3QRXA

Chlamydomonas reinhardtii centrin bound to melittin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
VGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKMGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrin
publication title The structure, molecular dynamics, and energetics of centrin-melittin complex.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Metal binding protein/toxin
total genus 49
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3qrxA02
1SL8A 2M97A 1K96A 2KI6D 4ZCVA 1WY9A 3LLEA 1FW4A 1TNQA 4E68A 2L0PA 1IWQA 4WQ3A 1E8AA 3LK0A 3SG7A 1JF2A 1A29A 3I5HB 2JWWA 4GGFA 4OV2A 2JT3A 4XJKA 1TTXA 1ALWA 1KSOA 5HLVA 3E3RA 1NIWA 1X02A 2AAOA 2EC6C 1DVIA 4PCWA 1NSHA 1S5GZ 1TRFA 4QJ4B 1CLLA 3BUWB 1MXLC 1SR6B 4GPLB 4PDZA 1LKJA 2H61C 3H4SE 2H61A 2F3ZA 1KFXL 2NLNA 2MLEC 4HREE 5IBWA 1S6IA 4BY4A 1MWNA 1TOPA 4OR9B 4JWQA 4USLA 1KK8B 1QVIY 5AFPA 3GK4X 4A4CA 1QVIZ 3ZNIA 4DIRA 2OS8B 1M45A 1V1FA 3PALA 3QRXA 3KPXA 2IS9A 3SG5A 2Q4UA 5K89A 2KSPA 2AMIA 1AK8A 2BL0B 1M31A 1CDPA 1CKKA 5ER5A 3EK7A 4CIDA 3NSOA 1UHHA 3VGOA 1AP4A 1OSAA 1IG5A 2KQ6A 1CNPA 4MLWA 1SR6C 3K21A 4YBHB 3AAKA 1NWDA 2OPOA 3HX4A 1IKUA 1TCFA 2K7DA 2GGZA 1ALVA 1ZFSA 2LUCA 4NQGA 1UP5A 1DJXA 2Q91A 3GK1A 3KHEA 4M2PA 1KK8C 1OE9B 1EG4A 1CLBA 4MRXA 1F4QA 4UPGA 2KYCA 1JC2A 1BT6A 2BBNA 1J7PA 1XA5A 2EHBA 4AQIA 1H8BA 1DF0B 5CPVA 1QTXA 1RECA 3FWCA 2LLUA 1HT9A 1LA0A 2HPSA 3FIAA 4HRHA 5I8NA 3WHUB 3BUNB 1EH2A 4R1EA 3EKHA 4I5LB 2Y1MA 2O60A 2BKIB 3CR2A 2LVIA 1CM4A 4JPZB 1IJ5A 1W7JB 2KAYA 3OB2B 3TDZA 2LANA 1JF0A 1TNPA 5J3XA 1SL9A 5HKYA 2KNEA 1Y1UA 4MRYA 1UHJA 2JOJA 4PE4A 2JTZA 2Y1NA 2KGRA 3PM8A 1C07A 1TIZA 1PVAA 2HF5A 5HLOA 3D0YB 2JT8A 1K9KA 3BXKA 4IL1A 1BODA 1NX3A 1UUSA 3JTDB 3CGAA 2M1UA 3BUOB 5CSNA 3BOWB 3I5IC 4DRWA 3CZTX 1YUTA 1S6JA 2LLSA 2BECA 2WCFA 1G8IA 4PHNA 2PASA 4HSZA 5AERA 2D8NA 1R6PA 1U5IB 2LC5A 1AUIB 1DJHA 3OX5A 4FTGA 2FCEA 3TUYC 2KAVA 1S36A 4WRIA 1QJTA 2F3YA 3EK8A 2CT9A 1J7QA 1A75A 5I2QA 1TNWA 2FCDA 2WORA 1B4CA 1DJGA 1EXRA 3CLNA 1EL4A 1XFWO 1FBVA 1UHNA 4PE0A 1G33A 3KF9A 3SJSA 4OKHA 4XJKB 3A8RA 2G9BA 1KSMA 3OB1B 2AUCA 1XYDA 2EC6B 1KFXS 1QV1A 2KOTA 1DJWA 2BCBA 3AKBA 3JVTC 4YI8A 2ZRSA 4MZLA 3BYAA 4FQOA 1M46A 1G4YR 1ZMZA 2JXLA 2L4HA 4ORBB 1RWYA 1CDMA 1F8HA 3SG6A 1CB1A 1F55A 1M63B 2LAPA 1KK7Y 2K7CA 4PHMA 2JULA 2KDHA 1KK7Z 1SNLA 1B8CA 1QIWA 3EVUA 4ORCB 4L9MA 1QX7A 2PVBA 4OCIA 2KBMA 2WOSA 1K93D 1M39A 2L50A 2L2EA 1GGZA 1OMRA 4GGFC 1B7TY 3VRRA 1B7TZ 1FI6A 3RLZA 3SG2A 1EJ3A 4YGCB 1YX8A 1N0YA 3SIBA 2LM5A 2M7LA 1IQ3A 1Y0VH 4A4BA 2BBMA 2JRFA 2JNFA 1F71A 1MXEA 2KFGA 4YI9A 1J7OA 2QACA 3O2PA 1F4OA 1CMFA 1JFJA 4QJ3B 2MBXA 1SYMA 5PALA 1NX2A 4ICBA 2HQWA 1FPWA 1SW8A 1SY9A 3TZ1A 1Q80A 3EVRA 3PN7B 4U8DA 2BCAA 1PVBA 1SCMC 1SRAA 1DTLA 1CTRA 1NUBA 2JT0A 1CM1A 2MRDA 2BE4A 1FF1A 1KQMC 1AJ5A 1SKTA 3CR4X 5JOLA 1DGVA 2R2IA 1SK6D 2KQYA 1WRZA 1K9PA 1JSAA 2K7OA 1DGUA 2F8PA 2LHIA 2Y5IA 3A4UB 4M2OA 4AOMA 2LLTA 1SPYA 2CXJA 2ZRTA 2CNPA 3DVMA 4MSPA 4ZCUA 1NYAA 1DT7B 2K8MB 2ZFDA 1B9AA 1BMOA 1TNXA 1YTZC 2BKHB 3OHMB 2KAXA 3PN7C 1KCYA 4BY5A 3I5IB 1Y1XA 3TS5B 3F45A 4MZKA 3NSLA 2G2BA 1B8LA 2M1KB 1BR1B 2MLFC 4GFTA 1WRKA 4MVFA 3VRPA 2KI4B 1BR4B 2LHLA 2PRUA 3IF7A 1OZOA 5B8IB 4I5NB 3TUYB 1KFUL 2ZNEA 1JWDA 2L4IA 5D7FA 1K94A 2HETA 3VRQA 2I18A 4CFQA 4C0KA 2LP2A 1A75B 1UHIA 1YR5A 1LXFC 2JU0A 1QV0A 4MBEA 2NCPA 4MZJA 4C0JA 4CFRA 3BQ3A 4P2YB 1QASA 2WC8A 1CFPA 1XFUO 3LCPC 2K7BA 1NP8A 5CSFA 3DF0B 3LL8B 2L5XB 3AKAA 1WDCB 1YVLA 1NPQA 2K2FA 1A2XA 2JPTA 2BE6A 3TS5C 3JVTB 1QXPA 4NDBA 2LP3A 4QJ5B 1BU3A 1XVJA 2JC2A 4I5KA 5F6TA 1YURA 5HKZA 2KI4C 2LMTA 1B8RA 1MUXA 1GGWA 1W7IB 2M8UA 2ZN8A 1WLZA 1NCYA 4D1EA 4ETOA 1YVHA 3VRNA 1B1GA 2CTNA 1JFKA 2NXQA 5TNCA 2M3WA 4PHJA 3DVEA 3LK1A 1DJYA 5KTYA 1OMVA 1FI5A 2JTTA 2SASA 1DF0A 2JQ6A 2KFFA 4YRUA 3BUMB 4YGBB 5DKRA 1N2DA 4GNKB 4N1FA 5CSIA 1OOJA 3VROA 1OMDA 2BCXA 1A4PA 1OQPA 4P5OE 4PHKA 3WHTB 1B47A 2PMYA 1WDCC 2EGDA 2E6WA 1F70A 2LCPA 3C1VA 4YGEB 2I7AA 3MSEB 4C0LA 3CTNA 1MHOA 1XK4A 1R2UA 3EK4A 4GGNA 4Q04A 5HKWA 4GUKA 1K95A 2M49B 1VRKA 3O78A 2GGMA 2CCMA 1ZOTB 1PULA 2MA2A 1C7WA 2L51A 2QPTA 1QIVA 5CSJA 2KBIA 2ZN9A 4MEWA 5BPJA 2ZKMX 4WQ2A 2JZIA 1IH0A 2COLB 1SCMB 3WNXB 2F33A 4I5JA 5HYDA 2F2PA 1KQMB 2M7NA 1BLQA 3GOFA 2CBLA 3OX6A 2M9GA 1CMGA 2M0RA 1BG1A 3CWGA 4PE7A 5FYXA 2MHHA 4JQ0D 5KSZA 3I5FC 4DUQA 2GV5A 2I94A 1S1EA 1IJ6A 1KWOC 3IQQA 4AQJA 4NDCA 2L98A 1MR8A 1NCZA 1SMGA 2V53A 2Y4QA 3CR5X 2K2AA 1IRJA 2KFHA 3D10A 1BJFA 1YRTB 3OP0A 5G08A 3O4YA 4DCKA 3NSIA 5I2LA 1S6CA 1CFFA 2RGIA 1L2OC 3PATA 4PALA 4XYNA 5D69A 1S5GY 1KFUS 2LE9B 1ODBA 2PSRA 1QX2A 1TCOB 1L7ZA 2A4JA 1JBAA 2KHNA 1RJVA 1UURA 4N1GA 1HQVA 2DOQA 2MAZA 3EVVA 1JUOA 3DVKA 3ZWHA 1BOCA 2NCOA 5AEQA 1QATA 1KQVA 4CPVA 1UHKA 4GAOA 3DVJA 2PALA 1IQ5A 1MQ1A 3M0WA 2LMVA 2M29A 2JNXA 3I5HC 5I2OA 1ZACA 1RFJA 2K61A 2I2RE 3GK2A 2LVVA 3SIAA 1PK0D 2F2OA 4N5XA 1RROA 2B1UA 2VRGA 1AVSA 1LA3A 2LUXA 2O5GA 1DJZA 1OZSA 1CDNA 1K9UA 1RK9A 1Y1AA 4NDDA 2LNKA 1NCXA 2KYFA 1NX0A 4HRGA 4MN0A 1SL7A 1TN4A 1K8UA 1PALA 2E30A 2FJUB 2OS8C 1SBJA 2FOTA 5AXIA 1XFXO 2MJWB 3PSRA 2K0JA 1PSRA 4GBAA 3RM1A 4TNCA 4M2QA 5AANA 2BL0C 1C7VA 1QS7A 1S26D 1K2HA 3O6BA 4PE1A 1CDLA 1V1GA 4OVNF 2LVKA 3BUXB 2LMUA 1QLKA 1WLMA 1IGVA 1J7RA 1XFYO 1CLMA 2TN4A 1YUSA 3ICBA 1YRUB 5ER4X 1XFVO 1DJIA 1QLSA 1ZUZA 2ISDA 1PSBA 2OTGB 1YUUA 3PFVA 1YX7A 1CFDA 1S3PA 1WRLA 2JXCA 3CS1A 4YGAA 1F54A 5DKNA 1UWOA 2KI6C 2ZNDA 4F0ZB 1GQMA 3TDUA 3NXAA 3NSKA 1XFZO 3EKJA 2HQ8A 1A03A 3I5GB 2SCPA 3I5FB 1XK4C 4YGDB 1DMOA 2KGBC 2WCEA 3KEVA 2P6BB 1BF5A 1KWOB 1LVCD 3FWBA 3DD4A 1AJ4A 1H4BA 1J1DA 5DKQA 1Y6WA 4CLNA 3SG3A 5GQQC 5JJGA 3D0YA 1GJYA 1PRWA 3PLFB 1AHRA 1J1EA 3AAJA 3TDIA 1NX1A 1MF8B 1N65A 2WNDA 3WXAA 4DS7A 1L2OB 3IQOA 1K90D 1LINA 2H2KA 2OTGC 3DF0A 3FS7A 3JTDC 3KO0A 1CFCA 2WCBA 3BOWA 1J55A 1QX5B 3SG4A 2LV7A 1D1OA 1SCVA 1XO5A 5KU1A 2NZ0A 3HCMA 4ORAB 1EG3A 1U5IA 1RTP1 2LVJA 3I5GC
chains in the Genus database with same CATH superfamily
1SL8A 2M97A 2WCJA 1K96A 2KI6D 4ZCVA 1WY9A 3LLEA 1FW4A 1TNQA 4E68A 2L0PA 1IWQA 4WQ3A 1E8AA 3LK0A 3SG7A 1JF2A 1A29A 3I5HB 2JWWA 4GGFA 4OV2A 2JT3A 4XJKA 1TTXA 1ALWA 1KSOA 5HLVA 3E3RA 1NIWA 1X02A 2AAOA 2EC6C 1DVIA 4PCWA 1NSHA 1S5GZ 1TRFA 5FI7A 4QJ4B 1CLLA 3BUWB 1MXLC 1SR6B 4GPLB 4IJ7A 1LKJA 2H61C 4PDZA 3H4SE 2H61A 2F3ZA 1KFXL 2NLNA 2MLEC 4HREE 5IBWA 1S6IA 3UNWA 4BY4A 1MWNA 1TOPA 4OR9B 4JWQA 4USLA 1KK8B 2L5YA 1QVIY 5AFPA 3GK4X 4A4CA 1QVIZ 3ZNIA 4DIRA 2OS8B 1M45A 1V1FA 3PALA 3QRXA 4KYNA 3KPXA 2IS9A 3SG5A 2Q4UA 5K89A 5FI2A 2KSPA 3CZ0A 2AMIA 1AK8A 2BL0B 1M31A 1CDPA 3FE6A 1CKKA 5ER5A 3EK7A 3R1PA 4CIDA 3NSOA 1UHHA 3VGOA 1AP4A 1OSAA 1IG5A 2KQ6A 1CNPA 4MLWA 1SR6C 4PT1A 4JKTA 3K21A 4YBHB 3AAKA 1NWDA 2OPOA 3HX4A 1IKUA 1TCFA 2K7DA 2GGZA 3DYEA 1ALVA 1ZFSA 2LUCA 4NQGA 1UP5A 1DJXA 1XFRA 2Q91A 3GK1A 3KHEA 3Q8IA 4M2PA 1KK8C 1OE9B 1EG4A 1C3YA 4MRXA 3L4LA 1CLBA 1F4QA 4UPGA 2KYCA 1JC2A 1BT6A 2BBNA 1J7PA 1XA5A 2EHBA 4AQIA 1H8BA 1DF0B 5CPVA 1QTXA 1RECA 1TWOA 2LLUA 3FWCA 1HT9A 1LA0A 2HPSA 3FIAA 4HRHA 5I8NA 3WHUB 3BUNB 1EH2A 4R1EA 3EKHA 4I5LB 2Y1MA 2O60A 2BKIB 3CR2A 2LVIA 1CM4A 4JPZB 1IJ5A 1W7JB 2KAYA 3CABA 3OB2B 5FI6A 3TDZA 2LANA 1JF0A 1TNPA 5J3XA 1SL9A 5HKYA 2KNEA 1Y1UA 4MRYA 1UHJA 2JOJA 4PE4A 2L2CA 2JTZA 2Y1NA 2KGRA 3B6XA 3PM8A 1TIZA 1PVAA 2HF5A 5HLOA 1C07A 3D0YB 2JT8A 1K9KA 3FE8A 3BXKA 4IL1A 1BODA 1NX3A 1UUSA 1DC1A 3JTDB 3CGAA 2M1UA 3BUOB 5CSNA 3BOWB 3I5IC 3S0GA 4DRWA 3CZTX 1YUTA 1S6JA 2BAPA 2BECA 2LLSA 1G8IA 2WCFA 4PHNA 2PASA 4F7FA 4HSZA 5AERA 2D8NA 1R6PA 1U5IB 2LC5A 1AUIB 1DJHA 2KLDA 3FE9A 3OX5A 2WCLA 4FTGA 2FCEA 3TUYC 2KAVA 1S36A 4WRIA 1QJTA 2F3YA 3EK8A 2CT9A 1J7QA 3B88A 1A75A 5I2QA 1TNWA 2FCDA 1OOIX 2WORA 1B4CA 1DJGA 1EXRA 3CLNA 4FQTA 1EL4A 1XFWO 1FBVA 1UHNA 4PE0A 1G33A 3KF9A 3S0DA 4OKHA 4XJKB 3SJSA 3A8RA 2G9BA 1KSMA 3QMEA 3OB1B 3BFHA 5HL1A 2AUCA 1XYDA 2EC6B 1KFXS 1QV1A 2KOTA 1DJWA 2BCBA 3AKBA 3JVTC 4YI8A 2ZRSA 4MZLA 3BYAA 4FQOA 3R72A 1M46A 1G4YR 3K1EA 1ZMZA 2JXLA 2L4HA 4ORBB 1RWYA 1CDMA 1F8HA 3SG6A 1CB1A 3D78A 1F55A 1M63B 2LAPA 1KK7Y 2K7CA 4PHMA 2JULA 2KDHA 1KK7Z 1SNLA 1B8CA 1QIWA 3EVUA 4ORCB 4L9MA 1QX7A 2PVBA 4OCIA 2KBMA 2WOSA 1K93D 1M39A 2L50A 2L2EA 1GGZA 1OMRA 1P28A 2BNXA 3PM2A 1B7TY 4GGFC 3VRRA 1B7TZ 1FI6A 3BJHA 3RLZA 3SG2A 1EJ3A 4YGCB 1YX8A 1N0YA 3SIBA 2LM5A 2M7LA 1IQ3A 1Y0VH 4A4BA 2BBMA 2JRFA 2JNFA 1F71A 1MXEA 2K60A 3D74A 2P70A 2KFGA 4YI9A 1J7OA 2QACA 3O2PA 1F4OA 3R1VA 1CMFA 1JFJA 4QJ3B 2MBXA 1SYMA 3CYZA 5PALA 1NX2A 4ICBA 2HQWA 1FPWA 1SW8A 1SY9A 3TZ1A 1Q80A 3EVRA 3PN7B 4U8DA 1OOGA 1PVBA 2BCAA 3R1OA 1SCMC 1SRAA 1DTLA 1CTRA 1NUBA 2JT0A 1CM1A 3NHIA 2MRDA 2BE4A 2QEHA 1FF1A 1KQMC 3IVTA 1SSEB 1AJ5A 1SKTA 3CR4X 5JOLA 1DGVA 2R2IA 1SK6D 4DS7A 1OW4A 2KQYA 1WRZA 1K9PA 1JSAA 2K7OA 1DGUA 2F8PA 2LHIA 2Y5IA 3A4UB 3OBVA 4M2OA 3DY9A 2WCKA 2LLTA 4AOMA 1SPYA 2CXJA 2ZRTA 2CNPA 3DVMA 4MSPA 4ZCUA 1NYAA 1DT7B 2K8MB 2ZFDA 1B9AA 1BMOA 1TNXA 1YTZC 2BKHB 3OHMB 2KAXA 3PN7C 1KCYA 4BY5A 3I5IB 1Y1XA 3TS5B 3F45A 4MZKA 3NSLA 2G2BA 1B8LA 2M1KB 2QEBA 1BR1B 2MLFC 5EL2A 4GFTA 1WRKA 4MVFA 3VRPA 2KI4B 1BR4B 2LHLA 2PRUA 3IF7A 1OZOA 5B8IB 4I5NB 3TUYB 1KFUL 2ZNEA 1JWDA 2L4IA 5D7FA 1K94A 2HETA 3VRQA 3D77A 2I18A 4INWA 4CFQA 1W9ZA 4C0KA 2LP2A 1A75B 1UHIA 1YR5A 1LXFC 2JU0A 2PQLA 1QV0A 4MBEA 2NCPA 4MZJA 4C0JA 4CFRA 3BQ3A 4P2YB 1QASA 2WC8A 1CFPA 1XFUO 3LCPC 2K7BA 1NP8A 2P71A 3B7AA 2GTEA 5CSFA 3DF0B 3LL8B 2L5XB 3AKAA 3CZ1A 3N7HA 3VB1A 1WDCB 1YVLA 1NPQA 2K2FA 1A2XA 2JPTA 2BE6A 3TS5C 3JVTB 3S0FA 1LS8A 1QXPA 2LP3A 4NDBA 1BU3A 1XVJA 2JC2A 4QJ5B 4I5KA 5F6TA 1YURA 5HKZA 2KI4C 2LMTA 1B8RA 1MUXA 1GGWA 1W7IB 2M8UA 2ZN8A 1WLZA 1NCYA 3BFBA 4D1EA 4ETOA 1DEKA 1YVHA 3VRNA 1B1GA 2CTNA 1OOFA 1JFKA 2NXQA 5TNCA 2M3WA 4PHJA 3DVEA 3LK1A 1DJYA 5KTYA 1OMVA 1FI5A 2JTTA 2SASA 1DF0A 2JQ6A 2KFFA 4YRUA 3BUMB 4YGBB 5DKRA 1N2DA 4GNKB 4N1FA 1DQEA 1OOJA 5CSIA 3VROA 1OMDA 2BCXA 1A4PA 1OQPA 4P5OE 4PHKA 3WHTB 1B47A 2PMYA 1WDCC 2EGDA 2E6WA 1F70A 2LCPA 3C1VA 4YGEB 2I7AA 3MSEB 4C0LA 2WCHA 3CTNA 1MHOA 1XK4A 1R2UA 3EK4A 4GGNA 4Q04A 5HKWA 4GUKA 1K95A 2M49B 1VRKA 3O78A 2GGMA 1ORGA 2CCMA 1OOHA 1ZOTB 3WXAA 1PULA 2MA2A 1C3ZA 1C7WA 2L51A 2QPTA 1QIVA 5CSJA 2KBIA 2ZN9A 3PJIA 4MEWA 5BPJA 2ZKMX 4WQ2A 2JZIA 4OZDA 1IH0A 2COLB 1SCMB 3WNXB 2F33A 2JPOA 4I5JA 5HYDA 2F2PA 1KQMB 3L47A 2M7NA 1BLQA 3GOFA 2CBLA 3OX6A 1TUJA 2KPHA 2M0RA 2M9GA 1BG1A 1CMGA 3CWGA 4PE7A 5FYXA 2MHHA 4JQ0D 5KSZA 3I5FC 3NHTA 4DUQA 2GV5A 2I94A 1S1EA 1IJ6A 1KWOC 3IQQA 4AQJA 4NDCA 2L98A 3D75A 1MR8A 2KLEA 1NCZA 1SMGA 2V53A 2Y4QA 3CR5X 2K2AA 1IRJA 2KFHA 3D10A 1BJFA 2FJYA 1YRTB 3OP0A 5G08A 2QEOA 3O4YA 4DCKA 3NSIA 5I2LA 1S6CA 1CFFA 2RGIA 2WCMA 1L2OC 3PATA 4PALA 4XYNA 5D69A 1S5GY 1KFUS 2LE9B 1ODBA 2PSRA 1QX2A 1TCOB 1L7ZA 2A4JA 2QDIA 3V2LA 3S0EA 1JBAA 2KHNA 1RJVA 1UURA 4N1GA 2QEVA 1HQVA 2DOQA 2MAZA 3EVVA 1JUOA 3UO9A 3DVKA 3ZWHA 1BOCA 1DELA 2NCOA 5AEQA 1QATA 1KQVA 4CPVA 1UHKA 4GAOA 3DVJA 2PALA 1IQ5A 1MQ1A 3M0WA 2LMVA 2M29A 3D73A 2JNXA 3I5HC 5I2OA 1ZACA 1RFJA 2K61A 2I2RE 2ERBA 3GK2A 3S0AA 2LVVA 3SIAA 1PK0D 2F2OA 4N5XA 1RROA 3SS3A 3EG5B 2B1UA 2VRGA 3SS4A 1AVSA 1LA3A 2LUXA 2O5GA 1DJZA 1OZSA 2WC6A 1K9UA 1RK9A 1Y1AA 1CDNA 4NDDA 2LNKA 2H8VA 1GM0A 1NCXA 2KYFA 1NX0A 1Z2CB 4HRGA 4MN0A 1SL7A 3O4XA 1TN4A 1K8UA 1PALA 3S0BA 1QWVA 2E30A 1IIOA 2FJUB 2OS8C 1SBJA 2FOTA 5AXIA 1XFXO 3OGNA 2MJWB 3PSRA 2K0JA 1PSRA 4GBAA 3RM1A 4TNCA 4M2QA 5AANA 2BL0C 5D3OA 1C7VA 1QS7A 1S26D 1K2HA 3O6BA 2PYQA 4PE1A 1CDLA 1V1GA 3L4AA 4OVNF 2LVKA 4JD9A 3DZTA 3BUXB 2LMUA 1QLKA 2WC5A 1T14A 1WLMA 1IGVA 1J7RA 1XFYO 1CLMA 2TN4A 1YUSA 3ICBA 1YRUB 1TUZA 5ER4X 1XFVO 1DJIA 1QLSA 1ZUZA 2ISDA 1PSBA 2OTGB 3B86A 1YUUA 3PFVA 1YX7A 1CFDA 1S3PA 1WRLA 2JXCA 3CS1A 4YGAA 3SS5A 1F54A 5DKNA 1UWOA 2KI6C 2ZNDA 3CDNA 3D76A 4F0ZB 1GQMA 3TDUA 3NXAA 3NSKA 1XFZO 3EKJA 2HQ8A 1A03A 3I5GB 2SCPA 3I5FB 1XK4C 4YGDB 1DMOA 2KGBC 2WCEA 3KEVA 2P6BB 1BF5A 1Z4HA 1KWOB 3RZSA 1LVCD 3FWBA 3DD4A 1AJ4A 5DICA 1J1DA 1H4BA 5DKQA 1Y6WA 3BFAA 5I94A 4CLNA 3SG3A 3CZ2A 5GQQC 5JJGA 3D0YA 1GJYA 1PRWA 3B87A 1AHRA 1J1EA 2YGUA 3AAJA 1NX1A 1MF8B 1N65A 2WNDA 3PLFB 4INXA 1L2OB 3TDIA 3IQOA 1K90D 1LINA 2H2KA 2OTGC 3DF0A 3FS7A 3JTDC 3KO0A 3NGVA 1CFCA 2WCBA 3BOWA 1J55A 1QX5B 3SG4A 2LV7A 1D1OA 1SCVA 1XO5A 5KU1A 2NZ0A 3HCMA 3DXLA 4ORAB 1EG3A 1U5IA 1RTP1 2LVJA 3I5GC
chains in the Genus database with same CATH topology
1SL8A 2M97A 1K96A 2KI6D 4ZCVA 1WY9A 3LLEA 1FW4A 1TNQA 4E68A 2L0PA 1IWQA 4WQ3A 1E8AA 3LK0A 3SG7A 1JF2A 1A29A 3I5HB 2JWWA 4GGFA 4OV2A 2JT3A 4XJKA 1TTXA 1ALWA 1KSOA 5HLVA 3E3RA 1NIWA 1X02A 2AAOA 2EC6C 1DVIA 4PCWA 1NSHA 1S5GZ 1TRFA 4QJ4B 1CLLA 3BUWB 1MXLC 1SR6B 4GPLB 4PDZA 1LKJA 2H61C 3H4SE 2H61A 2F3ZA 1KFXL 2NLNA 2MLEC 4HREE 5IBWA 1S6IA 4BY4A 1MWNA 1TOPA 4OR9B 4JWQA 4USLA 1KK8B 1QVIY 5AFPA 3GK4X 4A4CA 1QVIZ 3ZNIA 4DIRA 2OS8B 1M45A 1V1FA 3PALA 3QRXA 3KPXA 2IS9A 3SG5A 2Q4UA 5K89A 2KSPA 2AMIA 1AK8A 2BL0B 1M31A 1CDPA 1CKKA 5ER5A 3EK7A 4CIDA 3NSOA 1UHHA 3VGOA 1AP4A 1OSAA 1IG5A 2KQ6A 1CNPA 4MLWA 1SR6C 3K21A 4YBHB 3AAKA 1NWDA 2OPOA 3HX4A 1IKUA 1TCFA 2K7DA 2GGZA 1ALVA 1ZFSA 2LUCA 4NQGA 1UP5A 1DJXA 2Q91A 3GK1A 3KHEA 4M2PA 1KK8C 1OE9B 1EG4A 1CLBA 4MRXA 1F4QA 4UPGA 2KYCA 1JC2A 1BT6A 2BBNA 1J7PA 1XA5A 2EHBA 4AQIA 1H8BA 1DF0B 5CPVA 1QTXA 1RECA 3FWCA 2LLUA 1HT9A 1LA0A 2HPSA 3FIAA 4HRHA 5I8NA 3WHUB 3BUNB 1EH2A 4R1EA 3EKHA 4I5LB 2Y1MA 2O60A 2BKIB 3CR2A 2LVIA 1CM4A 4JPZB 1IJ5A 1W7JB 2KAYA 3OB2B 3TDZA 2LANA 1JF0A 1TNPA 5J3XA 1SL9A 5HKYA 2KNEA 1Y1UA 4MRYA 1UHJA 2JOJA 4PE4A 2JTZA 2Y1NA 2KGRA 3PM8A 1C07A 1TIZA 1PVAA 2HF5A 5HLOA 3D0YB 2JT8A 1K9KA 3BXKA 4IL1A 1BODA 1NX3A 1UUSA 3JTDB 3CGAA 2M1UA 3BUOB 5CSNA 3BOWB 3I5IC 4DRWA 3CZTX 1YUTA 1S6JA 2LLSA 2BECA 2WCFA 1G8IA 4PHNA 2PASA 4HSZA 5AERA 2D8NA 1R6PA 1U5IB 2LC5A 1AUIB 1DJHA 3OX5A 4FTGA 2FCEA 3TUYC 2KAVA 1S36A 4WRIA 1QJTA 2F3YA 3EK8A 2CT9A 1J7QA 1A75A 5I2QA 1TNWA 2FCDA 2WORA 1B4CA 1DJGA 1EXRA 3CLNA 1EL4A 1XFWO 1FBVA 1UHNA 4PE0A 1G33A 3KF9A 3SJSA 4OKHA 4XJKB 3A8RA 2G9BA 1KSMA 3OB1B 2AUCA 1XYDA 2EC6B 1KFXS 1QV1A 2KOTA 1DJWA 2BCBA 3AKBA 3JVTC 4YI8A 2ZRSA 4MZLA 3BYAA 4FQOA 1M46A 1G4YR 1ZMZA 2JXLA 2L4HA 4ORBB 1RWYA 1CDMA 1F8HA 3SG6A 1CB1A 1F55A 1M63B 2LAPA 1KK7Y 2K7CA 4PHMA 2JULA 2KDHA 1KK7Z 1SNLA 1B8CA 1QIWA 3EVUA 4ORCB 4L9MA 1QX7A 2PVBA 4OCIA 2KBMA 2WOSA 1K93D 1M39A 2L50A 2L2EA 1GGZA 1OMRA 4GGFC 1B7TY 3VRRA 1B7TZ 1FI6A 3RLZA 3SG2A 1EJ3A 4YGCB 1YX8A 1N0YA 3SIBA 2LM5A 2M7LA 1IQ3A 1Y0VH 4A4BA 2BBMA 2JRFA 2JNFA 1F71A 1MXEA 2KFGA 4YI9A 1J7OA 2QACA 3O2PA 1F4OA 1CMFA 1JFJA 4QJ3B 2MBXA 1SYMA 5PALA 1NX2A 4ICBA 2HQWA 1FPWA 1SW8A 1SY9A 3TZ1A 1Q80A 3EVRA 3PN7B 4U8DA 2BCAA 1PVBA 1SCMC 1SRAA 1DTLA 1CTRA 1NUBA 2JT0A 1CM1A 2MRDA 2BE4A 1FF1A 1KQMC 1AJ5A 1SKTA 3CR4X 5JOLA 1DGVA 2R2IA 1SK6D 2KQYA 1WRZA 1K9PA 1JSAA 2K7OA 1DGUA 2F8PA 2LHIA 2Y5IA 3A4UB 4M2OA 4AOMA 2LLTA 1SPYA 2CXJA 2ZRTA 2CNPA 3DVMA 4MSPA 4ZCUA 1NYAA 1DT7B 2K8MB 2ZFDA 1B9AA 1BMOA 1TNXA 1YTZC 2BKHB 3OHMB 2KAXA 3PN7C 1KCYA 4BY5A 3I5IB 1Y1XA 3TS5B 3F45A 4MZKA 3NSLA 2G2BA 1B8LA 2M1KB 1BR1B 2MLFC 4GFTA 1WRKA 4MVFA 3VRPA 2KI4B 1BR4B 2LHLA 2PRUA 3IF7A 1OZOA 5B8IB 4I5NB 3TUYB 1KFUL 2ZNEA 1JWDA 2L4IA 5D7FA 1K94A 2HETA 3VRQA 2I18A 4CFQA 4C0KA 2LP2A 1A75B 1UHIA 1YR5A 1LXFC 2JU0A 1QV0A 4MBEA 2NCPA 4MZJA 4C0JA 4CFRA 3BQ3A 4P2YB 1QASA 2WC8A 1CFPA 1XFUO 3LCPC 2K7BA 1NP8A 5CSFA 3DF0B 3LL8B 2L5XB 3AKAA 1WDCB 1YVLA 1NPQA 2K2FA 1A2XA 2JPTA 2BE6A 3TS5C 3JVTB 1QXPA 4NDBA 2LP3A 4QJ5B 1BU3A 1XVJA 2JC2A 4I5KA 5F6TA 1YURA 5HKZA 2KI4C 2LMTA 1B8RA 1MUXA 1GGWA 1W7IB 2M8UA 2ZN8A 1WLZA 1NCYA 4D1EA 4ETOA 1YVHA 3VRNA 1B1GA 2CTNA 1JFKA 2NXQA 5TNCA 2M3WA 4PHJA 3DVEA 3LK1A 1DJYA 5KTYA 1OMVA 1FI5A 2JTTA 2SASA 1DF0A 2JQ6A 2KFFA 4YRUA 3BUMB 4YGBB 5DKRA 1N2DA 4GNKB 4N1FA 5CSIA 1OOJA 3VROA 1OMDA 2BCXA 1A4PA 1OQPA 4P5OE 4PHKA 3WHTB 1B47A 2PMYA 1WDCC 2EGDA 2E6WA 1F70A 2LCPA 3C1VA 4YGEB 2I7AA 3MSEB 4C0LA 3CTNA 1MHOA 1XK4A 1R2UA 3EK4A 4GGNA 4Q04A 5HKWA 4GUKA 1K95A 2M49B 1VRKA 3O78A 2GGMA 2CCMA 1ZOTB 1PULA 2MA2A 1C7WA 2L51A 2QPTA 1QIVA 5CSJA 2KBIA 2ZN9A 4MEWA 5BPJA 2ZKMX 4WQ2A 2JZIA 1IH0A 2COLB 1SCMB 3WNXB 2F33A 4I5JA 5HYDA 2F2PA 1KQMB 2M7NA 1BLQA 3GOFA 2CBLA 3OX6A 2M9GA 1CMGA 2M0RA 1BG1A 3CWGA 4PE7A 5FYXA 2MHHA 4JQ0D 5KSZA 3I5FC 4DUQA 2GV5A 2I94A 1S1EA 1IJ6A 1KWOC 3IQQA 4AQJA 4NDCA 2L98A 1MR8A 1NCZA 1SMGA 2V53A 2Y4QA 3CR5X 2K2AA 1IRJA 2KFHA 3D10A 1BJFA 1YRTB 3OP0A 5G08A 3O4YA 4DCKA 3NSIA 5I2LA 1S6CA 1CFFA 2RGIA 1L2OC 3PATA 4PALA 4XYNA 5D69A 1S5GY 1KFUS 2LE9B 1ODBA 2PSRA 1QX2A 1TCOB 1L7ZA 2A4JA 1JBAA 2KHNA 1RJVA 1UURA 4N1GA 1HQVA 2DOQA 2MAZA 3EVVA 1JUOA 3DVKA 3ZWHA 1BOCA 2NCOA 5AEQA 1QATA 1KQVA 4CPVA 1UHKA 4GAOA 3DVJA 2PALA 1IQ5A 1MQ1A 3M0WA 2LMVA 2M29A 2JNXA 3I5HC 5I2OA 1ZACA 1RFJA 2K61A 2I2RE 3GK2A 2LVVA 3SIAA 1PK0D 2F2OA 4N5XA 1RROA 2B1UA 2VRGA 1AVSA 1LA3A 2LUXA 2O5GA 1DJZA 1OZSA 1CDNA 1K9UA 1RK9A 1Y1AA 4NDDA 2LNKA 1NCXA 2KYFA 1NX0A 4HRGA 4MN0A 1SL7A 1TN4A 1K8UA 1PALA 2E30A 2FJUB 2OS8C 1SBJA 2FOTA 5AXIA 1XFXO 2MJWB 3PSRA 2K0JA 1PSRA 4GBAA 3RM1A 4TNCA 4M2QA 5AANA 2BL0C 1C7VA 1QS7A 1S26D 1K2HA 3O6BA 4PE1A 1CDLA 1V1GA 4OVNF 2LVKA 3BUXB 2LMUA 1QLKA 1WLMA 1IGVA 1J7RA 1XFYO 1CLMA 2TN4A 1YUSA 3ICBA 1YRUB 5ER4X 1XFVO 1DJIA 1QLSA 1ZUZA 2ISDA 1PSBA 2OTGB 1YUUA 3PFVA 1YX7A 1CFDA 1S3PA 1WRLA 2JXCA 3CS1A 4YGAA 1F54A 5DKNA 1UWOA 2KI6C 2ZNDA 4F0ZB 1GQMA 3TDUA 3NXAA 3NSKA 1XFZO 3EKJA 2HQ8A 1A03A 3I5GB 2SCPA 3I5FB 1XK4C 4YGDB 1DMOA 2KGBC 2WCEA 3KEVA 2P6BB 1BF5A 1KWOB 1LVCD 3FWBA 3DD4A 1AJ4A 1H4BA 1J1DA 5DKQA 1Y6WA 4CLNA 3SG3A 5GQQC 5JJGA 3D0YA 1GJYA 1PRWA 3PLFB 1AHRA 1J1EA 3AAJA 3TDIA 1NX1A 1MF8B 1N65A 2WNDA 3WXAA 4DS7A 1L2OB 3IQOA 1K90D 1LINA 2H2KA 2OTGC 3DF0A 3FS7A 3JTDC 3KO0A 1CFCA 2WCBA 3BOWA 1J55A 1QX5B 3SG4A 2LV7A 1D1OA 1SCVA 1XO5A 5KU1A 2NZ0A 3HCMA 4ORAB 1EG3A 1U5IA 1RTP1 2LVJA 3I5GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL8 A;  2M97 A;  1K96 A;  2KI6 D;  4ZCV A;  1WY9 A;  3LLE A;  1FW4 A;  1TNQ A;  4E68 A;  2L0P A;  1IWQ A;  4WQ3 A;  1E8A A;  3LK0 A;  3SG7 A;  1JF2 A;  1A29 A;  3I5H B;  2JWW A;  4GGF A;  4OV2 A;  2JT3 A;  4XJK A;  1TTX A;  1ALW A;  1KSO A;  5HLV A;  3E3R A;  1NIW A;  1X02 A;  2AAO A;  2EC6 C;  1DVI A;  4PCW A;  1NSH A;  1S5G Z;  1TRF A;  4QJ4 B;  1CLL A;  3BUW B;  1MXL C;  1SR6 B;  4GPL B;  4PDZ A;  1LKJ A;  2H61 C;  3H4S E;  2H61 A;  2F3Z A;  1KFX L;  2NLN A;  2MLE C;  4HRE E;  5IBW A;  1S6I A;  4BY4 A;  1MWN A;  1TOP A;  4OR9 B;  4JWQ A;  4USL A;  1KK8 B;  1QVI Y;  5AFP A;  3GK4 X;  4A4C A;  1QVI Z;  3ZNI A;  4DIR A;  2OS8 B;  1M45 A;  1V1F A;  3PAL A;  3QRX A;  3KPX A;  2IS9 A;  3SG5 A;  2Q4U A;  5K89 A;  2KSP A;  2AMI A;  1AK8 A;  2BL0 B;  1M31 A;  1CDP A;  1CKK A;  5ER5 A;  3EK7 A;  4CID A;  3NSO A;  1UHH A;  3VGO A;  1AP4 A;  1OSA A;  1IG5 A;  2KQ6 A;  1CNP A;  4MLW A;  1SR6 C;  3K21 A;  4YBH B;  3AAK A;  1NWD A;  2OPO A;  3HX4 A;  1IKU A;  1TCF A;  2K7D A;  2GGZ A;  1ALV A;  1ZFS A;  2LUC A;  4NQG A;  1UP5 A;  1DJX A;  2Q91 A;  3GK1 A;  3KHE A;  4M2P A;  1KK8 C;  1OE9 B;  1EG4 A;  1CLB A;  4MRX A;  1F4Q A;  4UPG A;  2KYC A;  1JC2 A;  1BT6 A;  2BBN A;  1J7P A;  1XA5 A;  2EHB A;  4AQI A;  1H8B A;  1DF0 B;  5CPV A;  1QTX A;  1REC A;  3FWC A;  2LLU A;  1HT9 A;  1LA0 A;  2HPS A;  3FIA A;  4HRH A;  5I8N A;  3WHU B;  3BUN B;  1EH2 A;  4R1E A;  3EKH A;  4I5L B;  2Y1M A;  2O60 A;  2BKI B;  3CR2 A;  2LVI A;  1CM4 A;  4JPZ B;  1IJ5 A;  1W7J B;  2KAY A;  3OB2 B;  3TDZ A;  2LAN A;  1JF0 A;  1TNP A;  5J3X A;  1SL9 A;  5HKY A;  2KNE A;  1Y1U A;  4MRY A;  1UHJ A;  2JOJ A;  4PE4 A;  2JTZ A;  2Y1N A;  2KGR A;  3PM8 A;  1C07 A;  1TIZ A;  1PVA A;  2HF5 A;  5HLO A;  3D0Y B;  2JT8 A;  1K9K A;  3BXK A;  4IL1 A;  1BOD A;  1NX3 A;  1UUS A;  3JTD B;  3CGA A;  2M1U A;  3BUO B;  5CSN A;  3BOW B;  3I5I C;  4DRW A;  3CZT X;  1YUT A;  1S6J A;  2LLS A;  2BEC A;  2WCF A;  1G8I A;  4PHN A;  2PAS A;  4HSZ A;  5AER A;  2D8N A;  1R6P A;  1U5I B;  2LC5 A;  1AUI B;  1DJH A;  3OX5 A;  4FTG A;  2FCE A;  3TUY C;  2KAV A;  1S36 A;  4WRI A;  1QJT A;  2F3Y A;  3EK8 A;  2CT9 A;  1J7Q A;  1A75 A;  5I2Q A;  1TNW A;  2FCD A;  2WOR A;  1B4C A;  1DJG A;  1EXR A;  3CLN A;  1EL4 A;  1XFW O;  1FBV A;  1UHN A;  4PE0 A;  1G33 A;  3KF9 A;  3SJS A;  4OKH A;  4XJK B;  3A8R A;  2G9B A;  1KSM A;  3OB1 B;  2AUC A;  1XYD A;  2EC6 B;  1KFX S;  1QV1 A;  2KOT A;  1DJW A;  2BCB A;  3AKB A;  3JVT C;  4YI8 A;  2ZRS A;  4MZL A;  3BYA A;  4FQO A;  1M46 A;  1G4Y R;  1ZMZ A;  2JXL A;  2L4H A;  4ORB B;  1RWY A;  1CDM A;  1F8H A;  3SG6 A;  1CB1 A;  1F55 A;  1M63 B;  2LAP A;  1KK7 Y;  2K7C A;  4PHM A;  2JUL A;  2KDH A;  1KK7 Z;  1SNL A;  1B8C A;  1QIW A;  3EVU A;  4ORC B;  4L9M A;  1QX7 A;  2PVB A;  4OCI A;  2KBM A;  2WOS A;  1K93 D;  1M39 A;  2L50 A;  2L2E A;  1GGZ A;  1OMR A;  4GGF C;  1B7T Y;  3VRR A;  1B7T Z;  1FI6 A;  3RLZ A;  3SG2 A;  1EJ3 A;  4YGC B;  1YX8 A;  1N0Y A;  3SIB A;  2LM5 A;  2M7L A;  1IQ3 A;  1Y0V H;  4A4B A;  2BBM A;  2JRF A;  2JNF A;  1F71 A;  1MXE A;  2KFG A;  4YI9 A;  1J7O A;  2QAC A;  3O2P A;  1F4O A;  1CMF A;  1JFJ A;  4QJ3 B;  2MBX A;  1SYM A;  5PAL A;  1NX2 A;  4ICB A;  2HQW A;  1FPW A;  1SW8 A;  1SY9 A;  3TZ1 A;  1Q80 A;  3EVR A;  3PN7 B;  4U8D A;  2BCA A;  1PVB A;  1SCM C;  1SRA A;  1DTL A;  1CTR A;  1NUB A;  2JT0 A;  1CM1 A;  2MRD A;  2BE4 A;  1FF1 A;  1KQM C;  1AJ5 A;  1SKT A;  3CR4 X;  5JOL A;  1DGV A;  2R2I A;  1SK6 D;  2KQY A;  1WRZ A;  1K9P A;  1JSA A;  2K7O A;  1DGU A;  2F8P A;  2LHI A;  2Y5I A;  3A4U B;  4M2O A;  4AOM A;  2LLT A;  1SPY A;  2CXJ A;  2ZRT A;  2CNP A;  3DVM A;  4MSP A;  4ZCU A;  1NYA A;  1DT7 B;  2K8M B;  2ZFD A;  1B9A A;  1BMO A;  1TNX A;  1YTZ C;  2BKH B;  3OHM B;  2KAX A;  3PN7 C;  1KCY A;  4BY5 A;  3I5I B;  1Y1X A;  3TS5 B;  3F45 A;  4MZK A;  3NSL A;  2G2B A;  1B8L A;  2M1K B;  1BR1 B;  2MLF C;  4GFT A;  1WRK A;  4MVF A;  3VRP A;  2KI4 B;  1BR4 B;  2LHL A;  2PRU A;  3IF7 A;  1OZO A;  5B8I B;  4I5N B;  3TUY B;  1KFU L;  2ZNE A;  1JWD A;  2L4I A;  5D7F A;  1K94 A;  2HET A;  3VRQ A;  2I18 A;  4CFQ A;  4C0K A;  2LP2 A;  1A75 B;  1UHI A;  1YR5 A;  1LXF C;  2JU0 A;  1QV0 A;  4MBE A;  2NCP A;  4MZJ A;  4C0J A;  4CFR A;  3BQ3 A;  4P2Y B;  1QAS A;  2WC8 A;  1CFP A;  1XFU O;  3LCP C;  2K7B A;  1NP8 A;  5CSF A;  3DF0 B;  3LL8 B;  2L5X B;  3AKA A;  1WDC B;  1YVL A;  1NPQ A;  2K2F A;  1A2X A;  2JPT A;  2BE6 A;  3TS5 C;  3JVT B;  1QXP A;  4NDB A;  2LP3 A;  4QJ5 B;  1BU3 A;  1XVJ A;  2JC2 A;  4I5K A;  5F6T A;  1YUR A;  5HKZ A;  2KI4 C;  2LMT A;  1B8R A;  1MUX A;  1GGW A;  1W7I B;  2M8U A;  2ZN8 A;  1WLZ A;  1NCY A;  4D1E A;  4ETO A;  1YVH A;  3VRN A;  1B1G A;  2CTN A;  1JFK A;  2NXQ A;  5TNC A;  2M3W A;  4PHJ A;  3DVE A;  3LK1 A;  1DJY A;  5KTY A;  1OMV A;  1FI5 A;  2JTT A;  2SAS A;  1DF0 A;  2JQ6 A;  2KFF A;  4YRU A;  3BUM B;  4YGB B;  5DKR A;  1N2D A;  4GNK B;  4N1F A;  5CSI A;  1OOJ A;  3VRO A;  1OMD A;  2BCX A;  1A4P A;  1OQP A;  4P5O E;  4PHK A;  3WHT B;  1B47 A;  2PMY A;  1WDC C;  2EGD A;  2E6W A;  1F70 A;  2LCP A;  3C1V A;  4YGE B;  2I7A A;  3MSE B;  4C0L A;  3CTN A;  1MHO A;  1XK4 A;  1R2U A;  3EK4 A;  4GGN A;  4Q04 A;  5HKW A;  4GUK A;  1K95 A;  2M49 B;  1VRK A;  3O78 A;  2GGM A;  2CCM A;  1ZOT B;  1PUL A;  2MA2 A;  1C7W A;  2L51 A;  2QPT A;  1QIV A;  5CSJ A;  2KBI A;  2ZN9 A;  4MEW A;  5BPJ A;  2ZKM X;  4WQ2 A;  2JZI A;  1IH0 A;  2COL B;  1SCM B;  3WNX B;  2F33 A;  4I5J A;  5HYD A;  2F2P A;  1KQM B;  2M7N A;  1BLQ A;  3GOF A;  2CBL A;  3OX6 A;  2M9G A;  1CMG A;  2M0R A;  1BG1 A;  3CWG A;  4PE7 A;  5FYX A;  2MHH A;  4JQ0 D;  5KSZ A;  3I5F C;  4DUQ A;  2GV5 A;  2I94 A;  1S1E A;  1IJ6 A;  1KWO C;  3IQQ A;  4AQJ A;  4NDC A;  2L98 A;  1MR8 A;  1NCZ A;  1SMG A;  2V53 A;  2Y4Q A;  3CR5 X;  2K2A A;  1IRJ A;  2KFH A;  3D10 A;  1BJF A;  1YRT B;  3OP0 A;  5G08 A;  3O4Y A;  4DCK A;  3NSI A;  5I2L A;  1S6C A;  1CFF A;  2RGI A;  1L2O C;  3PAT A;  4PAL A;  4XYN A;  5D69 A;  1S5G Y;  1KFU S;  2LE9 B;  1ODB A;  2PSR A;  1QX2 A;  1TCO B;  1L7Z A;  2A4J A;  1JBA A;  2KHN A;  1RJV A;  1UUR A;  4N1G A;  1HQV A;  2DOQ A;  2MAZ A;  3EVV A;  1JUO A;  3DVK A;  3ZWH A;  1BOC A;  2NCO A;  5AEQ A;  1QAT A;  1KQV A;  4CPV A;  1UHK A;  4GAO A;  3DVJ A;  2PAL A;  1IQ5 A;  1MQ1 A;  3M0W A;  2LMV A;  2M29 A;  2JNX A;  3I5H C;  5I2O A;  1ZAC A;  1RFJ A;  2K61 A;  2I2R E;  3GK2 A;  2LVV A;  3SIA A;  1PK0 D;  2F2O A;  4N5X A;  1RRO A;  2B1U A;  2VRG A;  1AVS A;  1LA3 A;  2LUX A;  2O5G A;  1DJZ A;  1OZS A;  1CDN A;  1K9U A;  1RK9 A;  1Y1A A;  4NDD A;  2LNK A;  1NCX A;  2KYF A;  1NX0 A;  4HRG A;  4MN0 A;  1SL7 A;  1TN4 A;  1K8U A;  1PAL A;  2E30 A;  2FJU B;  2OS8 C;  1SBJ A;  2FOT A;  5AXI A;  1XFX O;  2MJW B;  3PSR A;  2K0J A;  1PSR A;  4GBA A;  3RM1 A;  4TNC A;  4M2Q A;  5AAN A;  2BL0 C;  1C7V A;  1QS7 A;  1S26 D;  1K2H A;  3O6B A;  4PE1 A;  1CDL A;  1V1G A;  4OVN F;  2LVK A;  3BUX B;  2LMU A;  1QLK A;  1WLM A;  1IGV A;  1J7R A;  1XFY O;  1CLM A;  2TN4 A;  1YUS A;  3ICB A;  1YRU B;  5ER4 X;  1XFV O;  1DJI A;  1QLS A;  1ZUZ A;  2ISD A;  1PSB A;  2OTG B;  1YUU A;  3PFV A;  1YX7 A;  1CFD A;  1S3P A;  1WRL A;  2JXC A;  3CS1 A;  4YGA A;  1F54 A;  5DKN A;  1UWO A;  2KI6 C;  2ZND A;  4F0Z B;  1GQM A;  3TDU A;  3NXA A;  3NSK A;  1XFZ O;  3EKJ A;  2HQ8 A;  1A03 A;  3I5G B;  2SCP A;  3I5F B;  1XK4 C;  4YGD B;  1DMO A;  2KGB C;  2WCE A;  3KEV A;  2P6B B;  1BF5 A;  1KWO B;  1LVC D;  3FWB A;  3DD4 A;  1AJ4 A;  1H4B A;  1J1D A;  5DKQ A;  1Y6W A;  4CLN A;  3SG3 A;  5GQQ C;  5JJG A;  3D0Y A;  1GJY A;  1PRW A;  3PLF B;  1AHR A;  1J1E A;  3AAJ A;  3TDI A;  1NX1 A;  1MF8 B;  1N65 A;  2WND A;  3WXA A;  4DS7 A;  1L2O B;  3IQO A;  1K90 D;  1LIN A;  2H2K A;  2OTG C;  3DF0 A;  3FS7 A;  3JTD C;  3KO0 A;  1CFC A;  2WCB A;  3BOW A;  1J55 A;  1QX5 B;  3SG4 A;  2LV7 A;  1D1O A;  1SCV A;  1XO5 A;  5KU1 A;  2NZ0 A;  3HCM A;  4ORA B;  1EG3 A;  1U5I A;  1RTP 1;  2LVJ A;  3I5G C; 
#chains in the Genus database with same CATH topology
 1SL8 A;  2M97 A;  2WCJ A;  1K96 A;  2KI6 D;  4ZCV A;  1WY9 A;  3LLE A;  1FW4 A;  1TNQ A;  4E68 A;  2L0P A;  1IWQ A;  4WQ3 A;  1E8A A;  3LK0 A;  3SG7 A;  1JF2 A;  1A29 A;  3I5H B;  2JWW A;  4GGF A;  4OV2 A;  2JT3 A;  4XJK A;  1TTX A;  1ALW A;  1KSO A;  5HLV A;  3E3R A;  1NIW A;  1X02 A;  2AAO A;  2EC6 C;  1DVI A;  4PCW A;  1NSH A;  1S5G Z;  1TRF A;  5FI7 A;  4QJ4 B;  1CLL A;  3BUW B;  1MXL C;  1SR6 B;  4GPL B;  4IJ7 A;  1LKJ A;  2H61 C;  4PDZ A;  3H4S E;  2H61 A;  2F3Z A;  1KFX L;  2NLN A;  2MLE C;  4HRE E;  5IBW A;  1S6I A;  3UNW A;  4BY4 A;  1MWN A;  1TOP A;  4OR9 B;  4JWQ A;  4USL A;  1KK8 B;  2L5Y A;  1QVI Y;  5AFP A;  3GK4 X;  4A4C A;  1QVI Z;  3ZNI A;  4DIR A;  2OS8 B;  1M45 A;  1V1F A;  3PAL A;  3QRX A;  4KYN A;  3KPX A;  2IS9 A;  3SG5 A;  2Q4U A;  5K89 A;  5FI2 A;  2KSP A;  3CZ0 A;  2AMI A;  1AK8 A;  2BL0 B;  1M31 A;  1CDP A;  3FE6 A;  1CKK A;  5ER5 A;  3EK7 A;  3R1P A;  4CID A;  3NSO A;  1UHH A;  3VGO A;  1AP4 A;  1OSA A;  1IG5 A;  2KQ6 A;  1CNP A;  4MLW A;  1SR6 C;  4PT1 A;  4JKT A;  3K21 A;  4YBH B;  3AAK A;  1NWD A;  2OPO A;  3HX4 A;  1IKU A;  1TCF A;  2K7D A;  2GGZ A;  3DYE A;  1ALV A;  1ZFS A;  2LUC A;  4NQG A;  1UP5 A;  1DJX A;  1XFR A;  2Q91 A;  3GK1 A;  3KHE A;  3Q8I A;  4M2P A;  1KK8 C;  1OE9 B;  1EG4 A;  1C3Y A;  4MRX A;  3L4L A;  1CLB A;  1F4Q A;  4UPG A;  2KYC A;  1JC2 A;  1BT6 A;  2BBN A;  1J7P A;  1XA5 A;  2EHB A;  4AQI A;  1H8B A;  1DF0 B;  5CPV A;  1QTX A;  1REC A;  1TWO A;  2LLU A;  3FWC A;  1HT9 A;  1LA0 A;  2HPS A;  3FIA A;  4HRH A;  5I8N A;  3WHU B;  3BUN B;  1EH2 A;  4R1E A;  3EKH A;  4I5L B;  2Y1M A;  2O60 A;  2BKI B;  3CR2 A;  2LVI A;  1CM4 A;  4JPZ B;  1IJ5 A;  1W7J B;  2KAY A;  3CAB A;  3OB2 B;  5FI6 A;  3TDZ A;  2LAN A;  1JF0 A;  1TNP A;  5J3X A;  1SL9 A;  5HKY A;  2KNE A;  1Y1U A;  4MRY A;  1UHJ A;  2JOJ A;  4PE4 A;  2L2C A;  2JTZ A;  2Y1N A;  2KGR A;  3B6X A;  3PM8 A;  1TIZ A;  1PVA A;  2HF5 A;  5HLO A;  1C07 A;  3D0Y B;  2JT8 A;  1K9K A;  3FE8 A;  3BXK A;  4IL1 A;  1BOD A;  1NX3 A;  1UUS A;  1DC1 A;  3JTD B;  3CGA A;  2M1U A;  3BUO B;  5CSN A;  3BOW B;  3I5I C;  3S0G A;  4DRW A;  3CZT X;  1YUT A;  1S6J A;  2BAP A;  2BEC A;  2LLS A;  1G8I A;  2WCF A;  4PHN A;  2PAS A;  4F7F A;  4HSZ A;  5AER A;  2D8N A;  1R6P A;  1U5I B;  2LC5 A;  1AUI B;  1DJH A;  2KLD A;  3FE9 A;  3OX5 A;  2WCL A;  4FTG A;  2FCE A;  3TUY C;  2KAV A;  1S36 A;  4WRI A;  1QJT A;  2F3Y A;  3EK8 A;  2CT9 A;  1J7Q A;  3B88 A;  1A75 A;  5I2Q A;  1TNW A;  2FCD A;  1OOI X;  2WOR A;  1B4C A;  1DJG A;  1EXR A;  3CLN A;  4FQT A;  1EL4 A;  1XFW O;  1FBV A;  1UHN A;  4PE0 A;  1G33 A;  3KF9 A;  3S0D A;  4OKH A;  4XJK B;  3SJS A;  3A8R A;  2G9B A;  1KSM A;  3QME A;  3OB1 B;  3BFH A;  5HL1 A;  2AUC A;  1XYD A;  2EC6 B;  1KFX S;  1QV1 A;  2KOT A;  1DJW A;  2BCB A;  3AKB A;  3JVT C;  4YI8 A;  2ZRS A;  4MZL A;  3BYA A;  4FQO A;  3R72 A;  1M46 A;  1G4Y R;  3K1E A;  1ZMZ A;  2JXL A;  2L4H A;  4ORB B;  1RWY A;  1CDM A;  1F8H A;  3SG6 A;  1CB1 A;  3D78 A;  1F55 A;  1M63 B;  2LAP A;  1KK7 Y;  2K7C A;  4PHM A;  2JUL A;  2KDH A;  1KK7 Z;  1SNL A;  1B8C A;  1QIW A;  3EVU A;  4ORC B;  4L9M A;  1QX7 A;  2PVB A;  4OCI A;  2KBM A;  2WOS A;  1K93 D;  1M39 A;  2L50 A;  2L2E A;  1GGZ A;  1OMR A;  1P28 A;  2BNX A;  3PM2 A;  1B7T Y;  4GGF C;  3VRR A;  1B7T Z;  1FI6 A;  3BJH A;  3RLZ A;  3SG2 A;  1EJ3 A;  4YGC B;  1YX8 A;  1N0Y A;  3SIB A;  2LM5 A;  2M7L A;  1IQ3 A;  1Y0V H;  4A4B A;  2BBM A;  2JRF A;  2JNF A;  1F71 A;  1MXE A;  2K60 A;  3D74 A;  2P70 A;  2KFG A;  4YI9 A;  1J7O A;  2QAC A;  3O2P A;  1F4O A;  3R1V A;  1CMF A;  1JFJ A;  4QJ3 B;  2MBX A;  1SYM A;  3CYZ A;  5PAL A;  1NX2 A;  4ICB A;  2HQW A;  1FPW A;  1SW8 A;  1SY9 A;  3TZ1 A;  1Q80 A;  3EVR A;  3PN7 B;  4U8D A;  1OOG A;  1PVB A;  2BCA A;  3R1O A;  1SCM C;  1SRA A;  1DTL A;  1CTR A;  1NUB A;  2JT0 A;  1CM1 A;  3NHI A;  2MRD A;  2BE4 A;  2QEH A;  1FF1 A;  1KQM C;  3IVT A;  1SSE B;  1AJ5 A;  1SKT A;  3CR4 X;  5JOL A;  1DGV A;  2R2I A;  1SK6 D;  4DS7 A;  1OW4 A;  2KQY A;  1WRZ A;  1K9P A;  1JSA A;  2K7O A;  1DGU A;  2F8P A;  2LHI A;  2Y5I A;  3A4U B;  3OBV A;  4M2O A;  3DY9 A;  2WCK A;  2LLT A;  4AOM A;  1SPY A;  2CXJ A;  2ZRT A;  2CNP A;  3DVM A;  4MSP A;  4ZCU A;  1NYA A;  1DT7 B;  2K8M B;  2ZFD A;  1B9A A;  1BMO A;  1TNX A;  1YTZ C;  2BKH B;  3OHM B;  2KAX A;  3PN7 C;  1KCY A;  4BY5 A;  3I5I B;  1Y1X A;  3TS5 B;  3F45 A;  4MZK A;  3NSL A;  2G2B A;  1B8L A;  2M1K B;  2QEB A;  1BR1 B;  2MLF C;  5EL2 A;  4GFT A;  1WRK A;  4MVF A;  3VRP A;  2KI4 B;  1BR4 B;  2LHL A;  2PRU A;  3IF7 A;  1OZO A;  5B8I B;  4I5N B;  3TUY B;  1KFU L;  2ZNE A;  1JWD A;  2L4I A;  5D7F A;  1K94 A;  2HET A;  3VRQ A;  3D77 A;  2I18 A;  4INW A;  4CFQ A;  1W9Z A;  4C0K A;  2LP2 A;  1A75 B;  1UHI A;  1YR5 A;  1LXF C;  2JU0 A;  2PQL A;  1QV0 A;  4MBE A;  2NCP A;  4MZJ A;  4C0J A;  4CFR A;  3BQ3 A;  4P2Y B;  1QAS A;  2WC8 A;  1CFP A;  1XFU O;  3LCP C;  2K7B A;  1NP8 A;  2P71 A;  3B7A A;  2GTE A;  5CSF A;  3DF0 B;  3LL8 B;  2L5X B;  3AKA A;  3CZ1 A;  3N7H A;  3VB1 A;  1WDC B;  1YVL A;  1NPQ A;  2K2F A;  1A2X A;  2JPT A;  2BE6 A;  3TS5 C;  3JVT B;  3S0F A;  1LS8 A;  1QXP A;  2LP3 A;  4NDB A;  1BU3 A;  1XVJ A;  2JC2 A;  4QJ5 B;  4I5K A;  5F6T A;  1YUR A;  5HKZ A;  2KI4 C;  2LMT A;  1B8R A;  1MUX A;  1GGW A;  1W7I B;  2M8U A;  2ZN8 A;  1WLZ A;  1NCY A;  3BFB A;  4D1E A;  4ETO A;  1DEK A;  1YVH A;  3VRN A;  1B1G A;  2CTN A;  1OOF A;  1JFK A;  2NXQ A;  5TNC A;  2M3W A;  4PHJ A;  3DVE A;  3LK1 A;  1DJY A;  5KTY A;  1OMV A;  1FI5 A;  2JTT A;  2SAS A;  1DF0 A;  2JQ6 A;  2KFF A;  4YRU A;  3BUM B;  4YGB B;  5DKR A;  1N2D A;  4GNK B;  4N1F A;  1DQE A;  1OOJ A;  5CSI A;  3VRO A;  1OMD A;  2BCX A;  1A4P A;  1OQP A;  4P5O E;  4PHK A;  3WHT B;  1B47 A;  2PMY A;  1WDC C;  2EGD A;  2E6W A;  1F70 A;  2LCP A;  3C1V A;  4YGE B;  2I7A A;  3MSE B;  4C0L A;  2WCH A;  3CTN A;  1MHO A;  1XK4 A;  1R2U A;  3EK4 A;  4GGN A;  4Q04 A;  5HKW A;  4GUK A;  1K95 A;  2M49 B;  1VRK A;  3O78 A;  2GGM A;  1ORG A;  2CCM A;  1OOH A;  1ZOT B;  3WXA A;  1PUL A;  2MA2 A;  1C3Z A;  1C7W A;  2L51 A;  2QPT A;  1QIV A;  5CSJ A;  2KBI A;  2ZN9 A;  3PJI A;  4MEW A;  5BPJ A;  2ZKM X;  4WQ2 A;  2JZI A;  4OZD A;  1IH0 A;  2COL B;  1SCM B;  3WNX B;  2F33 A;  2JPO A;  4I5J A;  5HYD A;  2F2P A;  1KQM B;  3L47 A;  2M7N A;  1BLQ A;  3GOF A;  2CBL A;  3OX6 A;  1TUJ A;  2KPH A;  2M0R A;  2M9G A;  1BG1 A;  1CMG A;  3CWG A;  4PE7 A;  5FYX A;  2MHH A;  4JQ0 D;  5KSZ A;  3I5F C;  3NHT A;  4DUQ A;  2GV5 A;  2I94 A;  1S1E A;  1IJ6 A;  1KWO C;  3IQQ A;  4AQJ A;  4NDC A;  2L98 A;  3D75 A;  1MR8 A;  2KLE A;  1NCZ A;  1SMG A;  2V53 A;  2Y4Q A;  3CR5 X;  2K2A A;  1IRJ A;  2KFH A;  3D10 A;  1BJF A;  2FJY A;  1YRT B;  3OP0 A;  5G08 A;  2QEO A;  3O4Y A;  4DCK A;  3NSI A;  5I2L A;  1S6C A;  1CFF A;  2RGI A;  2WCM A;  1L2O C;  3PAT A;  4PAL A;  4XYN A;  5D69 A;  1S5G Y;  1KFU S;  2LE9 B;  1ODB A;  2PSR A;  1QX2 A;  1TCO B;  1L7Z A;  2A4J A;  2QDI A;  3V2L A;  3S0E A;  1JBA A;  2KHN A;  1RJV A;  1UUR A;  4N1G A;  2QEV A;  1HQV A;  2DOQ A;  2MAZ A;  3EVV A;  1JUO A;  3UO9 A;  3DVK A;  3ZWH A;  1BOC A;  1DEL A;  2NCO A;  5AEQ A;  1QAT A;  1KQV A;  4CPV A;  1UHK A;  4GAO A;  3DVJ A;  2PAL A;  1IQ5 A;  1MQ1 A;  3M0W A;  2LMV A;  2M29 A;  3D73 A;  2JNX A;  3I5H C;  5I2O A;  1ZAC A;  1RFJ A;  2K61 A;  2I2R E;  2ERB A;  3GK2 A;  3S0A A;  2LVV A;  3SIA A;  1PK0 D;  2F2O A;  4N5X A;  1RRO A;  3SS3 A;  3EG5 B;  2B1U A;  2VRG A;  3SS4 A;  1AVS A;  1LA3 A;  2LUX A;  2O5G A;  1DJZ A;  1OZS A;  2WC6 A;  1K9U A;  1RK9 A;  1Y1A A;  1CDN A;  4NDD A;  2LNK A;  2H8V A;  1GM0 A;  1NCX A;  2KYF A;  1NX0 A;  1Z2C B;  4HRG A;  4MN0 A;  1SL7 A;  3O4X A;  1TN4 A;  1K8U A;  1PAL A;  3S0B A;  1QWV A;  2E30 A;  1IIO A;  2FJU B;  2OS8 C;  1SBJ A;  2FOT A;  5AXI A;  1XFX O;  3OGN A;  2MJW B;  3PSR A;  2K0J A;  1PSR A;  4GBA A;  3RM1 A;  4TNC A;  4M2Q A;  5AAN A;  2BL0 C;  5D3O A;  1C7V A;  1QS7 A;  1S26 D;  1K2H A;  3O6B A;  2PYQ A;  4PE1 A;  1CDL A;  1V1G A;  3L4A A;  4OVN F;  2LVK A;  4JD9 A;  3DZT A;  3BUX B;  2LMU A;  1QLK A;  2WC5 A;  1T14 A;  1WLM A;  1IGV A;  1J7R A;  1XFY O;  1CLM A;  2TN4 A;  1YUS A;  3ICB A;  1YRU B;  1TUZ A;  5ER4 X;  1XFV O;  1DJI A;  1QLS A;  1ZUZ A;  2ISD A;  1PSB A;  2OTG B;  3B86 A;  1YUU A;  3PFV A;  1YX7 A;  1CFD A;  1S3P A;  1WRL A;  2JXC A;  3CS1 A;  4YGA A;  3SS5 A;  1F54 A;  5DKN A;  1UWO A;  2KI6 C;  2ZND A;  3CDN A;  3D76 A;  4F0Z B;  1GQM A;  3TDU A;  3NXA A;  3NSK A;  1XFZ O;  3EKJ A;  2HQ8 A;  1A03 A;  3I5G B;  2SCP A;  3I5F B;  1XK4 C;  4YGD B;  1DMO A;  2KGB C;  2WCE A;  3KEV A;  2P6B B;  1BF5 A;  1Z4H A;  1KWO B;  3RZS A;  1LVC D;  3FWB A;  3DD4 A;  1AJ4 A;  5DIC A;  1J1D A;  1H4B A;  5DKQ A;  1Y6W A;  3BFA A;  5I94 A;  4CLN A;  3SG3 A;  3CZ2 A;  5GQQ C;  5JJG A;  3D0Y A;  1GJY A;  1PRW A;  3B87 A;  1AHR A;  1J1E A;  2YGU A;  3AAJ A;  1NX1 A;  1MF8 B;  1N65 A;  2WND A;  3PLF B;  4INX A;  1L2O B;  3TDI A;  3IQO A;  1K90 D;  1LIN A;  2H2K A;  2OTG C;  3DF0 A;  3FS7 A;  3JTD C;  3KO0 A;  3NGV A;  1CFC A;  2WCB A;  3BOW A;  1J55 A;  1QX5 B;  3SG4 A;  2LV7 A;  1D1O A;  1SCV A;  1XO5 A;  5KU1 A;  2NZ0 A;  3HCM A;  3DXL A;  4ORA B;  1EG3 A;  1U5I A;  1RTP 1;  2LVJ A;  3I5G C; 
#chains in the Genus database with same CATH homology
 1SL8 A;  2M97 A;  1K96 A;  2KI6 D;  4ZCV A;  1WY9 A;  3LLE A;  1FW4 A;  1TNQ A;  4E68 A;  2L0P A;  1IWQ A;  4WQ3 A;  1E8A A;  3LK0 A;  3SG7 A;  1JF2 A;  1A29 A;  3I5H B;  2JWW A;  4GGF A;  4OV2 A;  2JT3 A;  4XJK A;  1TTX A;  1ALW A;  1KSO A;  5HLV A;  3E3R A;  1NIW A;  1X02 A;  2AAO A;  2EC6 C;  1DVI A;  4PCW A;  1NSH A;  1S5G Z;  1TRF A;  4QJ4 B;  1CLL A;  3BUW B;  1MXL C;  1SR6 B;  4GPL B;  4PDZ A;  1LKJ A;  2H61 C;  3H4S E;  2H61 A;  2F3Z A;  1KFX L;  2NLN A;  2MLE C;  4HRE E;  5IBW A;  1S6I A;  4BY4 A;  1MWN A;  1TOP A;  4OR9 B;  4JWQ A;  4USL A;  1KK8 B;  1QVI Y;  5AFP A;  3GK4 X;  4A4C A;  1QVI Z;  3ZNI A;  4DIR A;  2OS8 B;  1M45 A;  1V1F A;  3PAL A;  3QRX A;  3KPX A;  2IS9 A;  3SG5 A;  2Q4U A;  5K89 A;  2KSP A;  2AMI A;  1AK8 A;  2BL0 B;  1M31 A;  1CDP A;  1CKK A;  5ER5 A;  3EK7 A;  4CID A;  3NSO A;  1UHH A;  3VGO A;  1AP4 A;  1OSA A;  1IG5 A;  2KQ6 A;  1CNP A;  4MLW A;  1SR6 C;  3K21 A;  4YBH B;  3AAK A;  1NWD A;  2OPO A;  3HX4 A;  1IKU A;  1TCF A;  2K7D A;  2GGZ A;  1ALV A;  1ZFS A;  2LUC A;  4NQG A;  1UP5 A;  1DJX A;  2Q91 A;  3GK1 A;  3KHE A;  4M2P A;  1KK8 C;  1OE9 B;  1EG4 A;  1CLB A;  4MRX A;  1F4Q A;  4UPG A;  2KYC A;  1JC2 A;  1BT6 A;  2BBN A;  1J7P A;  1XA5 A;  2EHB A;  4AQI A;  1H8B A;  1DF0 B;  5CPV A;  1QTX A;  1REC A;  3FWC A;  2LLU A;  1HT9 A;  1LA0 A;  2HPS A;  3FIA A;  4HRH A;  5I8N A;  3WHU B;  3BUN B;  1EH2 A;  4R1E A;  3EKH A;  4I5L B;  2Y1M A;  2O60 A;  2BKI B;  3CR2 A;  2LVI A;  1CM4 A;  4JPZ B;  1IJ5 A;  1W7J B;  2KAY A;  3OB2 B;  3TDZ A;  2LAN A;  1JF0 A;  1TNP A;  5J3X A;  1SL9 A;  5HKY A;  2KNE A;  1Y1U A;  4MRY A;  1UHJ A;  2JOJ A;  4PE4 A;  2JTZ A;  2Y1N A;  2KGR A;  3PM8 A;  1C07 A;  1TIZ A;  1PVA A;  2HF5 A;  5HLO A;  3D0Y B;  2JT8 A;  1K9K A;  3BXK A;  4IL1 A;  1BOD A;  1NX3 A;  1UUS A;  3JTD B;  3CGA A;  2M1U A;  3BUO B;  5CSN A;  3BOW B;  3I5I C;  4DRW A;  3CZT X;  1YUT A;  1S6J A;  2LLS A;  2BEC A;  2WCF A;  1G8I A;  4PHN A;  2PAS A;  4HSZ A;  5AER A;  2D8N A;  1R6P A;  1U5I B;  2LC5 A;  1AUI B;  1DJH A;  3OX5 A;  4FTG A;  2FCE A;  3TUY C;  2KAV A;  1S36 A;  4WRI A;  1QJT A;  2F3Y A;  3EK8 A;  2CT9 A;  1J7Q A;  1A75 A;  5I2Q A;  1TNW A;  2FCD A;  2WOR A;  1B4C A;  1DJG A;  1EXR A;  3CLN A;  1EL4 A;  1XFW O;  1FBV A;  1UHN A;  4PE0 A;  1G33 A;  3KF9 A;  3SJS A;  4OKH A;  4XJK B;  3A8R A;  2G9B A;  1KSM A;  3OB1 B;  2AUC A;  1XYD A;  2EC6 B;  1KFX S;  1QV1 A;  2KOT A;  1DJW A;  2BCB A;  3AKB A;  3JVT C;  4YI8 A;  2ZRS A;  4MZL A;  3BYA A;  4FQO A;  1M46 A;  1G4Y R;  1ZMZ A;  2JXL A;  2L4H A;  4ORB B;  1RWY A;  1CDM A;  1F8H A;  3SG6 A;  1CB1 A;  1F55 A;  1M63 B;  2LAP A;  1KK7 Y;  2K7C A;  4PHM A;  2JUL A;  2KDH A;  1KK7 Z;  1SNL A;  1B8C A;  1QIW A;  3EVU A;  4ORC B;  4L9M A;  1QX7 A;  2PVB A;  4OCI A;  2KBM A;  2WOS A;  1K93 D;  1M39 A;  2L50 A;  2L2E A;  1GGZ A;  1OMR A;  4GGF C;  1B7T Y;  3VRR A;  1B7T Z;  1FI6 A;  3RLZ A;  3SG2 A;  1EJ3 A;  4YGC B;  1YX8 A;  1N0Y A;  3SIB A;  2LM5 A;  2M7L A;  1IQ3 A;  1Y0V H;  4A4B A;  2BBM A;  2JRF A;  2JNF A;  1F71 A;  1MXE A;  2KFG A;  4YI9 A;  1J7O A;  2QAC A;  3O2P A;  1F4O A;  1CMF A;  1JFJ A;  4QJ3 B;  2MBX A;  1SYM A;  5PAL A;  1NX2 A;  4ICB A;  2HQW A;  1FPW A;  1SW8 A;  1SY9 A;  3TZ1 A;  1Q80 A;  3EVR A;  3PN7 B;  4U8D A;  2BCA A;  1PVB A;  1SCM C;  1SRA A;  1DTL A;  1CTR A;  1NUB A;  2JT0 A;  1CM1 A;  2MRD A;  2BE4 A;  1FF1 A;  1KQM C;  1AJ5 A;  1SKT A;  3CR4 X;  5JOL A;  1DGV A;  2R2I A;  1SK6 D;  2KQY A;  1WRZ A;  1K9P A;  1JSA A;  2K7O A;  1DGU A;  2F8P A;  2LHI A;  2Y5I A;  3A4U B;  4M2O A;  4AOM A;  2LLT A;  1SPY A;  2CXJ A;  2ZRT A;  2CNP A;  3DVM A;  4MSP A;  4ZCU A;  1NYA A;  1DT7 B;  2K8M B;  2ZFD A;  1B9A A;  1BMO A;  1TNX A;  1YTZ C;  2BKH B;  3OHM B;  2KAX A;  3PN7 C;  1KCY A;  4BY5 A;  3I5I B;  1Y1X A;  3TS5 B;  3F45 A;  4MZK A;  3NSL A;  2G2B A;  1B8L A;  2M1K B;  1BR1 B;  2MLF C;  4GFT A;  1WRK A;  4MVF A;  3VRP A;  2KI4 B;  1BR4 B;  2LHL A;  2PRU A;  3IF7 A;  1OZO A;  5B8I B;  4I5N B;  3TUY B;  1KFU L;  2ZNE A;  1JWD A;  2L4I A;  5D7F A;  1K94 A;  2HET A;  3VRQ A;  2I18 A;  4CFQ A;  4C0K A;  2LP2 A;  1A75 B;  1UHI A;  1YR5 A;  1LXF C;  2JU0 A;  1QV0 A;  4MBE A;  2NCP A;  4MZJ A;  4C0J A;  4CFR A;  3BQ3 A;  4P2Y B;  1QAS A;  2WC8 A;  1CFP A;  1XFU O;  3LCP C;  2K7B A;  1NP8 A;  5CSF A;  3DF0 B;  3LL8 B;  2L5X B;  3AKA A;  1WDC B;  1YVL A;  1NPQ A;  2K2F A;  1A2X A;  2JPT A;  2BE6 A;  3TS5 C;  3JVT B;  1QXP A;  4NDB A;  2LP3 A;  4QJ5 B;  1BU3 A;  1XVJ A;  2JC2 A;  4I5K A;  5F6T A;  1YUR A;  5HKZ A;  2KI4 C;  2LMT A;  1B8R A;  1MUX A;  1GGW A;  1W7I B;  2M8U A;  2ZN8 A;  1WLZ A;  1NCY A;  4D1E A;  4ETO A;  1YVH A;  3VRN A;  1B1G A;  2CTN A;  1JFK A;  2NXQ A;  5TNC A;  2M3W A;  4PHJ A;  3DVE A;  3LK1 A;  1DJY A;  5KTY A;  1OMV A;  1FI5 A;  2JTT A;  2SAS A;  1DF0 A;  2JQ6 A;  2KFF A;  4YRU A;  3BUM B;  4YGB B;  5DKR A;  1N2D A;  4GNK B;  4N1F A;  5CSI A;  1OOJ A;  3VRO A;  1OMD A;  2BCX A;  1A4P A;  1OQP A;  4P5O E;  4PHK A;  3WHT B;  1B47 A;  2PMY A;  1WDC C;  2EGD A;  2E6W A;  1F70 A;  2LCP A;  3C1V A;  4YGE B;  2I7A A;  3MSE B;  4C0L A;  3CTN A;  1MHO A;  1XK4 A;  1R2U A;  3EK4 A;  4GGN A;  4Q04 A;  5HKW A;  4GUK A;  1K95 A;  2M49 B;  1VRK A;  3O78 A;  2GGM A;  2CCM A;  1ZOT B;  1PUL A;  2MA2 A;  1C7W A;  2L51 A;  2QPT A;  1QIV A;  5CSJ A;  2KBI A;  2ZN9 A;  4MEW A;  5BPJ A;  2ZKM X;  4WQ2 A;  2JZI A;  1IH0 A;  2COL B;  1SCM B;  3WNX B;  2F33 A;  4I5J A;  5HYD A;  2F2P A;  1KQM B;  2M7N A;  1BLQ A;  3GOF A;  2CBL A;  3OX6 A;  2M9G A;  1CMG A;  2M0R A;  1BG1 A;  3CWG A;  4PE7 A;  5FYX A;  2MHH A;  4JQ0 D;  5KSZ A;  3I5F C;  4DUQ A;  2GV5 A;  2I94 A;  1S1E A;  1IJ6 A;  1KWO C;  3IQQ A;  4AQJ A;  4NDC A;  2L98 A;  1MR8 A;  1NCZ A;  1SMG A;  2V53 A;  2Y4Q A;  3CR5 X;  2K2A A;  1IRJ A;  2KFH A;  3D10 A;  1BJF A;  1YRT B;  3OP0 A;  5G08 A;  3O4Y A;  4DCK A;  3NSI A;  5I2L A;  1S6C A;  1CFF A;  2RGI A;  1L2O C;  3PAT A;  4PAL A;  4XYN A;  5D69 A;  1S5G Y;  1KFU S;  2LE9 B;  1ODB A;  2PSR A;  1QX2 A;  1TCO B;  1L7Z A;  2A4J A;  1JBA A;  2KHN A;  1RJV A;  1UUR A;  4N1G A;  1HQV A;  2DOQ A;  2MAZ A;  3EVV A;  1JUO A;  3DVK A;  3ZWH A;  1BOC A;  2NCO A;  5AEQ A;  1QAT A;  1KQV A;  4CPV A;  1UHK A;  4GAO A;  3DVJ A;  2PAL A;  1IQ5 A;  1MQ1 A;  3M0W A;  2LMV A;  2M29 A;  2JNX A;  3I5H C;  5I2O A;  1ZAC A;  1RFJ A;  2K61 A;  2I2R E;  3GK2 A;  2LVV A;  3SIA A;  1PK0 D;  2F2O A;  4N5X A;  1RRO A;  2B1U A;  2VRG A;  1AVS A;  1LA3 A;  2LUX A;  2O5G A;  1DJZ A;  1OZS A;  1CDN A;  1K9U A;  1RK9 A;  1Y1A A;  4NDD A;  2LNK A;  1NCX A;  2KYF A;  1NX0 A;  4HRG A;  4MN0 A;  1SL7 A;  1TN4 A;  1K8U A;  1PAL A;  2E30 A;  2FJU B;  2OS8 C;  1SBJ A;  2FOT A;  5AXI A;  1XFX O;  2MJW B;  3PSR A;  2K0J A;  1PSR A;  4GBA A;  3RM1 A;  4TNC A;  4M2Q A;  5AAN A;  2BL0 C;  1C7V A;  1QS7 A;  1S26 D;  1K2H A;  3O6B A;  4PE1 A;  1CDL A;  1V1G A;  4OVN F;  2LVK A;  3BUX B;  2LMU A;  1QLK A;  1WLM A;  1IGV A;  1J7R A;  1XFY O;  1CLM A;  2TN4 A;  1YUS A;  3ICB A;  1YRU B;  5ER4 X;  1XFV O;  1DJI A;  1QLS A;  1ZUZ A;  2ISD A;  1PSB A;  2OTG B;  1YUU A;  3PFV A;  1YX7 A;  1CFD A;  1S3P A;  1WRL A;  2JXC A;  3CS1 A;  4YGA A;  1F54 A;  5DKN A;  1UWO A;  2KI6 C;  2ZND A;  4F0Z B;  1GQM A;  3TDU A;  3NXA A;  3NSK A;  1XFZ O;  3EKJ A;  2HQ8 A;  1A03 A;  3I5G B;  2SCP A;  3I5F B;  1XK4 C;  4YGD B;  1DMO A;  2KGB C;  2WCE A;  3KEV A;  2P6B B;  1BF5 A;  1KWO B;  1LVC D;  3FWB A;  3DD4 A;  1AJ4 A;  1H4B A;  1J1D A;  5DKQ A;  1Y6W A;  4CLN A;  3SG3 A;  5GQQ C;  5JJG A;  3D0Y A;  1GJY A;  1PRW A;  3PLF B;  1AHR A;  1J1E A;  3AAJ A;  3TDI A;  1NX1 A;  1MF8 B;  1N65 A;  2WND A;  3WXA A;  4DS7 A;  1L2O B;  3IQO A;  1K90 D;  1LIN A;  2H2K A;  2OTG C;  3DF0 A;  3FS7 A;  3JTD C;  3KO0 A;  1CFC A;  2WCB A;  3BOW A;  1J55 A;  1QX5 B;  3SG4 A;  2LV7 A;  1D1O A;  1SCV A;  1XO5 A;  5KU1 A;  2NZ0 A;  3HCM A;  4ORA B;  1EG3 A;  1U5I A;  1RTP 1;  2LVJ A;  3I5G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...