3TUYB

Phosphorylated light chain domain of scallop smooth muscle myosin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
b'RLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule tags Structural protein
total genus 44
structure length 141
sequence length 141
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyB01
4YI9A 1F70A 1KWOB 1IGVA 3M0WA 4YBHB 1NSHA 5AEQA 3TUYB 1PSBA 3EK8A 1LXFC 1JF0A 2LE9B 4GGNA 1QASA 2LCPA 4GBAA 4OR9B 1YTZC 2F33A 3FIAA 4PHNA 1EG3A 1Y1UA 2LNKA 1M46A 1J7OA 4ICBA 2O5GA 1WDCC 1OOJA 1RTP1 3CGAA 4I5LB 2CNPA 2HETA 1Y1AA 2EGDA 2I18A 1NUBA 1CM4A 2JULA 2OTGB 3BOWB 4PHJA 2RGIA 5CSJA 2SASA 3BUXB 3ZWHA 2R2IA 3D10A 4CFQA 4PE4A 2FJUB 1CNPA 1N65A 2WNDA 3KEVA 2L50A 4N1FA 2F2OA 2JT3A 2M29A 1BF5A 1K93D 1TCOB 2AAOA 2KI6C 2LLUA 2P6BB 4N1GA 1YX8A 4L9MA 1OMRA 1ZFSA 4I5NB 3D0YB 3IF7A 5F6TA 3PFVA 1KFXL 1XFUO 2BL0C 2HPSA 4OCIA 1LINA 3DF0A 3KPXA 3CZTX 1A03A 1KCYA 3CR4X 1JUOA 4PHKA 1F71A 2B1UA 1DTLA 1NPQA 4YI8A 3LLEA 3FS7A 1QVIZ 1M63B 4Q04A 3RM1A 2ZN9A 3O2PA 2CBLA 4FQOA 2MBXA 1KK8C 3BUWB 4DRWA 1SL8A 1TNXA 4NDBA 2M0RA 4A4BA 3CS1A 1SYMA 2ZNDA 2WC8A 1IQ5A 3GK1A 3TS5C 2EHBA 2QACA 1FI6A 2LLSA 1CM1A 1SL9A 3OB1B 2NZ0A 4MRXA 3SG3A 1JBAA 1CMGA 2NCPA 3AKAA 1TNWA 3LK1A 1CDLA 1FPWA 2VRGA 2LAPA 2FOTA 1YURA 1NCXA 3I5IB 1M39A 1H4BA 3PSRA 2M49B 2JWWA 4FTGA 2PSRA 1N0YA 1SKTA 2KGBC 4U8DA 1IJ5A 2F2PA 4AOMA 2EC6C 2JNFA 3LCPC 4HRHA 2Y1NA 1S5GZ 2WORA 1HQVA 1AJ5A 2PALA 3SG4A 1XFYO 4MRYA 2JZIA 3I5GC 5KU1A 5AERA 2I2RE 1DJHA 2JPTA 2KI4C 1B4CA 1KQMB 2DOQA 1UHJA 2LANA 4MVFA 1F54A 2KHNA 1WRLA 2CTNA 3EK7A 1B8CA 1L2OC 1SPYA 1WRZA 3JVTC 2KQ6A 1OMDA 2HQWA 3AAKA 1SBJA 1IRJA 1UURA 2K2FA 2M9GA 4ZCUA 4DS7A 1KK7Y 3PLFB 1X02A 1NWDA 1UUSA 5ER4X 1CDNA 3EKJA 1F4OA 2M3WA 2BCXA 1SNLA 3DVJA 4YGBB 2MJWB 1SMGA 4DUQA 3D0YA 1IQ3A 1B8LA 1HT9A 1SRAA 4WQ2A 1TTXA 2MLEC 3OX5A 1AP4A 1DT7B 4D1EA 1QJTA 2KGRA 1BODA 4CFRA 1MWNA 3EVVA 2LHLA 1KQVA 5DKNA 2AUCA 4MBEA 4CPVA 2LC5A 1XFXO 1K9KA 1YUTA 1PRWA 4ZCVA 2PVBA 1FW4A 3JTDB 1J1DA 1DJZA 2L0PA 5B8IB 4MEWA 2K7OA 1FBVA 3VRRA 3TDZA 5HLOA 2KFGA 2GGMA 1CFCA 3DD4A 3FWBA 1RROA 5HKWA 3DVKA 1DJWA 1BLQA 1XFVO 1M45A 1OZSA 1DJXA 2WCBA 4HRGA 2BE4A 1CB1A 1ZACA 4M2PA 3CWGA 3IQOA 1IJ6A 1SCMB 1K9PA 3VRQA 1BJFA 1BR1B 3NSOA 1C07A 1IH0A 2LVKA 1SK6D 2Q91A 3OP0A 1CDMA 1XFZO 2JXCA 2JT8A 3SG7A 1KSMA 3CLNA 1DMOA 1OQPA 3O78A 4OVNF 2KBMA 3A8RA 1DVIA 4R1EA 1WRKA 1K90D 1TN4A 3TZ1A 5DKQA 2NCOA 3WNXB 4UPGA 1UHNA 5I8NA 1M31A 1TIZA 3I5HC 1WDCB 4YGAA 1JWDA 5JJGA 1A29A 1YR5A 1J55A 5K89A 2M7LA 3OHMB 5HYDA 1KSOA 4ORCB 1UWOA 2LMUA 2KDHA 1RJVA 2Y1MA 2JU0A 1NX3A 2MLFC 4A4CA 3BYAA 5TNCA 1Y0VH 2G9BA 3I5FC 3EKHA 2JRFA 1JFKA 2AMIA 2V53A 2M1UA 3OB2B 1J7RA 4GGFA 1B7TZ 1GJYA 1R6PA 3DVMA 1N2DA 3BXKA 3WHUB 2BL0B 2K61A 3NXAA 3SG6A 1BMOA 2BBNA 1AUIB 1G33A 2K7BA 1PK0D 5HLVA 2O60A 2CCMA 2H2KA 1YUUA 1KFUS 2H61A 5CSIA 1UHIA 2CT9A 5CSFA 1EG4A 4TNCA 1CFPA 1C7WA 1V1GA 2K2AA 1K2HA 2JXLA 3MSEB 1TNPA 3BUMB 3NSKA 5J3XA 1KK8B 1S3PA 1ALWA 1G4YR 2ZKMX 3LL8B 3K21A 4YGCB 1QLKA 3PALA 4DCKA 1MR8A 3SG2A 1JSAA 2JNXA 2LVIA 4C0LA 1WLZA 1CLBA 1QX7A 1NX1A 4GPLB 2BECA 1WLMA 3TS5B 4USLA 1CLLA 3A4UB 2L5XB 1LVCD 2F3ZA 1K94A 3LK0A 1CTRA 2LVJA 1S36A 4M2QA 5CSNA 1K96A 1XFWO 2L98A 2F3YA 1CLMA 1ZUZA 2ZFDA 4YGEB 5G08A 2A4JA 1BG1A 1QXPA 2LUXA 1CKKA 2WCEA 1TNQA 1ZMZA 5GQQC 5D7FA 5I2LA 2LUCA 1YVHA 1NX0A 1L7ZA 1S5GY 1D1OA 1YRTB 1NCZA 1XYDA 2JTTA 1A2XA 1KFUL 1J7PA 1BT6A 1AHRA 4HSZA 1QTXA 4PALA 1ZOTB 1PSRA 1UHKA 2EC6B 3H4SE 2LV7A 1AJ4A 3IQQA 2KQYA 1B9AA 1CFDA 1KK7Z 3GOFA 5JOLA 1S6JA 3I5GB 1PULA 4JWQA 4AQJA 2K7CA 4PHMA 1TOPA 2ZN8A 3NSLA 1K9UA 3PATA 4CIDA 1B47A 2KI4B 1NP8A 5IBWA 1K95A 3CR2A 2MHHA 4NDCA 4XYNA 1SR6B 2OS8B 1LKJA 5DKRA 4ETOA 1MF8B 1B8RA 2KOTA 1KWOC 2KAXA 1L2OB 4PE7A 3ICBA 3JVTB 2KSPA 4MZKA 1CMFA 3PN7B 4NDDA 3TUYC 2ZNEA 1W7JB 1B1GA 2NXQA 4F0ZB 2FCDA 4M2OA 4MZLA 2BKIB 2COLB 1SW8A 1NIWA 3EVUA 3CR5X 1PVAA 1CDPA 4ORAB 5KTYA 3E3RA 2BE6A 2LMTA 2L2EA 2OTGC 1WY9A 2Q4UA 1ALVA 3VRPA 1SCMC 1PVBA 4GNKB 1TCFA 2BCAA 3SIAA 1MXLC 1QX5B 2JTZA 3BUNB 3EK4A 1SL7A 1XK4A 2KAYA 4PE0A 1YX7A 2M8UA 1S6IA 2L4HA 4OKHA 4JPZB 4CLNA 1Y6WA 2PASA 2ISDA 3WHTB 2BCBA 1IG5A 2LLTA 1DJGA 3AKBA 1QIVA 5I2QA 5CPVA 1LA3A 3KHEA 2JT0A 3OX6A 1JC2A 3VRNA 1GGZA 2GGZA 4QJ4B 4NQGA 2G2BA 4GFTA 1MHOA 2TN4A 4N5XA 1J1EA 3TDIA 4MSPA 4WQ3A 1EL4A 4P2YB 1QLSA 2KBIA 3EVRA 1H8BA 4XJKB 1OMVA 1G8IA 2MA2A 3KF9A 3VGOA 2JQ6A 2WCFA 1Y1XA 1TRFA 3SG5A 1F4QA 1S1EA 2KYCA 2LMVA 1EJ3A 1GQMA 1BR4B 2L4IA 1RECA 1YRUB 1FI5A 1RK9A 3QRXA 2OPOA 2NLNA 4QJ5B 1EXRA 1W7IB 1A75B 3GK4X 4GUKA 4C0KA 1NX2A 1JF2A 4QJ3B 1QV1A 1QVIY 4PE1A 5BPJA 1QV0A 1VRKA 1LA0A 2ZRSA 1JFJA 1XK4C 4GAOA 3I5HB 2Y4QA 4HREE 1S26D 2KFHA 3I5IC 4DIRA 1XO5A 4MN0A 3BUOB 3C1VA 2LM5A 4AQIA 5ER5A 1B7TY 4BY4A 1XVJA 1K8UA 5HKZA 3I5FB 5AANA 3HCMA 2LVVA 1EH2A 1FF1A 1MQ1A 3BQ3A 2SCPA 1OZOA 4ORBB 2GV5A 5AXIA 2I7AA 1QIWA 1DF0A 3ZNIA 1KQMC 3SJSA 1DGUA 1YUSA 2KFFA 2KYFA 1J7QA 4OV2A 2M1KB 1A4PA 2HF5A 1RFJA 1CFFA 2LP3A 3O4YA 1R2UA 3PM8A 2L51A 2CXJA 4MLWA 2K0JA 1PALA 2I94A 1U5IA 4BY5A 1SCVA 4GGFC 3TDUA 1MUXA 1IWQA 3RLZA 2PMYA 3F45A 1BOCA 1F8HA 4YGDB 1DJIA 2PRUA 1AVSA 4P5OE 5AFPA 1QX2A 1UHHA 2KI6D 2KNEA 3DF0B 1F55A 3WXAA 1IKUA 1DJYA 4MZJA 1OSAA 1QS7A 2H61C 2MAZA 1BU3A 5FYXA 2BKHB 2LHIA 3AAJA 2F8PA 2JOJA 4C0JA 1V1FA 1XA5A 1C7VA 2Y5IA 2HQ8A 1SR6C 2MRDA 2OS8C 1QATA 1MXEA 1SY9A 4YRUA 2D8NA 1ODBA 3BOWA 2FCEA 3HX4A 4WRIA 1YVLA 1OE9B 1AK8A 3JTDC 3SIBA 4I5JA 3PN7C 3NSIA 2K8MB 3DVEA 3CTNA 2JC2A 2IS9A 2E30A 5KSZA 4XJKA 1Q80A 5PALA 3FWCA 1GGWA 1UP5A 1E8AA 2LP2A 3KO0A 1NYAA 5D69A 3GK2A 1DF0B 4I5KA 5HKYA 4E68A 4PCWA 1RWYA 1A75A 1NCYA 1S6CA 2WOSA 2QPTA 1DGVA 2M7NA 4JQ0D 4PDZA 2E6WA 2ZRTA 2KAVA 2BBMA 4IL1A 2K7DA 3O6BA 3VROA 1U5IB 5I2OA 1KFXS 2M97A
chains in the Genus database with same CATH superfamily
4YI9A 2YGUA 1KWOB 3BJHA 1F70A 1IGVA 2GTEA 2WCHA 3M0WA 4YBHB 1NSHA 5AEQA 3TUYB 3FE9A 1PSBA 3EK8A 1LXFC 1JF0A 2LE9B 4GGNA 1QASA 2LCPA 4GBAA 4OR9B 1YTZC 2F33A 3FIAA 4PHNA 1EG3A 1Y1UA 2LNKA 1M46A 1J7OA 4ICBA 2O5GA 1OW4A 1OOJA 1RTP1 1WDCC 3CGAA 4I5LB 2CNPA 2HETA 1Y1AA 2EGDA 2I18A 1NUBA 1CM4A 2JULA 2OTGB 3BOWB 4PHJA 2RGIA 5CSJA 2SASA 3BUXB 3ZWHA 2R2IA 3D10A 4CFQA 4PE4A 2FJUB 1CNPA 1N65A 3PJIA 2WNDA 3CABA 3KEVA 2L50A 3R1PA 4N1FA 2F2OA 2JT3A 2M29A 2P70A 1BF5A 1K93D 1TCOB 2AAOA 2KI6C 2LLUA 2P6BB 4N1GA 1YX8A 4L9MA 1OMRA 1ZFSA 4I5NB 3S0AA 3D0YB 3IF7A 5F6TA 3PFVA 1KFXL 1XFUO 2BL0C 2HPSA 3D76A 2QEVA 4OCIA 2P71A 1LINA 3DF0A 3KPXA 3CZTX 1A03A 1KCYA 3CR4X 1JUOA 4PHKA 3R1VA 1F71A 2B1UA 1DTLA 1NPQA 4YI8A 3LLEA 3CZ0A 1QVIZ 1M63B 3FS7A 4Q04A 3RM1A 2ZN9A 3SS3A 3O2PA 2CBLA 4FQOA 2MBXA 1KK8C 3BUWB 4DRWA 1SL8A 1TNXA 3L4LA 4NDBA 2M0RA 4A4BA 3FE8A 2KLDA 3CS1A 1SYMA 2ZNDA 3FE6A 2WC8A 3SS4A 1IQ5A 3GK1A 3TS5C 2EHBA 2QACA 1FI6A 2LLSA 1CM1A 1SL9A 3OB1B 2NZ0A 4MRXA 3SG3A 3L47A 1CMGA 1JBAA 2NCPA 3AKAA 1TNWA 3LK1A 1CDLA 1FPWA 3NGVA 2VRGA 2LAPA 3CZ1A 2FOTA 1YURA 1NCXA 3I5IB 1M39A 1H4BA 3PSRA 2M49B 2JWWA 4FTGA 2PSRA 5I94A 3B87A 1N0YA 1SKTA 2KGBC 2KPHA 4U8DA 1IJ5A 2F2PA 4AOMA 2EC6C 2JNFA 3LCPC 4HRHA 2Y1NA 1S5GZ 2WORA 4INXA 1HQVA 1AJ5A 2PALA 3SG4A 1TUJA 3NHIA 1XFYO 4MRYA 2JZIA 3I5GC 3CZ2A 5KU1A 5AERA 2KLEA 2I2RE 1DJHA 2JPTA 2KI4C 2WCMA 1KQMB 1B4CA 2DOQA 1UHJA 2LANA 4MVFA 1F54A 2KHNA 3B88A 1WRLA 2CTNA 3EK7A 2QEHA 1B8CA 1TUZA 3EG5B 1L2OC 1SPYA 1WRZA 3JVTC 2KQ6A 1OMDA 2HQWA 3AAKA 1SBJA 1IRJA 1UURA 2K2FA 2M9GA 1Z2CB 4ZCUA 1KK7Y 3PLFB 4DS7A 1X02A 1NWDA 4JKTA 1UUSA 1OOHA 5ER4X 1CDNA 3CDNA 3EKJA 1F4OA 2M3WA 3S0FA 1SSEB 2BCXA 1SNLA 3DVJA 4YGBB 2MJWB 1SMGA 4DUQA 3D0YA 1IQ3A 1B8LA 1HT9A 1SRAA 4WQ2A 1DELA 1TTXA 2MLEC 3OX5A 1DT7B 4D1EA 1QJTA 2KGRA 1BODA 4CFRA 1MWNA 3EVVA 2LHLA 1KQVA 5DKNA 2AUCA 4MBEA 4CPVA 2LC5A 1XFXO 1K9KA 1YUTA 1PRWA 4ZCVA 2PVBA 1FW4A 3JTDB 1J1DA 1DJZA 2L0PA 3IVTA 5B8IB 4MEWA 2K7OA 2WCKA 1FBVA 3VRRA 1OOFA 3TDZA 5HLOA 2KFGA 2GGMA 3OGNA 3DD4A 1CFCA 3FWBA 1C3YA 1IIOA 1RROA 4OZDA 5HKWA 3VB1A 3DVKA 1DJWA 1BLQA 1XFVO 1M45A 1AP4A 1OZSA 1W9ZA 5FI7A 1DJXA 2WCBA 4FQTA 2BE4A 4HRGA 1CB1A 1ZACA 4M2PA 3CWGA 3IQOA 1IJ6A 1SCMB 1K9PA 3VRQA 1BJFA 1BR1B 3NSOA 1C07A 1IH0A 2LVKA 1SK6D 2Q91A 3OP0A 1CDMA 1XFZO 2JXCA 2JT8A 3SG7A 1KSMA 3CLNA 1DMOA 1OQPA 3O78A 4OVNF 3L4AA 2KBMA 3UNWA 3A8RA 1DVIA 3NHTA 4R1EA 1WRKA 1K90D 1TN4A 3TZ1A 5DKQA 2NCOA 3WNXB 4UPGA 1UHNA 1Z4HA 5I8NA 1M31A 1TIZA 3I5HC 3UO9A 1WDCB 4YGAA 1JWDA 5JJGA 1A29A 1YR5A 3DYEA 1J55A 3S0BA 2M7LA 5K89A 3OHMB 5HYDA 1KSOA 4ORCB 1UWOA 2LMUA 2KDHA 1RJVA 1QWVA 2Y1MA 5EL2A 2JU0A 1NX3A 2MLFC 4A4CA 3BYAA 5TNCA 1Y0VH 2G9BA 3I5FC 3EKHA 2JRFA 5DICA 1JFKA 2AMIA 2V53A 2M1UA 3OB2B 1J7RA 4GGFA 1B7TZ 1GJYA 1R6PA 3DVMA 1N2DA 3BXKA 3WHUB 1DQEA 2BL0B 2K61A 3NXAA 3SG6A 1BMOA 2BBNA 1AUIB 1G33A 2K7BA 1PK0D 5HLVA 2O60A 2CCMA 2H2KA 1TWOA 5HL1A 1YUUA 1KFUS 2H61A 5CSIA 1UHIA 2CT9A 5CSFA 1EG4A 5FI2A 4TNCA 1CFPA 1C7WA 1V1GA 2K2AA 1K2HA 2JXLA 3MSEB 1TNPA 3BUMB 3NSKA 3B6XA 5J3XA 1KK8B 1S3PA 1ALWA 1G4YR 2ZKMX 3LL8B 3K21A 4YGCB 1QLKA 3PALA 4DCKA 1MR8A 3SG2A 2WC6A 1JSAA 2JNXA 2LVIA 4C0LA 1WLZA 1CLBA 1QX7A 1NX1A 4GPLB 2BECA 1WLMA 3TS5B 4USLA 1CLLA 3A4UB 2FJYA 2L5XB 1LVCD 2F3ZA 1K94A 3LK0A 1CTRA 2LVJA 1S36A 2PYQA 4M2QA 5CSNA 1K96A 3S0DA 1XFWO 2L98A 2F3YA 1CLMA 1LS8A 1ZUZA 2ZFDA 4YGEB 2A4JA 5G08A 1BG1A 1QXPA 2LUXA 1CKKA 2WCEA 2QDIA 1TNQA 1ZMZA 5GQQC 5D7FA 5I2LA 4KYNA 2LUCA 1YVHA 1NX0A 1L7ZA 1S5GY 3K1EA 1D1OA 3CYZA 1YRTB 1NCZA 1XYDA 2JTTA 1A2XA 1KFUL 1J7PA 1BT6A 2BAPA 1AHRA 4HSZA 1QTXA 4PALA 1ZOTB 1PSRA 1UHKA 2EC6B 3H4SE 2LV7A 1AJ4A 3IQQA 2WCLA 2KQYA 1B9AA 4F7FA 1CFDA 1KK7Z 3GOFA 5JOLA 2L5YA 1S6JA 3I5GB 1PULA 2QEOA 4JWQA 2K7CA 4PHMA 1TOPA 2ZN8A 3NSLA 1K9UA 3PATA 4AQJA 1B47A 4CIDA 2KI4B 1NP8A 3D74A 5IBWA 1K95A 3BFAA 2MHHA 3CR2A 4NDCA 1SR6B 4XYNA 5FI6A 2OS8B 1LKJA 5DKRA 4ETOA 1MF8B 4JD9A 1B8RA 3R72A 2ERBA 2KOTA 3D77A 1KWOC 2KAXA 1L2OB 2K60A 3D75A 3ICBA 3JVTB 4PE7A 2KSPA 4MZKA 1CMFA 3PN7B 4NDDA 1OOIX 3TUYC 1DEKA 2ZNEA 1W7JB 1B1GA 2NXQA 4F0ZB 2FCDA 4M2OA 4MZLA 2BKIB 2COLB 1SW8A 1NIWA 3EVUA 3N7HA 3CR5X 1PVAA 1CDPA 4ORAB 5KTYA 3E3RA 2BE6A 2LMTA 2L2EA 2OTGC 3S0GA 1WY9A 2Q4UA 1ALVA 3VRPA 3DXLA 1SCMC 2BNXA 4INWA 1PVBA 4GNKB 1TCFA 2BCAA 3BFBA 3S0EA 1MXLC 1QX5B 2JTZA 3BUNB 3EK4A 3SIAA 1SL7A 1XK4A 2KAYA 4PE0A 1YX7A 2M8UA 1S6IA 2L4HA 3D78A 4OKHA 4JPZB 4CLNA 1Y6WA 2PASA 2ISDA 3WHTB 2BCBA 2WCJA 1IG5A 2LLTA 1DJGA 3AKBA 1QIVA 1T14A 5I2QA 5CPVA 1LA3A 3KHEA 2JT0A 3OX6A 1JC2A 3VRNA 1GGZA 2H8VA 3V2LA 2GGZA 4QJ4B 3B86A 4NQGA 2G2BA 4GFTA 1MHOA 2TN4A 4N5XA 1J1EA 3TDIA 4MSPA 4WQ3A 1EL4A 4P2YB 1QLSA 2KBIA 3EVRA 1H8BA 4XJKB 1OMVA 1G8IA 2MA2A 3KF9A 3VGOA 2JQ6A 2WCFA 1Y1XA 1TRFA 3O4XA 1F4QA 1S1EA 2KYCA 2LMVA 3SG5A 1EJ3A 1GQMA 1BR4B 2L4IA 3DY9A 1RECA 1YRUB 3BFHA 1FI5A 1RK9A 3QRXA 3RZSA 2OPOA 2NLNA 3PM2A 4QJ5B 1EXRA 1W7IB 1A75B 3GK4X 4GUKA 4C0KA 1NX2A 1JF2A 4QJ3B 1QV1A 1QVIY 4PE1A 5BPJA 1QV0A 1VRKA 1LA0A 2ZRSA 4PT1A 1JFJA 1XK4C 4GAOA 3I5HB 2Y4QA 4HREE 1S26D 2KFHA 3I5IC 3Q8IA 4DIRA 1XO5A 4MN0A 3BUOB 3C1VA 2LM5A 4AQIA 5ER5A 1B7TY 1XFRA 1P28A 3DZTA 4BY4A 1XVJA 3OBVA 1K8UA 3SS5A 5HKZA 3I5FB 5AANA 3HCMA 2LVVA 3R1OA 1EH2A 1FF1A 1MQ1A 3BQ3A 2SCPA 1OZOA 4ORBB 2GV5A 1ORGA 5AXIA 2I7AA 1QIWA 1DF0A 3QMEA 3ZNIA 1KQMC 3SJSA 1DGUA 1YUSA 2KFFA 2KYFA 1J7QA 4OV2A 2M1KB 1A4PA 2HF5A 2PQLA 1RFJA 1CFFA 2LP3A 3O4YA 5D3OA 1R2UA 3PM8A 2L51A 2CXJA 4MLWA 2K0JA 1PALA 2I94A 1U5IA 4BY5A 1SCVA 4GGFC 3TDUA 1MUXA 1IWQA 3RLZA 2PMYA 3F45A 1BOCA 1F8HA 4YGDB 1DJIA 2PRUA 1AVSA 4P5OE 5AFPA 1QX2A 1UHHA 2KI6D 2KNEA 2QEBA 3DF0B 3D73A 3WXAA 1IKUA 1DJYA 4MZJA 1F55A 1OSAA 1QS7A 2H61C 2MAZA 1BU3A 5FYXA 2BKHB 2LHIA 3AAJA 2F8PA 2JOJA 4C0JA 1V1FA 1XA5A 1C7VA 2Y5IA 2HQ8A 1SR6C 2MRDA 2OS8C 1QATA 1MXEA 1SY9A 4YRUA 2D8NA 1ODBA 3BOWA 2FCEA 3HX4A 4WRIA 1YVLA 1OE9B 1AK8A 3JTDC 3SIBA 4I5JA 3PN7C 3NSIA 2K8MB 3DVEA 3CTNA 3B7AA 2JC2A 2IS9A 2E30A 5KSZA 4XJKA 1Q80A 2WC5A 3FWCA 5PALA 1GGWA 1UP5A 1C3ZA 1E8AA 2LP2A 3KO0A 1NYAA 1GM0A 5D69A 3GK2A 1DF0B 4I5KA 5HKYA 1OOGA 4PCWA 1RWYA 4E68A 1DC1A 1A75A 1NCYA 1S6CA 2WOSA 2QPTA 1DGVA 2L2CA 2M7NA 4JQ0D 2E6WA 4PDZA 2ZRTA 2KAVA 2BBMA 2JPOA 4IL1A 2K7DA 4IJ7A 3O6BA 3VROA 1U5IB 5I2OA 1KFXS 2M97A
chains in the Genus database with same CATH topology
4YI9A 1F70A 1KWOB 1IGVA 3M0WA 4YBHB 1NSHA 5AEQA 3TUYB 1PSBA 3EK8A 1LXFC 1JF0A 2LE9B 4GGNA 1QASA 2LCPA 4GBAA 4OR9B 1YTZC 2F33A 3FIAA 4PHNA 1EG3A 1Y1UA 2LNKA 1M46A 1J7OA 4ICBA 2O5GA 1WDCC 1OOJA 1RTP1 3CGAA 4I5LB 2CNPA 2HETA 1Y1AA 2EGDA 2I18A 1NUBA 1CM4A 2JULA 2OTGB 3BOWB 4PHJA 2RGIA 5CSJA 2SASA 3BUXB 3ZWHA 2R2IA 3D10A 4CFQA 4PE4A 2FJUB 1CNPA 1N65A 2WNDA 3KEVA 2L50A 4N1FA 2F2OA 2JT3A 2M29A 1BF5A 1K93D 1TCOB 2AAOA 2KI6C 2LLUA 2P6BB 4N1GA 1YX8A 4L9MA 1OMRA 1ZFSA 4I5NB 3D0YB 3IF7A 5F6TA 3PFVA 1KFXL 1XFUO 2BL0C 2HPSA 4OCIA 1LINA 3DF0A 3KPXA 3CZTX 1A03A 1KCYA 3CR4X 1JUOA 4PHKA 1F71A 2B1UA 1DTLA 1NPQA 4YI8A 3LLEA 3FS7A 1QVIZ 1M63B 4Q04A 3RM1A 2ZN9A 3O2PA 2CBLA 4FQOA 2MBXA 1KK8C 3BUWB 4DRWA 1SL8A 1TNXA 4NDBA 2M0RA 4A4BA 3CS1A 1SYMA 2ZNDA 2WC8A 1IQ5A 3GK1A 3TS5C 2EHBA 2QACA 1FI6A 2LLSA 1CM1A 1SL9A 3OB1B 2NZ0A 4MRXA 3SG3A 1JBAA 1CMGA 2NCPA 3AKAA 1TNWA 3LK1A 1CDLA 1FPWA 2VRGA 2LAPA 2FOTA 1YURA 1NCXA 3I5IB 1M39A 1H4BA 3PSRA 2M49B 2JWWA 4FTGA 2PSRA 1N0YA 1SKTA 2KGBC 4U8DA 1IJ5A 2F2PA 4AOMA 2EC6C 2JNFA 3LCPC 4HRHA 2Y1NA 1S5GZ 2WORA 1HQVA 1AJ5A 2PALA 3SG4A 1XFYO 4MRYA 2JZIA 3I5GC 5KU1A 5AERA 2I2RE 1DJHA 2JPTA 2KI4C 1B4CA 1KQMB 2DOQA 1UHJA 2LANA 4MVFA 1F54A 2KHNA 1WRLA 2CTNA 3EK7A 1B8CA 1L2OC 1SPYA 1WRZA 3JVTC 2KQ6A 1OMDA 2HQWA 3AAKA 1SBJA 1IRJA 1UURA 2K2FA 2M9GA 4ZCUA 4DS7A 1KK7Y 3PLFB 1X02A 1NWDA 1UUSA 5ER4X 1CDNA 3EKJA 1F4OA 2M3WA 2BCXA 1SNLA 3DVJA 4YGBB 2MJWB 1SMGA 4DUQA 3D0YA 1IQ3A 1B8LA 1HT9A 1SRAA 4WQ2A 1TTXA 2MLEC 3OX5A 1AP4A 1DT7B 4D1EA 1QJTA 2KGRA 1BODA 4CFRA 1MWNA 3EVVA 2LHLA 1KQVA 5DKNA 2AUCA 4MBEA 4CPVA 2LC5A 1XFXO 1K9KA 1YUTA 1PRWA 4ZCVA 2PVBA 1FW4A 3JTDB 1J1DA 1DJZA 2L0PA 5B8IB 4MEWA 2K7OA 1FBVA 3VRRA 3TDZA 5HLOA 2KFGA 2GGMA 1CFCA 3DD4A 3FWBA 1RROA 5HKWA 3DVKA 1DJWA 1BLQA 1XFVO 1M45A 1OZSA 1DJXA 2WCBA 4HRGA 2BE4A 1CB1A 1ZACA 4M2PA 3CWGA 3IQOA 1IJ6A 1SCMB 1K9PA 3VRQA 1BJFA 1BR1B 3NSOA 1C07A 1IH0A 2LVKA 1SK6D 2Q91A 3OP0A 1CDMA 1XFZO 2JXCA 2JT8A 3SG7A 1KSMA 3CLNA 1DMOA 1OQPA 3O78A 4OVNF 2KBMA 3A8RA 1DVIA 4R1EA 1WRKA 1K90D 1TN4A 3TZ1A 5DKQA 2NCOA 3WNXB 4UPGA 1UHNA 5I8NA 1M31A 1TIZA 3I5HC 1WDCB 4YGAA 1JWDA 5JJGA 1A29A 1YR5A 1J55A 5K89A 2M7LA 3OHMB 5HYDA 1KSOA 4ORCB 1UWOA 2LMUA 2KDHA 1RJVA 2Y1MA 2JU0A 1NX3A 2MLFC 4A4CA 3BYAA 5TNCA 1Y0VH 2G9BA 3I5FC 3EKHA 2JRFA 1JFKA 2AMIA 2V53A 2M1UA 3OB2B 1J7RA 4GGFA 1B7TZ 1GJYA 1R6PA 3DVMA 1N2DA 3BXKA 3WHUB 2BL0B 2K61A 3NXAA 3SG6A 1BMOA 2BBNA 1AUIB 1G33A 2K7BA 1PK0D 5HLVA 2O60A 2CCMA 2H2KA 1YUUA 1KFUS 2H61A 5CSIA 1UHIA 2CT9A 5CSFA 1EG4A 4TNCA 1CFPA 1C7WA 1V1GA 2K2AA 1K2HA 2JXLA 3MSEB 1TNPA 3BUMB 3NSKA 5J3XA 1KK8B 1S3PA 1ALWA 1G4YR 2ZKMX 3LL8B 3K21A 4YGCB 1QLKA 3PALA 4DCKA 1MR8A 3SG2A 1JSAA 2JNXA 2LVIA 4C0LA 1WLZA 1CLBA 1QX7A 1NX1A 4GPLB 2BECA 1WLMA 3TS5B 4USLA 1CLLA 3A4UB 2L5XB 1LVCD 2F3ZA 1K94A 3LK0A 1CTRA 2LVJA 1S36A 4M2QA 5CSNA 1K96A 1XFWO 2L98A 2F3YA 1CLMA 1ZUZA 2ZFDA 4YGEB 5G08A 2A4JA 1BG1A 1QXPA 2LUXA 1CKKA 2WCEA 1TNQA 1ZMZA 5GQQC 5D7FA 5I2LA 2LUCA 1YVHA 1NX0A 1L7ZA 1S5GY 1D1OA 1YRTB 1NCZA 1XYDA 2JTTA 1A2XA 1KFUL 1J7PA 1BT6A 1AHRA 4HSZA 1QTXA 4PALA 1ZOTB 1PSRA 1UHKA 2EC6B 3H4SE 2LV7A 1AJ4A 3IQQA 2KQYA 1B9AA 1CFDA 1KK7Z 3GOFA 5JOLA 1S6JA 3I5GB 1PULA 4JWQA 4AQJA 2K7CA 4PHMA 1TOPA 2ZN8A 3NSLA 1K9UA 3PATA 4CIDA 1B47A 2KI4B 1NP8A 5IBWA 1K95A 3CR2A 2MHHA 4NDCA 4XYNA 1SR6B 2OS8B 1LKJA 5DKRA 4ETOA 1MF8B 1B8RA 2KOTA 1KWOC 2KAXA 1L2OB 4PE7A 3ICBA 3JVTB 2KSPA 4MZKA 1CMFA 3PN7B 4NDDA 3TUYC 2ZNEA 1W7JB 1B1GA 2NXQA 4F0ZB 2FCDA 4M2OA 4MZLA 2BKIB 2COLB 1SW8A 1NIWA 3EVUA 3CR5X 1PVAA 1CDPA 4ORAB 5KTYA 3E3RA 2BE6A 2LMTA 2L2EA 2OTGC 1WY9A 2Q4UA 1ALVA 3VRPA 1SCMC 1PVBA 4GNKB 1TCFA 2BCAA 3SIAA 1MXLC 1QX5B 2JTZA 3BUNB 3EK4A 1SL7A 1XK4A 2KAYA 4PE0A 1YX7A 2M8UA 1S6IA 2L4HA 4OKHA 4JPZB 4CLNA 1Y6WA 2PASA 2ISDA 3WHTB 2BCBA 1IG5A 2LLTA 1DJGA 3AKBA 1QIVA 5I2QA 5CPVA 1LA3A 3KHEA 2JT0A 3OX6A 1JC2A 3VRNA 1GGZA 2GGZA 4QJ4B 4NQGA 2G2BA 4GFTA 1MHOA 2TN4A 4N5XA 1J1EA 3TDIA 4MSPA 4WQ3A 1EL4A 4P2YB 1QLSA 2KBIA 3EVRA 1H8BA 4XJKB 1OMVA 1G8IA 2MA2A 3KF9A 3VGOA 2JQ6A 2WCFA 1Y1XA 1TRFA 3SG5A 1F4QA 1S1EA 2KYCA 2LMVA 1EJ3A 1GQMA 1BR4B 2L4IA 1RECA 1YRUB 1FI5A 1RK9A 3QRXA 2OPOA 2NLNA 4QJ5B 1EXRA 1W7IB 1A75B 3GK4X 4GUKA 4C0KA 1NX2A 1JF2A 4QJ3B 1QV1A 1QVIY 4PE1A 5BPJA 1QV0A 1VRKA 1LA0A 2ZRSA 1JFJA 1XK4C 4GAOA 3I5HB 2Y4QA 4HREE 1S26D 2KFHA 3I5IC 4DIRA 1XO5A 4MN0A 3BUOB 3C1VA 2LM5A 4AQIA 5ER5A 1B7TY 4BY4A 1XVJA 1K8UA 5HKZA 3I5FB 5AANA 3HCMA 2LVVA 1EH2A 1FF1A 1MQ1A 3BQ3A 2SCPA 1OZOA 4ORBB 2GV5A 5AXIA 2I7AA 1QIWA 1DF0A 3ZNIA 1KQMC 3SJSA 1DGUA 1YUSA 2KFFA 2KYFA 1J7QA 4OV2A 2M1KB 1A4PA 2HF5A 1RFJA 1CFFA 2LP3A 3O4YA 1R2UA 3PM8A 2L51A 2CXJA 4MLWA 2K0JA 1PALA 2I94A 1U5IA 4BY5A 1SCVA 4GGFC 3TDUA 1MUXA 1IWQA 3RLZA 2PMYA 3F45A 1BOCA 1F8HA 4YGDB 1DJIA 2PRUA 1AVSA 4P5OE 5AFPA 1QX2A 1UHHA 2KI6D 2KNEA 3DF0B 1F55A 3WXAA 1IKUA 1DJYA 4MZJA 1OSAA 1QS7A 2H61C 2MAZA 1BU3A 5FYXA 2BKHB 2LHIA 3AAJA 2F8PA 2JOJA 4C0JA 1V1FA 1XA5A 1C7VA 2Y5IA 2HQ8A 1SR6C 2MRDA 2OS8C 1QATA 1MXEA 1SY9A 4YRUA 2D8NA 1ODBA 3BOWA 2FCEA 3HX4A 4WRIA 1YVLA 1OE9B 1AK8A 3JTDC 3SIBA 4I5JA 3PN7C 3NSIA 2K8MB 3DVEA 3CTNA 2JC2A 2IS9A 2E30A 5KSZA 4XJKA 1Q80A 5PALA 3FWCA 1GGWA 1UP5A 1E8AA 2LP2A 3KO0A 1NYAA 5D69A 3GK2A 1DF0B 4I5KA 5HKYA 4E68A 4PCWA 1RWYA 1A75A 1NCYA 1S6CA 2WOSA 2QPTA 1DGVA 2M7NA 4JQ0D 4PDZA 2E6WA 2ZRTA 2KAVA 2BBMA 4IL1A 2K7DA 3O6BA 3VROA 1U5IB 5I2OA 1KFXS 2M97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YI9 A;  1F70 A;  1KWO B;  1IGV A;  3M0W A;  4YBH B;  1NSH A;  5AEQ A;  3TUY B;  1PSB A;  3EK8 A;  1LXF C;  1JF0 A;  2LE9 B;  4GGN A;  1QAS A;  2LCP A;  4GBA A;  4OR9 B;  1YTZ C;  2F33 A;  3FIA A;  4PHN A;  1EG3 A;  1Y1U A;  2LNK A;  1M46 A;  1J7O A;  4ICB A;  2O5G A;  1WDC C;  1OOJ A;  1RTP 1;  3CGA A;  4I5L B;  2CNP A;  2HET A;  1Y1A A;  2EGD A;  2I18 A;  1NUB A;  1CM4 A;  2JUL A;  2OTG B;  3BOW B;  4PHJ A;  2RGI A;  5CSJ A;  2SAS A;  3BUX B;  3ZWH A;  2R2I A;  3D10 A;  4CFQ A;  4PE4 A;  2FJU B;  1CNP A;  1N65 A;  2WND A;  3KEV A;  2L50 A;  4N1F A;  2F2O A;  2JT3 A;  2M29 A;  1BF5 A;  1K93 D;  1TCO B;  2AAO A;  2KI6 C;  2LLU A;  2P6B B;  4N1G A;  1YX8 A;  4L9M A;  1OMR A;  1ZFS A;  4I5N B;  3D0Y B;  3IF7 A;  5F6T A;  3PFV A;  1KFX L;  1XFU O;  2BL0 C;  2HPS A;  4OCI A;  1LIN A;  3DF0 A;  3KPX A;  3CZT X;  1A03 A;  1KCY A;  3CR4 X;  1JUO A;  4PHK A;  1F71 A;  2B1U A;  1DTL A;  1NPQ A;  4YI8 A;  3LLE A;  3FS7 A;  1QVI Z;  1M63 B;  4Q04 A;  3RM1 A;  2ZN9 A;  3O2P A;  2CBL A;  4FQO A;  2MBX A;  1KK8 C;  3BUW B;  4DRW A;  1SL8 A;  1TNX A;  4NDB A;  2M0R A;  4A4B A;  3CS1 A;  1SYM A;  2ZND A;  2WC8 A;  1IQ5 A;  3GK1 A;  3TS5 C;  2EHB A;  2QAC A;  1FI6 A;  2LLS A;  1CM1 A;  1SL9 A;  3OB1 B;  2NZ0 A;  4MRX A;  3SG3 A;  1JBA A;  1CMG A;  2NCP A;  3AKA A;  1TNW A;  3LK1 A;  1CDL A;  1FPW A;  2VRG A;  2LAP A;  2FOT A;  1YUR A;  1NCX A;  3I5I B;  1M39 A;  1H4B A;  3PSR A;  2M49 B;  2JWW A;  4FTG A;  2PSR A;  1N0Y A;  1SKT A;  2KGB C;  4U8D A;  1IJ5 A;  2F2P A;  4AOM A;  2EC6 C;  2JNF A;  3LCP C;  4HRH A;  2Y1N A;  1S5G Z;  2WOR A;  1HQV A;  1AJ5 A;  2PAL A;  3SG4 A;  1XFY O;  4MRY A;  2JZI A;  3I5G C;  5KU1 A;  5AER A;  2I2R E;  1DJH A;  2JPT A;  2KI4 C;  1B4C A;  1KQM B;  2DOQ A;  1UHJ A;  2LAN A;  4MVF A;  1F54 A;  2KHN A;  1WRL A;  2CTN A;  3EK7 A;  1B8C A;  1L2O C;  1SPY A;  1WRZ A;  3JVT C;  2KQ6 A;  1OMD A;  2HQW A;  3AAK A;  1SBJ A;  1IRJ A;  1UUR A;  2K2F A;  2M9G A;  4ZCU A;  4DS7 A;  1KK7 Y;  3PLF B;  1X02 A;  1NWD A;  1UUS A;  5ER4 X;  1CDN A;  3EKJ A;  1F4O A;  2M3W A;  2BCX A;  1SNL A;  3DVJ A;  4YGB B;  2MJW B;  1SMG A;  4DUQ A;  3D0Y A;  1IQ3 A;  1B8L A;  1HT9 A;  1SRA A;  4WQ2 A;  1TTX A;  2MLE C;  3OX5 A;  1AP4 A;  1DT7 B;  4D1E A;  1QJT A;  2KGR A;  1BOD A;  4CFR A;  1MWN A;  3EVV A;  2LHL A;  1KQV A;  5DKN A;  2AUC A;  4MBE A;  4CPV A;  2LC5 A;  1XFX O;  1K9K A;  1YUT A;  1PRW A;  4ZCV A;  2PVB A;  1FW4 A;  3JTD B;  1J1D A;  1DJZ A;  2L0P A;  5B8I B;  4MEW A;  2K7O A;  1FBV A;  3VRR A;  3TDZ A;  5HLO A;  2KFG A;  2GGM A;  1CFC A;  3DD4 A;  3FWB A;  1RRO A;  5HKW A;  3DVK A;  1DJW A;  1BLQ A;  1XFV O;  1M45 A;  1OZS A;  1DJX A;  2WCB A;  4HRG A;  2BE4 A;  1CB1 A;  1ZAC A;  4M2P A;  3CWG A;  3IQO A;  1IJ6 A;  1SCM B;  1K9P A;  3VRQ A;  1BJF A;  1BR1 B;  3NSO A;  1C07 A;  1IH0 A;  2LVK A;  1SK6 D;  2Q91 A;  3OP0 A;  1CDM A;  1XFZ O;  2JXC A;  2JT8 A;  3SG7 A;  1KSM A;  3CLN A;  1DMO A;  1OQP A;  3O78 A;  4OVN F;  2KBM A;  3A8R A;  1DVI A;  4R1E A;  1WRK A;  1K90 D;  1TN4 A;  3TZ1 A;  5DKQ A;  2NCO A;  3WNX B;  4UPG A;  1UHN A;  5I8N A;  1M31 A;  1TIZ A;  3I5H C;  1WDC B;  4YGA A;  1JWD A;  5JJG A;  1A29 A;  1YR5 A;  1J55 A;  5K89 A;  2M7L A;  3OHM B;  5HYD A;  1KSO A;  4ORC B;  1UWO A;  2LMU A;  2KDH A;  1RJV A;  2Y1M A;  2JU0 A;  1NX3 A;  2MLF C;  4A4C A;  3BYA A;  5TNC A;  1Y0V H;  2G9B A;  3I5F C;  3EKH A;  2JRF A;  1JFK A;  2AMI A;  2V53 A;  2M1U A;  3OB2 B;  1J7R A;  4GGF A;  1B7T Z;  1GJY A;  1R6P A;  3DVM A;  1N2D A;  3BXK A;  3WHU B;  2BL0 B;  2K61 A;  3NXA A;  3SG6 A;  1BMO A;  2BBN A;  1AUI B;  1G33 A;  2K7B A;  1PK0 D;  5HLV A;  2O60 A;  2CCM A;  2H2K A;  1YUU A;  1KFU S;  2H61 A;  5CSI A;  1UHI A;  2CT9 A;  5CSF A;  1EG4 A;  4TNC A;  1CFP A;  1C7W A;  1V1G A;  2K2A A;  1K2H A;  2JXL A;  3MSE B;  1TNP A;  3BUM B;  3NSK A;  5J3X A;  1KK8 B;  1S3P A;  1ALW A;  1G4Y R;  2ZKM X;  3LL8 B;  3K21 A;  4YGC B;  1QLK A;  3PAL A;  4DCK A;  1MR8 A;  3SG2 A;  1JSA A;  2JNX A;  2LVI A;  4C0L A;  1WLZ A;  1CLB A;  1QX7 A;  1NX1 A;  4GPL B;  2BEC A;  1WLM A;  3TS5 B;  4USL A;  1CLL A;  3A4U B;  2L5X B;  1LVC D;  2F3Z A;  1K94 A;  3LK0 A;  1CTR A;  2LVJ A;  1S36 A;  4M2Q A;  5CSN A;  1K96 A;  1XFW O;  2L98 A;  2F3Y A;  1CLM A;  1ZUZ A;  2ZFD A;  4YGE B;  5G08 A;  2A4J A;  1BG1 A;  1QXP A;  2LUX A;  1CKK A;  2WCE A;  1TNQ A;  1ZMZ A;  5GQQ C;  5D7F A;  5I2L A;  2LUC A;  1YVH A;  1NX0 A;  1L7Z A;  1S5G Y;  1D1O A;  1YRT B;  1NCZ A;  1XYD A;  2JTT A;  1A2X A;  1KFU L;  1J7P A;  1BT6 A;  1AHR A;  4HSZ A;  1QTX A;  4PAL A;  1ZOT B;  1PSR A;  1UHK A;  2EC6 B;  3H4S E;  2LV7 A;  1AJ4 A;  3IQQ A;  2KQY A;  1B9A A;  1CFD A;  1KK7 Z;  3GOF A;  5JOL A;  1S6J A;  3I5G B;  1PUL A;  4JWQ A;  4AQJ A;  2K7C A;  4PHM A;  1TOP A;  2ZN8 A;  3NSL A;  1K9U A;  3PAT A;  4CID A;  1B47 A;  2KI4 B;  1NP8 A;  5IBW A;  1K95 A;  3CR2 A;  2MHH A;  4NDC A;  4XYN A;  1SR6 B;  2OS8 B;  1LKJ A;  5DKR A;  4ETO A;  1MF8 B;  1B8R A;  2KOT A;  1KWO C;  2KAX A;  1L2O B;  4PE7 A;  3ICB A;  3JVT B;  2KSP A;  4MZK A;  1CMF A;  3PN7 B;  4NDD A;  3TUY C;  2ZNE A;  1W7J B;  1B1G A;  2NXQ A;  4F0Z B;  2FCD A;  4M2O A;  4MZL A;  2BKI B;  2COL B;  1SW8 A;  1NIW A;  3EVU A;  3CR5 X;  1PVA A;  1CDP A;  4ORA B;  5KTY A;  3E3R A;  2BE6 A;  2LMT A;  2L2E A;  2OTG C;  1WY9 A;  2Q4U A;  1ALV A;  3VRP A;  1SCM C;  1PVB A;  4GNK B;  1TCF A;  2BCA A;  3SIA A;  1MXL C;  1QX5 B;  2JTZ A;  3BUN B;  3EK4 A;  1SL7 A;  1XK4 A;  2KAY A;  4PE0 A;  1YX7 A;  2M8U A;  1S6I A;  2L4H A;  4OKH A;  4JPZ B;  4CLN A;  1Y6W A;  2PAS A;  2ISD A;  3WHT B;  2BCB A;  1IG5 A;  2LLT A;  1DJG A;  3AKB A;  1QIV A;  5I2Q A;  5CPV A;  1LA3 A;  3KHE A;  2JT0 A;  3OX6 A;  1JC2 A;  3VRN A;  1GGZ A;  2GGZ A;  4QJ4 B;  4NQG A;  2G2B A;  4GFT A;  1MHO A;  2TN4 A;  4N5X A;  1J1E A;  3TDI A;  4MSP A;  4WQ3 A;  1EL4 A;  4P2Y B;  1QLS A;  2KBI A;  3EVR A;  1H8B A;  4XJK B;  1OMV A;  1G8I A;  2MA2 A;  3KF9 A;  3VGO A;  2JQ6 A;  2WCF A;  1Y1X A;  1TRF A;  3SG5 A;  1F4Q A;  1S1E A;  2KYC A;  2LMV A;  1EJ3 A;  1GQM A;  1BR4 B;  2L4I A;  1REC A;  1YRU B;  1FI5 A;  1RK9 A;  3QRX A;  2OPO A;  2NLN A;  4QJ5 B;  1EXR A;  1W7I B;  1A75 B;  3GK4 X;  4GUK A;  4C0K A;  1NX2 A;  1JF2 A;  4QJ3 B;  1QV1 A;  1QVI Y;  4PE1 A;  5BPJ A;  1QV0 A;  1VRK A;  1LA0 A;  2ZRS A;  1JFJ A;  1XK4 C;  4GAO A;  3I5H B;  2Y4Q A;  4HRE E;  1S26 D;  2KFH A;  3I5I C;  4DIR A;  1XO5 A;  4MN0 A;  3BUO B;  3C1V A;  2LM5 A;  4AQI A;  5ER5 A;  1B7T Y;  4BY4 A;  1XVJ A;  1K8U A;  5HKZ A;  3I5F B;  5AAN A;  3HCM A;  2LVV A;  1EH2 A;  1FF1 A;  1MQ1 A;  3BQ3 A;  2SCP A;  1OZO A;  4ORB B;  2GV5 A;  5AXI A;  2I7A A;  1QIW A;  1DF0 A;  3ZNI A;  1KQM C;  3SJS A;  1DGU A;  1YUS A;  2KFF A;  2KYF A;  1J7Q A;  4OV2 A;  2M1K B;  1A4P A;  2HF5 A;  1RFJ A;  1CFF A;  2LP3 A;  3O4Y A;  1R2U A;  3PM8 A;  2L51 A;  2CXJ A;  4MLW A;  2K0J A;  1PAL A;  2I94 A;  1U5I A;  4BY5 A;  1SCV A;  4GGF C;  3TDU A;  1MUX A;  1IWQ A;  3RLZ A;  2PMY A;  3F45 A;  1BOC A;  1F8H A;  4YGD B;  1DJI A;  2PRU A;  1AVS A;  4P5O E;  5AFP A;  1QX2 A;  1UHH A;  2KI6 D;  2KNE A;  3DF0 B;  1F55 A;  3WXA A;  1IKU A;  1DJY A;  4MZJ A;  1OSA A;  1QS7 A;  2H61 C;  2MAZ A;  1BU3 A;  5FYX A;  2BKH B;  2LHI A;  3AAJ A;  2F8P A;  2JOJ A;  4C0J A;  1V1F A;  1XA5 A;  1C7V A;  2Y5I A;  2HQ8 A;  1SR6 C;  2MRD A;  2OS8 C;  1QAT A;  1MXE A;  1SY9 A;  4YRU A;  2D8N A;  1ODB A;  3BOW A;  2FCE A;  3HX4 A;  4WRI A;  1YVL A;  1OE9 B;  1AK8 A;  3JTD C;  3SIB A;  4I5J A;  3PN7 C;  3NSI A;  2K8M B;  3DVE A;  3CTN A;  2JC2 A;  2IS9 A;  2E30 A;  5KSZ A;  4XJK A;  1Q80 A;  5PAL A;  3FWC A;  1GGW A;  1UP5 A;  1E8A A;  2LP2 A;  3KO0 A;  1NYA A;  5D69 A;  3GK2 A;  1DF0 B;  4I5K A;  5HKY A;  4E68 A;  4PCW A;  1RWY A;  1A75 A;  1NCY A;  1S6C A;  2WOS A;  2QPT A;  1DGV A;  2M7N A;  4JQ0 D;  4PDZ A;  2E6W A;  2ZRT A;  2KAV A;  2BBM A;  4IL1 A;  2K7D A;  3O6B A;  3VRO A;  1U5I B;  5I2O A;  1KFX S;  2M97 A; 
#chains in the Genus database with same CATH topology
 4YI9 A;  2YGU A;  1KWO B;  3BJH A;  1F70 A;  1IGV A;  2GTE A;  2WCH A;  3M0W A;  4YBH B;  1NSH A;  5AEQ A;  3TUY B;  3FE9 A;  1PSB A;  3EK8 A;  1LXF C;  1JF0 A;  2LE9 B;  4GGN A;  1QAS A;  2LCP A;  4GBA A;  4OR9 B;  1YTZ C;  2F33 A;  3FIA A;  4PHN A;  1EG3 A;  1Y1U A;  2LNK A;  1M46 A;  1J7O A;  4ICB A;  2O5G A;  1OW4 A;  1OOJ A;  1RTP 1;  1WDC C;  3CGA A;  4I5L B;  2CNP A;  2HET A;  1Y1A A;  2EGD A;  2I18 A;  1NUB A;  1CM4 A;  2JUL A;  2OTG B;  3BOW B;  4PHJ A;  2RGI A;  5CSJ A;  2SAS A;  3BUX B;  3ZWH A;  2R2I A;  3D10 A;  4CFQ A;  4PE4 A;  2FJU B;  1CNP A;  1N65 A;  3PJI A;  2WND A;  3CAB A;  3KEV A;  2L50 A;  3R1P A;  4N1F A;  2F2O A;  2JT3 A;  2M29 A;  2P70 A;  1BF5 A;  1K93 D;  1TCO B;  2AAO A;  2KI6 C;  2LLU A;  2P6B B;  4N1G A;  1YX8 A;  4L9M A;  1OMR A;  1ZFS A;  4I5N B;  3S0A A;  3D0Y B;  3IF7 A;  5F6T A;  3PFV A;  1KFX L;  1XFU O;  2BL0 C;  2HPS A;  3D76 A;  2QEV A;  4OCI A;  2P71 A;  1LIN A;  3DF0 A;  3KPX A;  3CZT X;  1A03 A;  1KCY A;  3CR4 X;  1JUO A;  4PHK A;  3R1V A;  1F71 A;  2B1U A;  1DTL A;  1NPQ A;  4YI8 A;  3LLE A;  3CZ0 A;  1QVI Z;  1M63 B;  3FS7 A;  4Q04 A;  3RM1 A;  2ZN9 A;  3SS3 A;  3O2P A;  2CBL A;  4FQO A;  2MBX A;  1KK8 C;  3BUW B;  4DRW A;  1SL8 A;  1TNX A;  3L4L A;  4NDB A;  2M0R A;  4A4B A;  3FE8 A;  2KLD A;  3CS1 A;  1SYM A;  2ZND A;  3FE6 A;  2WC8 A;  3SS4 A;  1IQ5 A;  3GK1 A;  3TS5 C;  2EHB A;  2QAC A;  1FI6 A;  2LLS A;  1CM1 A;  1SL9 A;  3OB1 B;  2NZ0 A;  4MRX A;  3SG3 A;  3L47 A;  1CMG A;  1JBA A;  2NCP A;  3AKA A;  1TNW A;  3LK1 A;  1CDL A;  1FPW A;  3NGV A;  2VRG A;  2LAP A;  3CZ1 A;  2FOT A;  1YUR A;  1NCX A;  3I5I B;  1M39 A;  1H4B A;  3PSR A;  2M49 B;  2JWW A;  4FTG A;  2PSR A;  5I94 A;  3B87 A;  1N0Y A;  1SKT A;  2KGB C;  2KPH A;  4U8D A;  1IJ5 A;  2F2P A;  4AOM A;  2EC6 C;  2JNF A;  3LCP C;  4HRH A;  2Y1N A;  1S5G Z;  2WOR A;  4INX A;  1HQV A;  1AJ5 A;  2PAL A;  3SG4 A;  1TUJ A;  3NHI A;  1XFY O;  4MRY A;  2JZI A;  3I5G C;  3CZ2 A;  5KU1 A;  5AER A;  2KLE A;  2I2R E;  1DJH A;  2JPT A;  2KI4 C;  2WCM A;  1KQM B;  1B4C A;  2DOQ A;  1UHJ A;  2LAN A;  4MVF A;  1F54 A;  2KHN A;  3B88 A;  1WRL A;  2CTN A;  3EK7 A;  2QEH A;  1B8C A;  1TUZ A;  3EG5 B;  1L2O C;  1SPY A;  1WRZ A;  3JVT C;  2KQ6 A;  1OMD A;  2HQW A;  3AAK A;  1SBJ A;  1IRJ A;  1UUR A;  2K2F A;  2M9G A;  1Z2C B;  4ZCU A;  1KK7 Y;  3PLF B;  4DS7 A;  1X02 A;  1NWD A;  4JKT A;  1UUS A;  1OOH A;  5ER4 X;  1CDN A;  3CDN A;  3EKJ A;  1F4O A;  2M3W A;  3S0F A;  1SSE B;  2BCX A;  1SNL A;  3DVJ A;  4YGB B;  2MJW B;  1SMG A;  4DUQ A;  3D0Y A;  1IQ3 A;  1B8L A;  1HT9 A;  1SRA A;  4WQ2 A;  1DEL A;  1TTX A;  2MLE C;  3OX5 A;  1DT7 B;  4D1E A;  1QJT A;  2KGR A;  1BOD A;  4CFR A;  1MWN A;  3EVV A;  2LHL A;  1KQV A;  5DKN A;  2AUC A;  4MBE A;  4CPV A;  2LC5 A;  1XFX O;  1K9K A;  1YUT A;  1PRW A;  4ZCV A;  2PVB A;  1FW4 A;  3JTD B;  1J1D A;  1DJZ A;  2L0P A;  3IVT A;  5B8I B;  4MEW A;  2K7O A;  2WCK A;  1FBV A;  3VRR A;  1OOF A;  3TDZ A;  5HLO A;  2KFG A;  2GGM A;  3OGN A;  3DD4 A;  1CFC A;  3FWB A;  1C3Y A;  1IIO A;  1RRO A;  4OZD A;  5HKW A;  3VB1 A;  3DVK A;  1DJW A;  1BLQ A;  1XFV O;  1M45 A;  1AP4 A;  1OZS A;  1W9Z A;  5FI7 A;  1DJX A;  2WCB A;  4FQT A;  2BE4 A;  4HRG A;  1CB1 A;  1ZAC A;  4M2P A;  3CWG A;  3IQO A;  1IJ6 A;  1SCM B;  1K9P A;  3VRQ A;  1BJF A;  1BR1 B;  3NSO A;  1C07 A;  1IH0 A;  2LVK A;  1SK6 D;  2Q91 A;  3OP0 A;  1CDM A;  1XFZ O;  2JXC A;  2JT8 A;  3SG7 A;  1KSM A;  3CLN A;  1DMO A;  1OQP A;  3O78 A;  4OVN F;  3L4A A;  2KBM A;  3UNW A;  3A8R A;  1DVI A;  3NHT A;  4R1E A;  1WRK A;  1K90 D;  1TN4 A;  3TZ1 A;  5DKQ A;  2NCO A;  3WNX B;  4UPG A;  1UHN A;  1Z4H A;  5I8N A;  1M31 A;  1TIZ A;  3I5H C;  3UO9 A;  1WDC B;  4YGA A;  1JWD A;  5JJG A;  1A29 A;  1YR5 A;  3DYE A;  1J55 A;  3S0B A;  2M7L A;  5K89 A;  3OHM B;  5HYD A;  1KSO A;  4ORC B;  1UWO A;  2LMU A;  2KDH A;  1RJV A;  1QWV A;  2Y1M A;  5EL2 A;  2JU0 A;  1NX3 A;  2MLF C;  4A4C A;  3BYA A;  5TNC A;  1Y0V H;  2G9B A;  3I5F C;  3EKH A;  2JRF A;  5DIC A;  1JFK A;  2AMI A;  2V53 A;  2M1U A;  3OB2 B;  1J7R A;  4GGF A;  1B7T Z;  1GJY A;  1R6P A;  3DVM A;  1N2D A;  3BXK A;  3WHU B;  1DQE A;  2BL0 B;  2K61 A;  3NXA A;  3SG6 A;  1BMO A;  2BBN A;  1AUI B;  1G33 A;  2K7B A;  1PK0 D;  5HLV A;  2O60 A;  2CCM A;  2H2K A;  1TWO A;  5HL1 A;  1YUU A;  1KFU S;  2H61 A;  5CSI A;  1UHI A;  2CT9 A;  5CSF A;  1EG4 A;  5FI2 A;  4TNC A;  1CFP A;  1C7W A;  1V1G A;  2K2A A;  1K2H A;  2JXL A;  3MSE B;  1TNP A;  3BUM B;  3NSK A;  3B6X A;  5J3X A;  1KK8 B;  1S3P A;  1ALW A;  1G4Y R;  2ZKM X;  3LL8 B;  3K21 A;  4YGC B;  1QLK A;  3PAL A;  4DCK A;  1MR8 A;  3SG2 A;  2WC6 A;  1JSA A;  2JNX A;  2LVI A;  4C0L A;  1WLZ A;  1CLB A;  1QX7 A;  1NX1 A;  4GPL B;  2BEC A;  1WLM A;  3TS5 B;  4USL A;  1CLL A;  3A4U B;  2FJY A;  2L5X B;  1LVC D;  2F3Z A;  1K94 A;  3LK0 A;  1CTR A;  2LVJ A;  1S36 A;  2PYQ A;  4M2Q A;  5CSN A;  1K96 A;  3S0D A;  1XFW O;  2L98 A;  2F3Y A;  1CLM A;  1LS8 A;  1ZUZ A;  2ZFD A;  4YGE B;  2A4J A;  5G08 A;  1BG1 A;  1QXP A;  2LUX A;  1CKK A;  2WCE A;  2QDI A;  1TNQ A;  1ZMZ A;  5GQQ C;  5D7F A;  5I2L A;  4KYN A;  2LUC A;  1YVH A;  1NX0 A;  1L7Z A;  1S5G Y;  3K1E A;  1D1O A;  3CYZ A;  1YRT B;  1NCZ A;  1XYD A;  2JTT A;  1A2X A;  1KFU L;  1J7P A;  1BT6 A;  2BAP A;  1AHR A;  4HSZ A;  1QTX A;  4PAL A;  1ZOT B;  1PSR A;  1UHK A;  2EC6 B;  3H4S E;  2LV7 A;  1AJ4 A;  3IQQ A;  2WCL A;  2KQY A;  1B9A A;  4F7F A;  1CFD A;  1KK7 Z;  3GOF A;  5JOL A;  2L5Y A;  1S6J A;  3I5G B;  1PUL A;  2QEO A;  4JWQ A;  2K7C A;  4PHM A;  1TOP A;  2ZN8 A;  3NSL A;  1K9U A;  3PAT A;  4AQJ A;  1B47 A;  4CID A;  2KI4 B;  1NP8 A;  3D74 A;  5IBW A;  1K95 A;  3BFA A;  2MHH A;  3CR2 A;  4NDC A;  1SR6 B;  4XYN A;  5FI6 A;  2OS8 B;  1LKJ A;  5DKR A;  4ETO A;  1MF8 B;  4JD9 A;  1B8R A;  3R72 A;  2ERB A;  2KOT A;  3D77 A;  1KWO C;  2KAX A;  1L2O B;  2K60 A;  3D75 A;  3ICB A;  3JVT B;  4PE7 A;  2KSP A;  4MZK A;  1CMF A;  3PN7 B;  4NDD A;  1OOI X;  3TUY C;  1DEK A;  2ZNE A;  1W7J B;  1B1G A;  2NXQ A;  4F0Z B;  2FCD A;  4M2O A;  4MZL A;  2BKI B;  2COL B;  1SW8 A;  1NIW A;  3EVU A;  3N7H A;  3CR5 X;  1PVA A;  1CDP A;  4ORA B;  5KTY A;  3E3R A;  2BE6 A;  2LMT A;  2L2E A;  2OTG C;  3S0G A;  1WY9 A;  2Q4U A;  1ALV A;  3VRP A;  3DXL A;  1SCM C;  2BNX A;  4INW A;  1PVB A;  4GNK B;  1TCF A;  2BCA A;  3BFB A;  3S0E A;  1MXL C;  1QX5 B;  2JTZ A;  3BUN B;  3EK4 A;  3SIA A;  1SL7 A;  1XK4 A;  2KAY A;  4PE0 A;  1YX7 A;  2M8U A;  1S6I A;  2L4H A;  3D78 A;  4OKH A;  4JPZ B;  4CLN A;  1Y6W A;  2PAS A;  2ISD A;  3WHT B;  2BCB A;  2WCJ A;  1IG5 A;  2LLT A;  1DJG A;  3AKB A;  1QIV A;  1T14 A;  5I2Q A;  5CPV A;  1LA3 A;  3KHE A;  2JT0 A;  3OX6 A;  1JC2 A;  3VRN A;  1GGZ A;  2H8V A;  3V2L A;  2GGZ A;  4QJ4 B;  3B86 A;  4NQG A;  2G2B A;  4GFT A;  1MHO A;  2TN4 A;  4N5X A;  1J1E A;  3TDI A;  4MSP A;  4WQ3 A;  1EL4 A;  4P2Y B;  1QLS A;  2KBI A;  3EVR A;  1H8B A;  4XJK B;  1OMV A;  1G8I A;  2MA2 A;  3KF9 A;  3VGO A;  2JQ6 A;  2WCF A;  1Y1X A;  1TRF A;  3O4X A;  1F4Q A;  1S1E A;  2KYC A;  2LMV A;  3SG5 A;  1EJ3 A;  1GQM A;  1BR4 B;  2L4I A;  3DY9 A;  1REC A;  1YRU B;  3BFH A;  1FI5 A;  1RK9 A;  3QRX A;  3RZS A;  2OPO A;  2NLN A;  3PM2 A;  4QJ5 B;  1EXR A;  1W7I B;  1A75 B;  3GK4 X;  4GUK A;  4C0K A;  1NX2 A;  1JF2 A;  4QJ3 B;  1QV1 A;  1QVI Y;  4PE1 A;  5BPJ A;  1QV0 A;  1VRK A;  1LA0 A;  2ZRS A;  4PT1 A;  1JFJ A;  1XK4 C;  4GAO A;  3I5H B;  2Y4Q A;  4HRE E;  1S26 D;  2KFH A;  3I5I C;  3Q8I A;  4DIR A;  1XO5 A;  4MN0 A;  3BUO B;  3C1V A;  2LM5 A;  4AQI A;  5ER5 A;  1B7T Y;  1XFR A;  1P28 A;  3DZT A;  4BY4 A;  1XVJ A;  3OBV A;  1K8U A;  3SS5 A;  5HKZ A;  3I5F B;  5AAN A;  3HCM A;  2LVV A;  3R1O A;  1EH2 A;  1FF1 A;  1MQ1 A;  3BQ3 A;  2SCP A;  1OZO A;  4ORB B;  2GV5 A;  1ORG A;  5AXI A;  2I7A A;  1QIW A;  1DF0 A;  3QME A;  3ZNI A;  1KQM C;  3SJS A;  1DGU A;  1YUS A;  2KFF A;  2KYF A;  1J7Q A;  4OV2 A;  2M1K B;  1A4P A;  2HF5 A;  2PQL A;  1RFJ A;  1CFF A;  2LP3 A;  3O4Y A;  5D3O A;  1R2U A;  3PM8 A;  2L51 A;  2CXJ A;  4MLW A;  2K0J A;  1PAL A;  2I94 A;  1U5I A;  4BY5 A;  1SCV A;  4GGF C;  3TDU A;  1MUX A;  1IWQ A;  3RLZ A;  2PMY A;  3F45 A;  1BOC A;  1F8H A;  4YGD B;  1DJI A;  2PRU A;  1AVS A;  4P5O E;  5AFP A;  1QX2 A;  1UHH A;  2KI6 D;  2KNE A;  2QEB A;  3DF0 B;  3D73 A;  3WXA A;  1IKU A;  1DJY A;  4MZJ A;  1F55 A;  1OSA A;  1QS7 A;  2H61 C;  2MAZ A;  1BU3 A;  5FYX A;  2BKH B;  2LHI A;  3AAJ A;  2F8P A;  2JOJ A;  4C0J A;  1V1F A;  1XA5 A;  1C7V A;  2Y5I A;  2HQ8 A;  1SR6 C;  2MRD A;  2OS8 C;  1QAT A;  1MXE A;  1SY9 A;  4YRU A;  2D8N A;  1ODB A;  3BOW A;  2FCE A;  3HX4 A;  4WRI A;  1YVL A;  1OE9 B;  1AK8 A;  3JTD C;  3SIB A;  4I5J A;  3PN7 C;  3NSI A;  2K8M B;  3DVE A;  3CTN A;  3B7A A;  2JC2 A;  2IS9 A;  2E30 A;  5KSZ A;  4XJK A;  1Q80 A;  2WC5 A;  3FWC A;  5PAL A;  1GGW A;  1UP5 A;  1C3Z A;  1E8A A;  2LP2 A;  3KO0 A;  1NYA A;  1GM0 A;  5D69 A;  3GK2 A;  1DF0 B;  4I5K A;  5HKY A;  1OOG A;  4PCW A;  1RWY A;  4E68 A;  1DC1 A;  1A75 A;  1NCY A;  1S6C A;  2WOS A;  2QPT A;  1DGV A;  2L2C A;  2M7N A;  4JQ0 D;  2E6W A;  4PDZ A;  2ZRT A;  2KAV A;  2BBM A;  2JPO A;  4IL1 A;  2K7D A;  4IJ7 A;  3O6B A;  3VRO A;  1U5I B;  5I2O A;  1KFX S;  2M97 A; 
#chains in the Genus database with same CATH homology
 4YI9 A;  1F70 A;  1KWO B;  1IGV A;  3M0W A;  4YBH B;  1NSH A;  5AEQ A;  3TUY B;  1PSB A;  3EK8 A;  1LXF C;  1JF0 A;  2LE9 B;  4GGN A;  1QAS A;  2LCP A;  4GBA A;  4OR9 B;  1YTZ C;  2F33 A;  3FIA A;  4PHN A;  1EG3 A;  1Y1U A;  2LNK A;  1M46 A;  1J7O A;  4ICB A;  2O5G A;  1WDC C;  1OOJ A;  1RTP 1;  3CGA A;  4I5L B;  2CNP A;  2HET A;  1Y1A A;  2EGD A;  2I18 A;  1NUB A;  1CM4 A;  2JUL A;  2OTG B;  3BOW B;  4PHJ A;  2RGI A;  5CSJ A;  2SAS A;  3BUX B;  3ZWH A;  2R2I A;  3D10 A;  4CFQ A;  4PE4 A;  2FJU B;  1CNP A;  1N65 A;  2WND A;  3KEV A;  2L50 A;  4N1F A;  2F2O A;  2JT3 A;  2M29 A;  1BF5 A;  1K93 D;  1TCO B;  2AAO A;  2KI6 C;  2LLU A;  2P6B B;  4N1G A;  1YX8 A;  4L9M A;  1OMR A;  1ZFS A;  4I5N B;  3D0Y B;  3IF7 A;  5F6T A;  3PFV A;  1KFX L;  1XFU O;  2BL0 C;  2HPS A;  4OCI A;  1LIN A;  3DF0 A;  3KPX A;  3CZT X;  1A03 A;  1KCY A;  3CR4 X;  1JUO A;  4PHK A;  1F71 A;  2B1U A;  1DTL A;  1NPQ A;  4YI8 A;  3LLE A;  3FS7 A;  1QVI Z;  1M63 B;  4Q04 A;  3RM1 A;  2ZN9 A;  3O2P A;  2CBL A;  4FQO A;  2MBX A;  1KK8 C;  3BUW B;  4DRW A;  1SL8 A;  1TNX A;  4NDB A;  2M0R A;  4A4B A;  3CS1 A;  1SYM A;  2ZND A;  2WC8 A;  1IQ5 A;  3GK1 A;  3TS5 C;  2EHB A;  2QAC A;  1FI6 A;  2LLS A;  1CM1 A;  1SL9 A;  3OB1 B;  2NZ0 A;  4MRX A;  3SG3 A;  1JBA A;  1CMG A;  2NCP A;  3AKA A;  1TNW A;  3LK1 A;  1CDL A;  1FPW A;  2VRG A;  2LAP A;  2FOT A;  1YUR A;  1NCX A;  3I5I B;  1M39 A;  1H4B A;  3PSR A;  2M49 B;  2JWW A;  4FTG A;  2PSR A;  1N0Y A;  1SKT A;  2KGB C;  4U8D A;  1IJ5 A;  2F2P A;  4AOM A;  2EC6 C;  2JNF A;  3LCP C;  4HRH A;  2Y1N A;  1S5G Z;  2WOR A;  1HQV A;  1AJ5 A;  2PAL A;  3SG4 A;  1XFY O;  4MRY A;  2JZI A;  3I5G C;  5KU1 A;  5AER A;  2I2R E;  1DJH A;  2JPT A;  2KI4 C;  1B4C A;  1KQM B;  2DOQ A;  1UHJ A;  2LAN A;  4MVF A;  1F54 A;  2KHN A;  1WRL A;  2CTN A;  3EK7 A;  1B8C A;  1L2O C;  1SPY A;  1WRZ A;  3JVT C;  2KQ6 A;  1OMD A;  2HQW A;  3AAK A;  1SBJ A;  1IRJ A;  1UUR A;  2K2F A;  2M9G A;  4ZCU A;  4DS7 A;  1KK7 Y;  3PLF B;  1X02 A;  1NWD A;  1UUS A;  5ER4 X;  1CDN A;  3EKJ A;  1F4O A;  2M3W A;  2BCX A;  1SNL A;  3DVJ A;  4YGB B;  2MJW B;  1SMG A;  4DUQ A;  3D0Y A;  1IQ3 A;  1B8L A;  1HT9 A;  1SRA A;  4WQ2 A;  1TTX A;  2MLE C;  3OX5 A;  1AP4 A;  1DT7 B;  4D1E A;  1QJT A;  2KGR A;  1BOD A;  4CFR A;  1MWN A;  3EVV A;  2LHL A;  1KQV A;  5DKN A;  2AUC A;  4MBE A;  4CPV A;  2LC5 A;  1XFX O;  1K9K A;  1YUT A;  1PRW A;  4ZCV A;  2PVB A;  1FW4 A;  3JTD B;  1J1D A;  1DJZ A;  2L0P A;  5B8I B;  4MEW A;  2K7O A;  1FBV A;  3VRR A;  3TDZ A;  5HLO A;  2KFG A;  2GGM A;  1CFC A;  3DD4 A;  3FWB A;  1RRO A;  5HKW A;  3DVK A;  1DJW A;  1BLQ A;  1XFV O;  1M45 A;  1OZS A;  1DJX A;  2WCB A;  4HRG A;  2BE4 A;  1CB1 A;  1ZAC A;  4M2P A;  3CWG A;  3IQO A;  1IJ6 A;  1SCM B;  1K9P A;  3VRQ A;  1BJF A;  1BR1 B;  3NSO A;  1C07 A;  1IH0 A;  2LVK A;  1SK6 D;  2Q91 A;  3OP0 A;  1CDM A;  1XFZ O;  2JXC A;  2JT8 A;  3SG7 A;  1KSM A;  3CLN A;  1DMO A;  1OQP A;  3O78 A;  4OVN F;  2KBM A;  3A8R A;  1DVI A;  4R1E A;  1WRK A;  1K90 D;  1TN4 A;  3TZ1 A;  5DKQ A;  2NCO A;  3WNX B;  4UPG A;  1UHN A;  5I8N A;  1M31 A;  1TIZ A;  3I5H C;  1WDC B;  4YGA A;  1JWD A;  5JJG A;  1A29 A;  1YR5 A;  1J55 A;  5K89 A;  2M7L A;  3OHM B;  5HYD A;  1KSO A;  4ORC B;  1UWO A;  2LMU A;  2KDH A;  1RJV A;  2Y1M A;  2JU0 A;  1NX3 A;  2MLF C;  4A4C A;  3BYA A;  5TNC A;  1Y0V H;  2G9B A;  3I5F C;  3EKH A;  2JRF A;  1JFK A;  2AMI A;  2V53 A;  2M1U A;  3OB2 B;  1J7R A;  4GGF A;  1B7T Z;  1GJY A;  1R6P A;  3DVM A;  1N2D A;  3BXK A;  3WHU B;  2BL0 B;  2K61 A;  3NXA A;  3SG6 A;  1BMO A;  2BBN A;  1AUI B;  1G33 A;  2K7B A;  1PK0 D;  5HLV A;  2O60 A;  2CCM A;  2H2K A;  1YUU A;  1KFU S;  2H61 A;  5CSI A;  1UHI A;  2CT9 A;  5CSF A;  1EG4 A;  4TNC A;  1CFP A;  1C7W A;  1V1G A;  2K2A A;  1K2H A;  2JXL A;  3MSE B;  1TNP A;  3BUM B;  3NSK A;  5J3X A;  1KK8 B;  1S3P A;  1ALW A;  1G4Y R;  2ZKM X;  3LL8 B;  3K21 A;  4YGC B;  1QLK A;  3PAL A;  4DCK A;  1MR8 A;  3SG2 A;  1JSA A;  2JNX A;  2LVI A;  4C0L A;  1WLZ A;  1CLB A;  1QX7 A;  1NX1 A;  4GPL B;  2BEC A;  1WLM A;  3TS5 B;  4USL A;  1CLL A;  3A4U B;  2L5X B;  1LVC D;  2F3Z A;  1K94 A;  3LK0 A;  1CTR A;  2LVJ A;  1S36 A;  4M2Q A;  5CSN A;  1K96 A;  1XFW O;  2L98 A;  2F3Y A;  1CLM A;  1ZUZ A;  2ZFD A;  4YGE B;  5G08 A;  2A4J A;  1BG1 A;  1QXP A;  2LUX A;  1CKK A;  2WCE A;  1TNQ A;  1ZMZ A;  5GQQ C;  5D7F A;  5I2L A;  2LUC A;  1YVH A;  1NX0 A;  1L7Z A;  1S5G Y;  1D1O A;  1YRT B;  1NCZ A;  1XYD A;  2JTT A;  1A2X A;  1KFU L;  1J7P A;  1BT6 A;  1AHR A;  4HSZ A;  1QTX A;  4PAL A;  1ZOT B;  1PSR A;  1UHK A;  2EC6 B;  3H4S E;  2LV7 A;  1AJ4 A;  3IQQ A;  2KQY A;  1B9A A;  1CFD A;  1KK7 Z;  3GOF A;  5JOL A;  1S6J A;  3I5G B;  1PUL A;  4JWQ A;  4AQJ A;  2K7C A;  4PHM A;  1TOP A;  2ZN8 A;  3NSL A;  1K9U A;  3PAT A;  4CID A;  1B47 A;  2KI4 B;  1NP8 A;  5IBW A;  1K95 A;  3CR2 A;  2MHH A;  4NDC A;  4XYN A;  1SR6 B;  2OS8 B;  1LKJ A;  5DKR A;  4ETO A;  1MF8 B;  1B8R A;  2KOT A;  1KWO C;  2KAX A;  1L2O B;  4PE7 A;  3ICB A;  3JVT B;  2KSP A;  4MZK A;  1CMF A;  3PN7 B;  4NDD A;  3TUY C;  2ZNE A;  1W7J B;  1B1G A;  2NXQ A;  4F0Z B;  2FCD A;  4M2O A;  4MZL A;  2BKI B;  2COL B;  1SW8 A;  1NIW A;  3EVU A;  3CR5 X;  1PVA A;  1CDP A;  4ORA B;  5KTY A;  3E3R A;  2BE6 A;  2LMT A;  2L2E A;  2OTG C;  1WY9 A;  2Q4U A;  1ALV A;  3VRP A;  1SCM C;  1PVB A;  4GNK B;  1TCF A;  2BCA A;  3SIA A;  1MXL C;  1QX5 B;  2JTZ A;  3BUN B;  3EK4 A;  1SL7 A;  1XK4 A;  2KAY A;  4PE0 A;  1YX7 A;  2M8U A;  1S6I A;  2L4H A;  4OKH A;  4JPZ B;  4CLN A;  1Y6W A;  2PAS A;  2ISD A;  3WHT B;  2BCB A;  1IG5 A;  2LLT A;  1DJG A;  3AKB A;  1QIV A;  5I2Q A;  5CPV A;  1LA3 A;  3KHE A;  2JT0 A;  3OX6 A;  1JC2 A;  3VRN A;  1GGZ A;  2GGZ A;  4QJ4 B;  4NQG A;  2G2B A;  4GFT A;  1MHO A;  2TN4 A;  4N5X A;  1J1E A;  3TDI A;  4MSP A;  4WQ3 A;  1EL4 A;  4P2Y B;  1QLS A;  2KBI A;  3EVR A;  1H8B A;  4XJK B;  1OMV A;  1G8I A;  2MA2 A;  3KF9 A;  3VGO A;  2JQ6 A;  2WCF A;  1Y1X A;  1TRF A;  3SG5 A;  1F4Q A;  1S1E A;  2KYC A;  2LMV A;  1EJ3 A;  1GQM A;  1BR4 B;  2L4I A;  1REC A;  1YRU B;  1FI5 A;  1RK9 A;  3QRX A;  2OPO A;  2NLN A;  4QJ5 B;  1EXR A;  1W7I B;  1A75 B;  3GK4 X;  4GUK A;  4C0K A;  1NX2 A;  1JF2 A;  4QJ3 B;  1QV1 A;  1QVI Y;  4PE1 A;  5BPJ A;  1QV0 A;  1VRK A;  1LA0 A;  2ZRS A;  1JFJ A;  1XK4 C;  4GAO A;  3I5H B;  2Y4Q A;  4HRE E;  1S26 D;  2KFH A;  3I5I C;  4DIR A;  1XO5 A;  4MN0 A;  3BUO B;  3C1V A;  2LM5 A;  4AQI A;  5ER5 A;  1B7T Y;  4BY4 A;  1XVJ A;  1K8U A;  5HKZ A;  3I5F B;  5AAN A;  3HCM A;  2LVV A;  1EH2 A;  1FF1 A;  1MQ1 A;  3BQ3 A;  2SCP A;  1OZO A;  4ORB B;  2GV5 A;  5AXI A;  2I7A A;  1QIW A;  1DF0 A;  3ZNI A;  1KQM C;  3SJS A;  1DGU A;  1YUS A;  2KFF A;  2KYF A;  1J7Q A;  4OV2 A;  2M1K B;  1A4P A;  2HF5 A;  1RFJ A;  1CFF A;  2LP3 A;  3O4Y A;  1R2U A;  3PM8 A;  2L51 A;  2CXJ A;  4MLW A;  2K0J A;  1PAL A;  2I94 A;  1U5I A;  4BY5 A;  1SCV A;  4GGF C;  3TDU A;  1MUX A;  1IWQ A;  3RLZ A;  2PMY A;  3F45 A;  1BOC A;  1F8H A;  4YGD B;  1DJI A;  2PRU A;  1AVS A;  4P5O E;  5AFP A;  1QX2 A;  1UHH A;  2KI6 D;  2KNE A;  3DF0 B;  1F55 A;  3WXA A;  1IKU A;  1DJY A;  4MZJ A;  1OSA A;  1QS7 A;  2H61 C;  2MAZ A;  1BU3 A;  5FYX A;  2BKH B;  2LHI A;  3AAJ A;  2F8P A;  2JOJ A;  4C0J A;  1V1F A;  1XA5 A;  1C7V A;  2Y5I A;  2HQ8 A;  1SR6 C;  2MRD A;  2OS8 C;  1QAT A;  1MXE A;  1SY9 A;  4YRU A;  2D8N A;  1ODB A;  3BOW A;  2FCE A;  3HX4 A;  4WRI A;  1YVL A;  1OE9 B;  1AK8 A;  3JTD C;  3SIB A;  4I5J A;  3PN7 C;  3NSI A;  2K8M B;  3DVE A;  3CTN A;  2JC2 A;  2IS9 A;  2E30 A;  5KSZ A;  4XJK A;  1Q80 A;  5PAL A;  3FWC A;  1GGW A;  1UP5 A;  1E8A A;  2LP2 A;  3KO0 A;  1NYA A;  5D69 A;  3GK2 A;  1DF0 B;  4I5K A;  5HKY A;  4E68 A;  4PCW A;  1RWY A;  1A75 A;  1NCY A;  1S6C A;  2WOS A;  2QPT A;  1DGV A;  2M7N A;  4JQ0 D;  4PDZ A;  2E6W A;  2ZRT A;  2KAV A;  2BBM A;  4IL1 A;  2K7D A;  3O6B A;  3VRO A;  1U5I B;  5I2O A;  1KFX S;  2M97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...