3QRXA

Chlamydomonas reinhardtii centrin bound to melittin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
VGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKMGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrin
publication title The structure, molecular dynamics, and energetics of centrin-melittin complex.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Metal binding protein/toxin
total genus 49
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3qrxA02
3TDUA 3TS5B 3RLZA 4E68A 3WHUB 1YUUA 1BOCA 3PM8A 5G08A 1OZSA 1V1FA 3ICBA 4CLNA 1J7RA 3NSOA 1KK8B 2JTTA 2CT9A 2COLB 1OMRA 1UURA 4ZCVA 2ISDA 3LLEA 1MR8A 1HQVA 4FQOA 4PCWA 5HLOA 1TN4A 4GAOA 4WQ2A 2LV7A 3DD4A 2D8NA 1W7IB 3RM1A 3PN7C 3BOWA 1DJGA 5CSIA 2KQYA 3BQ3A 3EVUA 4NQGA 1TNWA 1XFYO 1Y0VH 1Y1AA 4NDCA 1SCVA 2OS8B 3VRPA 1IJ5A 1OZOA 3BUMB 1EXRA 2M3WA 1SL7A 4A4CA 1KCYA 1QLKA 1YVHA 1XFWO 1TNPA 3OB1B 2PMYA 3OX6A 3O4YA 1BG1A 1QTXA 2JZIA 2K8MB 5HKYA 1B8LA 1KQMB 5ER5A 1XFZO 4GPLB 1K96A 1ZMZA 3GK2A 3SJSA 2LP3A 3NSKA 3HX4A 1CLLA 4JWQA 1NCXA 4GNKB 2WC8A 1J1EA 1QVIY 1DJXA 2K7CA 1KQVA 1LVCD 3PLFB 2JRFA 3I5IB 1CKKA 2ZFDA 2MAZA 4YGDB 2KOTA 3TZ1A 1YR5A 1SBJA 2CNPA 2R2IA 3SG4A 4UPGA 2O5GA 2PALA 1W7JB 3BYAA 3FWCA 1CDPA 1LXFC 1MF8B 3EK8A 2ZNDA 5B8IB 4ZCUA 4YGCB 3D10A 2HF5A 1K9KA 3LK0A 5ER4X 1S1EA 2FCDA 3AAKA 4GUKA 5I8NA 2LMUA 2LMVA 2PVBA 2L4HA 1LINA 1SKTA 3VRRA 1B47A 2E6WA 1IQ3A 1JC2A 4MZJA 2KFFA 3E3RA 4PE7A 3JTDB 2K61A 2F2PA 2KSPA 2MRDA 5GQQC 1RROA 2LM5A 4MBEA 2LUXA 3I5FC 4AOMA 5KSZA 1YTZC 4C0JA 4F0ZB 1H8BA 2PRUA 2VRGA 1NX2A 3DF0B 1KQMC 2K7OA 2RGIA 4XJKB 2M8UA 2BBMA 2KI4B 4P5OE 5AERA 1ZOTB 2GV5A 2ZKMX 2NCPA 2LHIA 1JFJA 4TNCA 1IKUA 1CMGA 1R6PA 2O60A 3MSEB 1VRKA 2KFHA 1QLSA 1NCZA 1YRUB 1JBAA 2BCAA 1DF0B 2A4JA 2SASA 2H61C 2ZN8A 3I5IC 5HYDA 1XK4C 1AK8A 1X02A 1SYMA 1OMDA 4OCIA 2KI6D 3EKHA 1CDLA 1NIWA 1N2DA 2I7AA 2BBNA 2CCMA 2WCEA 1CB1A 5HLVA 2F2OA 4WRIA 4D1EA 1U5IB 3LCPC 4M2PA 1DJYA 1L2OB 2MHHA 1JWDA 5BPJA 2JXLA 3OP0A 1K90D 4I5NB 3VROA 5AFPA 2JNFA 1BMOA 1YURA 1FBVA 1WLMA 2BL0C 1SPYA 1V1GA 2E30A 4ORAB 3SIBA 1SK6D 1LKJA 1K2HA 4PHMA 1YX7A 2I18A 4MEWA 2M1UA 1G4YR 4YBHB 4AQIA 1EG4A 2K2FA 3CGAA 1OOJA 4N1GA 3AAJA 5AXIA 3KEVA 3WHTB 3ZWHA 2LE9B 1YRTB 2MA2A 1KWOB 1SL8A 3CS1A 1C7WA 1ODBA 1NUBA 1TIZA 5AANA 3ZNIA 4PE1A 1RFJA 1IJ6A 2JQ6A 4IL1A 2BKIB 1B8RA 3KO0A 2MLEC 2KI4C 2LLSA 5D7FA 1DTLA 1DGUA 1SCMC 2OTGB 1F71A 4PE0A 5PALA 1CNPA 1SL9A 1M46A 2KYCA 2I94A 1J7QA 4YGBB 3OB2B 2KGRA 2AAOA 3BXKA 4P2YB 3PATA 4MVFA 3EK4A 1UHHA 1JSAA 2KQ6A 1KK7Z 1MXLC 4M2QA 2HPSA 2MBXA 4C0LA 2LVJA 3I5FB 2EGDA 2KFGA 4HRGA 1UHKA 1KFUS 1UHNA 2KHNA 1XVJA 2SCPA 1Y6WA 2WNDA 1FW4A 3FS7A 1L2OC 1A75A 4YRUA 3M0WA 5IBWA 3GK4X 1RJVA 1CDMA 2JT8A 3EVRA 1NX3A 2Q4UA 4OV2A 4GGFA 1FPWA 2EC6B 1K93D 3CR5X 5KTYA 1EL4A 1A03A 4OKHA 2LVVA 2PSRA 3DVMA 1CLBA 1KFUL 1S6IA 1GQMA 4MLWA 2L0PA 2L50A 1BLQA 1OQPA 1SNLA 1CMFA 1IQ5A 5JJGA 1Q80A 3NSIA 5DKNA 3SIAA 1KWOC 2KAXA 2FJUB 2K2AA 1DJWA 1RTP1 2Y1NA 1UP5A 3I5HB 4MN0A 4GGNA 3CLNA 3VRNA 1B8CA 1ALWA 1ZACA 2CTNA 1BT6A 3DVKA 2L51A 1MHOA 4QJ5B 5CPVA 2OTGC 2M1KB 3GOFA 1QX5B 4USLA 1CFCA 2BE4A 3K21A 5DKQA 1J7PA 2JXCA 2M7NA 2BECA 1NYAA 1YVLA 2JOJA 2BL0B 3FIAA 4DRWA 4ORCB 1SY9A 1PSRA 1PVBA 3A8RA 1AP4A 2HETA 5CSFA 1B7TZ 1OMVA 2MJWB 1N0YA 1N65A 1OSAA 1EJ3A 1XFXO 4OR9B 1IG5A 2I2RE 3D0YA 2EHBA 4I5LB 5D69A 1C7VA 4U8DA 1J55A 2JU0A 1R2UA 2WCFA 3BOWB 4JPZB 2EC6C 2NLNA 5I2LA 1SCMB 2GGMA 1CLMA 4QJ4B 2Y4QA 1UWOA 3IQOA 1CFPA 2L5XB 2L2EA 4PDZA 1L7ZA 1GGZA 1XFVO 4DS7A 1SW8A 1IWQA 1K9UA 1KK7Y 4HRHA 2P6BB 1XO5A 5JOLA 1QIVA 3I5HC 4BY5A 3FWBA 2M49B 1XA5A 1PSBA 4HSZA 1D1OA 3BUWB 1QIWA 1CTRA 1RK9A 1S6JA 1G8IA 2BE6A 3VGOA 1QV0A 4GBAA 3TUYC 1YX8A 3LK1A 1TCFA 4A4BA 1TTXA 3PSRA 4BY4A 2PASA 2AUCA 1S5GZ 1RWYA 1UHIA 2KGBC 2KI6C 1NPQA 1DJHA 2JNXA 2ZRSA 1OE9B 1KSOA 2FCEA 1B1GA 2H61A 1WY9A 1AUIB 1FI5A 4DCKA 3AKAA 1PVAA 1MXEA 1MQ1A 1YUTA 3O6BA 4L9MA 1J1DA 3VRQA 1DMOA 2JC2A 1IGVA 3DVEA 1AVSA 3GK1A 5K89A 1C07A 5HKZA 4ORBB 1TCOB 1DJIA 1JF0A 3KPXA 3WNXB 1QASA 1NX1A 2M0RA 1PULA 1TNXA 3SG7A 1F54A 2WORA 5I2QA 1B7TY 2BKHB 3I5GC 1F8HA 2LAPA 3NXAA 1QATA 3OX5A 2ZNEA 3LL8B 1K95A 2LLTA 4MSPA 2LVKA 4ICBA 4GGFC 4DIRA 1K9PA 1S6CA 4QJ3B 1EH2A 1BR4B 3EKJA 3EVVA 1WRLA 1ZFSA 2L98A 3CTNA 1SR6C 4PHNA 2JTZA 2LANA 3DF0A 4MZKA 5F6TA 2MLFC 4NDDA 4XJKA 2M9GA 1H4BA 1FF1A 2Y5IA 1B9AA 2LP2A 4N1FA 5I2OA 2KAYA 1Y1XA 1CM4A 1MWNA 1F70A 4AQJA 1SMGA 2BCXA 1GJYA 3SG2A 1RECA 1UHJA 1DF0A 3HCMA 2NCOA 3H4SE 2F3YA 1XFUO 2F33A 1DGVA 2WOSA 3BUNB 1S36A 3TDIA 1S3PA 2DOQA 1AHRA 2G9BA 2LMTA 2LVIA 1M31A 3EK7A 3JVTB 4CPVA 3SG3A 3PALA 1BU3A 1FI6A 2Y1MA 1PK0D 4Q04A 3DVJA 3SG6A 1NP8A 1ALVA 4R1EA 1U5IA 3O78A 4GFTA 1F4OA 2BCBA 2ZRTA 3BUXB 1KFXS 3TUYB 2QACA 1WDCC 4DUQA 3IF7A 3QRXA 1QX7A 1S5GY 1IRJA 1DT7B 1TNQA 1JFKA 2LC5A 1IH0A 4YI8A 1AJ5A 1KFXL 1EG3A 2QPTA 2CBLA 3TS5C 3TDZA 1YUSA 2CXJA 3CR2A 1CM1A 5J3XA 3CZTX 1NWDA 2LHLA 1F55A 1KK8C 1MUXA 2LUCA 2AMIA 2KAVA 4CIDA 2KDHA 2G2BA 1A29A 2KYFA 1UUSA 3BUOB 4NDBA 2F8PA 2OPOA 1M45A 5DKRA 1QV1A 4JQ0D 4OVNF 2LNKA 4M2OA 1KSMA 4HREE 2FOTA 3KHEA 3NSLA 1QXPA 1NX0A 2OS8C 5AEQA 1TOPA 3I5GB 2ZN9A 1A4PA 4YGEB 1Y1UA 4PE4A 4CFQA 2K7DA 2Q91A 1A75B 1BODA 4YI9A 2B1UA 3WXAA 2GGZA 2JWWA 1J7OA 4N5XA 1PALA 1NSHA 2KNEA 5CSJA 3JVTC 3PFVA 1CFDA 4MRYA 1DJZA 2WCBA 1WRKA 5KU1A 4ETOA 2LLUA 5TNCA 3C1VA 4FTGA 2M7LA 1SR6B 1WRZA 2HQWA 2JT3A 4PHJA 1S26D 1JUOA 2NZ0A 2F3ZA 1HT9A 1NCYA 2M97A 5CSNA 1CFFA 4C0KA 2NXQA 3PN7B 3A4UB 1QVIZ 1M39A 1DVIA 3F45A 2JT0A 3O2PA 4CFRA 5HKWA 4MRXA 1CDNA 2TN4A 1QS7A 1BF5A 2LCPA 3SG5A 1TRFA 1G33A 2M29A 1E8AA 2K7BA 2V53A 1F4QA 1K8UA 1K94A 2L4IA 1XK4A 2H2KA 4YGAA 1WLZA 3CWGA 1LA3A 1ZUZA 3AKBA 1GGWA 3CR4X 5FYXA 2HQ8A 1B4CA 1BR1B 3IQQA 4WQ3A 1QX2A 2K0JA 2KBIA 1A2XA 2KBMA 2JPTA 1BJFA 2IS9A 1XYDA 3OHMB 1QJTA 1WDCB 4I5KA 1PRWA 1M63B 3JTDC 2JULA 1JF2A 1LA0A 1SRAA 1AJ4A 4MZLA 4PALA 4XYNA 4I5JA 4PHKA 3D0YB 3KF9A
chains in the Genus database with same CATH superfamily
2PYQA 3TDUA 3TS5B 3RLZA 4E68A 3WHUB 1YUUA 1BOCA 3PM8A 1LS8A 5G08A 1OZSA 1V1FA 3ICBA 4CLNA 1J7RA 3NSOA 1KK8B 2JTTA 2CT9A 2COLB 1OMRA 1UURA 3B6XA 4ZCVA 2ISDA 3LLEA 1MR8A 1HQVA 4FQOA 4PCWA 5HLOA 1TN4A 3BFBA 4GAOA 4WQ2A 2LV7A 3DD4A 2D8NA 1W7IB 3RM1A 3PN7C 3BOWA 1DJGA 5CSIA 2KQYA 3BQ3A 3EVUA 4NQGA 1TNWA 1XFYO 1Y0VH 1Y1AA 4NDCA 1SCVA 2OS8B 1C3ZA 3VRPA 1IJ5A 1OZOA 3BUMB 1EXRA 2M3WA 1SL7A 4A4CA 1KCYA 1QLKA 1YVHA 1XFWO 1TNPA 3OB1B 2PMYA 3OX6A 3O4YA 2JPOA 1BG1A 1QTXA 2JZIA 2K8MB 3BFHA 5HKYA 1B8LA 1KQMB 3QMEA 5ER5A 1XFZO 4GPLB 1K96A 1ZMZA 3GK2A 3L47A 3SJSA 1TUJA 2LP3A 3NSKA 3HX4A 1CLLA 4JWQA 1NCXA 4GNKB 2WC8A 1J1EA 1QVIY 1DJXA 2K7CA 1KQVA 1LVCD 3PLFB 2JRFA 3I5IB 1CKKA 2ZFDA 2MAZA 4YGDB 2KOTA 3TZ1A 1YR5A 1SBJA 2CNPA 2R2IA 3SG4A 1DQEA 4UPGA 2O5GA 2PALA 1W7JB 3BYAA 3FWCA 1CDPA 1LXFC 3Q8IA 1MF8B 3EK8A 2ZNDA 5B8IB 4ZCUA 4YGCB 3D10A 2HF5A 2YGUA 1K9KA 3LK0A 5ER4X 1TWOA 2BNXA 1S1EA 2FCDA 3AAKA 2P71A 4GUKA 5I8NA 1SSEB 2LMUA 2LMVA 2PVBA 2L4HA 1OOHA 1LINA 1SKTA 3VRRA 3O4XA 1P28A 2QDIA 2WCHA 1B47A 2E6WA 2KLEA 2BAPA 1IQ3A 1JC2A 4MZJA 2KFFA 3E3RA 4PE7A 3JTDB 2K61A 2F2PA 2KSPA 2MRDA 5GQQC 1RROA 2LM5A 1W9ZA 4MBEA 2LUXA 3I5FC 4AOMA 5KSZA 1YTZC 3BJHA 1Z4HA 4C0JA 4F0ZB 1H8BA 2PRUA 2VRGA 1NX2A 3DF0B 1QWVA 3SS3A 1KQMC 2K7OA 2RGIA 4XJKB 2M8UA 3N7HA 2BBMA 2KI4B 4P5OE 5AERA 3R1PA 1ZOTB 2GV5A 2ZKMX 2NCPA 2LHIA 1JFJA 1ORGA 4TNCA 1IKUA 1CMGA 3OBVA 1R6PA 2O60A 3MSEB 1VRKA 2KFHA 3D77A 1QLSA 1DEKA 1NCZA 1YRUB 3S0DA 2BCAA 1JBAA 1DF0B 2A4JA 2SASA 2H61C 2ZN8A 3I5IC 5HYDA 1XK4C 1AK8A 1X02A 1SYMA 1OMDA 4OCIA 2KI6D 3EKHA 1CDLA 1NIWA 1N2DA 2I7AA 2BBNA 5I94A 2CCMA 2WCEA 1CB1A 3PJIA 2F2OA 4WRIA 5HLVA 4D1EA 3D73A 1U5IB 3LCPC 4M2PA 1DJYA 1L2OB 2MHHA 1JWDA 5BPJA 2JXLA 2QEHA 3OP0A 1K90D 4I5NB 3VROA 5AFPA 2JNFA 1BMOA 1YURA 1FBVA 1WLMA 2BL0C 1SPYA 1V1GA 2E30A 4ORAB 3SIBA 1SK6D 1LKJA 1K2HA 4PHMA 1YX7A 2I18A 4MEWA 2M1UA 1G4YR 3R72A 4YBHB 4AQIA 1EG4A 2K2FA 3CGAA 1OOJA 4N1GA 3AAJA 5AXIA 3KEVA 3WHTB 3ZWHA 2LE9B 1YRTB 2MA2A 1KWOB 1SL8A 3CS1A 1C7WA 1ODBA 1NUBA 1TIZA 2WC5A 5AANA 3ZNIA 4PE1A 1RFJA 1IJ6A 2GTEA 2JQ6A 4IL1A 2BKIB 1B8RA 3KO0A 2MLEC 3DY9A 2KI4C 2LLSA 5D7FA 5FI7A 1DTLA 3BFAA 3FE9A 1DGUA 1SCMC 2OTGB 1F71A 3OGNA 4PE0A 5PALA 1CNPA 1SL9A 3CZ0A 3NHTA 1M46A 2KYCA 2I94A 3D78A 4YGBB 1OW4A 3OB2B 1J7QA 2KGRA 2AAOA 3BXKA 4P2YB 3PATA 4MVFA 3EK4A 1UHHA 1JSAA 2KQ6A 1KK7Z 1MXLC 4M2QA 2HPSA 2MBXA 4C0LA 2LVJA 3I5FB 2EGDA 2KFGA 4HRGA 1GM0A 1UHKA 1KFUS 1UHNA 2KHNA 1XVJA 2SCPA 1Y6WA 2WNDA 1FW4A 3FS7A 1L2OC 1A75A 4YRUA 2KLDA 3M0WA 5IBWA 3GK4X 1RJVA 1CDMA 2JT8A 3EVRA 1NX3A 2Q4UA 4OV2A 4GGFA 1FPWA 2EC6B 1K93D 3CR5X 5KTYA 1EL4A 1A03A 4OKHA 2LVVA 2PSRA 3DVMA 1CLBA 1KFUL 1S6IA 1GQMA 4MLWA 2WCKA 2L0PA 2L50A 1BLQA 1OQPA 1SNLA 1CMFA 1IQ5A 5JJGA 1Q80A 3NSIA 5DKNA 3SIAA 1KWOC 2KAXA 2FJUB 2K2AA 1DJWA 1RTP1 2QEBA 2Y1NA 1UP5A 3I5HB 2FJYA 4MN0A 4GGNA 4FQTA 3CLNA 3VRNA 2QEOA 1B8CA 1ALWA 1ZACA 2CTNA 1BT6A 3DVKA 2L51A 1MHOA 3VB1A 4QJ5B 5CPVA 2OTGC 2M1KB 3CZ2A 3GOFA 1QX5B 3L4LA 4USLA 1CFCA 2BE4A 3K21A 5DKQA 1J7PA 4JD9A 2JXCA 2M7NA 2BECA 1NYAA 1YVLA 2JOJA 2BL0B 3FIAA 4JKTA 4ORCB 4DRWA 1SY9A 1PSRA 3SS5A 2WCJA 1PVBA 5D3OA 3A8RA 1AP4A 2HETA 5CSFA 1B7TZ 1OMVA 2MJWB 1N0YA 1N65A 1OSAA 2ERBA 1EJ3A 1XFXO 4OR9B 3S0GA 1OOFA 1IG5A 2I2RE 3D0YA 5FI6A 2EHBA 3UO9A 3R1OA 4I5LB 5D69A 1C7VA 4U8DA 1J55A 2JU0A 1R2UA 2WCFA 3BOWB 4JPZB 2EC6C 2NLNA 4PT1A 5I2LA 1SCMB 2GGMA 1CLMA 2KPHA 4F7FA 4QJ4B 2L5YA 2Y4QA 1UWOA 3IQOA 1CFPA 2L5XB 2L2EA 4PDZA 1L7ZA 1GGZA 1XFVO 4DS7A 1SW8A 1IWQA 3UNWA 1K9UA 1KK7Y 4HRHA 2P6BB 1XO5A 5JOLA 1QIVA 3I5HC 4BY5A 3FWBA 2M49B 2P70A 1XA5A 1PSBA 4HSZA 1D1OA 3BUWB 1QIWA 3FE6A 1CTRA 1RK9A 1XFRA 1S6JA 1G8IA 2BE6A 3VGOA 1QV0A 4GBAA 3TUYC 1YX8A 3LK1A 1TCFA 4A4BA 1TTXA 3PSRA 4BY4A 1DC1A 2PASA 2AUCA 1S5GZ 1RWYA 1UHIA 2KGBC 2KI6C 3DZTA 3IVTA 1NPQA 1DJHA 2JNXA 2ZRSA 3S0AA 1OE9B 1KSOA 2FCEA 1B1GA 2H61A 2QEVA 1WY9A 1AUIB 1FI5A 3B88A 3AKAA 1PVAA 1MXEA 4DCKA 1MQ1A 1YUTA 3O6BA 4L9MA 1J1DA 3VRQA 1DMOA 2JC2A 1IGVA 3DVEA 1AVSA 3GK1A 5K89A 1C07A 5HKZA 4ORBB 1TCOB 1DJIA 1JF0A 3KPXA 3WNXB 1QASA 1NX1A 2M0RA 1PULA 1TNXA 3SG7A 1F54A 2WORA 5I2QA 1B7TY 2BKHB 3I5GC 1F8HA 2LAPA 3NXAA 1QATA 3CYZA 3OX5A 2ZNEA 4INWA 3L4AA 3LL8B 5HL1A 1K95A 2LLTA 4MSPA 2LVKA 4ICBA 4GGFC 4DIRA 1K9PA 1S6CA 2WCLA 2WC6A 4QJ3B 1BR4B 3EKJA 1EH2A 3V2LA 3EVVA 5DICA 1WRLA 1ZFSA 2L98A 3CTNA 1SR6C 4INXA 4PHNA 2JTZA 2LANA 3DF0A 4MZKA 5F6TA 2MLFC 4NDDA 4XJKA 3D75A 2M9GA 1H4BA 1FF1A 2Y5IA 1B9AA 2LP2A 2WCMA 4N1FA 5I2OA 2KAYA 1Y1XA 1CM4A 1MWNA 1F70A 4AQJA 1SMGA 2BCXA 1GJYA 3SG2A 1RECA 1UHJA 1DF0A 1OOIX 3HCMA 3EG5B 3K1EA 1Z2CB 2NCOA 3H4SE 3B87A 2F3YA 1XFUO 2F33A 1DGVA 2WOSA 3BUNB 1S36A 3TDIA 1S3PA 2DOQA 1AHRA 2G9BA 2LMTA 2LVIA 1M31A 3EK7A 3JVTB 4CPVA 3SG3A 3PALA 3S0FA 1BU3A 3DYEA 1FI6A 2Y1MA 1PK0D 4Q04A 3DVJA 3SG6A 1NP8A 1ALVA 4R1EA 1U5IA 3O78A 4GFTA 1F4OA 3DXLA 2BCBA 2ZRTA 3BUXB 1KFXS 3TUYB 2QACA 3FE8A 1WDCC 4DUQA 3IF7A 3QRXA 4IJ7A 1C3YA 1QX7A 1S5GY 1IRJA 1DT7B 2H8VA 1TNQA 1JFKA 2LC5A 1IH0A 4YI8A 1AJ5A 1KFXL 1EG3A 2QPTA 2CBLA 3TS5C 4KYNA 1YUSA 3TDZA 2CXJA 3CR2A 1CM1A 5J3XA 3CZTX 3CABA 3D76A 1NWDA 3S0EA 2LHLA 1F55A 1KK8C 1MUXA 2LUCA 2AMIA 2KAVA 4CIDA 2KDHA 2G2BA 1A29A 2KYFA 1UUSA 3BUOB 4NDBA 1OOGA 1TUZA 2F8PA 2OPOA 1M45A 3RZSA 5DKRA 1QV1A 4JQ0D 4OVNF 2LNKA 4M2OA 1KSMA 2PQLA 3B7AA 4HREE 2FOTA 3KHEA 3NSLA 1QXPA 1NX0A 2OS8C 5AEQA 1TOPA 3I5GB 2ZN9A 3PM2A 1IIOA 1A4PA 4YGEB 1Y1UA 3R1VA 4PE4A 4CFQA 2K7DA 2Q91A 1A75B 1BODA 4YI9A 2B1UA 3WXAA 2GGZA 2JWWA 1J7OA 4N5XA 1PALA 1NSHA 2KNEA 5CSJA 3JVTC 3PFVA 1CFDA 4MRYA 1DJZA 2WCBA 1WRKA 5EL2A 5KU1A 4ETOA 2LLUA 5TNCA 3C1VA 4FTGA 2M7LA 2L2CA 1SR6B 1T14A 1WRZA 2HQWA 2JT3A 4PHJA 1S26D 1JUOA 3SS4A 2NZ0A 2F3ZA 1HT9A 1NCYA 2M97A 5CSNA 1CFFA 4C0KA 2NXQA 3PN7B 3A4UB 1QVIZ 1M39A 1DVIA 3F45A 2JT0A 3O2PA 4CFRA 5HKWA 4MRXA 1CDNA 2TN4A 1QS7A 1BF5A 2LCPA 3SG5A 1TRFA 4OZDA 1G33A 2M29A 1E8AA 2K7BA 2V53A 1F4QA 1K8UA 1K94A 2L4IA 1XK4A 2H2KA 4YGAA 3B86A 1WLZA 3CWGA 1LA3A 1ZUZA 3AKBA 3CZ1A 1GGWA 3CR4X 5FYXA 2HQ8A 1B4CA 1BR1B 3IQQA 3CDNA 4WQ3A 1QX2A 3S0BA 2K0JA 2KBIA 1A2XA 2KBMA 2JPTA 1BJFA 2IS9A 1XYDA 3OHMB 1QJTA 1WDCB 1DELA 4I5KA 1PRWA 1M63B 3D74A 2JULA 3JTDC 1JF2A 1LA0A 3NHIA 1SRAA 1AJ4A 4MZLA 3NGVA 2K60A 4PALA 4XYNA 4I5JA 4PHKA 3D0YB 5FI2A 3KF9A
chains in the Genus database with same CATH topology
3TDUA 3TS5B 3RLZA 4E68A 3WHUB 1YUUA 1BOCA 3PM8A 5G08A 1OZSA 1V1FA 3ICBA 4CLNA 1J7RA 3NSOA 1KK8B 2JTTA 2CT9A 2COLB 1OMRA 1UURA 4ZCVA 2ISDA 3LLEA 1MR8A 1HQVA 4FQOA 4PCWA 5HLOA 1TN4A 4GAOA 4WQ2A 2LV7A 3DD4A 2D8NA 1W7IB 3RM1A 3PN7C 3BOWA 1DJGA 5CSIA 2KQYA 3BQ3A 3EVUA 4NQGA 1TNWA 1XFYO 1Y0VH 1Y1AA 4NDCA 1SCVA 2OS8B 3VRPA 1IJ5A 1OZOA 3BUMB 1EXRA 2M3WA 1SL7A 4A4CA 1KCYA 1QLKA 1YVHA 1XFWO 1TNPA 3OB1B 2PMYA 3OX6A 3O4YA 1BG1A 1QTXA 2JZIA 2K8MB 5HKYA 1B8LA 1KQMB 5ER5A 1XFZO 4GPLB 1K96A 1ZMZA 3GK2A 3SJSA 2LP3A 3NSKA 3HX4A 1CLLA 4JWQA 1NCXA 4GNKB 2WC8A 1J1EA 1QVIY 1DJXA 2K7CA 1KQVA 1LVCD 3PLFB 2JRFA 3I5IB 1CKKA 2ZFDA 2MAZA 4YGDB 2KOTA 3TZ1A 1YR5A 1SBJA 2CNPA 2R2IA 3SG4A 4UPGA 2O5GA 2PALA 1W7JB 3BYAA 3FWCA 1CDPA 1LXFC 1MF8B 3EK8A 2ZNDA 5B8IB 4ZCUA 4YGCB 3D10A 2HF5A 1K9KA 3LK0A 5ER4X 1S1EA 2FCDA 3AAKA 4GUKA 5I8NA 2LMUA 2LMVA 2PVBA 2L4HA 1LINA 1SKTA 3VRRA 1B47A 2E6WA 1IQ3A 1JC2A 4MZJA 2KFFA 3E3RA 4PE7A 3JTDB 2K61A 2F2PA 2KSPA 2MRDA 5GQQC 1RROA 2LM5A 4MBEA 2LUXA 3I5FC 4AOMA 5KSZA 1YTZC 4C0JA 4F0ZB 1H8BA 2PRUA 2VRGA 1NX2A 3DF0B 1KQMC 2K7OA 2RGIA 4XJKB 2M8UA 2BBMA 2KI4B 4P5OE 5AERA 1ZOTB 2GV5A 2ZKMX 2NCPA 2LHIA 1JFJA 4TNCA 1IKUA 1CMGA 1R6PA 2O60A 3MSEB 1VRKA 2KFHA 1QLSA 1NCZA 1YRUB 1JBAA 2BCAA 1DF0B 2A4JA 2SASA 2H61C 2ZN8A 3I5IC 5HYDA 1XK4C 1AK8A 1X02A 1SYMA 1OMDA 4OCIA 2KI6D 3EKHA 1CDLA 1NIWA 1N2DA 2I7AA 2BBNA 2CCMA 2WCEA 1CB1A 5HLVA 2F2OA 4WRIA 4D1EA 1U5IB 3LCPC 4M2PA 1DJYA 1L2OB 2MHHA 1JWDA 5BPJA 2JXLA 3OP0A 1K90D 4I5NB 3VROA 5AFPA 2JNFA 1BMOA 1YURA 1FBVA 1WLMA 2BL0C 1SPYA 1V1GA 2E30A 4ORAB 3SIBA 1SK6D 1LKJA 1K2HA 4PHMA 1YX7A 2I18A 4MEWA 2M1UA 1G4YR 4YBHB 4AQIA 1EG4A 2K2FA 3CGAA 1OOJA 4N1GA 3AAJA 5AXIA 3KEVA 3WHTB 3ZWHA 2LE9B 1YRTB 2MA2A 1KWOB 1SL8A 3CS1A 1C7WA 1ODBA 1NUBA 1TIZA 5AANA 3ZNIA 4PE1A 1RFJA 1IJ6A 2JQ6A 4IL1A 2BKIB 1B8RA 3KO0A 2MLEC 2KI4C 2LLSA 5D7FA 1DTLA 1DGUA 1SCMC 2OTGB 1F71A 4PE0A 5PALA 1CNPA 1SL9A 1M46A 2KYCA 2I94A 1J7QA 4YGBB 3OB2B 2KGRA 2AAOA 3BXKA 4P2YB 3PATA 4MVFA 3EK4A 1UHHA 1JSAA 2KQ6A 1KK7Z 1MXLC 4M2QA 2HPSA 2MBXA 4C0LA 2LVJA 3I5FB 2EGDA 2KFGA 4HRGA 1UHKA 1KFUS 1UHNA 2KHNA 1XVJA 2SCPA 1Y6WA 2WNDA 1FW4A 3FS7A 1L2OC 1A75A 4YRUA 3M0WA 5IBWA 3GK4X 1RJVA 1CDMA 2JT8A 3EVRA 1NX3A 2Q4UA 4OV2A 4GGFA 1FPWA 2EC6B 1K93D 3CR5X 5KTYA 1EL4A 1A03A 4OKHA 2LVVA 2PSRA 3DVMA 1CLBA 1KFUL 1S6IA 1GQMA 4MLWA 2L0PA 2L50A 1BLQA 1OQPA 1SNLA 1CMFA 1IQ5A 5JJGA 1Q80A 3NSIA 5DKNA 3SIAA 1KWOC 2KAXA 2FJUB 2K2AA 1DJWA 1RTP1 2Y1NA 1UP5A 3I5HB 4MN0A 4GGNA 3CLNA 3VRNA 1B8CA 1ALWA 1ZACA 2CTNA 1BT6A 3DVKA 2L51A 1MHOA 4QJ5B 5CPVA 2OTGC 2M1KB 3GOFA 1QX5B 4USLA 1CFCA 2BE4A 3K21A 5DKQA 1J7PA 2JXCA 2M7NA 2BECA 1NYAA 1YVLA 2JOJA 2BL0B 3FIAA 4DRWA 4ORCB 1SY9A 1PSRA 1PVBA 3A8RA 1AP4A 2HETA 5CSFA 1B7TZ 1OMVA 2MJWB 1N0YA 1N65A 1OSAA 1EJ3A 1XFXO 4OR9B 1IG5A 2I2RE 3D0YA 2EHBA 4I5LB 5D69A 1C7VA 4U8DA 1J55A 2JU0A 1R2UA 2WCFA 3BOWB 4JPZB 2EC6C 2NLNA 5I2LA 1SCMB 2GGMA 1CLMA 4QJ4B 2Y4QA 1UWOA 3IQOA 1CFPA 2L5XB 2L2EA 4PDZA 1L7ZA 1GGZA 1XFVO 4DS7A 1SW8A 1IWQA 1K9UA 1KK7Y 4HRHA 2P6BB 1XO5A 5JOLA 1QIVA 3I5HC 4BY5A 3FWBA 2M49B 1XA5A 1PSBA 4HSZA 1D1OA 3BUWB 1QIWA 1CTRA 1RK9A 1S6JA 1G8IA 2BE6A 3VGOA 1QV0A 4GBAA 3TUYC 1YX8A 3LK1A 1TCFA 4A4BA 1TTXA 3PSRA 4BY4A 2PASA 2AUCA 1S5GZ 1RWYA 1UHIA 2KGBC 2KI6C 1NPQA 1DJHA 2JNXA 2ZRSA 1OE9B 1KSOA 2FCEA 1B1GA 2H61A 1WY9A 1AUIB 1FI5A 4DCKA 3AKAA 1PVAA 1MXEA 1MQ1A 1YUTA 3O6BA 4L9MA 1J1DA 3VRQA 1DMOA 2JC2A 1IGVA 3DVEA 1AVSA 3GK1A 5K89A 1C07A 5HKZA 4ORBB 1TCOB 1DJIA 1JF0A 3KPXA 3WNXB 1QASA 1NX1A 2M0RA 1PULA 1TNXA 3SG7A 1F54A 2WORA 5I2QA 1B7TY 2BKHB 3I5GC 1F8HA 2LAPA 3NXAA 1QATA 3OX5A 2ZNEA 3LL8B 1K95A 2LLTA 4MSPA 2LVKA 4ICBA 4GGFC 4DIRA 1K9PA 1S6CA 4QJ3B 1EH2A 1BR4B 3EKJA 3EVVA 1WRLA 1ZFSA 2L98A 3CTNA 1SR6C 4PHNA 2JTZA 2LANA 3DF0A 4MZKA 5F6TA 2MLFC 4NDDA 4XJKA 2M9GA 1H4BA 1FF1A 2Y5IA 1B9AA 2LP2A 4N1FA 5I2OA 2KAYA 1Y1XA 1CM4A 1MWNA 1F70A 4AQJA 1SMGA 2BCXA 1GJYA 3SG2A 1RECA 1UHJA 1DF0A 3HCMA 2NCOA 3H4SE 2F3YA 1XFUO 2F33A 1DGVA 2WOSA 3BUNB 1S36A 3TDIA 1S3PA 2DOQA 1AHRA 2G9BA 2LMTA 2LVIA 1M31A 3EK7A 3JVTB 4CPVA 3SG3A 3PALA 1BU3A 1FI6A 2Y1MA 1PK0D 4Q04A 3DVJA 3SG6A 1NP8A 1ALVA 4R1EA 1U5IA 3O78A 4GFTA 1F4OA 2BCBA 2ZRTA 3BUXB 1KFXS 3TUYB 2QACA 1WDCC 4DUQA 3IF7A 3QRXA 1QX7A 1S5GY 1IRJA 1DT7B 1TNQA 1JFKA 2LC5A 1IH0A 4YI8A 1AJ5A 1KFXL 1EG3A 2QPTA 2CBLA 3TS5C 3TDZA 1YUSA 2CXJA 3CR2A 1CM1A 5J3XA 3CZTX 1NWDA 2LHLA 1F55A 1KK8C 1MUXA 2LUCA 2AMIA 2KAVA 4CIDA 2KDHA 2G2BA 1A29A 2KYFA 1UUSA 3BUOB 4NDBA 2F8PA 2OPOA 1M45A 5DKRA 1QV1A 4JQ0D 4OVNF 2LNKA 4M2OA 1KSMA 4HREE 2FOTA 3KHEA 3NSLA 1QXPA 1NX0A 2OS8C 5AEQA 1TOPA 3I5GB 2ZN9A 1A4PA 4YGEB 1Y1UA 4PE4A 4CFQA 2K7DA 2Q91A 1A75B 1BODA 4YI9A 2B1UA 3WXAA 2GGZA 2JWWA 1J7OA 4N5XA 1PALA 1NSHA 2KNEA 5CSJA 3JVTC 3PFVA 1CFDA 4MRYA 1DJZA 2WCBA 1WRKA 5KU1A 4ETOA 2LLUA 5TNCA 3C1VA 4FTGA 2M7LA 1SR6B 1WRZA 2HQWA 2JT3A 4PHJA 1S26D 1JUOA 2NZ0A 2F3ZA 1HT9A 1NCYA 2M97A 5CSNA 1CFFA 4C0KA 2NXQA 3PN7B 3A4UB 1QVIZ 1M39A 1DVIA 3F45A 2JT0A 3O2PA 4CFRA 5HKWA 4MRXA 1CDNA 2TN4A 1QS7A 1BF5A 2LCPA 3SG5A 1TRFA 1G33A 2M29A 1E8AA 2K7BA 2V53A 1F4QA 1K8UA 1K94A 2L4IA 1XK4A 2H2KA 4YGAA 1WLZA 3CWGA 1LA3A 1ZUZA 3AKBA 1GGWA 3CR4X 5FYXA 2HQ8A 1B4CA 1BR1B 3IQQA 4WQ3A 1QX2A 2K0JA 2KBIA 1A2XA 2KBMA 2JPTA 1BJFA 2IS9A 1XYDA 3OHMB 1QJTA 1WDCB 4I5KA 1PRWA 1M63B 3JTDC 2JULA 1JF2A 1LA0A 1SRAA 1AJ4A 4MZLA 4PALA 4XYNA 4I5JA 4PHKA 3D0YB 3KF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDU A;  3TS5 B;  3RLZ A;  4E68 A;  3WHU B;  1YUU A;  1BOC A;  3PM8 A;  5G08 A;  1OZS A;  1V1F A;  3ICB A;  4CLN A;  1J7R A;  3NSO A;  1KK8 B;  2JTT A;  2CT9 A;  2COL B;  1OMR A;  1UUR A;  4ZCV A;  2ISD A;  3LLE A;  1MR8 A;  1HQV A;  4FQO A;  4PCW A;  5HLO A;  1TN4 A;  4GAO A;  4WQ2 A;  2LV7 A;  3DD4 A;  2D8N A;  1W7I B;  3RM1 A;  3PN7 C;  3BOW A;  1DJG A;  5CSI A;  2KQY A;  3BQ3 A;  3EVU A;  4NQG A;  1TNW A;  1XFY O;  1Y0V H;  1Y1A A;  4NDC A;  1SCV A;  2OS8 B;  3VRP A;  1IJ5 A;  1OZO A;  3BUM B;  1EXR A;  2M3W A;  1SL7 A;  4A4C A;  1KCY A;  1QLK A;  1YVH A;  1XFW O;  1TNP A;  3OB1 B;  2PMY A;  3OX6 A;  3O4Y A;  1BG1 A;  1QTX A;  2JZI A;  2K8M B;  5HKY A;  1B8L A;  1KQM B;  5ER5 A;  1XFZ O;  4GPL B;  1K96 A;  1ZMZ A;  3GK2 A;  3SJS A;  2LP3 A;  3NSK A;  3HX4 A;  1CLL A;  4JWQ A;  1NCX A;  4GNK B;  2WC8 A;  1J1E A;  1QVI Y;  1DJX A;  2K7C A;  1KQV A;  1LVC D;  3PLF B;  2JRF A;  3I5I B;  1CKK A;  2ZFD A;  2MAZ A;  4YGD B;  2KOT A;  3TZ1 A;  1YR5 A;  1SBJ A;  2CNP A;  2R2I A;  3SG4 A;  4UPG A;  2O5G A;  2PAL A;  1W7J B;  3BYA A;  3FWC A;  1CDP A;  1LXF C;  1MF8 B;  3EK8 A;  2ZND A;  5B8I B;  4ZCU A;  4YGC B;  3D10 A;  2HF5 A;  1K9K A;  3LK0 A;  5ER4 X;  1S1E A;  2FCD A;  3AAK A;  4GUK A;  5I8N A;  2LMU A;  2LMV A;  2PVB A;  2L4H A;  1LIN A;  1SKT A;  3VRR A;  1B47 A;  2E6W A;  1IQ3 A;  1JC2 A;  4MZJ A;  2KFF A;  3E3R A;  4PE7 A;  3JTD B;  2K61 A;  2F2P A;  2KSP A;  2MRD A;  5GQQ C;  1RRO A;  2LM5 A;  4MBE A;  2LUX A;  3I5F C;  4AOM A;  5KSZ A;  1YTZ C;  4C0J A;  4F0Z B;  1H8B A;  2PRU A;  2VRG A;  1NX2 A;  3DF0 B;  1KQM C;  2K7O A;  2RGI A;  4XJK B;  2M8U A;  2BBM A;  2KI4 B;  4P5O E;  5AER A;  1ZOT B;  2GV5 A;  2ZKM X;  2NCP A;  2LHI A;  1JFJ A;  4TNC A;  1IKU A;  1CMG A;  1R6P A;  2O60 A;  3MSE B;  1VRK A;  2KFH A;  1QLS A;  1NCZ A;  1YRU B;  1JBA A;  2BCA A;  1DF0 B;  2A4J A;  2SAS A;  2H61 C;  2ZN8 A;  3I5I C;  5HYD A;  1XK4 C;  1AK8 A;  1X02 A;  1SYM A;  1OMD A;  4OCI A;  2KI6 D;  3EKH A;  1CDL A;  1NIW A;  1N2D A;  2I7A A;  2BBN A;  2CCM A;  2WCE A;  1CB1 A;  5HLV A;  2F2O A;  4WRI A;  4D1E A;  1U5I B;  3LCP C;  4M2P A;  1DJY A;  1L2O B;  2MHH A;  1JWD A;  5BPJ A;  2JXL A;  3OP0 A;  1K90 D;  4I5N B;  3VRO A;  5AFP A;  2JNF A;  1BMO A;  1YUR A;  1FBV A;  1WLM A;  2BL0 C;  1SPY A;  1V1G A;  2E30 A;  4ORA B;  3SIB A;  1SK6 D;  1LKJ A;  1K2H A;  4PHM A;  1YX7 A;  2I18 A;  4MEW A;  2M1U A;  1G4Y R;  4YBH B;  4AQI A;  1EG4 A;  2K2F A;  3CGA A;  1OOJ A;  4N1G A;  3AAJ A;  5AXI A;  3KEV A;  3WHT B;  3ZWH A;  2LE9 B;  1YRT B;  2MA2 A;  1KWO B;  1SL8 A;  3CS1 A;  1C7W A;  1ODB A;  1NUB A;  1TIZ A;  5AAN A;  3ZNI A;  4PE1 A;  1RFJ A;  1IJ6 A;  2JQ6 A;  4IL1 A;  2BKI B;  1B8R A;  3KO0 A;  2MLE C;  2KI4 C;  2LLS A;  5D7F A;  1DTL A;  1DGU A;  1SCM C;  2OTG B;  1F71 A;  4PE0 A;  5PAL A;  1CNP A;  1SL9 A;  1M46 A;  2KYC A;  2I94 A;  1J7Q A;  4YGB B;  3OB2 B;  2KGR A;  2AAO A;  3BXK A;  4P2Y B;  3PAT A;  4MVF A;  3EK4 A;  1UHH A;  1JSA A;  2KQ6 A;  1KK7 Z;  1MXL C;  4M2Q A;  2HPS A;  2MBX A;  4C0L A;  2LVJ A;  3I5F B;  2EGD A;  2KFG A;  4HRG A;  1UHK A;  1KFU S;  1UHN A;  2KHN A;  1XVJ A;  2SCP A;  1Y6W A;  2WND A;  1FW4 A;  3FS7 A;  1L2O C;  1A75 A;  4YRU A;  3M0W A;  5IBW A;  3GK4 X;  1RJV A;  1CDM A;  2JT8 A;  3EVR A;  1NX3 A;  2Q4U A;  4OV2 A;  4GGF A;  1FPW A;  2EC6 B;  1K93 D;  3CR5 X;  5KTY A;  1EL4 A;  1A03 A;  4OKH A;  2LVV A;  2PSR A;  3DVM A;  1CLB A;  1KFU L;  1S6I A;  1GQM A;  4MLW A;  2L0P A;  2L50 A;  1BLQ A;  1OQP A;  1SNL A;  1CMF A;  1IQ5 A;  5JJG A;  1Q80 A;  3NSI A;  5DKN A;  3SIA A;  1KWO C;  2KAX A;  2FJU B;  2K2A A;  1DJW A;  1RTP 1;  2Y1N A;  1UP5 A;  3I5H B;  4MN0 A;  4GGN A;  3CLN A;  3VRN A;  1B8C A;  1ALW A;  1ZAC A;  2CTN A;  1BT6 A;  3DVK A;  2L51 A;  1MHO A;  4QJ5 B;  5CPV A;  2OTG C;  2M1K B;  3GOF A;  1QX5 B;  4USL A;  1CFC A;  2BE4 A;  3K21 A;  5DKQ A;  1J7P A;  2JXC A;  2M7N A;  2BEC A;  1NYA A;  1YVL A;  2JOJ A;  2BL0 B;  3FIA A;  4DRW A;  4ORC B;  1SY9 A;  1PSR A;  1PVB A;  3A8R A;  1AP4 A;  2HET A;  5CSF A;  1B7T Z;  1OMV A;  2MJW B;  1N0Y A;  1N65 A;  1OSA A;  1EJ3 A;  1XFX O;  4OR9 B;  1IG5 A;  2I2R E;  3D0Y A;  2EHB A;  4I5L B;  5D69 A;  1C7V A;  4U8D A;  1J55 A;  2JU0 A;  1R2U A;  2WCF A;  3BOW B;  4JPZ B;  2EC6 C;  2NLN A;  5I2L A;  1SCM B;  2GGM A;  1CLM A;  4QJ4 B;  2Y4Q A;  1UWO A;  3IQO A;  1CFP A;  2L5X B;  2L2E A;  4PDZ A;  1L7Z A;  1GGZ A;  1XFV O;  4DS7 A;  1SW8 A;  1IWQ A;  1K9U A;  1KK7 Y;  4HRH A;  2P6B B;  1XO5 A;  5JOL A;  1QIV A;  3I5H C;  4BY5 A;  3FWB A;  2M49 B;  1XA5 A;  1PSB A;  4HSZ A;  1D1O A;  3BUW B;  1QIW A;  1CTR A;  1RK9 A;  1S6J A;  1G8I A;  2BE6 A;  3VGO A;  1QV0 A;  4GBA A;  3TUY C;  1YX8 A;  3LK1 A;  1TCF A;  4A4B A;  1TTX A;  3PSR A;  4BY4 A;  2PAS A;  2AUC A;  1S5G Z;  1RWY A;  1UHI A;  2KGB C;  2KI6 C;  1NPQ A;  1DJH A;  2JNX A;  2ZRS A;  1OE9 B;  1KSO A;  2FCE A;  1B1G A;  2H61 A;  1WY9 A;  1AUI B;  1FI5 A;  4DCK A;  3AKA A;  1PVA A;  1MXE A;  1MQ1 A;  1YUT A;  3O6B A;  4L9M A;  1J1D A;  3VRQ A;  1DMO A;  2JC2 A;  1IGV A;  3DVE A;  1AVS A;  3GK1 A;  5K89 A;  1C07 A;  5HKZ A;  4ORB B;  1TCO B;  1DJI A;  1JF0 A;  3KPX A;  3WNX B;  1QAS A;  1NX1 A;  2M0R A;  1PUL A;  1TNX A;  3SG7 A;  1F54 A;  2WOR A;  5I2Q A;  1B7T Y;  2BKH B;  3I5G C;  1F8H A;  2LAP A;  3NXA A;  1QAT A;  3OX5 A;  2ZNE A;  3LL8 B;  1K95 A;  2LLT A;  4MSP A;  2LVK A;  4ICB A;  4GGF C;  4DIR A;  1K9P A;  1S6C A;  4QJ3 B;  1EH2 A;  1BR4 B;  3EKJ A;  3EVV A;  1WRL A;  1ZFS A;  2L98 A;  3CTN A;  1SR6 C;  4PHN A;  2JTZ A;  2LAN A;  3DF0 A;  4MZK A;  5F6T A;  2MLF C;  4NDD A;  4XJK A;  2M9G A;  1H4B A;  1FF1 A;  2Y5I A;  1B9A A;  2LP2 A;  4N1F A;  5I2O A;  2KAY A;  1Y1X A;  1CM4 A;  1MWN A;  1F70 A;  4AQJ A;  1SMG A;  2BCX A;  1GJY A;  3SG2 A;  1REC A;  1UHJ A;  1DF0 A;  3HCM A;  2NCO A;  3H4S E;  2F3Y A;  1XFU O;  2F33 A;  1DGV A;  2WOS A;  3BUN B;  1S36 A;  3TDI A;  1S3P A;  2DOQ A;  1AHR A;  2G9B A;  2LMT A;  2LVI A;  1M31 A;  3EK7 A;  3JVT B;  4CPV A;  3SG3 A;  3PAL A;  1BU3 A;  1FI6 A;  2Y1M A;  1PK0 D;  4Q04 A;  3DVJ A;  3SG6 A;  1NP8 A;  1ALV A;  4R1E A;  1U5I A;  3O78 A;  4GFT A;  1F4O A;  2BCB A;  2ZRT A;  3BUX B;  1KFX S;  3TUY B;  2QAC A;  1WDC C;  4DUQ A;  3IF7 A;  3QRX A;  1QX7 A;  1S5G Y;  1IRJ A;  1DT7 B;  1TNQ A;  1JFK A;  2LC5 A;  1IH0 A;  4YI8 A;  1AJ5 A;  1KFX L;  1EG3 A;  2QPT A;  2CBL A;  3TS5 C;  3TDZ A;  1YUS A;  2CXJ A;  3CR2 A;  1CM1 A;  5J3X A;  3CZT X;  1NWD A;  2LHL A;  1F55 A;  1KK8 C;  1MUX A;  2LUC A;  2AMI A;  2KAV A;  4CID A;  2KDH A;  2G2B A;  1A29 A;  2KYF A;  1UUS A;  3BUO B;  4NDB A;  2F8P A;  2OPO A;  1M45 A;  5DKR A;  1QV1 A;  4JQ0 D;  4OVN F;  2LNK A;  4M2O A;  1KSM A;  4HRE E;  2FOT A;  3KHE A;  3NSL A;  1QXP A;  1NX0 A;  2OS8 C;  5AEQ A;  1TOP A;  3I5G B;  2ZN9 A;  1A4P A;  4YGE B;  1Y1U A;  4PE4 A;  4CFQ A;  2K7D A;  2Q91 A;  1A75 B;  1BOD A;  4YI9 A;  2B1U A;  3WXA A;  2GGZ A;  2JWW A;  1J7O A;  4N5X A;  1PAL A;  1NSH A;  2KNE A;  5CSJ A;  3JVT C;  3PFV A;  1CFD A;  4MRY A;  1DJZ A;  2WCB A;  1WRK A;  5KU1 A;  4ETO A;  2LLU A;  5TNC A;  3C1V A;  4FTG A;  2M7L A;  1SR6 B;  1WRZ A;  2HQW A;  2JT3 A;  4PHJ A;  1S26 D;  1JUO A;  2NZ0 A;  2F3Z A;  1HT9 A;  1NCY A;  2M97 A;  5CSN A;  1CFF A;  4C0K A;  2NXQ A;  3PN7 B;  3A4U B;  1QVI Z;  1M39 A;  1DVI A;  3F45 A;  2JT0 A;  3O2P A;  4CFR A;  5HKW A;  4MRX A;  1CDN A;  2TN4 A;  1QS7 A;  1BF5 A;  2LCP A;  3SG5 A;  1TRF A;  1G33 A;  2M29 A;  1E8A A;  2K7B A;  2V53 A;  1F4Q A;  1K8U A;  1K94 A;  2L4I A;  1XK4 A;  2H2K A;  4YGA A;  1WLZ A;  3CWG A;  1LA3 A;  1ZUZ A;  3AKB A;  1GGW A;  3CR4 X;  5FYX A;  2HQ8 A;  1B4C A;  1BR1 B;  3IQQ A;  4WQ3 A;  1QX2 A;  2K0J A;  2KBI A;  1A2X A;  2KBM A;  2JPT A;  1BJF A;  2IS9 A;  1XYD A;  3OHM B;  1QJT A;  1WDC B;  4I5K A;  1PRW A;  1M63 B;  3JTD C;  2JUL A;  1JF2 A;  1LA0 A;  1SRA A;  1AJ4 A;  4MZL A;  4PAL A;  4XYN A;  4I5J A;  4PHK A;  3D0Y B;  3KF9 A; 
#chains in the Genus database with same CATH topology
 2PYQ A;  3TDU A;  3TS5 B;  3RLZ A;  4E68 A;  3WHU B;  1YUU A;  1BOC A;  3PM8 A;  1LS8 A;  5G08 A;  1OZS A;  1V1F A;  3ICB A;  4CLN A;  1J7R A;  3NSO A;  1KK8 B;  2JTT A;  2CT9 A;  2COL B;  1OMR A;  1UUR A;  3B6X A;  4ZCV A;  2ISD A;  3LLE A;  1MR8 A;  1HQV A;  4FQO A;  4PCW A;  5HLO A;  1TN4 A;  3BFB A;  4GAO A;  4WQ2 A;  2LV7 A;  3DD4 A;  2D8N A;  1W7I B;  3RM1 A;  3PN7 C;  3BOW A;  1DJG A;  5CSI A;  2KQY A;  3BQ3 A;  3EVU A;  4NQG A;  1TNW A;  1XFY O;  1Y0V H;  1Y1A A;  4NDC A;  1SCV A;  2OS8 B;  1C3Z A;  3VRP A;  1IJ5 A;  1OZO A;  3BUM B;  1EXR A;  2M3W A;  1SL7 A;  4A4C A;  1KCY A;  1QLK A;  1YVH A;  1XFW O;  1TNP A;  3OB1 B;  2PMY A;  3OX6 A;  3O4Y A;  2JPO A;  1BG1 A;  1QTX A;  2JZI A;  2K8M B;  3BFH A;  5HKY A;  1B8L A;  1KQM B;  3QME A;  5ER5 A;  1XFZ O;  4GPL B;  1K96 A;  1ZMZ A;  3GK2 A;  3L47 A;  3SJS A;  1TUJ A;  2LP3 A;  3NSK A;  3HX4 A;  1CLL A;  4JWQ A;  1NCX A;  4GNK B;  2WC8 A;  1J1E A;  1QVI Y;  1DJX A;  2K7C A;  1KQV A;  1LVC D;  3PLF B;  2JRF A;  3I5I B;  1CKK A;  2ZFD A;  2MAZ A;  4YGD B;  2KOT A;  3TZ1 A;  1YR5 A;  1SBJ A;  2CNP A;  2R2I A;  3SG4 A;  1DQE A;  4UPG A;  2O5G A;  2PAL A;  1W7J B;  3BYA A;  3FWC A;  1CDP A;  1LXF C;  3Q8I A;  1MF8 B;  3EK8 A;  2ZND A;  5B8I B;  4ZCU A;  4YGC B;  3D10 A;  2HF5 A;  2YGU A;  1K9K A;  3LK0 A;  5ER4 X;  1TWO A;  2BNX A;  1S1E A;  2FCD A;  3AAK A;  2P71 A;  4GUK A;  5I8N A;  1SSE B;  2LMU A;  2LMV A;  2PVB A;  2L4H A;  1OOH A;  1LIN A;  1SKT A;  3VRR A;  3O4X A;  1P28 A;  2QDI A;  2WCH A;  1B47 A;  2E6W A;  2KLE A;  2BAP A;  1IQ3 A;  1JC2 A;  4MZJ A;  2KFF A;  3E3R A;  4PE7 A;  3JTD B;  2K61 A;  2F2P A;  2KSP A;  2MRD A;  5GQQ C;  1RRO A;  2LM5 A;  1W9Z A;  4MBE A;  2LUX A;  3I5F C;  4AOM A;  5KSZ A;  1YTZ C;  3BJH A;  1Z4H A;  4C0J A;  4F0Z B;  1H8B A;  2PRU A;  2VRG A;  1NX2 A;  3DF0 B;  1QWV A;  3SS3 A;  1KQM C;  2K7O A;  2RGI A;  4XJK B;  2M8U A;  3N7H A;  2BBM A;  2KI4 B;  4P5O E;  5AER A;  3R1P A;  1ZOT B;  2GV5 A;  2ZKM X;  2NCP A;  2LHI A;  1JFJ A;  1ORG A;  4TNC A;  1IKU A;  1CMG A;  3OBV A;  1R6P A;  2O60 A;  3MSE B;  1VRK A;  2KFH A;  3D77 A;  1QLS A;  1DEK A;  1NCZ A;  1YRU B;  3S0D A;  2BCA A;  1JBA A;  1DF0 B;  2A4J A;  2SAS A;  2H61 C;  2ZN8 A;  3I5I C;  5HYD A;  1XK4 C;  1AK8 A;  1X02 A;  1SYM A;  1OMD A;  4OCI A;  2KI6 D;  3EKH A;  1CDL A;  1NIW A;  1N2D A;  2I7A A;  2BBN A;  5I94 A;  2CCM A;  2WCE A;  1CB1 A;  3PJI A;  2F2O A;  4WRI A;  5HLV A;  4D1E A;  3D73 A;  1U5I B;  3LCP C;  4M2P A;  1DJY A;  1L2O B;  2MHH A;  1JWD A;  5BPJ A;  2JXL A;  2QEH A;  3OP0 A;  1K90 D;  4I5N B;  3VRO A;  5AFP A;  2JNF A;  1BMO A;  1YUR A;  1FBV A;  1WLM A;  2BL0 C;  1SPY A;  1V1G A;  2E30 A;  4ORA B;  3SIB A;  1SK6 D;  1LKJ A;  1K2H A;  4PHM A;  1YX7 A;  2I18 A;  4MEW A;  2M1U A;  1G4Y R;  3R72 A;  4YBH B;  4AQI A;  1EG4 A;  2K2F A;  3CGA A;  1OOJ A;  4N1G A;  3AAJ A;  5AXI A;  3KEV A;  3WHT B;  3ZWH A;  2LE9 B;  1YRT B;  2MA2 A;  1KWO B;  1SL8 A;  3CS1 A;  1C7W A;  1ODB A;  1NUB A;  1TIZ A;  2WC5 A;  5AAN A;  3ZNI A;  4PE1 A;  1RFJ A;  1IJ6 A;  2GTE A;  2JQ6 A;  4IL1 A;  2BKI B;  1B8R A;  3KO0 A;  2MLE C;  3DY9 A;  2KI4 C;  2LLS A;  5D7F A;  5FI7 A;  1DTL A;  3BFA A;  3FE9 A;  1DGU A;  1SCM C;  2OTG B;  1F71 A;  3OGN A;  4PE0 A;  5PAL A;  1CNP A;  1SL9 A;  3CZ0 A;  3NHT A;  1M46 A;  2KYC A;  2I94 A;  3D78 A;  4YGB B;  1OW4 A;  3OB2 B;  1J7Q A;  2KGR A;  2AAO A;  3BXK A;  4P2Y B;  3PAT A;  4MVF A;  3EK4 A;  1UHH A;  1JSA A;  2KQ6 A;  1KK7 Z;  1MXL C;  4M2Q A;  2HPS A;  2MBX A;  4C0L A;  2LVJ A;  3I5F B;  2EGD A;  2KFG A;  4HRG A;  1GM0 A;  1UHK A;  1KFU S;  1UHN A;  2KHN A;  1XVJ A;  2SCP A;  1Y6W A;  2WND A;  1FW4 A;  3FS7 A;  1L2O C;  1A75 A;  4YRU A;  2KLD A;  3M0W A;  5IBW A;  3GK4 X;  1RJV A;  1CDM A;  2JT8 A;  3EVR A;  1NX3 A;  2Q4U A;  4OV2 A;  4GGF A;  1FPW A;  2EC6 B;  1K93 D;  3CR5 X;  5KTY A;  1EL4 A;  1A03 A;  4OKH A;  2LVV A;  2PSR A;  3DVM A;  1CLB A;  1KFU L;  1S6I A;  1GQM A;  4MLW A;  2WCK A;  2L0P A;  2L50 A;  1BLQ A;  1OQP A;  1SNL A;  1CMF A;  1IQ5 A;  5JJG A;  1Q80 A;  3NSI A;  5DKN A;  3SIA A;  1KWO C;  2KAX A;  2FJU B;  2K2A A;  1DJW A;  1RTP 1;  2QEB A;  2Y1N A;  1UP5 A;  3I5H B;  2FJY A;  4MN0 A;  4GGN A;  4FQT A;  3CLN A;  3VRN A;  2QEO A;  1B8C A;  1ALW A;  1ZAC A;  2CTN A;  1BT6 A;  3DVK A;  2L51 A;  1MHO A;  3VB1 A;  4QJ5 B;  5CPV A;  2OTG C;  2M1K B;  3CZ2 A;  3GOF A;  1QX5 B;  3L4L A;  4USL A;  1CFC A;  2BE4 A;  3K21 A;  5DKQ A;  1J7P A;  4JD9 A;  2JXC A;  2M7N A;  2BEC A;  1NYA A;  1YVL A;  2JOJ A;  2BL0 B;  3FIA A;  4JKT A;  4ORC B;  4DRW A;  1SY9 A;  1PSR A;  3SS5 A;  2WCJ A;  1PVB A;  5D3O A;  3A8R A;  1AP4 A;  2HET A;  5CSF A;  1B7T Z;  1OMV A;  2MJW B;  1N0Y A;  1N65 A;  1OSA A;  2ERB A;  1EJ3 A;  1XFX O;  4OR9 B;  3S0G A;  1OOF A;  1IG5 A;  2I2R E;  3D0Y A;  5FI6 A;  2EHB A;  3UO9 A;  3R1O A;  4I5L B;  5D69 A;  1C7V A;  4U8D A;  1J55 A;  2JU0 A;  1R2U A;  2WCF A;  3BOW B;  4JPZ B;  2EC6 C;  2NLN A;  4PT1 A;  5I2L A;  1SCM B;  2GGM A;  1CLM A;  2KPH A;  4F7F A;  4QJ4 B;  2L5Y A;  2Y4Q A;  1UWO A;  3IQO A;  1CFP A;  2L5X B;  2L2E A;  4PDZ A;  1L7Z A;  1GGZ A;  1XFV O;  4DS7 A;  1SW8 A;  1IWQ A;  3UNW A;  1K9U A;  1KK7 Y;  4HRH A;  2P6B B;  1XO5 A;  5JOL A;  1QIV A;  3I5H C;  4BY5 A;  3FWB A;  2M49 B;  2P70 A;  1XA5 A;  1PSB A;  4HSZ A;  1D1O A;  3BUW B;  1QIW A;  3FE6 A;  1CTR A;  1RK9 A;  1XFR A;  1S6J A;  1G8I A;  2BE6 A;  3VGO A;  1QV0 A;  4GBA A;  3TUY C;  1YX8 A;  3LK1 A;  1TCF A;  4A4B A;  1TTX A;  3PSR A;  4BY4 A;  1DC1 A;  2PAS A;  2AUC A;  1S5G Z;  1RWY A;  1UHI A;  2KGB C;  2KI6 C;  3DZT A;  3IVT A;  1NPQ A;  1DJH A;  2JNX A;  2ZRS A;  3S0A A;  1OE9 B;  1KSO A;  2FCE A;  1B1G A;  2H61 A;  2QEV A;  1WY9 A;  1AUI B;  1FI5 A;  3B88 A;  3AKA A;  1PVA A;  1MXE A;  4DCK A;  1MQ1 A;  1YUT A;  3O6B A;  4L9M A;  1J1D A;  3VRQ A;  1DMO A;  2JC2 A;  1IGV A;  3DVE A;  1AVS A;  3GK1 A;  5K89 A;  1C07 A;  5HKZ A;  4ORB B;  1TCO B;  1DJI A;  1JF0 A;  3KPX A;  3WNX B;  1QAS A;  1NX1 A;  2M0R A;  1PUL A;  1TNX A;  3SG7 A;  1F54 A;  2WOR A;  5I2Q A;  1B7T Y;  2BKH B;  3I5G C;  1F8H A;  2LAP A;  3NXA A;  1QAT A;  3CYZ A;  3OX5 A;  2ZNE A;  4INW A;  3L4A A;  3LL8 B;  5HL1 A;  1K95 A;  2LLT A;  4MSP A;  2LVK A;  4ICB A;  4GGF C;  4DIR A;  1K9P A;  1S6C A;  2WCL A;  2WC6 A;  4QJ3 B;  1BR4 B;  3EKJ A;  1EH2 A;  3V2L A;  3EVV A;  5DIC A;  1WRL A;  1ZFS A;  2L98 A;  3CTN A;  1SR6 C;  4INX A;  4PHN A;  2JTZ A;  2LAN A;  3DF0 A;  4MZK A;  5F6T A;  2MLF C;  4NDD A;  4XJK A;  3D75 A;  2M9G A;  1H4B A;  1FF1 A;  2Y5I A;  1B9A A;  2LP2 A;  2WCM A;  4N1F A;  5I2O A;  2KAY A;  1Y1X A;  1CM4 A;  1MWN A;  1F70 A;  4AQJ A;  1SMG A;  2BCX A;  1GJY A;  3SG2 A;  1REC A;  1UHJ A;  1DF0 A;  1OOI X;  3HCM A;  3EG5 B;  3K1E A;  1Z2C B;  2NCO A;  3H4S E;  3B87 A;  2F3Y A;  1XFU O;  2F33 A;  1DGV A;  2WOS A;  3BUN B;  1S36 A;  3TDI A;  1S3P A;  2DOQ A;  1AHR A;  2G9B A;  2LMT A;  2LVI A;  1M31 A;  3EK7 A;  3JVT B;  4CPV A;  3SG3 A;  3PAL A;  3S0F A;  1BU3 A;  3DYE A;  1FI6 A;  2Y1M A;  1PK0 D;  4Q04 A;  3DVJ A;  3SG6 A;  1NP8 A;  1ALV A;  4R1E A;  1U5I A;  3O78 A;  4GFT A;  1F4O A;  3DXL A;  2BCB A;  2ZRT A;  3BUX B;  1KFX S;  3TUY B;  2QAC A;  3FE8 A;  1WDC C;  4DUQ A;  3IF7 A;  3QRX A;  4IJ7 A;  1C3Y A;  1QX7 A;  1S5G Y;  1IRJ A;  1DT7 B;  2H8V A;  1TNQ A;  1JFK A;  2LC5 A;  1IH0 A;  4YI8 A;  1AJ5 A;  1KFX L;  1EG3 A;  2QPT A;  2CBL A;  3TS5 C;  4KYN A;  1YUS A;  3TDZ A;  2CXJ A;  3CR2 A;  1CM1 A;  5J3X A;  3CZT X;  3CAB A;  3D76 A;  1NWD A;  3S0E A;  2LHL A;  1F55 A;  1KK8 C;  1MUX A;  2LUC A;  2AMI A;  2KAV A;  4CID A;  2KDH A;  2G2B A;  1A29 A;  2KYF A;  1UUS A;  3BUO B;  4NDB A;  1OOG A;  1TUZ A;  2F8P A;  2OPO A;  1M45 A;  3RZS A;  5DKR A;  1QV1 A;  4JQ0 D;  4OVN F;  2LNK A;  4M2O A;  1KSM A;  2PQL A;  3B7A A;  4HRE E;  2FOT A;  3KHE A;  3NSL A;  1QXP A;  1NX0 A;  2OS8 C;  5AEQ A;  1TOP A;  3I5G B;  2ZN9 A;  3PM2 A;  1IIO A;  1A4P A;  4YGE B;  1Y1U A;  3R1V A;  4PE4 A;  4CFQ A;  2K7D A;  2Q91 A;  1A75 B;  1BOD A;  4YI9 A;  2B1U A;  3WXA A;  2GGZ A;  2JWW A;  1J7O A;  4N5X A;  1PAL A;  1NSH A;  2KNE A;  5CSJ A;  3JVT C;  3PFV A;  1CFD A;  4MRY A;  1DJZ A;  2WCB A;  1WRK A;  5EL2 A;  5KU1 A;  4ETO A;  2LLU A;  5TNC A;  3C1V A;  4FTG A;  2M7L A;  2L2C A;  1SR6 B;  1T14 A;  1WRZ A;  2HQW A;  2JT3 A;  4PHJ A;  1S26 D;  1JUO A;  3SS4 A;  2NZ0 A;  2F3Z A;  1HT9 A;  1NCY A;  2M97 A;  5CSN A;  1CFF A;  4C0K A;  2NXQ A;  3PN7 B;  3A4U B;  1QVI Z;  1M39 A;  1DVI A;  3F45 A;  2JT0 A;  3O2P A;  4CFR A;  5HKW A;  4MRX A;  1CDN A;  2TN4 A;  1QS7 A;  1BF5 A;  2LCP A;  3SG5 A;  1TRF A;  4OZD A;  1G33 A;  2M29 A;  1E8A A;  2K7B A;  2V53 A;  1F4Q A;  1K8U A;  1K94 A;  2L4I A;  1XK4 A;  2H2K A;  4YGA A;  3B86 A;  1WLZ A;  3CWG A;  1LA3 A;  1ZUZ A;  3AKB A;  3CZ1 A;  1GGW A;  3CR4 X;  5FYX A;  2HQ8 A;  1B4C A;  1BR1 B;  3IQQ A;  3CDN A;  4WQ3 A;  1QX2 A;  3S0B A;  2K0J A;  2KBI A;  1A2X A;  2KBM A;  2JPT A;  1BJF A;  2IS9 A;  1XYD A;  3OHM B;  1QJT A;  1WDC B;  1DEL A;  4I5K A;  1PRW A;  1M63 B;  3D74 A;  2JUL A;  3JTD C;  1JF2 A;  1LA0 A;  3NHI A;  1SRA A;  1AJ4 A;  4MZL A;  3NGV A;  2K60 A;  4PAL A;  4XYN A;  4I5J A;  4PHK A;  3D0Y B;  5FI2 A;  3KF9 A; 
#chains in the Genus database with same CATH homology
 3TDU A;  3TS5 B;  3RLZ A;  4E68 A;  3WHU B;  1YUU A;  1BOC A;  3PM8 A;  5G08 A;  1OZS A;  1V1F A;  3ICB A;  4CLN A;  1J7R A;  3NSO A;  1KK8 B;  2JTT A;  2CT9 A;  2COL B;  1OMR A;  1UUR A;  4ZCV A;  2ISD A;  3LLE A;  1MR8 A;  1HQV A;  4FQO A;  4PCW A;  5HLO A;  1TN4 A;  4GAO A;  4WQ2 A;  2LV7 A;  3DD4 A;  2D8N A;  1W7I B;  3RM1 A;  3PN7 C;  3BOW A;  1DJG A;  5CSI A;  2KQY A;  3BQ3 A;  3EVU A;  4NQG A;  1TNW A;  1XFY O;  1Y0V H;  1Y1A A;  4NDC A;  1SCV A;  2OS8 B;  3VRP A;  1IJ5 A;  1OZO A;  3BUM B;  1EXR A;  2M3W A;  1SL7 A;  4A4C A;  1KCY A;  1QLK A;  1YVH A;  1XFW O;  1TNP A;  3OB1 B;  2PMY A;  3OX6 A;  3O4Y A;  1BG1 A;  1QTX A;  2JZI A;  2K8M B;  5HKY A;  1B8L A;  1KQM B;  5ER5 A;  1XFZ O;  4GPL B;  1K96 A;  1ZMZ A;  3GK2 A;  3SJS A;  2LP3 A;  3NSK A;  3HX4 A;  1CLL A;  4JWQ A;  1NCX A;  4GNK B;  2WC8 A;  1J1E A;  1QVI Y;  1DJX A;  2K7C A;  1KQV A;  1LVC D;  3PLF B;  2JRF A;  3I5I B;  1CKK A;  2ZFD A;  2MAZ A;  4YGD B;  2KOT A;  3TZ1 A;  1YR5 A;  1SBJ A;  2CNP A;  2R2I A;  3SG4 A;  4UPG A;  2O5G A;  2PAL A;  1W7J B;  3BYA A;  3FWC A;  1CDP A;  1LXF C;  1MF8 B;  3EK8 A;  2ZND A;  5B8I B;  4ZCU A;  4YGC B;  3D10 A;  2HF5 A;  1K9K A;  3LK0 A;  5ER4 X;  1S1E A;  2FCD A;  3AAK A;  4GUK A;  5I8N A;  2LMU A;  2LMV A;  2PVB A;  2L4H A;  1LIN A;  1SKT A;  3VRR A;  1B47 A;  2E6W A;  1IQ3 A;  1JC2 A;  4MZJ A;  2KFF A;  3E3R A;  4PE7 A;  3JTD B;  2K61 A;  2F2P A;  2KSP A;  2MRD A;  5GQQ C;  1RRO A;  2LM5 A;  4MBE A;  2LUX A;  3I5F C;  4AOM A;  5KSZ A;  1YTZ C;  4C0J A;  4F0Z B;  1H8B A;  2PRU A;  2VRG A;  1NX2 A;  3DF0 B;  1KQM C;  2K7O A;  2RGI A;  4XJK B;  2M8U A;  2BBM A;  2KI4 B;  4P5O E;  5AER A;  1ZOT B;  2GV5 A;  2ZKM X;  2NCP A;  2LHI A;  1JFJ A;  4TNC A;  1IKU A;  1CMG A;  1R6P A;  2O60 A;  3MSE B;  1VRK A;  2KFH A;  1QLS A;  1NCZ A;  1YRU B;  1JBA A;  2BCA A;  1DF0 B;  2A4J A;  2SAS A;  2H61 C;  2ZN8 A;  3I5I C;  5HYD A;  1XK4 C;  1AK8 A;  1X02 A;  1SYM A;  1OMD A;  4OCI A;  2KI6 D;  3EKH A;  1CDL A;  1NIW A;  1N2D A;  2I7A A;  2BBN A;  2CCM A;  2WCE A;  1CB1 A;  5HLV A;  2F2O A;  4WRI A;  4D1E A;  1U5I B;  3LCP C;  4M2P A;  1DJY A;  1L2O B;  2MHH A;  1JWD A;  5BPJ A;  2JXL A;  3OP0 A;  1K90 D;  4I5N B;  3VRO A;  5AFP A;  2JNF A;  1BMO A;  1YUR A;  1FBV A;  1WLM A;  2BL0 C;  1SPY A;  1V1G A;  2E30 A;  4ORA B;  3SIB A;  1SK6 D;  1LKJ A;  1K2H A;  4PHM A;  1YX7 A;  2I18 A;  4MEW A;  2M1U A;  1G4Y R;  4YBH B;  4AQI A;  1EG4 A;  2K2F A;  3CGA A;  1OOJ A;  4N1G A;  3AAJ A;  5AXI A;  3KEV A;  3WHT B;  3ZWH A;  2LE9 B;  1YRT B;  2MA2 A;  1KWO B;  1SL8 A;  3CS1 A;  1C7W A;  1ODB A;  1NUB A;  1TIZ A;  5AAN A;  3ZNI A;  4PE1 A;  1RFJ A;  1IJ6 A;  2JQ6 A;  4IL1 A;  2BKI B;  1B8R A;  3KO0 A;  2MLE C;  2KI4 C;  2LLS A;  5D7F A;  1DTL A;  1DGU A;  1SCM C;  2OTG B;  1F71 A;  4PE0 A;  5PAL A;  1CNP A;  1SL9 A;  1M46 A;  2KYC A;  2I94 A;  1J7Q A;  4YGB B;  3OB2 B;  2KGR A;  2AAO A;  3BXK A;  4P2Y B;  3PAT A;  4MVF A;  3EK4 A;  1UHH A;  1JSA A;  2KQ6 A;  1KK7 Z;  1MXL C;  4M2Q A;  2HPS A;  2MBX A;  4C0L A;  2LVJ A;  3I5F B;  2EGD A;  2KFG A;  4HRG A;  1UHK A;  1KFU S;  1UHN A;  2KHN A;  1XVJ A;  2SCP A;  1Y6W A;  2WND A;  1FW4 A;  3FS7 A;  1L2O C;  1A75 A;  4YRU A;  3M0W A;  5IBW A;  3GK4 X;  1RJV A;  1CDM A;  2JT8 A;  3EVR A;  1NX3 A;  2Q4U A;  4OV2 A;  4GGF A;  1FPW A;  2EC6 B;  1K93 D;  3CR5 X;  5KTY A;  1EL4 A;  1A03 A;  4OKH A;  2LVV A;  2PSR A;  3DVM A;  1CLB A;  1KFU L;  1S6I A;  1GQM A;  4MLW A;  2L0P A;  2L50 A;  1BLQ A;  1OQP A;  1SNL A;  1CMF A;  1IQ5 A;  5JJG A;  1Q80 A;  3NSI A;  5DKN A;  3SIA A;  1KWO C;  2KAX A;  2FJU B;  2K2A A;  1DJW A;  1RTP 1;  2Y1N A;  1UP5 A;  3I5H B;  4MN0 A;  4GGN A;  3CLN A;  3VRN A;  1B8C A;  1ALW A;  1ZAC A;  2CTN A;  1BT6 A;  3DVK A;  2L51 A;  1MHO A;  4QJ5 B;  5CPV A;  2OTG C;  2M1K B;  3GOF A;  1QX5 B;  4USL A;  1CFC A;  2BE4 A;  3K21 A;  5DKQ A;  1J7P A;  2JXC A;  2M7N A;  2BEC A;  1NYA A;  1YVL A;  2JOJ A;  2BL0 B;  3FIA A;  4DRW A;  4ORC B;  1SY9 A;  1PSR A;  1PVB A;  3A8R A;  1AP4 A;  2HET A;  5CSF A;  1B7T Z;  1OMV A;  2MJW B;  1N0Y A;  1N65 A;  1OSA A;  1EJ3 A;  1XFX O;  4OR9 B;  1IG5 A;  2I2R E;  3D0Y A;  2EHB A;  4I5L B;  5D69 A;  1C7V A;  4U8D A;  1J55 A;  2JU0 A;  1R2U A;  2WCF A;  3BOW B;  4JPZ B;  2EC6 C;  2NLN A;  5I2L A;  1SCM B;  2GGM A;  1CLM A;  4QJ4 B;  2Y4Q A;  1UWO A;  3IQO A;  1CFP A;  2L5X B;  2L2E A;  4PDZ A;  1L7Z A;  1GGZ A;  1XFV O;  4DS7 A;  1SW8 A;  1IWQ A;  1K9U A;  1KK7 Y;  4HRH A;  2P6B B;  1XO5 A;  5JOL A;  1QIV A;  3I5H C;  4BY5 A;  3FWB A;  2M49 B;  1XA5 A;  1PSB A;  4HSZ A;  1D1O A;  3BUW B;  1QIW A;  1CTR A;  1RK9 A;  1S6J A;  1G8I A;  2BE6 A;  3VGO A;  1QV0 A;  4GBA A;  3TUY C;  1YX8 A;  3LK1 A;  1TCF A;  4A4B A;  1TTX A;  3PSR A;  4BY4 A;  2PAS A;  2AUC A;  1S5G Z;  1RWY A;  1UHI A;  2KGB C;  2KI6 C;  1NPQ A;  1DJH A;  2JNX A;  2ZRS A;  1OE9 B;  1KSO A;  2FCE A;  1B1G A;  2H61 A;  1WY9 A;  1AUI B;  1FI5 A;  4DCK A;  3AKA A;  1PVA A;  1MXE A;  1MQ1 A;  1YUT A;  3O6B A;  4L9M A;  1J1D A;  3VRQ A;  1DMO A;  2JC2 A;  1IGV A;  3DVE A;  1AVS A;  3GK1 A;  5K89 A;  1C07 A;  5HKZ A;  4ORB B;  1TCO B;  1DJI A;  1JF0 A;  3KPX A;  3WNX B;  1QAS A;  1NX1 A;  2M0R A;  1PUL A;  1TNX A;  3SG7 A;  1F54 A;  2WOR A;  5I2Q A;  1B7T Y;  2BKH B;  3I5G C;  1F8H A;  2LAP A;  3NXA A;  1QAT A;  3OX5 A;  2ZNE A;  3LL8 B;  1K95 A;  2LLT A;  4MSP A;  2LVK A;  4ICB A;  4GGF C;  4DIR A;  1K9P A;  1S6C A;  4QJ3 B;  1EH2 A;  1BR4 B;  3EKJ A;  3EVV A;  1WRL A;  1ZFS A;  2L98 A;  3CTN A;  1SR6 C;  4PHN A;  2JTZ A;  2LAN A;  3DF0 A;  4MZK A;  5F6T A;  2MLF C;  4NDD A;  4XJK A;  2M9G A;  1H4B A;  1FF1 A;  2Y5I A;  1B9A A;  2LP2 A;  4N1F A;  5I2O A;  2KAY A;  1Y1X A;  1CM4 A;  1MWN A;  1F70 A;  4AQJ A;  1SMG A;  2BCX A;  1GJY A;  3SG2 A;  1REC A;  1UHJ A;  1DF0 A;  3HCM A;  2NCO A;  3H4S E;  2F3Y A;  1XFU O;  2F33 A;  1DGV A;  2WOS A;  3BUN B;  1S36 A;  3TDI A;  1S3P A;  2DOQ A;  1AHR A;  2G9B A;  2LMT A;  2LVI A;  1M31 A;  3EK7 A;  3JVT B;  4CPV A;  3SG3 A;  3PAL A;  1BU3 A;  1FI6 A;  2Y1M A;  1PK0 D;  4Q04 A;  3DVJ A;  3SG6 A;  1NP8 A;  1ALV A;  4R1E A;  1U5I A;  3O78 A;  4GFT A;  1F4O A;  2BCB A;  2ZRT A;  3BUX B;  1KFX S;  3TUY B;  2QAC A;  1WDC C;  4DUQ A;  3IF7 A;  3QRX A;  1QX7 A;  1S5G Y;  1IRJ A;  1DT7 B;  1TNQ A;  1JFK A;  2LC5 A;  1IH0 A;  4YI8 A;  1AJ5 A;  1KFX L;  1EG3 A;  2QPT A;  2CBL A;  3TS5 C;  3TDZ A;  1YUS A;  2CXJ A;  3CR2 A;  1CM1 A;  5J3X A;  3CZT X;  1NWD A;  2LHL A;  1F55 A;  1KK8 C;  1MUX A;  2LUC A;  2AMI A;  2KAV A;  4CID A;  2KDH A;  2G2B A;  1A29 A;  2KYF A;  1UUS A;  3BUO B;  4NDB A;  2F8P A;  2OPO A;  1M45 A;  5DKR A;  1QV1 A;  4JQ0 D;  4OVN F;  2LNK A;  4M2O A;  1KSM A;  4HRE E;  2FOT A;  3KHE A;  3NSL A;  1QXP A;  1NX0 A;  2OS8 C;  5AEQ A;  1TOP A;  3I5G B;  2ZN9 A;  1A4P A;  4YGE B;  1Y1U A;  4PE4 A;  4CFQ A;  2K7D A;  2Q91 A;  1A75 B;  1BOD A;  4YI9 A;  2B1U A;  3WXA A;  2GGZ A;  2JWW A;  1J7O A;  4N5X A;  1PAL A;  1NSH A;  2KNE A;  5CSJ A;  3JVT C;  3PFV A;  1CFD A;  4MRY A;  1DJZ A;  2WCB A;  1WRK A;  5KU1 A;  4ETO A;  2LLU A;  5TNC A;  3C1V A;  4FTG A;  2M7L A;  1SR6 B;  1WRZ A;  2HQW A;  2JT3 A;  4PHJ A;  1S26 D;  1JUO A;  2NZ0 A;  2F3Z A;  1HT9 A;  1NCY A;  2M97 A;  5CSN A;  1CFF A;  4C0K A;  2NXQ A;  3PN7 B;  3A4U B;  1QVI Z;  1M39 A;  1DVI A;  3F45 A;  2JT0 A;  3O2P A;  4CFR A;  5HKW A;  4MRX A;  1CDN A;  2TN4 A;  1QS7 A;  1BF5 A;  2LCP A;  3SG5 A;  1TRF A;  1G33 A;  2M29 A;  1E8A A;  2K7B A;  2V53 A;  1F4Q A;  1K8U A;  1K94 A;  2L4I A;  1XK4 A;  2H2K A;  4YGA A;  1WLZ A;  3CWG A;  1LA3 A;  1ZUZ A;  3AKB A;  1GGW A;  3CR4 X;  5FYX A;  2HQ8 A;  1B4C A;  1BR1 B;  3IQQ A;  4WQ3 A;  1QX2 A;  2K0J A;  2KBI A;  1A2X A;  2KBM A;  2JPT A;  1BJF A;  2IS9 A;  1XYD A;  3OHM B;  1QJT A;  1WDC B;  4I5K A;  1PRW A;  1M63 B;  3JTD C;  2JUL A;  1JF2 A;  1LA0 A;  1SRA A;  1AJ4 A;  4MZL A;  4PAL A;  4XYN A;  4I5J A;  4PHK A;  3D0Y B;  3KF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...