3QRXA

Chlamydomonas reinhardtii centrin bound to melittin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
VGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKMGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/toxin
molecule keywords Centrin
publication title The structure, molecular dynamics, and energetics of centrin-melittin complex.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 49
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3qrxA02
2LVVA 3BOWB 3OHMB 2LNKA 1TNXA 4A4BA 1NP8A 4ORCB 1IJ5A 1XFZO 4YGDB 1KSOA 5KU1A 2IS9A 3WNXB 1KFXL 1R6PA 1MHOA 1JFKA 1WLMA 2H61C 2HQ8A 3BUWB 3KHEA 1A29A 1KQMC 1MXEA 2G9BA 3NSKA 1OMVA 1KK7Y 3BOWA 3KF9A 2LMVA 4GGFC 4ICBA 2WC8A 1NIWA 2I18A 1QV0A 1SL9A 2K0JA 3ICBA 3BUXB 1ALVA 4WQ3A 2I94A 2BE4A 4PDZA 3LK1A 1SNLA 2LHIA 3TS5B 1FI5A 2KQYA 4PHKA 2WOSA 3I5HC 2KYFA 1TCFA 1OSAA 1RROA 1SY9A 1J7PA 1Y6WA 4AQJA 3SG2A 3OB2B 4CPVA 2JOJA 1BMOA 1DJHA 1S6IA 4N1FA 1AVSA 1OZOA 1S3PA 4GGNA 3TUYB 1M63B 3VRPA 2L4IA 2NCOA 2OPOA 4BY4A 4QJ5B 1Y1XA 5I8NA 2JXLA 4PALA 1DTLA 3KPXA 1CDPA 1KSMA 2L0PA 3AKBA 2HETA 1RJVA 5HKWA 1EL4A 1IG5A 1QVIY 2MRDA 1IQ5A 1ZOTB 2Y1MA 2KFHA 1K96A 1KWOB 3EVVA 3DVEA 1PVAA 1NX0A 1W7JB 4NQGA 1D1OA 1PULA 1F8HA 2G2BA 2K61A 3OB1B 3FS7A 3A4UB 2MA2A 1A4PA 4PHNA 4MN0A 1CNPA 2JT8A 1M45A 1PALA 4P2YB 3D10A 3EKJA 1KFUL 2EHBA 2WCBA 1TRFA 1NX3A 1UHJA 5PALA 1OMDA 1Y0VH 1SR6B 2LVKA 1YR5A 1IGVA 4IL1A 3DD4A 2QPTA 4FQOA 1F4OA 2JULA 1A03A 2P6BB 4WRIA 2HQWA 1PSBA 1TIZA 1YUTA 1K90D 5I2QA 1TOPA 4CIDA 5JOLA 2LC5A 4JWQA 1OE9B 5CSNA 3D0YB 4MZKA 1XFVO 1CKKA 1CFDA 1QS7A 1RFJA 3TUYC 4I5KA 1BJFA 2WORA 2JU0A 3OP0A 2A4JA 1J7RA 1S5GY 1TN4A 1F70A 3KO0A 5AXIA 2KGRA 1CMFA 3D0YA 2NXQA 1AJ5A 4AQIA 2M8UA 2KFGA 4PE7A 1KWOC 5KTYA 2ZRSA 2KNEA 3SIBA 2L98A 1MWNA 1SCVA 2M29A 5DKQA 1KCYA 2M7NA 1TNPA 1DT7B 1NX1A 2WCEA 3CWGA 3OX5A 4MEWA 1H8BA 4ZCVA 1UHKA 2LP2A 1QJTA 2M0RA 1V1GA 1PRWA 1JFJA 2BKIB 1F71A 3MSEB 1TCOB 3GK2A 1IQ3A 2LCPA 1SR6C 1DMOA 3BQ3A 4ORBB 3WHTB 2JNXA 1IKUA 1QX2A 5ER4X 4MZLA 4HRGA 3WHUB 2JXCA 5AANA 3VROA 2Y4QA 4PCWA 1H4BA 2KGBC 4GUKA 4JPZB 4OKHA 4Q04A 3I5GB 1UWOA 1SL8A 2B1UA 2JTZA 1GGZA 4L9MA 5CPVA 2ZRTA 2ZN9A 2PRUA 1NYAA 1B8CA 2HF5A 3CTNA 3TDUA 1BF5A 3PATA 1DJYA 1IWQA 1BU3A 2M1UA 1RTP1 3NXAA 3O2PA 2KOTA 4M2OA 1SCMB 5F6TA 2KSPA 4PE0A 3F45A 1QV1A 1B4CA 4YGBB 2LLTA 2KI4B 1K9KA 2COLB 4ZCUA 1CDLA 1MR8A 2ZNDA 1WLZA 2JT3A 1TNQA 1B8RA 2LUXA 3RLZA 3SIAA 3PSRA 1BR1B 2BBNA 1F54A 2M9GA 1NX2A 2ZFDA 3LLEA 3NSIA 4PE1A 1RWYA 4P5OE 2JQ6A 4OR9B 4M2QA 1CFPA 1TTXA 1QIVA 1YUSA 2M97A 1BOCA 3IF7A 5HYDA 2K8MB 2O60A 1R2UA 2LVJA 4I5JA 1IRJA 2LVIA 4MVFA 2KBIA 1CFFA 2I2RE 1AJ4A 3SJSA 1HT9A 2M1KB 1N2DA 1A2XA 3I5GC 4NDDA 2LM5A 4E68A 1XK4A 3TDZA 1L2OB 4WQ2A 4ETOA 1QASA 4GPLB 1K93D 1DJWA 2KAXA 3EK7A 1HQVA 2M3WA 5TNCA 1B9AA 3TDIA 1SCMC 1V1FA 2KAYA 1EJ3A 5HLOA 1SMGA 4DCKA 4PHMA 4BY5A 4YGAA 1QXPA 2KI4C 2LV7A 5FYXA 2ZKMX 2MBXA 1K95A 2FCDA 1CFCA 1WDCB 2BCAA 1C07A 1K94A 3EKHA 5CSFA 1LVCD 1RECA 3DVJA 4ORAB 1AK8A 1CLBA 1S6CA 5I2LA 1N0YA 1G8IA 1LA0A 3PLFB 2KBMA 1B7TY 2KDHA 1DF0B 3AAKA 2CXJA 1UURA 2JPTA 3JTDB 1FF1A 4YI8A 4MZJA 3RM1A 1GQMA 2CT9A 4CFQA 3CLNA 3PALA 1XK4C 1PK0D 1S36A 3TS5C 2OS8B 2LAPA 3PFVA 1AP4A 1JWDA 1J7OA 3ZWHA 2BECA 2Y1NA 2F2PA 1LKJA 3GK1A 1TNWA 1S26D 5B8IB 2BCBA 1K9PA 2E30A 1G4YR 2L50A 1DJZA 2I7AA 2EC6B 3SG7A 4DUQA 1CDMA 3HX4A 1SKTA 1AHRA 1QX5B 2D8NA 3SG3A 1L2OC 1WY9A 1XFUO 2NZ0A 5HLVA 4C0KA 2ZNEA 1EXRA 1NCXA 1FPWA 2CTNA 4MRYA 4N5XA 2KQ6A 3FIAA 3EVUA 1QLSA 1XYDA 1CM1A 4AOMA 5D7FA 1W7IB 2M7LA 4MRXA 3DF0B 5DKRA 5J3XA 2GGZA 1SW8A 2K2AA 3M0WA 3NSLA 3CR4X 3O4YA 4GBAA 1BT6A 2JC2A 5AFPA 1WDCC 2BL0B 3KEVA 3IQQA 3H4SE 2KYCA 5DKNA 1BG1A 4R1EA 2L51A 2KAVA 1UHIA 1Y1AA 4PHJA 4FTGA 4UPGA 2L4HA 1NUBA 1F55A 1QIWA 3JTDC 1J1DA 1CDNA 2PMYA 1JUOA 1JF2A 2OS8C 3CZTX 4YRUA 3DVMA 2PVBA 2LUCA 2K7BA 3BUOB 1QLKA 1Y1UA 1M31A 3EK4A 1KK8B 4DRWA 4XYNA 1C7WA 1GGWA 2EC6C 1SRAA 1PVBA 1NCZA 3VRQA 3CR5X 1WRLA 2JWWA 2LMUA 1ALWA 1JF0A 1VRKA 1XA5A 3NSOA 5G08A 2K7DA 1JBAA 2GGMA 4MSPA 1B1GA 2AMIA 2Q91A 1ZUZA 1NSHA 1SBJA 4MBEA 3WXAA 4M2PA 1YVHA 1L7ZA 2O5GA 1MQ1A 2CBLA 1QX7A 2F3YA 2BL0C 3LCPC 2AUCA 1SPYA 2VRGA 1ZFSA 2E6WA 1LINA 1J1EA 1XO5A 2SCPA 1DVIA 1M39A 1KFXS 1S5GZ 3BUNB 2BE6A 3HCMA 1C7VA 3PN7B 3SG4A 3GOFA 1QATA 3VRNA 2JNFA 4OCIA 2OTGB 1BR4B 3O78A 1YVLA 3E3RA 4HREE 1DJXA 1N65A 2ISDA 4HSZA 5ER5A 2K7CA 3CGAA 1ZACA 2BKHB 1NCYA 1UHNA 2MAZA 1KK8C 1XVJA 4GFTA 1CMGA 1DGVA 2Y5IA 1IJ6A 2F3ZA 4OV2A 4PE4A 2GV5A 1F4QA 4MLWA 5AEQA 4A4CA 4XJKB 1CLLA 1OMRA 1U5IB 1OQPA 4CLNA 4JQ0D 2TN4A 3I5IB 1K9UA 1FI6A 4CFRA 2FJUB 2MLEC 4U8DA 2ZN8A 2CCMA 3DVKA 1EG3A 2LP3A 3VGOA 1OOJA 1FBVA 1B47A 2K7OA 3FWCA 4QJ3B 3IQOA 2QACA 4XJKA 1U5IA 2KFFA 3TZ1A 1CM4A 2H2KA 2R2IA 1DJGA 1YX7A 2PASA 1K8UA 1AUIB 2PSRA 1A75B 3I5FB 5HKYA 3SG5A 4YGEB 2LLUA 4YGCB 3PM8A 4DS7A 5CSIA 1M46A 3PN7C 2LMTA 1B8LA 4F0ZB 3BUMB 1KFUS 1DF0A 3K21A 3AAJA 1XFYO 1A75A 2OTGC 2PALA 3OX6A 2WNDA 5AERA 2SASA 4D1EA 5I2OA 1YTZC 5BPJA 1KK7Z 2Q4UA 3A8RA 2KI6D 1J7QA 4I5LB 2L5XB 2V53A 2JRFA 4TNCA 4C0LA 1S6JA 2MHHA 2WCFA 3BXKA 2HPSA 4DIRA 1NWDA 2KI6C 2L2EA 2JT0A 2MJWB 3CR2A 1YURA 3I5IC 2JTTA 2FOTA 1EG4A 2RGIA 3JVTB 3EK8A 3FWBA 1J55A 2BCXA 1UHHA 1UUSA 1YRTB 1S1EA 2FCEA 3C1VA 1BODA 1E8AA 1CTRA 2DOQA 2NCPA 3DF0A 1MUXA 3GK4X 4NDCA 1CLMA 3SG6A 3ZNIA 1G33A 1DJIA 3I5FC 2NLNA 3EVRA 4HRHA 1GJYA 1SL7A 2MLFC 4QJ4B 1NPQA 1QVIZ 1QTXA 1RK9A 5KSZA 1LXFC 1KQMB 1XFXO 1BLQA 1SYMA 1UP5A 1DGUA 5JJGA 2AAOA 1JC2A 1IH0A 4YBHB 1YX8A 4GAOA 1YUUA 1EH2A 2K2FA 2LE9B 3CS1A 2F8PA 1WRZA 1MXLC 1WRKA 5GQQC 2KHNA 4NDBA 2H61A 1LA3A 2LHLA 5HKZA 3I5HB 1OZSA 5CSJA 1ZMZA 4GGFA 3LL8B 2LLSA 1B7TZ 3O6BA 4YI9A 1XFWO 1CB1A 4C0JA 1K2HA 1SK6D 5IBWA 2JZIA 5K89A 1KQVA 1YRUB 2BBMA 4GNKB 4N1GA 1FW4A 4USLA 1MF8B 1Q80A 5D69A 3LK0A 1PSRA 2LANA 3JVTC 1JSAA 1ODBA 2CNPA 2F33A 2M49B 3AKAA 4I5NB 3VRRA 2F2OA 2EGDA 3QRXA 3BYAA 4OVNF 1X02A
chains in the Genus database with same CATH superfamily
2LVVA 3BOWB 3OHMB 2LNKA 1TNXA 4A4BA 1NP8A 4ORCB 1IJ5A 1XFZO 4YGDB 3PJIA 1KSOA 5KU1A 2IS9A 3WNXB 1KFXL 2L2CA 1R6PA 4IJ7A 1MHOA 1JFKA 1WLMA 2H61C 2HQ8A 3BUWB 4KYNA 3KHEA 1A29A 3OBVA 1KQMC 1MXEA 2G9BA 3NSKA 1OMVA 1KK7Y 3BOWA 3KF9A 2LMVA 4GGFC 4ICBA 2WC8A 1NIWA 2I18A 1QV0A 1SL9A 2K0JA 3ICBA 3BUXB 1ALVA 4WQ3A 2I94A 2BE4A 3BFAA 3D78A 4PDZA 3LK1A 1SNLA 2LHIA 3TS5B 1FI5A 2KQYA 4PHKA 2WOSA 3I5HC 2KYFA 1TCFA 4JKTA 1OSAA 1RROA 1SY9A 1J7PA 1Y6WA 2KPHA 4AQJA 3SG2A 3OB2B 4CPVA 2JOJA 1BMOA 1DJHA 1S6IA 4N1FA 1OOGA 1AVSA 1OZOA 1S3PA 4GGNA 3TUYB 1M63B 3VRPA 2L4IA 2NCOA 2OPOA 3BFHA 4BY4A 4QJ5B 1Y1XA 5I8NA 2JXLA 4PALA 1DTLA 3KPXA 1CDPA 1KSMA 2L0PA 3AKBA 2HETA 1RJVA 5HKWA 1EL4A 1IG5A 1QVIY 2MRDA 1IQ5A 1ZOTB 2Y1MA 2KFHA 1K96A 1KWOB 3EVVA 3DVEA 3NHTA 1PVAA 1NX0A 1W7JB 4NQGA 1D1OA 1PULA 2JPOA 2G2BA 2K61A 3OB1B 1F8HA 3FS7A 3A4UB 2MA2A 1A4PA 4PHNA 3PM2A 4MN0A 1CNPA 2JT8A 1M45A 1PALA 2WCLA 3D10A 4P2YB 3EKJA 1KFUL 1W9ZA 2EHBA 2WCBA 1TRFA 1NX3A 1UHJA 5PALA 1OMDA 1Y0VH 1SR6B 2LVKA 5D3OA 1YR5A 1IGVA 4IL1A 2BNXA 3DD4A 2QPTA 2YGUA 4FQOA 1F4OA 2JULA 1A03A 2P6BB 4WRIA 2HQWA 1PSBA 1DELA 1TIZA 1K90D 1YUTA 5I2QA 1TOPA 4CIDA 5JOLA 2LC5A 4JWQA 1OE9B 5CSNA 3D0YB 4MZKA 1XFVO 1CKKA 1CFDA 1QS7A 1RFJA 3TUYC 4I5KA 1BJFA 2WORA 2JU0A 2WC5A 3OP0A 1QWVA 2A4JA 1J7RA 1S5GY 1TN4A 1F70A 3KO0A 5AXIA 2KGRA 3B7AA 1CMFA 3D0YA 2NXQA 1AJ5A 4AQIA 2M8UA 2KFGA 4PE7A 1KWOC 5KTYA 2ZRSA 2KNEA 2QDIA 5FI6A 3SIBA 2L98A 1MWNA 1SCVA 2M29A 5DKQA 1KCYA 2M7NA 1TNPA 1DT7B 2KLEA 3R1VA 4F7FA 1NX1A 2WCEA 3CWGA 3OX5A 4MEWA 1H8BA 4ZCVA 1UHKA 2LP2A 1QJTA 2M0RA 1V1GA 1PRWA 2QEOA 1JFJA 2BKIB 1F71A 3MSEB 1TCOB 3GK2A 1IQ3A 2LCPA 1SR6C 1DMOA 3BQ3A 4ORBB 3WHTB 2JNXA 1IKUA 1QX2A 5ER4X 4MZLA 4HRGA 3WHUB 2JXCA 5AANA 3VROA 2Y4QA 4PCWA 1H4BA 2KGBC 4GUKA 4JPZB 3RZSA 4INXA 4OKHA 4Q04A 3I5GB 1UWOA 1SL8A 2B1UA 2JTZA 1GGZA 4L9MA 5CPVA 2ZRTA 2ZN9A 2PRUA 1NYAA 1B8CA 2HF5A 3CTNA 3TDUA 1BF5A 3PATA 1DJYA 1IWQA 1BU3A 4JD9A 2M1UA 1RTP1 3NXAA 3O2PA 2KOTA 4M2OA 3SS4A 1SCMB 5F6TA 2KSPA 4PE0A 3F45A 1QV1A 1B4CA 4YGBB 2LLTA 2KI4B 3DYEA 3R1OA 3S0DA 1K9KA 2COLB 4ZCUA 1CDLA 1MR8A 2ZNDA 3B87A 1WLZA 2JT3A 1TNQA 1B8RA 2LUXA 3RLZA 3SIAA 3PSRA 1OW4A 1BR1B 2BBNA 1F54A 2M9GA 1NX2A 2ZFDA 3LLEA 3NSIA 4PE1A 2P71A 1RWYA 4P5OE 2JQ6A 4OR9B 4M2QA 1CFPA 1TTXA 1QIVA 1YUSA 2M97A 1BOCA 3IF7A 5HYDA 2K8MB 2BAPA 2O60A 1R2UA 2LVJA 4I5JA 1IRJA 2LVIA 4MVFA 3S0GA 2KBIA 1CFFA 2I2RE 1AJ4A 3SJSA 1T14A 1HT9A 2M1KB 3EG5B 1N2DA 1A2XA 3I5GC 4NDDA 2LM5A 4E68A 1XK4A 3TDZA 1L2OB 4WQ2A 4ETOA 1QASA 4GPLB 1K93D 1DJWA 2KAXA 3EK7A 3FE9A 1HQVA 1C3YA 2M3WA 5TNCA 1B9AA 3TDIA 1SCMC 3UO9A 1V1FA 2KAYA 1EJ3A 3BFBA 5HLOA 1SMGA 4DCKA 4PHMA 4BY5A 3K1EA 1QXPA 2KI4C 4YGAA 3S0FA 2LV7A 5FYXA 2ZKMX 2MBXA 1K95A 2FCDA 3DZTA 3FE8A 1CFCA 1WDCB 1TUJA 2BCAA 5FI2A 1C07A 1K94A 3EKHA 5CSFA 1LVCD 1RECA 3DVJA 4ORAB 1AK8A 1CLBA 1S6CA 3B6XA 1N0YA 5I2LA 1G8IA 1GM0A 1LA0A 1SSEB 3PLFB 2QEBA 1Z2CB 2KBMA 1B7TY 2KDHA 1DF0B 3AAKA 2CXJA 1UURA 2JPTA 3D75A 1DEKA 2PYQA 3JTDB 4YI8A 1FF1A 4MZJA 3RM1A 1GQMA 2CT9A 4CFQA 3CLNA 3PALA 1XK4C 1PK0D 1S36A 3TS5C 2OS8B 2LAPA 3PFVA 1AP4A 1JWDA 1J7OA 3ZWHA 2BECA 2Y1NA 1TUZA 2F2PA 1LKJA 3GK1A 1TNWA 1S26D 3R1PA 3D73A 5B8IB 2BCBA 1K9PA 2E30A 1G4YR 2L50A 1DJZA 2I7AA 2EC6B 3SG7A 4DUQA 1CDMA 3HX4A 1SKTA 1AHRA 1QX5B 2D8NA 3SG3A 1L2OC 1WY9A 1XFUO 2NZ0A 5HLVA 4C0KA 2ZNEA 3B86A 1EXRA 3R72A 1NCXA 1FPWA 2CTNA 3FE6A 4MRYA 4N5XA 2KQ6A 3FIAA 3EVUA 3O4XA 1QLSA 1XYDA 1CM1A 4AOMA 5D7FA 1W7IB 2M7LA 4MRXA 3DF0B 5DKRA 5J3XA 2GGZA 1SW8A 2K2AA 3M0WA 3NSLA 3CR4X 3QMEA 3O4YA 4GBAA 3D74A 1BT6A 2JC2A 5AFPA 1WDCC 1C3ZA 2BL0B 3KEVA 3Q8IA 3IQQA 3H4SE 2KYCA 5DKNA 1BG1A 3L47A 4R1EA 2L51A 2KAVA 1UHIA 1Y1AA 4PHJA 1DQEA 4FTGA 4UPGA 3V2LA 2L4HA 1NUBA 1OOHA 1F55A 1QIWA 3JTDC 1J1DA 1CDNA 2PMYA 1JUOA 1JF2A 2OS8C 3CZTX 4YRUA 3DVMA 2PVBA 2LUCA 2K7BA 3BUOB 1QLKA 1Y1UA 4PT1A 1M31A 3B88A 3EK4A 1KK8B 4DRWA 4XYNA 1C7WA 3CZ2A 1GGWA 2EC6C 1SRAA 1PVBA 1NCZA 3DXLA 3VRQA 3CR5X 2ERBA 1WRLA 2JWWA 2LMUA 1ALWA 1JF0A 1VRKA 1XA5A 3NSOA 5HL1A 1OOFA 5G08A 2K7DA 3S0BA 1JBAA 2GGMA 4MSPA 4OZDA 1B1GA 2AMIA 2Q91A 1ZUZA 1NSHA 1SBJA 4MBEA 3WXAA 4M2PA 1YVHA 1L7ZA 2O5GA 1MQ1A 1Z4HA 2CBLA 1QX7A 2F3YA 3S0AA 2BL0C 3LCPC 3OGNA 2AUCA 1SPYA 2VRGA 1ZFSA 1OOIX 2E6WA 1LINA 1J1EA 1XO5A 2SCPA 1DVIA 1M39A 5I94A 1KFXS 1S5GZ 3BUNB 1ORGA 2BE6A 3IVTA 3HCMA 1C7VA 3CABA 3PN7B 3SG4A 3GOFA 1QATA 3VRNA 2JNFA 4OCIA 2OTGB 1BR4B 1TWOA 3N7HA 3O78A 1YVLA 3E3RA 5DICA 4HREE 1DJXA 1N65A 1IIOA 2ISDA 4HSZA 5ER5A 2K7CA 2QEHA 1ZACA 3CGAA 2BKHB 1NCYA 1UHNA 2MAZA 2WC6A 1KK8C 1XVJA 2H8VA 2PQLA 4GFTA 1DC1A 1DGVA 2Y5IA 1IJ6A 2F3ZA 4OV2A 1CMGA 4PE4A 2GV5A 1F4QA 2GTEA 4MLWA 3UNWA 5AEQA 4FQTA 4A4CA 4XJKB 1CLLA 1OMRA 1U5IB 1OQPA 4CLNA 4JQ0D 2TN4A 3I5IB 1K9UA 3D76A 1FI6A 4CFRA 2FJUB 2MLEC 4U8DA 2ZN8A 2CCMA 3DVKA 1EG3A 2LP3A 3VGOA 1OOJA 3D77A 1FBVA 1B47A 2K7OA 3FWCA 4QJ3B 3IQOA 2QACA 3BJHA 4XJKA 1U5IA 2KFFA 3TZ1A 1CM4A 2H2KA 2R2IA 1DJGA 1YX7A 2PASA 1K8UA 3CZ1A 2WCMA 5FI7A 1AUIB 2KLDA 2PSRA 1A75B 3I5FB 5HKYA 3SG5A 4YGEB 2LLUA 4YGCB 3PM8A 2P70A 4DS7A 5CSIA 1M46A 3PN7C 2LMTA 1B8LA 4F0ZB 3BUMB 1KFUS 1DF0A 3K21A 3AAJA 1XFYO 1A75A 2OTGC 2PALA 3OX6A 2FJYA 2WNDA 5AERA 2SASA 5EL2A 4D1EA 5I2OA 1YTZC 5BPJA 1XFRA 1KK7Z 2Q4UA 3A8RA 1P28A 2KI6D 1J7QA 4I5LB 2L5XB 2V53A 2JRFA 4TNCA 4C0LA 1S6JA 2MHHA 2WCFA 3BXKA 2HPSA 4DIRA 1NWDA 2KI6C 2L2EA 2JT0A 2MJWB 3CR2A 1YURA 3I5IC 2JTTA 2FOTA 1EG4A 2RGIA 4INWA 3JVTB 3EK8A 3FWBA 1J55A 2BCXA 1UHHA 1UUSA 1YRTB 1S1EA 2FCEA 1LS8A 3C1VA 2QEVA 1BODA 1E8AA 1CTRA 2DOQA 2NCPA 3DF0A 1MUXA 3GK4X 4NDCA 1CLMA 3SG6A 3SS3A 3VB1A 3ZNIA 1G33A 1DJIA 2WCJA 3I5FC 2NLNA 3EVRA 4HRHA 1GJYA 1SL7A 2MLFC 4QJ4B 1NPQA 1QVIZ 1QTXA 1RK9A 5KSZA 1LXFC 1KQMB 1XFXO 1BLQA 1SYMA 1UP5A 1DGUA 5JJGA 2AAOA 1JC2A 1IH0A 3NHIA 4YBHB 1YX8A 4GAOA 1YUUA 1EH2A 2K2FA 2LE9B 3CS1A 2F8PA 1WRZA 1MXLC 1WRKA 5GQQC 3L4AA 2KHNA 2K60A 4NDBA 3NGVA 2H61A 1LA3A 2LHLA 5HKZA 3I5HB 1OZSA 5CSJA 1ZMZA 2L5YA 4GGFA 3LL8B 2LLSA 1B7TZ 3O6BA 3SS5A 4YI9A 1XFWO 1CB1A 3CZ0A 4C0JA 1K2HA 1SK6D 3L4LA 5IBWA 2JZIA 5K89A 1KQVA 3CDNA 1YRUB 2BBMA 4GNKB 4N1GA 1FW4A 4USLA 2WCHA 1MF8B 3CYZA 1Q80A 5D69A 2WCKA 3LK0A 1PSRA 2LANA 3JVTC 1JSAA 1ODBA 2CNPA 2F33A 2M49B 3AKAA 4I5NB 3VRRA 2F2OA 2EGDA 3QRXA 3BYAA 4OVNF 3DY9A 1X02A 3S0EA
chains in the Genus database with same CATH topology
2LVVA 3BOWB 3OHMB 2LNKA 1TNXA 4A4BA 1NP8A 4ORCB 1IJ5A 1XFZO 4YGDB 1KSOA 5KU1A 2IS9A 3WNXB 1KFXL 1R6PA 1MHOA 1JFKA 1WLMA 2H61C 2HQ8A 3BUWB 3KHEA 1A29A 1KQMC 1MXEA 2G9BA 3NSKA 1OMVA 1KK7Y 3BOWA 3KF9A 2LMVA 4GGFC 4ICBA 2WC8A 1NIWA 2I18A 1QV0A 1SL9A 2K0JA 3ICBA 3BUXB 1ALVA 4WQ3A 2I94A 2BE4A 4PDZA 3LK1A 1SNLA 2LHIA 3TS5B 1FI5A 2KQYA 4PHKA 2WOSA 3I5HC 2KYFA 1TCFA 1OSAA 1RROA 1SY9A 1J7PA 1Y6WA 4AQJA 3SG2A 3OB2B 4CPVA 2JOJA 1BMOA 1DJHA 1S6IA 4N1FA 1AVSA 1OZOA 1S3PA 4GGNA 3TUYB 1M63B 3VRPA 2L4IA 2NCOA 2OPOA 4BY4A 4QJ5B 1Y1XA 5I8NA 2JXLA 4PALA 1DTLA 3KPXA 1CDPA 1KSMA 2L0PA 3AKBA 2HETA 1RJVA 5HKWA 1EL4A 1IG5A 1QVIY 2MRDA 1IQ5A 1ZOTB 2Y1MA 2KFHA 1K96A 1KWOB 3EVVA 3DVEA 1PVAA 1NX0A 1W7JB 4NQGA 1D1OA 1PULA 1F8HA 2G2BA 2K61A 3OB1B 3FS7A 3A4UB 2MA2A 1A4PA 4PHNA 4MN0A 1CNPA 2JT8A 1M45A 1PALA 4P2YB 3D10A 3EKJA 1KFUL 2EHBA 2WCBA 1TRFA 1NX3A 1UHJA 5PALA 1OMDA 1Y0VH 1SR6B 2LVKA 1YR5A 1IGVA 4IL1A 3DD4A 2QPTA 4FQOA 1F4OA 2JULA 1A03A 2P6BB 4WRIA 2HQWA 1PSBA 1TIZA 1YUTA 1K90D 5I2QA 1TOPA 4CIDA 5JOLA 2LC5A 4JWQA 1OE9B 5CSNA 3D0YB 4MZKA 1XFVO 1CKKA 1CFDA 1QS7A 1RFJA 3TUYC 4I5KA 1BJFA 2WORA 2JU0A 3OP0A 2A4JA 1J7RA 1S5GY 1TN4A 1F70A 3KO0A 5AXIA 2KGRA 1CMFA 3D0YA 2NXQA 1AJ5A 4AQIA 2M8UA 2KFGA 4PE7A 1KWOC 5KTYA 2ZRSA 2KNEA 3SIBA 2L98A 1MWNA 1SCVA 2M29A 5DKQA 1KCYA 2M7NA 1TNPA 1DT7B 1NX1A 2WCEA 3CWGA 3OX5A 4MEWA 1H8BA 4ZCVA 1UHKA 2LP2A 1QJTA 2M0RA 1V1GA 1PRWA 1JFJA 2BKIB 1F71A 3MSEB 1TCOB 3GK2A 1IQ3A 2LCPA 1SR6C 1DMOA 3BQ3A 4ORBB 3WHTB 2JNXA 1IKUA 1QX2A 5ER4X 4MZLA 4HRGA 3WHUB 2JXCA 5AANA 3VROA 2Y4QA 4PCWA 1H4BA 2KGBC 4GUKA 4JPZB 4OKHA 4Q04A 3I5GB 1UWOA 1SL8A 2B1UA 2JTZA 1GGZA 4L9MA 5CPVA 2ZRTA 2ZN9A 2PRUA 1NYAA 1B8CA 2HF5A 3CTNA 3TDUA 1BF5A 3PATA 1DJYA 1IWQA 1BU3A 2M1UA 1RTP1 3NXAA 3O2PA 2KOTA 4M2OA 1SCMB 5F6TA 2KSPA 4PE0A 3F45A 1QV1A 1B4CA 4YGBB 2LLTA 2KI4B 1K9KA 2COLB 4ZCUA 1CDLA 1MR8A 2ZNDA 1WLZA 2JT3A 1TNQA 1B8RA 2LUXA 3RLZA 3SIAA 3PSRA 1BR1B 2BBNA 1F54A 2M9GA 1NX2A 2ZFDA 3LLEA 3NSIA 4PE1A 1RWYA 4P5OE 2JQ6A 4OR9B 4M2QA 1CFPA 1TTXA 1QIVA 1YUSA 2M97A 1BOCA 3IF7A 5HYDA 2K8MB 2O60A 1R2UA 2LVJA 4I5JA 1IRJA 2LVIA 4MVFA 2KBIA 1CFFA 2I2RE 1AJ4A 3SJSA 1HT9A 2M1KB 1N2DA 1A2XA 3I5GC 4NDDA 2LM5A 4E68A 1XK4A 3TDZA 1L2OB 4WQ2A 4ETOA 1QASA 4GPLB 1K93D 1DJWA 2KAXA 3EK7A 1HQVA 2M3WA 5TNCA 1B9AA 3TDIA 1SCMC 1V1FA 2KAYA 1EJ3A 5HLOA 1SMGA 4DCKA 4PHMA 4BY5A 4YGAA 1QXPA 2KI4C 2LV7A 5FYXA 2ZKMX 2MBXA 1K95A 2FCDA 1CFCA 1WDCB 2BCAA 1C07A 1K94A 3EKHA 5CSFA 1LVCD 1RECA 3DVJA 4ORAB 1AK8A 1CLBA 1S6CA 5I2LA 1N0YA 1G8IA 1LA0A 3PLFB 2KBMA 1B7TY 2KDHA 1DF0B 3AAKA 2CXJA 1UURA 2JPTA 3JTDB 1FF1A 4YI8A 4MZJA 3RM1A 1GQMA 2CT9A 4CFQA 3CLNA 3PALA 1XK4C 1PK0D 1S36A 3TS5C 2OS8B 2LAPA 3PFVA 1AP4A 1JWDA 1J7OA 3ZWHA 2BECA 2Y1NA 2F2PA 1LKJA 3GK1A 1TNWA 1S26D 5B8IB 2BCBA 1K9PA 2E30A 1G4YR 2L50A 1DJZA 2I7AA 2EC6B 3SG7A 4DUQA 1CDMA 3HX4A 1SKTA 1AHRA 1QX5B 2D8NA 3SG3A 1L2OC 1WY9A 1XFUO 2NZ0A 5HLVA 4C0KA 2ZNEA 1EXRA 1NCXA 1FPWA 2CTNA 4MRYA 4N5XA 2KQ6A 3FIAA 3EVUA 1QLSA 1XYDA 1CM1A 4AOMA 5D7FA 1W7IB 2M7LA 4MRXA 3DF0B 5DKRA 5J3XA 2GGZA 1SW8A 2K2AA 3M0WA 3NSLA 3CR4X 3O4YA 4GBAA 1BT6A 2JC2A 5AFPA 1WDCC 2BL0B 3KEVA 3IQQA 3H4SE 2KYCA 5DKNA 1BG1A 4R1EA 2L51A 2KAVA 1UHIA 1Y1AA 4PHJA 4FTGA 4UPGA 2L4HA 1NUBA 1F55A 1QIWA 3JTDC 1J1DA 1CDNA 2PMYA 1JUOA 1JF2A 2OS8C 3CZTX 4YRUA 3DVMA 2PVBA 2LUCA 2K7BA 3BUOB 1QLKA 1Y1UA 1M31A 3EK4A 1KK8B 4DRWA 4XYNA 1C7WA 1GGWA 2EC6C 1SRAA 1PVBA 1NCZA 3VRQA 3CR5X 1WRLA 2JWWA 2LMUA 1ALWA 1JF0A 1VRKA 1XA5A 3NSOA 5G08A 2K7DA 1JBAA 2GGMA 4MSPA 1B1GA 2AMIA 2Q91A 1ZUZA 1NSHA 1SBJA 4MBEA 3WXAA 4M2PA 1YVHA 1L7ZA 2O5GA 1MQ1A 2CBLA 1QX7A 2F3YA 2BL0C 3LCPC 2AUCA 1SPYA 2VRGA 1ZFSA 2E6WA 1LINA 1J1EA 1XO5A 2SCPA 1DVIA 1M39A 1KFXS 1S5GZ 3BUNB 2BE6A 3HCMA 1C7VA 3PN7B 3SG4A 3GOFA 1QATA 3VRNA 2JNFA 4OCIA 2OTGB 1BR4B 3O78A 1YVLA 3E3RA 4HREE 1DJXA 1N65A 2ISDA 4HSZA 5ER5A 2K7CA 3CGAA 1ZACA 2BKHB 1NCYA 1UHNA 2MAZA 1KK8C 1XVJA 4GFTA 1CMGA 1DGVA 2Y5IA 1IJ6A 2F3ZA 4OV2A 4PE4A 2GV5A 1F4QA 4MLWA 5AEQA 4A4CA 4XJKB 1CLLA 1OMRA 1U5IB 1OQPA 4CLNA 4JQ0D 2TN4A 3I5IB 1K9UA 1FI6A 4CFRA 2FJUB 2MLEC 4U8DA 2ZN8A 2CCMA 3DVKA 1EG3A 2LP3A 3VGOA 1OOJA 1FBVA 1B47A 2K7OA 3FWCA 4QJ3B 3IQOA 2QACA 4XJKA 1U5IA 2KFFA 3TZ1A 1CM4A 2H2KA 2R2IA 1DJGA 1YX7A 2PASA 1K8UA 1AUIB 2PSRA 1A75B 3I5FB 5HKYA 3SG5A 4YGEB 2LLUA 4YGCB 3PM8A 4DS7A 5CSIA 1M46A 3PN7C 2LMTA 1B8LA 4F0ZB 3BUMB 1KFUS 1DF0A 3K21A 3AAJA 1XFYO 1A75A 2OTGC 2PALA 3OX6A 2WNDA 5AERA 2SASA 4D1EA 5I2OA 1YTZC 5BPJA 1KK7Z 2Q4UA 3A8RA 2KI6D 1J7QA 4I5LB 2L5XB 2V53A 2JRFA 4TNCA 4C0LA 1S6JA 2MHHA 2WCFA 3BXKA 2HPSA 4DIRA 1NWDA 2KI6C 2L2EA 2JT0A 2MJWB 3CR2A 1YURA 3I5IC 2JTTA 2FOTA 1EG4A 2RGIA 3JVTB 3EK8A 3FWBA 1J55A 2BCXA 1UHHA 1UUSA 1YRTB 1S1EA 2FCEA 3C1VA 1BODA 1E8AA 1CTRA 2DOQA 2NCPA 3DF0A 1MUXA 3GK4X 4NDCA 1CLMA 3SG6A 3ZNIA 1G33A 1DJIA 3I5FC 2NLNA 3EVRA 4HRHA 1GJYA 1SL7A 2MLFC 4QJ4B 1NPQA 1QVIZ 1QTXA 1RK9A 5KSZA 1LXFC 1KQMB 1XFXO 1BLQA 1SYMA 1UP5A 1DGUA 5JJGA 2AAOA 1JC2A 1IH0A 4YBHB 1YX8A 4GAOA 1YUUA 1EH2A 2K2FA 2LE9B 3CS1A 2F8PA 1WRZA 1MXLC 1WRKA 5GQQC 2KHNA 4NDBA 2H61A 1LA3A 2LHLA 5HKZA 3I5HB 1OZSA 5CSJA 1ZMZA 4GGFA 3LL8B 2LLSA 1B7TZ 3O6BA 4YI9A 1XFWO 1CB1A 4C0JA 1K2HA 1SK6D 5IBWA 2JZIA 5K89A 1KQVA 1YRUB 2BBMA 4GNKB 4N1GA 1FW4A 4USLA 1MF8B 1Q80A 5D69A 3LK0A 1PSRA 2LANA 3JVTC 1JSAA 1ODBA 2CNPA 2F33A 2M49B 3AKAA 4I5NB 3VRRA 2F2OA 2EGDA 3QRXA 3BYAA 4OVNF 1X02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVV A;  3BOW B;  3OHM B;  2LNK A;  1TNX A;  4A4B A;  1NP8 A;  4ORC B;  1IJ5 A;  1XFZ O;  4YGD B;  1KSO A;  5KU1 A;  2IS9 A;  3WNX B;  1KFX L;  1R6P A;  1MHO A;  1JFK A;  1WLM A;  2H61 C;  2HQ8 A;  3BUW B;  3KHE A;  1A29 A;  1KQM C;  1MXE A;  2G9B A;  3NSK A;  1OMV A;  1KK7 Y;  3BOW A;  3KF9 A;  2LMV A;  4GGF C;  4ICB A;  2WC8 A;  1NIW A;  2I18 A;  1QV0 A;  1SL9 A;  2K0J A;  3ICB A;  3BUX B;  1ALV A;  4WQ3 A;  2I94 A;  2BE4 A;  4PDZ A;  3LK1 A;  1SNL A;  2LHI A;  3TS5 B;  1FI5 A;  2KQY A;  4PHK A;  2WOS A;  3I5H C;  2KYF A;  1TCF A;  1OSA A;  1RRO A;  1SY9 A;  1J7P A;  1Y6W A;  4AQJ A;  3SG2 A;  3OB2 B;  4CPV A;  2JOJ A;  1BMO A;  1DJH A;  1S6I A;  4N1F A;  1AVS A;  1OZO A;  1S3P A;  4GGN A;  3TUY B;  1M63 B;  3VRP A;  2L4I A;  2NCO A;  2OPO A;  4BY4 A;  4QJ5 B;  1Y1X A;  5I8N A;  2JXL A;  4PAL A;  1DTL A;  3KPX A;  1CDP A;  1KSM A;  2L0P A;  3AKB A;  2HET A;  1RJV A;  5HKW A;  1EL4 A;  1IG5 A;  1QVI Y;  2MRD A;  1IQ5 A;  1ZOT B;  2Y1M A;  2KFH A;  1K96 A;  1KWO B;  3EVV A;  3DVE A;  1PVA A;  1NX0 A;  1W7J B;  4NQG A;  1D1O A;  1PUL A;  1F8H A;  2G2B A;  2K61 A;  3OB1 B;  3FS7 A;  3A4U B;  2MA2 A;  1A4P A;  4PHN A;  4MN0 A;  1CNP A;  2JT8 A;  1M45 A;  1PAL A;  4P2Y B;  3D10 A;  3EKJ A;  1KFU L;  2EHB A;  2WCB A;  1TRF A;  1NX3 A;  1UHJ A;  5PAL A;  1OMD A;  1Y0V H;  1SR6 B;  2LVK A;  1YR5 A;  1IGV A;  4IL1 A;  3DD4 A;  2QPT A;  4FQO A;  1F4O A;  2JUL A;  1A03 A;  2P6B B;  4WRI A;  2HQW A;  1PSB A;  1TIZ A;  1YUT A;  1K90 D;  5I2Q A;  1TOP A;  4CID A;  5JOL A;  2LC5 A;  4JWQ A;  1OE9 B;  5CSN A;  3D0Y B;  4MZK A;  1XFV O;  1CKK A;  1CFD A;  1QS7 A;  1RFJ A;  3TUY C;  4I5K A;  1BJF A;  2WOR A;  2JU0 A;  3OP0 A;  2A4J A;  1J7R A;  1S5G Y;  1TN4 A;  1F70 A;  3KO0 A;  5AXI A;  2KGR A;  1CMF A;  3D0Y A;  2NXQ A;  1AJ5 A;  4AQI A;  2M8U A;  2KFG A;  4PE7 A;  1KWO C;  5KTY A;  2ZRS A;  2KNE A;  3SIB A;  2L98 A;  1MWN A;  1SCV A;  2M29 A;  5DKQ A;  1KCY A;  2M7N A;  1TNP A;  1DT7 B;  1NX1 A;  2WCE A;  3CWG A;  3OX5 A;  4MEW A;  1H8B A;  4ZCV A;  1UHK A;  2LP2 A;  1QJT A;  2M0R A;  1V1G A;  1PRW A;  1JFJ A;  2BKI B;  1F71 A;  3MSE B;  1TCO B;  3GK2 A;  1IQ3 A;  2LCP A;  1SR6 C;  1DMO A;  3BQ3 A;  4ORB B;  3WHT B;  2JNX A;  1IKU A;  1QX2 A;  5ER4 X;  4MZL A;  4HRG A;  3WHU B;  2JXC A;  5AAN A;  3VRO A;  2Y4Q A;  4PCW A;  1H4B A;  2KGB C;  4GUK A;  4JPZ B;  4OKH A;  4Q04 A;  3I5G B;  1UWO A;  1SL8 A;  2B1U A;  2JTZ A;  1GGZ A;  4L9M A;  5CPV A;  2ZRT A;  2ZN9 A;  2PRU A;  1NYA A;  1B8C A;  2HF5 A;  3CTN A;  3TDU A;  1BF5 A;  3PAT A;  1DJY A;  1IWQ A;  1BU3 A;  2M1U A;  1RTP 1;  3NXA A;  3O2P A;  2KOT A;  4M2O A;  1SCM B;  5F6T A;  2KSP A;  4PE0 A;  3F45 A;  1QV1 A;  1B4C A;  4YGB B;  2LLT A;  2KI4 B;  1K9K A;  2COL B;  4ZCU A;  1CDL A;  1MR8 A;  2ZND A;  1WLZ A;  2JT3 A;  1TNQ A;  1B8R A;  2LUX A;  3RLZ A;  3SIA A;  3PSR A;  1BR1 B;  2BBN A;  1F54 A;  2M9G A;  1NX2 A;  2ZFD A;  3LLE A;  3NSI A;  4PE1 A;  1RWY A;  4P5O E;  2JQ6 A;  4OR9 B;  4M2Q A;  1CFP A;  1TTX A;  1QIV A;  1YUS A;  2M97 A;  1BOC A;  3IF7 A;  5HYD A;  2K8M B;  2O60 A;  1R2U A;  2LVJ A;  4I5J A;  1IRJ A;  2LVI A;  4MVF A;  2KBI A;  1CFF A;  2I2R E;  1AJ4 A;  3SJS A;  1HT9 A;  2M1K B;  1N2D A;  1A2X A;  3I5G C;  4NDD A;  2LM5 A;  4E68 A;  1XK4 A;  3TDZ A;  1L2O B;  4WQ2 A;  4ETO A;  1QAS A;  4GPL B;  1K93 D;  1DJW A;  2KAX A;  3EK7 A;  1HQV A;  2M3W A;  5TNC A;  1B9A A;  3TDI A;  1SCM C;  1V1F A;  2KAY A;  1EJ3 A;  5HLO A;  1SMG A;  4DCK A;  4PHM A;  4BY5 A;  4YGA A;  1QXP A;  2KI4 C;  2LV7 A;  5FYX A;  2ZKM X;  2MBX A;  1K95 A;  2FCD A;  1CFC A;  1WDC B;  2BCA A;  1C07 A;  1K94 A;  3EKH A;  5CSF A;  1LVC D;  1REC A;  3DVJ A;  4ORA B;  1AK8 A;  1CLB A;  1S6C A;  5I2L A;  1N0Y A;  1G8I A;  1LA0 A;  3PLF B;  2KBM A;  1B7T Y;  2KDH A;  1DF0 B;  3AAK A;  2CXJ A;  1UUR A;  2JPT A;  3JTD B;  1FF1 A;  4YI8 A;  4MZJ A;  3RM1 A;  1GQM A;  2CT9 A;  4CFQ A;  3CLN A;  3PAL A;  1XK4 C;  1PK0 D;  1S36 A;  3TS5 C;  2OS8 B;  2LAP A;  3PFV A;  1AP4 A;  1JWD A;  1J7O A;  3ZWH A;  2BEC A;  2Y1N A;  2F2P A;  1LKJ A;  3GK1 A;  1TNW A;  1S26 D;  5B8I B;  2BCB A;  1K9P A;  2E30 A;  1G4Y R;  2L50 A;  1DJZ A;  2I7A A;  2EC6 B;  3SG7 A;  4DUQ A;  1CDM A;  3HX4 A;  1SKT A;  1AHR A;  1QX5 B;  2D8N A;  3SG3 A;  1L2O C;  1WY9 A;  1XFU O;  2NZ0 A;  5HLV A;  4C0K A;  2ZNE A;  1EXR A;  1NCX A;  1FPW A;  2CTN A;  4MRY A;  4N5X A;  2KQ6 A;  3FIA A;  3EVU A;  1QLS A;  1XYD A;  1CM1 A;  4AOM A;  5D7F A;  1W7I B;  2M7L A;  4MRX A;  3DF0 B;  5DKR A;  5J3X A;  2GGZ A;  1SW8 A;  2K2A A;  3M0W A;  3NSL A;  3CR4 X;  3O4Y A;  4GBA A;  1BT6 A;  2JC2 A;  5AFP A;  1WDC C;  2BL0 B;  3KEV A;  3IQQ A;  3H4S E;  2KYC A;  5DKN A;  1BG1 A;  4R1E A;  2L51 A;  2KAV A;  1UHI A;  1Y1A A;  4PHJ A;  4FTG A;  4UPG A;  2L4H A;  1NUB A;  1F55 A;  1QIW A;  3JTD C;  1J1D A;  1CDN A;  2PMY A;  1JUO A;  1JF2 A;  2OS8 C;  3CZT X;  4YRU A;  3DVM A;  2PVB A;  2LUC A;  2K7B A;  3BUO B;  1QLK A;  1Y1U A;  1M31 A;  3EK4 A;  1KK8 B;  4DRW A;  4XYN A;  1C7W A;  1GGW A;  2EC6 C;  1SRA A;  1PVB A;  1NCZ A;  3VRQ A;  3CR5 X;  1WRL A;  2JWW A;  2LMU A;  1ALW A;  1JF0 A;  1VRK A;  1XA5 A;  3NSO A;  5G08 A;  2K7D A;  1JBA A;  2GGM A;  4MSP A;  1B1G A;  2AMI A;  2Q91 A;  1ZUZ A;  1NSH A;  1SBJ A;  4MBE A;  3WXA A;  4M2P A;  1YVH A;  1L7Z A;  2O5G A;  1MQ1 A;  2CBL A;  1QX7 A;  2F3Y A;  2BL0 C;  3LCP C;  2AUC A;  1SPY A;  2VRG A;  1ZFS A;  2E6W A;  1LIN A;  1J1E A;  1XO5 A;  2SCP A;  1DVI A;  1M39 A;  1KFX S;  1S5G Z;  3BUN B;  2BE6 A;  3HCM A;  1C7V A;  3PN7 B;  3SG4 A;  3GOF A;  1QAT A;  3VRN A;  2JNF A;  4OCI A;  2OTG B;  1BR4 B;  3O78 A;  1YVL A;  3E3R A;  4HRE E;  1DJX A;  1N65 A;  2ISD A;  4HSZ A;  5ER5 A;  2K7C A;  3CGA A;  1ZAC A;  2BKH B;  1NCY A;  1UHN A;  2MAZ A;  1KK8 C;  1XVJ A;  4GFT A;  1CMG A;  1DGV A;  2Y5I A;  1IJ6 A;  2F3Z A;  4OV2 A;  4PE4 A;  2GV5 A;  1F4Q A;  4MLW A;  5AEQ A;  4A4C A;  4XJK B;  1CLL A;  1OMR A;  1U5I B;  1OQP A;  4CLN A;  4JQ0 D;  2TN4 A;  3I5I B;  1K9U A;  1FI6 A;  4CFR A;  2FJU B;  2MLE C;  4U8D A;  2ZN8 A;  2CCM A;  3DVK A;  1EG3 A;  2LP3 A;  3VGO A;  1OOJ A;  1FBV A;  1B47 A;  2K7O A;  3FWC A;  4QJ3 B;  3IQO A;  2QAC A;  4XJK A;  1U5I A;  2KFF A;  3TZ1 A;  1CM4 A;  2H2K A;  2R2I A;  1DJG A;  1YX7 A;  2PAS A;  1K8U A;  1AUI B;  2PSR A;  1A75 B;  3I5F B;  5HKY A;  3SG5 A;  4YGE B;  2LLU A;  4YGC B;  3PM8 A;  4DS7 A;  5CSI A;  1M46 A;  3PN7 C;  2LMT A;  1B8L A;  4F0Z B;  3BUM B;  1KFU S;  1DF0 A;  3K21 A;  3AAJ A;  1XFY O;  1A75 A;  2OTG C;  2PAL A;  3OX6 A;  2WND A;  5AER A;  2SAS A;  4D1E A;  5I2O A;  1YTZ C;  5BPJ A;  1KK7 Z;  2Q4U A;  3A8R A;  2KI6 D;  1J7Q A;  4I5L B;  2L5X B;  2V53 A;  2JRF A;  4TNC A;  4C0L A;  1S6J A;  2MHH A;  2WCF A;  3BXK A;  2HPS A;  4DIR A;  1NWD A;  2KI6 C;  2L2E A;  2JT0 A;  2MJW B;  3CR2 A;  1YUR A;  3I5I C;  2JTT A;  2FOT A;  1EG4 A;  2RGI A;  3JVT B;  3EK8 A;  3FWB A;  1J55 A;  2BCX A;  1UHH A;  1UUS A;  1YRT B;  1S1E A;  2FCE A;  3C1V A;  1BOD A;  1E8A A;  1CTR A;  2DOQ A;  2NCP A;  3DF0 A;  1MUX A;  3GK4 X;  4NDC A;  1CLM A;  3SG6 A;  3ZNI A;  1G33 A;  1DJI A;  3I5F C;  2NLN A;  3EVR A;  4HRH A;  1GJY A;  1SL7 A;  2MLF C;  4QJ4 B;  1NPQ A;  1QVI Z;  1QTX A;  1RK9 A;  5KSZ A;  1LXF C;  1KQM B;  1XFX O;  1BLQ A;  1SYM A;  1UP5 A;  1DGU A;  5JJG A;  2AAO A;  1JC2 A;  1IH0 A;  4YBH B;  1YX8 A;  4GAO A;  1YUU A;  1EH2 A;  2K2F A;  2LE9 B;  3CS1 A;  2F8P A;  1WRZ A;  1MXL C;  1WRK A;  5GQQ C;  2KHN A;  4NDB A;  2H61 A;  1LA3 A;  2LHL A;  5HKZ A;  3I5H B;  1OZS A;  5CSJ A;  1ZMZ A;  4GGF A;  3LL8 B;  2LLS A;  1B7T Z;  3O6B A;  4YI9 A;  1XFW O;  1CB1 A;  4C0J A;  1K2H A;  1SK6 D;  5IBW A;  2JZI A;  5K89 A;  1KQV A;  1YRU B;  2BBM A;  4GNK B;  4N1G A;  1FW4 A;  4USL A;  1MF8 B;  1Q80 A;  5D69 A;  3LK0 A;  1PSR A;  2LAN A;  3JVT C;  1JSA A;  1ODB A;  2CNP A;  2F33 A;  2M49 B;  3AKA A;  4I5N B;  3VRR A;  2F2O A;  2EGD A;  3QRX A;  3BYA A;  4OVN F;  1X02 A; 
#chains in the Genus database with same CATH topology
 2LVV A;  3BOW B;  3OHM B;  2LNK A;  1TNX A;  4A4B A;  1NP8 A;  4ORC B;  1IJ5 A;  1XFZ O;  4YGD B;  3PJI A;  1KSO A;  5KU1 A;  2IS9 A;  3WNX B;  1KFX L;  2L2C A;  1R6P A;  4IJ7 A;  1MHO A;  1JFK A;  1WLM A;  2H61 C;  2HQ8 A;  3BUW B;  4KYN A;  3KHE A;  1A29 A;  3OBV A;  1KQM C;  1MXE A;  2G9B A;  3NSK A;  1OMV A;  1KK7 Y;  3BOW A;  3KF9 A;  2LMV A;  4GGF C;  4ICB A;  2WC8 A;  1NIW A;  2I18 A;  1QV0 A;  1SL9 A;  2K0J A;  3ICB A;  3BUX B;  1ALV A;  4WQ3 A;  2I94 A;  2BE4 A;  3BFA A;  3D78 A;  4PDZ A;  3LK1 A;  1SNL A;  2LHI A;  3TS5 B;  1FI5 A;  2KQY A;  4PHK A;  2WOS A;  3I5H C;  2KYF A;  1TCF A;  4JKT A;  1OSA A;  1RRO A;  1SY9 A;  1J7P A;  1Y6W A;  2KPH A;  4AQJ A;  3SG2 A;  3OB2 B;  4CPV A;  2JOJ A;  1BMO A;  1DJH A;  1S6I A;  4N1F A;  1OOG A;  1AVS A;  1OZO A;  1S3P A;  4GGN A;  3TUY B;  1M63 B;  3VRP A;  2L4I A;  2NCO A;  2OPO A;  3BFH A;  4BY4 A;  4QJ5 B;  1Y1X A;  5I8N A;  2JXL A;  4PAL A;  1DTL A;  3KPX A;  1CDP A;  1KSM A;  2L0P A;  3AKB A;  2HET A;  1RJV A;  5HKW A;  1EL4 A;  1IG5 A;  1QVI Y;  2MRD A;  1IQ5 A;  1ZOT B;  2Y1M A;  2KFH A;  1K96 A;  1KWO B;  3EVV A;  3DVE A;  3NHT A;  1PVA A;  1NX0 A;  1W7J B;  4NQG A;  1D1O A;  1PUL A;  2JPO A;  2G2B A;  2K61 A;  3OB1 B;  1F8H A;  3FS7 A;  3A4U B;  2MA2 A;  1A4P A;  4PHN A;  3PM2 A;  4MN0 A;  1CNP A;  2JT8 A;  1M45 A;  1PAL A;  2WCL A;  3D10 A;  4P2Y B;  3EKJ A;  1KFU L;  1W9Z A;  2EHB A;  2WCB A;  1TRF A;  1NX3 A;  1UHJ A;  5PAL A;  1OMD A;  1Y0V H;  1SR6 B;  2LVK A;  5D3O A;  1YR5 A;  1IGV A;  4IL1 A;  2BNX A;  3DD4 A;  2QPT A;  2YGU A;  4FQO A;  1F4O A;  2JUL A;  1A03 A;  2P6B B;  4WRI A;  2HQW A;  1PSB A;  1DEL A;  1TIZ A;  1K90 D;  1YUT A;  5I2Q A;  1TOP A;  4CID A;  5JOL A;  2LC5 A;  4JWQ A;  1OE9 B;  5CSN A;  3D0Y B;  4MZK A;  1XFV O;  1CKK A;  1CFD A;  1QS7 A;  1RFJ A;  3TUY C;  4I5K A;  1BJF A;  2WOR A;  2JU0 A;  2WC5 A;  3OP0 A;  1QWV A;  2A4J A;  1J7R A;  1S5G Y;  1TN4 A;  1F70 A;  3KO0 A;  5AXI A;  2KGR A;  3B7A A;  1CMF A;  3D0Y A;  2NXQ A;  1AJ5 A;  4AQI A;  2M8U A;  2KFG A;  4PE7 A;  1KWO C;  5KTY A;  2ZRS A;  2KNE A;  2QDI A;  5FI6 A;  3SIB A;  2L98 A;  1MWN A;  1SCV A;  2M29 A;  5DKQ A;  1KCY A;  2M7N A;  1TNP A;  1DT7 B;  2KLE A;  3R1V A;  4F7F A;  1NX1 A;  2WCE A;  3CWG A;  3OX5 A;  4MEW A;  1H8B A;  4ZCV A;  1UHK A;  2LP2 A;  1QJT A;  2M0R A;  1V1G A;  1PRW A;  2QEO A;  1JFJ A;  2BKI B;  1F71 A;  3MSE B;  1TCO B;  3GK2 A;  1IQ3 A;  2LCP A;  1SR6 C;  1DMO A;  3BQ3 A;  4ORB B;  3WHT B;  2JNX A;  1IKU A;  1QX2 A;  5ER4 X;  4MZL A;  4HRG A;  3WHU B;  2JXC A;  5AAN A;  3VRO A;  2Y4Q A;  4PCW A;  1H4B A;  2KGB C;  4GUK A;  4JPZ B;  3RZS A;  4INX A;  4OKH A;  4Q04 A;  3I5G B;  1UWO A;  1SL8 A;  2B1U A;  2JTZ A;  1GGZ A;  4L9M A;  5CPV A;  2ZRT A;  2ZN9 A;  2PRU A;  1NYA A;  1B8C A;  2HF5 A;  3CTN A;  3TDU A;  1BF5 A;  3PAT A;  1DJY A;  1IWQ A;  1BU3 A;  4JD9 A;  2M1U A;  1RTP 1;  3NXA A;  3O2P A;  2KOT A;  4M2O A;  3SS4 A;  1SCM B;  5F6T A;  2KSP A;  4PE0 A;  3F45 A;  1QV1 A;  1B4C A;  4YGB B;  2LLT A;  2KI4 B;  3DYE A;  3R1O A;  3S0D A;  1K9K A;  2COL B;  4ZCU A;  1CDL A;  1MR8 A;  2ZND A;  3B87 A;  1WLZ A;  2JT3 A;  1TNQ A;  1B8R A;  2LUX A;  3RLZ A;  3SIA A;  3PSR A;  1OW4 A;  1BR1 B;  2BBN A;  1F54 A;  2M9G A;  1NX2 A;  2ZFD A;  3LLE A;  3NSI A;  4PE1 A;  2P71 A;  1RWY A;  4P5O E;  2JQ6 A;  4OR9 B;  4M2Q A;  1CFP A;  1TTX A;  1QIV A;  1YUS A;  2M97 A;  1BOC A;  3IF7 A;  5HYD A;  2K8M B;  2BAP A;  2O60 A;  1R2U A;  2LVJ A;  4I5J A;  1IRJ A;  2LVI A;  4MVF A;  3S0G A;  2KBI A;  1CFF A;  2I2R E;  1AJ4 A;  3SJS A;  1T14 A;  1HT9 A;  2M1K B;  3EG5 B;  1N2D A;  1A2X A;  3I5G C;  4NDD A;  2LM5 A;  4E68 A;  1XK4 A;  3TDZ A;  1L2O B;  4WQ2 A;  4ETO A;  1QAS A;  4GPL B;  1K93 D;  1DJW A;  2KAX A;  3EK7 A;  3FE9 A;  1HQV A;  1C3Y A;  2M3W A;  5TNC A;  1B9A A;  3TDI A;  1SCM C;  3UO9 A;  1V1F A;  2KAY A;  1EJ3 A;  3BFB A;  5HLO A;  1SMG A;  4DCK A;  4PHM A;  4BY5 A;  3K1E A;  1QXP A;  2KI4 C;  4YGA A;  3S0F A;  2LV7 A;  5FYX A;  2ZKM X;  2MBX A;  1K95 A;  2FCD A;  3DZT A;  3FE8 A;  1CFC A;  1WDC B;  1TUJ A;  2BCA A;  5FI2 A;  1C07 A;  1K94 A;  3EKH A;  5CSF A;  1LVC D;  1REC A;  3DVJ A;  4ORA B;  1AK8 A;  1CLB A;  1S6C A;  3B6X A;  1N0Y A;  5I2L A;  1G8I A;  1GM0 A;  1LA0 A;  1SSE B;  3PLF B;  2QEB A;  1Z2C B;  2KBM A;  1B7T Y;  2KDH A;  1DF0 B;  3AAK A;  2CXJ A;  1UUR A;  2JPT A;  3D75 A;  1DEK A;  2PYQ A;  3JTD B;  4YI8 A;  1FF1 A;  4MZJ A;  3RM1 A;  1GQM A;  2CT9 A;  4CFQ A;  3CLN A;  3PAL A;  1XK4 C;  1PK0 D;  1S36 A;  3TS5 C;  2OS8 B;  2LAP A;  3PFV A;  1AP4 A;  1JWD A;  1J7O A;  3ZWH A;  2BEC A;  2Y1N A;  1TUZ A;  2F2P A;  1LKJ A;  3GK1 A;  1TNW A;  1S26 D;  3R1P A;  3D73 A;  5B8I B;  2BCB A;  1K9P A;  2E30 A;  1G4Y R;  2L50 A;  1DJZ A;  2I7A A;  2EC6 B;  3SG7 A;  4DUQ A;  1CDM A;  3HX4 A;  1SKT A;  1AHR A;  1QX5 B;  2D8N A;  3SG3 A;  1L2O C;  1WY9 A;  1XFU O;  2NZ0 A;  5HLV A;  4C0K A;  2ZNE A;  3B86 A;  1EXR A;  3R72 A;  1NCX A;  1FPW A;  2CTN A;  3FE6 A;  4MRY A;  4N5X A;  2KQ6 A;  3FIA A;  3EVU A;  3O4X A;  1QLS A;  1XYD A;  1CM1 A;  4AOM A;  5D7F A;  1W7I B;  2M7L A;  4MRX A;  3DF0 B;  5DKR A;  5J3X A;  2GGZ A;  1SW8 A;  2K2A A;  3M0W A;  3NSL A;  3CR4 X;  3QME A;  3O4Y A;  4GBA A;  3D74 A;  1BT6 A;  2JC2 A;  5AFP A;  1WDC C;  1C3Z A;  2BL0 B;  3KEV A;  3Q8I A;  3IQQ A;  3H4S E;  2KYC A;  5DKN A;  1BG1 A;  3L47 A;  4R1E A;  2L51 A;  2KAV A;  1UHI A;  1Y1A A;  4PHJ A;  1DQE A;  4FTG A;  4UPG A;  3V2L A;  2L4H A;  1NUB A;  1OOH A;  1F55 A;  1QIW A;  3JTD C;  1J1D A;  1CDN A;  2PMY A;  1JUO A;  1JF2 A;  2OS8 C;  3CZT X;  4YRU A;  3DVM A;  2PVB A;  2LUC A;  2K7B A;  3BUO B;  1QLK A;  1Y1U A;  4PT1 A;  1M31 A;  3B88 A;  3EK4 A;  1KK8 B;  4DRW A;  4XYN A;  1C7W A;  3CZ2 A;  1GGW A;  2EC6 C;  1SRA A;  1PVB A;  1NCZ A;  3DXL A;  3VRQ A;  3CR5 X;  2ERB A;  1WRL A;  2JWW A;  2LMU A;  1ALW A;  1JF0 A;  1VRK A;  1XA5 A;  3NSO A;  5HL1 A;  1OOF A;  5G08 A;  2K7D A;  3S0B A;  1JBA A;  2GGM A;  4MSP A;  4OZD A;  1B1G A;  2AMI A;  2Q91 A;  1ZUZ A;  1NSH A;  1SBJ A;  4MBE A;  3WXA A;  4M2P A;  1YVH A;  1L7Z A;  2O5G A;  1MQ1 A;  1Z4H A;  2CBL A;  1QX7 A;  2F3Y A;  3S0A A;  2BL0 C;  3LCP C;  3OGN A;  2AUC A;  1SPY A;  2VRG A;  1ZFS A;  1OOI X;  2E6W A;  1LIN A;  1J1E A;  1XO5 A;  2SCP A;  1DVI A;  1M39 A;  5I94 A;  1KFX S;  1S5G Z;  3BUN B;  1ORG A;  2BE6 A;  3IVT A;  3HCM A;  1C7V A;  3CAB A;  3PN7 B;  3SG4 A;  3GOF A;  1QAT A;  3VRN A;  2JNF A;  4OCI A;  2OTG B;  1BR4 B;  1TWO A;  3N7H A;  3O78 A;  1YVL A;  3E3R A;  5DIC A;  4HRE E;  1DJX A;  1N65 A;  1IIO A;  2ISD A;  4HSZ A;  5ER5 A;  2K7C A;  2QEH A;  1ZAC A;  3CGA A;  2BKH B;  1NCY A;  1UHN A;  2MAZ A;  2WC6 A;  1KK8 C;  1XVJ A;  2H8V A;  2PQL A;  4GFT A;  1DC1 A;  1DGV A;  2Y5I A;  1IJ6 A;  2F3Z A;  4OV2 A;  1CMG A;  4PE4 A;  2GV5 A;  1F4Q A;  2GTE A;  4MLW A;  3UNW A;  5AEQ A;  4FQT A;  4A4C A;  4XJK B;  1CLL A;  1OMR A;  1U5I B;  1OQP A;  4CLN A;  4JQ0 D;  2TN4 A;  3I5I B;  1K9U A;  3D76 A;  1FI6 A;  4CFR A;  2FJU B;  2MLE C;  4U8D A;  2ZN8 A;  2CCM A;  3DVK A;  1EG3 A;  2LP3 A;  3VGO A;  1OOJ A;  3D77 A;  1FBV A;  1B47 A;  2K7O A;  3FWC A;  4QJ3 B;  3IQO A;  2QAC A;  3BJH A;  4XJK A;  1U5I A;  2KFF A;  3TZ1 A;  1CM4 A;  2H2K A;  2R2I A;  1DJG A;  1YX7 A;  2PAS A;  1K8U A;  3CZ1 A;  2WCM A;  5FI7 A;  1AUI B;  2KLD A;  2PSR A;  1A75 B;  3I5F B;  5HKY A;  3SG5 A;  4YGE B;  2LLU A;  4YGC B;  3PM8 A;  2P70 A;  4DS7 A;  5CSI A;  1M46 A;  3PN7 C;  2LMT A;  1B8L A;  4F0Z B;  3BUM B;  1KFU S;  1DF0 A;  3K21 A;  3AAJ A;  1XFY O;  1A75 A;  2OTG C;  2PAL A;  3OX6 A;  2FJY A;  2WND A;  5AER A;  2SAS A;  5EL2 A;  4D1E A;  5I2O A;  1YTZ C;  5BPJ A;  1XFR A;  1KK7 Z;  2Q4U A;  3A8R A;  1P28 A;  2KI6 D;  1J7Q A;  4I5L B;  2L5X B;  2V53 A;  2JRF A;  4TNC A;  4C0L A;  1S6J A;  2MHH A;  2WCF A;  3BXK A;  2HPS A;  4DIR A;  1NWD A;  2KI6 C;  2L2E A;  2JT0 A;  2MJW B;  3CR2 A;  1YUR A;  3I5I C;  2JTT A;  2FOT A;  1EG4 A;  2RGI A;  4INW A;  3JVT B;  3EK8 A;  3FWB A;  1J55 A;  2BCX A;  1UHH A;  1UUS A;  1YRT B;  1S1E A;  2FCE A;  1LS8 A;  3C1V A;  2QEV A;  1BOD A;  1E8A A;  1CTR A;  2DOQ A;  2NCP A;  3DF0 A;  1MUX A;  3GK4 X;  4NDC A;  1CLM A;  3SG6 A;  3SS3 A;  3VB1 A;  3ZNI A;  1G33 A;  1DJI A;  2WCJ A;  3I5F C;  2NLN A;  3EVR A;  4HRH A;  1GJY A;  1SL7 A;  2MLF C;  4QJ4 B;  1NPQ A;  1QVI Z;  1QTX A;  1RK9 A;  5KSZ A;  1LXF C;  1KQM B;  1XFX O;  1BLQ A;  1SYM A;  1UP5 A;  1DGU A;  5JJG A;  2AAO A;  1JC2 A;  1IH0 A;  3NHI A;  4YBH B;  1YX8 A;  4GAO A;  1YUU A;  1EH2 A;  2K2F A;  2LE9 B;  3CS1 A;  2F8P A;  1WRZ A;  1MXL C;  1WRK A;  5GQQ C;  3L4A A;  2KHN A;  2K60 A;  4NDB A;  3NGV A;  2H61 A;  1LA3 A;  2LHL A;  5HKZ A;  3I5H B;  1OZS A;  5CSJ A;  1ZMZ A;  2L5Y A;  4GGF A;  3LL8 B;  2LLS A;  1B7T Z;  3O6B A;  3SS5 A;  4YI9 A;  1XFW O;  1CB1 A;  3CZ0 A;  4C0J A;  1K2H A;  1SK6 D;  3L4L A;  5IBW A;  2JZI A;  5K89 A;  1KQV A;  3CDN A;  1YRU B;  2BBM A;  4GNK B;  4N1G A;  1FW4 A;  4USL A;  2WCH A;  1MF8 B;  3CYZ A;  1Q80 A;  5D69 A;  2WCK A;  3LK0 A;  1PSR A;  2LAN A;  3JVT C;  1JSA A;  1ODB A;  2CNP A;  2F33 A;  2M49 B;  3AKA A;  4I5N B;  3VRR A;  2F2O A;  2EGD A;  3QRX A;  3BYA A;  4OVN F;  3DY9 A;  1X02 A;  3S0E A; 
#chains in the Genus database with same CATH homology
 2LVV A;  3BOW B;  3OHM B;  2LNK A;  1TNX A;  4A4B A;  1NP8 A;  4ORC B;  1IJ5 A;  1XFZ O;  4YGD B;  1KSO A;  5KU1 A;  2IS9 A;  3WNX B;  1KFX L;  1R6P A;  1MHO A;  1JFK A;  1WLM A;  2H61 C;  2HQ8 A;  3BUW B;  3KHE A;  1A29 A;  1KQM C;  1MXE A;  2G9B A;  3NSK A;  1OMV A;  1KK7 Y;  3BOW A;  3KF9 A;  2LMV A;  4GGF C;  4ICB A;  2WC8 A;  1NIW A;  2I18 A;  1QV0 A;  1SL9 A;  2K0J A;  3ICB A;  3BUX B;  1ALV A;  4WQ3 A;  2I94 A;  2BE4 A;  4PDZ A;  3LK1 A;  1SNL A;  2LHI A;  3TS5 B;  1FI5 A;  2KQY A;  4PHK A;  2WOS A;  3I5H C;  2KYF A;  1TCF A;  1OSA A;  1RRO A;  1SY9 A;  1J7P A;  1Y6W A;  4AQJ A;  3SG2 A;  3OB2 B;  4CPV A;  2JOJ A;  1BMO A;  1DJH A;  1S6I A;  4N1F A;  1AVS A;  1OZO A;  1S3P A;  4GGN A;  3TUY B;  1M63 B;  3VRP A;  2L4I A;  2NCO A;  2OPO A;  4BY4 A;  4QJ5 B;  1Y1X A;  5I8N A;  2JXL A;  4PAL A;  1DTL A;  3KPX A;  1CDP A;  1KSM A;  2L0P A;  3AKB A;  2HET A;  1RJV A;  5HKW A;  1EL4 A;  1IG5 A;  1QVI Y;  2MRD A;  1IQ5 A;  1ZOT B;  2Y1M A;  2KFH A;  1K96 A;  1KWO B;  3EVV A;  3DVE A;  1PVA A;  1NX0 A;  1W7J B;  4NQG A;  1D1O A;  1PUL A;  1F8H A;  2G2B A;  2K61 A;  3OB1 B;  3FS7 A;  3A4U B;  2MA2 A;  1A4P A;  4PHN A;  4MN0 A;  1CNP A;  2JT8 A;  1M45 A;  1PAL A;  4P2Y B;  3D10 A;  3EKJ A;  1KFU L;  2EHB A;  2WCB A;  1TRF A;  1NX3 A;  1UHJ A;  5PAL A;  1OMD A;  1Y0V H;  1SR6 B;  2LVK A;  1YR5 A;  1IGV A;  4IL1 A;  3DD4 A;  2QPT A;  4FQO A;  1F4O A;  2JUL A;  1A03 A;  2P6B B;  4WRI A;  2HQW A;  1PSB A;  1TIZ A;  1YUT A;  1K90 D;  5I2Q A;  1TOP A;  4CID A;  5JOL A;  2LC5 A;  4JWQ A;  1OE9 B;  5CSN A;  3D0Y B;  4MZK A;  1XFV O;  1CKK A;  1CFD A;  1QS7 A;  1RFJ A;  3TUY C;  4I5K A;  1BJF A;  2WOR A;  2JU0 A;  3OP0 A;  2A4J A;  1J7R A;  1S5G Y;  1TN4 A;  1F70 A;  3KO0 A;  5AXI A;  2KGR A;  1CMF A;  3D0Y A;  2NXQ A;  1AJ5 A;  4AQI A;  2M8U A;  2KFG A;  4PE7 A;  1KWO C;  5KTY A;  2ZRS A;  2KNE A;  3SIB A;  2L98 A;  1MWN A;  1SCV A;  2M29 A;  5DKQ A;  1KCY A;  2M7N A;  1TNP A;  1DT7 B;  1NX1 A;  2WCE A;  3CWG A;  3OX5 A;  4MEW A;  1H8B A;  4ZCV A;  1UHK A;  2LP2 A;  1QJT A;  2M0R A;  1V1G A;  1PRW A;  1JFJ A;  2BKI B;  1F71 A;  3MSE B;  1TCO B;  3GK2 A;  1IQ3 A;  2LCP A;  1SR6 C;  1DMO A;  3BQ3 A;  4ORB B;  3WHT B;  2JNX A;  1IKU A;  1QX2 A;  5ER4 X;  4MZL A;  4HRG A;  3WHU B;  2JXC A;  5AAN A;  3VRO A;  2Y4Q A;  4PCW A;  1H4B A;  2KGB C;  4GUK A;  4JPZ B;  4OKH A;  4Q04 A;  3I5G B;  1UWO A;  1SL8 A;  2B1U A;  2JTZ A;  1GGZ A;  4L9M A;  5CPV A;  2ZRT A;  2ZN9 A;  2PRU A;  1NYA A;  1B8C A;  2HF5 A;  3CTN A;  3TDU A;  1BF5 A;  3PAT A;  1DJY A;  1IWQ A;  1BU3 A;  2M1U A;  1RTP 1;  3NXA A;  3O2P A;  2KOT A;  4M2O A;  1SCM B;  5F6T A;  2KSP A;  4PE0 A;  3F45 A;  1QV1 A;  1B4C A;  4YGB B;  2LLT A;  2KI4 B;  1K9K A;  2COL B;  4ZCU A;  1CDL A;  1MR8 A;  2ZND A;  1WLZ A;  2JT3 A;  1TNQ A;  1B8R A;  2LUX A;  3RLZ A;  3SIA A;  3PSR A;  1BR1 B;  2BBN A;  1F54 A;  2M9G A;  1NX2 A;  2ZFD A;  3LLE A;  3NSI A;  4PE1 A;  1RWY A;  4P5O E;  2JQ6 A;  4OR9 B;  4M2Q A;  1CFP A;  1TTX A;  1QIV A;  1YUS A;  2M97 A;  1BOC A;  3IF7 A;  5HYD A;  2K8M B;  2O60 A;  1R2U A;  2LVJ A;  4I5J A;  1IRJ A;  2LVI A;  4MVF A;  2KBI A;  1CFF A;  2I2R E;  1AJ4 A;  3SJS A;  1HT9 A;  2M1K B;  1N2D A;  1A2X A;  3I5G C;  4NDD A;  2LM5 A;  4E68 A;  1XK4 A;  3TDZ A;  1L2O B;  4WQ2 A;  4ETO A;  1QAS A;  4GPL B;  1K93 D;  1DJW A;  2KAX A;  3EK7 A;  1HQV A;  2M3W A;  5TNC A;  1B9A A;  3TDI A;  1SCM C;  1V1F A;  2KAY A;  1EJ3 A;  5HLO A;  1SMG A;  4DCK A;  4PHM A;  4BY5 A;  4YGA A;  1QXP A;  2KI4 C;  2LV7 A;  5FYX A;  2ZKM X;  2MBX A;  1K95 A;  2FCD A;  1CFC A;  1WDC B;  2BCA A;  1C07 A;  1K94 A;  3EKH A;  5CSF A;  1LVC D;  1REC A;  3DVJ A;  4ORA B;  1AK8 A;  1CLB A;  1S6C A;  5I2L A;  1N0Y A;  1G8I A;  1LA0 A;  3PLF B;  2KBM A;  1B7T Y;  2KDH A;  1DF0 B;  3AAK A;  2CXJ A;  1UUR A;  2JPT A;  3JTD B;  1FF1 A;  4YI8 A;  4MZJ A;  3RM1 A;  1GQM A;  2CT9 A;  4CFQ A;  3CLN A;  3PAL A;  1XK4 C;  1PK0 D;  1S36 A;  3TS5 C;  2OS8 B;  2LAP A;  3PFV A;  1AP4 A;  1JWD A;  1J7O A;  3ZWH A;  2BEC A;  2Y1N A;  2F2P A;  1LKJ A;  3GK1 A;  1TNW A;  1S26 D;  5B8I B;  2BCB A;  1K9P A;  2E30 A;  1G4Y R;  2L50 A;  1DJZ A;  2I7A A;  2EC6 B;  3SG7 A;  4DUQ A;  1CDM A;  3HX4 A;  1SKT A;  1AHR A;  1QX5 B;  2D8N A;  3SG3 A;  1L2O C;  1WY9 A;  1XFU O;  2NZ0 A;  5HLV A;  4C0K A;  2ZNE A;  1EXR A;  1NCX A;  1FPW A;  2CTN A;  4MRY A;  4N5X A;  2KQ6 A;  3FIA A;  3EVU A;  1QLS A;  1XYD A;  1CM1 A;  4AOM A;  5D7F A;  1W7I B;  2M7L A;  4MRX A;  3DF0 B;  5DKR A;  5J3X A;  2GGZ A;  1SW8 A;  2K2A A;  3M0W A;  3NSL A;  3CR4 X;  3O4Y A;  4GBA A;  1BT6 A;  2JC2 A;  5AFP A;  1WDC C;  2BL0 B;  3KEV A;  3IQQ A;  3H4S E;  2KYC A;  5DKN A;  1BG1 A;  4R1E A;  2L51 A;  2KAV A;  1UHI A;  1Y1A A;  4PHJ A;  4FTG A;  4UPG A;  2L4H A;  1NUB A;  1F55 A;  1QIW A;  3JTD C;  1J1D A;  1CDN A;  2PMY A;  1JUO A;  1JF2 A;  2OS8 C;  3CZT X;  4YRU A;  3DVM A;  2PVB A;  2LUC A;  2K7B A;  3BUO B;  1QLK A;  1Y1U A;  1M31 A;  3EK4 A;  1KK8 B;  4DRW A;  4XYN A;  1C7W A;  1GGW A;  2EC6 C;  1SRA A;  1PVB A;  1NCZ A;  3VRQ A;  3CR5 X;  1WRL A;  2JWW A;  2LMU A;  1ALW A;  1JF0 A;  1VRK A;  1XA5 A;  3NSO A;  5G08 A;  2K7D A;  1JBA A;  2GGM A;  4MSP A;  1B1G A;  2AMI A;  2Q91 A;  1ZUZ A;  1NSH A;  1SBJ A;  4MBE A;  3WXA A;  4M2P A;  1YVH A;  1L7Z A;  2O5G A;  1MQ1 A;  2CBL A;  1QX7 A;  2F3Y A;  2BL0 C;  3LCP C;  2AUC A;  1SPY A;  2VRG A;  1ZFS A;  2E6W A;  1LIN A;  1J1E A;  1XO5 A;  2SCP A;  1DVI A;  1M39 A;  1KFX S;  1S5G Z;  3BUN B;  2BE6 A;  3HCM A;  1C7V A;  3PN7 B;  3SG4 A;  3GOF A;  1QAT A;  3VRN A;  2JNF A;  4OCI A;  2OTG B;  1BR4 B;  3O78 A;  1YVL A;  3E3R A;  4HRE E;  1DJX A;  1N65 A;  2ISD A;  4HSZ A;  5ER5 A;  2K7C A;  3CGA A;  1ZAC A;  2BKH B;  1NCY A;  1UHN A;  2MAZ A;  1KK8 C;  1XVJ A;  4GFT A;  1CMG A;  1DGV A;  2Y5I A;  1IJ6 A;  2F3Z A;  4OV2 A;  4PE4 A;  2GV5 A;  1F4Q A;  4MLW A;  5AEQ A;  4A4C A;  4XJK B;  1CLL A;  1OMR A;  1U5I B;  1OQP A;  4CLN A;  4JQ0 D;  2TN4 A;  3I5I B;  1K9U A;  1FI6 A;  4CFR A;  2FJU B;  2MLE C;  4U8D A;  2ZN8 A;  2CCM A;  3DVK A;  1EG3 A;  2LP3 A;  3VGO A;  1OOJ A;  1FBV A;  1B47 A;  2K7O A;  3FWC A;  4QJ3 B;  3IQO A;  2QAC A;  4XJK A;  1U5I A;  2KFF A;  3TZ1 A;  1CM4 A;  2H2K A;  2R2I A;  1DJG A;  1YX7 A;  2PAS A;  1K8U A;  1AUI B;  2PSR A;  1A75 B;  3I5F B;  5HKY A;  3SG5 A;  4YGE B;  2LLU A;  4YGC B;  3PM8 A;  4DS7 A;  5CSI A;  1M46 A;  3PN7 C;  2LMT A;  1B8L A;  4F0Z B;  3BUM B;  1KFU S;  1DF0 A;  3K21 A;  3AAJ A;  1XFY O;  1A75 A;  2OTG C;  2PAL A;  3OX6 A;  2WND A;  5AER A;  2SAS A;  4D1E A;  5I2O A;  1YTZ C;  5BPJ A;  1KK7 Z;  2Q4U A;  3A8R A;  2KI6 D;  1J7Q A;  4I5L B;  2L5X B;  2V53 A;  2JRF A;  4TNC A;  4C0L A;  1S6J A;  2MHH A;  2WCF A;  3BXK A;  2HPS A;  4DIR A;  1NWD A;  2KI6 C;  2L2E A;  2JT0 A;  2MJW B;  3CR2 A;  1YUR A;  3I5I C;  2JTT A;  2FOT A;  1EG4 A;  2RGI A;  3JVT B;  3EK8 A;  3FWB A;  1J55 A;  2BCX A;  1UHH A;  1UUS A;  1YRT B;  1S1E A;  2FCE A;  3C1V A;  1BOD A;  1E8A A;  1CTR A;  2DOQ A;  2NCP A;  3DF0 A;  1MUX A;  3GK4 X;  4NDC A;  1CLM A;  3SG6 A;  3ZNI A;  1G33 A;  1DJI A;  3I5F C;  2NLN A;  3EVR A;  4HRH A;  1GJY A;  1SL7 A;  2MLF C;  4QJ4 B;  1NPQ A;  1QVI Z;  1QTX A;  1RK9 A;  5KSZ A;  1LXF C;  1KQM B;  1XFX O;  1BLQ A;  1SYM A;  1UP5 A;  1DGU A;  5JJG A;  2AAO A;  1JC2 A;  1IH0 A;  4YBH B;  1YX8 A;  4GAO A;  1YUU A;  1EH2 A;  2K2F A;  2LE9 B;  3CS1 A;  2F8P A;  1WRZ A;  1MXL C;  1WRK A;  5GQQ C;  2KHN A;  4NDB A;  2H61 A;  1LA3 A;  2LHL A;  5HKZ A;  3I5H B;  1OZS A;  5CSJ A;  1ZMZ A;  4GGF A;  3LL8 B;  2LLS A;  1B7T Z;  3O6B A;  4YI9 A;  1XFW O;  1CB1 A;  4C0J A;  1K2H A;  1SK6 D;  5IBW A;  2JZI A;  5K89 A;  1KQV A;  1YRU B;  2BBM A;  4GNK B;  4N1G A;  1FW4 A;  4USL A;  1MF8 B;  1Q80 A;  5D69 A;  3LK0 A;  1PSR A;  2LAN A;  3JVT C;  1JSA A;  1ODB A;  2CNP A;  2F33 A;  2M49 B;  3AKA A;  4I5N B;  3VRR A;  2F2O A;  2EGD A;  3QRX A;  3BYA A;  4OVN F;  1X02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...