS A;  4PAL A;  1SK6 D;  2KAX A;  2LLU A;  2LP2 A;  2G9B A;  1D1O A;  1NCZ A;  2V53 A;  3A4U B;  3JVT C;  4ZCV A;  1X02 A;  4L9M A;  2OS8 B;  1XVJ A;  3K21 A;  1IRJ A;  2PSR A;  1PSB A;  1KSM A;  3PAT A;  3TDZ A;  4XYN A;  5KU1 A;  1DF0 B;  4C0L A;  1QIV A;  2JT3 A;  2JWW A;  3KHE A;  2OPO A;  5BPJ A;  5CSJ A;  5HLV A;  1NPQ A;  4MBE A;  1WRZ A;  3D10 A;  2LHL A;  2LLS A;  1S36 A;  1CNP A;  1ZMZ A;  1KFU S;  3ZWH A;  2F3Y A;  4MRY A;  3RM1 A;  2I2R E;  2HET A;  1SYM A;  1CKK A;  1L2O B;  2LE9 B;  1IQ5 A;  1IG5 A;  4PE1 A;  3I5G B;  3LCP C;  1SNL A;  1PUL A;  2KYC A;  2BKI B;  4AQI A;  2KGB C;  2JRF A;  5HLO A;  2JPT A;  5HKZ A;  1DJG A;  1F71 A;  1MUX A;  3BOW A;  3WXA A;  1G4Y R;  1ALW A;  2JZI A;  3E3R A;  1H4B A;  2PAS A;  1NCX A;  4GGF C;  2K61 A;  2A4J A;  3CS1 A;  2KYF A;  1B7T Y;  2KNE A;  5HKY A;  3CWG A;  5ER5 A;  1A75 A;  1BMO A;  3JVT B;  4A4B A;  1WDC C;  1OMV A;  1F8H A;  1TNW A;  3NSO A;  1BOD A;  1DMO A;  1K9U A;  1AHR A;  2JC2 A;  2KDH A;  2M0R A;  1KK7 Z;  2PMY A;  3TDI A;  2O60 A;  1V1G A;  4NDB A;  1CFP A;  1J7P A;  4CPV A;  1QX5 B;  1S1E A;  4NQG A;  3EKJ A;  1IH0 A;  4GFT A;  3PN7 B;  4D1E A;  2Q4U A;  1B4C A;  3NSI A;  2KAY A;  1GQM A;  2M3W A;  2LCP A;  2CT9 A;  1TCO B;  2F2P A;  2K2F A;  1B8L A;  3DF0 B;  2CTN A;  1XK4 C;  3PLF B;  4PHJ A;  1S6J A;  4F0Z B;  3BUM B;  2F2O A;  1DT7 B;  1NX3 A;  1EG3 A;  3CR4 X;  3EK8 A;  3M0W A;  1QS7 A;  2FJU B;  2RGI A;  1YUR A;  1ALV A;  2K7O A;  2KBM A;  2ZRT A;  1OZS A;  2JOJ A;  1M45 A;  2PAL A;  2BCB A;  3IF7 A;  1UP5 A;  1AJ4 A;  1WDC B;  3DVK A;  1IJ6 A;  1XFW O;  2ZFD A;  1B1G A;  1MXL C;  5ER4 X;  1A4P A;  1UHI A;  4CID A;  5I2O A;  3AAK A;  1BJF A;  1KFU L;  4Q04 A;  1XO5 A;  3A8R A;  3GK2 A;  4I5K A;  3AKB A;  4GAO A;  3SG2 A;  1LA0 A;  1SW8 A;  2KQY A;  3MSE B;  1NUB A;  4C0J A;  1UHK A;  1XK4 A;  2L4I A;  3GK1 A;  2LMU A;  4FQO A;  2ZN8 A;  1AK8 A;  2BE4 A;  3FIA A;  1S6I A;  1K96 A;  2LUC A;  2NXQ A;  1V1F A;  4DRW A;  1DVI A;  1YUS A;  2CCM A;  2M1K B;  2EGD A;  4AQJ A;  1S26 D;  2LV7 A;  1TNX A;  2M29 A;  1K93 D;  3QRX A;  1MQ1 A;  1CFF A;  1TRF A;  3VRR A;  1PAL A;  2FOT A;  4MRX A;  3SG7 A;  3RLZ A;  3TDU A;  3PFV A;  4GGF A;  3CTN A;  1OQP A;  1U5I B;  1LVC D;  4MSP A;  1C7W A;  1BR4 B;  1J55 A;  1AUI B;  1BT6 A;  5JJG A;  1KWO B;  2MLF C;  1BR1 B;  1Y1X A;  1TNP A;  2BL0 C;  3I5H C;  4CFQ A;  1JFK A;  1SR6 C;  2KBI A;  2BBN A;  1DJY A;  3I5G C;  2KGR A;  2B1U A;  3VRO A;  3BUX B;  2CBL A;  2AMI A;  1N65 A;  2JTZ A;  1CFD A;  1SKT A;  2WC8 A;  1OSA A;  1QLK A;  4YBH B;  1CMG A;  1LIN A;  1REC A;  1ZAC A;  3EKH A;  4AOM A;  2BE6 A;  1QAS A;  3FWB A;  3CLN A;  3KF9 A;  2JQ6 A;  1UWO A;  5K89 A;  1MXE A;  1SPY A;  3SG6 A;  3GK4 X;  4BY5 A;  4GGN A;  1DF0 A;  2K0J A;  1GGW A;  2MLE C;  4PE7 A;  1CFC A;  1TTX A;  4MN0 A;  3AAJ A;  1ZOT B;  2LM5 A;  5DKR A;  2Y1M A;  4GUK A;  4MLW A;  1QVI Z;  3OHM B;  1J1D A;  1OE9 B;  2ZKM X;  1QV1 A;  1KK7 Y;  5IBW A;  4P5O E;  1KFX S;  2NCO A;  4M2O A;  1ODB A;  1DGU A;  2NCP A;  2IS9 A;  2L50 A;  3EVU A;  1N2D A;  2I94 A;  1K95 A;  1QV0 A;  1DJW A;  5GQQ C;  4CLN A;  2HPS A;  3CR5 X;  4N5X A;  1TNQ A;  2JU0 A;  2PVB A;  1JUO A;  5G08 A;  2MBX A;  2F8P A;  1YVL A;  4IL1 A;  3WNX B;  1J1E A;  2KI6 D;  2TN4 A;  3HX4 A;  4WRI A;  1BF5 A;  3GOF A;  1SY9 A;  1R6P A;  4YI8 A;  1B47 A;  1WLZ A;  1FW4 A;  2LMV A;  5CSN A;  1W7I B;  2E6W A;  1YR5 A;  3NXA A;  1UHH A;  1NX0 A;  2K2A A;  1L7Z A;  2COL B;  2D8N A;  1TCF A;  4ORA B;  2BEC A;  2JT8 A;  3CZT X;  3EK4 A;  4R1E A;  1JSA A;  3BUN B;  3VRP A;  2HQ8 A;  5CPV A;  4OR9 B;  1QAT A;  3ICB A;  2BCA A;  5FYX A;  3I5H B;  1F54 A;  3I5I C;  4MZK A;  1UHN A;  2QPT A;  5I2L A;  1F70 A;  4QJ5 B;  2M1U A;  5TNC A;  4DIR A;  4OV2 A;  1JBA A;  3TZ1 A;  1SCM C;  2H61 A;  1NX1 A;  4QJ4 B;  3PAL A;  3VRN A;  1H8B A;  1YVH A;  2KHN A;  1ZFS A;  2HQW A;  2ZND A;  4PHM A;  1K94 A;  1KWO C;  4YGD B;  4DS7 A;  4HRH A;  2M49 B;  2L51 A;  1SR6 B;  2LAN A;  2OTG B;  2M97 A;  4ORB B;  2DOQ A;  1SCV A;  5JOL A;  2LP3 A;  4JWQ A;  1YX8 A;  1IGV A;  1Y1U A;  1JWD A;  4YRU A;  1DGV A;  1EG4 A;  1KQV A;  1OZO A;  1CM1 A;  3WHU B;  3ZNI A;  2LVV A;  1BLQ A;  1M39 A;  2PRU A;  1K8U A;  2MAZ A;  3PM8 A;  4MZL A;  2O5G A;  1UUR A;  1DJZ A;  2WOS A;  2LUX A;  5HYD A;  1G8I A;  1NYA A;  1OMR A;  1SCM B;  4PE4 A;  1F4O A;  1KSO A;  3C1V A;  3LK0 A;  2M7N A;  2ISD A;  4WQ2 A;  1KQM C;  1SBJ A;  4BY4 A;  1KQM B;  2KI6 C;  2M8U A;  3BUW B;  1RFJ A;  2SCP A;  3KPX A;  2Q91 A;  1GJY A;  1K90 D;  2H2K A;  2BCX A;  3I5F B;  1PSR A;  4I5N B;  3VRQ A;  5B8I B;  2E30 A;  3OX6 A;  2L2E A;  1CLL A;  2EC6 C;  1BOC A;  2CXJ A;  1PVB A;  1W7J B;  3TUY C;  1A2X A;  1HT9 A;  3BQ3 A;  5AXI A;  2SAS A;  1S3P A;  1IQ3 A;  1CDN A;  4OCI A;  2F3Z A;  1NIW A;  2KOT A;  3NSK A;  2F33 A;  4YGC B;  2QAC A;  4QJ3 B;  1A03 A;  3PSR A;  3NSL A;  1NP8 A;  5I8N A;  2GGM A;  4PCW A;  4P2Y B;  3KEV A;  4N1G A;  2WCE A;  4HRE E;  1CDP A;  1M63 B;  1S5G Z;  1G33 A;  4DCK A;  1XFY O;  1J7R A;  2JXC A;  2BL0 B;  3I5I B;  5F6T A;  1DJX A;  1YX7 A;  1F4Q A;  1U5I A;  2G2B A;  1Y0V H;  3OP0 A;  2EHB A;  2EC6 B;  3BYA A;  1RTP 1;  1XA5 A;  1MHO A;  5D69 A;  2MRD A;  1F55 A;  4MVF A;  1JF2 A;  1FPW A;  1AP4 A;  2WND A;  1YUT A;  4PHN A;  3O2P A;  1QX7 A;  2BKH B;  2KFF A;  1UUS A;  3KO0 A;  3OB1 B;  1CLB A;  2FCE A;  4YGA A;  2ZRS A;  1XFX O;  1C7V A;  3HCM A;  1FI5 A;  3DVE A;  2K7C A;  4YI9 A;  1QVI Y;  1YRU B;  2H61 C;  2MA2 A;  1PVA A;  3LK1 A;  3BXK A;  3TUY B;  1FI6 A;  1IJ5 A;  1S6C A;  4XJK A;  3IQO A;  2MHH A;  1OOJ A;  2WOR A;  2L0P A;  1SMG A;  5KSZ A;  1WLM A;  1RJV A;  1XFU O;  2P6B B;  2JT0 A;  3D0Y A;  2WCF A;  2LAP A;  1YTZ C;  1LKJ A;  1J7O A;  4GPL B;  2KAV A;  4C0K A;  3VGO A;  3EVV A;  1RK9 A;  2ZN9 A;  3H4S E;  4FTG A;  4OVN F;  3LLE A;  1AJ5 A;  1Q80 A;  5AEQ A;  4M2Q A;  3WHT B;  2M9G A;  2M7L A;  3SJS A;  1IWQ A;  1XYD A;  1NCY A;  1QXP A;  1XFZ O;  1CTR A;  1UHJ A;  5J3X A;  5AFP A;  2JXL A;  1CLM A;  4N1F A;  2CNP A;  4ETO A;  1RWY A;  4ZCU A;  1M46 A;  4JQ0 D;  4PHK A;  2L4H A;  1JFJ A;  1XFV O;  2BBM A;  1SL7 A;  5KTY A;  4I5J A;  5CSI A;  4I5L B;  5DKQ A;  2KI4 C;  1CM4 A;  1R2U A;  3BUO B;  2NLN A;  3DD4 A;  3F45 A;  3LL8 B;  1K9P A;  3O4Y A;  2ZNE A;  2LNK A;  1CDL A;  4GBA A;  3SIB A;  5I2Q A;  4U8D A;  3FS7 A;  1A29 A;  1SL9 A;  1Y6W A;  2I7A A;  2R2I A;  1NWD A;  4HRG A;  1TN4 A;  1A75 B;  1EJ3 A;  1B7T Z;  3O6B A;  1QIW A;  1WRK A;  1CMF A;  1SL8 A;  4M2P A;  5CSF A;  3SG3 A;  4PDZ A;  2LHI A;  1KCY A;  2OTG C;  2AUC A;  2WCB A;  4PE0 A;  3CGA A;  1BG1 A;  3BOW B;  1HQV A;  4DUQ A;  4WQ3 A;  1CB1 A;  2JNF A;  3O78 A;  3OB2 B;  4YGB B;  3SIA A;  2K8M B;  2Y4Q A;  1DJI A;  1EL4 A;  2KQ6 A;  2KI4 B;  1YRT B;  1ZUZ A; 
#chains in the Genus database with same CATH topology
 4UPG A;  2JNX A;  5EL2 A;  3JTD C;  1KK8 B;  2HF5 A;  3EK7 A;  4ICB A;  1E8A A;  4USL A;  1J7Q A;  1DEL A;  1S5G Y;  1Y1A A;  4NDD A;  3TS5 C;  3TS5 B;  4CFR A;  4INW A;  4YGE B;  1K9K A;  1C07 A;  1IKU A;  2LVK A;  3AKA A;  1MWN A;  3PN7 C;  1PRW A;  2KFH A;  2L5X B;  1QLS A;  4NDC A;  1EH2 A;  2MJW B;  1B8C A;  4ORC B;  1WY9 A;  1JC2 A;  2VRG A;  3EVR A;  1JF0 A;  2L98 A;  2LVI A;  2NZ0 A;  3CR2 A;  1MF8 B;  4GNK B;  3V2L A;  1EXR A;  1YUU A;  1FF1 A;  1OOF A;  1WRL A;  1GGZ A;  1M31 A;  2KFG A;  1MR8 A;  3CAB A;  2Y1N A;  3DF0 A;  1KK8 C;  4TNC A;  1GM0 A;  2KSP A;  1VRK A;  2LC5 A;  4IJ7 A;  4OKH A;  1LXF C;  1BU3 A;  4HSZ A;  1TIZ A;  1LA3 A;  3I5F C;  3FE6 A;  1FBV A;  2K7B A;  1B9A A;  2LVJ A;  3SG5 A;  4E68 A;  1N0Y A;  5PAL A;  1DJH A;  2JUL A;  2OS8 C;  3L47 A;  3DVJ A;  1SRA A;  1NSH A;  5DKN A;  2FCD A;  1NX2 A;  1QTX A;  1B8R A;  4JKT A;  2GGZ A;  1PK0 D;  2I18 A;  2K7D A;  3FWC A;  5AAN A;  3IQQ A;  3JTD B;  2LLT A;  1KFX L;  1L2O C;  4MZJ A;  2GV5 A;  5HKW A;  1QX2 A;  4MEW A;  5D7F A;  3SG4 A;  2Y5I A;  5AER A;  3PM2 A;  1C3Z A;  1TOP A;  3DVM A;  2JTT A;  4XJK B;  2AAO A;  4A4C A;  1DTL A;  1OOG A;  3L4L A;  3DXL A;  2LMT A;  2PQL A;  1CDM A;  1QJT A;  3BFH A;  1RRO A;  4JPZ B;  3OX5 A;  1K2H A;  3CZ2 A;  3D0Y B;  1OMD A;  1AVS A;  4PAL A;  1SK6 D;  2KAX A;  2LLU A;  2LP2 A;  2G9B A;  1D1O A;  1NCZ A;  2BAP A;  2V53 A;  3A4U B;  3JVT C;  4ZCV A;  2FJY A;  1X02 A;  4L9M A;  2OS8 B;  2H8V A;  1XVJ A;  3K21 A;  1IRJ A;  2PSR A;  1PSB A;  2P71 A;  1KSM A;  3PAT A;  3TDZ A;  4XYN A;  1ORG A;  5KU1 A;  1DF0 B;  4C0L A;  1QIV A;  2JT3 A;  2JWW A;  3KHE A;  3FE9 A;  2OPO A;  5BPJ A;  5CSJ A;  3BFB A;  1NPQ A;  5HLV A;  4MBE A;  1WRZ A;  3D10 A;  2LHL A;  2LLS A;  1S36 A;  1CNP A;  1ZMZ A;  1KFU S;  3ZWH A;  2F3Y A;  4MRY A;  3RM1 A;  2I2R E;  2HET A;  1SYM A;  1CKK A;  1L2O B;  2LE9 B;  1IQ5 A;  1IG5 A;  3EG5 B;  4PE1 A;  3I5G B;  3LCP C;  1SNL A;  1PUL A;  1P28 A;  2BKI B;  2KYC A;  3DYE A;  2KGB C;  2ERB A;  4AQI A;  2JRF A;  5HLO A;  2JPT A;  5HKZ A;  1DJG A;  1F71 A;  1MUX A;  3BOW A;  4JD9 A;  3WXA A;  1G4Y R;  1ALW A;  2JZI A;  3E3R A;  1H4B A;  2PAS A;  1NCX A;  4GGF C;  2K61 A;  2A4J A;  3CZ0 A;  2KQ6 A;  3CS1 A;  2KYF A;  1B7T Y;  2KNE A;  5HKY A;  3CWG A;  5ER5 A;  1A75 A;  1BMO A;  3JVT B;  4A4B A;  1WDC C;  1Z4H A;  1OMV A;  1F8H A;  1TNW A;  3NSO A;  1BOD A;  1DMO A;  1K9U A;  1AHR A;  2JC2 A;  2KDH A;  2M0R A;  1KK7 Z;  2PMY A;  4FQT A;  3TDI A;  4OZD A;  3S0F A;  2O60 A;  1V1G A;  4NDB A;  1CFP A;  1J7P A;  4CPV A;  3B86 A;  1QX5 B;  1S1E A;  4NQG A;  3EKJ A;  1IH0 A;  4GFT A;  5FI7 A;  2YGU A;  3PN7 B;  4D1E A;  2Q4U A;  1B4C A;  3NSI A;  2KAY A;  3NHT A;  1GQM A;  2M3W A;  2LCP A;  2CT9 A;  1TCO B;  2F2P A;  2K2F A;  1B8L A;  3DF0 B;  2CTN A;  3IVT A;  1XK4 C;  3PLF B;  4PHJ A;  3CYZ A;  1S6J A;  4F0Z B;  3BUM B;  2F2O A;  1DT7 B;  1NX3 A;  1EG3 A;  5D3O A;  3CR4 X;  3EK8 A;  3M0W A;  1QS7 A;  2FJU B;  2RGI A;  1YUR A;  1ALV A;  2K7O A;  2KBM A;  2ZRT A;  1OZS A;  2JOJ A;  1M45 A;  2PAL A;  2BCB A;  3IF7 A;  1UP5 A;  2BNX A;  3R72 A;  1AJ4 A;  1LS8 A;  1WDC B;  1IJ6 A;  1XFW O;  2ZFD A;  3DVK A;  1B1G A;  1MXL C;  5ER4 X;  1A4P A;  1UHI A;  4CID A;  5I2O A;  3SS3 A;  3AAK A;  1BJF A;  1KFU L;  4Q04 A;  1XO5 A;  3A8R A;  3GK2 A;  4I5K A;  3AKB A;  4GAO A;  3SG2 A;  1LA0 A;  1SW8 A;  2KQY A;  3MSE B;  3OGN A;  1IIO A;  1NUB A;  4C0J A;  4KYN A;  1UHK A;  1XK4 A;  2L4I A;  3GK1 A;  2LMU A;  4FQO A;  2ZN8 A;  1AK8 A;  2BE4 A;  3FIA A;  1S6I A;  1K96 A;  2LUC A;  2NXQ A;  2WCH A;  1V1F A;  4DRW A;  1DVI A;  1YUS A;  2CCM A;  2M1K B;  3PJI A;  2EGD A;  1OOH A;  2GTE A;  4AQJ A;  3CZ1 A;  1S26 D;  2LV7 A;  1TNX A;  2M29 A;  1K93 D;  3QRX A;  1MQ1 A;  3R1V A;  1CFF A;  3FE8 A;  2WCJ A;  1TRF A;  1Z2C B;  3VRR A;  1PAL A;  2FOT A;  4MRX A;  3SG7 A;  2L2C A;  3RLZ A;  3TDU A;  3PFV A;  4GGF A;  3CTN A;  1OQP A;  1U5I B;  1LVC D;  4MSP A;  1C7W A;  1BR4 B;  1J55 A;  1AUI B;  3DY9 A;  1BT6 A;  5JJG A;  1KWO B;  2MLF C;  1BR1 B;  1Y1X A;  1TNP A;  2BL0 C;  3I5H C;  4CFQ A;  1JFK A;  1SR6 C;  2KBI A;  2BBN A;  1DJY A;  3I5G C;  2KGR A;  3D78 A;  2B1U A;  3VRO A;  3BUX B;  2CBL A;  2AMI A;  1N65 A;  2JTZ A;  1CFD A;  1SKT A;  2WC8 A;  1OSA A;  1QLK A;  4YBH B;  1CMG A;  3S0G A;  3B7A A;  1LIN A;  1REC A;  1ZAC A;  3EKH A;  4AOM A;  2BE6 A;  1QAS A;  3FWB A;  2WC5 A;  3CLN A;  3KF9 A;  2JQ6 A;  1UWO A;  2JPO A;  1XFR A;  5K89 A;  1MXE A;  1SPY A;  3SG6 A;  3GK4 X;  4BY5 A;  4GGN A;  1DF0 A;  2K0J A;  1GGW A;  2MLE C;  4PE7 A;  4INX A;  1CFC A;  1TTX A;  4MN0 A;  3AAJ A;  1ZOT B;  2LM5 A;  5DKR A;  2Y1M A;  4GUK A;  4MLW A;  1QVI Z;  3OHM B;  1J1D A;  1OE9 B;  2ZKM X;  1QV1 A;  1KK7 Y;  1TUJ A;  3D75 A;  5IBW A;  4P5O E;  1KFX S;  2NCO A;  4M2O A;  3RZS A;  2KLE A;  1OW4 A;  1ODB A;  1DGU A;  2NCP A;  2IS9 A;  2L50 A;  3EVU A;  1N2D A;  2I94 A;  1K95 A;  1QV0 A;  1DJW A;  5GQQ C;  4CLN A;  2HPS A;  3CR5 X;  4N5X A;  1TNQ A;  2JU0 A;  2PVB A;  1JUO A;  5G08 A;  2MBX A;  2F8P A;  1YVL A;  3BFA A;  4IL1 A;  3WNX B;  1J1E A;  2KI6 D;  2TN4 A;  3HX4 A;  4WRI A;  1BF5 A;  3GOF A;  1SY9 A;  1R6P A;  4YI8 A;  1B47 A;  1WLZ A;  1FW4 A;  2LMV A;  5CSN A;  3OBV A;  1W7I B;  2E6W A;  1YR5 A;  3NXA A;  1UHH A;  1NX0 A;  2K2A A;  3SS4 A;  2QEH A;  1L7Z A;  2K60 A;  2COL B;  3NHI A;  2D8N A;  1TCF A;  4ORA B;  1QWV A;  2BEC A;  2JT8 A;  3CZT X;  3EK4 A;  4R1E A;  1JSA A;  3BUN B;  3VRP A;  2HQ8 A;  5CPV A;  4OR9 B;  1QAT A;  3O4X A;  3ICB A;  2BCA A;  3CDN A;  3Q8I A;  5FYX A;  3I5H B;  1F54 A;  3D73 A;  3I5I C;  4MZK A;  1UHN A;  2QPT A;  5DIC A;  5I2L A;  1F70 A;  4QJ5 B;  2M1U A;  5TNC A;  4DIR A;  4OV2 A;  1JBA A;  5FI6 A;  3TZ1 A;  1SCM C;  2H61 A;  3R1P A;  4F7F A;  1NX1 A;  4QJ4 B;  3PAL A;  3VRN A;  1H8B A;  1YVH A;  1DEK A;  2KHN A;  1ZFS A;  2HQW A;  2ZND A;  4PHM A;  3S0E A;  1K94 A;  1KWO C;  4YGD B;  4DS7 A;  4HRH A;  2M49 B;  2L51 A;  1SR6 B;  2LAN A;  2OTG B;  2M97 A;  4ORB B;  2DOQ A;  1SCV A;  5JOL A;  2LP3 A;  4JWQ A;  1YX8 A;  2KPH A;  3QME A;  3R1O A;  3DZT A;  1IGV A;  1Y1U A;  1JWD A;  4YRU A;  1DGV A;  1EG4 A;  1KQV A;  1OZO A;  1CM1 A;  3WHU B;  3ZNI A;  3K1E A;  3S0A A;  2LVV A;  1BLQ A;  1M39 A;  2PRU A;  1K8U A;  2MAZ A;  3B87 A;  3PM8 A;  4MZL A;  2O5G A;  1UUR A;  3BJH A;  1DJZ A;  1SSE B;  2LUX A;  2QEV A;  1G8I A;  1NYA A;  2WOS A;  5HYD A;  1OMR A;  3D77 A;  1SCM B;  4PE4 A;  1F4O A;  1KSO A;  3C1V A;  3LK0 A;  2M7N A;  2ISD A;  4WQ2 A;  1KQM C;  1SBJ A;  4BY4 A;  1KQM B;  2KI6 C;  2M8U A;  1DC1 A;  3BUW B;  2QEB A;  1RFJ A;  2SCP A;  3KPX A;  2Q91 A;  1GJY A;  1K90 D;  2H2K A;  2BCX A;  3I5F B;  1PSR A;  4I5N B;  3VRQ A;  5B8I B;  2E30 A;  3OX6 A;  2L2E A;  1CLL A;  2EC6 C;  2WC6 A;  4PT1 A;  1BOC A;  2CXJ A;  1PVB A;  1W7J B;  3TUY C;  1A2X A;  1HT9 A;  3BQ3 A;  5AXI A;  2WCL A;  2SAS A;  1S3P A;  1IQ3 A;  1CDN A;  4OCI A;  2KLD A;  2F3Z A;  1NIW A;  2KOT A;  3NSK A;  2F33 A;  4YGC B;  2QAC A;  4QJ3 B;  1TWO A;  1A03 A;  1C3Y A;  3PSR A;  3NSL A;  1NP8 A;  5I8N A;  2GGM A;  4PCW A;  4P2Y B;  3KEV A;  4N1G A;  2WCE A;  4HRE E;  1CDP A;  1M63 B;  1S5G Z;  1G33 A;  4DCK A;  1XFY O;  1J7R A;  2JXC A;  2BL0 B;  3I5I B;  5F6T A;  1DJX A;  1YX7 A;  1F4Q A;  1U5I A;  2G2B A;  1Y0V H;  3L4A A;  2EHB A;  3OP0 A;  1T14 A;  2EC6 B;  3SS5 A;  3BYA A;  1RTP 1;  2P70 A;  1XA5 A;  1MHO A;  5D69 A;  2MRD A;  1F55 A;  4MVF A;  1JF2 A;  1FPW A;  1AP4 A;  2WND A;  1YUT A;  4PHN A;  3O2P A;  1QX7 A;  2BKH B;  2KFF A;  2QEO A;  1UUS A;  3KO0 A;  3OB1 B;  1CLB A;  2FCE A;  4YGA A;  2ZRS A;  1XFX O;  1C7V A;  3HCM A;  1FI5 A;  3DVE A;  2K7C A;  4YI9 A;  1QVI Y;  1YRU B;  2H61 C;  2MA2 A;  1PVA A;  3LK1 A;  1TUZ A;  3BXK A;  3TUY B;  1IJ5 A;  1FI6 A;  1S6C A;  4XJK A;  3IQO A;  2MHH A;  1OOJ A;  2WOR A;  2L0P A;  3D76 A;  1SMG A;  5KSZ A;  1WLM A;  1RJV A;  1XFU O;  2P6B B;  2JT0 A;  3D0Y A;  2WCF A;  2LAP A;  3N7H A;  1YTZ C;  1LKJ A;  1J7O A;  4GPL B;  2KAV A;  4C0K A;  3VGO A;  1DQE A;  3EVV A;  2PYQ A;  1RK9 A;  2ZN9 A;  3S0D A;  3H4S E;  4FTG A;  4OVN F;  3LLE A;  1AJ5 A;  1Q80 A;  5AEQ A;  4M2Q A;  3WHT B;  2M9G A;  2WCK A;  2M7L A;  3SJS A;  1IWQ A;  1XYD A;  1NCY A;  1QXP A;  1XFZ O;  1CTR A;  1UHJ A;  5J3X A;  5AFP A;  2JXL A;  1CLM A;  4N1F A;  2CNP A;  4ETO A;  3B6X A;  1RWY A;  4ZCU A;  1M46 A;  4JQ0 D;  4PHK A;  2L4H A;  1JFJ A;  1XFV O;  2BBM A;  1SL7 A;  5KTY A;  4I5J A;  5CSI A;  4I5L B;  5DKQ A;  2KI4 C;  1CM4 A;  1R2U A;  3BUO B;  2NLN A;  3DD4 A;  3F45 A;  3LL8 B;  1K9P A;  3O4Y A;  5HL1 A;  2ZNE A;  2LNK A;  1CDL A;  4GBA A;  3SIB A;  5I2Q A;  4U8D A;  3FS7 A;  1A29 A;  1SL9 A;  5FI2 A;  5I94 A;  1Y6W A;  2I7A A;  2R2I A;  1NWD A;  4HRG A;  1TN4 A;  1A75 B;  1EJ3 A;  1B7T Z;  3O6B A;  1QIW A;  1WRK A;  1CMF A;  1SL8 A;  4M2P A;  3D74 A;  5CSF A;  3S0B A;  3SG3 A;  3UO9 A;  3VB1 A;  4PDZ A;  2LHI A;  1KCY A;  2OTG C;  2QDI A;  2AUC A;  2WCB A;  3B88 A;  2WCM A;  4PE0 A;  3CGA A;  1BG1 A;  3BOW B;  1HQV A;  4DUQ A;  4WQ3 A;  1CB1 A;  2JNF A;  3O78 A;  3OB2 B;  4YGB B;  3SIA A;  2K8M B;  2Y4Q A;  2L5Y A;  3NGV A;  1DJI A;  3UNW A;  1EL4 A;  1W9Z A;  2KI4 B;  1OOI X;  1YRT B;  1ZUZ A; 
#chains in the Genus database with same CATH homology
 4UPG A;  2JNX A;  3JTD C;  1KK8 B;  2HF5 A;  3EK7 A;  4ICB A;  1E8A A;  4USL A;  1J7Q A;  1S5G Y;  1Y1A A;  4NDD A;  3TS5 C;  3TS5 B;  4CFR A;  4YGE B;  1K9K A;  1C07 A;  1IKU A;  2LVK A;  3AKA A;  1MWN A;  3PN7 C;  1PRW A;  2KFH A;  2L5X B;  1QLS A;  4NDC A;  1EH2 A;  2MJW B;  1B8C A;  4ORC B;  1WY9 A;  1JC2 A;  2VRG A;  3EVR A;  1JF0 A;  2L98 A;  2LVI A;  2NZ0 A;  3CR2 A;  1MF8 B;  4GNK B;  1EXR A;  1YUU A;  1FF1 A;  1WRL A;  2KFG A;  1GGZ A;  1M31 A;  1MR8 A;  2Y1N A;  3DF0 A;  1KK8 C;  4TNC A;  2KSP A;  1VRK A;  2LC5 A;  4OKH A;  1LXF C;  1BU3 A;  4HSZ A;  1TIZ A;  1LA3 A;  3I5F C;  1FBV A;  2K7B A;  1B9A A;  2LVJ A;  3SG5 A;  4E68 A;  1N0Y A;  5PAL A;  1DJH A;  2JUL A;  2OS8 C;  3DVJ A;  1SRA A;  1NSH A;  5DKN A;  2FCD A;  1NX2 A;  1QTX A;  1B8R A;  2GGZ A;  1PK0 D;  2I18 A;  2K7D A;  3FWC A;  5AAN A;  3IQQ A;  3JTD B;  2LLT A;  1KFX L;  1L2O C;  4MZJ A;  2GV5 A;  5HKW A;  1QX2 A;  4MEW A;  5D7F A;  3SG4 A;  2Y5I A;  5AER A;  1TOP A;  3DVM A;  2JTT A;  4XJK B;  2AAO A;  4A4C A;  1DTL A;  2LMT A;  1CDM A;  1QJT A;  1RRO A;  4JPZ B;  3OX5 A;  1K2H A;  3D0Y B;  1OMD A;  1AVS A;  4PAL A;  1SK6 D;  2KAX A;  2LLU A;  2LP2 A;  2G9B A;  1D1O A;  1NCZ A;  2V53 A;  3A4U B;  3JVT C;  4ZCV A;  1X02 A;  4L9M A;  2OS8 B;  1XVJ A;  3K21 A;  1IRJ A;  2PSR A;  1PSB A;  1KSM A;  3PAT A;  3TDZ A;  4XYN A;  5KU1 A;  1DF0 B;  4C0L A;  1QIV A;  2JT3 A;  2JWW A;  3KHE A;  2OPO A;  5BPJ A;  5CSJ A;  5HLV A;  1NPQ A;  4MBE A;  1WRZ A;  3D10 A;  2LHL A;  2LLS A;  1S36 A;  1CNP A;  1ZMZ A;  1KFU S;  3ZWH A;  2F3Y A;  4MRY A;  3RM1 A;  2I2R E;  2HET A;  1SYM A;  1CKK A;  1L2O B;  2LE9 B;  1IQ5 A;  1IG5 A;  4PE1 A;  3I5G B;  3LCP C;  1SNL A;  1PUL A;  2KYC A;  2BKI B;  4AQI A;  2KGB C;  2JRF A;  5HLO A;  2JPT A;  5HKZ A;  1DJG A;  1F71 A;  1MUX A;  3BOW A;  3WXA A;  1G4Y R;  1ALW A;  2JZI A;  3E3R A;  1H4B A;  2PAS A;  1NCX A;  4GGF C;  2K61 A;  2A4J A;  3CS1 A;  2KYF A;  1B7T Y;  2KNE A;  5HKY A;  3CWG A;  5ER5 A;  1A75 A;  1BMO A;  3JVT B;  4A4B A;  1WDC C;  1OMV A;  1F8H A;  1TNW A;  3NSO A;  1BOD A;  1DMO A;  1K9U A;  1AHR A;  2JC2 A;  2KDH A;  2M0R A;  1KK7 Z;  2PMY A;  3TDI A;  2O60 A;  1V1G A;  4NDB A;  1CFP A;  1J7P A;  4CPV A;  1QX5 B;  1S1E A;  4NQG A;  3EKJ A;  1IH0 A;  4GFT A;  3PN7 B;  4D1E A;  2Q4U A;  1B4C A;  3NSI A;  2KAY A;  1GQM A;  2M3W A;  2LCP A;  2CT9 A;  1TCO B;  2F2P A;  2K2F A;  1B8L A;  3DF0 B;  2CTN A;  1XK4 C;  3PLF B;  4PHJ A;  1S6J A;  4F0Z B;  3BUM B;  2F2O A;  1DT7 B;  1NX3 A;  1EG3 A;  3CR4 X;  3EK8 A;  3M0W A;  1QS7 A;  2FJU B;  2RGI A;  1YUR A;  1ALV A;  2K7O A;  2KBM A;  2ZRT A;  1OZS A;  2JOJ A;  1M45 A;  2PAL A;  2BCB A;  3IF7 A;  1UP5 A;  1AJ4 A;  1WDC B;  3DVK A;  1IJ6 A;  1XFW O;  2ZFD A;  1B1G A;  1MXL C;  5ER4 X;  1A4P A;  1UHI A;  4CID A;  5I2O A;  3AAK A;  1BJF A;  1KFU L;  4Q04 A;  1XO5 A;  3A8R A;  3GK2 A;  4I5K A;  3AKB A;  4GAO A;  3SG2 A;  1LA0 A;  1SW8 A;  2KQY A;  3MSE B;  1NUB A;  4C0J A;  1UHK A;  1XK4 A;  2L4I A;  3GK1 A;  2LMU A;  4FQO A;  2ZN8 A;  1AK8 A;  2BE4 A;  3FIA A;  1S6I A;  1K96 A;  2LUC A;  2NXQ A;  1V1F A;  4DRW A;  1DVI A;  1YUS A;  2CCM A;  2M1K B;  2EGD A;  4AQJ A;  1S26 D;  2LV7 A;  1TNX A;  2M29 A;  1K93 D;  3QRX A;  1MQ1 A;  1CFF A;  1TRF A;  3VRR A;  1PAL A;  2FOT A;  4MRX A;  3SG7 A;  3RLZ A;  3TDU A;  3PFV A;  4GGF A;  3CTN A;  1OQP A;  1U5I B;  1LVC D;  4MSP A;  1C7W A;  1BR4 B;  1J55 A;  1AUI B;  1BT6 A;  5JJG A;  1KWO B;  2MLF C;  1BR1 B;  1Y1X A;  1TNP A;  2BL0 C;  3I5H C;  4CFQ A;  1JFK A;  1SR6 C;  2KBI A;  2BBN A;  1DJY A;  3I5G C;  2KGR A;  2B1U A;  3VRO A;  3BUX B;  2CBL A;  2AMI A;  1N65 A;  2JTZ A;  1CFD A;  1SKT A;  2WC8 A;  1OSA A;  1QLK A;  4YBH B;  1CMG A;  1LIN A;  1REC A;  1ZAC A;  3EKH A;  4AOM A;  2BE6 A;  1QAS A;  3FWB A;  3CLN A;  3KF9 A;  2JQ6 A;  1UWO A;  5K89 A;  1MXE A;  1SPY A;  3SG6 A;  3GK4 X;  4BY5 A;  4GGN A;  1DF0 A;  2K0J A;  1GGW A;  2MLE C;  4PE7 A;  1CFC A;  1TTX A;  4MN0 A;  3AAJ A;  1ZOT B;  2LM5 A;  5DKR A;  2Y1M A;  4GUK A;  4MLW A;  1QVI Z;  3OHM B;  1J1D A;  1OE9 B;  2ZKM X;  1QV1 A;  1KK7 Y;  5IBW A;  4P5O E;  1KFX S;  2NCO A;  4M2O A;  1ODB A;  1DGU A;  2NCP A;  2IS9 A;  2L50 A;  3EVU A;  1N2D A;  2I94 A;  1K95 A;  1QV0 A;  1DJW A;  5GQQ C;  4CLN A;  2HPS A;  3CR5 X;  4N5X A;  1TNQ A;  2JU0 A;  2PVB A;  1JUO A;  5G08 A;  2MBX A;  2F8P A;  1YVL A;  4IL1 A;  3WNX B;  1J1E A;  2KI6 D;  2TN4 A;  3HX4 A;  4WRI A;  1BF5 A;  3GOF A;  1SY9 A;  1R6P A;  4YI8 A;  1B47 A;  1WLZ A;  1FW4 A;  2LMV A;  5CSN A;  1W7I B;  2E6W A;  1YR5 A;  3NXA A;  1UHH A;  1NX0 A;  2K2A A;  1L7Z A;  2COL B;  2D8N A;  1TCF A;  4ORA B;  2BEC A;  2JT8 A;  3CZT X;  3EK4 A;  4R1E A;  1JSA A;  3BUN B;  3VRP A;  2HQ8 A;  5CPV A;  4OR9 B;  1QAT A;  3ICB A;  2BCA A;  5FYX A;  3I5H B;  1F54 A;  3I5I C;  4MZK A;  1UHN A;  2QPT A;  5I2L A;  1F70 A;  4QJ5 B;  2M1U A;  5TNC A;  4DIR A;  4OV2 A;  1JBA A;  3TZ1 A;  1SCM C;  2H61 A;  1NX1 A;  4QJ4 B;  3PAL A;  3VRN A;  1H8B A;  1YVH A;  2KHN A;  1ZFS A;  2HQW A;  2ZND A;  4PHM A;  1K94 A;  1KWO C;  4YGD B;  4DS7 A;  4HRH A;  2M49 B;  2L51 A;  1SR6 B;  2LAN A;  2OTG B;  2M97 A;  4ORB B;  2DOQ A;  1SCV A;  5JOL A;  2LP3 A;  4JWQ A;  1YX8 A;  1IGV A;  1Y1U A;  1JWD A;  4YRU A;  1DGV A;  1EG4 A;  1KQV A;  1OZO A;  1CM1 A;  3WHU B;  3ZNI A;  2LVV A;  1BLQ A;  1M39 A;  2PRU A;  1K8U A;  2MAZ A;  3PM8 A;  4MZL A;  2O5G A;  1UUR A;  1DJZ A;  2WOS A;  2LUX A;  5HYD A;  1G8I A;  1NYA A;  1OMR A;  1SCM B;  4PE4 A;  1F4O A;  1KSO A;  3C1V A;  3LK0 A;  2M7N A;  2ISD A;  4WQ2 A;  1KQM C;  1SBJ A;  4BY4 A;  1KQM B;  2KI6 C;  2M8U A;  3BUW B;  1RFJ A;  2SCP A;  3KPX A;  2Q91 A;  1GJY A;  1K90 D;  2H2K A;  2BCX A;  3I5F B;  1PSR A;  4I5N B;  3VRQ A;  5B8I B;  2E30 A;  3OX6 A;  2L2E A;  1CLL A;  2EC6 C;  1BOC A;  2CXJ A;  1PVB A;  1W7J B;  3TUY C;  1A2X A;  1HT9 A;  3BQ3 A;  5AXI A;  2SAS A;  1S3P A;  1IQ3 A;  1CDN A;  4OCI A;  2F3Z A;  1NIW A;  2KOT A;  3NSK A;  2F33 A;  4YGC B;  2QAC A;  4QJ3 B;  1A03 A;  3PSR A;  3NSL A;  1NP8 A;  5I8N A;  2GGM A;  4PCW A;  4P2Y B;  3KEV A;  4N1G A;  2WCE A;  4HRE E;  1CDP A;  1M63 B;  1S5G Z;  1G33 A;  4DCK A;  1XFY O;  1J7R A;  2JXC A;  2BL0 B;  3I5I B;  5F6T A;  1DJX A;  1YX7 A;  1F4Q A;  1U5I A;  2G2B A;  1Y0V H;  3OP0 A;  2EHB A;  2EC6 B;  3BYA A;  1RTP 1;  1XA5 A;  1MHO A;  5D69 A;  2MRD A;  1F55 A;  4MVF A;  1JF2 A;  1FPW A;  1AP4 A;  2WND A;  1YUT A;  4PHN A;  3O2P A;  1QX7 A;  2BKH B;  2KFF A;  1UUS A;  3KO0 A;  3OB1 B;  1CLB A;  2FCE A;  4YGA A;  2ZRS A;  1XFX O;  1C7V A;  3HCM A;  1FI5 A;  3DVE A;  2K7C A;  4YI9 A;  1QVI Y;  1YRU B;  2H61 C;  2MA2 A;  1PVA A;  3LK1 A;  3BXK A;  3TUY B;  1FI6 A;  1IJ5 A;  1S6C A;  4XJK A;  3IQO A;  2MHH A;  1OOJ A;  2WOR A;  2L0P A;  1SMG A;  5KSZ A;  1WLM A;  1RJV A;  1XFU O;  2P6B B;  2JT0 A;  3D0Y A;  2WCF A;  2LAP A;  1YTZ C;  1LKJ A;  1J7O A;  4GPL B;  2KAV A;  4C0K A;  3VGO A;  3EVV A;  1RK9 A;  2ZN9 A;  3H4S E;  4FTG A;  4OVN F;  3LLE A;  1AJ5 A;  1Q80 A;  5AEQ A;  4M2Q A;  3WHT B;  2M9G A;  2M7L A;  3SJS A;  1IWQ A;  1XYD A;  1NCY A;  1QXP A;  1XFZ O;  1CTR A;  1UHJ A;  5J3X A;  5AFP A;  2JXL A;  1CLM A;  4N1F A;  2CNP A;  4ETO A;  1RWY A;  4ZCU A;  1M46 A;  4JQ0 D;  4PHK A;  2L4H A;  1JFJ A;  1XFV O;  2BBM A;  1SL7 A;  5KTY A;  4I5J A;  5CSI A;  4I5L B;  5DKQ A;  2KI4 C;  1CM4 A;  1R2U A;  3BUO B;  2NLN A;  3DD4 A;  3F45 A;  3LL8 B;  1K9P A;  3O4Y A;  2ZNE A;  2LNK A;  1CDL A;  4GBA A;  3SIB A;  5I2Q A;  4U8D A;  3FS7 A;  1A29 A;  1SL9 A;  1Y6W A;  2I7A A;  2R2I A;  1NWD A;  4HRG A;  1TN4 A;  1A75 B;  1EJ3 A;  1B7T Z;  3O6B A;  1QIW A;  1WRK A;  1CMF A;  1SL8 A;  4M2P A;  5CSF A;  3SG3 A;  4PDZ A;  2LHI A;  1KCY A;  2OTG C;  2AUC A;  2WCB A;  4PE0 A;  3CGA A;  1BG1 A;  3BOW B;  1HQV A;  4DUQ A;  4WQ3 A;  1CB1 A;  2JNF A;  3O78 A;  3OB2 B;  4YGB B;  3SIA A;  2K8M B;  2Y4Q A;  1DJI A;  1EL4 A;  2KQ6 A;  2KI4 B;  1YRT B;  1ZUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...