3QRXA

Chlamydomonas reinhardtii centrin bound to melittin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
145
structure length
145
Chain Sequence
b'VGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKMGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrin
molecule tags Metal binding protein/toxin
source organism Chlamydomonas reinhardtii
publication title The structure, molecular dynamics, and energetics of centrin-melittin complex.
pubmed doi rcsb
total genus 49
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3qrxA02
1K8UA 1GGZA 2M7LA 2JTZA 2KBMA 3FIAA 1UURA 1W7JB 4YGAA 1VRKA 1KQVA 1XFYO 4OR9B 1BOCA 4DUQA 5I2OA 5PALA 1AVSA 1N0YA 2BCAA 1W7IB 2JNXA 2KGRA 3SG4A 3TUYB 1CDMA 3I5GB 2ZNEA 1NX3A 1NWDA 1A4PA 1XFVO 4ORCB 3D0YB 1MQ1A 4OCIA 1JFKA 2A4JA 1N65A 3BUNB 2NCPA 2KAXA 2H61C 1TNXA 3I5IB 3K21A 4R1EA 3GK2A 1NCYA 2LHIA 1CM4A 2K7OA 3JVTB 3OB1B 1RK9A 2WORA 1OQPA 1DJIA 2L50A 3DF0B 1QXPA 2G9BA 2F2PA 1GQMA 4AQIA 2M1KB 2M7NA 1BU3A 4PDZA 3ICBA 4YI9A 1QJTA 3EK4A 3GK1A 1YRUB 4M2PA 3TZ1A 1LXFC 2WOSA 5CSNA 2BBNA 3BUMB 4YI8A 1OSAA 1YUTA 1K95A 4I5NB 1QX2A 4YRUA 2OS8C 2KFGA 3SG6A 1XFWO 2L4HA 1U5IA 4DIRA 1G33A 1KK7Z 2MAZA 3OB2B 2JULA 1EG3A 1JF2A 2M29A 2LVKA 3NXAA 1CDPA 3KHEA 2Y1MA 4ICBA 2PALA 1YVHA 4AQJA 1JUOA 2DOQA 1YTZC 4L9MA 2K7DA 2JU0A 1NCXA 1B9AA 1F8HA 1IJ5A 4E68A 2MRDA 1ALWA 1SCMC 3FWBA 1SW8A 1XA5A 3DVEA 4MVFA 3TS5B 2WCEA 1IQ5A 1S5GZ 2NLNA 5I2QA 2PASA 4YGEB 1KQMC 1KSMA 2O5GA 4AOMA 4XJKB 1WRLA 2GGZA 1K96A 1OMRA 2E6WA 3NSIA 1B8CA 2OPOA 1EXRA 2KQYA 3CR5X 1NCZA 2JC2A 4N1GA 3F45A 4USLA 1Y1AA 4TNCA 1NX2A 4PE4A 2LC5A 4WQ2A 1YUSA 1ZACA 2OS8B 2V53A 5AANA 1UHHA 4DS7A 2G2BA 2E30A 5D69A 3GK4X 1UP5A 1YURA 1XK4A 5HLOA 3PLFB 1CFDA 1UHJA 4FQOA 1U5IB 3DVMA 2JT0A 1V1FA 1IKUA 4NDCA 1M31A 2BBMA 2LVVA 3VRPA 3CLNA 4YGBB 2LLUA 2TN4A 2M3WA 3OHMB 5K89A 2LMUA 2ZN8A 4GGNA 1DJYA 1QATA 1B7TY 1OMVA 3RLZA 4A4BA 3EVUA 1S6JA 1WY9A 2LLTA 1XFZO 3ZNIA 2LUCA 1CDNA 2I2RE 1KWOC 4GPLB 1OOJA 1KCYA 2KDHA 3TUYC 2BCXA 1SBJA 2MLEC 1AHRA 1AJ4A 1DF0A 1PRWA 2M97A 5AERA 3BUOB 1DJWA 1J1DA 1M45A 1QX5B 4PE7A 1XVJA 1MWNA 5I8NA 2LHLA 4CLNA 1J1EA 1QIWA 1TIZA 1DVIA 2LP3A 1FBVA 2LLSA 2CCMA 1GJYA 1FF1A 1MXLC 3PN7C 4HRHA 1BR1B 1S1EA 1C07A 2CBLA 3CWGA 1IGVA 4MRXA 2H2KA 1F4OA 2JNFA 2QPTA 5JJGA 1C7VA 2KSPA 4GUKA 1LKJA 1MF8B 1OE9B 2FCEA 2SCPA 3MSEB 2LCPA 1S6IA 1TCFA 2SASA 2K7CA 1RECA 4JQ0D 1A2XA 1HQVA 2PSRA 4ETOA 2ZRSA 1UHKA 2H61A 3VRNA 1QASA 4NQGA 5ER4X 5AFPA 1DMOA 1NIWA 1GGWA 1AP4A 2JPTA 1BT6A 1WRKA 1IH0A 5HKWA 3SG3A 3FWCA 2QACA 1NSHA 3A4UB 4PHMA 1FW4A 1K9KA 2F3ZA 5GQQC 1IG5A 2HF5A 1JBAA 1KFUS 1YX8A 2KNEA 2L4IA 2MLFC 1LINA 2B1UA 4M2OA 3SIAA 2JTTA 1B47A 2GV5A 4D1EA 1AK8A 1M46A 3IQQA 3O6BA 1DJXA 1SCMB 3TDIA 1BJFA 3TS5C 1M39A 2Q91A 2Q4UA 4P5OE 5DKRA 3RM1A 2D8NA 3AAKA 3CR2A 3CR4X 3LLEA 2L5XB 2LUXA 4WQ3A 1B1GA 5CSFA 1CNPA 2NXQA 3I5GC 3VGOA 2L51A 1XO5A 1QIVA 1F4QA 1J7PA 1EL4A 1AJ5A 1KWOB 1TNWA 1UHIA 2NZ0A 4QJ5B 3JVTC 3WHTB 3EVRA 2ZRTA 5DKNA 1PSBA 3IF7A 3SG7A 1PVAA 1RWYA 1DF0B 2KI6D 1RJVA 3I5HC 3LCPC 3BOWB 3A8RA 1ZMZA 5AXIA 4GNKB 1TNQA 3LK0A 1F54A 1L2OB 1A03A 4BY4A 1X02A 2CT9A 2CXJA 2M1UA 1J7QA 1FI6A 2FJUB 3KF9A 3WXAA 4YGDB 5KTYA 2L0PA 1TNPA 1F71A 3O78A 2LANA 5CSIA 1PK0D 1S36A 3HCMA 1XFXO 1R2UA 1RTP1 2K0JA 3NSOA 4BY5A 3PATA 1EH2A 1C7WA 1J7RA 2JWWA 4MRYA 4MZLA 4C0JA 2HETA 1ZUZA 1M63B 2Y1NA 1EG4A 1WLZA 2F8PA 2Y5IA 2AUCA 1F70A 4YGCB 1G8IA 1ODBA 3IQOA 1NX1A 2BECA 1RFJA 3H4SE 1CLBA 2ZFDA 3I5FC 2LVJA 2P6BB 3PSRA 1DT7B 5B8IB 1J7OA 4CFRA 5AEQA 4GGFC 1WDCC 4PHKA 3KO0A 4GGFA 2FCDA 1PSRA 1BMOA 4PCWA 2AMIA 1SR6B 1IRJA 1SYMA 3BUWB 3CZTX 1K94A 1NPQA 1S6CA 5TNCA 1Y1XA 1QV1A 2F33A 1FPWA 2L98A 3BUXB 3JTDB 4MBEA 4GAOA 1SKTA 3EVVA 2K2AA 3O2PA 1CMFA 2EGDA 1WRZA 5JOLA 1TOPA 2BE6A 4CPVA 2KFHA 5HKZA 5KSZA 2EHBA 4C0LA 2HQ8A 3BOWA 1TTXA 1MHOA 1F55A 2NCOA 1SPYA 1HT9A 5FYXA 1Y0VH 4I5JA 4GFTA 1N2DA 5CPVA 1SMGA 4MN0A 2HQWA 1CMGA 3OP0A 1CB1A 3D0YA 1JSAA 1KFXL 1PVBA 5HKYA 4PE0A 2LM5A 3I5FB 5IBWA 1K9UA 2FOTA 2WNDA 2KAYA 3JTDC 1ZFSA 1BR4B 2ZKMX 3SJSA 1XFUO 1D1OA 4PHJA 4HRGA 1KQMB 2RGIA 5HYDA 2EC6B 1SR6C 4MLWA 3KPXA 3BQ3A 4QJ3B 3QRXA 1SY9A 3FS7A 4I5LB 2HPSA 1CLMA 4PE1A 1QTXA 1JF0A 4A4CA 1K9PA 1XK4C 1ALVA 1S3PA 2LV7A 4MZKA 1UUSA 2CTNA 1QS7A 1K90D 2M8UA 1CM1A 4DCKA 3EK8A 4I5KA 5G08A 2ISDA 1B8LA 2JOJA 2I18A 3OX6A 2L2EA 3AKBA 3AAJA 4CIDA 3DD4A 2KYFA 2CNPA 1A29A 1J55A 2PVBA 3EKHA 1UWOA 2JT3A 1IJ6A 4GBAA 2KOTA 1BF5A 1KK8B 4MZJA 2KBIA 3BXKA 5KU1A 2LAPA 2IS9A 1Q80A 1TRFA 1CFFA 4HSZA 2KI6C 3SG5A 1S26D 1JFJA 4YBHB 1NP8A 1UHNA 1WLMA 1KK8C 3I5IC 1MUXA 2WCFA 4UPGA 3I5HB 4CFQA 1KK7Y 2BL0B 3C1VA 2JRFA 1DTLA 3NSLA 5J3XA 2M0RA 1YR5A 2K2FA 1B4CA 1B8RA 1AUIB 3BYAA 5DKQA 3NSKA 2PMYA 2KHNA 2WC8A 1KFXS 4M2QA 1K93D 4NDDA 2LP2A 3DVKA 2LNKA 2I7AA 4ZCUA 1TN4A 1LA0A 2F2OA 4U8DA 4PHNA 4XJKA 4C0KA 1PALA 5F6TA 1Y1UA 3CS1A 5D7FA 1YUUA 1V1GA 3PN7B 4ORBB 2PRUA 4IL1A 4MEWA 2K7BA 2BE4A 4JWQA 1S5GY 3VRQA 1BLQA 2MHHA 3SIBA 1MXEA 1QLKA 1SL9A 1BG1A 1OMDA 1QX7A 1YX7A 1H8BA 1QVIY 1SNLA 2LMTA 1K2HA 1PULA 2KAVA 2LVIA 1IWQA 3HX4A 2KGBC 3VROA 1H4BA 4NDBA 4JPZB 1QLSA 3OX5A 3PALA 2M49B 1IQ3A 4PALA 1KSOA 1QVIZ 1XYDA 1E8AA 2VRGA 3WHUB 4OV2A 2BCBA 2KFFA 3TDZA 3ZWHA 1TCOB 2R2IA 3LK1A 3VRRA 1L2OC 2M9GA 1L7ZA 1SCVA 3E3RA 2MJWB 1KFUL 4OVNF 4N1FA 2BKHB 5I2LA 1A75A 1LVCD 1SK6D 1B7TZ 3M0WA 1NYAA 1WDCB 1NUBA 2KQ6A 2MA2A 1DJGA 1CFPA 2LMVA 2K8MB 3DVJA 4WRIA 4HREE 3EK7A 1G4YR 4FTGA 4Q04A 2GGMA 3WNXB 1ZOTB 1CTRA 3LL8B 1A75B 3TDUA 4N5XA 1CLLA 3AKAA 2F3YA 4ORAB 3SG2A 3EKJA 2OTGB 1DGVA 2EC6C 5CSJA 2O60A 1LA3A 1R6PA 1DGUA 3CGAA 1SL7A 2LE9B 2BKIB 1OZOA 1DJZA 5ER5A 5HLVA 2AAOA 1YRTB 2OTGC 1RROA 4MSPA 4ZCVA 2KI4B 1QV0A 4XYNA 2JZIA 4F0ZB 1CDLA 1JC2A 1FI5A 3GOFA 2ZN9A 2JQ6A 3O4YA 3KEVA 2MBXA 1EJ3A 2KYCA 2BL0C 2JXCA 1MR8A 3D10A 3PM8A 4P2YB 1JWDA 1BODA 1YVLA 2WCBA 4DRWA 3CTNA 2JXLA 2ZNDA 1CFCA 1OZSA 2I94A 2JT8A 3DF0A 1DJHA 1Y6WA 5BPJA 2K61A 2Y4QA 2COLB 2KI4C 4OKHA 1SRAA 3PFVA 1CKKA 4QJ4B 1SL8A 1NX0A
chains in the Genus database with same CATH superfamily
3SS5A 1K8UA 1GGZA 2M7LA 2JTZA 2KBMA 2WCMA 3FIAA 1UURA 1W7JB 4YGAA 1VRKA 1KQVA 1XFYO 4OR9B 1BOCA 1OOFA 4DUQA 5I2OA 2BNXA 1AVSA 5PALA 1N0YA 2BCAA 1W7IB 2JNXA 2KGRA 2P71A 3SG4A 1CDMA 3TUYB 3UO9A 3I5GB 1DELA 2ZNEA 1NX3A 1NWDA 1A4PA 1XFVO 3S0BA 4ORCB 3D0YB 1MQ1A 4OCIA 1JFKA 2A4JA 1Z2CB 3R1PA 1N65A 3BUNB 4JKTA 3S0GA 2NCPA 4JD9A 2KAXA 2H61C 1TNXA 3I5IB 3K21A 4R1EA 3GK2A 1NCYA 2LHIA 1CM4A 2K7OA 3JVTB 3OB1B 1RK9A 2KPHA 2WORA 1OQPA 1DJIA 2L50A 3DF0B 1QXPA 2G9BA 2F2PA 1GQMA 4AQIA 2M1KB 2M7NA 1BU3A 2P70A 4PDZA 3ICBA 4YI9A 1QJTA 3EK4A 3GK1A 1YRUB 4M2PA 3TZ1A 1LXFC 2WOSA 1C3ZA 5CSNA 5DICA 1TUJA 2BBNA 3BUMB 4YI8A 3OBVA 5FI6A 1OSAA 1YUTA 1K95A 4I5NB 1QX2A 4YRUA 2OS8C 2KFGA 3SG6A 1XFWO 3CDNA 2L4HA 1U5IA 4DIRA 2L5YA 1G33A 1KK7Z 1QWVA 2MAZA 2JULA 1EG3A 1JF2A 2M29A 3OB2B 2LVKA 3EG5B 3NXAA 1CDPA 3KHEA 3BFHA 2Y1MA 4ICBA 2PALA 1YVHA 4AQJA 1JUOA 2DOQA 1YTZC 4L9MA 2K7DA 4F7FA 2JU0A 1NCXA 1B9AA 1F8HA 1IJ5A 4E68A 2MRDA 1ALWA 1SCMC 3FWBA 1SW8A 1XA5A 3DVEA 4MVFA 3TS5B 2WCEA 3DXLA 1IQ5A 1S5GZ 2NLNA 5I2QA 2PASA 4YGEB 1KQMC 1KSMA 2O5GA 4AOMA 1XFRA 1WRLA 4XJKB 2GGZA 1K96A 1OMRA 2E6WA 3NSIA 1B8CA 2OPOA 1EXRA 2KQYA 3CR5X 1NCZA 2JC2A 4N1GA 3F45A 4USLA 2WC6A 3D73A 1Y1AA 4TNCA 1NX2A 4PE4A 3R1VA 2LC5A 2KLEA 3CZ2A 4WQ2A 1YUSA 1ZACA 2OS8B 2PYQA 2V53A 5AANA 1UHHA 4DS7A 2G2BA 2E30A 5D69A 3GK4X 1UP5A 1YURA 3R1OA 1XK4A 5HLOA 3PLFB 1CFDA 4INWA 1UHJA 4FQOA 3BFAA 3BJHA 1U5IB 3DVMA 2JT0A 1V1FA 1IKUA 4NDCA 3IVTA 1M31A 2BBMA 2LVVA 3VRPA 3CLNA 4YGBB 2LLUA 2TN4A 2M3WA 3OHMB 5K89A 2LMUA 2ZN8A 3DZTA 3K1EA 4GGNA 1DJYA 1QATA 4FQTA 1B7TY 1OMVA 3RLZA 4A4BA 3EVUA 1S6JA 1WY9A 2LLTA 1XFZO 3ZNIA 2LUCA 1CDNA 2I2RE 3R72A 1KWOC 4GPLB 1OOJA 1KCYA 2KDHA 3TUYC 2BCXA 2YGUA 1SBJA 3CZ0A 2MLEC 1AHRA 3CZ1A 1AJ4A 1DF0A 3B86A 1PRWA 3V2LA 2M97A 5AERA 3BUOB 1DJWA 1J1DA 1M45A 1QX5B 4PE7A 1XVJA 1MWNA 5I8NA 1LS8A 2LHLA 4CLNA 1TIZA 1J1EA 1QIWA 1DVIA 2LP3A 1FBVA 2LLSA 2CCMA 1GJYA 2WCHA 1MXLC 3PN7C 1FF1A 3S0EA 4HRHA 2K60A 1BR1B 1S1EA 5I94A 1C07A 2CBLA 3CWGA 1IGVA 3RZSA 4MRXA 2H2KA 1F4OA 2JNFA 2QPTA 5JJGA 1C7VA 2KSPA 3L4AA 1LKJA 1MF8B 1OE9B 2FCEA 2SCPA 3MSEB 4GUKA 2LCPA 1S6IA 1TCFA 2SASA 3NHIA 2K7CA 1RECA 4JQ0D 1A2XA 1HQVA 2PSRA 4ETOA 2ZRSA 1UHKA 2H61A 3VRNA 1QASA 4NQGA 5ER4X 5AFPA 1DMOA 1NIWA 1GGWA 1AP4A 2JPTA 2L2CA 1BT6A 1WRKA 1IH0A 5HKWA 3SG3A 3FWCA 2QACA 1NSHA 3A4UB 4PHMA 1FW4A 1K9KA 2F3ZA 5GQQC 1IG5A 2HF5A 1JBAA 1KFUS 1YX8A 2KNEA 2L4IA 2MLFC 1LINA 2B1UA 4M2OA 3SIAA 2JTTA 1B47A 2GV5A 3DYEA 4D1EA 1M46A 3IQQA 3O6BA 1DJXA 1AK8A 1SCMB 3TDIA 1BJFA 3TS5C 1M39A 2Q91A 2Q4UA 4P5OE 2QEVA 5DKRA 3RM1A 2D8NA 3AAKA 3CR2A 3CR4X 1Z4HA 2L5XB 2LUXA 3LLEA 4WQ3A 1B1GA 5CSFA 1CNPA 2NXQA 3I5GC 3Q8IA 2L51A 3VGOA 1OW4A 1XO5A 1QIVA 1F4QA 1J7PA 1EL4A 1AJ5A 1KWOB 1TNWA 1UHIA 2NZ0A 4QJ5B 3JVTC 3WHTB 3EVRA 2ZRTA 5DKNA 3VB1A 1PSBA 3IF7A 2WCLA 1TWOA 3SG7A 1PVAA 1RWYA 1DF0B 2KI6D 1RJVA 3I5HC 3LCPC 3BOWB 3A8RA 1ZMZA 5AXIA 4GNKB 1TNQA 1OOIX 3LK0A 1F54A 1L2OB 1A03A 4BY4A 1OOHA 1X02A 2CT9A 2CXJA 2M1UA 2QEHA 1J7QA 1FI6A 2FJUB 3KF9A 3B88A 3WXAA 4YGDB 5KTYA 2L0PA 1TNPA 1F71A 3O78A 2LANA 5CSIA 1PK0D 1S36A 3HCMA 1XFXO 1R2UA 1RTP1 2K0JA 3NSOA 4BY5A 3PATA 4PT1A 1EH2A 1C7WA 1J7RA 2JWWA 4MRYA 4MZLA 4C0JA 2HETA 1ZUZA 1M63B 2Y1NA 1EG4A 1WLZA 2F8PA 5D3OA 2Y5IA 2AUCA 1F70A 2BAPA 4YGCB 1G8IA 1ODBA 3IQOA 1NX1A 2BECA 1RFJA 3H4SE 1CLBA 2ZFDA 3I5FC 2LVJA 2P6BB 3PSRA 1DT7B 5B8IB 1J7OA 4CFRA 5AEQA 1SSEB 4GGFC 5FI7A 1WDCC 4PHKA 3KO0A 4GGFA 2FCDA 1PSRA 1BMOA 3OGNA 4PCWA 2AMIA 1SR6B 1IRJA 2PQLA 2WCJA 3L4LA 1SYMA 3BUWB 3CZTX 1K94A 1NPQA 2ERBA 1S6CA 5TNCA 1Y1XA 1QV1A 2F33A 1FPWA 2L98A 3BUXB 3JTDB 4MBEA 4GAOA 1SKTA 3EVVA 2K2AA 3O2PA 1CMFA 2EGDA 1WRZA 5JOLA 5FI2A 1TOPA 2BE6A 4CPVA 2KFHA 5HKZA 5KSZA 2EHBA 3NHTA 2KLDA 4C0LA 2HQ8A 3BOWA 1TTXA 1MHOA 1F55A 2NCOA 3SS4A 1SPYA 1HT9A 5FYXA 1Y0VH 4I5JA 4GFTA 1N2DA 5CPVA 1SMGA 4MN0A 2HQWA 1CMGA 3DY9A 3OP0A 1CB1A 3D0YA 1JSAA 1KFXL 1PVBA 5HKYA 4PE0A 2LM5A 3I5FB 5IBWA 1K9UA 2FOTA 2WNDA 2KAYA 3JTDC 1ZFSA 1BR4B 2ZKMX 3UNWA 2FJYA 3SJSA 1XFUO 1D1OA 4PHJA 4HRGA 1KQMB 2QEBA 2RGIA 3D74A 5HYDA 2EC6B 1SR6C 4MLWA 3KPXA 3BQ3A 4QJ3B 3QRXA 1SY9A 3FS7A 4I5LB 2HPSA 1CLMA 4PE1A 1QTXA 1JF0A 4A4CA 1K9PA 1XK4C 3NGVA 1ALVA 1S3PA 2LV7A 4MZKA 1UUSA 2CTNA 1QS7A 1K90D 2M8UA 1C3YA 1CM1A 4DCKA 3EK8A 4I5KA 5G08A 2ISDA 3S0DA 1B8LA 2JOJA 2I18A 3OX6A 2L2EA 3SS3A 3AKBA 3AAJA 4CIDA 3DD4A 2KYFA 2CNPA 1A29A 1J55A 2PVBA 3EKHA 1UWOA 2JT3A 1IJ6A 2WCKA 4GBAA 2KOTA 1BF5A 1KK8B 4MZJA 2KBIA 3BXKA 5KU1A 2LAPA 2IS9A 1Q80A 1TRFA 1CFFA 4HSZA 2KI6C 3SG5A 1T14A 1S26D 1JFJA 4YBHB 1NP8A 1UHNA 3CABA 3N7HA 1WLMA 3PJIA 1KK8C 3QMEA 3I5IC 1MUXA 2WCFA 4UPGA 3I5HB 4CFQA 2JPOA 1KK7Y 2BL0B 3C1VA 2JRFA 2GTEA 1DTLA 3NSLA 5J3XA 2M0RA 1YR5A 2K2FA 1B4CA 1B8RA 1AUIB 3S0AA 3BYAA 5DKQA 3NSKA 2PMYA 2KHNA 5HL1A 2WC8A 4IJ7A 3BFBA 1KFXS 4M2QA 1K93D 4NDDA 2LP2A 3DVKA 2LNKA 2I7AA 3L47A 4ZCUA 1TN4A 1LA0A 2F2OA 4U8DA 4PHNA 4XJKA 4C0KA 1PALA 5F6TA 1Y1UA 3CS1A 5D7FA 1YUUA 1V1GA 3PN7B 4ORBB 2PRUA 3D75A 4IL1A 2WC5A 4MEWA 2K7BA 2BE4A 4JWQA 1P28A 1S5GY 3D78A 3VRQA 1BLQA 2MHHA 3FE9A 3SIBA 1MXEA 1DEKA 1QLKA 1SL9A 1OMDA 1QX7A 1YX7A 1BG1A 1H8BA 1SNLA 1QVIY 3B6XA 2LMTA 1K2HA 1PULA 2KAVA 2LVIA 1IWQA 3HX4A 2KGBC 3VROA 4OZDA 1H4BA 4NDBA 1IIOA 4JPZB 1QLSA 3D77A 3OX5A 3PALA 2M49B 1IQ3A 4PALA 1KSOA 1QVIZ 1XYDA 1GM0A 1E8AA 2VRGA 2QDIA 4OV2A 2BCBA 2KFFA 3TDZA 3WHUB 1TCOB 2R2IA 3LK1A 3VRRA 3ZWHA 1L2OC 2M9GA 1L7ZA 1SCVA 3E3RA 2MJWB 1KFUL 4OVNF 4N1FA 2BKHB 5I2LA 1A75A 1LVCD 5EL2A 1SK6D 1B7TZ 3M0WA 1NYAA 1WDCB 1NUBA 1DC1A 2KQ6A 2MA2A 1DJGA 1CFPA 2LMVA 2K8MB 3DVJA 3PM2A 4WRIA 4HREE 3EK7A 1G4YR 1ORGA 4FTGA 4Q04A 2GGMA 3WNXB 1ZOTB 1CTRA 3LL8B 1A75B 3FE8A 3TDUA 3B7AA 4N5XA 3B87A 1CLLA 3AKAA 2F3YA 4ORAB 3SG2A 3EKJA 4INXA 2OTGB 1DGVA 2EC6C 5CSJA 2O60A 1LA3A 1R6PA 1DGUA 3CGAA 1SL7A 2LE9B 2BKIB 1OZOA 1DJZA 5ER5A 5HLVA 2AAOA 1YRTB 3FE6A 2OTGC 1RROA 4MSPA 4ZCVA 2KI4B 1QV0A 4XYNA 2JZIA 4F0ZB 1CDLA 1JC2A 1FI5A 3GOFA 2ZN9A 2JQ6A 3O4YA 3KEVA 2MBXA 3O4XA 1OOGA 3D76A 1W9ZA 3CYZA 1EJ3A 2KYCA 2BL0C 2JXCA 1MR8A 2QEOA 3D10A 3PM8A 4P2YB 1JWDA 1BODA 1YVLA 1DQEA 2WCBA 4DRWA 3CTNA 2JXLA 2ZNDA 1TUZA 1OZSA 1CFCA 2I94A 2JT8A 3DF0A 4KYNA 1DJHA 1Y6WA 5BPJA 2K61A 2Y4QA 3S0FA 2COLB 2KI4C 4OKHA 1SRAA 3PFVA 1CKKA 4QJ4B 2H8VA 1SL8A 1NX0A
chains in the Genus database with same CATH topology
1K8UA 1GGZA 2M7LA 2JTZA 2KBMA 3FIAA 1UURA 1W7JB 4YGAA 1VRKA 1KQVA 1XFYO 4OR9B 1BOCA 4DUQA 5I2OA 5PALA 1AVSA 1N0YA 2BCAA 1W7IB 2JNXA 2KGRA 3SG4A 3TUYB 1CDMA 3I5GB 2ZNEA 1NX3A 1NWDA 1A4PA 1XFVO 4ORCB 3D0YB 1MQ1A 4OCIA 1JFKA 2A4JA 1N65A 3BUNB 2NCPA 2KAXA 2H61C 1TNXA 3I5IB 3K21A 4R1EA 3GK2A 1NCYA 2LHIA 1CM4A 2K7OA 3JVTB 3OB1B 1RK9A 2WORA 1OQPA 1DJIA 2L50A 3DF0B 1QXPA 2G9BA 2F2PA 1GQMA 4AQIA 2M1KB 2M7NA 1BU3A 4PDZA 3ICBA 4YI9A 1QJTA 3EK4A 3GK1A 1YRUB 4M2PA 3TZ1A 1LXFC 2WOSA 5CSNA 2BBNA 3BUMB 4YI8A 1OSAA 1YUTA 1K95A 4I5NB 1QX2A 4YRUA 2OS8C 2KFGA 3SG6A 1XFWO 2L4HA 1U5IA 4DIRA 1G33A 1KK7Z 2MAZA 3OB2B 2JULA 1EG3A 1JF2A 2M29A 2LVKA 3NXAA 1CDPA 3KHEA 2Y1MA 4ICBA 2PALA 1YVHA 4AQJA 1JUOA 2DOQA 1YTZC 4L9MA 2K7DA 2JU0A 1NCXA 1B9AA 1F8HA 1IJ5A 4E68A 2MRDA 1ALWA 1SCMC 3FWBA 1SW8A 1XA5A 3DVEA 4MVFA 3TS5B 2WCEA 1IQ5A 1S5GZ 2NLNA 5I2QA 2PASA 4YGEB 1KQMC 1KSMA 2O5GA 4AOMA 4XJKB 1WRLA 2GGZA 1K96A 1OMRA 2E6WA 3NSIA 1B8CA 2OPOA 1EXRA 2KQYA 3CR5X 1NCZA 2JC2A 4N1GA 3F45A 4USLA 1Y1AA 4TNCA 1NX2A 4PE4A 2LC5A 4WQ2A 1YUSA 1ZACA 2OS8B 2V53A 5AANA 1UHHA 4DS7A 2G2BA 2E30A 5D69A 3GK4X 1UP5A 1YURA 1XK4A 5HLOA 3PLFB 1CFDA 1UHJA 4FQOA 1U5IB 3DVMA 2JT0A 1V1FA 1IKUA 4NDCA 1M31A 2BBMA 2LVVA 3VRPA 3CLNA 4YGBB 2LLUA 2TN4A 2M3WA 3OHMB 5K89A 2LMUA 2ZN8A 4GGNA 1DJYA 1QATA 1B7TY 1OMVA 3RLZA 4A4BA 3EVUA 1S6JA 1WY9A 2LLTA 1XFZO 3ZNIA 2LUCA 1CDNA 2I2RE 1KWOC 4GPLB 1OOJA 1KCYA 2KDHA 3TUYC 2BCXA 1SBJA 2MLEC 1AHRA 1AJ4A 1DF0A 1PRWA 2M97A 5AERA 3BUOB 1DJWA 1J1DA 1M45A 1QX5B 4PE7A 1XVJA 1MWNA 5I8NA 2LHLA 4CLNA 1J1EA 1QIWA 1TIZA 1DVIA 2LP3A 1FBVA 2LLSA 2CCMA 1GJYA 1FF1A 1MXLC 3PN7C 4HRHA 1BR1B 1S1EA 1C07A 2CBLA 3CWGA 1IGVA 4MRXA 2H2KA 1F4OA 2JNFA 2QPTA 5JJGA 1C7VA 2KSPA 4GUKA 1LKJA 1MF8B 1OE9B 2FCEA 2SCPA 3MSEB 2LCPA 1S6IA 1TCFA 2SASA 2K7CA 1RECA 4JQ0D 1A2XA 1HQVA 2PSRA 4ETOA 2ZRSA 1UHKA 2H61A 3VRNA 1QASA 4NQGA 5ER4X 5AFPA 1DMOA 1NIWA 1GGWA 1AP4A 2JPTA 1BT6A 1WRKA 1IH0A 5HKWA 3SG3A 3FWCA 2QACA 1NSHA 3A4UB 4PHMA 1FW4A 1K9KA 2F3ZA 5GQQC 1IG5A 2HF5A 1JBAA 1KFUS 1YX8A 2KNEA 2L4IA 2MLFC 1LINA 2B1UA 4M2OA 3SIAA 2JTTA 1B47A 2GV5A 4D1EA 1AK8A 1M46A 3IQQA 3O6BA 1DJXA 1SCMB 3TDIA 1BJFA 3TS5C 1M39A 2Q91A 2Q4UA 4P5OE 5DKRA 3RM1A 2D8NA 3AAKA 3CR2A 3CR4X 3LLEA 2L5XB 2LUXA 4WQ3A 1B1GA 5CSFA 1CNPA 2NXQA 3I5GC 3VGOA 2L51A 1XO5A 1QIVA 1F4QA 1J7PA 1EL4A 1AJ5A 1KWOB 1TNWA 1UHIA 2NZ0A 4QJ5B 3JVTC 3WHTB 3EVRA 2ZRTA 5DKNA 1PSBA 3IF7A 3SG7A 1PVAA 1RWYA 1DF0B 2KI6D 1RJVA 3I5HC 3LCPC 3BOWB 3A8RA 1ZMZA 5AXIA 4GNKB 1TNQA 3LK0A 1F54A 1L2OB 1A03A 4BY4A 1X02A 2CT9A 2CXJA 2M1UA 1J7QA 1FI6A 2FJUB 3KF9A 3WXAA 4YGDB 5KTYA 2L0PA 1TNPA 1F71A 3O78A 2LANA 5CSIA 1PK0D 1S36A 3HCMA 1XFXO 1R2UA 1RTP1 2K0JA 3NSOA 4BY5A 3PATA 1EH2A 1C7WA 1J7RA 2JWWA 4MRYA 4MZLA 4C0JA 2HETA 1ZUZA 1M63B 2Y1NA 1EG4A 1WLZA 2F8PA 2Y5IA 2AUCA 1F70A 4YGCB 1G8IA 1ODBA 3IQOA 1NX1A 2BECA 1RFJA 3H4SE 1CLBA 2ZFDA 3I5FC 2LVJA 2P6BB 3PSRA 1DT7B 5B8IB 1J7OA 4CFRA 5AEQA 4GGFC 1WDCC 4PHKA 3KO0A 4GGFA 2FCDA 1PSRA 1BMOA 4PCWA 2AMIA 1SR6B 1IRJA 1SYMA 3BUWB 3CZTX 1K94A 1NPQA 1S6CA 5TNCA 1Y1XA 1QV1A 2F33A 1FPWA 2L98A 3BUXB 3JTDB 4MBEA 4GAOA 1SKTA 3EVVA 2K2AA 3O2PA 1CMFA 2EGDA 1WRZA 5JOLA 1TOPA 2BE6A 4CPVA 2KFHA 5HKZA 5KSZA 2EHBA 4C0LA 2HQ8A 3BOWA 1TTXA 1MHOA 1F55A 2NCOA 1SPYA 1HT9A 5FYXA 1Y0VH 4I5JA 4GFTA 1N2DA 5CPVA 1SMGA 4MN0A 2HQWA 1CMGA 3OP0A 1CB1A 3D0YA 1JSAA 1KFXL 1PVBA 5HKYA 4PE0A 2LM5A 3I5FB 5IBWA 1K9UA 2FOTA 2WNDA 2KAYA 3JTDC 1ZFSA 1BR4B 2ZKMX 3SJSA 1XFUO 1D1OA 4PHJA 4HRGA 1KQMB 2RGIA 5HYDA 2EC6B 1SR6C 4MLWA 3KPXA 3BQ3A 4QJ3B 3QRXA 1SY9A 3FS7A 4I5LB 2HPSA 1CLMA 4PE1A 1QTXA 1JF0A 4A4CA 1K9PA 1XK4C 1ALVA 1S3PA 2LV7A 4MZKA 1UUSA 2CTNA 1QS7A 1K90D 2M8UA 1CM1A 4DCKA 3EK8A 4I5KA 5G08A 2ISDA 1B8LA 2JOJA 2I18A 3OX6A 2L2EA 3AKBA 3AAJA 4CIDA 3DD4A 2KYFA 2CNPA 1A29A 1J55A 2PVBA 3EKHA 1UWOA 2JT3A 1IJ6A 4GBAA 2KOTA 1BF5A 1KK8B 4MZJA 2KBIA 3BXKA 5KU1A 2LAPA 2IS9A 1Q80A 1TRFA 1CFFA 4HSZA 2KI6C 3SG5A 1S26D 1JFJA 4YBHB 1NP8A 1UHNA 1WLMA 1KK8C 3I5IC 1MUXA 2WCFA 4UPGA 3I5HB 4CFQA 1KK7Y 2BL0B 3C1VA 2JRFA 1DTLA 3NSLA 5J3XA 2M0RA 1YR5A 2K2FA 1B4CA 1B8RA 1AUIB 3BYAA 5DKQA 3NSKA 2PMYA 2KHNA 2WC8A 1KFXS 4M2QA 1K93D 4NDDA 2LP2A 3DVKA 2LNKA 2I7AA 4ZCUA 1TN4A 1LA0A 2F2OA 4U8DA 4PHNA 4XJKA 4C0KA 1PALA 5F6TA 1Y1UA 3CS1A 5D7FA 1YUUA 1V1GA 3PN7B 4ORBB 2PRUA 4IL1A 4MEWA 2K7BA 2BE4A 4JWQA 1S5GY 3VRQA 1BLQA 2MHHA 3SIBA 1MXEA 1QLKA 1SL9A 1BG1A 1OMDA 1QX7A 1YX7A 1H8BA 1QVIY 1SNLA 2LMTA 1K2HA 1PULA 2KAVA 2LVIA 1IWQA 3HX4A 2KGBC 3VROA 1H4BA 4NDBA 4JPZB 1QLSA 3OX5A 3PALA 2M49B 1IQ3A 4PALA 1KSOA 1QVIZ 1XYDA 1E8AA 2VRGA 3WHUB 4OV2A 2BCBA 2KFFA 3TDZA 3ZWHA 1TCOB 2R2IA 3LK1A 3VRRA 1L2OC 2M9GA 1L7ZA 1SCVA 3E3RA 2MJWB 1KFUL 4OVNF 4N1FA 2BKHB 5I2LA 1A75A 1LVCD 1SK6D 1B7TZ 3M0WA 1NYAA 1WDCB 1NUBA 2KQ6A 2MA2A 1DJGA 1CFPA 2LMVA 2K8MB 3DVJA 4WRIA 4HREE 3EK7A 1G4YR 4FTGA 4Q04A 2GGMA 3WNXB 1ZOTB 1CTRA 3LL8B 1A75B 3TDUA 4N5XA 1CLLA 3AKAA 2F3YA 4ORAB 3SG2A 3EKJA 2OTGB 1DGVA 2EC6C 5CSJA 2O60A 1LA3A 1R6PA 1DGUA 3CGAA 1SL7A 2LE9B 2BKIB 1OZOA 1DJZA 5ER5A 5HLVA 2AAOA 1YRTB 2OTGC 1RROA 4MSPA 4ZCVA 2KI4B 1QV0A 4XYNA 2JZIA 4F0ZB 1CDLA 1JC2A 1FI5A 3GOFA 2ZN9A 2JQ6A 3O4YA 3KEVA 2MBXA 1EJ3A 2KYCA 2BL0C 2JXCA 1MR8A 3D10A 3PM8A 4P2YB 1JWDA 1BODA 1YVLA 2WCBA 4DRWA 3CTNA 2JXLA 2ZNDA 1CFCA 1OZSA 2I94A 2JT8A 3DF0A 1DJHA 1Y6WA 5BPJA 2K61A 2Y4QA 2COLB 2KI4C 4OKHA 1SRAA 3PFVA 1CKKA 4QJ4B 1SL8A 1NX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8U A;  1GGZ A;  2M7L A;  2JTZ A;  2KBM A;  3FIA A;  1UUR A;  1W7J B;  4YGA A;  1VRK A;  1KQV A;  1XFY O;  4OR9 B;  1BOC A;  4DUQ A;  5I2O A;  5PAL A;  1AVS A;  1N0Y A;  2BCA A;  1W7I B;  2JNX A;  2KGR A;  3SG4 A;  3TUY B;  1CDM A;  3I5G B;  2ZNE A;  1NX3 A;  1NWD A;  1A4P A;  1XFV O;  4ORC B;  3D0Y B;  1MQ1 A;  4OCI A;  1JFK A;  2A4J A;  1N65 A;  3BUN B;  2NCP A;  2KAX A;  2H61 C;  1TNX A;  3I5I B;  3K21 A;  4R1E A;  3GK2 A;  1NCY A;  2LHI A;  1CM4 A;  2K7O A;  3JVT B;  3OB1 B;  1RK9 A;  2WOR A;  1OQP A;  1DJI A;  2L50 A;  3DF0 B;  1QXP A;  2G9B A;  2F2P A;  1GQM A;  4AQI A;  2M1K B;  2M7N A;  1BU3 A;  4PDZ A;  3ICB A;  4YI9 A;  1QJT A;  3EK4 A;  3GK1 A;  1YRU B;  4M2P A;  3TZ1 A;  1LXF C;  2WOS A;  5CSN A;  2BBN A;  3BUM B;  4YI8 A;  1OSA A;  1YUT A;  1K95 A;  4I5N B;  1QX2 A;  4YRU A;  2OS8 C;  2KFG A;  3SG6 A;  1XFW O;  2L4H A;  1U5I A;  4DIR A;  1G33 A;  1KK7 Z;  2MAZ A;  3OB2 B;  2JUL A;  1EG3 A;  1JF2 A;  2M29 A;  2LVK A;  3NXA A;  1CDP A;  3KHE A;  2Y1M A;  4ICB A;  2PAL A;  1YVH A;  4AQJ A;  1JUO A;  2DOQ A;  1YTZ C;  4L9M A;  2K7D A;  2JU0 A;  1NCX A;  1B9A A;  1F8H A;  1IJ5 A;  4E68 A;  2MRD A;  1ALW A;  1SCM C;  3FWB A;  1SW8 A;  1XA5 A;  3DVE A;  4MVF A;  3TS5 B;  2WCE A;  1IQ5 A;  1S5G Z;  2NLN A;  5I2Q A;  2PAS A;  4YGE B;  1KQM C;  1KSM A;  2O5G A;  4AOM A;  4XJK B;  1WRL A;  2GGZ A;  1K96 A;  1OMR A;  2E6W A;  3NSI A;  1B8C A;  2OPO A;  1EXR A;  2KQY A;  3CR5 X;  1NCZ A;  2JC2 A;  4N1G A;  3F45 A;  4USL A;  1Y1A A;  4TNC A;  1NX2 A;  4PE4 A;  2LC5 A;  4WQ2 A;  1YUS A;  1ZAC A;  2OS8 B;  2V53 A;  5AAN A;  1UHH A;  4DS7 A;  2G2B A;  2E30 A;  5D69 A;  3GK4 X;  1UP5 A;  1YUR A;  1XK4 A;  5HLO A;  3PLF B;  1CFD A;  1UHJ A;  4FQO A;  1U5I B;  3DVM A;  2JT0 A;  1V1F A;  1IKU A;  4NDC A;  1M31 A;  2BBM A;  2LVV A;  3VRP A;  3CLN A;  4YGB B;  2LLU A;  2TN4 A;  2M3W A;  3OHM B;  5K89 A;  2LMU A;  2ZN8 A;  4GGN A;  1DJY A;  1QAT A;  1B7T Y;  1OMV A;  3RLZ A;  4A4B A;  3EVU A;  1S6J A;  1WY9 A;  2LLT A;  1XFZ O;  3ZNI A;  2LUC A;  1CDN A;  2I2R E;  1KWO C;  4GPL B;  1OOJ A;  1KCY A;  2KDH A;  3TUY C;  2BCX A;  1SBJ A;  2MLE C;  1AHR A;  1AJ4 A;  1DF0 A;  1PRW A;  2M97 A;  5AER A;  3BUO B;  1DJW A;  1J1D A;  1M45 A;  1QX5 B;  4PE7 A;  1XVJ A;  1MWN A;  5I8N A;  2LHL A;  4CLN A;  1J1E A;  1QIW A;  1TIZ A;  1DVI A;  2LP3 A;  1FBV A;  2LLS A;  2CCM A;  1GJY A;  1FF1 A;  1MXL C;  3PN7 C;  4HRH A;  1BR1 B;  1S1E A;  1C07 A;  2CBL A;  3CWG A;  1IGV A;  4MRX A;  2H2K A;  1F4O A;  2JNF A;  2QPT A;  5JJG A;  1C7V A;  2KSP A;  4GUK A;  1LKJ A;  1MF8 B;  1OE9 B;  2FCE A;  2SCP A;  3MSE B;  2LCP A;  1S6I A;  1TCF A;  2SAS A;  2K7C A;  1REC A;  4JQ0 D;  1A2X A;  1HQV A;  2PSR A;  4ETO A;  2ZRS A;  1UHK A;  2H61 A;  3VRN A;  1QAS A;  4NQG A;  5ER4 X;  5AFP A;  1DMO A;  1NIW A;  1GGW A;  1AP4 A;  2JPT A;  1BT6 A;  1WRK A;  1IH0 A;  5HKW A;  3SG3 A;  3FWC A;  2QAC A;  1NSH A;  3A4U B;  4PHM A;  1FW4 A;  1K9K A;  2F3Z A;  5GQQ C;  1IG5 A;  2HF5 A;  1JBA A;  1KFU S;  1YX8 A;  2KNE A;  2L4I A;  2MLF C;  1LIN A;  2B1U A;  4M2O A;  3SIA A;  2JTT A;  1B47 A;  2GV5 A;  4D1E A;  1AK8 A;  1M46 A;  3IQQ A;  3O6B A;  1DJX A;  1SCM B;  3TDI A;  1BJF A;  3TS5 C;  1M39 A;  2Q91 A;  2Q4U A;  4P5O E;  5DKR A;  3RM1 A;  2D8N A;  3AAK A;  3CR2 A;  3CR4 X;  3LLE A;  2L5X B;  2LUX A;  4WQ3 A;  1B1G A;  5CSF A;  1CNP A;  2NXQ A;  3I5G C;  3VGO A;  2L51 A;  1XO5 A;  1QIV A;  1F4Q A;  1J7P A;  1EL4 A;  1AJ5 A;  1KWO B;  1TNW A;  1UHI A;  2NZ0 A;  4QJ5 B;  3JVT C;  3WHT B;  3EVR A;  2ZRT A;  5DKN A;  1PSB A;  3IF7 A;  3SG7 A;  1PVA A;  1RWY A;  1DF0 B;  2KI6 D;  1RJV A;  3I5H C;  3LCP C;  3BOW B;  3A8R A;  1ZMZ A;  5AXI A;  4GNK B;  1TNQ A;  3LK0 A;  1F54 A;  1L2O B;  1A03 A;  4BY4 A;  1X02 A;  2CT9 A;  2CXJ A;  2M1U A;  1J7Q A;  1FI6 A;  2FJU B;  3KF9 A;  3WXA A;  4YGD B;  5KTY A;  2L0P A;  1TNP A;  1F71 A;  3O78 A;  2LAN A;  5CSI A;  1PK0 D;  1S36 A;  3HCM A;  1XFX O;  1R2U A;  1RTP 1;  2K0J A;  3NSO A;  4BY5 A;  3PAT A;  1EH2 A;  1C7W A;  1J7R A;  2JWW A;  4MRY A;  4MZL A;  4C0J A;  2HET A;  1ZUZ A;  1M63 B;  2Y1N A;  1EG4 A;  1WLZ A;  2F8P A;  2Y5I A;  2AUC A;  1F70 A;  4YGC B;  1G8I A;  1ODB A;  3IQO A;  1NX1 A;  2BEC A;  1RFJ A;  3H4S E;  1CLB A;  2ZFD A;  3I5F C;  2LVJ A;  2P6B B;  3PSR A;  1DT7 B;  5B8I B;  1J7O A;  4CFR A;  5AEQ A;  4GGF C;  1WDC C;  4PHK A;  3KO0 A;  4GGF A;  2FCD A;  1PSR A;  1BMO A;  4PCW A;  2AMI A;  1SR6 B;  1IRJ A;  1SYM A;  3BUW B;  3CZT X;  1K94 A;  1NPQ A;  1S6C A;  5TNC A;  1Y1X A;  1QV1 A;  2F33 A;  1FPW A;  2L98 A;  3BUX B;  3JTD B;  4MBE A;  4GAO A;  1SKT A;  3EVV A;  2K2A A;  3O2P A;  1CMF A;  2EGD A;  1WRZ A;  5JOL A;  1TOP A;  2BE6 A;  4CPV A;  2KFH A;  5HKZ A;  5KSZ A;  2EHB A;  4C0L A;  2HQ8 A;  3BOW A;  1TTX A;  1MHO A;  1F55 A;  2NCO A;  1SPY A;  1HT9 A;  5FYX A;  1Y0V H;  4I5J A;  4GFT A;  1N2D A;  5CPV A;  1SMG A;  4MN0 A;  2HQW A;  1CMG A;  3OP0 A;  1CB1 A;  3D0Y A;  1JSA A;  1KFX L;  1PVB A;  5HKY A;  4PE0 A;  2LM5 A;  3I5F B;  5IBW A;  1K9U A;  2FOT A;  2WND A;  2KAY A;  3JTD C;  1ZFS A;  1BR4 B;  2ZKM X;  3SJS A;  1XFU O;  1D1O A;  4PHJ A;  4HRG A;  1KQM B;  2RGI A;  5HYD A;  2EC6 B;  1SR6 C;  4MLW A;  3KPX A;  3BQ3 A;  4QJ3 B;  3QRX A;  1SY9 A;  3FS7 A;  4I5L B;  2HPS A;  1CLM A;  4PE1 A;  1QTX A;  1JF0 A;  4A4C A;  1K9P A;  1XK4 C;  1ALV A;  1S3P A;  2LV7 A;  4MZK A;  1UUS A;  2CTN A;  1QS7 A;  1K90 D;  2M8U A;  1CM1 A;  4DCK A;  3EK8 A;  4I5K A;  5G08 A;  2ISD A;  1B8L A;  2JOJ A;  2I18 A;  3OX6 A;  2L2E A;  3AKB A;  3AAJ A;  4CID A;  3DD4 A;  2KYF A;  2CNP A;  1A29 A;  1J55 A;  2PVB A;  3EKH A;  1UWO A;  2JT3 A;  1IJ6 A;  4GBA A;  2KOT A;  1BF5 A;  1KK8 B;  4MZJ A;  2KBI A;  3BXK A;  5KU1 A;  2LAP A;  2IS9 A;  1Q80 A;  1TRF A;  1CFF A;  4HSZ A;  2KI6 C;  3SG5 A;  1S26 D;  1JFJ A;  4YBH B;  1NP8 A;  1UHN A;  1WLM A;  1KK8 C;  3I5I C;  1MUX A;  2WCF A;  4UPG A;  3I5H B;  4CFQ A;  1KK7 Y;  2BL0 B;  3C1V A;  2JRF A;  1DTL A;  3NSL A;  5J3X A;  2M0R A;  1YR5 A;  2K2F A;  1B4C A;  1B8R A;  1AUI B;  3BYA A;  5DKQ A;  3NSK A;  2PMY A;  2KHN A;  2WC8 A;  1KFX S;  4M2Q A;  1K93 D;  4NDD A;  2LP2 A;  3DVK A;  2LNK A;  2I7A A;  4ZCU A;  1TN4 A;  1LA0 A;  2F2O A;  4U8D A;  4PHN A;  4XJK A;  4C0K A;  1PAL A;  5F6T A;  1Y1U A;  3CS1 A;  5D7F A;  1YUU A;  1V1G A;  3PN7 B;  4ORB B;  2PRU A;  4IL1 A;  4MEW A;  2K7B A;  2BE4 A;  4JWQ A;  1S5G Y;  3VRQ A;  1BLQ A;  2MHH A;  3SIB A;  1MXE A;  1QLK A;  1SL9 A;  1BG1 A;  1OMD A;  1QX7 A;  1YX7 A;  1H8B A;  1QVI Y;  1SNL A;  2LMT A;  1K2H A;  1PUL A;  2KAV A;  2LVI A;  1IWQ A;  3HX4 A;  2KGB C;  3VRO A;  1H4B A;  4NDB A;  4JPZ B;  1QLS A;  3OX5 A;  3PAL A;  2M49 B;  1IQ3 A;  4PAL A;  1KSO A;  1QVI Z;  1XYD A;  1E8A A;  2VRG A;  3WHU B;  4OV2 A;  2BCB A;  2KFF A;  3TDZ A;  3ZWH A;  1TCO B;  2R2I A;  3LK1 A;  3VRR A;  1L2O C;  2M9G A;  1L7Z A;  1SCV A;  3E3R A;  2MJW B;  1KFU L;  4OVN F;  4N1F A;  2BKH B;  5I2L A;  1A75 A;  1LVC D;  1SK6 D;  1B7T Z;  3M0W A;  1NYA A;  1WDC B;  1NUB A;  2KQ6 A;  2MA2 A;  1DJG A;  1CFP A;  2LMV A;  2K8M B;  3DVJ A;  4WRI A;  4HRE E;  3EK7 A;  1G4Y R;  4FTG A;  4Q04 A;  2GGM A;  3WNX B;  1ZOT B;  1CTR A;  3LL8 B;  1A75 B;  3TDU A;  4N5X A;  1CLL A;  3AKA A;  2F3Y A;  4ORA B;  3SG2 A;  3EKJ A;  2OTG B;  1DGV A;  2EC6 C;  5CSJ A;  2O60 A;  1LA3 A;  1R6P A;  1DGU A;  3CGA A;  1SL7 A;  2LE9 B;  2BKI B;  1OZO A;  1DJZ A;  5ER5 A;  5HLV A;  2AAO A;  1YRT B;  2OTG C;  1RRO A;  4MSP A;  4ZCV A;  2KI4 B;  1QV0 A;  4XYN A;  2JZI A;  4F0Z B;  1CDL A;  1JC2 A;  1FI5 A;  3GOF A;  2ZN9 A;  2JQ6 A;  3O4Y A;  3KEV A;  2MBX A;  1EJ3 A;  2KYC A;  2BL0 C;  2JXC A;  1MR8 A;  3D10 A;  3PM8 A;  4P2Y B;  1JWD A;  1BOD A;  1YVL A;  2WCB A;  4DRW A;  3CTN A;  2JXL A;  2ZND A;  1CFC A;  1OZS A;  2I94 A;  2JT8 A;  3DF0 A;  1DJH A;  1Y6W A;  5BPJ A;  2K61 A;  2Y4Q A;  2COL B;  2KI4 C;  4OKH A;  1SRA A;  3PFV A;  1CKK A;  4QJ4 B;  1SL8 A;  1NX0 A; 
#chains in the Genus database with same CATH topology
 3SS5 A;  1K8U A;  1GGZ A;  2M7L A;  2JTZ A;  2KBM A;  2WCM A;  3FIA A;  1UUR A;  1W7J B;  4YGA A;  1VRK A;  1KQV A;  1XFY O;  4OR9 B;  1BOC A;  1OOF A;  4DUQ A;  5I2O A;  2BNX A;  1AVS A;  5PAL A;  1N0Y A;  2BCA A;  1W7I B;  2JNX A;  2KGR A;  2P71 A;  3SG4 A;  1CDM A;  3TUY B;  3UO9 A;  3I5G B;  1DEL A;  2ZNE A;  1NX3 A;  1NWD A;  1A4P A;  1XFV O;  3S0B A;  4ORC B;  3D0Y B;  1MQ1 A;  4OCI A;  1JFK A;  2A4J A;  1Z2C B;  3R1P A;  1N65 A;  3BUN B;  4JKT A;  3S0G A;  2NCP A;  4JD9 A;  2KAX A;  2H61 C;  1TNX A;  3I5I B;  3K21 A;  4R1E A;  3GK2 A;  1NCY A;  2LHI A;  1CM4 A;  2K7O A;  3JVT B;  3OB1 B;  1RK9 A;  2KPH A;  2WOR A;  1OQP A;  1DJI A;  2L50 A;  3DF0 B;  1QXP A;  2G9B A;  2F2P A;  1GQM A;  4AQI A;  2M1K B;  2M7N A;  1BU3 A;  2P70 A;  4PDZ A;  3ICB A;  4YI9 A;  1QJT A;  3EK4 A;  3GK1 A;  1YRU B;  4M2P A;  3TZ1 A;  1LXF C;  2WOS A;  1C3Z A;  5CSN A;  5DIC A;  1TUJ A;  2BBN A;  3BUM B;  4YI8 A;  3OBV A;  5FI6 A;  1OSA A;  1YUT A;  1K95 A;  4I5N B;  1QX2 A;  4YRU A;  2OS8 C;  2KFG A;  3SG6 A;  1XFW O;  3CDN A;  2L4H A;  1U5I A;  4DIR A;  2L5Y A;  1G33 A;  1KK7 Z;  1QWV A;  2MAZ A;  2JUL A;  1EG3 A;  1JF2 A;  2M29 A;  3OB2 B;  2LVK A;  3EG5 B;  3NXA A;  1CDP A;  3KHE A;  3BFH A;  2Y1M A;  4ICB A;  2PAL A;  1YVH A;  4AQJ A;  1JUO A;  2DOQ A;  1YTZ C;  4L9M A;  2K7D A;  4F7F A;  2JU0 A;  1NCX A;  1B9A A;  1F8H A;  1IJ5 A;  4E68 A;  2MRD A;  1ALW A;  1SCM C;  3FWB A;  1SW8 A;  1XA5 A;  3DVE A;  4MVF A;  3TS5 B;  2WCE A;  3DXL A;  1IQ5 A;  1S5G Z;  2NLN A;  5I2Q A;  2PAS A;  4YGE B;  1KQM C;  1KSM A;  2O5G A;  4AOM A;  1XFR A;  1WRL A;  4XJK B;  2GGZ A;  1K96 A;  1OMR A;  2E6W A;  3NSI A;  1B8C A;  2OPO A;  1EXR A;  2KQY A;  3CR5 X;  1NCZ A;  2JC2 A;  4N1G A;  3F45 A;  4USL A;  2WC6 A;  3D73 A;  1Y1A A;  4TNC A;  1NX2 A;  4PE4 A;  3R1V A;  2LC5 A;  2KLE A;  3CZ2 A;  4WQ2 A;  1YUS A;  1ZAC A;  2OS8 B;  2PYQ A;  2V53 A;  5AAN A;  1UHH A;  4DS7 A;  2G2B A;  2E30 A;  5D69 A;  3GK4 X;  1UP5 A;  1YUR A;  3R1O A;  1XK4 A;  5HLO A;  3PLF B;  1CFD A;  4INW A;  1UHJ A;  4FQO A;  3BFA A;  3BJH A;  1U5I B;  3DVM A;  2JT0 A;  1V1F A;  1IKU A;  4NDC A;  3IVT A;  1M31 A;  2BBM A;  2LVV A;  3VRP A;  3CLN A;  4YGB B;  2LLU A;  2TN4 A;  2M3W A;  3OHM B;  5K89 A;  2LMU A;  2ZN8 A;  3DZT A;  3K1E A;  4GGN A;  1DJY A;  1QAT A;  4FQT A;  1B7T Y;  1OMV A;  3RLZ A;  4A4B A;  3EVU A;  1S6J A;  1WY9 A;  2LLT A;  1XFZ O;  3ZNI A;  2LUC A;  1CDN A;  2I2R E;  3R72 A;  1KWO C;  4GPL B;  1OOJ A;  1KCY A;  2KDH A;  3TUY C;  2BCX A;  2YGU A;  1SBJ A;  3CZ0 A;  2MLE C;  1AHR A;  3CZ1 A;  1AJ4 A;  1DF0 A;  3B86 A;  1PRW A;  3V2L A;  2M97 A;  5AER A;  3BUO B;  1DJW A;  1J1D A;  1M45 A;  1QX5 B;  4PE7 A;  1XVJ A;  1MWN A;  5I8N A;  1LS8 A;  2LHL A;  4CLN A;  1TIZ A;  1J1E A;  1QIW A;  1DVI A;  2LP3 A;  1FBV A;  2LLS A;  2CCM A;  1GJY A;  2WCH A;  1MXL C;  3PN7 C;  1FF1 A;  3S0E A;  4HRH A;  2K60 A;  1BR1 B;  1S1E A;  5I94 A;  1C07 A;  2CBL A;  3CWG A;  1IGV A;  3RZS A;  4MRX A;  2H2K A;  1F4O A;  2JNF A;  2QPT A;  5JJG A;  1C7V A;  2KSP A;  3L4A A;  1LKJ A;  1MF8 B;  1OE9 B;  2FCE A;  2SCP A;  3MSE B;  4GUK A;  2LCP A;  1S6I A;  1TCF A;  2SAS A;  3NHI A;  2K7C A;  1REC A;  4JQ0 D;  1A2X A;  1HQV A;  2PSR A;  4ETO A;  2ZRS A;  1UHK A;  2H61 A;  3VRN A;  1QAS A;  4NQG A;  5ER4 X;  5AFP A;  1DMO A;  1NIW A;  1GGW A;  1AP4 A;  2JPT A;  2L2C A;  1BT6 A;  1WRK A;  1IH0 A;  5HKW A;  3SG3 A;  3FWC A;  2QAC A;  1NSH A;  3A4U B;  4PHM A;  1FW4 A;  1K9K A;  2F3Z A;  5GQQ C;  1IG5 A;  2HF5 A;  1JBA A;  1KFU S;  1YX8 A;  2KNE A;  2L4I A;  2MLF C;  1LIN A;  2B1U A;  4M2O A;  3SIA A;  2JTT A;  1B47 A;  2GV5 A;  3DYE A;  4D1E A;  1M46 A;  3IQQ A;  3O6B A;  1DJX A;  1AK8 A;  1SCM B;  3TDI A;  1BJF A;  3TS5 C;  1M39 A;  2Q91 A;  2Q4U A;  4P5O E;  2QEV A;  5DKR A;  3RM1 A;  2D8N A;  3AAK A;  3CR2 A;  3CR4 X;  1Z4H A;  2L5X B;  2LUX A;  3LLE A;  4WQ3 A;  1B1G A;  5CSF A;  1CNP A;  2NXQ A;  3I5G C;  3Q8I A;  2L51 A;  3VGO A;  1OW4 A;  1XO5 A;  1QIV A;  1F4Q A;  1J7P A;  1EL4 A;  1AJ5 A;  1KWO B;  1TNW A;  1UHI A;  2NZ0 A;  4QJ5 B;  3JVT C;  3WHT B;  3EVR A;  2ZRT A;  5DKN A;  3VB1 A;  1PSB A;  3IF7 A;  2WCL A;  1TWO A;  3SG7 A;  1PVA A;  1RWY A;  1DF0 B;  2KI6 D;  1RJV A;  3I5H C;  3LCP C;  3BOW B;  3A8R A;  1ZMZ A;  5AXI A;  4GNK B;  1TNQ A;  1OOI X;  3LK0 A;  1F54 A;  1L2O B;  1A03 A;  4BY4 A;  1OOH A;  1X02 A;  2CT9 A;  2CXJ A;  2M1U A;  2QEH A;  1J7Q A;  1FI6 A;  2FJU B;  3KF9 A;  3B88 A;  3WXA A;  4YGD B;  5KTY A;  2L0P A;  1TNP A;  1F71 A;  3O78 A;  2LAN A;  5CSI A;  1PK0 D;  1S36 A;  3HCM A;  1XFX O;  1R2U A;  1RTP 1;  2K0J A;  3NSO A;  4BY5 A;  3PAT A;  4PT1 A;  1EH2 A;  1C7W A;  1J7R A;  2JWW A;  4MRY A;  4MZL A;  4C0J A;  2HET A;  1ZUZ A;  1M63 B;  2Y1N A;  1EG4 A;  1WLZ A;  2F8P A;  5D3O A;  2Y5I A;  2AUC A;  1F70 A;  2BAP A;  4YGC B;  1G8I A;  1ODB A;  3IQO A;  1NX1 A;  2BEC A;  1RFJ A;  3H4S E;  1CLB A;  2ZFD A;  3I5F C;  2LVJ A;  2P6B B;  3PSR A;  1DT7 B;  5B8I B;  1J7O A;  4CFR A;  5AEQ A;  1SSE B;  4GGF C;  5FI7 A;  1WDC C;  4PHK A;  3KO0 A;  4GGF A;  2FCD A;  1PSR A;  1BMO A;  3OGN A;  4PCW A;  2AMI A;  1SR6 B;  1IRJ A;  2PQL A;  2WCJ A;  3L4L A;  1SYM A;  3BUW B;  3CZT X;  1K94 A;  1NPQ A;  2ERB A;  1S6C A;  5TNC A;  1Y1X A;  1QV1 A;  2F33 A;  1FPW A;  2L98 A;  3BUX B;  3JTD B;  4MBE A;  4GAO A;  1SKT A;  3EVV A;  2K2A A;  3O2P A;  1CMF A;  2EGD A;  1WRZ A;  5JOL A;  5FI2 A;  1TOP A;  2BE6 A;  4CPV A;  2KFH A;  5HKZ A;  5KSZ A;  2EHB A;  3NHT A;  2KLD A;  4C0L A;  2HQ8 A;  3BOW A;  1TTX A;  1MHO A;  1F55 A;  2NCO A;  3SS4 A;  1SPY A;  1HT9 A;  5FYX A;  1Y0V H;  4I5J A;  4GFT A;  1N2D A;  5CPV A;  1SMG A;  4MN0 A;  2HQW A;  1CMG A;  3DY9 A;  3OP0 A;  1CB1 A;  3D0Y A;  1JSA A;  1KFX L;  1PVB A;  5HKY A;  4PE0 A;  2LM5 A;  3I5F B;  5IBW A;  1K9U A;  2FOT A;  2WND A;  2KAY A;  3JTD C;  1ZFS A;  1BR4 B;  2ZKM X;  3UNW A;  2FJY A;  3SJS A;  1XFU O;  1D1O A;  4PHJ A;  4HRG A;  1KQM B;  2QEB A;  2RGI A;  3D74 A;  5HYD A;  2EC6 B;  1SR6 C;  4MLW A;  3KPX A;  3BQ3 A;  4QJ3 B;  3QRX A;  1SY9 A;  3FS7 A;  4I5L B;  2HPS A;  1CLM A;  4PE1 A;  1QTX A;  1JF0 A;  4A4C A;  1K9P A;  1XK4 C;  3NGV A;  1ALV A;  1S3P A;  2LV7 A;  4MZK A;  1UUS A;  2CTN A;  1QS7 A;  1K90 D;  2M8U A;  1C3Y A;  1CM1 A;  4DCK A;  3EK8 A;  4I5K A;  5G08 A;  2ISD A;  3S0D A;  1B8L A;  2JOJ A;  2I18 A;  3OX6 A;  2L2E A;  3SS3 A;  3AKB A;  3AAJ A;  4CID A;  3DD4 A;  2KYF A;  2CNP A;  1A29 A;  1J55 A;  2PVB A;  3EKH A;  1UWO A;  2JT3 A;  1IJ6 A;  2WCK A;  4GBA A;  2KOT A;  1BF5 A;  1KK8 B;  4MZJ A;  2KBI A;  3BXK A;  5KU1 A;  2LAP A;  2IS9 A;  1Q80 A;  1TRF A;  1CFF A;  4HSZ A;  2KI6 C;  3SG5 A;  1T14 A;  1S26 D;  1JFJ A;  4YBH B;  1NP8 A;  1UHN A;  3CAB A;  3N7H A;  1WLM A;  3PJI A;  1KK8 C;  3QME A;  3I5I C;  1MUX A;  2WCF A;  4UPG A;  3I5H B;  4CFQ A;  2JPO A;  1KK7 Y;  2BL0 B;  3C1V A;  2JRF A;  2GTE A;  1DTL A;  3NSL A;  5J3X A;  2M0R A;  1YR5 A;  2K2F A;  1B4C A;  1B8R A;  1AUI B;  3S0A A;  3BYA A;  5DKQ A;  3NSK A;  2PMY A;  2KHN A;  5HL1 A;  2WC8 A;  4IJ7 A;  3BFB A;  1KFX S;  4M2Q A;  1K93 D;  4NDD A;  2LP2 A;  3DVK A;  2LNK A;  2I7A A;  3L47 A;  4ZCU A;  1TN4 A;  1LA0 A;  2F2O A;  4U8D A;  4PHN A;  4XJK A;  4C0K A;  1PAL A;  5F6T A;  1Y1U A;  3CS1 A;  5D7F A;  1YUU A;  1V1G A;  3PN7 B;  4ORB B;  2PRU A;  3D75 A;  4IL1 A;  2WC5 A;  4MEW A;  2K7B A;  2BE4 A;  4JWQ A;  1P28 A;  1S5G Y;  3D78 A;  3VRQ A;  1BLQ A;  2MHH A;  3FE9 A;  3SIB A;  1MXE A;  1DEK A;  1QLK A;  1SL9 A;  1OMD A;  1QX7 A;  1YX7 A;  1BG1 A;  1H8B A;  1SNL A;  1QVI Y;  3B6X A;  2LMT A;  1K2H A;  1PUL A;  2KAV A;  2LVI A;  1IWQ A;  3HX4 A;  2KGB C;  3VRO A;  4OZD A;  1H4B A;  4NDB A;  1IIO A;  4JPZ B;  1QLS A;  3D77 A;  3OX5 A;  3PAL A;  2M49 B;  1IQ3 A;  4PAL A;  1KSO A;  1QVI Z;  1XYD A;  1GM0 A;  1E8A A;  2VRG A;  2QDI A;  4OV2 A;  2BCB A;  2KFF A;  3TDZ A;  3WHU B;  1TCO B;  2R2I A;  3LK1 A;  3VRR A;  3ZWH A;  1L2O C;  2M9G A;  1L7Z A;  1SCV A;  3E3R A;  2MJW B;  1KFU L;  4OVN F;  4N1F A;  2BKH B;  5I2L A;  1A75 A;  1LVC D;  5EL2 A;  1SK6 D;  1B7T Z;  3M0W A;  1NYA A;  1WDC B;  1NUB A;  1DC1 A;  2KQ6 A;  2MA2 A;  1DJG A;  1CFP A;  2LMV A;  2K8M B;  3DVJ A;  3PM2 A;  4WRI A;  4HRE E;  3EK7 A;  1G4Y R;  1ORG A;  4FTG A;  4Q04 A;  2GGM A;  3WNX B;  1ZOT B;  1CTR A;  3LL8 B;  1A75 B;  3FE8 A;  3TDU A;  3B7A A;  4N5X A;  3B87 A;  1CLL A;  3AKA A;  2F3Y A;  4ORA B;  3SG2 A;  3EKJ A;  4INX A;  2OTG B;  1DGV A;  2EC6 C;  5CSJ A;  2O60 A;  1LA3 A;  1R6P A;  1DGU A;  3CGA A;  1SL7 A;  2LE9 B;  2BKI B;  1OZO A;  1DJZ A;  5ER5 A;  5HLV A;  2AAO A;  1YRT B;  3FE6 A;  2OTG C;  1RRO A;  4MSP A;  4ZCV A;  2KI4 B;  1QV0 A;  4XYN A;  2JZI A;  4F0Z B;  1CDL A;  1JC2 A;  1FI5 A;  3GOF A;  2ZN9 A;  2JQ6 A;  3O4Y A;  3KEV A;  2MBX A;  3O4X A;  1OOG A;  3D76 A;  1W9Z A;  3CYZ A;  1EJ3 A;  2KYC A;  2BL0 C;  2JXC A;  1MR8 A;  2QEO A;  3D10 A;  3PM8 A;  4P2Y B;  1JWD A;  1BOD A;  1YVL A;  1DQE A;  2WCB A;  4DRW A;  3CTN A;  2JXL A;  2ZND A;  1TUZ A;  1OZS A;  1CFC A;  2I94 A;  2JT8 A;  3DF0 A;  4KYN A;  1DJH A;  1Y6W A;  5BPJ A;  2K61 A;  2Y4Q A;  3S0F A;  2COL B;  2KI4 C;  4OKH A;  1SRA A;  3PFV A;  1CKK A;  4QJ4 B;  2H8V A;  1SL8 A;  1NX0 A; 
#chains in the Genus database with same CATH homology
 1K8U A;  1GGZ A;  2M7L A;  2JTZ A;  2KBM A;  3FIA A;  1UUR A;  1W7J B;  4YGA A;  1VRK A;  1KQV A;  1XFY O;  4OR9 B;  1BOC A;  4DUQ A;  5I2O A;  5PAL A;  1AVS A;  1N0Y A;  2BCA A;  1W7I B;  2JNX A;  2KGR A;  3SG4 A;  3TUY B;  1CDM A;  3I5G B;  2ZNE A;  1NX3 A;  1NWD A;  1A4P A;  1XFV O;  4ORC B;  3D0Y B;  1MQ1 A;  4OCI A;  1JFK A;  2A4J A;  1N65 A;  3BUN B;  2NCP A;  2KAX A;  2H61 C;  1TNX A;  3I5I B;  3K21 A;  4R1E A;  3GK2 A;  1NCY A;  2LHI A;  1CM4 A;  2K7O A;  3JVT B;  3OB1 B;  1RK9 A;  2WOR A;  1OQP A;  1DJI A;  2L50 A;  3DF0 B;  1QXP A;  2G9B A;  2F2P A;  1GQM A;  4AQI A;  2M1K B;  2M7N A;  1BU3 A;  4PDZ A;  3ICB A;  4YI9 A;  1QJT A;  3EK4 A;  3GK1 A;  1YRU B;  4M2P A;  3TZ1 A;  1LXF C;  2WOS A;  5CSN A;  2BBN A;  3BUM B;  4YI8 A;  1OSA A;  1YUT A;  1K95 A;  4I5N B;  1QX2 A;  4YRU A;  2OS8 C;  2KFG A;  3SG6 A;  1XFW O;  2L4H A;  1U5I A;  4DIR A;  1G33 A;  1KK7 Z;  2MAZ A;  3OB2 B;  2JUL A;  1EG3 A;  1JF2 A;  2M29 A;  2LVK A;  3NXA A;  1CDP A;  3KHE A;  2Y1M A;  4ICB A;  2PAL A;  1YVH A;  4AQJ A;  1JUO A;  2DOQ A;  1YTZ C;  4L9M A;  2K7D A;  2JU0 A;  1NCX A;  1B9A A;  1F8H A;  1IJ5 A;  4E68 A;  2MRD A;  1ALW A;  1SCM C;  3FWB A;  1SW8 A;  1XA5 A;  3DVE A;  4MVF A;  3TS5 B;  2WCE A;  1IQ5 A;  1S5G Z;  2NLN A;  5I2Q A;  2PAS A;  4YGE B;  1KQM C;  1KSM A;  2O5G A;  4AOM A;  4XJK B;  1WRL A;  2GGZ A;  1K96 A;  1OMR A;  2E6W A;  3NSI A;  1B8C A;  2OPO A;  1EXR A;  2KQY A;  3CR5 X;  1NCZ A;  2JC2 A;  4N1G A;  3F45 A;  4USL A;  1Y1A A;  4TNC A;  1NX2 A;  4PE4 A;  2LC5 A;  4WQ2 A;  1YUS A;  1ZAC A;  2OS8 B;  2V53 A;  5AAN A;  1UHH A;  4DS7 A;  2G2B A;  2E30 A;  5D69 A;  3GK4 X;  1UP5 A;  1YUR A;  1XK4 A;  5HLO A;  3PLF B;  1CFD A;  1UHJ A;  4FQO A;  1U5I B;  3DVM A;  2JT0 A;  1V1F A;  1IKU A;  4NDC A;  1M31 A;  2BBM A;  2LVV A;  3VRP A;  3CLN A;  4YGB B;  2LLU A;  2TN4 A;  2M3W A;  3OHM B;  5K89 A;  2LMU A;  2ZN8 A;  4GGN A;  1DJY A;  1QAT A;  1B7T Y;  1OMV A;  3RLZ A;  4A4B A;  3EVU A;  1S6J A;  1WY9 A;  2LLT A;  1XFZ O;  3ZNI A;  2LUC A;  1CDN A;  2I2R E;  1KWO C;  4GPL B;  1OOJ A;  1KCY A;  2KDH A;  3TUY C;  2BCX A;  1SBJ A;  2MLE C;  1AHR A;  1AJ4 A;  1DF0 A;  1PRW A;  2M97 A;  5AER A;  3BUO B;  1DJW A;  1J1D A;  1M45 A;  1QX5 B;  4PE7 A;  1XVJ A;  1MWN A;  5I8N A;  2LHL A;  4CLN A;  1J1E A;  1QIW A;  1TIZ A;  1DVI A;  2LP3 A;  1FBV A;  2LLS A;  2CCM A;  1GJY A;  1FF1 A;  1MXL C;  3PN7 C;  4HRH A;  1BR1 B;  1S1E A;  1C07 A;  2CBL A;  3CWG A;  1IGV A;  4MRX A;  2H2K A;  1F4O A;  2JNF A;  2QPT A;  5JJG A;  1C7V A;  2KSP A;  4GUK A;  1LKJ A;  1MF8 B;  1OE9 B;  2FCE A;  2SCP A;  3MSE B;  2LCP A;  1S6I A;  1TCF A;  2SAS A;  2K7C A;  1REC A;  4JQ0 D;  1A2X A;  1HQV A;  2PSR A;  4ETO A;  2ZRS A;  1UHK A;  2H61 A;  3VRN A;  1QAS A;  4NQG A;  5ER4 X;  5AFP A;  1DMO A;  1NIW A;  1GGW A;  1AP4 A;  2JPT A;  1BT6 A;  1WRK A;  1IH0 A;  5HKW A;  3SG3 A;  3FWC A;  2QAC A;  1NSH A;  3A4U B;  4PHM A;  1FW4 A;  1K9K A;  2F3Z A;  5GQQ C;  1IG5 A;  2HF5 A;  1JBA A;  1KFU S;  1YX8 A;  2KNE A;  2L4I A;  2MLF C;  1LIN A;  2B1U A;  4M2O A;  3SIA A;  2JTT A;  1B47 A;  2GV5 A;  4D1E A;  1AK8 A;  1M46 A;  3IQQ A;  3O6B A;  1DJX A;  1SCM B;  3TDI A;  1BJF A;  3TS5 C;  1M39 A;  2Q91 A;  2Q4U A;  4P5O E;  5DKR A;  3RM1 A;  2D8N A;  3AAK A;  3CR2 A;  3CR4 X;  3LLE A;  2L5X B;  2LUX A;  4WQ3 A;  1B1G A;  5CSF A;  1CNP A;  2NXQ A;  3I5G C;  3VGO A;  2L51 A;  1XO5 A;  1QIV A;  1F4Q A;  1J7P A;  1EL4 A;  1AJ5 A;  1KWO B;  1TNW A;  1UHI A;  2NZ0 A;  4QJ5 B;  3JVT C;  3WHT B;  3EVR A;  2ZRT A;  5DKN A;  1PSB A;  3IF7 A;  3SG7 A;  1PVA A;  1RWY A;  1DF0 B;  2KI6 D;  1RJV A;  3I5H C;  3LCP C;  3BOW B;  3A8R A;  1ZMZ A;  5AXI A;  4GNK B;  1TNQ A;  3LK0 A;  1F54 A;  1L2O B;  1A03 A;  4BY4 A;  1X02 A;  2CT9 A;  2CXJ A;  2M1U A;  1J7Q A;  1FI6 A;  2FJU B;  3KF9 A;  3WXA A;  4YGD B;  5KTY A;  2L0P A;  1TNP A;  1F71 A;  3O78 A;  2LAN A;  5CSI A;  1PK0 D;  1S36 A;  3HCM A;  1XFX O;  1R2U A;  1RTP 1;  2K0J A;  3NSO A;  4BY5 A;  3PAT A;  1EH2 A;  1C7W A;  1J7R A;  2JWW A;  4MRY A;  4MZL A;  4C0J A;  2HET A;  1ZUZ A;  1M63 B;  2Y1N A;  1EG4 A;  1WLZ A;  2F8P A;  2Y5I A;  2AUC A;  1F70 A;  4YGC B;  1G8I A;  1ODB A;  3IQO A;  1NX1 A;  2BEC A;  1RFJ A;  3H4S E;  1CLB A;  2ZFD A;  3I5F C;  2LVJ A;  2P6B B;  3PSR A;  1DT7 B;  5B8I B;  1J7O A;  4CFR A;  5AEQ A;  4GGF C;  1WDC C;  4PHK A;  3KO0 A;  4GGF A;  2FCD A;  1PSR A;  1BMO A;  4PCW A;  2AMI A;  1SR6 B;  1IRJ A;  1SYM A;  3BUW B;  3CZT X;  1K94 A;  1NPQ A;  1S6C A;  5TNC A;  1Y1X A;  1QV1 A;  2F33 A;  1FPW A;  2L98 A;  3BUX B;  3JTD B;  4MBE A;  4GAO A;  1SKT A;  3EVV A;  2K2A A;  3O2P A;  1CMF A;  2EGD A;  1WRZ A;  5JOL A;  1TOP A;  2BE6 A;  4CPV A;  2KFH A;  5HKZ A;  5KSZ A;  2EHB A;  4C0L A;  2HQ8 A;  3BOW A;  1TTX A;  1MHO A;  1F55 A;  2NCO A;  1SPY A;  1HT9 A;  5FYX A;  1Y0V H;  4I5J A;  4GFT A;  1N2D A;  5CPV A;  1SMG A;  4MN0 A;  2HQW A;  1CMG A;  3OP0 A;  1CB1 A;  3D0Y A;  1JSA A;  1KFX L;  1PVB A;  5HKY A;  4PE0 A;  2LM5 A;  3I5F B;  5IBW A;  1K9U A;  2FOT A;  2WND A;  2KAY A;  3JTD C;  1ZFS A;  1BR4 B;  2ZKM X;  3SJS A;  1XFU O;  1D1O A;  4PHJ A;  4HRG A;  1KQM B;  2RGI A;  5HYD A;  2EC6 B;  1SR6 C;  4MLW A;  3KPX A;  3BQ3 A;  4QJ3 B;  3QRX A;  1SY9 A;  3FS7 A;  4I5L B;  2HPS A;  1CLM A;  4PE1 A;  1QTX A;  1JF0 A;  4A4C A;  1K9P A;  1XK4 C;  1ALV A;  1S3P A;  2LV7 A;  4MZK A;  1UUS A;  2CTN A;  1QS7 A;  1K90 D;  2M8U A;  1CM1 A;  4DCK A;  3EK8 A;  4I5K A;  5G08 A;  2ISD A;  1B8L A;  2JOJ A;  2I18 A;  3OX6 A;  2L2E A;  3AKB A;  3AAJ A;  4CID A;  3DD4 A;  2KYF A;  2CNP A;  1A29 A;  1J55 A;  2PVB A;  3EKH A;  1UWO A;  2JT3 A;  1IJ6 A;  4GBA A;  2KOT A;  1BF5 A;  1KK8 B;  4MZJ A;  2KBI A;  3BXK A;  5KU1 A;  2LAP A;  2IS9 A;  1Q80 A;  1TRF A;  1CFF A;  4HSZ A;  2KI6 C;  3SG5 A;  1S26 D;  1JFJ A;  4YBH B;  1NP8 A;  1UHN A;  1WLM A;  1KK8 C;  3I5I C;  1MUX A;  2WCF A;  4UPG A;  3I5H B;  4CFQ A;  1KK7 Y;  2BL0 B;  3C1V A;  2JRF A;  1DTL A;  3NSL A;  5J3X A;  2M0R A;  1YR5 A;  2K2F A;  1B4C A;  1B8R A;  1AUI B;  3BYA A;  5DKQ A;  3NSK A;  2PMY A;  2KHN A;  2WC8 A;  1KFX S;  4M2Q A;  1K93 D;  4NDD A;  2LP2 A;  3DVK A;  2LNK A;  2I7A A;  4ZCU A;  1TN4 A;  1LA0 A;  2F2O A;  4U8D A;  4PHN A;  4XJK A;  4C0K A;  1PAL A;  5F6T A;  1Y1U A;  3CS1 A;  5D7F A;  1YUU A;  1V1G A;  3PN7 B;  4ORB B;  2PRU A;  4IL1 A;  4MEW A;  2K7B A;  2BE4 A;  4JWQ A;  1S5G Y;  3VRQ A;  1BLQ A;  2MHH A;  3SIB A;  1MXE A;  1QLK A;  1SL9 A;  1BG1 A;  1OMD A;  1QX7 A;  1YX7 A;  1H8B A;  1QVI Y;  1SNL A;  2LMT A;  1K2H A;  1PUL A;  2KAV A;  2LVI A;  1IWQ A;  3HX4 A;  2KGB C;  3VRO A;  1H4B A;  4NDB A;  4JPZ B;  1QLS A;  3OX5 A;  3PAL A;  2M49 B;  1IQ3 A;  4PAL A;  1KSO A;  1QVI Z;  1XYD A;  1E8A A;  2VRG A;  3WHU B;  4OV2 A;  2BCB A;  2KFF A;  3TDZ A;  3ZWH A;  1TCO B;  2R2I A;  3LK1 A;  3VRR A;  1L2O C;  2M9G A;  1L7Z A;  1SCV A;  3E3R A;  2MJW B;  1KFU L;  4OVN F;  4N1F A;  2BKH B;  5I2L A;  1A75 A;  1LVC D;  1SK6 D;  1B7T Z;  3M0W A;  1NYA A;  1WDC B;  1NUB A;  2KQ6 A;  2MA2 A;  1DJG A;  1CFP A;  2LMV A;  2K8M B;  3DVJ A;  4WRI A;  4HRE E;  3EK7 A;  1G4Y R;  4FTG A;  4Q04 A;  2GGM A;  3WNX B;  1ZOT B;  1CTR A;  3LL8 B;  1A75 B;  3TDU A;  4N5X A;  1CLL A;  3AKA A;  2F3Y A;  4ORA B;  3SG2 A;  3EKJ A;  2OTG B;  1DGV A;  2EC6 C;  5CSJ A;  2O60 A;  1LA3 A;  1R6P A;  1DGU A;  3CGA A;  1SL7 A;  2LE9 B;  2BKI B;  1OZO A;  1DJZ A;  5ER5 A;  5HLV A;  2AAO A;  1YRT B;  2OTG C;  1RRO A;  4MSP A;  4ZCV A;  2KI4 B;  1QV0 A;  4XYN A;  2JZI A;  4F0Z B;  1CDL A;  1JC2 A;  1FI5 A;  3GOF A;  2ZN9 A;  2JQ6 A;  3O4Y A;  3KEV A;  2MBX A;  1EJ3 A;  2KYC A;  2BL0 C;  2JXC A;  1MR8 A;  3D10 A;  3PM8 A;  4P2Y B;  1JWD A;  1BOD A;  1YVL A;  2WCB A;  4DRW A;  3CTN A;  2JXL A;  2ZND A;  1CFC A;  1OZS A;  2I94 A;  2JT8 A;  3DF0 A;  1DJH A;  1Y6W A;  5BPJ A;  2K61 A;  2Y4Q A;  2COL B;  2KI4 C;  4OKH A;  1SRA A;  3PFV A;  1CKK A;  4QJ4 B;  1SL8 A;  1NX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...