3ZWHA

Ca2+-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with myosin iia
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ca-binding protein/motor protein
molecule keywords PROTEIN S100-A4
publication title Crystal Structure of the S100A4-Nonmuscle Myosin Iia Tail Fragment Complex Reveals an Asymmetric Target Binding Mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3zwhA00
1QIWA 3SG6A 2NZ0A 4JQ0D 4M2PA 1KWOC 1OMVA 1TRFA 1KSOA 4P2YB 1LINA 4A4BA 3PM8A 2NCOA 2O5GA 3OX6A 4MN0A 1KK8B 1Y0VH 2PASA 1WDCC 2LLTA 2H61C 2KDHA 1UURA 3AKBA 1UHHA 1JBAA 2F3ZA 2ZRSA 2JT3A 1GJYA 1K95A 3D10A 1TNXA 1FW4A 2K0JA 4A4CA 5KTYA 1RFJA 3RLZA 1CFCA 3TUYC 1J55A 1BOCA 2LVVA 4TNCA 1S1EA 1ODBA 3PFVA 1AK8A 4ZCUA 2HQWA 3SIAA 3WHUB 4ORCB 1PRWA 2I2RE 1F55A 3HX4A 4I5KA 4MRYA 2WORA 2M1KB 4IL1A 2WCFA 2KAVA 1AJ5A 1Y6WA 1NX3A 1CFPA 2KAXA 2L0PA 1M46A 1R6PA 2BE6A 2CT9A 4AOMA 1JUOA 4ORBB 1B47A 1PALA 2FCEA 2PALA 1K94A 1L7ZA 4WQ3A 1S6JA 3VRPA 5TNCA 1A75B 1BU3A 2KQ6A 2ZN9A 1DJHA 2IS9A 3QRXA 1CNPA 2I7AA 1S5GZ 2OS8B 1NIWA 1V1FA 1EG4A 1A03A 4OVNF 2M0RA 1K96A 2K7DA 3VRQA 1YUUA 3E3RA 1SYMA 3JVTC 5DKNA 2SCPA 5D7FA 1FBVA 2F33A 5HLOA 1B8LA 1K90D 4GNKB 4YGDB 1ZMZA 3WHTB 4GFTA 5G08A 1RK9A 2K8MB 5HKYA 1XFZO 1NCYA 2LANA 2M7LA 3F45A 1A75A 1OMDA 2LMUA 1DT7B 2DOQA 4NQGA 4GPLB 2LP2A 3JTDB 1CLBA 1TIZA 3LK1A 1QX7A 1G33A 1PK0D 2ZNEA 2KYFA 3K21A 4HREE 4I5JA 1UWOA 3LCPC 3BUNB 1L2OB 4I5NB 2KFGA 2EC6C 3TZ1A 3IF7A 1B4CA 1PSRA 4WQ2A 2BECA 2KFFA 2BCBA 2LLUA 4DCKA 3TDUA 1QJTA 5JJGA 1OSAA 2KGRA 1DJGA 4YGBB 2O60A 1QLKA 1KK8C 3OX5A 2GGMA 5DKRA 3BQ3A 1IH0A 1BJFA 4NDCA 3OP0A 1D1OA 1DJXA 2LLSA 1SL7A 2I94A 1C7WA 2JULA 2Y5IA 2ZN8A 4QJ3B 4YBHB 1K2HA 1A2XA 4JPZB 2EGDA 2LC5A 1V1GA 2PRUA 3IQQA 4DUQA 1F71A 5CSIA 5CSFA 4C0JA 2QPTA 4MLWA 1NUBA 1VRKA 2JXCA 2M9GA 4MZKA 2KI6C 1MHOA 1M45A 3SG2A 2P6BB 1B8RA 1KSMA 4OV2A 2LM5A 1FF1A 1Q80A 1CDMA 2M49B 3O78A 1FI5A 2BKHB 2BCXA 2LUCA 4C0KA 1ALVA 1B1GA 2MAZA 1F4QA 5I2OA 5F6TA 1CFDA 1OQPA 2LAPA 2LV7A 5B8IB 1XK4A 2LNKA 3ZWHA 1K9PA 2MA2A 1TNQA 4NDBA 5ER4X 3FWCA 1GGWA 1WY9A 3GK2A 3SG3A 4GGFA 4MZJA 2LVKA 1CDLA 3GOFA 2AUCA 1SKTA 2NXQA 1YUSA 2OS8C 1YVHA 5KSZA 1F8HA 1XFUO 2FJUB 3PSRA 3FS7A 1H4BA 2JTTA 2NCPA 2G2BA 4MEWA 5AFPA 5AANA 1N0YA 1OOJA 3SG4A 1K9UA 1IKUA 3A8RA 2Q91A 1FPWA 1IJ6A 2ZFDA 2D8NA 1QX5B 2KI6D 2MRDA 4C0LA 3OB1B 3H4SE 1MF8B 1SR6B 2AMIA 1J7RA 1NX2A 1XA5A 3WNXB 4PHKA 4PHJA 1S5GY 3JTDC 5D69A 1PVAA 3TDZA 2CCMA 1L2OC 1XVJA 5GQQC 4I5LB 1S6CA 2WNDA 1PSBA 2M7NA 1JC2A 1QTXA 1OMRA 1CM4A 1K8UA 4FTGA 3OHMB 2JU0A 2L50A 1KFXS 2WOSA 3BOWB 1SMGA 2F3YA 1J1EA 3I5IC 2K2FA 1MQ1A 1ZFSA 1WLMA 2BL0B 2OTGC 2R2IA 4CLNA 3CZTX 1UHKA 1YTZC 1SBJA 1XFVO 2B1UA 1KCYA 1SNLA 4MVFA 1QXPA 2KI4C 3I5HB 2F2PA 4HSZA 4QJ5B 4GGNA 5AXIA 2CNPA 1IQ5A 1XK4C 2WCEA 1CKKA 2NLNA 1OE9B 3KHEA 2KOTA 1J1DA 2V53A 3TDIA 2LVJA 1NWDA 3PN7C 3BOWA 4D1EA 1JFKA 4PHNA 2CBLA 4GGFC 1AHRA 1BMOA 2MLEC 2Y4QA 1M63B 1SL9A 1HT9A 5I2LA 3KPXA 4MZLA 1IRJA 2KSPA 1UUSA 1YVLA 1XFWO 1M31A 3BUMB 1NCXA 3NXAA 2JZIA 2AAOA 3TS5C 2SASA 1F70A 1MXLC 1DVIA 2JXLA 1RTP1 3CR2A 1KWOB 4FQOA 1SCMC 4PE1A 2LE9B 4MRXA 1RECA 3CR4X 2KFHA 2PMYA 3CLNA 3HCMA 1RROA 3DVMA 4CFQA 4CFRA 1MUXA 1WDCB 2L2EA 2L4HA 4HRHA 4PHMA 2FOTA 3SG7A 2BCAA 2LUXA 3LL8B 3VRRA 4N1GA 1N2DA 1DMOA 3VGOA 3FWBA 1DTLA 1WLZA 1GQMA 1CM1A 5IBWA 1KFUL 4GAOA 2MBXA 1X02A 2JQ6A 2L98A 2F8PA 1SR6C 3FIAA 4YI8A 2Y1NA 1F54A 3O4YA 3CR5X 2KBIA 4QJ4B 1Y1XA 1W7IB 2M8UA 1CB1A 1TN4A 2H2KA 3GK4X 1BLQA 1MXEA 4BY4A 1EG3A 1ALWA 1LKJA 1SCVA 2H61A 3PALA 3I5GB 4PALA 2EHBA 4E68A 1EH2A 2LHIA 1TNPA 1CLMA 2WCBA 3AKAA 3SIBA 3DVJA 2GGZA 2M3WA 2VRGA 1DJIA 1G4YR 4PE4A 1KFUS 4L9MA 4YGCB 5ER5A 1JF0A 3ZNIA 1DGVA 2JC2A 3CGAA 1J7QA 4U8DA 2BE4A 1QV0A 1QATA 4USLA 1YX7A 3EVRA 2JNFA 5AEQA 1MR8A 1CFFA 3C1VA 3OB2B 2L4IA 3BYAA 1QASA 1SRAA 3BXKA 2CXJA 2K7BA 4YI9A 1S36A 2ISDA 1TCOB 4HRGA 2KGBC 1UHNA 3NSOA 3BUWB 1QX2A 1S6IA 3AAKA 4PE0A 3CS1A 1UP5A 1XYDA 2KQYA 3MSEB 2K2AA 2JNXA 1NX0A 1OZSA 1CTRA 3CWGA 3EKHA 2E6WA 1KFXL 1A29A 2EC6B 2HETA 4UPGA 3KF9A 1IG5A 1K9KA 1KQVA 1EJ3A 5CPVA 2K7CA 4ETOA 4M2OA 1QIVA 1YR5A 1S3PA 1CLLA 2KBMA 3I5FB 1CMGA 4OR9B 3NSKA 1IJ5A 2QACA 4OCIA 4DRWA 1A4PA 4MSPA 1OZOA 1AJ4A 1QVIZ 2ZKMX 4ORAB 4PE7A 1DJWA 1U5IB 1KQMB 1EL4A 4PCWA 4PDZA 1YURA 3LLEA 1LA0A 1DJZA 4XYNA 1W7JB 1B9AA 2LHLA 1RWYA 5JOLA 1SK6D 1K93D 1SW8A 2BBNA 1WRKA 4DS7A 2HQ8A 1H8BA 3SG5A 3BUXB 3SJSA 2ZNDA 2LVIA 1ZUZA 3KO0A 3EK4A 2OPOA 1IGVA 1C07A 1U5IA 1XFXO 3PLFB 4F0ZB 1GGZA 4M2QA 3I5GC 1NP8A 1TNWA 4WRIA 1AVSA 1XFYO 1QS7A 2I18A 1BR4B 1CDPA 4XJKB 5CSJA 5J3XA 5HKZA 1BT6A 1NPQA 3DVKA 1YRUB 1ZACA 1C7VA 2FCDA 1J7OA 5HLVA 2WC8A 2KAYA 5I8NA 4NDDA 5I2QA 1IQ3A 3DVEA 1QLSA 2BBMA 4DIRA 5FYXA 1M39A 1HQVA 1N65A 2JT8A 4YGEB 2Y1MA 1DF0B 1SY9A 3A4UB 1CDNA 1WRLA 1PVBA 3RM1A 1UHJA 1DJYA 4XJKA 1NCZA 3AAJA 2A4JA 2JRFA 3ICBA 4MBEA 4YGAA 1CMFA 2Q4UA 1NYAA 3D0YB 1LVCD 1LXFC 1BF5A 4YRUA 1JF2A 3DD4A 4BY5A 2CTNA 4ZCVA 4P5OE 5CSNA 3VROA 1YX8A 2K7OA 2E30A 3TUYB 2COLB 1DF0A 2JPTA 1EXRA 1IWQA 4GUKA 5KU1A 1BODA 2HPSA 3PATA 1B7TY 1AUIB 1SPYA 1TCFA 3WXAA 3O2PA 1BG1A 1G8IA 4R1EA 3LK0A 1JFJA 1JWDA 3I5FC 3D0YA 4OKHA 1E8AA 1ZOTB 3CTNA 2G9BA 4N5XA 2JOJA 3I5IB 1R2UA 3KEVA 1NX1A 2M1UA 3EK7A 1WRZA 2KYCA 3NSIA 1YUTA 1KK7Y 2OTGB 5K89A 1KQMC 1NSHA 1RJVA 4N1FA 4GBAA 2F2OA 5PALA 1S26D 2KI4B 2LMTA 5DKQA 5HYDA 2KNEA 3O6BA 3IQOA 1YRTB 4CIDA 2MLFC 1JSAA 2LP3A 2BL0C 1SL8A 1UHIA 1BR1B 3EK8A 1J7PA 2LMVA 2ZRTA 3PN7B 2MHHA 3JVTB 2KHNA 3I5HC 1PULA 4CPVA 2JTZA 2LCPA 3NSLA 1B7TZ 2BKIB 3EVVA 1F4OA 3DF0B 2PSRA 2TN4A 3EKJA 1QVIY 5HKWA 4ICBA 2MJWB 1TOPA 2RGIA 4AQIA 2M29A 2M97A 2HF5A 2JWWA 2L5XB 4Q04A 3TS5B 1KK7Z 1MWNA 3VRNA 1DGUA 5BPJA 3GK1A 1AP4A 2L51A 1TTXA 1QV1A 1LA3A 2K61A 1SCMB 1Y1UA 2GV5A 3EVUA 2JT0A 4JWQA 4AQJA 1XO5A 1FI6A 5AERA 2PVBA 3BUOB 1B8CA 3DF0A 3M0WA 1Y1AA
chains in the Genus database with same CATH superfamily
1QIWA 3SG6A 2NZ0A 4JQ0D 4M2PA 1KWOC 1OMVA 1TRFA 1KSOA 5DICA 3FE8A 4P2YB 1LINA 4A4BA 3PM8A 2NCOA 2O5GA 3OX6A 4MN0A 1KK8B 1OW4A 3S0AA 3SS5A 1Y0VH 2PASA 1WDCC 2LLTA 2WCJA 1C3YA 2H61C 2KDHA 4INXA 1UURA 3AKBA 1UHHA 1JBAA 2F3ZA 2ZRSA 2JT3A 1GJYA 1K95A 3D10A 1TNXA 1FW4A 2K0JA 4A4CA 5KTYA 1RFJA 3RLZA 2WCHA 3TUYC 1J55A 1TUZA 2LVVA 3NHIA 1OOGA 1S1EA 4TNCA 1BOCA 1ODBA 3PFVA 1AK8A 1OOIX 4ZCUA 2HQWA 3SIAA 3WHUB 4ORCB 1PRWA 2I2RE 1F55A 3HX4A 2JPOA 4I5KA 4MRYA 2WORA 2M1KB 4IL1A 2WCFA 3CZ2A 2KAVA 1AJ5A 1Y6WA 1NX3A 1CFPA 2KAXA 2L0PA 1M46A 1R6PA 2BE6A 2CT9A 4AOMA 1JUOA 4ORBB 1B47A 1PALA 2FCEA 2PALA 1K94A 1L7ZA 4WQ3A 1S6JA 1LS8A 3VRPA 5TNCA 1A75B 1BU3A 2KQ6A 2ZN9A 1DJHA 2IS9A 3QRXA 1CNPA 2I7AA 1S5GZ 2OS8B 1NIWA 1V1FA 1EG4A 1A03A 4OVNF 2M0RA 1K96A 2K7DA 3VRQA 1YUUA 3E3RA 1SYMA 3FE6A 3JVTC 5DKNA 1ORGA 2SCPA 5D7FA 1FBVA 2F33A 5HLOA 3D78A 3K1EA 1B8LA 1K90D 4GNKB 4YGDB 1ZMZA 3WHTB 4GFTA 5G08A 1RK9A 2K8MB 5HKYA 1XFZO 3RZSA 1NCYA 2LANA 2M7LA 5FI6A 3F45A 1A75A 1OMDA 2LMUA 1DT7B 2DOQA 4NQGA 3BJHA 4GPLB 2LP2A 3CYZA 3R1PA 3JTDB 1CLBA 1TIZA 3LK1A 1QX7A 1G33A 1PK0D 2ZNEA 2KYFA 3K21A 4HREE 4I5JA 1UWOA 2WCLA 3BUNB 1L2OB 3EG5B 2KFGA 2EC6C 3LCPC 4I5NB 3IF7A 1B4CA 2KPHA 1P28A 1PSRA 4WQ2A 2BECA 2KFFA 2WCMA 2BCBA 2LLUA 4DCKA 3TDUA 1QJTA 5JJGA 2WC6A 1OSAA 2KGRA 1DJGA 4YGBB 2O60A 3BFBA 1QLKA 1KK8C 2FJYA 1GM0A 3OX5A 2GGMA 5DKRA 3BQ3A 1IH0A 1BJFA 2H8VA 4NDCA 3OP0A 1D1OA 1DJXA 2LLSA 3FE9A 1SL7A 2I94A 1C7WA 2JULA 2Y5IA 2ZN8A 4QJ3B 3R72A 4YBHB 1K2HA 1A2XA 4JPZB 1CFCA 2EGDA 2LC5A 1V1GA 2PRUA 3IQQA 3TZ1A 4DUQA 1F71A 5CSIA 5CSFA 2P71A 2QPTA 4MLWA 1NUBA 4C0JA 1VRKA 2JXCA 2M9GA 4MZKA 2KI6C 1MHOA 4OZDA 3R1VA 1M45A 3SG2A 2P6BB 1B8RA 1KSMA 4OV2A 2LM5A 1FF1A 1Q80A 1CDMA 2M49B 3O78A 3S0BA 1FI5A 2BKHB 3QMEA 2BCXA 3PJIA 2LUCA 3OGNA 1ALVA 4C0KA 1B1GA 2MAZA 1F4QA 5I2OA 5F6TA 2BAPA 1CFDA 1OQPA 2LAPA 2LV7A 3B86A 1XK4A 2LNKA 5B8IB 3DZTA 1K9PA 3ZWHA 2MA2A 1TNQA 4NDBA 5ER4X 2WCKA 3FWCA 1GGWA 1WY9A 3GK2A 3SG3A 4GGFA 4MZJA 5D3OA 2LVKA 1CDLA 3GOFA 2AUCA 1SKTA 2NXQA 1YUSA 2OS8C 1YVHA 5KSZA 1F8HA 1XFUO 2FJUB 3PSRA 3FS7A 3UO9A 2JTTA 2NCPA 1H4BA 2G2BA 4MEWA 5AFPA 3B87A 3SS4A 5AANA 1N0YA 2YGUA 1OOJA 3SG4A 1K9UA 1IKUA 3A8RA 2Q91A 3L4AA 1FPWA 1IJ6A 2ZFDA 2D8NA 1QX5B 2KI6D 2MRDA 4C0LA 3OB1B 3H4SE 1MF8B 3S0GA 1SR6B 2AMIA 3SS3A 1J7RA 1NX2A 1XA5A 3WNXB 4PHKA 3S0EA 4PHJA 1S5GY 2QEHA 3JTDC 5D69A 1PVAA 3TDZA 2CCMA 1L2OC 1XVJA 5GQQC 4I5LB 1S6CA 2WNDA 2PYQA 1PSBA 2M7NA 1JC2A 1QTXA 1OMRA 1CM4A 5EL2A 1K8UA 4FTGA 3OHMB 2JU0A 2L50A 1KFXS 2WOSA 3BOWB 1SMGA 2F3YA 1J1EA 3R1OA 3I5IC 2K2FA 1MQ1A 1ZFSA 1WLMA 3OBVA 1IIOA 2BL0B 2OTGC 2R2IA 4CLNA 3CZTX 1UHKA 1YTZC 1SBJA 1XFVO 2B1UA 2QDIA 1KCYA 1SNLA 4MVFA 1QXPA 2KI4C 3I5HB 2F2PA 4HSZA 4QJ5B 4GGNA 5AXIA 2CNPA 1IQ5A 1XK4C 2WCEA 1DQEA 1CKKA 2NLNA 1OE9B 3KHEA 2KOTA 1J1DA 2V53A 3TDIA 2LVJA 1NWDA 3PN7C 3BOWA 4D1EA 1JFKA 4PHNA 2CBLA 4GGFC 1AHRA 1BMOA 2MLEC 2Y4QA 3V2LA 1M63B 1SL9A 1HT9A 5I2LA 2P70A 3KPXA 4MZLA 1IRJA 2KSPA 1UUSA 1YVLA 1XFWO 1M31A 3BUMB 1NCXA 3NXAA 2JZIA 2AAOA 3TS5C 2SASA 3CABA 3CZ0A 1F70A 1MXLC 1DVIA 2JXLA 1RTP1 3CR2A 1KWOB 4FQOA 1SCMC 4PE1A 2LE9B 4MRXA 1RECA 3CR4X 2KFHA 4PT1A 2PMYA 3CLNA 3HCMA 3D73A 1RROA 3DVMA 5FI7A 4CFQA 4CFRA 1MUXA 1WDCB 2L2EA 2L4HA 4HRHA 4PHMA 2FOTA 3SG7A 2BCAA 3IVTA 2PQLA 2LUXA 3LL8B 3VRRA 4N1GA 1N2DA 1DMOA 3VGOA 3FWBA 1DTLA 1WLZA 1GQMA 1CM1A 4KYNA 5IBWA 1KFUL 4GAOA 2MBXA 1X02A 2JQ6A 2L98A 2F8PA 1SR6C 3FIAA 4YI8A 2Y1NA 1F54A 3O4YA 3CR5X 2KLEA 2KBIA 1DC1A 4QJ4B 1Y1XA 1W7IB 2M8UA 1CB1A 1T14A 3D75A 1TN4A 2H2KA 3GK4X 3BFAA 1BLQA 1Z2CB 1MXEA 1DELA 4BY4A 1EG3A 1ALWA 1LKJA 1SCVA 1TWOA 2H61A 3PALA 3S0FA 3I5GB 4PALA 2EHBA 4E68A 1EH2A 2LHIA 1TNPA 1CLMA 2WCBA 3AKAA 3SIBA 3DVJA 2GGZA 2M3WA 2VRGA 1DJIA 1G4YR 4JD9A 4PE4A 1KFUS 4L9MA 4YGCB 5ER5A 1JF0A 3VB1A 3ZNIA 1DGVA 2JC2A 3CGAA 1J7QA 4U8DA 2BE4A 1QV0A 1QATA 4USLA 1YX7A 3EVRA 2JNFA 5AEQA 1MR8A 1CFFA 3C1VA 3L47A 3D77A 3OB2B 2L4IA 3BYAA 1QASA 1SRAA 3BXKA 2CXJA 2K7BA 4YI9A 1S36A 2ISDA 1TCOB 4HRGA 3S0DA 2KGBC 1UHNA 3NSOA 3BUWB 1QX2A 1S6IA 3AAKA 4PE0A 3CS1A 1UP5A 1XYDA 2KQYA 3MSEB 3D76A 2K2AA 2JNXA 1NX0A 1OZSA 1CTRA 3CWGA 3EKHA 2E6WA 2KLDA 1KFXL 1A29A 2EC6B 3DYEA 2HETA 4UPGA 3KF9A 1IG5A 1K9KA 1KQVA 1EJ3A 5CPVA 2K7CA 4ETOA 4M2OA 1QIVA 1YR5A 1S3PA 1CLLA 2KBMA 3I5FB 1CMGA 4OR9B 3NSKA 1IJ5A 2QACA 4OCIA 2L5YA 3NHTA 4DRWA 1A4PA 4MSPA 1OZOA 1AJ4A 1QVIZ 2ZKMX 4ORAB 4PE7A 1DJWA 1U5IB 1KQMB 1EL4A 4PCWA 4PDZA 1YURA 3LLEA 1LA0A 1DJZA 4XYNA 1W7JB 1B9AA 2LHLA 1RWYA 5JOLA 1SK6D 3O4XA 2BNXA 1K93D 1SW8A 2BBNA 1WRKA 1DEKA 4DS7A 2HQ8A 1H8BA 3SG5A 3BUXB 3SJSA 2ZNDA 2LVIA 1ZUZA 3KO0A 3EK4A 5HL1A 2OPOA 1IGVA 1C07A 1U5IA 1XFXO 3PLFB 4F0ZB 1GGZA 2WC5A 4M2QA 3L4LA 5I94A 3I5GC 1NP8A 1TNWA 4WRIA 1AVSA 1XFYO 1QS7A 2I18A 1BR4B 1CDPA 4XJKB 5CSJA 5J3XA 5HKZA 1BT6A 1NPQA 2GTEA 1YRUB 1ZACA 3B7AA 3DVKA 2FCDA 1C7VA 1J7OA 5HLVA 2WC8A 1SSEB 2KAYA 3N7HA 5I8NA 3B88A 4NDDA 5I2QA 1IQ3A 3DVEA 1QLSA 2BBMA 4DIRA 1QWVA 5FYXA 1M39A 1HQVA 1N65A 3CDNA 2JT8A 4YGEB 1Z4HA 2Y1MA 1DF0B 1SY9A 3A4UB 1CDNA 1WRLA 1PVBA 3RM1A 1UHJA 1DJYA 4XJKA 1NCZA 3AAJA 2A4JA 2JRFA 3ICBA 4MBEA 4YGAA 1CMFA 2Q4UA 1NYAA 3D0YB 1LVCD 1LXFC 1BF5A 4YRUA 1JF2A 3DD4A 1XFRA 4BY5A 2CTNA 4ZCVA 4P5OE 5CSNA 2QEBA 3VROA 1YX8A 2K7OA 3DY9A 4IJ7A 2E30A 3TUYB 1OOHA 2COLB 1DF0A 2JPTA 1EXRA 1IWQA 4GUKA 5KU1A 1BODA 2HPSA 3PATA 1B7TY 1AUIB 4FQTA 1SPYA 1TCFA 3WXAA 3O2PA 1BG1A 1G8IA 2QEVA 4R1EA 2QEOA 3LK0A 4F7FA 1JFJA 1JWDA 3I5FC 3CZ1A 3D0YA 4OKHA 1W9ZA 1E8AA 1ZOTB 3CTNA 2G9BA 4N5XA 2JOJA 3I5IB 1R2UA 3D74A 3KEVA 1NX1A 2M1UA 3EK7A 1WRZA 2KYCA 3NSIA 1YUTA 1KK7Y 2OTGB 5K89A 1KQMC 1NSHA 1RJVA 4N1FA 4GBAA 2F2OA 5PALA 1S26D 2KI4B 2LMTA 5DKQA 5HYDA 2KNEA 3O6BA 1TUJA 3IQOA 1YRTB 4CIDA 2MLFC 1JSAA 2LP3A 2BL0C 1SL8A 1UHIA 3Q8IA 1BR1B 3EK8A 1J7PA 2LMVA 4JKTA 2ZRTA 3PN7B 2MHHA 3BFHA 3JVTB 2KHNA 3I5HC 1PULA 4CPVA 3PM2A 2JTZA 2LCPA 2ERBA 3UNWA 3NSLA 1B7TZ 2BKIB 3EVVA 1F4OA 3DF0B 2PSRA 2TN4A 3EKJA 1QVIY 5HKWA 4ICBA 2MJWB 3NGVA 1TOPA 2RGIA 1OOFA 2K60A 2M29A 4INWA 4AQIA 2M97A 2HF5A 2JWWA 2L2CA 2L5XB 4Q04A 3TS5B 1KK7Z 1MWNA 5FI2A 3VRNA 1DGUA 3DXLA 3GK1A 5BPJA 1AP4A 2L51A 1C3ZA 1TTXA 1QV1A 3B6XA 1LA3A 2K61A 1SCMB 1Y1UA 2GV5A 3EVUA 2JT0A 4JWQA 4AQJA 1XO5A 1FI6A 5AERA 2PVBA 3BUOB 1B8CA 3DF0A 3M0WA 1Y1AA
chains in the Genus database with same CATH topology
1QIWA 3SG6A 2NZ0A 4JQ0D 4M2PA 1KWOC 1OMVA 1TRFA 1KSOA 4P2YB 1LINA 4A4BA 3PM8A 2NCOA 2O5GA 3OX6A 4MN0A 1KK8B 1Y0VH 2PASA 1WDCC 2LLTA 2H61C 2KDHA 1UURA 3AKBA 1UHHA 1JBAA 2F3ZA 2ZRSA 2JT3A 1GJYA 1K95A 3D10A 1TNXA 1FW4A 2K0JA 4A4CA 5KTYA 1RFJA 3RLZA 1CFCA 3TUYC 1J55A 1BOCA 2LVVA 4TNCA 1S1EA 1ODBA 3PFVA 1AK8A 4ZCUA 2HQWA 3SIAA 3WHUB 4ORCB 1PRWA 2I2RE 1F55A 3HX4A 4I5KA 4MRYA 2WORA 2M1KB 4IL1A 2WCFA 2KAVA 1AJ5A 1Y6WA 1NX3A 1CFPA 2KAXA 2L0PA 1M46A 1R6PA 2BE6A 2CT9A 4AOMA 1JUOA 4ORBB 1B47A 1PALA 2FCEA 2PALA 1K94A 1L7ZA 4WQ3A 1S6JA 3VRPA 5TNCA 1A75B 1BU3A 2KQ6A 2ZN9A 1DJHA 2IS9A 3QRXA 1CNPA 2I7AA 1S5GZ 2OS8B 1NIWA 1V1FA 1EG4A 1A03A 4OVNF 2M0RA 1K96A 2K7DA 3VRQA 1YUUA 3E3RA 1SYMA 3JVTC 5DKNA 2SCPA 5D7FA 1FBVA 2F33A 5HLOA 1B8LA 1K90D 4GNKB 4YGDB 1ZMZA 3WHTB 4GFTA 5G08A 1RK9A 2K8MB 5HKYA 1XFZO 1NCYA 2LANA 2M7LA 3F45A 1A75A 1OMDA 2LMUA 1DT7B 2DOQA 4NQGA 4GPLB 2LP2A 3JTDB 1CLBA 1TIZA 3LK1A 1QX7A 1G33A 1PK0D 2ZNEA 2KYFA 3K21A 4HREE 4I5JA 1UWOA 3LCPC 3BUNB 1L2OB 4I5NB 2KFGA 2EC6C 3TZ1A 3IF7A 1B4CA 1PSRA 4WQ2A 2BECA 2KFFA 2BCBA 2LLUA 4DCKA 3TDUA 1QJTA 5JJGA 1OSAA 2KGRA 1DJGA 4YGBB 2O60A 1QLKA 1KK8C 3OX5A 2GGMA 5DKRA 3BQ3A 1IH0A 1BJFA 4NDCA 3OP0A 1D1OA 1DJXA 2LLSA 1SL7A 2I94A 1C7WA 2JULA 2Y5IA 2ZN8A 4QJ3B 4YBHB 1K2HA 1A2XA 4JPZB 2EGDA 2LC5A 1V1GA 2PRUA 3IQQA 4DUQA 1F71A 5CSIA 5CSFA 4C0JA 2QPTA 4MLWA 1NUBA 1VRKA 2JXCA 2M9GA 4MZKA 2KI6C 1MHOA 1M45A 3SG2A 2P6BB 1B8RA 1KSMA 4OV2A 2LM5A 1FF1A 1Q80A 1CDMA 2M49B 3O78A 1FI5A 2BKHB 2BCXA 2LUCA 4C0KA 1ALVA 1B1GA 2MAZA 1F4QA 5I2OA 5F6TA 1CFDA 1OQPA 2LAPA 2LV7A 5B8IB 1XK4A 2LNKA 3ZWHA 1K9PA 2MA2A 1TNQA 4NDBA 5ER4X 3FWCA 1GGWA 1WY9A 3GK2A 3SG3A 4GGFA 4MZJA 2LVKA 1CDLA 3GOFA 2AUCA 1SKTA 2NXQA 1YUSA 2OS8C 1YVHA 5KSZA 1F8HA 1XFUO 2FJUB 3PSRA 3FS7A 1H4BA 2JTTA 2NCPA 2G2BA 4MEWA 5AFPA 5AANA 1N0YA 1OOJA 3SG4A 1K9UA 1IKUA 3A8RA 2Q91A 1FPWA 1IJ6A 2ZFDA 2D8NA 1QX5B 2KI6D 2MRDA 4C0LA 3OB1B 3H4SE 1MF8B 1SR6B 2AMIA 1J7RA 1NX2A 1XA5A 3WNXB 4PHKA 4PHJA 1S5GY 3JTDC 5D69A 1PVAA 3TDZA 2CCMA 1L2OC 1XVJA 5GQQC 4I5LB 1S6CA 2WNDA 1PSBA 2M7NA 1JC2A 1QTXA 1OMRA 1CM4A 1K8UA 4FTGA 3OHMB 2JU0A 2L50A 1KFXS 2WOSA 3BOWB 1SMGA 2F3YA 1J1EA 3I5IC 2K2FA 1MQ1A 1ZFSA 1WLMA 2BL0B 2OTGC 2R2IA 4CLNA 3CZTX 1UHKA 1YTZC 1SBJA 1XFVO 2B1UA 1KCYA 1SNLA 4MVFA 1QXPA 2KI4C 3I5HB 2F2PA 4HSZA 4QJ5B 4GGNA 5AXIA 2CNPA 1IQ5A 1XK4C 2WCEA 1CKKA 2NLNA 1OE9B 3KHEA 2KOTA 1J1DA 2V53A 3TDIA 2LVJA 1NWDA 3PN7C 3BOWA 4D1EA 1JFKA 4PHNA 2CBLA 4GGFC 1AHRA 1BMOA 2MLEC 2Y4QA 1M63B 1SL9A 1HT9A 5I2LA 3KPXA 4MZLA 1IRJA 2KSPA 1UUSA 1YVLA 1XFWO 1M31A 3BUMB 1NCXA 3NXAA 2JZIA 2AAOA 3TS5C 2SASA 1F70A 1MXLC 1DVIA 2JXLA 1RTP1 3CR2A 1KWOB 4FQOA 1SCMC 4PE1A 2LE9B 4MRXA 1RECA 3CR4X 2KFHA 2PMYA 3CLNA 3HCMA 1RROA 3DVMA 4CFQA 4CFRA 1MUXA 1WDCB 2L2EA 2L4HA 4HRHA 4PHMA 2FOTA 3SG7A 2BCAA 2LUXA 3LL8B 3VRRA 4N1GA 1N2DA 1DMOA 3VGOA 3FWBA 1DTLA 1WLZA 1GQMA 1CM1A 5IBWA 1KFUL 4GAOA 2MBXA 1X02A 2JQ6A 2L98A 2F8PA 1SR6C 3FIAA 4YI8A 2Y1NA 1F54A 3O4YA 3CR5X 2KBIA 4QJ4B 1Y1XA 1W7IB 2M8UA 1CB1A 1TN4A 2H2KA 3GK4X 1BLQA 1MXEA 4BY4A 1EG3A 1ALWA 1LKJA 1SCVA 2H61A 3PALA 3I5GB 4PALA 2EHBA 4E68A 1EH2A 2LHIA 1TNPA 1CLMA 2WCBA 3AKAA 3SIBA 3DVJA 2GGZA 2M3WA 2VRGA 1DJIA 1G4YR 4PE4A 1KFUS 4L9MA 4YGCB 5ER5A 1JF0A 3ZNIA 1DGVA 2JC2A 3CGAA 1J7QA 4U8DA 2BE4A 1QV0A 1QATA 4USLA 1YX7A 3EVRA 2JNFA 5AEQA 1MR8A 1CFFA 3C1VA 3OB2B 2L4IA 3BYAA 1QASA 1SRAA 3BXKA 2CXJA 2K7BA 4YI9A 1S36A 2ISDA 1TCOB 4HRGA 2KGBC 1UHNA 3NSOA 3BUWB 1QX2A 1S6IA 3AAKA 4PE0A 3CS1A 1UP5A 1XYDA 2KQYA 3MSEB 2K2AA 2JNXA 1NX0A 1OZSA 1CTRA 3CWGA 3EKHA 2E6WA 1KFXL 1A29A 2EC6B 2HETA 4UPGA 3KF9A 1IG5A 1K9KA 1KQVA 1EJ3A 5CPVA 2K7CA 4ETOA 4M2OA 1QIVA 1YR5A 1S3PA 1CLLA 2KBMA 3I5FB 1CMGA 4OR9B 3NSKA 1IJ5A 2QACA 4OCIA 4DRWA 1A4PA 4MSPA 1OZOA 1AJ4A 1QVIZ 2ZKMX 4ORAB 4PE7A 1DJWA 1U5IB 1KQMB 1EL4A 4PCWA 4PDZA 1YURA 3LLEA 1LA0A 1DJZA 4XYNA 1W7JB 1B9AA 2LHLA 1RWYA 5JOLA 1SK6D 1K93D 1SW8A 2BBNA 1WRKA 4DS7A 2HQ8A 1H8BA 3SG5A 3BUXB 3SJSA 2ZNDA 2LVIA 1ZUZA 3KO0A 3EK4A 2OPOA 1IGVA 1C07A 1U5IA 1XFXO 3PLFB 4F0ZB 1GGZA 4M2QA 3I5GC 1NP8A 1TNWA 4WRIA 1AVSA 1XFYO 1QS7A 2I18A 1BR4B 1CDPA 4XJKB 5CSJA 5J3XA 5HKZA 1BT6A 1NPQA 3DVKA 1YRUB 1ZACA 1C7VA 2FCDA 1J7OA 5HLVA 2WC8A 2KAYA 5I8NA 4NDDA 5I2QA 1IQ3A 3DVEA 1QLSA 2BBMA 4DIRA 5FYXA 1M39A 1HQVA 1N65A 2JT8A 4YGEB 2Y1MA 1DF0B 1SY9A 3A4UB 1CDNA 1WRLA 1PVBA 3RM1A 1UHJA 1DJYA 4XJKA 1NCZA 3AAJA 2A4JA 2JRFA 3ICBA 4MBEA 4YGAA 1CMFA 2Q4UA 1NYAA 3D0YB 1LVCD 1LXFC 1BF5A 4YRUA 1JF2A 3DD4A 4BY5A 2CTNA 4ZCVA 4P5OE 5CSNA 3VROA 1YX8A 2K7OA 2E30A 3TUYB 2COLB 1DF0A 2JPTA 1EXRA 1IWQA 4GUKA 5KU1A 1BODA 2HPSA 3PATA 1B7TY 1AUIB 1SPYA 1TCFA 3WXAA 3O2PA 1BG1A 1G8IA 4R1EA 3LK0A 1JFJA 1JWDA 3I5FC 3D0YA 4OKHA 1E8AA 1ZOTB 3CTNA 2G9BA 4N5XA 2JOJA 3I5IB 1R2UA 3KEVA 1NX1A 2M1UA 3EK7A 1WRZA 2KYCA 3NSIA 1YUTA 1KK7Y 2OTGB 5K89A 1KQMC 1NSHA 1RJVA 4N1FA 4GBAA 2F2OA 5PALA 1S26D 2KI4B 2LMTA 5DKQA 5HYDA 2KNEA 3O6BA 3IQOA 1YRTB 4CIDA 2MLFC 1JSAA 2LP3A 2BL0C 1SL8A 1UHIA 1BR1B 3EK8A 1J7PA 2LMVA 2ZRTA 3PN7B 2MHHA 3JVTB 2KHNA 3I5HC 1PULA 4CPVA 2JTZA 2LCPA 3NSLA 1B7TZ 2BKIB 3EVVA 1F4OA 3DF0B 2PSRA 2TN4A 3EKJA 1QVIY 5HKWA 4ICBA 2MJWB 1TOPA 2RGIA 4AQIA 2M29A 2M97A 2HF5A 2JWWA 2L5XB 4Q04A 3TS5B 1KK7Z 1MWNA 3VRNA 1DGUA 5BPJA 3GK1A 1AP4A 2L51A 1TTXA 1QV1A 1LA3A 2K61A 1SCMB 1Y1UA 2GV5A 3EVUA 2JT0A 4JWQA 4AQJA 1XO5A 1FI6A 5AERA 2PVBA 3BUOB 1B8CA 3DF0A 3M0WA 1Y1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QIW A;  3SG6 A;  2NZ0 A;  4JQ0 D;  4M2P A;  1KWO C;  1OMV A;  1TRF A;  1KSO A;  4P2Y B;  1LIN A;  4A4B A;  3PM8 A;  2NCO A;  2O5G A;  3OX6 A;  4MN0 A;  1KK8 B;  1Y0V H;  2PAS A;  1WDC C;  2LLT A;  2H61 C;  2KDH A;  1UUR A;  3AKB A;  1UHH A;  1JBA A;  2F3Z A;  2ZRS A;  2JT3 A;  1GJY A;  1K95 A;  3D10 A;  1TNX A;  1FW4 A;  2K0J A;  4A4C A;  5KTY A;  1RFJ A;  3RLZ A;  1CFC A;  3TUY C;  1J55 A;  1BOC A;  2LVV A;  4TNC A;  1S1E A;  1ODB A;  3PFV A;  1AK8 A;  4ZCU A;  2HQW A;  3SIA A;  3WHU B;  4ORC B;  1PRW A;  2I2R E;  1F55 A;  3HX4 A;  4I5K A;  4MRY A;  2WOR A;  2M1K B;  4IL1 A;  2WCF A;  2KAV A;  1AJ5 A;  1Y6W A;  1NX3 A;  1CFP A;  2KAX A;  2L0P A;  1M46 A;  1R6P A;  2BE6 A;  2CT9 A;  4AOM A;  1JUO A;  4ORB B;  1B47 A;  1PAL A;  2FCE A;  2PAL A;  1K94 A;  1L7Z A;  4WQ3 A;  1S6J A;  3VRP A;  5TNC A;  1A75 B;  1BU3 A;  2KQ6 A;  2ZN9 A;  1DJH A;  2IS9 A;  3QRX A;  1CNP A;  2I7A A;  1S5G Z;  2OS8 B;  1NIW A;  1V1F A;  1EG4 A;  1A03 A;  4OVN F;  2M0R A;  1K96 A;  2K7D A;  3VRQ A;  1YUU A;  3E3R A;  1SYM A;  3JVT C;  5DKN A;  2SCP A;  5D7F A;  1FBV A;  2F33 A;  5HLO A;  1B8L A;  1K90 D;  4GNK B;  4YGD B;  1ZMZ A;  3WHT B;  4GFT A;  5G08 A;  1RK9 A;  2K8M B;  5HKY A;  1XFZ O;  1NCY A;  2LAN A;  2M7L A;  3F45 A;  1A75 A;  1OMD A;  2LMU A;  1DT7 B;  2DOQ A;  4NQG A;  4GPL B;  2LP2 A;  3JTD B;  1CLB A;  1TIZ A;  3LK1 A;  1QX7 A;  1G33 A;  1PK0 D;  2ZNE A;  2KYF A;  3K21 A;  4HRE E;  4I5J A;  1UWO A;  3LCP C;  3BUN B;  1L2O B;  4I5N B;  2KFG A;  2EC6 C;  3TZ1 A;  3IF7 A;  1B4C A;  1PSR A;  4WQ2 A;  2BEC A;  2KFF A;  2BCB A;  2LLU A;  4DCK A;  3TDU A;  1QJT A;  5JJG A;  1OSA A;  2KGR A;  1DJG A;  4YGB B;  2O60 A;  1QLK A;  1KK8 C;  3OX5 A;  2GGM A;  5DKR A;  3BQ3 A;  1IH0 A;  1BJF A;  4NDC A;  3OP0 A;  1D1O A;  1DJX A;  2LLS A;  1SL7 A;  2I94 A;  1C7W A;  2JUL A;  2Y5I A;  2ZN8 A;  4QJ3 B;  4YBH B;  1K2H A;  1A2X A;  4JPZ B;  2EGD A;  2LC5 A;  1V1G A;  2PRU A;  3IQQ A;  4DUQ A;  1F71 A;  5CSI A;  5CSF A;  4C0J A;  2QPT A;  4MLW A;  1NUB A;  1VRK A;  2JXC A;  2M9G A;  4MZK A;  2KI6 C;  1MHO A;  1M45 A;  3SG2 A;  2P6B B;  1B8R A;  1KSM A;  4OV2 A;  2LM5 A;  1FF1 A;  1Q80 A;  1CDM A;  2M49 B;  3O78 A;  1FI5 A;  2BKH B;  2BCX A;  2LUC A;  4C0K A;  1ALV A;  1B1G A;  2MAZ A;  1F4Q A;  5I2O A;  5F6T A;  1CFD A;  1OQP A;  2LAP A;  2LV7 A;  5B8I B;  1XK4 A;  2LNK A;  3ZWH A;  1K9P A;  2MA2 A;  1TNQ A;  4NDB A;  5ER4 X;  3FWC A;  1GGW A;  1WY9 A;  3GK2 A;  3SG3 A;  4GGF A;  4MZJ A;  2LVK A;  1CDL A;  3GOF A;  2AUC A;  1SKT A;  2NXQ A;  1YUS A;  2OS8 C;  1YVH A;  5KSZ A;  1F8H A;  1XFU O;  2FJU B;  3PSR A;  3FS7 A;  1H4B A;  2JTT A;  2NCP A;  2G2B A;  4MEW A;  5AFP A;  5AAN A;  1N0Y A;  1OOJ A;  3SG4 A;  1K9U A;  1IKU A;  3A8R A;  2Q91 A;  1FPW A;  1IJ6 A;  2ZFD A;  2D8N A;  1QX5 B;  2KI6 D;  2MRD A;  4C0L A;  3OB1 B;  3H4S E;  1MF8 B;  1SR6 B;  2AMI A;  1J7R A;  1NX2 A;  1XA5 A;  3WNX B;  4PHK A;  4PHJ A;  1S5G Y;  3JTD C;  5D69 A;  1PVA A;  3TDZ A;  2CCM A;  1L2O C;  1XVJ A;  5GQQ C;  4I5L B;  1S6C A;  2WND A;  1PSB A;  2M7N A;  1JC2 A;  1QTX A;  1OMR A;  1CM4 A;  1K8U A;  4FTG A;  3OHM B;  2JU0 A;  2L50 A;  1KFX S;  2WOS A;  3BOW B;  1SMG A;  2F3Y A;  1J1E A;  3I5I C;  2K2F A;  1MQ1 A;  1ZFS A;  1WLM A;  2BL0 B;  2OTG C;  2R2I A;  4CLN A;  3CZT X;  1UHK A;  1YTZ C;  1SBJ A;  1XFV O;  2B1U A;  1KCY A;  1SNL A;  4MVF A;  1QXP A;  2KI4 C;  3I5H B;  2F2P A;  4HSZ A;  4QJ5 B;  4GGN A;  5AXI A;  2CNP A;  1IQ5 A;  1XK4 C;  2WCE A;  1CKK A;  2NLN A;  1OE9 B;  3KHE A;  2KOT A;  1J1D A;  2V53 A;  3TDI A;  2LVJ A;  1NWD A;  3PN7 C;  3BOW A;  4D1E A;  1JFK A;  4PHN A;  2CBL A;  4GGF C;  1AHR A;  1BMO A;  2MLE C;  2Y4Q A;  1M63 B;  1SL9 A;  1HT9 A;  5I2L A;  3KPX A;  4MZL A;  1IRJ A;  2KSP A;  1UUS A;  1YVL A;  1XFW O;  1M31 A;  3BUM B;  1NCX A;  3NXA A;  2JZI A;  2AAO A;  3TS5 C;  2SAS A;  1F70 A;  1MXL C;  1DVI A;  2JXL A;  1RTP 1;  3CR2 A;  1KWO B;  4FQO A;  1SCM C;  4PE1 A;  2LE9 B;  4MRX A;  1REC A;  3CR4 X;  2KFH A;  2PMY A;  3CLN A;  3HCM A;  1RRO A;  3DVM A;  4CFQ A;  4CFR A;  1MUX A;  1WDC B;  2L2E A;  2L4H A;  4HRH A;  4PHM A;  2FOT A;  3SG7 A;  2BCA A;  2LUX A;  3LL8 B;  3VRR A;  4N1G A;  1N2D A;  1DMO A;  3VGO A;  3FWB A;  1DTL A;  1WLZ A;  1GQM A;  1CM1 A;  5IBW A;  1KFU L;  4GAO A;  2MBX A;  1X02 A;  2JQ6 A;  2L98 A;  2F8P A;  1SR6 C;  3FIA A;  4YI8 A;  2Y1N A;  1F54 A;  3O4Y A;  3CR5 X;  2KBI A;  4QJ4 B;  1Y1X A;  1W7I B;  2M8U A;  1CB1 A;  1TN4 A;  2H2K A;  3GK4 X;  1BLQ A;  1MXE A;  4BY4 A;  1EG3 A;  1ALW A;  1LKJ A;  1SCV A;  2H61 A;  3PAL A;  3I5G B;  4PAL A;  2EHB A;  4E68 A;  1EH2 A;  2LHI A;  1TNP A;  1CLM A;  2WCB A;  3AKA A;  3SIB A;  3DVJ A;  2GGZ A;  2M3W A;  2VRG A;  1DJI A;  1G4Y R;  4PE4 A;  1KFU S;  4L9M A;  4YGC B;  5ER5 A;  1JF0 A;  3ZNI A;  1DGV A;  2JC2 A;  3CGA A;  1J7Q A;  4U8D A;  2BE4 A;  1QV0 A;  1QAT A;  4USL A;  1YX7 A;  3EVR A;  2JNF A;  5AEQ A;  1MR8 A;  1CFF A;  3C1V A;  3OB2 B;  2L4I A;  3BYA A;  1QAS A;  1SRA A;  3BXK A;  2CXJ A;  2K7B A;  4YI9 A;  1S36 A;  2ISD A;  1TCO B;  4HRG A;  2KGB C;  1UHN A;  3NSO A;  3BUW B;  1QX2 A;  1S6I A;  3AAK A;  4PE0 A;  3CS1 A;  1UP5 A;  1XYD A;  2KQY A;  3MSE B;  2K2A A;  2JNX A;  1NX0 A;  1OZS A;  1CTR A;  3CWG A;  3EKH A;  2E6W A;  1KFX L;  1A29 A;  2EC6 B;  2HET A;  4UPG A;  3KF9 A;  1IG5 A;  1K9K A;  1KQV A;  1EJ3 A;  5CPV A;  2K7C A;  4ETO A;  4M2O A;  1QIV A;  1YR5 A;  1S3P A;  1CLL A;  2KBM A;  3I5F B;  1CMG A;  4OR9 B;  3NSK A;  1IJ5 A;  2QAC A;  4OCI A;  4DRW A;  1A4P A;  4MSP A;  1OZO A;  1AJ4 A;  1QVI Z;  2ZKM X;  4ORA B;  4PE7 A;  1DJW A;  1U5I B;  1KQM B;  1EL4 A;  4PCW A;  4PDZ A;  1YUR A;  3LLE A;  1LA0 A;  1DJZ A;  4XYN A;  1W7J B;  1B9A A;  2LHL A;  1RWY A;  5JOL A;  1SK6 D;  1K93 D;  1SW8 A;  2BBN A;  1WRK A;  4DS7 A;  2HQ8 A;  1H8B A;  3SG5 A;  3BUX B;  3SJS A;  2ZND A;  2LVI A;  1ZUZ A;  3KO0 A;  3EK4 A;  2OPO A;  1IGV A;  1C07 A;  1U5I A;  1XFX O;  3PLF B;  4F0Z B;  1GGZ A;  4M2Q A;  3I5G C;  1NP8 A;  1TNW A;  4WRI A;  1AVS A;  1XFY O;  1QS7 A;  2I18 A;  1BR4 B;  1CDP A;  4XJK B;  5CSJ A;  5J3X A;  5HKZ A;  1BT6 A;  1NPQ A;  3DVK A;  1YRU B;  1ZAC A;  1C7V A;  2FCD A;  1J7O A;  5HLV A;  2WC8 A;  2KAY A;  5I8N A;  4NDD A;  5I2Q A;  1IQ3 A;  3DVE A;  1QLS A;  2BBM A;  4DIR A;  5FYX A;  1M39 A;  1HQV A;  1N65 A;  2JT8 A;  4YGE B;  2Y1M A;  1DF0 B;  1SY9 A;  3A4U B;  1CDN A;  1WRL A;  1PVB A;  3RM1 A;  1UHJ A;  1DJY A;  4XJK A;  1NCZ A;  3AAJ A;  2A4J A;  2JRF A;  3ICB A;  4MBE A;  4YGA A;  1CMF A;  2Q4U A;  1NYA A;  3D0Y B;  1LVC D;  1LXF C;  1BF5 A;  4YRU A;  1JF2 A;  3DD4 A;  4BY5 A;  2CTN A;  4ZCV A;  4P5O E;  5CSN A;  3VRO A;  1YX8 A;  2K7O A;  2E30 A;  3TUY B;  2COL B;  1DF0 A;  2JPT A;  1EXR A;  1IWQ A;  4GUK A;  5KU1 A;  1BOD A;  2HPS A;  3PAT A;  1B7T Y;  1AUI B;  1SPY A;  1TCF A;  3WXA A;  3O2P A;  1BG1 A;  1G8I A;  4R1E A;  3LK0 A;  1JFJ A;  1JWD A;  3I5F C;  3D0Y A;  4OKH A;  1E8A A;  1ZOT B;  3CTN A;  2G9B A;  4N5X A;  2JOJ A;  3I5I B;  1R2U A;  3KEV A;  1NX1 A;  2M1U A;  3EK7 A;  1WRZ A;  2KYC A;  3NSI A;  1YUT A;  1KK7 Y;  2OTG B;  5K89 A;  1KQM C;  1NSH A;  1RJV A;  4N1F A;  4GBA A;  2F2O A;  5PAL A;  1S26 D;  2KI4 B;  2LMT A;  5DKQ A;  5HYD A;  2KNE A;  3O6B A;  3IQO A;  1YRT B;  4CID A;  2MLF C;  1JSA A;  2LP3 A;  2BL0 C;  1SL8 A;  1UHI A;  1BR1 B;  3EK8 A;  1J7P A;  2LMV A;  2ZRT A;  3PN7 B;  2MHH A;  3JVT B;  2KHN A;  3I5H C;  1PUL A;  4CPV A;  2JTZ A;  2LCP A;  3NSL A;  1B7T Z;  2BKI B;  3EVV A;  1F4O A;  3DF0 B;  2PSR A;  2TN4 A;  3EKJ A;  1QVI Y;  5HKW A;  4ICB A;  2MJW B;  1TOP A;  2RGI A;  4AQI A;  2M29 A;  2M97 A;  2HF5 A;  2JWW A;  2L5X B;  4Q04 A;  3TS5 B;  1KK7 Z;  1MWN A;  3VRN A;  1DGU A;  5BPJ A;  3GK1 A;  1AP4 A;  2L51 A;  1TTX A;  1QV1 A;  1LA3 A;  2K61 A;  1SCM B;  1Y1U A;  2GV5 A;  3EVU A;  2JT0 A;  4JWQ A;  4AQJ A;  1XO5 A;  1FI6 A;  5AER A;  2PVB A;  3BUO B;  1B8C A;  3DF0 A;  3M0W A;  1Y1A A; 
#chains in the Genus database with same CATH topology
 1QIW A;  3SG6 A;  2NZ0 A;  4JQ0 D;  4M2P A;  1KWO C;  1OMV A;  1TRF A;  1KSO A;  5DIC A;  3FE8 A;  4P2Y B;  1LIN A;  4A4B A;  3PM8 A;  2NCO A;  2O5G A;  3OX6 A;  4MN0 A;  1KK8 B;  1OW4 A;  3S0A A;  3SS5 A;  1Y0V H;  2PAS A;  1WDC C;  2LLT A;  2WCJ A;  1C3Y A;  2H61 C;  2KDH A;  4INX A;  1UUR A;  3AKB A;  1UHH A;  1JBA A;  2F3Z A;  2ZRS A;  2JT3 A;  1GJY A;  1K95 A;  3D10 A;  1TNX A;  1FW4 A;  2K0J A;  4A4C A;  5KTY A;  1RFJ A;  3RLZ A;  2WCH A;  3TUY C;  1J55 A;  1TUZ A;  2LVV A;  3NHI A;  1OOG A;  1S1E A;  4TNC A;  1BOC A;  1ODB A;  3PFV A;  1AK8 A;  1OOI X;  4ZCU A;  2HQW A;  3SIA A;  3WHU B;  4ORC B;  1PRW A;  2I2R E;  1F55 A;  3HX4 A;  2JPO A;  4I5K A;  4MRY A;  2WOR A;  2M1K B;  4IL1 A;  2WCF A;  3CZ2 A;  2KAV A;  1AJ5 A;  1Y6W A;  1NX3 A;  1CFP A;  2KAX A;  2L0P A;  1M46 A;  1R6P A;  2BE6 A;  2CT9 A;  4AOM A;  1JUO A;  4ORB B;  1B47 A;  1PAL A;  2FCE A;  2PAL A;  1K94 A;  1L7Z A;  4WQ3 A;  1S6J A;  1LS8 A;  3VRP A;  5TNC A;  1A75 B;  1BU3 A;  2KQ6 A;  2ZN9 A;  1DJH A;  2IS9 A;  3QRX A;  1CNP A;  2I7A A;  1S5G Z;  2OS8 B;  1NIW A;  1V1F A;  1EG4 A;  1A03 A;  4OVN F;  2M0R A;  1K96 A;  2K7D A;  3VRQ A;  1YUU A;  3E3R A;  1SYM A;  3FE6 A;  3JVT C;  5DKN A;  1ORG A;  2SCP A;  5D7F A;  1FBV A;  2F33 A;  5HLO A;  3D78 A;  3K1E A;  1B8L A;  1K90 D;  4GNK B;  4YGD B;  1ZMZ A;  3WHT B;  4GFT A;  5G08 A;  1RK9 A;  2K8M B;  5HKY A;  1XFZ O;  3RZS A;  1NCY A;  2LAN A;  2M7L A;  5FI6 A;  3F45 A;  1A75 A;  1OMD A;  2LMU A;  1DT7 B;  2DOQ A;  4NQG A;  3BJH A;  4GPL B;  2LP2 A;  3CYZ A;  3R1P A;  3JTD B;  1CLB A;  1TIZ A;  3LK1 A;  1QX7 A;  1G33 A;  1PK0 D;  2ZNE A;  2KYF A;  3K21 A;  4HRE E;  4I5J A;  1UWO A;  2WCL A;  3BUN B;  1L2O B;  3EG5 B;  2KFG A;  2EC6 C;  3LCP C;  4I5N B;  3IF7 A;  1B4C A;  2KPH A;  1P28 A;  1PSR A;  4WQ2 A;  2BEC A;  2KFF A;  2WCM A;  2BCB A;  2LLU A;  4DCK A;  3TDU A;  1QJT A;  5JJG A;  2WC6 A;  1OSA A;  2KGR A;  1DJG A;  4YGB B;  2O60 A;  3BFB A;  1QLK A;  1KK8 C;  2FJY A;  1GM0 A;  3OX5 A;  2GGM A;  5DKR A;  3BQ3 A;  1IH0 A;  1BJF A;  2H8V A;  4NDC A;  3OP0 A;  1D1O A;  1DJX A;  2LLS A;  3FE9 A;  1SL7 A;  2I94 A;  1C7W A;  2JUL A;  2Y5I A;  2ZN8 A;  4QJ3 B;  3R72 A;  4YBH B;  1K2H A;  1A2X A;  4JPZ B;  1CFC A;  2EGD A;  2LC5 A;  1V1G A;  2PRU A;  3IQQ A;  3TZ1 A;  4DUQ A;  1F71 A;  5CSI A;  5CSF A;  2P71 A;  2QPT A;  4MLW A;  1NUB A;  4C0J A;  1VRK A;  2JXC A;  2M9G A;  4MZK A;  2KI6 C;  1MHO A;  4OZD A;  3R1V A;  1M45 A;  3SG2 A;  2P6B B;  1B8R A;  1KSM A;  4OV2 A;  2LM5 A;  1FF1 A;  1Q80 A;  1CDM A;  2M49 B;  3O78 A;  3S0B A;  1FI5 A;  2BKH B;  3QME A;  2BCX A;  3PJI A;  2LUC A;  3OGN A;  1ALV A;  4C0K A;  1B1G A;  2MAZ A;  1F4Q A;  5I2O A;  5F6T A;  2BAP A;  1CFD A;  1OQP A;  2LAP A;  2LV7 A;  3B86 A;  1XK4 A;  2LNK A;  5B8I B;  3DZT A;  1K9P A;  3ZWH A;  2MA2 A;  1TNQ A;  4NDB A;  5ER4 X;  2WCK A;  3FWC A;  1GGW A;  1WY9 A;  3GK2 A;  3SG3 A;  4GGF A;  4MZJ A;  5D3O A;  2LVK A;  1CDL A;  3GOF A;  2AUC A;  1SKT A;  2NXQ A;  1YUS A;  2OS8 C;  1YVH A;  5KSZ A;  1F8H A;  1XFU O;  2FJU B;  3PSR A;  3FS7 A;  3UO9 A;  2JTT A;  2NCP A;  1H4B A;  2G2B A;  4MEW A;  5AFP A;  3B87 A;  3SS4 A;  5AAN A;  1N0Y A;  2YGU A;  1OOJ A;  3SG4 A;  1K9U A;  1IKU A;  3A8R A;  2Q91 A;  3L4A A;  1FPW A;  1IJ6 A;  2ZFD A;  2D8N A;  1QX5 B;  2KI6 D;  2MRD A;  4C0L A;  3OB1 B;  3H4S E;  1MF8 B;  3S0G A;  1SR6 B;  2AMI A;  3SS3 A;  1J7R A;  1NX2 A;  1XA5 A;  3WNX B;  4PHK A;  3S0E A;  4PHJ A;  1S5G Y;  2QEH A;  3JTD C;  5D69 A;  1PVA A;  3TDZ A;  2CCM A;  1L2O C;  1XVJ A;  5GQQ C;  4I5L B;  1S6C A;  2WND A;  2PYQ A;  1PSB A;  2M7N A;  1JC2 A;  1QTX A;  1OMR A;  1CM4 A;  5EL2 A;  1K8U A;  4FTG A;  3OHM B;  2JU0 A;  2L50 A;  1KFX S;  2WOS A;  3BOW B;  1SMG A;  2F3Y A;  1J1E A;  3R1O A;  3I5I C;  2K2F A;  1MQ1 A;  1ZFS A;  1WLM A;  3OBV A;  1IIO A;  2BL0 B;  2OTG C;  2R2I A;  4CLN A;  3CZT X;  1UHK A;  1YTZ C;  1SBJ A;  1XFV O;  2B1U A;  2QDI A;  1KCY A;  1SNL A;  4MVF A;  1QXP A;  2KI4 C;  3I5H B;  2F2P A;  4HSZ A;  4QJ5 B;  4GGN A;  5AXI A;  2CNP A;  1IQ5 A;  1XK4 C;  2WCE A;  1DQE A;  1CKK A;  2NLN A;  1OE9 B;  3KHE A;  2KOT A;  1J1D A;  2V53 A;  3TDI A;  2LVJ A;  1NWD A;  3PN7 C;  3BOW A;  4D1E A;  1JFK A;  4PHN A;  2CBL A;  4GGF C;  1AHR A;  1BMO A;  2MLE C;  2Y4Q A;  3V2L A;  1M63 B;  1SL9 A;  1HT9 A;  5I2L A;  2P70 A;  3KPX A;  4MZL A;  1IRJ A;  2KSP A;  1UUS A;  1YVL A;  1XFW O;  1M31 A;  3BUM B;  1NCX A;  3NXA A;  2JZI A;  2AAO A;  3TS5 C;  2SAS A;  3CAB A;  3CZ0 A;  1F70 A;  1MXL C;  1DVI A;  2JXL A;  1RTP 1;  3CR2 A;  1KWO B;  4FQO A;  1SCM C;  4PE1 A;  2LE9 B;  4MRX A;  1REC A;  3CR4 X;  2KFH A;  4PT1 A;  2PMY A;  3CLN A;  3HCM A;  3D73 A;  1RRO A;  3DVM A;  5FI7 A;  4CFQ A;  4CFR A;  1MUX A;  1WDC B;  2L2E A;  2L4H A;  4HRH A;  4PHM A;  2FOT A;  3SG7 A;  2BCA A;  3IVT A;  2PQL A;  2LUX A;  3LL8 B;  3VRR A;  4N1G A;  1N2D A;  1DMO A;  3VGO A;  3FWB A;  1DTL A;  1WLZ A;  1GQM A;  1CM1 A;  4KYN A;  5IBW A;  1KFU L;  4GAO A;  2MBX A;  1X02 A;  2JQ6 A;  2L98 A;  2F8P A;  1SR6 C;  3FIA A;  4YI8 A;  2Y1N A;  1F54 A;  3O4Y A;  3CR5 X;  2KLE A;  2KBI A;  1DC1 A;  4QJ4 B;  1Y1X A;  1W7I B;  2M8U A;  1CB1 A;  1T14 A;  3D75 A;  1TN4 A;  2H2K A;  3GK4 X;  3BFA A;  1BLQ A;  1Z2C B;  1MXE A;  1DEL A;  4BY4 A;  1EG3 A;  1ALW A;  1LKJ A;  1SCV A;  1TWO A;  2H61 A;  3PAL A;  3S0F A;  3I5G B;  4PAL A;  2EHB A;  4E68 A;  1EH2 A;  2LHI A;  1TNP A;  1CLM A;  2WCB A;  3AKA A;  3SIB A;  3DVJ A;  2GGZ A;  2M3W A;  2VRG A;  1DJI A;  1G4Y R;  4JD9 A;  4PE4 A;  1KFU S;  4L9M A;  4YGC B;  5ER5 A;  1JF0 A;  3VB1 A;  3ZNI A;  1DGV A;  2JC2 A;  3CGA A;  1J7Q A;  4U8D A;  2BE4 A;  1QV0 A;  1QAT A;  4USL A;  1YX7 A;  3EVR A;  2JNF A;  5AEQ A;  1MR8 A;  1CFF A;  3C1V A;  3L47 A;  3D77 A;  3OB2 B;  2L4I A;  3BYA A;  1QAS A;  1SRA A;  3BXK A;  2CXJ A;  2K7B A;  4YI9 A;  1S36 A;  2ISD A;  1TCO B;  4HRG A;  3S0D A;  2KGB C;  1UHN A;  3NSO A;  3BUW B;  1QX2 A;  1S6I A;  3AAK A;  4PE0 A;  3CS1 A;  1UP5 A;  1XYD A;  2KQY A;  3MSE B;  3D76 A;  2K2A A;  2JNX A;  1NX0 A;  1OZS A;  1CTR A;  3CWG A;  3EKH A;  2E6W A;  2KLD A;  1KFX L;  1A29 A;  2EC6 B;  3DYE A;  2HET A;  4UPG A;  3KF9 A;  1IG5 A;  1K9K A;  1KQV A;  1EJ3 A;  5CPV A;  2K7C A;  4ETO A;  4M2O A;  1QIV A;  1YR5 A;  1S3P A;  1CLL A;  2KBM A;  3I5F B;  1CMG A;  4OR9 B;  3NSK A;  1IJ5 A;  2QAC A;  4OCI A;  2L5Y A;  3NHT A;  4DRW A;  1A4P A;  4MSP A;  1OZO A;  1AJ4 A;  1QVI Z;  2ZKM X;  4ORA B;  4PE7 A;  1DJW A;  1U5I B;  1KQM B;  1EL4 A;  4PCW A;  4PDZ A;  1YUR A;  3LLE A;  1LA0 A;  1DJZ A;  4XYN A;  1W7J B;  1B9A A;  2LHL A;  1RWY A;  5JOL A;  1SK6 D;  3O4X A;  2BNX A;  1K93 D;  1SW8 A;  2BBN A;  1WRK A;  1DEK A;  4DS7 A;  2HQ8 A;  1H8B A;  3SG5 A;  3BUX B;  3SJS A;  2ZND A;  2LVI A;  1ZUZ A;  3KO0 A;  3EK4 A;  5HL1 A;  2OPO A;  1IGV A;  1C07 A;  1U5I A;  1XFX O;  3PLF B;  4F0Z B;  1GGZ A;  2WC5 A;  4M2Q A;  3L4L A;  5I94 A;  3I5G C;  1NP8 A;  1TNW A;  4WRI A;  1AVS A;  1XFY O;  1QS7 A;  2I18 A;  1BR4 B;  1CDP A;  4XJK B;  5CSJ A;  5J3X A;  5HKZ A;  1BT6 A;  1NPQ A;  2GTE A;  1YRU B;  1ZAC A;  3B7A A;  3DVK A;  2FCD A;  1C7V A;  1J7O A;  5HLV A;  2WC8 A;  1SSE B;  2KAY A;  3N7H A;  5I8N A;  3B88 A;  4NDD A;  5I2Q A;  1IQ3 A;  3DVE A;  1QLS A;  2BBM A;  4DIR A;  1QWV A;  5FYX A;  1M39 A;  1HQV A;  1N65 A;  3CDN A;  2JT8 A;  4YGE B;  1Z4H A;  2Y1M A;  1DF0 B;  1SY9 A;  3A4U B;  1CDN A;  1WRL A;  1PVB A;  3RM1 A;  1UHJ A;  1DJY A;  4XJK A;  1NCZ A;  3AAJ A;  2A4J A;  2JRF A;  3ICB A;  4MBE A;  4YGA A;  1CMF A;  2Q4U A;  1NYA A;  3D0Y B;  1LVC D;  1LXF C;  1BF5 A;  4YRU A;  1JF2 A;  3DD4 A;  1XFR A;  4BY5 A;  2CTN A;  4ZCV A;  4P5O E;  5CSN A;  2QEB A;  3VRO A;  1YX8 A;  2K7O A;  3DY9 A;  4IJ7 A;  2E30 A;  3TUY B;  1OOH A;  2COL B;  1DF0 A;  2JPT A;  1EXR A;  1IWQ A;  4GUK A;  5KU1 A;  1BOD A;  2HPS A;  3PAT A;  1B7T Y;  1AUI B;  4FQT A;  1SPY A;  1TCF A;  3WXA A;  3O2P A;  1BG1 A;  1G8I A;  2QEV A;  4R1E A;  2QEO A;  3LK0 A;  4F7F A;  1JFJ A;  1JWD A;  3I5F C;  3CZ1 A;  3D0Y A;  4OKH A;  1W9Z A;  1E8A A;  1ZOT B;  3CTN A;  2G9B A;  4N5X A;  2JOJ A;  3I5I B;  1R2U A;  3D74 A;  3KEV A;  1NX1 A;  2M1U A;  3EK7 A;  1WRZ A;  2KYC A;  3NSI A;  1YUT A;  1KK7 Y;  2OTG B;  5K89 A;  1KQM C;  1NSH A;  1RJV A;  4N1F A;  4GBA A;  2F2O A;  5PAL A;  1S26 D;  2KI4 B;  2LMT A;  5DKQ A;  5HYD A;  2KNE A;  3O6B A;  1TUJ A;  3IQO A;  1YRT B;  4CID A;  2MLF C;  1JSA A;  2LP3 A;  2BL0 C;  1SL8 A;  1UHI A;  3Q8I A;  1BR1 B;  3EK8 A;  1J7P A;  2LMV A;  4JKT A;  2ZRT A;  3PN7 B;  2MHH A;  3BFH A;  3JVT B;  2KHN A;  3I5H C;  1PUL A;  4CPV A;  3PM2 A;  2JTZ A;  2LCP A;  2ERB A;  3UNW A;  3NSL A;  1B7T Z;  2BKI B;  3EVV A;  1F4O A;  3DF0 B;  2PSR A;  2TN4 A;  3EKJ A;  1QVI Y;  5HKW A;  4ICB A;  2MJW B;  3NGV A;  1TOP A;  2RGI A;  1OOF A;  2K60 A;  2M29 A;  4INW A;  4AQI A;  2M97 A;  2HF5 A;  2JWW A;  2L2C A;  2L5X B;  4Q04 A;  3TS5 B;  1KK7 Z;  1MWN A;  5FI2 A;  3VRN A;  1DGU A;  3DXL A;  3GK1 A;  5BPJ A;  1AP4 A;  2L51 A;  1C3Z A;  1TTX A;  1QV1 A;  3B6X A;  1LA3 A;  2K61 A;  1SCM B;  1Y1U A;  2GV5 A;  3EVU A;  2JT0 A;  4JWQ A;  4AQJ A;  1XO5 A;  1FI6 A;  5AER A;  2PVB A;  3BUO B;  1B8C A;  3DF0 A;  3M0W A;  1Y1A A; 
#chains in the Genus database with same CATH homology
 1QIW A;  3SG6 A;  2NZ0 A;  4JQ0 D;  4M2P A;  1KWO C;  1OMV A;  1TRF A;  1KSO A;  4P2Y B;  1LIN A;  4A4B A;  3PM8 A;  2NCO A;  2O5G A;  3OX6 A;  4MN0 A;  1KK8 B;  1Y0V H;  2PAS A;  1WDC C;  2LLT A;  2H61 C;  2KDH A;  1UUR A;  3AKB A;  1UHH A;  1JBA A;  2F3Z A;  2ZRS A;  2JT3 A;  1GJY A;  1K95 A;  3D10 A;  1TNX A;  1FW4 A;  2K0J A;  4A4C A;  5KTY A;  1RFJ A;  3RLZ A;  1CFC A;  3TUY C;  1J55 A;  1BOC A;  2LVV A;  4TNC A;  1S1E A;  1ODB A;  3PFV A;  1AK8 A;  4ZCU A;  2HQW A;  3SIA A;  3WHU B;  4ORC B;  1PRW A;  2I2R E;  1F55 A;  3HX4 A;  4I5K A;  4MRY A;  2WOR A;  2M1K B;  4IL1 A;  2WCF A;  2KAV A;  1AJ5 A;  1Y6W A;  1NX3 A;  1CFP A;  2KAX A;  2L0P A;  1M46 A;  1R6P A;  2BE6 A;  2CT9 A;  4AOM A;  1JUO A;  4ORB B;  1B47 A;  1PAL A;  2FCE A;  2PAL A;  1K94 A;  1L7Z A;  4WQ3 A;  1S6J A;  3VRP A;  5TNC A;  1A75 B;  1BU3 A;  2KQ6 A;  2ZN9 A;  1DJH A;  2IS9 A;  3QRX A;  1CNP A;  2I7A A;  1S5G Z;  2OS8 B;  1NIW A;  1V1F A;  1EG4 A;  1A03 A;  4OVN F;  2M0R A;  1K96 A;  2K7D A;  3VRQ A;  1YUU A;  3E3R A;  1SYM A;  3JVT C;  5DKN A;  2SCP A;  5D7F A;  1FBV A;  2F33 A;  5HLO A;  1B8L A;  1K90 D;  4GNK B;  4YGD B;  1ZMZ A;  3WHT B;  4GFT A;  5G08 A;  1RK9 A;  2K8M B;  5HKY A;  1XFZ O;  1NCY A;  2LAN A;  2M7L A;  3F45 A;  1A75 A;  1OMD A;  2LMU A;  1DT7 B;  2DOQ A;  4NQG A;  4GPL B;  2LP2 A;  3JTD B;  1CLB A;  1TIZ A;  3LK1 A;  1QX7 A;  1G33 A;  1PK0 D;  2ZNE A;  2KYF A;  3K21 A;  4HRE E;  4I5J A;  1UWO A;  3LCP C;  3BUN B;  1L2O B;  4I5N B;  2KFG A;  2EC6 C;  3TZ1 A;  3IF7 A;  1B4C A;  1PSR A;  4WQ2 A;  2BEC A;  2KFF A;  2BCB A;  2LLU A;  4DCK A;  3TDU A;  1QJT A;  5JJG A;  1OSA A;  2KGR A;  1DJG A;  4YGB B;  2O60 A;  1QLK A;  1KK8 C;  3OX5 A;  2GGM A;  5DKR A;  3BQ3 A;  1IH0 A;  1BJF A;  4NDC A;  3OP0 A;  1D1O A;  1DJX A;  2LLS A;  1SL7 A;  2I94 A;  1C7W A;  2JUL A;  2Y5I A;  2ZN8 A;  4QJ3 B;  4YBH B;  1K2H A;  1A2X A;  4JPZ B;  2EGD A;  2LC5 A;  1V1G A;  2PRU A;  3IQQ A;  4DUQ A;  1F71 A;  5CSI A;  5CSF A;  4C0J A;  2QPT A;  4MLW A;  1NUB A;  1VRK A;  2JXC A;  2M9G A;  4MZK A;  2KI6 C;  1MHO A;  1M45 A;  3SG2 A;  2P6B B;  1B8R A;  1KSM A;  4OV2 A;  2LM5 A;  1FF1 A;  1Q80 A;  1CDM A;  2M49 B;  3O78 A;  1FI5 A;  2BKH B;  2BCX A;  2LUC A;  4C0K A;  1ALV A;  1B1G A;  2MAZ A;  1F4Q A;  5I2O A;  5F6T A;  1CFD A;  1OQP A;  2LAP A;  2LV7 A;  5B8I B;  1XK4 A;  2LNK A;  3ZWH A;  1K9P A;  2MA2 A;  1TNQ A;  4NDB A;  5ER4 X;  3FWC A;  1GGW A;  1WY9 A;  3GK2 A;  3SG3 A;  4GGF A;  4MZJ A;  2LVK A;  1CDL A;  3GOF A;  2AUC A;  1SKT A;  2NXQ A;  1YUS A;  2OS8 C;  1YVH A;  5KSZ A;  1F8H A;  1XFU O;  2FJU B;  3PSR A;  3FS7 A;  1H4B A;  2JTT A;  2NCP A;  2G2B A;  4MEW A;  5AFP A;  5AAN A;  1N0Y A;  1OOJ A;  3SG4 A;  1K9U A;  1IKU A;  3A8R A;  2Q91 A;  1FPW A;  1IJ6 A;  2ZFD A;  2D8N A;  1QX5 B;  2KI6 D;  2MRD A;  4C0L A;  3OB1 B;  3H4S E;  1MF8 B;  1SR6 B;  2AMI A;  1J7R A;  1NX2 A;  1XA5 A;  3WNX B;  4PHK A;  4PHJ A;  1S5G Y;  3JTD C;  5D69 A;  1PVA A;  3TDZ A;  2CCM A;  1L2O C;  1XVJ A;  5GQQ C;  4I5L B;  1S6C A;  2WND A;  1PSB A;  2M7N A;  1JC2 A;  1QTX A;  1OMR A;  1CM4 A;  1K8U A;  4FTG A;  3OHM B;  2JU0 A;  2L50 A;  1KFX S;  2WOS A;  3BOW B;  1SMG A;  2F3Y A;  1J1E A;  3I5I C;  2K2F A;  1MQ1 A;  1ZFS A;  1WLM A;  2BL0 B;  2OTG C;  2R2I A;  4CLN A;  3CZT X;  1UHK A;  1YTZ C;  1SBJ A;  1XFV O;  2B1U A;  1KCY A;  1SNL A;  4MVF A;  1QXP A;  2KI4 C;  3I5H B;  2F2P A;  4HSZ A;  4QJ5 B;  4GGN A;  5AXI A;  2CNP A;  1IQ5 A;  1XK4 C;  2WCE A;  1CKK A;  2NLN A;  1OE9 B;  3KHE A;  2KOT A;  1J1D A;  2V53 A;  3TDI A;  2LVJ A;  1NWD A;  3PN7 C;  3BOW A;  4D1E A;  1JFK A;  4PHN A;  2CBL A;  4GGF C;  1AHR A;  1BMO A;  2MLE C;  2Y4Q A;  1M63 B;  1SL9 A;  1HT9 A;  5I2L A;  3KPX A;  4MZL A;  1IRJ A;  2KSP A;  1UUS A;  1YVL A;  1XFW O;  1M31 A;  3BUM B;  1NCX A;  3NXA A;  2JZI A;  2AAO A;  3TS5 C;  2SAS A;  1F70 A;  1MXL C;  1DVI A;  2JXL A;  1RTP 1;  3CR2 A;  1KWO B;  4FQO A;  1SCM C;  4PE1 A;  2LE9 B;  4MRX A;  1REC A;  3CR4 X;  2KFH A;  2PMY A;  3CLN A;  3HCM A;  1RRO A;  3DVM A;  4CFQ A;  4CFR A;  1MUX A;  1WDC B;  2L2E A;  2L4H A;  4HRH A;  4PHM A;  2FOT A;  3SG7 A;  2BCA A;  2LUX A;  3LL8 B;  3VRR A;  4N1G A;  1N2D A;  1DMO A;  3VGO A;  3FWB A;  1DTL A;  1WLZ A;  1GQM A;  1CM1 A;  5IBW A;  1KFU L;  4GAO A;  2MBX A;  1X02 A;  2JQ6 A;  2L98 A;  2F8P A;  1SR6 C;  3FIA A;  4YI8 A;  2Y1N A;  1F54 A;  3O4Y A;  3CR5 X;  2KBI A;  4QJ4 B;  1Y1X A;  1W7I B;  2M8U A;  1CB1 A;  1TN4 A;  2H2K A;  3GK4 X;  1BLQ A;  1MXE A;  4BY4 A;  1EG3 A;  1ALW A;  1LKJ A;  1SCV A;  2H61 A;  3PAL A;  3I5G B;  4PAL A;  2EHB A;  4E68 A;  1EH2 A;  2LHI A;  1TNP A;  1CLM A;  2WCB A;  3AKA A;  3SIB A;  3DVJ A;  2GGZ A;  2M3W A;  2VRG A;  1DJI A;  1G4Y R;  4PE4 A;  1KFU S;  4L9M A;  4YGC B;  5ER5 A;  1JF0 A;  3ZNI A;  1DGV A;  2JC2 A;  3CGA A;  1J7Q A;  4U8D A;  2BE4 A;  1QV0 A;  1QAT A;  4USL A;  1YX7 A;  3EVR A;  2JNF A;  5AEQ A;  1MR8 A;  1CFF A;  3C1V A;  3OB2 B;  2L4I A;  3BYA A;  1QAS A;  1SRA A;  3BXK A;  2CXJ A;  2K7B A;  4YI9 A;  1S36 A;  2ISD A;  1TCO B;  4HRG A;  2KGB C;  1UHN A;  3NSO A;  3BUW B;  1QX2 A;  1S6I A;  3AAK A;  4PE0 A;  3CS1 A;  1UP5 A;  1XYD A;  2KQY A;  3MSE B;  2K2A A;  2JNX A;  1NX0 A;  1OZS A;  1CTR A;  3CWG A;  3EKH A;  2E6W A;  1KFX L;  1A29 A;  2EC6 B;  2HET A;  4UPG A;  3KF9 A;  1IG5 A;  1K9K A;  1KQV A;  1EJ3 A;  5CPV A;  2K7C A;  4ETO A;  4M2O A;  1QIV A;  1YR5 A;  1S3P A;  1CLL A;  2KBM A;  3I5F B;  1CMG A;  4OR9 B;  3NSK A;  1IJ5 A;  2QAC A;  4OCI A;  4DRW A;  1A4P A;  4MSP A;  1OZO A;  1AJ4 A;  1QVI Z;  2ZKM X;  4ORA B;  4PE7 A;  1DJW A;  1U5I B;  1KQM B;  1EL4 A;  4PCW A;  4PDZ A;  1YUR A;  3LLE A;  1LA0 A;  1DJZ A;  4XYN A;  1W7J B;  1B9A A;  2LHL A;  1RWY A;  5JOL A;  1SK6 D;  1K93 D;  1SW8 A;  2BBN A;  1WRK A;  4DS7 A;  2HQ8 A;  1H8B A;  3SG5 A;  3BUX B;  3SJS A;  2ZND A;  2LVI A;  1ZUZ A;  3KO0 A;  3EK4 A;  2OPO A;  1IGV A;  1C07 A;  1U5I A;  1XFX O;  3PLF B;  4F0Z B;  1GGZ A;  4M2Q A;  3I5G C;  1NP8 A;  1TNW A;  4WRI A;  1AVS A;  1XFY O;  1QS7 A;  2I18 A;  1BR4 B;  1CDP A;  4XJK B;  5CSJ A;  5J3X A;  5HKZ A;  1BT6 A;  1NPQ A;  3DVK A;  1YRU B;  1ZAC A;  1C7V A;  2FCD A;  1J7O A;  5HLV A;  2WC8 A;  2KAY A;  5I8N A;  4NDD A;  5I2Q A;  1IQ3 A;  3DVE A;  1QLS A;  2BBM A;  4DIR A;  5FYX A;  1M39 A;  1HQV A;  1N65 A;  2JT8 A;  4YGE B;  2Y1M A;  1DF0 B;  1SY9 A;  3A4U B;  1CDN A;  1WRL A;  1PVB A;  3RM1 A;  1UHJ A;  1DJY A;  4XJK A;  1NCZ A;  3AAJ A;  2A4J A;  2JRF A;  3ICB A;  4MBE A;  4YGA A;  1CMF A;  2Q4U A;  1NYA A;  3D0Y B;  1LVC D;  1LXF C;  1BF5 A;  4YRU A;  1JF2 A;  3DD4 A;  4BY5 A;  2CTN A;  4ZCV A;  4P5O E;  5CSN A;  3VRO A;  1YX8 A;  2K7O A;  2E30 A;  3TUY B;  2COL B;  1DF0 A;  2JPT A;  1EXR A;  1IWQ A;  4GUK A;  5KU1 A;  1BOD A;  2HPS A;  3PAT A;  1B7T Y;  1AUI B;  1SPY A;  1TCF A;  3WXA A;  3O2P A;  1BG1 A;  1G8I A;  4R1E A;  3LK0 A;  1JFJ A;  1JWD A;  3I5F C;  3D0Y A;  4OKH A;  1E8A A;  1ZOT B;  3CTN A;  2G9B A;  4N5X A;  2JOJ A;  3I5I B;  1R2U A;  3KEV A;  1NX1 A;  2M1U A;  3EK7 A;  1WRZ A;  2KYC A;  3NSI A;  1YUT A;  1KK7 Y;  2OTG B;  5K89 A;  1KQM C;  1NSH A;  1RJV A;  4N1F A;  4GBA A;  2F2O A;  5PAL A;  1S26 D;  2KI4 B;  2LMT A;  5DKQ A;  5HYD A;  2KNE A;  3O6B A;  3IQO A;  1YRT B;  4CID A;  2MLF C;  1JSA A;  2LP3 A;  2BL0 C;  1SL8 A;  1UHI A;  1BR1 B;  3EK8 A;  1J7P A;  2LMV A;  2ZRT A;  3PN7 B;  2MHH A;  3JVT B;  2KHN A;  3I5H C;  1PUL A;  4CPV A;  2JTZ A;  2LCP A;  3NSL A;  1B7T Z;  2BKI B;  3EVV A;  1F4O A;  3DF0 B;  2PSR A;  2TN4 A;  3EKJ A;  1QVI Y;  5HKW A;  4ICB A;  2MJW B;  1TOP A;  2RGI A;  4AQI A;  2M29 A;  2M97 A;  2HF5 A;  2JWW A;  2L5X B;  4Q04 A;  3TS5 B;  1KK7 Z;  1MWN A;  3VRN A;  1DGU A;  5BPJ A;  3GK1 A;  1AP4 A;  2L51 A;  1TTX A;  1QV1 A;  1LA3 A;  2K61 A;  1SCM B;  1Y1U A;  2GV5 A;  3EVU A;  2JT0 A;  4JWQ A;  4AQJ A;  1XO5 A;  1FI6 A;  5AER A;  2PVB A;  3BUO B;  1B8C A;  3DF0 A;  3M0W A;  1Y1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...