3B88A

Complex of t57a substituted drosophila lush protein with ethanol
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGAVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General odorant-binding protein lush
publication title The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 44
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3b88A00
2WC5A 3S0GA 1OW4A 3Q8IA 3FE6A 3K1EA 3BFBA 3D73A 3R1PA 2WCLA 4INXA 3BFHA 3L4AA 2QEOA 2P71A 2QEVA 4OZDA 3DYEA 2QEBA 4F7FA 3D78A 2WCHA 3NHTA 3DY9A 3BJHA 1OOIX 2WC6A 3FE8A 3CYZA 3S0DA 3B88A 3RZSA 3B7AA 3CZ0A 2JPOA 3CABA 3V2LA 1XFRA 1LS8A 2P70A 1QWVA 1TUJA 3R1OA 3B87A 3DZTA 1GM0A 1P28A 3S0AA 3S0FA 2KPHA 1OOHA 3CZ2A 3NHIA 1OOGA 4PT1A 2ERBA 2FJYA 3VB1A 2WCKA 1T14A 2H8VA 3R72A 3S0EA 3L4LA 3N7HA 3D77A 3QMEA 1ORGA 3D75A 2WCJA 3L47A 1OOFA 5EL2A 1TWOA 1DQEA 3CZ1A 3NGVA 2QDIA 4INWA 4JD9A 3FE9A 3B86A 3PJIA 2PQLA 3R1VA 3BFAA 3OGNA 1C3YA 5DICA 2WCMA 3S0BA 4FQTA 3D74A 2L2CA 3D76A 3CDNA 3DXLA 3B6XA 2QEHA 1C3ZA 2GTEA
chains in the Genus database with same CATH superfamily
1DF0A 1QV0A 1Y1AA 2MA2A 1DVIA 3Q8IA 2JT3A 2WNDA 4ZCUA 5KU1A 3IQQA 2OS8B 3LK1A 1C07A 2I7AA 2K2AA 2NCPA 3EVVA 1NCZA 1A29A 1SYMA 2JT0A 1DGVA 5HLOA 2BCXA 3EG5B 5HKZA 2F8PA 1Z2CB 3EK8A 2D8NA 1B7TZ 2JC2A 1LVCD 2WCLA 1L2OB 3FIAA 4INXA 3DVEA 3I5HC 3L4AA 5AERA 2LP3A 5CPVA 1K94A 1IJ5A 1OE9B 1TUZA 1S5GY 4OZDA 1TNXA 2BKHB 1G33A 1X02A 1PSBA 5HL1A 2PVBA 3IQOA 1QS7A 3D78A 3VRQA 1M46A 1XK4A 1UHHA 5I8NA 1L2OC 1DELA 1PSRA 2LMTA 3BJHA 2LANA 3I5IB 1J7OA 1KQVA 2WC6A 2LE9B 1AUIB 1XFXO 4OKHA 1CFDA 1WDCB 1UURA 1QTXA 4NDBA 1OMDA 1DJGA 3CZ0A 3LL8B 2KI6D 1OSAA 1B9AA 1WRKA 2L51A 4GGFC 3V2LA 1K2HA 4N5XA 3A4UB 3SG3A 3BUWB 2P70A 4GPLB 2JPTA 2M1UA 1BG1A 1Y1UA 2M7NA 2K8MB 4USLA 1TCOB 3I5IC 3FS7A 3GK1A 3B87A 4OR9B 1C7WA 2O60A 1CMGA 2WCFA 1QLSA 2F3YA 5GQQC 1F70A 3CTNA 1ALWA 1D1OA 3DZTA 1GM0A 3DVKA 1IG5A 1J7PA 1P28A 3CWGA 3OP0A 1WRLA 1CTRA 2MRDA 3RM1A 5HLVA 1DTLA 3CZ2A 1K96A 2COLB 3JVTC 1B8RA 1CM1A 1SPYA 1DJZA 3O2PA 1CLBA 4D1EA 2BE4A 1IRJA 2BCAA 1SSEB 2LUXA 3TUYC 2L2EA 1S5GZ 1MWNA 1U5IA 3WNXB 1QX2A 4PE1A 3S0EA 1CDPA 2KGBC 2LVJA 2KYFA 3IF7A 4MZLA 2M7LA 3D77A 4I5KA 1SBJA 1PVAA 1CLLA 1YUTA 1YVHA 2PMYA 2R2IA 2L5YA 3BUOB 3JTDC 5EL2A 2K7BA 1W7IB 3VGOA 1TWOA 1IH0A 1IJ6A 1DJIA 3AAKA 2CXJA 2KHNA 4INWA 2LAPA 3F45A 1QATA 3DVMA 1BU3A 1UWOA 3PJIA 1DJXA 1XK4C 2A4JA 3QRXA 1HT9A 5FYXA 3WXAA 4YRUA 4A4BA 2LV7A 1ODBA 1NCYA 2K7OA 2I94A 1V1GA 1JF2A 4FQTA 1SCMB 1BODA 2E30A 2Q91A 5FI6A 1OMVA 3KPXA 5JOLA 4CIDA 1M39A 1UHKA 1QV1A 2FJUB 4MEWA 3EKJA 3BUXB 5KTYA 2KFHA 4XJKA 4CPVA 2WC5A 1FW4A 2KQ6A 1FPWA 1KWOB 4UPGA 1SCMC 1SL9A 4PHJA 1NCXA 1U5IB 2F3ZA 4GAOA 4OCIA 3DF0A 2L4IA 3R1PA 1KK7Y 2KFFA 2G2BA 1B8CA 2PRUA 4MRXA 2M8UA 3SS4A 1BLQA 4C0JA 1YR5A 1EH2A 5I2QA 2QEOA 1KWOC 3EVUA 1K9PA 2ZRTA 4FTGA 2TN4A 1S3PA 3UO9A 2MLEC 1V1FA 1H8BA 2KSPA 3AKAA 4AOMA 1G8IA 1SKTA 2KYCA 1QLKA 1UHJA 3DYEA 1NIWA 2F2OA 4JWQA 3OX6A 2WCHA 1QX7A 1SY9A 3KO0A 1M31A 3I5HB 2L98A 2LNKA 3PFVA 1RTP1 3BXKA 4HRHA 4XYNA 3SS5A 2L50A 5AEQA 1NYAA 2F2PA 2KI4C 1MR8A 2MJWB 2BNXA 3NSIA 4CFRA 3RZSA 1AK8A 1KQMC 3NSLA 4CFQA 2KLEA 4MRYA 1QXPA 2YGUA 5ER4X 3SJSA 3IVTA 2KFGA 2WCBA 3WHUB 4C0LA 3VRNA 2ZN9A 1BJFA 3VRRA 2FCDA 3LLEA 1S6JA 4PDZA 5KSZA 3CR4X 3R1OA 1BR4B 3OHMB 1NX3A 2KBMA 2BE6A 4R1EA 1OOJA 2KNEA 2LLUA 2M97A 3H4SE 2KOTA 3KHEA 1BT6A 3SG5A 2JQ6A 1CFCA 1KK7Z 1YX8A 3S0FA 3TZ1A 1S26D 2M49B 1PK0D 4M2PA 2JZIA 5AANA 2ERBA 4YI9A 4PHNA 2NZ0A 1LA3A 2GGZA 2HQWA 2FJYA 2KAXA 2MAZA 3AAJA 1A4PA 4JKTA 3SG4A 4DUQA 4PHKA 2BBNA 1CLMA 1B8LA 2OPOA 4PHMA 1B4CA 1NWDA 3FWCA 3L4LA 1RJVA 4HRGA 1AP4A 3SG6A 3JVTB 1FF1A 2HETA 2JTTA 1CB1A 1DF0B 3D75A 1KFUS 3MSEB 2AUCA 1QVIY 3TUYB 1CKKA 1OOFA 1JSAA 1K8UA 4JPZB 2HPSA 3BUMB 5JJGA 2AMIA 5AXIA 4ZCVA 3NSOA 1LXFC 2QDIA 4DRWA 2Y1MA 1DMOA 5DKQA 2NLNA 4GNKB 2NCOA 1A03A 2SASA 4NDDA 3SG2A 2OTGC 1MXEA 1UHNA 4ICBA 1QASA 5HKWA 1KFUL 3OGNA 3JTDB 4NQGA 5DICA 2B1UA 4YI8A 2K2FA 2M1KB 3O78A 1Y6WA 2K7CA 3CS1A 1A75A 1DJWA 2KAYA 4BY4A 2K61A 1MQ1A 2H2KA 3DXLA 3HCMA 2MHHA 5BPJA 1N65A 1W7JB 1PULA 1TN4A 4ORBB 1YUUA 1M45A 2GTEA 1AVSA 5K89A 5AFPA 1DEKA 1NX0A 1RFJA 3GK2A 4TNCA 1CDMA 1F55A 4C0KA 2Y1NA 1XFYO 4OVNF 3D73A 4OV2A 2BL0C 2I18A 4N1FA 1FI5A 1DJYA 2JTZA 2KQYA 2LM5A 1KFXS 1ZMZA 2E6WA 2LP2A 3BFHA 3KEVA 3SG7A 1QVIZ 4WQ2A 2ISDA 2P71A 3SIBA 3VROA 4E68A 2QPTA 1SK6D 1TNPA 1WRZA 3C1VA 1SL8A 3CGAA 4IL1A 2WORA 5CSIA 3TDUA 4GFTA 1NUBA 1VRKA 2PYQA 3GOFA 4ETOA 1QX5B 2CNPA 4P2YB 4A4CA 4F7FA 1XVJA 1SR6B 5B8IB 3SIAA 2PSRA 2RGIA 1ZOTB 1CMFA 1OOIX 3FE8A 2VRGA 5HKYA 3PM2A 4P5OE 1NX2A 3D0YA 2JWWA 3CYZA 1GGWA 1EG3A 1TNQA 1A75B 4DIRA 3PM8A 1PVBA 2CCMA 1F4QA 3EK7A 1FBVA 2KBIA 3B7AA 4AQJA 2JPOA 2JXLA 1N0YA 2JU0A 3CABA 1GQMA 1J1EA 1XFRA 1LS8A 1SR6C 3ZWHA 4YGBB 1XFUO 1B47A 1QWVA 1MXLC 1SNLA 4AQIA 4U8DA 1TUJA 2KI4B 2KLDA 3ZNIA 2M9GA 1ALVA 1WLZA 2EGDA 4MSPA 1NX1A 4PE7A 2EHBA 1TNWA 1KQMB 3PSRA 4QJ5B 1GGZA 1K90D 3E3RA 1RK9A 3RLZA 1J55A 1PALA 1NSHA 1M63B 1H4BA 1Q80A 3KF9A 2EC6C 2FCEA 3S0AA 4QJ4B 2KPHA 2LHLA 1MHOA 1TRFA 1NPQA 2L0PA 1LINA 3I5GB 1E8AA 3NHIA 4M2OA 4PT1A 3SS3A 1OZOA 2M3WA 5D69A 5G08A 2K7DA 5IBWA 1AJ5A 1T14A 1TOPA 1RROA 3CR5X 1YUSA 5F6TA 1W9ZA 1ZUZA 2H8VA 3R72A 4GBAA 3PLFB 1S6IA 2I2RE 4MBEA 1IQ5A 1EXRA 3I5GC 4XJKB 3QMEA 4GUKA 1BF5A 4YGCB 4DS7A 1FI6A 2WOSA 4PALA 3D0YB 2ZFDA 5ER5A 1CDLA 2M29A 3DF0B 4DCKA 2ZN8A 1XO5A 3LCPC 1F71A 1DQEA 3NGVA 1XYDA 2HQ8A 3K21A 3BYAA 3FE9A 4JD9A 2CTNA 4KYNA 1KSMA 2SCPA 4CLNA 4F0ZB 3R1VA 1Y1XA 4M2QA 4QJ3B 1RECA 1C3YA 3O4XA 2BECA 1YURA 2WCMA 5J3XA 2QACA 3EVRA 1SW8A 1OQPA 4MLWA 2L2CA 2PASA 3D76A 4I5LB 1JUOA 1DJHA 1UUSA 3CDNA 3NXAA 3TDZA 1S36A 1OZSA 2LCPA 2ZKMX 4MZKA 2OS8C 2KI6C 2LMVA 4HREE 2OTGB 2V53A 4WQ3A 1YRUB 2MBXA 1BOCA 5TNCA 1C3ZA 4YGDB 1IGVA 1K9KA 1G4YR 2JRFA 3BOWA 2H61A 3S0GA 3LK0A 3OB2B 1OW4A 3BQ3A 2K60A 3FE6A 5DKRA 3OB1B 3K1EA 1KK8B 1N2DA 3BFBA 2CBLA 2JNXA 1GJYA 2L5XB 2WC8A 5CSFA 1JFKA 3A8RA 4PE4A 1K95A 4WRIA 4MZJA 2DOQA 1QJTA 4YBHB 2G9BA 5D3OA 1UHIA 5FI2A 5DKNA 1YRTB 4HSZA 1LA0A 2FOTA 1MUXA 2QEVA 3PN7B 1F8HA 3DVJA 1WDCC 1L7ZA 2BL0B 2LHIA 1KK8C 3CZTX 1YVLA 2JULA 1BR1B 2QEBA 2PALA 1YX7A 3NHTA 1IWQA 1AJ4A 3NSKA 3TDIA 2JXCA 2JNFA 2WCEA 3O4YA 3DY9A 4PCWA 2LLSA 1F54A 3DD4A 3ICBA 4Q04A 1SCVA 3BUNB 4MVFA 5I94A 2LVKA 1ZFSA 2LVVA 3S0DA 3TS5B 3B88A 3WHTB 3CLNA 1JWDA 2LMUA 1XFVO 1XFZO 1UP5A 3PN7C 4I5NB 1WLMA 3OBVA 1J7QA 1KCYA 1EL4A 1EG4A 2CT9A 2KGRA 1K9UA 1XFWO 2HF5A 4ORAB 4ORCB 2JOJA 1EJ3A 1TIZA 1S1EA 2BCBA 2Y4QA 1JFJA 4YGAA 1DT7B 3O6BA 1IIOA 3BOWB 1SL7A 3TS5C 1QIVA 1MF8B 2GGMA 1RWYA 2LVIA 5CSJA 3HX4A 2BBMA 1IQ3A 2BAPA 2IS9A 1A2XA 2KAVA 1WY9A 3AKBA 2BKIB 2KDHA 1C7VA 2ZNDA 1KFXL 2GV5A 1OOHA 1CFPA 1OOGA 1DC1A 2AAOA 3I5FB 4PE0A 5HYDA 1R6PA 3OX5A 2NXQA 2H61C 3VB1A 2WCKA 3PALA 1JBAA 1TTXA 1JF0A 2LLTA 4I5JA 3EKHA 2EC6B 3PATA 1SRAA 5PALA 1OMRA 3N7HA 2LC5A 1JC2A 2Q4UA 2LUCA 3CR2A 1B7TY 3GK4X 1ORGA 2L4HA 3I5FC 4MN0A 2WCJA 3L47A 4GGNA 3VRPA 2M0RA 2ZNEA 5CSNA 4N1GA 1B1GA 3D10A 1CM4A 1S6CA 4YGEB 3EK4A 5I2LA 3CZ1A 4FQOA 1NP8A 1F4OA 2MLFC 4JQ0D 1KSOA 1AHRA 2JT8A 3B86A 4GGFA 2O5GA 2PQLA 5I2OA 1QIWA 1Y0VH 2K0JA 1PRWA 1R2UA 1J7RA 5D7FA 3BFAA 1CFFA 1Z4HA 3S0BA 1IKUA 1J1DA 1K93D 3M0WA 3UNWA 3D74A 1YTZC 1XA5A 2P6BB 1SMGA 1ZACA 1BMOA 4IJ7A 1CNPA 2ZRSA 4BY5A 3FWBA 1LKJA 4NDCA 2Y5IA 1DGUA 3B6XA 1HQVA 2F33A 2QEHA 1TCFA 5FI7A 1CDNA 4L9MA
chains in the Genus database with same CATH topology
2WC5A 3S0GA 1OW4A 3Q8IA 3FE6A 3K1EA 3BFBA 3D73A 3R1PA 2WCLA 4INXA 3BFHA 3L4AA 2QEOA 2P71A 2QEVA 4OZDA 3DYEA 2QEBA 4F7FA 3D78A 2WCHA 3NHTA 3DY9A 3BJHA 1OOIX 2WC6A 3FE8A 3CYZA 3S0DA 3B88A 3RZSA 3B7AA 3CZ0A 2JPOA 3CABA 3V2LA 1XFRA 1LS8A 2P70A 1QWVA 1TUJA 3R1OA 3B87A 3DZTA 1GM0A 1P28A 3S0AA 3S0FA 2KPHA 1OOHA 3CZ2A 3NHIA 1OOGA 4PT1A 2ERBA 2FJYA 3VB1A 2WCKA 1T14A 2H8VA 3R72A 3S0EA 3L4LA 3N7HA 3D77A 3QMEA 1ORGA 3D75A 2WCJA 3L47A 1OOFA 5EL2A 1TWOA 1DQEA 3CZ1A 3NGVA 2QDIA 4INWA 4JD9A 3FE9A 3B86A 3PJIA 2PQLA 3R1VA 3BFAA 3OGNA 1C3YA 5DICA 2WCMA 3S0BA 4FQTA 3D74A 2L2CA 3D76A 3CDNA 3DXLA 3B6XA 2QEHA 1C3ZA 2GTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WC5 A;  3S0G A;  1OW4 A;  3Q8I A;  3FE6 A;  3K1E A;  3BFB A;  3D73 A;  3R1P A;  2WCL A;  4INX A;  3BFH A;  3L4A A;  2QEO A;  2P71 A;  2QEV A;  4OZD A;  3DYE A;  2QEB A;  4F7F A;  3D78 A;  2WCH A;  3NHT A;  3DY9 A;  3BJH A;  1OOI X;  2WC6 A;  3FE8 A;  3CYZ A;  3S0D A;  3B88 A;  3RZS A;  3B7A A;  3CZ0 A;  2JPO A;  3CAB A;  3V2L A;  1XFR A;  1LS8 A;  2P70 A;  1QWV A;  1TUJ A;  3R1O A;  3B87 A;  3DZT A;  1GM0 A;  1P28 A;  3S0A A;  3S0F A;  2KPH A;  1OOH A;  3CZ2 A;  3NHI A;  1OOG A;  4PT1 A;  2ERB A;  2FJY A;  3VB1 A;  2WCK A;  1T14 A;  2H8V A;  3R72 A;  3S0E A;  3L4L A;  3N7H A;  3D77 A;  3QME A;  1ORG A;  3D75 A;  2WCJ A;  3L47 A;  1OOF A;  5EL2 A;  1TWO A;  1DQE A;  3CZ1 A;  3NGV A;  2QDI A;  4INW A;  4JD9 A;  3FE9 A;  3B86 A;  3PJI A;  2PQL A;  3R1V A;  3BFA A;  3OGN A;  1C3Y A;  5DIC A;  2WCM A;  3S0B A;  4FQT A;  3D74 A;  2L2C A;  3D76 A;  3CDN A;  3DXL A;  3B6X A;  2QEH A;  1C3Z A;  2GTE A; 
#chains in the Genus database with same CATH topology
 1DF0 A;  1QV0 A;  1Y1A A;  2MA2 A;  1DVI A;  3Q8I A;  2JT3 A;  2WND A;  4ZCU A;  5KU1 A;  3IQQ A;  2OS8 B;  3LK1 A;  1C07 A;  2I7A A;  2K2A A;  2NCP A;  3EVV A;  1NCZ A;  1A29 A;  1SYM A;  2JT0 A;  1DGV A;  5HLO A;  2BCX A;  3EG5 B;  5HKZ A;  2F8P A;  1Z2C B;  3EK8 A;  2D8N A;  1B7T Z;  2JC2 A;  1LVC D;  2WCL A;  1L2O B;  3FIA A;  4INX A;  3DVE A;  3I5H C;  3L4A A;  5AER A;  2LP3 A;  5CPV A;  1K94 A;  1IJ5 A;  1OE9 B;  1TUZ A;  1S5G Y;  4OZD A;  1TNX A;  2BKH B;  1G33 A;  1X02 A;  1PSB A;  5HL1 A;  2PVB A;  3IQO A;  1QS7 A;  3D78 A;  3VRQ A;  1M46 A;  1XK4 A;  1UHH A;  5I8N A;  1L2O C;  1DEL A;  1PSR A;  2LMT A;  3BJH A;  2LAN A;  3I5I B;  1J7O A;  1KQV A;  2WC6 A;  2LE9 B;  1AUI B;  1XFX O;  4OKH A;  1CFD A;  1WDC B;  1UUR A;  1QTX A;  4NDB A;  1OMD A;  1DJG A;  3CZ0 A;  3LL8 B;  2KI6 D;  1OSA A;  1B9A A;  1WRK A;  2L51 A;  4GGF C;  3V2L A;  1K2H A;  4N5X A;  3A4U B;  3SG3 A;  3BUW B;  2P70 A;  4GPL B;  2JPT A;  2M1U A;  1BG1 A;  1Y1U A;  2M7N A;  2K8M B;  4USL A;  1TCO B;  3I5I C;  3FS7 A;  3GK1 A;  3B87 A;  4OR9 B;  1C7W A;  2O60 A;  1CMG A;  2WCF A;  1QLS A;  2F3Y A;  5GQQ C;  1F70 A;  3CTN A;  1ALW A;  1D1O A;  3DZT A;  1GM0 A;  3DVK A;  1IG5 A;  1J7P A;  1P28 A;  3CWG A;  3OP0 A;  1WRL A;  1CTR A;  2MRD A;  3RM1 A;  5HLV A;  1DTL A;  3CZ2 A;  1K96 A;  2COL B;  3JVT C;  1B8R A;  1CM1 A;  1SPY A;  1DJZ A;  3O2P A;  1CLB A;  4D1E A;  2BE4 A;  1IRJ A;  2BCA A;  1SSE B;  2LUX A;  3TUY C;  2L2E A;  1S5G Z;  1MWN A;  1U5I A;  3WNX B;  1QX2 A;  4PE1 A;  3S0E A;  1CDP A;  2KGB C;  2LVJ A;  2KYF A;  3IF7 A;  4MZL A;  2M7L A;  3D77 A;  4I5K A;  1SBJ A;  1PVA A;  1CLL A;  1YUT A;  1YVH A;  2PMY A;  2R2I A;  2L5Y A;  3BUO B;  3JTD C;  5EL2 A;  2K7B A;  1W7I B;  3VGO A;  1TWO A;  1IH0 A;  1IJ6 A;  1DJI A;  3AAK A;  2CXJ A;  2KHN A;  4INW A;  2LAP A;  3F45 A;  1QAT A;  3DVM A;  1BU3 A;  1UWO A;  3PJI A;  1DJX A;  1XK4 C;  2A4J A;  3QRX A;  1HT9 A;  5FYX A;  3WXA A;  4YRU A;  4A4B A;  2LV7 A;  1ODB A;  1NCY A;  2K7O A;  2I94 A;  1V1G A;  1JF2 A;  4FQT A;  1SCM B;  1BOD A;  2E30 A;  2Q91 A;  5FI6 A;  1OMV A;  3KPX A;  5JOL A;  4CID A;  1M39 A;  1UHK A;  1QV1 A;  2FJU B;  4MEW A;  3EKJ A;  3BUX B;  5KTY A;  2KFH A;  4XJK A;  4CPV A;  2WC5 A;  1FW4 A;  2KQ6 A;  1FPW A;  1KWO B;  4UPG A;  1SCM C;  1SL9 A;  4PHJ A;  1NCX A;  1U5I B;  2F3Z A;  4GAO A;  4OCI A;  3DF0 A;  2L4I A;  3R1P A;  1KK7 Y;  2KFF A;  2G2B A;  1B8C A;  2PRU A;  4MRX A;  2M8U A;  3SS4 A;  1BLQ A;  4C0J A;  1YR5 A;  1EH2 A;  5I2Q A;  2QEO A;  1KWO C;  3EVU A;  1K9P A;  2ZRT A;  4FTG A;  2TN4 A;  1S3P A;  3UO9 A;  2MLE C;  1V1F A;  1H8B A;  2KSP A;  3AKA A;  4AOM A;  1G8I A;  1SKT A;  2KYC A;  1QLK A;  1UHJ A;  3DYE A;  1NIW A;  2F2O A;  4JWQ A;  3OX6 A;  2WCH A;  1QX7 A;  1SY9 A;  3KO0 A;  1M31 A;  3I5H B;  2L98 A;  2LNK A;  3PFV A;  1RTP 1;  3BXK A;  4HRH A;  4XYN A;  3SS5 A;  2L50 A;  5AEQ A;  1NYA A;  2F2P A;  2KI4 C;  1MR8 A;  2MJW B;  2BNX A;  3NSI A;  4CFR A;  3RZS A;  1AK8 A;  1KQM C;  3NSL A;  4CFQ A;  2KLE A;  4MRY A;  1QXP A;  2YGU A;  5ER4 X;  3SJS A;  3IVT A;  2KFG A;  2WCB A;  3WHU B;  4C0L A;  3VRN A;  2ZN9 A;  1BJF A;  3VRR A;  2FCD A;  3LLE A;  1S6J A;  4PDZ A;  5KSZ A;  3CR4 X;  3R1O A;  1BR4 B;  3OHM B;  1NX3 A;  2KBM A;  2BE6 A;  4R1E A;  1OOJ A;  2KNE A;  2LLU A;  2M97 A;  3H4S E;  2KOT A;  3KHE A;  1BT6 A;  3SG5 A;  2JQ6 A;  1CFC A;  1KK7 Z;  1YX8 A;  3S0F A;  3TZ1 A;  1S26 D;  2M49 B;  1PK0 D;  4M2P A;  2JZI A;  5AAN A;  2ERB A;  4YI9 A;  4PHN A;  2NZ0 A;  1LA3 A;  2GGZ A;  2HQW A;  2FJY A;  2KAX A;  2MAZ A;  3AAJ A;  1A4P A;  4JKT A;  3SG4 A;  4DUQ A;  4PHK A;  2BBN A;  1CLM A;  1B8L A;  2OPO A;  4PHM A;  1B4C A;  1NWD A;  3FWC A;  3L4L A;  1RJV A;  4HRG A;  1AP4 A;  3SG6 A;  3JVT B;  1FF1 A;  2HET A;  2JTT A;  1CB1 A;  1DF0 B;  3D75 A;  1KFU S;  3MSE B;  2AUC A;  1QVI Y;  3TUY B;  1CKK A;  1OOF A;  1JSA A;  1K8U A;  4JPZ B;  2HPS A;  3BUM B;  5JJG A;  2AMI A;  5AXI A;  4ZCV A;  3NSO A;  1LXF C;  2QDI A;  4DRW A;  2Y1M A;  1DMO A;  5DKQ A;  2NLN A;  4GNK B;  2NCO A;  1A03 A;  2SAS A;  4NDD A;  3SG2 A;  2OTG C;  1MXE A;  1UHN A;  4ICB A;  1QAS A;  5HKW A;  1KFU L;  3OGN A;  3JTD B;  4NQG A;  5DIC A;  2B1U A;  4YI8 A;  2K2F A;  2M1K B;  3O78 A;  1Y6W A;  2K7C A;  3CS1 A;  1A75 A;  1DJW A;  2KAY A;  4BY4 A;  2K61 A;  1MQ1 A;  2H2K A;  3DXL A;  3HCM A;  2MHH A;  5BPJ A;  1N65 A;  1W7J B;  1PUL A;  1TN4 A;  4ORB B;  1YUU A;  1M45 A;  2GTE A;  1AVS A;  5K89 A;  5AFP A;  1DEK A;  1NX0 A;  1RFJ A;  3GK2 A;  4TNC A;  1CDM A;  1F55 A;  4C0K A;  2Y1N A;  1XFY O;  4OVN F;  3D73 A;  4OV2 A;  2BL0 C;  2I18 A;  4N1F A;  1FI5 A;  1DJY A;  2JTZ A;  2KQY A;  2LM5 A;  1KFX S;  1ZMZ A;  2E6W A;  2LP2 A;  3BFH A;  3KEV A;  3SG7 A;  1QVI Z;  4WQ2 A;  2ISD A;  2P71 A;  3SIB A;  3VRO A;  4E68 A;  2QPT A;  1SK6 D;  1TNP A;  1WRZ A;  3C1V A;  1SL8 A;  3CGA A;  4IL1 A;  2WOR A;  5CSI A;  3TDU A;  4GFT A;  1NUB A;  1VRK A;  2PYQ A;  3GOF A;  4ETO A;  1QX5 B;  2CNP A;  4P2Y B;  4A4C A;  4F7F A;  1XVJ A;  1SR6 B;  5B8I B;  3SIA A;  2PSR A;  2RGI A;  1ZOT B;  1CMF A;  1OOI X;  3FE8 A;  2VRG A;  5HKY A;  3PM2 A;  4P5O E;  1NX2 A;  3D0Y A;  2JWW A;  3CYZ A;  1GGW A;  1EG3 A;  1TNQ A;  1A75 B;  4DIR A;  3PM8 A;  1PVB A;  2CCM A;  1F4Q A;  3EK7 A;  1FBV A;  2KBI A;  3B7A A;  4AQJ A;  2JPO A;  2JXL A;  1N0Y A;  2JU0 A;  3CAB A;  1GQM A;  1J1E A;  1XFR A;  1LS8 A;  1SR6 C;  3ZWH A;  4YGB B;  1XFU O;  1B47 A;  1QWV A;  1MXL C;  1SNL A;  4AQI A;  4U8D A;  1TUJ A;  2KI4 B;  2KLD A;  3ZNI A;  2M9G A;  1ALV A;  1WLZ A;  2EGD A;  4MSP A;  1NX1 A;  4PE7 A;  2EHB A;  1TNW A;  1KQM B;  3PSR A;  4QJ5 B;  1GGZ A;  1K90 D;  3E3R A;  1RK9 A;  3RLZ A;  1J55 A;  1PAL A;  1NSH A;  1M63 B;  1H4B A;  1Q80 A;  3KF9 A;  2EC6 C;  2FCE A;  3S0A A;  4QJ4 B;  2KPH A;  2LHL A;  1MHO A;  1TRF A;  1NPQ A;  2L0P A;  1LIN A;  3I5G B;  1E8A A;  3NHI A;  4M2O A;  4PT1 A;  3SS3 A;  1OZO A;  2M3W A;  5D69 A;  5G08 A;  2K7D A;  5IBW A;  1AJ5 A;  1T14 A;  1TOP A;  1RRO A;  3CR5 X;  1YUS A;  5F6T A;  1W9Z A;  1ZUZ A;  2H8V A;  3R72 A;  4GBA A;  3PLF B;  1S6I A;  2I2R E;  4MBE A;  1IQ5 A;  1EXR A;  3I5G C;  4XJK B;  3QME A;  4GUK A;  1BF5 A;  4YGC B;  4DS7 A;  1FI6 A;  2WOS A;  4PAL A;  3D0Y B;  2ZFD A;  5ER5 A;  1CDL A;  2M29 A;  3DF0 B;  4DCK A;  2ZN8 A;  1XO5 A;  3LCP C;  1F71 A;  1DQE A;  3NGV A;  1XYD A;  2HQ8 A;  3K21 A;  3BYA A;  3FE9 A;  4JD9 A;  2CTN A;  4KYN A;  1KSM A;  2SCP A;  4CLN A;  4F0Z B;  3R1V A;  1Y1X A;  4M2Q A;  4QJ3 B;  1REC A;  1C3Y A;  3O4X A;  2BEC A;  1YUR A;  2WCM A;  5J3X A;  2QAC A;  3EVR A;  1SW8 A;  1OQP A;  4MLW A;  2L2C A;  2PAS A;  3D76 A;  4I5L B;  1JUO A;  1DJH A;  1UUS A;  3CDN A;  3NXA A;  3TDZ A;  1S36 A;  1OZS A;  2LCP A;  2ZKM X;  4MZK A;  2OS8 C;  2KI6 C;  2LMV A;  4HRE E;  2OTG B;  2V53 A;  4WQ3 A;  1YRU B;  2MBX A;  1BOC A;  5TNC A;  1C3Z A;  4YGD B;  1IGV A;  1K9K A;  1G4Y R;  2JRF A;  3BOW A;  2H61 A;  3S0G A;  3LK0 A;  3OB2 B;  1OW4 A;  3BQ3 A;  2K60 A;  3FE6 A;  5DKR A;  3OB1 B;  3K1E A;  1KK8 B;  1N2D A;  3BFB A;  2CBL A;  2JNX A;  1GJY A;  2L5X B;  2WC8 A;  5CSF A;  1JFK A;  3A8R A;  4PE4 A;  1K95 A;  4WRI A;  4MZJ A;  2DOQ A;  1QJT A;  4YBH B;  2G9B A;  5D3O A;  1UHI A;  5FI2 A;  5DKN A;  1YRT B;  4HSZ A;  1LA0 A;  2FOT A;  1MUX A;  2QEV A;  3PN7 B;  1F8H A;  3DVJ A;  1WDC C;  1L7Z A;  2BL0 B;  2LHI A;  1KK8 C;  3CZT X;  1YVL A;  2JUL A;  1BR1 B;  2QEB A;  2PAL A;  1YX7 A;  3NHT A;  1IWQ A;  1AJ4 A;  3NSK A;  3TDI A;  2JXC A;  2JNF A;  2WCE A;  3O4Y A;  3DY9 A;  4PCW A;  2LLS A;  1F54 A;  3DD4 A;  3ICB A;  4Q04 A;  1SCV A;  3BUN B;  4MVF A;  5I94 A;  2LVK A;  1ZFS A;  2LVV A;  3S0D A;  3TS5 B;  3B88 A;  3WHT B;  3CLN A;  1JWD A;  2LMU A;  1XFV O;  1XFZ O;  1UP5 A;  3PN7 C;  4I5N B;  1WLM A;  3OBV A;  1J7Q A;  1KCY A;  1EL4 A;  1EG4 A;  2CT9 A;  2KGR A;  1K9U A;  1XFW O;  2HF5 A;  4ORA B;  4ORC B;  2JOJ A;  1EJ3 A;  1TIZ A;  1S1E A;  2BCB A;  2Y4Q A;  1JFJ A;  4YGA A;  1DT7 B;  3O6B A;  1IIO A;  3BOW B;  1SL7 A;  3TS5 C;  1QIV A;  1MF8 B;  2GGM A;  1RWY A;  2LVI A;  5CSJ A;  3HX4 A;  2BBM A;  1IQ3 A;  2BAP A;  2IS9 A;  1A2X A;  2KAV A;  1WY9 A;  3AKB A;  2BKI B;  2KDH A;  1C7V A;  2ZND A;  1KFX L;  2GV5 A;  1OOH A;  1CFP A;  1OOG A;  1DC1 A;  2AAO A;  3I5F B;  4PE0 A;  5HYD A;  1R6P A;  3OX5 A;  2NXQ A;  2H61 C;  3VB1 A;  2WCK A;  3PAL A;  1JBA A;  1TTX A;  1JF0 A;  2LLT A;  4I5J A;  3EKH A;  2EC6 B;  3PAT A;  1SRA A;  5PAL A;  1OMR A;  3N7H A;  2LC5 A;  1JC2 A;  2Q4U A;  2LUC A;  3CR2 A;  1B7T Y;  3GK4 X;  1ORG A;  2L4H A;  3I5F C;  4MN0 A;  2WCJ A;  3L47 A;  4GGN A;  3VRP A;  2M0R A;  2ZNE A;  5CSN A;  4N1G A;  1B1G A;  3D10 A;  1CM4 A;  1S6C A;  4YGE B;  3EK4 A;  5I2L A;  3CZ1 A;  4FQO A;  1NP8 A;  1F4O A;  2MLF C;  4JQ0 D;  1KSO A;  1AHR A;  2JT8 A;  3B86 A;  4GGF A;  2O5G A;  2PQL A;  5I2O A;  1QIW A;  1Y0V H;  2K0J A;  1PRW A;  1R2U A;  1J7R A;  5D7F A;  3BFA A;  1CFF A;  1Z4H A;  3S0B A;  1IKU A;  1J1D A;  1K93 D;  3M0W A;  3UNW A;  3D74 A;  1YTZ C;  1XA5 A;  2P6B B;  1SMG A;  1ZAC A;  1BMO A;  4IJ7 A;  1CNP A;  2ZRS A;  4BY5 A;  3FWB A;  1LKJ A;  4NDC A;  2Y5I A;  1DGU A;  3B6X A;  1HQV A;  2F33 A;  2QEH A;  1TCF A;  5FI7 A;  1CDN A;  4L9M A; 
#chains in the Genus database with same CATH homology
 2WC5 A;  3S0G A;  1OW4 A;  3Q8I A;  3FE6 A;  3K1E A;  3BFB A;  3D73 A;  3R1P A;  2WCL A;  4INX A;  3BFH A;  3L4A A;  2QEO A;  2P71 A;  2QEV A;  4OZD A;  3DYE A;  2QEB A;  4F7F A;  3D78 A;  2WCH A;  3NHT A;  3DY9 A;  3BJH A;  1OOI X;  2WC6 A;  3FE8 A;  3CYZ A;  3S0D A;  3B88 A;  3RZS A;  3B7A A;  3CZ0 A;  2JPO A;  3CAB A;  3V2L A;  1XFR A;  1LS8 A;  2P70 A;  1QWV A;  1TUJ A;  3R1O A;  3B87 A;  3DZT A;  1GM0 A;  1P28 A;  3S0A A;  3S0F A;  2KPH A;  1OOH A;  3CZ2 A;  3NHI A;  1OOG A;  4PT1 A;  2ERB A;  2FJY A;  3VB1 A;  2WCK A;  1T14 A;  2H8V A;  3R72 A;  3S0E A;  3L4L A;  3N7H A;  3D77 A;  3QME A;  1ORG A;  3D75 A;  2WCJ A;  3L47 A;  1OOF A;  5EL2 A;  1TWO A;  1DQE A;  3CZ1 A;  3NGV A;  2QDI A;  4INW A;  4JD9 A;  3FE9 A;  3B86 A;  3PJI A;  2PQL A;  3R1V A;  3BFA A;  3OGN A;  1C3Y A;  5DIC A;  2WCM A;  3S0B A;  4FQT A;  3D74 A;  2L2C A;  3D76 A;  3CDN A;  3DXL A;  3B6X A;  2QEH A;  1C3Z A;  2GTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...