3TUYB

Phosphorylated light chain domain of scallop smooth muscle myosin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
RLPQKLMQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Crystal structure of a phosphorylated light chain domain of scallop smooth-muscle Myosin.
pubmed doi rcsb
molecule tags Structural protein
total genus 44
structure length 141
sequence length 141
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tuyB01
1KSOA 3CWGA 2HF5A 4Q04A 1EXRA 1B4CA 1BU3A 3EK8A 1SCMC 3CR4X 1FPWA 1DGVA 2M9GA 1CFCA 1SMGA 2QPTA 2KQ6A 2PRUA 4I5NB 2MJWB 1SW8A 2KSPA 1SCVA 2PMYA 4MLWA 3VRPA 2O60A 3TUYC 1A4PA 4QJ4B 4ZCVA 1IG5A 3DVMA 1B47A 2L98A 2JU0A 2FOTA 3O2PA 5CPVA 1SL8A 4MZJA 2D8NA 1JBAA 2JULA 4C0KA 3SG7A 1K8UA 1DVIA 2OTGB 1B8RA 4XYNA 5I2OA 1OMRA 3I5HC 1DJXA 4A4BA 4IL1A 2OTGC 1TCOB 2E30A 2F33A 1BR1B 1WRKA 2LVKA 1U5IB 1XFZO 3O6BA 1XO5A 1QVIZ 5HKZA 2LVIA 4AOMA 1BT6A 1NP8A 4YI8A 1IQ3A 2JNXA 2ZN8A 3IQOA 1NX1A 2ZKMX 3BUWB 5I2QA 1BODA 1V1FA 1IRJA 4AQIA 3M0WA 2WC8A 2BKIB 3GK4X 1ODBA 1XFVO 1HQVA 1NX2A 3KF9A 2I2RE 1CDMA 1B7TZ 2KAXA 1NCYA 1M39A 1YVLA 3H4SE 5DKRA 2F2PA 2JC2A 2ISDA 5DKNA 2F3YA 1A03A 2IS9A 3BXKA 1BR4B 2LLSA 4MN0A 3SG5A 1JFKA 1RROA 1TN4A 1CKKA 1HT9A 3OHMB 1OMVA 3JVTB 1YX8A 3WHTB 1E8AA 1K90D 1S1EA 3BQ3A 1Q80A 1PULA 1TNXA 3D0YB 1DJGA 4CPVA 2CCMA 1Y6WA 1J1DA 4MBEA 4PHMA 3RM1A 3MSEB 1KWOC 2KGRA 4JWQA 1KFUL 2CTNA 3EKHA 3SG4A 1X02A 3O78A 2KBMA 1YRTB 3VGOA 1UHKA 1MXEA 2LLUA 2R2IA 3BYAA 1MR8A 4I5KA 1YUTA 2L51A 4ORBB 2E6WA 1J7RA 2FCEA 4MRXA 4GNKB 4GUKA 4UPGA 4NDBA 3PATA 5ER5A 4FQOA 2JRFA 2KNEA 4CFRA 3FIAA 4HRGA 1AJ5A 1XVJA 1QIWA 2NCPA 3CS1A 2NCOA 1CM1A 1QVIY 1KQVA 1U5IA 1RK9A 4YGAA 1Y1AA 4L9MA 1UHJA 1TIZA 5CSFA 1VRKA 3DD4A 1L7ZA 3CR2A 2KFGA 1J1EA 4FTGA 1PSRA 4JQ0D 1OZSA 2ZRTA 4QJ3B 1UHNA 2BCXA 4PCWA 5AERA 5J3XA 4YRUA 3JTDC 1F71A 1F70A 2A4JA 1D1OA 2KAYA 1SL7A 2BCAA 4PE1A 1EH2A 2I18A 1YX7A 1R6PA 1SR6B 1KFXL 2MA2A 4PE4A 4CIDA 2MLEC 1OSAA 1RTP1 3KEVA 1YUUA 2GGMA 4GBAA 4DS7A 2L5XB 3AKAA 3DVKA 3EVVA 1M45A 1KQMC 4HSZA 4XJKB 3D0YA 1ZACA 3EKJA 3IF7A 1K9UA 1SY9A 2HQ8A 3ZWHA 4OVNF 4N5XA 1NYAA 2L4IA 1JSAA 1ALVA 1DT7B 3HX4A 3SIAA 2M3WA 2LNKA 2PASA 1SCMB 1ZUZA 1YUSA 4QJ5B 2F2OA 1SBJA 3F45A 2LMTA 4YGDB 1QIVA 3TUYB 2KAVA 1J7PA 3I5IC 1NCXA 1YR5A 3O4YA 1QV1A 3I5GC 2EHBA 1M46A 2LE9B 3LL8B 2K7BA 2AUCA 2K7CA 1BJFA 1QX2A 1CDPA 4F0ZB 3EK4A 3I5HB 5K89A 1JC2A 1PSBA 2VRGA 4NQGA 2BCBA 1PVAA 2KGBC 3IQQA 2O5GA 1YRUB 2JT8A 1Y0VH 2KFHA 3C1VA 2LHIA 4OV2A 5G08A 3WHUB 1FI6A 1K94A 1QATA 3DVJA 1C7WA 3A8RA 1Y1XA 1JWDA 4N1GA 1KK8C 1OOJA 1MUXA 2SASA 1DJYA 1XA5A 1S6IA 2B1UA 1GGZA 1M31A 1PALA 1G33A 1XYDA 2L0PA 1L2OC 3BUNB 3LK1A 1LA0A 1A75B 3DF0B 1TNPA 3TZ1A 1IQ5A 1OZOA 2OS8C 4YGCB 4XJKA 4WRIA 3SG2A 1J55A 3AAKA 2QACA 1J7QA 1G4YR 2JPTA 3I5FC 1NPQA 2LP3A 3PN7B 3BOWB 1A2XA 1GQMA 1K96A 1NWDA 4M2OA 4U8DA 4YI9A 2K2FA 3PN7C 4PDZA 1NX3A 4JPZB 5B8IB 1KWOB 2F8PA 2I94A 2KI4C 1XFYO 1SRAA 4DRWA 2FCDA 4CFQA 1DJZA 1S36A 1PK0D 5FYXA 2JT3A 3SIBA 3VRNA 3HCMA 1H4BA 1AHRA 1K9PA 4BY4A 5DKQA 2H61C 2BKHB 4OR9B 2BE6A 2LHLA 1CNPA 3PALA 1JF2A 4YGEB 3SJSA 1KK7Z 2JT0A 4GPLB 1XFUO 2KDHA 2P6BB 3TS5C 1MWNA 3NSIA 1XFWO 1AP4A 1EL4A 3PM8A 2NZ0A 1SNLA 2BL0C 1QASA 1TNWA 4USLA 2EGDA 3VRQA 2V53A 2Y1MA 2CT9A 2DOQA 1CLBA 3GK2A 5I8NA 1CFPA 1KCYA 2HPSA 2LMVA 1LVCD 3JTDB 1S3PA 3TDUA 1QX5B 2SCPA 4DUQA 1K95A 1QV0A 1KFUS 5HYDA 2K0JA 2KYCA 5AFPA 1CMGA 2KI6D 2LP2A 4P2YB 1A75A 3DF0A 1GJYA 1IGVA 4ORCB 4HRHA 4I5LB 2LCPA 2NXQA 3AAJA 4GGFC 2TN4A 2G2BA 1UURA 1CFFA 2K7DA 1IJ5A 1KQMB 2WCEA 4D1EA 1NCZA 4N1FA 2BE4A 3BOWA 4ICBA 4OKHA 3TDIA 2LAPA 1AJ4A 3GOFA 2K7OA 4GAOA 1N2DA 2L50A 4GGNA 3EVRA 1UUSA 3FWBA 2MHHA 2Y4QA 4M2PA 1WDCB 1MXLC 1BLQA 1ZMZA 1OMDA 2KI6C 4MSPA 1QLSA 1NUBA 1WDCC 5AEQA 1F4QA 1ALWA 1TRFA 4NDCA 4HREE 1FW4A 1XFXO 1XK4C 1CDLA 3ZNIA 1S5GZ 1YURA 1CTRA 2M29A 2KFFA 2JTZA 3FWCA 1Y1UA 2OPOA 3I5IB 4MVFA 1QX7A 3I5GB 2K2AA 2I7AA 1KFXS 2M1KB 5JOLA 1WRLA 1KK7Y 1B1GA 4PALA 1IH0A 1RFJA 1LA3A 3OB1B 1F4OA 3VRRA 2RGIA 1BOCA 4YBHB 1K2HA 4C0JA 1WLZA 1NIWA 2LANA 1PRWA 3K21A 1DF0B 3AKBA 1LXFC 5TNCA 1JFJA 1PVBA 2M49B 4NDDA 1S6JA 4MZLA 4AQJA 4DIRA 1MQ1A 1MHOA 5KTYA 5AXIA 1EJ3A 1GGWA 3CZTX 1EG4A 2NLNA 3D10A 1F54A 1SL9A 2PVBA 5JJGA 1KK8B 4MEWA 5KSZA 1W7JB 1IKUA 2M0RA 4GFTA 5PALA 1J7OA 2F3ZA 2M97A 4GGFA 2MAZA 3BUMB 1L2OB 3LK0A 3WXAA 2WCFA 3KPXA 3ICBA 5IBWA 1CLMA 2M8UA 3KHEA 1DMOA 1S6CA 1K93D 2OS8B 2AAOA 1BG1A 2BECA 1IWQA 1B9AA 1QJTA 1SYMA 3BUOB 1QS7A 3CR5X 2Q4UA 4PHKA 1UHIA 3I5FB 3BUXB 2KYFA 4I5JA 3OX5A 4ETOA 1QTXA 2PSRA 2JQ6A 4A4CA 1CM4A 1CMFA 3CGAA 3OX6A 1UP5A 2FJUB 3CLNA 2LMUA 2LUCA 4TNCA 1ZOTB 1XK4A 2KI4B 5D7FA 1S5GY 1M63B 3EVUA 4BY5A 1C7VA 1NSHA 1G8IA 1N65A 5HLOA 1LINA 2JNFA 1FBVA 4PHNA 1CDNA 1C07A 4M2QA 5I2LA 5ER4X 2GGZA 3VROA 1TCFA 1WRZA 4PE7A 1OQPA 2CXJA 1DJIA 1AUIB 2HQWA 2WORA 1UWOA 3EK7A 1DF0A 1RJVA 3JVTC 3LCPC 2JXCA 2L4HA 4MRYA 2KBIA 3TS5B 1CB1A 1TOPA 1YTZC 3TDZA 2BBMA 1AVSA 2BL0B 2L2EA 1TNQA 1RECA 2KHNA 2JXLA 3NSLA 2H2KA 2WCBA 3GK1A 2HETA 5F6TA 2PALA 2EC6B 1WLMA 1BF5A 1B8LA 1DJWA 2EC6C 2KQYA 1SPYA 3OP0A 2GV5A 1R2UA 4YGBB 1IJ6A 2LVVA 1F55A 1S26D 2CBLA 1SKTA 2LM5A 2ZNDA 3OB2B 3NSOA 2WNDA 1K9KA 1UHHA 3KO0A 1KSMA 2Y5IA 1QLKA 2MBXA 3PFVA 5HKYA 4P5OE 1QXPA 2JZIA 2LLTA 1V1GA 1JUOA 4C0LA 3LLEA 4CLNA 2M7NA 1DGUA 3NXAA 1CFDA 5CSNA 5HLVA 2BBNA 3WNXB 2JOJA 3FS7A 2K61A 2MLFC 4WQ2A 1NX0A 5GQQC 2M1UA 1OE9B 1JF0A 1RWYA 4ORAB 2LVJA 2Y1NA 2K8MB 3RLZA 1ZFSA 3SG6A 1B7TY 3SG3A 5BPJA 2ZNEA 4PHJA 5AANA 2LC5A 1FF1A 1H8BA 1B8CA 3CTNA 1DJHA 2KOTA 2WOSA 1A29A 1TTXA 1EG3A 1CLLA 2JWWA 3PLFB 1SR6C 5D69A 2COLB 2ZFDA 3NSKA 3PSRA 1MF8B 5CSJA 3QRXA 2CNPA 4ZCUA 1F8HA 3A4UB 1N0YA 4DCKA 2H61A 4PE0A 4R1EA 3DVEA 4MZKA 4OCIA 5CSIA 5KU1A 4E68A 1WY9A 1LKJA 1FI5A 2LUXA 1YVHA 1W7IB 3E3RA 2JTTA 1AK8A 2Q91A 1DTLA 1SK6D 1BMOA 2ZRSA 5HKWA 2MRDA 2ZN9A 2M7LA 2LV7A 4WQ3A 2AMIA 2G9BA
chains in the Genus database with same CATH superfamily
1KSOA 3CWGA 2HF5A 3BJHA 1DEKA 4Q04A 1EXRA 1B4CA 1LS8A 1BU3A 3EK8A 1SCMC 3CR4X 1FPWA 1DGVA 4INXA 2M9GA 1CFCA 3BFAA 1SMGA 2QPTA 2KQ6A 2PRUA 4I5NB 2MJWB 1SW8A 2KSPA 1SCVA 2PMYA 4MLWA 3VRPA 1TUZA 2O60A 1A4PA 3TUYC 4QJ4B 4ZCVA 1IG5A 3DVMA 3Q8IA 1B47A 2L98A 2JU0A 2FOTA 3B6XA 3O2PA 5CPVA 1SL8A 4MZJA 2D8NA 1JBAA 2JULA 4C0KA 3SG7A 1K8UA 1DVIA 2OTGB 1B8RA 2L5YA 4XYNA 5I2OA 1OMRA 3I5HC 1DJXA 1OOIX 4A4BA 4IL1A 2OTGC 1TCOB 2E30A 3K1EA 2F33A 1BR1B 1WRKA 2LVKA 1U5IB 1XFZO 3O6BA 1XO5A 1QVIZ 4IJ7A 2LVIA 5HKZA 4AOMA 1BT6A 1NP8A 4YI8A 1IQ3A 2JNXA 2ZN8A 3IQOA 2BAPA 1NX1A 4PT1A 2ZKMX 3BUWB 5I2QA 1BODA 1V1FA 1IRJA 4AQIA 3M0WA 5FI7A 3L47A 2WC8A 2BKIB 3GK4X 3O4XA 1ODBA 1XFVO 1HQVA 1NX2A 3KF9A 2I2RE 1CDMA 1B7TZ 2KAXA 1NCYA 1M39A 1YVLA 3D73A 3DY9A 3H4SE 2F2PA 5DKRA 2JC2A 2ISDA 5DKNA 2F3YA 1A03A 2IS9A 3BXKA 1BR4B 2LLSA 4MN0A 3SG5A 1JFKA 1RROA 1TN4A 1CKKA 1HT9A 3OHMB 1OMVA 3JVTB 5HL1A 1YX8A 3WHTB 1E8AA 1ORGA 5DICA 1K90D 1S1EA 3BQ3A 1Q80A 1PULA 1TNXA 3D0YB 1DJGA 4CPVA 2CCMA 1Y6WA 1J1DA 4MBEA 4PHMA 3RM1A 3MSEB 3VB1A 1KWOC 2KGRA 4JWQA 1KFUL 2CTNA 3EKHA 3SG4A 1X02A 4JKTA 3O78A 2KBMA 1YRTB 3VGOA 1UHKA 1MXEA 2LLUA 2R2IA 3BYAA 1MR8A 4I5KA 2WC6A 1YUTA 2L51A 4ORBB 2E6WA 1J7RA 2FCEA 4MRXA 4GNKB 4GUKA 4UPGA 4NDBA 3PATA 5ER5A 4FQOA 2JRFA 2KNEA 4CFRA 3FIAA 4HRGA 1AJ5A 1XVJA 1QIWA 2NCPA 3CS1A 2NCOA 1CM1A 1QVIY 1KQVA 1U5IA 1RK9A 4YGAA 1Y1AA 4L9MA 1GM0A 1UHJA 1TIZA 5CSFA 1OOGA 1VRKA 3DD4A 1L7ZA 3CR2A 2KFGA 1J1EA 4JD9A 4FTGA 1PSRA 4JQ0D 3CABA 1OZSA 2ZRTA 4QJ3B 1UHNA 2BCXA 4PCWA 5AERA 5J3XA 4YRUA 3JTDC 1F71A 1F70A 2A4JA 3L4LA 3CYZA 1D1OA 2KAYA 1SL7A 2BCAA 4PE1A 1EH2A 2I18A 1YX7A 1R6PA 1SR6B 1KFXL 2MA2A 4PE4A 2FJYA 4CIDA 2MLEC 1OSAA 1RTP1 3KEVA 1YUUA 2GGMA 4GBAA 4DS7A 2L5XB 3AKAA 3DVKA 2WCJA 3V2LA 5EL2A 1P28A 1BG1A 3EVVA 1M45A 1KQMC 4HSZA 1OW4A 4XJKB 5FI2A 3D0YA 1ZACA 3EKJA 3IF7A 3N7HA 1K9UA 3S0FA 1SY9A 2HQ8A 3ZWHA 4OVNF 4N5XA 1NYAA 2L4IA 1JSAA 1ALVA 1DT7B 3HX4A 2QEHA 3SIAA 2M3WA 2LNKA 2PASA 1SCMB 1ZUZA 1YUSA 3CZ2A 3FE9A 4QJ5B 2F2OA 1SBJA 3F45A 2LMTA 4YGDB 4F7FA 1QIVA 3TUYB 2KAVA 1J7PA 3I5IC 1NCXA 1YR5A 2QEVA 3O4YA 3QMEA 1QV1A 3FE6A 3I5GC 2EHBA 1M46A 2LE9B 3LL8B 2K7BA 2AUCA 2K7CA 3D78A 1BJFA 1QX2A 1CDPA 4F0ZB 3EK4A 3I5HB 5K89A 1JC2A 1PSBA 2VRGA 4NQGA 2BCBA 1PVAA 2KGBC 3IQQA 2O5GA 1YRUB 2JT8A 1Y0VH 2KFHA 2WCLA 3UO9A 3C1VA 2LHIA 4OV2A 5G08A 3WHUB 1DC1A 1FI6A 1K94A 1QATA 3B88A 3DVJA 1C7WA 3B7AA 3A8RA 1Y1XA 1JWDA 4N1GA 1IIOA 1KK8C 1OOJA 1MUXA 2SASA 1DJYA 1XA5A 1S6IA 2B1UA 1GGZA 1M31A 1PALA 1G33A 1XYDA 2L0PA 1L2OC 3BUNB 3LK1A 1LA0A 1A75B 3DF0B 1TNPA 3D77A 3TZ1A 1IQ5A 2JPOA 1OZOA 2OS8C 4YGCB 4XJKA 4WRIA 3SG2A 1J55A 3AAKA 2QACA 3S0GA 1J7QA 1G4YR 2JPTA 3I5FC 1NPQA 2LP3A 3R1PA 3PN7B 3BOWB 1A2XA 1GQMA 1K96A 1NWDA 4M2OA 4U8DA 4YI9A 2K2FA 3PM2A 3PN7C 4PDZA 1NX3A 4JPZB 5B8IB 2K60A 1KWOB 2F8PA 2I94A 2KI4C 1XFYO 1SRAA 4DRWA 2FCDA 4CFQA 1DJZA 1S36A 2L2CA 1PK0D 2BNXA 5FYXA 2JT3A 3SIBA 2H8VA 3VRNA 3L4AA 3HCMA 3S0DA 3UNWA 1H4BA 1AHRA 3PJIA 1K9PA 3CDNA 4BY4A 5DKQA 2H61C 1SSEB 2BKHB 4OR9B 2BE6A 2LHLA 1CNPA 3PALA 1JF2A 4YGEB 3D76A 3SJSA 1KK7Z 2JT0A 4GPLB 1XFUO 2KDHA 2P6BB 3TS5C 1MWNA 1Z2CB 3NSIA 1XFWO 1AP4A 1C3ZA 1EL4A 3PM8A 1TUJA 2NZ0A 1SNLA 2BL0C 1QASA 1TNWA 4USLA 2EGDA 5I94A 3DYEA 3VRQA 2V53A 2Y1MA 2CT9A 2DOQA 1CLBA 3GK2A 5I8NA 1CFPA 1KCYA 2HPSA 2LMVA 2QEOA 1LVCD 3JTDB 1S3PA 3TDUA 1QX5B 2SCPA 4DUQA 1K95A 1QV0A 1KFUS 5HYDA 2K0JA 2KYCA 3OBVA 5AFPA 3S0AA 1CMGA 2KI6D 3BFBA 2LP2A 3R1OA 4P2YB 1A75A 3B87A 3DF0A 1GJYA 1IGVA 2ERBA 4ORCB 3DXLA 4HRHA 2KLDA 4I5LB 3SS3A 2LCPA 2KPHA 2NXQA 3AAJA 4GGFC 2TN4A 1W9ZA 2G2BA 1UURA 1CFFA 2K7DA 1IJ5A 1KQMB 2WCEA 4D1EA 2PYQA 1NCZA 4N1FA 2BE4A 3BOWA 3EG5B 4ICBA 4OKHA 3TDIA 2LAPA 1AJ4A 3GOFA 2K7OA 4GAOA 1N2DA 2L50A 4GGNA 3EVRA 1UUSA 1Z4HA 3FWBA 2MHHA 2Y4QA 4M2PA 1WDCB 1DELA 1MXLC 1BLQA 1ZMZA 1OMDA 2KI6C 4MSPA 3DZTA 1QLSA 1NUBA 1WDCC 5AEQA 1F4QA 1ALWA 1TRFA 4NDCA 4HREE 1FW4A 1XFXO 1XK4C 1CDLA 3ZNIA 1S5GZ 1YURA 1CTRA 2M29A 2KFFA 2JTZA 3FWCA 1Y1UA 2OPOA 3I5IB 4MVFA 1QX7A 3I5GB 1DQEA 2I7AA 1KFXS 2K2AA 2M1KB 5JOLA 1WRLA 1KK7Y 1B1GA 4PALA 3BFHA 1IH0A 1RFJA 1LA3A 3OB1B 1F4OA 3VRRA 2P70A 2RGIA 4YBHB 1BOCA 1K2HA 4C0JA 2P71A 1WLZA 1NIWA 2LANA 1PRWA 3K21A 1DF0B 3AKBA 1LXFC 5TNCA 1JFJA 1PVBA 2M49B 4NDDA 1S6JA 4MZLA 4AQJA 4DIRA 2YGUA 1MQ1A 1MHOA 2KLEA 5KTYA 5AXIA 1EJ3A 1GGWA 3CZTX 3CZ1A 1EG4A 3SS5A 2NLNA 3D10A 1F54A 1SL9A 2PVBA 5JJGA 1KK8B 4MEWA 5KSZA 1W7JB 3NHTA 2M0RA 4GFTA 5PALA 1IKUA 1C3YA 1J7OA 2F3ZA 2M97A 4GGFA 2MAZA 3BUMB 1L2OB 3LK0A 3WXAA 2WCFA 3KPXA 3ICBA 5IBWA 1CLMA 2M8UA 3KHEA 1DMOA 1S6CA 1K93D 2OS8B 2AAOA 2WCHA 2BECA 1IWQA 1B9AA 1QJTA 1SYMA 3BUOB 1QS7A 3CR5X 2Q4UA 4PHKA 1UHIA 3NHIA 3I5FB 1XFRA 2QEBA 3R1VA 3BUXB 2KYFA 4I5JA 3OX5A 3B86A 1QTXA 2PSRA 4ETOA 2JQ6A 4A4CA 3FE8A 1CM4A 1CMFA 3CGAA 3OX6A 1UP5A 2FJUB 3CLNA 2QDIA 2LMUA 2LUCA 4TNCA 1ZOTB 1XK4A 2KI4B 2PQLA 5D7FA 1S5GY 1M63B 3EVUA 4BY5A 1C7VA 1NSHA 1G8IA 2WC5A 1N65A 5HLOA 1LINA 2JNFA 1FBVA 4PHNA 1CDNA 1C07A 4M2QA 3RZSA 4FQTA 5ER4X 2GGZA 5I2LA 1TCFA 3VROA 1WRZA 4PE7A 3NGVA 1OQPA 2CXJA 5FI6A 1DJIA 1AUIB 2HQWA 2WORA 1UWOA 3EK7A 1DF0A 1RJVA 3JVTC 3LCPC 2JXCA 2L4HA 4MRYA 2KBIA 3TS5B 5D3OA 1CB1A 1TOPA 1YTZC 3TDZA 2BBMA 1AVSA 2BL0B 2L2EA 3D74A 1TNQA 1RECA 2KHNA 2JXLA 3NSLA 2H2KA 1QWVA 2WCBA 3GK1A 2HETA 1T14A 2WCKA 5F6TA 2PALA 2EC6B 1WLMA 1BF5A 1B8LA 1DJWA 2EC6C 2KQYA 1SPYA 3OP0A 2GV5A 1R2UA 4YGBB 1IJ6A 2LVVA 1F55A 3CZ0A 1S26D 2CBLA 1SKTA 2LM5A 2ZNDA 2GTEA 3OB2B 3NSOA 2WNDA 1K9KA 1UHHA 3KO0A 4KYNA 1KSMA 2Y5IA 1QLKA 4INWA 2MBXA 3PFVA 5HKYA 4P5OE 1QXPA 2JZIA 2LLTA 3IVTA 1V1GA 1JUOA 4C0LA 3LLEA 4CLNA 3S0BA 2M7NA 1DGUA 3NXAA 1CFDA 5CSNA 5HLVA 2BBNA 3WNXB 2JOJA 1OOHA 3FS7A 2K61A 2MLFC 4WQ2A 1NX0A 5GQQC 2M1UA 1OE9B 1TWOA 1JF0A 3OGNA 1RWYA 4ORAB 2LVJA 2Y1NA 2K8MB 3RLZA 1ZFSA 3SG6A 2WCMA 1B7TY 3SG3A 5BPJA 2ZNEA 1OOFA 4PHJA 2LC5A 5AANA 1FF1A 1B8CA 3CTNA 3S0EA 1H8BA 1DJHA 2KOTA 2WOSA 1A29A 1TTXA 1EG3A 1CLLA 2JWWA 3PLFB 1SR6C 5D69A 2COLB 2ZFDA 3NSKA 3PSRA 1MF8B 3D75A 4OZDA 3QRXA 5CSJA 2CNPA 4ZCUA 1F8HA 3A4UB 1N0YA 4DCKA 2H61A 4PE0A 4R1EA 3DVEA 4MZKA 4OCIA 5CSIA 5KU1A 4E68A 1WY9A 1LKJA 1FI5A 2LUXA 1YVHA 1W7IB 3E3RA 2JTTA 1AK8A 2Q91A 1DTLA 1SK6D 3SS4A 1BMOA 2ZRSA 5HKWA 2MRDA 2ZN9A 2M7LA 3R72A 2LV7A 4WQ3A 2AMIA 2G9BA
chains in the Genus database with same CATH topology
1KSOA 3CWGA 2HF5A 4Q04A 1EXRA 1B4CA 1BU3A 3EK8A 1SCMC 3CR4X 1FPWA 1DGVA 2M9GA 1CFCA 1SMGA 2QPTA 2KQ6A 2PRUA 4I5NB 2MJWB 1SW8A 2KSPA 1SCVA 2PMYA 4MLWA 3VRPA 2O60A 3TUYC 1A4PA 4QJ4B 4ZCVA 1IG5A 3DVMA 1B47A 2L98A 2JU0A 2FOTA 3O2PA 5CPVA 1SL8A 4MZJA 2D8NA 1JBAA 2JULA 4C0KA 3SG7A 1K8UA 1DVIA 2OTGB 1B8RA 4XYNA 5I2OA 1OMRA 3I5HC 1DJXA 4A4BA 4IL1A 2OTGC 1TCOB 2E30A 2F33A 1BR1B 1WRKA 2LVKA 1U5IB 1XFZO 3O6BA 1XO5A 1QVIZ 5HKZA 2LVIA 4AOMA 1BT6A 1NP8A 4YI8A 1IQ3A 2JNXA 2ZN8A 3IQOA 1NX1A 2ZKMX 3BUWB 5I2QA 1BODA 1V1FA 1IRJA 4AQIA 3M0WA 2WC8A 2BKIB 3GK4X 1ODBA 1XFVO 1HQVA 1NX2A 3KF9A 2I2RE 1CDMA 1B7TZ 2KAXA 1NCYA 1M39A 1YVLA 3H4SE 5DKRA 2F2PA 2JC2A 2ISDA 5DKNA 2F3YA 1A03A 2IS9A 3BXKA 1BR4B 2LLSA 4MN0A 3SG5A 1JFKA 1RROA 1TN4A 1CKKA 1HT9A 3OHMB 1OMVA 3JVTB 1YX8A 3WHTB 1E8AA 1K90D 1S1EA 3BQ3A 1Q80A 1PULA 1TNXA 3D0YB 1DJGA 4CPVA 2CCMA 1Y6WA 1J1DA 4MBEA 4PHMA 3RM1A 3MSEB 1KWOC 2KGRA 4JWQA 1KFUL 2CTNA 3EKHA 3SG4A 1X02A 3O78A 2KBMA 1YRTB 3VGOA 1UHKA 1MXEA 2LLUA 2R2IA 3BYAA 1MR8A 4I5KA 1YUTA 2L51A 4ORBB 2E6WA 1J7RA 2FCEA 4MRXA 4GNKB 4GUKA 4UPGA 4NDBA 3PATA 5ER5A 4FQOA 2JRFA 2KNEA 4CFRA 3FIAA 4HRGA 1AJ5A 1XVJA 1QIWA 2NCPA 3CS1A 2NCOA 1CM1A 1QVIY 1KQVA 1U5IA 1RK9A 4YGAA 1Y1AA 4L9MA 1UHJA 1TIZA 5CSFA 1VRKA 3DD4A 1L7ZA 3CR2A 2KFGA 1J1EA 4FTGA 1PSRA 4JQ0D 1OZSA 2ZRTA 4QJ3B 1UHNA 2BCXA 4PCWA 5AERA 5J3XA 4YRUA 3JTDC 1F71A 1F70A 2A4JA 1D1OA 2KAYA 1SL7A 2BCAA 4PE1A 1EH2A 2I18A 1YX7A 1R6PA 1SR6B 1KFXL 2MA2A 4PE4A 4CIDA 2MLEC 1OSAA 1RTP1 3KEVA 1YUUA 2GGMA 4GBAA 4DS7A 2L5XB 3AKAA 3DVKA 3EVVA 1M45A 1KQMC 4HSZA 4XJKB 3D0YA 1ZACA 3EKJA 3IF7A 1K9UA 1SY9A 2HQ8A 3ZWHA 4OVNF 4N5XA 1NYAA 2L4IA 1JSAA 1ALVA 1DT7B 3HX4A 3SIAA 2M3WA 2LNKA 2PASA 1SCMB 1ZUZA 1YUSA 4QJ5B 2F2OA 1SBJA 3F45A 2LMTA 4YGDB 1QIVA 3TUYB 2KAVA 1J7PA 3I5IC 1NCXA 1YR5A 3O4YA 1QV1A 3I5GC 2EHBA 1M46A 2LE9B 3LL8B 2K7BA 2AUCA 2K7CA 1BJFA 1QX2A 1CDPA 4F0ZB 3EK4A 3I5HB 5K89A 1JC2A 1PSBA 2VRGA 4NQGA 2BCBA 1PVAA 2KGBC 3IQQA 2O5GA 1YRUB 2JT8A 1Y0VH 2KFHA 3C1VA 2LHIA 4OV2A 5G08A 3WHUB 1FI6A 1K94A 1QATA 3DVJA 1C7WA 3A8RA 1Y1XA 1JWDA 4N1GA 1KK8C 1OOJA 1MUXA 2SASA 1DJYA 1XA5A 1S6IA 2B1UA 1GGZA 1M31A 1PALA 1G33A 1XYDA 2L0PA 1L2OC 3BUNB 3LK1A 1LA0A 1A75B 3DF0B 1TNPA 3TZ1A 1IQ5A 1OZOA 2OS8C 4YGCB 4XJKA 4WRIA 3SG2A 1J55A 3AAKA 2QACA 1J7QA 1G4YR 2JPTA 3I5FC 1NPQA 2LP3A 3PN7B 3BOWB 1A2XA 1GQMA 1K96A 1NWDA 4M2OA 4U8DA 4YI9A 2K2FA 3PN7C 4PDZA 1NX3A 4JPZB 5B8IB 1KWOB 2F8PA 2I94A 2KI4C 1XFYO 1SRAA 4DRWA 2FCDA 4CFQA 1DJZA 1S36A 1PK0D 5FYXA 2JT3A 3SIBA 3VRNA 3HCMA 1H4BA 1AHRA 1K9PA 4BY4A 5DKQA 2H61C 2BKHB 4OR9B 2BE6A 2LHLA 1CNPA 3PALA 1JF2A 4YGEB 3SJSA 1KK7Z 2JT0A 4GPLB 1XFUO 2KDHA 2P6BB 3TS5C 1MWNA 3NSIA 1XFWO 1AP4A 1EL4A 3PM8A 2NZ0A 1SNLA 2BL0C 1QASA 1TNWA 4USLA 2EGDA 3VRQA 2V53A 2Y1MA 2CT9A 2DOQA 1CLBA 3GK2A 5I8NA 1CFPA 1KCYA 2HPSA 2LMVA 1LVCD 3JTDB 1S3PA 3TDUA 1QX5B 2SCPA 4DUQA 1K95A 1QV0A 1KFUS 5HYDA 2K0JA 2KYCA 5AFPA 1CMGA 2KI6D 2LP2A 4P2YB 1A75A 3DF0A 1GJYA 1IGVA 4ORCB 4HRHA 4I5LB 2LCPA 2NXQA 3AAJA 4GGFC 2TN4A 2G2BA 1UURA 1CFFA 2K7DA 1IJ5A 1KQMB 2WCEA 4D1EA 1NCZA 4N1FA 2BE4A 3BOWA 4ICBA 4OKHA 3TDIA 2LAPA 1AJ4A 3GOFA 2K7OA 4GAOA 1N2DA 2L50A 4GGNA 3EVRA 1UUSA 3FWBA 2MHHA 2Y4QA 4M2PA 1WDCB 1MXLC 1BLQA 1ZMZA 1OMDA 2KI6C 4MSPA 1QLSA 1NUBA 1WDCC 5AEQA 1F4QA 1ALWA 1TRFA 4NDCA 4HREE 1FW4A 1XFXO 1XK4C 1CDLA 3ZNIA 1S5GZ 1YURA 1CTRA 2M29A 2KFFA 2JTZA 3FWCA 1Y1UA 2OPOA 3I5IB 4MVFA 1QX7A 3I5GB 2K2AA 2I7AA 1KFXS 2M1KB 5JOLA 1WRLA 1KK7Y 1B1GA 4PALA 1IH0A 1RFJA 1LA3A 3OB1B 1F4OA 3VRRA 2RGIA 1BOCA 4YBHB 1K2HA 4C0JA 1WLZA 1NIWA 2LANA 1PRWA 3K21A 1DF0B 3AKBA 1LXFC 5TNCA 1JFJA 1PVBA 2M49B 4NDDA 1S6JA 4MZLA 4AQJA 4DIRA 1MQ1A 1MHOA 5KTYA 5AXIA 1EJ3A 1GGWA 3CZTX 1EG4A 2NLNA 3D10A 1F54A 1SL9A 2PVBA 5JJGA 1KK8B 4MEWA 5KSZA 1W7JB 1IKUA 2M0RA 4GFTA 5PALA 1J7OA 2F3ZA 2M97A 4GGFA 2MAZA 3BUMB 1L2OB 3LK0A 3WXAA 2WCFA 3KPXA 3ICBA 5IBWA 1CLMA 2M8UA 3KHEA 1DMOA 1S6CA 1K93D 2OS8B 2AAOA 1BG1A 2BECA 1IWQA 1B9AA 1QJTA 1SYMA 3BUOB 1QS7A 3CR5X 2Q4UA 4PHKA 1UHIA 3I5FB 3BUXB 2KYFA 4I5JA 3OX5A 4ETOA 1QTXA 2PSRA 2JQ6A 4A4CA 1CM4A 1CMFA 3CGAA 3OX6A 1UP5A 2FJUB 3CLNA 2LMUA 2LUCA 4TNCA 1ZOTB 1XK4A 2KI4B 5D7FA 1S5GY 1M63B 3EVUA 4BY5A 1C7VA 1NSHA 1G8IA 1N65A 5HLOA 1LINA 2JNFA 1FBVA 4PHNA 1CDNA 1C07A 4M2QA 5I2LA 5ER4X 2GGZA 3VROA 1TCFA 1WRZA 4PE7A 1OQPA 2CXJA 1DJIA 1AUIB 2HQWA 2WORA 1UWOA 3EK7A 1DF0A 1RJVA 3JVTC 3LCPC 2JXCA 2L4HA 4MRYA 2KBIA 3TS5B 1CB1A 1TOPA 1YTZC 3TDZA 2BBMA 1AVSA 2BL0B 2L2EA 1TNQA 1RECA 2KHNA 2JXLA 3NSLA 2H2KA 2WCBA 3GK1A 2HETA 5F6TA 2PALA 2EC6B 1WLMA 1BF5A 1B8LA 1DJWA 2EC6C 2KQYA 1SPYA 3OP0A 2GV5A 1R2UA 4YGBB 1IJ6A 2LVVA 1F55A 1S26D 2CBLA 1SKTA 2LM5A 2ZNDA 3OB2B 3NSOA 2WNDA 1K9KA 1UHHA 3KO0A 1KSMA 2Y5IA 1QLKA 2MBXA 3PFVA 5HKYA 4P5OE 1QXPA 2JZIA 2LLTA 1V1GA 1JUOA 4C0LA 3LLEA 4CLNA 2M7NA 1DGUA 3NXAA 1CFDA 5CSNA 5HLVA 2BBNA 3WNXB 2JOJA 3FS7A 2K61A 2MLFC 4WQ2A 1NX0A 5GQQC 2M1UA 1OE9B 1JF0A 1RWYA 4ORAB 2LVJA 2Y1NA 2K8MB 3RLZA 1ZFSA 3SG6A 1B7TY 3SG3A 5BPJA 2ZNEA 4PHJA 5AANA 2LC5A 1FF1A 1H8BA 1B8CA 3CTNA 1DJHA 2KOTA 2WOSA 1A29A 1TTXA 1EG3A 1CLLA 2JWWA 3PLFB 1SR6C 5D69A 2COLB 2ZFDA 3NSKA 3PSRA 1MF8B 5CSJA 3QRXA 2CNPA 4ZCUA 1F8HA 3A4UB 1N0YA 4DCKA 2H61A 4PE0A 4R1EA 3DVEA 4MZKA 4OCIA 5CSIA 5KU1A 4E68A 1WY9A 1LKJA 1FI5A 2LUXA 1YVHA 1W7IB 3E3RA 2JTTA 1AK8A 2Q91A 1DTLA 1SK6D 1BMOA 2ZRSA 5HKWA 2MRDA 2ZN9A 2M7LA 2LV7A 4WQ3A 2AMIA 2G9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSO A;  3CWG A;  2HF5 A;  4Q04 A;  1EXR A;  1B4C A;  1BU3 A;  3EK8 A;  1SCM C;  3CR4 X;  1FPW A;  1DGV A;  2M9G A;  1CFC A;  1SMG A;  2QPT A;  2KQ6 A;  2PRU A;  4I5N B;  2MJW B;  1SW8 A;  2KSP A;  1SCV A;  2PMY A;  4MLW A;  3VRP A;  2O60 A;  3TUY C;  1A4P A;  4QJ4 B;  4ZCV A;  1IG5 A;  3DVM A;  1B47 A;  2L98 A;  2JU0 A;  2FOT A;  3O2P A;  5CPV A;  1SL8 A;  4MZJ A;  2D8N A;  1JBA A;  2JUL A;  4C0K A;  3SG7 A;  1K8U A;  1DVI A;  2OTG B;  1B8R A;  4XYN A;  5I2O A;  1OMR A;  3I5H C;  1DJX A;  4A4B A;  4IL1 A;  2OTG C;  1TCO B;  2E30 A;  2F33 A;  1BR1 B;  1WRK A;  2LVK A;  1U5I B;  1XFZ O;  3O6B A;  1XO5 A;  1QVI Z;  5HKZ A;  2LVI A;  4AOM A;  1BT6 A;  1NP8 A;  4YI8 A;  1IQ3 A;  2JNX A;  2ZN8 A;  3IQO A;  1NX1 A;  2ZKM X;  3BUW B;  5I2Q A;  1BOD A;  1V1F A;  1IRJ A;  4AQI A;  3M0W A;  2WC8 A;  2BKI B;  3GK4 X;  1ODB A;  1XFV O;  1HQV A;  1NX2 A;  3KF9 A;  2I2R E;  1CDM A;  1B7T Z;  2KAX A;  1NCY A;  1M39 A;  1YVL A;  3H4S E;  5DKR A;  2F2P A;  2JC2 A;  2ISD A;  5DKN A;  2F3Y A;  1A03 A;  2IS9 A;  3BXK A;  1BR4 B;  2LLS A;  4MN0 A;  3SG5 A;  1JFK A;  1RRO A;  1TN4 A;  1CKK A;  1HT9 A;  3OHM B;  1OMV A;  3JVT B;  1YX8 A;  3WHT B;  1E8A A;  1K90 D;  1S1E A;  3BQ3 A;  1Q80 A;  1PUL A;  1TNX A;  3D0Y B;  1DJG A;  4CPV A;  2CCM A;  1Y6W A;  1J1D A;  4MBE A;  4PHM A;  3RM1 A;  3MSE B;  1KWO C;  2KGR A;  4JWQ A;  1KFU L;  2CTN A;  3EKH A;  3SG4 A;  1X02 A;  3O78 A;  2KBM A;  1YRT B;  3VGO A;  1UHK A;  1MXE A;  2LLU A;  2R2I A;  3BYA A;  1MR8 A;  4I5K A;  1YUT A;  2L51 A;  4ORB B;  2E6W A;  1J7R A;  2FCE A;  4MRX A;  4GNK B;  4GUK A;  4UPG A;  4NDB A;  3PAT A;  5ER5 A;  4FQO A;  2JRF A;  2KNE A;  4CFR A;  3FIA A;  4HRG A;  1AJ5 A;  1XVJ A;  1QIW A;  2NCP A;  3CS1 A;  2NCO A;  1CM1 A;  1QVI Y;  1KQV A;  1U5I A;  1RK9 A;  4YGA A;  1Y1A A;  4L9M A;  1UHJ A;  1TIZ A;  5CSF A;  1VRK A;  3DD4 A;  1L7Z A;  3CR2 A;  2KFG A;  1J1E A;  4FTG A;  1PSR A;  4JQ0 D;  1OZS A;  2ZRT A;  4QJ3 B;  1UHN A;  2BCX A;  4PCW A;  5AER A;  5J3X A;  4YRU A;  3JTD C;  1F71 A;  1F70 A;  2A4J A;  1D1O A;  2KAY A;  1SL7 A;  2BCA A;  4PE1 A;  1EH2 A;  2I18 A;  1YX7 A;  1R6P A;  1SR6 B;  1KFX L;  2MA2 A;  4PE4 A;  4CID A;  2MLE C;  1OSA A;  1RTP 1;  3KEV A;  1YUU A;  2GGM A;  4GBA A;  4DS7 A;  2L5X B;  3AKA A;  3DVK A;  3EVV A;  1M45 A;  1KQM C;  4HSZ A;  4XJK B;  3D0Y A;  1ZAC A;  3EKJ A;  3IF7 A;  1K9U A;  1SY9 A;  2HQ8 A;  3ZWH A;  4OVN F;  4N5X A;  1NYA A;  2L4I A;  1JSA A;  1ALV A;  1DT7 B;  3HX4 A;  3SIA A;  2M3W A;  2LNK A;  2PAS A;  1SCM B;  1ZUZ A;  1YUS A;  4QJ5 B;  2F2O A;  1SBJ A;  3F45 A;  2LMT A;  4YGD B;  1QIV A;  3TUY B;  2KAV A;  1J7P A;  3I5I C;  1NCX A;  1YR5 A;  3O4Y A;  1QV1 A;  3I5G C;  2EHB A;  1M46 A;  2LE9 B;  3LL8 B;  2K7B A;  2AUC A;  2K7C A;  1BJF A;  1QX2 A;  1CDP A;  4F0Z B;  3EK4 A;  3I5H B;  5K89 A;  1JC2 A;  1PSB A;  2VRG A;  4NQG A;  2BCB A;  1PVA A;  2KGB C;  3IQQ A;  2O5G A;  1YRU B;  2JT8 A;  1Y0V H;  2KFH A;  3C1V A;  2LHI A;  4OV2 A;  5G08 A;  3WHU B;  1FI6 A;  1K94 A;  1QAT A;  3DVJ A;  1C7W A;  3A8R A;  1Y1X A;  1JWD A;  4N1G A;  1KK8 C;  1OOJ A;  1MUX A;  2SAS A;  1DJY A;  1XA5 A;  1S6I A;  2B1U A;  1GGZ A;  1M31 A;  1PAL A;  1G33 A;  1XYD A;  2L0P A;  1L2O C;  3BUN B;  3LK1 A;  1LA0 A;  1A75 B;  3DF0 B;  1TNP A;  3TZ1 A;  1IQ5 A;  1OZO A;  2OS8 C;  4YGC B;  4XJK A;  4WRI A;  3SG2 A;  1J55 A;  3AAK A;  2QAC A;  1J7Q A;  1G4Y R;  2JPT A;  3I5F C;  1NPQ A;  2LP3 A;  3PN7 B;  3BOW B;  1A2X A;  1GQM A;  1K96 A;  1NWD A;  4M2O A;  4U8D A;  4YI9 A;  2K2F A;  3PN7 C;  4PDZ A;  1NX3 A;  4JPZ B;  5B8I B;  1KWO B;  2F8P A;  2I94 A;  2KI4 C;  1XFY O;  1SRA A;  4DRW A;  2FCD A;  4CFQ A;  1DJZ A;  1S36 A;  1PK0 D;  5FYX A;  2JT3 A;  3SIB A;  3VRN A;  3HCM A;  1H4B A;  1AHR A;  1K9P A;  4BY4 A;  5DKQ A;  2H61 C;  2BKH B;  4OR9 B;  2BE6 A;  2LHL A;  1CNP A;  3PAL A;  1JF2 A;  4YGE B;  3SJS A;  1KK7 Z;  2JT0 A;  4GPL B;  1XFU O;  2KDH A;  2P6B B;  3TS5 C;  1MWN A;  3NSI A;  1XFW O;  1AP4 A;  1EL4 A;  3PM8 A;  2NZ0 A;  1SNL A;  2BL0 C;  1QAS A;  1TNW A;  4USL A;  2EGD A;  3VRQ A;  2V53 A;  2Y1M A;  2CT9 A;  2DOQ A;  1CLB A;  3GK2 A;  5I8N A;  1CFP A;  1KCY A;  2HPS A;  2LMV A;  1LVC D;  3JTD B;  1S3P A;  3TDU A;  1QX5 B;  2SCP A;  4DUQ A;  1K95 A;  1QV0 A;  1KFU S;  5HYD A;  2K0J A;  2KYC A;  5AFP A;  1CMG A;  2KI6 D;  2LP2 A;  4P2Y B;  1A75 A;  3DF0 A;  1GJY A;  1IGV A;  4ORC B;  4HRH A;  4I5L B;  2LCP A;  2NXQ A;  3AAJ A;  4GGF C;  2TN4 A;  2G2B A;  1UUR A;  1CFF A;  2K7D A;  1IJ5 A;  1KQM B;  2WCE A;  4D1E A;  1NCZ A;  4N1F A;  2BE4 A;  3BOW A;  4ICB A;  4OKH A;  3TDI A;  2LAP A;  1AJ4 A;  3GOF A;  2K7O A;  4GAO A;  1N2D A;  2L50 A;  4GGN A;  3EVR A;  1UUS A;  3FWB A;  2MHH A;  2Y4Q A;  4M2P A;  1WDC B;  1MXL C;  1BLQ A;  1ZMZ A;  1OMD A;  2KI6 C;  4MSP A;  1QLS A;  1NUB A;  1WDC C;  5AEQ A;  1F4Q A;  1ALW A;  1TRF A;  4NDC A;  4HRE E;  1FW4 A;  1XFX O;  1XK4 C;  1CDL A;  3ZNI A;  1S5G Z;  1YUR A;  1CTR A;  2M29 A;  2KFF A;  2JTZ A;  3FWC A;  1Y1U A;  2OPO A;  3I5I B;  4MVF A;  1QX7 A;  3I5G B;  2K2A A;  2I7A A;  1KFX S;  2M1K B;  5JOL A;  1WRL A;  1KK7 Y;  1B1G A;  4PAL A;  1IH0 A;  1RFJ A;  1LA3 A;  3OB1 B;  1F4O A;  3VRR A;  2RGI A;  1BOC A;  4YBH B;  1K2H A;  4C0J A;  1WLZ A;  1NIW A;  2LAN A;  1PRW A;  3K21 A;  1DF0 B;  3AKB A;  1LXF C;  5TNC A;  1JFJ A;  1PVB A;  2M49 B;  4NDD A;  1S6J A;  4MZL A;  4AQJ A;  4DIR A;  1MQ1 A;  1MHO A;  5KTY A;  5AXI A;  1EJ3 A;  1GGW A;  3CZT X;  1EG4 A;  2NLN A;  3D10 A;  1F54 A;  1SL9 A;  2PVB A;  5JJG A;  1KK8 B;  4MEW A;  5KSZ A;  1W7J B;  1IKU A;  2M0R A;  4GFT A;  5PAL A;  1J7O A;  2F3Z A;  2M97 A;  4GGF A;  2MAZ A;  3BUM B;  1L2O B;  3LK0 A;  3WXA A;  2WCF A;  3KPX A;  3ICB A;  5IBW A;  1CLM A;  2M8U A;  3KHE A;  1DMO A;  1S6C A;  1K93 D;  2OS8 B;  2AAO A;  1BG1 A;  2BEC A;  1IWQ A;  1B9A A;  1QJT A;  1SYM A;  3BUO B;  1QS7 A;  3CR5 X;  2Q4U A;  4PHK A;  1UHI A;  3I5F B;  3BUX B;  2KYF A;  4I5J A;  3OX5 A;  4ETO A;  1QTX A;  2PSR A;  2JQ6 A;  4A4C A;  1CM4 A;  1CMF A;  3CGA A;  3OX6 A;  1UP5 A;  2FJU B;  3CLN A;  2LMU A;  2LUC A;  4TNC A;  1ZOT B;  1XK4 A;  2KI4 B;  5D7F A;  1S5G Y;  1M63 B;  3EVU A;  4BY5 A;  1C7V A;  1NSH A;  1G8I A;  1N65 A;  5HLO A;  1LIN A;  2JNF A;  1FBV A;  4PHN A;  1CDN A;  1C07 A;  4M2Q A;  5I2L A;  5ER4 X;  2GGZ A;  3VRO A;  1TCF A;  1WRZ A;  4PE7 A;  1OQP A;  2CXJ A;  1DJI A;  1AUI B;  2HQW A;  2WOR A;  1UWO A;  3EK7 A;  1DF0 A;  1RJV A;  3JVT C;  3LCP C;  2JXC A;  2L4H A;  4MRY A;  2KBI A;  3TS5 B;  1CB1 A;  1TOP A;  1YTZ C;  3TDZ A;  2BBM A;  1AVS A;  2BL0 B;  2L2E A;  1TNQ A;  1REC A;  2KHN A;  2JXL A;  3NSL A;  2H2K A;  2WCB A;  3GK1 A;  2HET A;  5F6T A;  2PAL A;  2EC6 B;  1WLM A;  1BF5 A;  1B8L A;  1DJW A;  2EC6 C;  2KQY A;  1SPY A;  3OP0 A;  2GV5 A;  1R2U A;  4YGB B;  1IJ6 A;  2LVV A;  1F55 A;  1S26 D;  2CBL A;  1SKT A;  2LM5 A;  2ZND A;  3OB2 B;  3NSO A;  2WND A;  1K9K A;  1UHH A;  3KO0 A;  1KSM A;  2Y5I A;  1QLK A;  2MBX A;  3PFV A;  5HKY A;  4P5O E;  1QXP A;  2JZI A;  2LLT A;  1V1G A;  1JUO A;  4C0L A;  3LLE A;  4CLN A;  2M7N A;  1DGU A;  3NXA A;  1CFD A;  5CSN A;  5HLV A;  2BBN A;  3WNX B;  2JOJ A;  3FS7 A;  2K61 A;  2MLF C;  4WQ2 A;  1NX0 A;  5GQQ C;  2M1U A;  1OE9 B;  1JF0 A;  1RWY A;  4ORA B;  2LVJ A;  2Y1N A;  2K8M B;  3RLZ A;  1ZFS A;  3SG6 A;  1B7T Y;  3SG3 A;  5BPJ A;  2ZNE A;  4PHJ A;  5AAN A;  2LC5 A;  1FF1 A;  1H8B A;  1B8C A;  3CTN A;  1DJH A;  2KOT A;  2WOS A;  1A29 A;  1TTX A;  1EG3 A;  1CLL A;  2JWW A;  3PLF B;  1SR6 C;  5D69 A;  2COL B;  2ZFD A;  3NSK A;  3PSR A;  1MF8 B;  5CSJ A;  3QRX A;  2CNP A;  4ZCU A;  1F8H A;  3A4U B;  1N0Y A;  4DCK A;  2H61 A;  4PE0 A;  4R1E A;  3DVE A;  4MZK A;  4OCI A;  5CSI A;  5KU1 A;  4E68 A;  1WY9 A;  1LKJ A;  1FI5 A;  2LUX A;  1YVH A;  1W7I B;  3E3R A;  2JTT A;  1AK8 A;  2Q91 A;  1DTL A;  1SK6 D;  1BMO A;  2ZRS A;  5HKW A;  2MRD A;  2ZN9 A;  2M7L A;  2LV7 A;  4WQ3 A;  2AMI A;  2G9B A; 
#chains in the Genus database with same CATH topology
 1KSO A;  3CWG A;  2HF5 A;  3BJH A;  1DEK A;  4Q04 A;  1EXR A;  1B4C A;  1LS8 A;  1BU3 A;  3EK8 A;  1SCM C;  3CR4 X;  1FPW A;  1DGV A;  4INX A;  2M9G A;  1CFC A;  3BFA A;  1SMG A;  2QPT A;  2KQ6 A;  2PRU A;  4I5N B;  2MJW B;  1SW8 A;  2KSP A;  1SCV A;  2PMY A;  4MLW A;  3VRP A;  1TUZ A;  2O60 A;  1A4P A;  3TUY C;  4QJ4 B;  4ZCV A;  1IG5 A;  3DVM A;  3Q8I A;  1B47 A;  2L98 A;  2JU0 A;  2FOT A;  3B6X A;  3O2P A;  5CPV A;  1SL8 A;  4MZJ A;  2D8N A;  1JBA A;  2JUL A;  4C0K A;  3SG7 A;  1K8U A;  1DVI A;  2OTG B;  1B8R A;  2L5Y A;  4XYN A;  5I2O A;  1OMR A;  3I5H C;  1DJX A;  1OOI X;  4A4B A;  4IL1 A;  2OTG C;  1TCO B;  2E30 A;  3K1E A;  2F33 A;  1BR1 B;  1WRK A;  2LVK A;  1U5I B;  1XFZ O;  3O6B A;  1XO5 A;  1QVI Z;  4IJ7 A;  2LVI A;  5HKZ A;  4AOM A;  1BT6 A;  1NP8 A;  4YI8 A;  1IQ3 A;  2JNX A;  2ZN8 A;  3IQO A;  2BAP A;  1NX1 A;  4PT1 A;  2ZKM X;  3BUW B;  5I2Q A;  1BOD A;  1V1F A;  1IRJ A;  4AQI A;  3M0W A;  5FI7 A;  3L47 A;  2WC8 A;  2BKI B;  3GK4 X;  3O4X A;  1ODB A;  1XFV O;  1HQV A;  1NX2 A;  3KF9 A;  2I2R E;  1CDM A;  1B7T Z;  2KAX A;  1NCY A;  1M39 A;  1YVL A;  3D73 A;  3DY9 A;  3H4S E;  2F2P A;  5DKR A;  2JC2 A;  2ISD A;  5DKN A;  2F3Y A;  1A03 A;  2IS9 A;  3BXK A;  1BR4 B;  2LLS A;  4MN0 A;  3SG5 A;  1JFK A;  1RRO A;  1TN4 A;  1CKK A;  1HT9 A;  3OHM B;  1OMV A;  3JVT B;  5HL1 A;  1YX8 A;  3WHT B;  1E8A A;  1ORG A;  5DIC A;  1K90 D;  1S1E A;  3BQ3 A;  1Q80 A;  1PUL A;  1TNX A;  3D0Y B;  1DJG A;  4CPV A;  2CCM A;  1Y6W A;  1J1D A;  4MBE A;  4PHM A;  3RM1 A;  3MSE B;  3VB1 A;  1KWO C;  2KGR A;  4JWQ A;  1KFU L;  2CTN A;  3EKH A;  3SG4 A;  1X02 A;  4JKT A;  3O78 A;  2KBM A;  1YRT B;  3VGO A;  1UHK A;  1MXE A;  2LLU A;  2R2I A;  3BYA A;  1MR8 A;  4I5K A;  2WC6 A;  1YUT A;  2L51 A;  4ORB B;  2E6W A;  1J7R A;  2FCE A;  4MRX A;  4GNK B;  4GUK A;  4UPG A;  4NDB A;  3PAT A;  5ER5 A;  4FQO A;  2JRF A;  2KNE A;  4CFR A;  3FIA A;  4HRG A;  1AJ5 A;  1XVJ A;  1QIW A;  2NCP A;  3CS1 A;  2NCO A;  1CM1 A;  1QVI Y;  1KQV A;  1U5I A;  1RK9 A;  4YGA A;  1Y1A A;  4L9M A;  1GM0 A;  1UHJ A;  1TIZ A;  5CSF A;  1OOG A;  1VRK A;  3DD4 A;  1L7Z A;  3CR2 A;  2KFG A;  1J1E A;  4JD9 A;  4FTG A;  1PSR A;  4JQ0 D;  3CAB A;  1OZS A;  2ZRT A;  4QJ3 B;  1UHN A;  2BCX A;  4PCW A;  5AER A;  5J3X A;  4YRU A;  3JTD C;  1F71 A;  1F70 A;  2A4J A;  3L4L A;  3CYZ A;  1D1O A;  2KAY A;  1SL7 A;  2BCA A;  4PE1 A;  1EH2 A;  2I18 A;  1YX7 A;  1R6P A;  1SR6 B;  1KFX L;  2MA2 A;  4PE4 A;  2FJY A;  4CID A;  2MLE C;  1OSA A;  1RTP 1;  3KEV A;  1YUU A;  2GGM A;  4GBA A;  4DS7 A;  2L5X B;  3AKA A;  3DVK A;  2WCJ A;  3V2L A;  5EL2 A;  1P28 A;  1BG1 A;  3EVV A;  1M45 A;  1KQM C;  4HSZ A;  1OW4 A;  4XJK B;  5FI2 A;  3D0Y A;  1ZAC A;  3EKJ A;  3IF7 A;  3N7H A;  1K9U A;  3S0F A;  1SY9 A;  2HQ8 A;  3ZWH A;  4OVN F;  4N5X A;  1NYA A;  2L4I A;  1JSA A;  1ALV A;  1DT7 B;  3HX4 A;  2QEH A;  3SIA A;  2M3W A;  2LNK A;  2PAS A;  1SCM B;  1ZUZ A;  1YUS A;  3CZ2 A;  3FE9 A;  4QJ5 B;  2F2O A;  1SBJ A;  3F45 A;  2LMT A;  4YGD B;  4F7F A;  1QIV A;  3TUY B;  2KAV A;  1J7P A;  3I5I C;  1NCX A;  1YR5 A;  2QEV A;  3O4Y A;  3QME A;  1QV1 A;  3FE6 A;  3I5G C;  2EHB A;  1M46 A;  2LE9 B;  3LL8 B;  2K7B A;  2AUC A;  2K7C A;  3D78 A;  1BJF A;  1QX2 A;  1CDP A;  4F0Z B;  3EK4 A;  3I5H B;  5K89 A;  1JC2 A;  1PSB A;  2VRG A;  4NQG A;  2BCB A;  1PVA A;  2KGB C;  3IQQ A;  2O5G A;  1YRU B;  2JT8 A;  1Y0V H;  2KFH A;  2WCL A;  3UO9 A;  3C1V A;  2LHI A;  4OV2 A;  5G08 A;  3WHU B;  1DC1 A;  1FI6 A;  1K94 A;  1QAT A;  3B88 A;  3DVJ A;  1C7W A;  3B7A A;  3A8R A;  1Y1X A;  1JWD A;  4N1G A;  1IIO A;  1KK8 C;  1OOJ A;  1MUX A;  2SAS A;  1DJY A;  1XA5 A;  1S6I A;  2B1U A;  1GGZ A;  1M31 A;  1PAL A;  1G33 A;  1XYD A;  2L0P A;  1L2O C;  3BUN B;  3LK1 A;  1LA0 A;  1A75 B;  3DF0 B;  1TNP A;  3D77 A;  3TZ1 A;  1IQ5 A;  2JPO A;  1OZO A;  2OS8 C;  4YGC B;  4XJK A;  4WRI A;  3SG2 A;  1J55 A;  3AAK A;  2QAC A;  3S0G A;  1J7Q A;  1G4Y R;  2JPT A;  3I5F C;  1NPQ A;  2LP3 A;  3R1P A;  3PN7 B;  3BOW B;  1A2X A;  1GQM A;  1K96 A;  1NWD A;  4M2O A;  4U8D A;  4YI9 A;  2K2F A;  3PM2 A;  3PN7 C;  4PDZ A;  1NX3 A;  4JPZ B;  5B8I B;  2K60 A;  1KWO B;  2F8P A;  2I94 A;  2KI4 C;  1XFY O;  1SRA A;  4DRW A;  2FCD A;  4CFQ A;  1DJZ A;  1S36 A;  2L2C A;  1PK0 D;  2BNX A;  5FYX A;  2JT3 A;  3SIB A;  2H8V A;  3VRN A;  3L4A A;  3HCM A;  3S0D A;  3UNW A;  1H4B A;  1AHR A;  3PJI A;  1K9P A;  3CDN A;  4BY4 A;  5DKQ A;  2H61 C;  1SSE B;  2BKH B;  4OR9 B;  2BE6 A;  2LHL A;  1CNP A;  3PAL A;  1JF2 A;  4YGE B;  3D76 A;  3SJS A;  1KK7 Z;  2JT0 A;  4GPL B;  1XFU O;  2KDH A;  2P6B B;  3TS5 C;  1MWN A;  1Z2C B;  3NSI A;  1XFW O;  1AP4 A;  1C3Z A;  1EL4 A;  3PM8 A;  1TUJ A;  2NZ0 A;  1SNL A;  2BL0 C;  1QAS A;  1TNW A;  4USL A;  2EGD A;  5I94 A;  3DYE A;  3VRQ A;  2V53 A;  2Y1M A;  2CT9 A;  2DOQ A;  1CLB A;  3GK2 A;  5I8N A;  1CFP A;  1KCY A;  2HPS A;  2LMV A;  2QEO A;  1LVC D;  3JTD B;  1S3P A;  3TDU A;  1QX5 B;  2SCP A;  4DUQ A;  1K95 A;  1QV0 A;  1KFU S;  5HYD A;  2K0J A;  2KYC A;  3OBV A;  5AFP A;  3S0A A;  1CMG A;  2KI6 D;  3BFB A;  2LP2 A;  3R1O A;  4P2Y B;  1A75 A;  3B87 A;  3DF0 A;  1GJY A;  1IGV A;  2ERB A;  4ORC B;  3DXL A;  4HRH A;  2KLD A;  4I5L B;  3SS3 A;  2LCP A;  2KPH A;  2NXQ A;  3AAJ A;  4GGF C;  2TN4 A;  1W9Z A;  2G2B A;  1UUR A;  1CFF A;  2K7D A;  1IJ5 A;  1KQM B;  2WCE A;  4D1E A;  2PYQ A;  1NCZ A;  4N1F A;  2BE4 A;  3BOW A;  3EG5 B;  4ICB A;  4OKH A;  3TDI A;  2LAP A;  1AJ4 A;  3GOF A;  2K7O A;  4GAO A;  1N2D A;  2L50 A;  4GGN A;  3EVR A;  1UUS A;  1Z4H A;  3FWB A;  2MHH A;  2Y4Q A;  4M2P A;  1WDC B;  1DEL A;  1MXL C;  1BLQ A;  1ZMZ A;  1OMD A;  2KI6 C;  4MSP A;  3DZT A;  1QLS A;  1NUB A;  1WDC C;  5AEQ A;  1F4Q A;  1ALW A;  1TRF A;  4NDC A;  4HRE E;  1FW4 A;  1XFX O;  1XK4 C;  1CDL A;  3ZNI A;  1S5G Z;  1YUR A;  1CTR A;  2M29 A;  2KFF A;  2JTZ A;  3FWC A;  1Y1U A;  2OPO A;  3I5I B;  4MVF A;  1QX7 A;  3I5G B;  1DQE A;  2I7A A;  1KFX S;  2K2A A;  2M1K B;  5JOL A;  1WRL A;  1KK7 Y;  1B1G A;  4PAL A;  3BFH A;  1IH0 A;  1RFJ A;  1LA3 A;  3OB1 B;  1F4O A;  3VRR A;  2P70 A;  2RGI A;  4YBH B;  1BOC A;  1K2H A;  4C0J A;  2P71 A;  1WLZ A;  1NIW A;  2LAN A;  1PRW A;  3K21 A;  1DF0 B;  3AKB A;  1LXF C;  5TNC A;  1JFJ A;  1PVB A;  2M49 B;  4NDD A;  1S6J A;  4MZL A;  4AQJ A;  4DIR A;  2YGU A;  1MQ1 A;  1MHO A;  2KLE A;  5KTY A;  5AXI A;  1EJ3 A;  1GGW A;  3CZT X;  3CZ1 A;  1EG4 A;  3SS5 A;  2NLN A;  3D10 A;  1F54 A;  1SL9 A;  2PVB A;  5JJG A;  1KK8 B;  4MEW A;  5KSZ A;  1W7J B;  3NHT A;  2M0R A;  4GFT A;  5PAL A;  1IKU A;  1C3Y A;  1J7O A;  2F3Z A;  2M97 A;  4GGF A;  2MAZ A;  3BUM B;  1L2O B;  3LK0 A;  3WXA A;  2WCF A;  3KPX A;  3ICB A;  5IBW A;  1CLM A;  2M8U A;  3KHE A;  1DMO A;  1S6C A;  1K93 D;  2OS8 B;  2AAO A;  2WCH A;  2BEC A;  1IWQ A;  1B9A A;  1QJT A;  1SYM A;  3BUO B;  1QS7 A;  3CR5 X;  2Q4U A;  4PHK A;  1UHI A;  3NHI A;  3I5F B;  1XFR A;  2QEB A;  3R1V A;  3BUX B;  2KYF A;  4I5J A;  3OX5 A;  3B86 A;  1QTX A;  2PSR A;  4ETO A;  2JQ6 A;  4A4C A;  3FE8 A;  1CM4 A;  1CMF A;  3CGA A;  3OX6 A;  1UP5 A;  2FJU B;  3CLN A;  2QDI A;  2LMU A;  2LUC A;  4TNC A;  1ZOT B;  1XK4 A;  2KI4 B;  2PQL A;  5D7F A;  1S5G Y;  1M63 B;  3EVU A;  4BY5 A;  1C7V A;  1NSH A;  1G8I A;  2WC5 A;  1N65 A;  5HLO A;  1LIN A;  2JNF A;  1FBV A;  4PHN A;  1CDN A;  1C07 A;  4M2Q A;  3RZS A;  4FQT A;  5ER4 X;  2GGZ A;  5I2L A;  1TCF A;  3VRO A;  1WRZ A;  4PE7 A;  3NGV A;  1OQP A;  2CXJ A;  5FI6 A;  1DJI A;  1AUI B;  2HQW A;  2WOR A;  1UWO A;  3EK7 A;  1DF0 A;  1RJV A;  3JVT C;  3LCP C;  2JXC A;  2L4H A;  4MRY A;  2KBI A;  3TS5 B;  5D3O A;  1CB1 A;  1TOP A;  1YTZ C;  3TDZ A;  2BBM A;  1AVS A;  2BL0 B;  2L2E A;  3D74 A;  1TNQ A;  1REC A;  2KHN A;  2JXL A;  3NSL A;  2H2K A;  1QWV A;  2WCB A;  3GK1 A;  2HET A;  1T14 A;  2WCK A;  5F6T A;  2PAL A;  2EC6 B;  1WLM A;  1BF5 A;  1B8L A;  1DJW A;  2EC6 C;  2KQY A;  1SPY A;  3OP0 A;  2GV5 A;  1R2U A;  4YGB B;  1IJ6 A;  2LVV A;  1F55 A;  3CZ0 A;  1S26 D;  2CBL A;  1SKT A;  2LM5 A;  2ZND A;  2GTE A;  3OB2 B;  3NSO A;  2WND A;  1K9K A;  1UHH A;  3KO0 A;  4KYN A;  1KSM A;  2Y5I A;  1QLK A;  4INW A;  2MBX A;  3PFV A;  5HKY A;  4P5O E;  1QXP A;  2JZI A;  2LLT A;  3IVT A;  1V1G A;  1JUO A;  4C0L A;  3LLE A;  4CLN A;  3S0B A;  2M7N A;  1DGU A;  3NXA A;  1CFD A;  5CSN A;  5HLV A;  2BBN A;  3WNX B;  2JOJ A;  1OOH A;  3FS7 A;  2K61 A;  2MLF C;  4WQ2 A;  1NX0 A;  5GQQ C;  2M1U A;  1OE9 B;  1TWO A;  1JF0 A;  3OGN A;  1RWY A;  4ORA B;  2LVJ A;  2Y1N A;  2K8M B;  3RLZ A;  1ZFS A;  3SG6 A;  2WCM A;  1B7T Y;  3SG3 A;  5BPJ A;  2ZNE A;  1OOF A;  4PHJ A;  2LC5 A;  5AAN A;  1FF1 A;  1B8C A;  3CTN A;  3S0E A;  1H8B A;  1DJH A;  2KOT A;  2WOS A;  1A29 A;  1TTX A;  1EG3 A;  1CLL A;  2JWW A;  3PLF B;  1SR6 C;  5D69 A;  2COL B;  2ZFD A;  3NSK A;  3PSR A;  1MF8 B;  3D75 A;  4OZD A;  3QRX A;  5CSJ A;  2CNP A;  4ZCU A;  1F8H A;  3A4U B;  1N0Y A;  4DCK A;  2H61 A;  4PE0 A;  4R1E A;  3DVE A;  4MZK A;  4OCI A;  5CSI A;  5KU1 A;  4E68 A;  1WY9 A;  1LKJ A;  1FI5 A;  2LUX A;  1YVH A;  1W7I B;  3E3R A;  2JTT A;  1AK8 A;  2Q91 A;  1DTL A;  1SK6 D;  3SS4 A;  1BMO A;  2ZRS A;  5HKW A;  2MRD A;  2ZN9 A;  2M7L A;  3R72 A;  2LV7 A;  4WQ3 A;  2AMI A;  2G9B A; 
#chains in the Genus database with same CATH homology
 1KSO A;  3CWG A;  2HF5 A;  4Q04 A;  1EXR A;  1B4C A;  1BU3 A;  3EK8 A;  1SCM C;  3CR4 X;  1FPW A;  1DGV A;  2M9G A;  1CFC A;  1SMG A;  2QPT A;  2KQ6 A;  2PRU A;  4I5N B;  2MJW B;  1SW8 A;  2KSP A;  1SCV A;  2PMY A;  4MLW A;  3VRP A;  2O60 A;  3TUY C;  1A4P A;  4QJ4 B;  4ZCV A;  1IG5 A;  3DVM A;  1B47 A;  2L98 A;  2JU0 A;  2FOT A;  3O2P A;  5CPV A;  1SL8 A;  4MZJ A;  2D8N A;  1JBA A;  2JUL A;  4C0K A;  3SG7 A;  1K8U A;  1DVI A;  2OTG B;  1B8R A;  4XYN A;  5I2O A;  1OMR A;  3I5H C;  1DJX A;  4A4B A;  4IL1 A;  2OTG C;  1TCO B;  2E30 A;  2F33 A;  1BR1 B;  1WRK A;  2LVK A;  1U5I B;  1XFZ O;  3O6B A;  1XO5 A;  1QVI Z;  5HKZ A;  2LVI A;  4AOM A;  1BT6 A;  1NP8 A;  4YI8 A;  1IQ3 A;  2JNX A;  2ZN8 A;  3IQO A;  1NX1 A;  2ZKM X;  3BUW B;  5I2Q A;  1BOD A;  1V1F A;  1IRJ A;  4AQI A;  3M0W A;  2WC8 A;  2BKI B;  3GK4 X;  1ODB A;  1XFV O;  1HQV A;  1NX2 A;  3KF9 A;  2I2R E;  1CDM A;  1B7T Z;  2KAX A;  1NCY A;  1M39 A;  1YVL A;  3H4S E;  5DKR A;  2F2P A;  2JC2 A;  2ISD A;  5DKN A;  2F3Y A;  1A03 A;  2IS9 A;  3BXK A;  1BR4 B;  2LLS A;  4MN0 A;  3SG5 A;  1JFK A;  1RRO A;  1TN4 A;  1CKK A;  1HT9 A;  3OHM B;  1OMV A;  3JVT B;  1YX8 A;  3WHT B;  1E8A A;  1K90 D;  1S1E A;  3BQ3 A;  1Q80 A;  1PUL A;  1TNX A;  3D0Y B;  1DJG A;  4CPV A;  2CCM A;  1Y6W A;  1J1D A;  4MBE A;  4PHM A;  3RM1 A;  3MSE B;  1KWO C;  2KGR A;  4JWQ A;  1KFU L;  2CTN A;  3EKH A;  3SG4 A;  1X02 A;  3O78 A;  2KBM A;  1YRT B;  3VGO A;  1UHK A;  1MXE A;  2LLU A;  2R2I A;  3BYA A;  1MR8 A;  4I5K A;  1YUT A;  2L51 A;  4ORB B;  2E6W A;  1J7R A;  2FCE A;  4MRX A;  4GNK B;  4GUK A;  4UPG A;  4NDB A;  3PAT A;  5ER5 A;  4FQO A;  2JRF A;  2KNE A;  4CFR A;  3FIA A;  4HRG A;  1AJ5 A;  1XVJ A;  1QIW A;  2NCP A;  3CS1 A;  2NCO A;  1CM1 A;  1QVI Y;  1KQV A;  1U5I A;  1RK9 A;  4YGA A;  1Y1A A;  4L9M A;  1UHJ A;  1TIZ A;  5CSF A;  1VRK A;  3DD4 A;  1L7Z A;  3CR2 A;  2KFG A;  1J1E A;  4FTG A;  1PSR A;  4JQ0 D;  1OZS A;  2ZRT A;  4QJ3 B;  1UHN A;  2BCX A;  4PCW A;  5AER A;  5J3X A;  4YRU A;  3JTD C;  1F71 A;  1F70 A;  2A4J A;  1D1O A;  2KAY A;  1SL7 A;  2BCA A;  4PE1 A;  1EH2 A;  2I18 A;  1YX7 A;  1R6P A;  1SR6 B;  1KFX L;  2MA2 A;  4PE4 A;  4CID A;  2MLE C;  1OSA A;  1RTP 1;  3KEV A;  1YUU A;  2GGM A;  4GBA A;  4DS7 A;  2L5X B;  3AKA A;  3DVK A;  3EVV A;  1M45 A;  1KQM C;  4HSZ A;  4XJK B;  3D0Y A;  1ZAC A;  3EKJ A;  3IF7 A;  1K9U A;  1SY9 A;  2HQ8 A;  3ZWH A;  4OVN F;  4N5X A;  1NYA A;  2L4I A;  1JSA A;  1ALV A;  1DT7 B;  3HX4 A;  3SIA A;  2M3W A;  2LNK A;  2PAS A;  1SCM B;  1ZUZ A;  1YUS A;  4QJ5 B;  2F2O A;  1SBJ A;  3F45 A;  2LMT A;  4YGD B;  1QIV A;  3TUY B;  2KAV A;  1J7P A;  3I5I C;  1NCX A;  1YR5 A;  3O4Y A;  1QV1 A;  3I5G C;  2EHB A;  1M46 A;  2LE9 B;  3LL8 B;  2K7B A;  2AUC A;  2K7C A;  1BJF A;  1QX2 A;  1CDP A;  4F0Z B;  3EK4 A;  3I5H B;  5K89 A;  1JC2 A;  1PSB A;  2VRG A;  4NQG A;  2BCB A;  1PVA A;  2KGB C;  3IQQ A;  2O5G A;  1YRU B;  2JT8 A;  1Y0V H;  2KFH A;  3C1V A;  2LHI A;  4OV2 A;  5G08 A;  3WHU B;  1FI6 A;  1K94 A;  1QAT A;  3DVJ A;  1C7W A;  3A8R A;  1Y1X A;  1JWD A;  4N1G A;  1KK8 C;  1OOJ A;  1MUX A;  2SAS A;  1DJY A;  1XA5 A;  1S6I A;  2B1U A;  1GGZ A;  1M31 A;  1PAL A;  1G33 A;  1XYD A;  2L0P A;  1L2O C;  3BUN B;  3LK1 A;  1LA0 A;  1A75 B;  3DF0 B;  1TNP A;  3TZ1 A;  1IQ5 A;  1OZO A;  2OS8 C;  4YGC B;  4XJK A;  4WRI A;  3SG2 A;  1J55 A;  3AAK A;  2QAC A;  1J7Q A;  1G4Y R;  2JPT A;  3I5F C;  1NPQ A;  2LP3 A;  3PN7 B;  3BOW B;  1A2X A;  1GQM A;  1K96 A;  1NWD A;  4M2O A;  4U8D A;  4YI9 A;  2K2F A;  3PN7 C;  4PDZ A;  1NX3 A;  4JPZ B;  5B8I B;  1KWO B;  2F8P A;  2I94 A;  2KI4 C;  1XFY O;  1SRA A;  4DRW A;  2FCD A;  4CFQ A;  1DJZ A;  1S36 A;  1PK0 D;  5FYX A;  2JT3 A;  3SIB A;  3VRN A;  3HCM A;  1H4B A;  1AHR A;  1K9P A;  4BY4 A;  5DKQ A;  2H61 C;  2BKH B;  4OR9 B;  2BE6 A;  2LHL A;  1CNP A;  3PAL A;  1JF2 A;  4YGE B;  3SJS A;  1KK7 Z;  2JT0 A;  4GPL B;  1XFU O;  2KDH A;  2P6B B;  3TS5 C;  1MWN A;  3NSI A;  1XFW O;  1AP4 A;  1EL4 A;  3PM8 A;  2NZ0 A;  1SNL A;  2BL0 C;  1QAS A;  1TNW A;  4USL A;  2EGD A;  3VRQ A;  2V53 A;  2Y1M A;  2CT9 A;  2DOQ A;  1CLB A;  3GK2 A;  5I8N A;  1CFP A;  1KCY A;  2HPS A;  2LMV A;  1LVC D;  3JTD B;  1S3P A;  3TDU A;  1QX5 B;  2SCP A;  4DUQ A;  1K95 A;  1QV0 A;  1KFU S;  5HYD A;  2K0J A;  2KYC A;  5AFP A;  1CMG A;  2KI6 D;  2LP2 A;  4P2Y B;  1A75 A;  3DF0 A;  1GJY A;  1IGV A;  4ORC B;  4HRH A;  4I5L B;  2LCP A;  2NXQ A;  3AAJ A;  4GGF C;  2TN4 A;  2G2B A;  1UUR A;  1CFF A;  2K7D A;  1IJ5 A;  1KQM B;  2WCE A;  4D1E A;  1NCZ A;  4N1F A;  2BE4 A;  3BOW A;  4ICB A;  4OKH A;  3TDI A;  2LAP A;  1AJ4 A;  3GOF A;  2K7O A;  4GAO A;  1N2D A;  2L50 A;  4GGN A;  3EVR A;  1UUS A;  3FWB A;  2MHH A;  2Y4Q A;  4M2P A;  1WDC B;  1MXL C;  1BLQ A;  1ZMZ A;  1OMD A;  2KI6 C;  4MSP A;  1QLS A;  1NUB A;  1WDC C;  5AEQ A;  1F4Q A;  1ALW A;  1TRF A;  4NDC A;  4HRE E;  1FW4 A;  1XFX O;  1XK4 C;  1CDL A;  3ZNI A;  1S5G Z;  1YUR A;  1CTR A;  2M29 A;  2KFF A;  2JTZ A;  3FWC A;  1Y1U A;  2OPO A;  3I5I B;  4MVF A;  1QX7 A;  3I5G B;  2K2A A;  2I7A A;  1KFX S;  2M1K B;  5JOL A;  1WRL A;  1KK7 Y;  1B1G A;  4PAL A;  1IH0 A;  1RFJ A;  1LA3 A;  3OB1 B;  1F4O A;  3VRR A;  2RGI A;  1BOC A;  4YBH B;  1K2H A;  4C0J A;  1WLZ A;  1NIW A;  2LAN A;  1PRW A;  3K21 A;  1DF0 B;  3AKB A;  1LXF C;  5TNC A;  1JFJ A;  1PVB A;  2M49 B;  4NDD A;  1S6J A;  4MZL A;  4AQJ A;  4DIR A;  1MQ1 A;  1MHO A;  5KTY A;  5AXI A;  1EJ3 A;  1GGW A;  3CZT X;  1EG4 A;  2NLN A;  3D10 A;  1F54 A;  1SL9 A;  2PVB A;  5JJG A;  1KK8 B;  4MEW A;  5KSZ A;  1W7J B;  1IKU A;  2M0R A;  4GFT A;  5PAL A;  1J7O A;  2F3Z A;  2M97 A;  4GGF A;  2MAZ A;  3BUM B;  1L2O B;  3LK0 A;  3WXA A;  2WCF A;  3KPX A;  3ICB A;  5IBW A;  1CLM A;  2M8U A;  3KHE A;  1DMO A;  1S6C A;  1K93 D;  2OS8 B;  2AAO A;  1BG1 A;  2BEC A;  1IWQ A;  1B9A A;  1QJT A;  1SYM A;  3BUO B;  1QS7 A;  3CR5 X;  2Q4U A;  4PHK A;  1UHI A;  3I5F B;  3BUX B;  2KYF A;  4I5J A;  3OX5 A;  4ETO A;  1QTX A;  2PSR A;  2JQ6 A;  4A4C A;  1CM4 A;  1CMF A;  3CGA A;  3OX6 A;  1UP5 A;  2FJU B;  3CLN A;  2LMU A;  2LUC A;  4TNC A;  1ZOT B;  1XK4 A;  2KI4 B;  5D7F A;  1S5G Y;  1M63 B;  3EVU A;  4BY5 A;  1C7V A;  1NSH A;  1G8I A;  1N65 A;  5HLO A;  1LIN A;  2JNF A;  1FBV A;  4PHN A;  1CDN A;  1C07 A;  4M2Q A;  5I2L A;  5ER4 X;  2GGZ A;  3VRO A;  1TCF A;  1WRZ A;  4PE7 A;  1OQP A;  2CXJ A;  1DJI A;  1AUI B;  2HQW A;  2WOR A;  1UWO A;  3EK7 A;  1DF0 A;  1RJV A;  3JVT C;  3LCP C;  2JXC A;  2L4H A;  4MRY A;  2KBI A;  3TS5 B;  1CB1 A;  1TOP A;  1YTZ C;  3TDZ A;  2BBM A;  1AVS A;  2BL0 B;  2L2E A;  1TNQ A;  1REC A;  2KHN A;  2JXL A;  3NSL A;  2H2K A;  2WCB A;  3GK1 A;  2HET A;  5F6T A;  2PAL A;  2EC6 B;  1WLM A;  1BF5 A;  1B8L A;  1DJW A;  2EC6 C;  2KQY A;  1SPY A;  3OP0 A;  2GV5 A;  1R2U A;  4YGB B;  1IJ6 A;  2LVV A;  1F55 A;  1S26 D;  2CBL A;  1SKT A;  2LM5 A;  2ZND A;  3OB2 B;  3NSO A;  2WND A;  1K9K A;  1UHH A;  3KO0 A;  1KSM A;  2Y5I A;  1QLK A;  2MBX A;  3PFV A;  5HKY A;  4P5O E;  1QXP A;  2JZI A;  2LLT A;  1V1G A;  1JUO A;  4C0L A;  3LLE A;  4CLN A;  2M7N A;  1DGU A;  3NXA A;  1CFD A;  5CSN A;  5HLV A;  2BBN A;  3WNX B;  2JOJ A;  3FS7 A;  2K61 A;  2MLF C;  4WQ2 A;  1NX0 A;  5GQQ C;  2M1U A;  1OE9 B;  1JF0 A;  1RWY A;  4ORA B;  2LVJ A;  2Y1N A;  2K8M B;  3RLZ A;  1ZFS A;  3SG6 A;  1B7T Y;  3SG3 A;  5BPJ A;  2ZNE A;  4PHJ A;  5AAN A;  2LC5 A;  1FF1 A;  1H8B A;  1B8C A;  3CTN A;  1DJH A;  2KOT A;  2WOS A;  1A29 A;  1TTX A;  1EG3 A;  1CLL A;  2JWW A;  3PLF B;  1SR6 C;  5D69 A;  2COL B;  2ZFD A;  3NSK A;  3PSR A;  1MF8 B;  5CSJ A;  3QRX A;  2CNP A;  4ZCU A;  1F8H A;  3A4U B;  1N0Y A;  4DCK A;  2H61 A;  4PE0 A;  4R1E A;  3DVE A;  4MZK A;  4OCI A;  5CSI A;  5KU1 A;  4E68 A;  1WY9 A;  1LKJ A;  1FI5 A;  2LUX A;  1YVH A;  1W7I B;  3E3R A;  2JTT A;  1AK8 A;  2Q91 A;  1DTL A;  1SK6 D;  1BMO A;  2ZRS A;  5HKW A;  2MRD A;  2ZN9 A;  2M7L A;  2LV7 A;  4WQ3 A;  2AMI A;  2G9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...