3ZWHA

Ca2+-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with myosin iia
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN S100-A4
publication title Crystal Structure of the S100A4-Nonmuscle Myosin Iia Tail Fragment Complex Reveals an Asymmetric Target Binding Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ca-binding protein/motor protein
total genus 37
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3zwhA00
3PN7B 1AJ4A 1QV0A 2WNDA 3EVRA 1CDPA 3CWGA 1TNXA 2JTTA 4PE1A 4DIRA 2JT0A 2H61C 1JWDA 1KCYA 1CB1A 2O60A 2K61A 3VRPA 1Y6WA 1X02A 1J55A 2Q4UA 2LLSA 3CGAA 1K9UA 1SYMA 1YURA 2BBMA 1SK6D 2WOSA 1PVBA 1V1GA 1BLQA 4IL1A 3WXAA 2KAVA 2K7DA 2I7AA 1KK8C 3BUMB 2TN4A 2JOJA 1DJWA 1XK4A 1OQPA 2JU0A 1MWNA 1SRAA 1F71A 1DF0B 4N5XA 1BOCA 2K8MB 3VRRA 3CS1A 1U5IB 3TS5C 1NCYA 1SCMB 3MSEB 2M0RA 1DGUA 1S26D 2LHLA 1GQMA 2SCPA 2K7BA 4F0ZB 2JZIA 1F4OA 4OR9B 2NLNA 3D0YA 1B4CA 3A8RA 1FPWA 1KFXS 1IGVA 1KK8B 2BE4A 4PHKA 1Q80A 1YUSA 3NSIA 3GOFA 4CIDA 1PRWA 1DGVA 1EJ3A 2K7CA 2KFFA 1IG5A 4M2QA 1Y1UA 2BCXA 2LCPA 2ZRTA 4WQ3A 1CKKA 3TS5B 1NUBA 1K9PA 4NQGA 4I5NB 3KEVA 1KWOC 2GGMA 1WRZA 2NCPA 3AAJA 1M46A 1MHOA 3AAKA 4D1EA 2K2AA 2NCOA 2LVKA 3DVJA 3K21A 2KNEA 4CFRA 1YUUA 2M29A 1DJXA 1ZOTB 4GAOA 3DD4A 4MSPA 5TNCA 2B1UA 5CSIA 1NP8A 1JFKA 4BY4A 1SL8A 1EG3A 2MAZA 2ZFDA 3KHEA 1D1OA 4M2PA 1OMRA 1MXEA 1PK0D 2MA2A 3KO0A 5I8NA 1ZFSA 3CR2A 3O6BA 1NCXA 1QX7A 1KWOB 2FCDA 1QATA 1F54A 1TNPA 1UURA 4I5LB 2KHNA 4JWQA 1TCFA 1YRTB 2F33A 3WHTB 2WCEA 3EKHA 1K94A 4QJ3B 1B47A 4GGFC 2F3ZA 2GGZA 4HSZA 1B8RA 1CLMA 2ZNDA 1XA5A 1AJ5A 3BUNB 1PALA 4BY5A 1WLMA 1SL7A 1JBAA 1F70A 2E6WA 2HF5A 1Y1AA 1SY9A 3PSRA 1QASA 2CTNA 1IWQA 1UHKA 3GK1A 4GGNA 5CSFA 4ORCB 1A2XA 1G4YR 5HLVA 4CFQA 4NDDA 4WRIA 1J7PA 4CLNA 2LAPA 3DF0A 1N0YA 2JNXA 1B7TZ 4OVNF 1OZSA 1B8CA 3IQQA 3I5FC 1KSOA 1TCOB 4WQ2A 4DUQA 1BJFA 1SPYA 1KQVA 3TDZA 2PVBA 3HCMA 2CT9A 1A75A 5J3XA 1JF2A 2HQ8A 1BT6A 3BOWB 2V53A 4ZCUA 1F4QA 2JC2A 4QJ5B 2K7OA 5AEQA 2FOTA 2JXLA 1NWDA 1M31A 2EGDA 2LVIA 5AANA 2WCBA 3I5FB 1DJZA 2M1UA 4MEWA 4CPVA 1LA0A 2QPTA 1TTXA 1N65A 3SG4A 1QLKA 2HQWA 4MN0A 2LNKA 1K93D 1CDMA 1KFUS 2Y4QA 1QVIZ 2A4JA 2KYCA 3CR4X 2ISDA 1K2HA 1MF8B 4MRXA 3SIAA 1YTZC 1NX3A 2MLEC 3OB1B 4AQIA 5I2OA 1CMFA 4YGBB 3SG2A 1UUSA 3PM8A 1B8LA 4HREE 1WRKA 1KFXL 2KSPA 1B1GA 1M45A 2KQ6A 5CPVA 1FW4A 4XYNA 1XYDA 5HKWA 1K95A 2JULA 1DTLA 1OZOA 1QIVA 1H4BA 5DKQA 1SW8A 3BQ3A 1UHIA 1AHRA 3RM1A 1B7TY 1H8BA 4I5JA 5AERA 2NZ0A 1OMVA 4PE0A 2JTZA 3NSLA 2LM5A 1RJVA 3KF9A 5HLOA 1B9AA 1NCZA 1ZUZA 2QACA 3SG3A 2JQ6A 1QXPA 1MQ1A 3VRNA 1OMDA 2HETA 1G8IA 1CTRA 2LC5A 4MLWA 1TNWA 2M3WA 1E8AA 1S5GZ 3EKJA 1XFZO 1OE9B 2JXCA 2KGBC 4P2YB 5IBWA 1DF0A 1J1EA 2H61A 1BF5A 1IH0A 1GJYA 4USLA 4A4CA 2KI6D 1FI5A 1C7WA 1DJIA 1GGZA 1U5IA 1BMOA 2WCFA 3BUXB 2Q91A 2Y5IA 2Y1NA 1NYAA 4GFTA 1A4PA 3WNXB 1AP4A 2PSRA 1YVHA 5I2QA 4XJKB 1RECA 1AUIB 3OP0A 4N1FA 2GV5A 1WLZA 3DVMA 1QVIY 2JWWA 1BODA 4PE4A 1Y0VH 3PALA 4OKHA 3SG6A 1IKUA 1K90D 3QRXA 4GNKB 1EG4A 2LMTA 2COLB 1A29A 2I18A 5I2LA 2ZNEA 2L5XB 4GBAA 1RWYA 1NPQA 2KI6C 1XO5A 1XFVO 3CLNA 4HRGA 2KFGA 1UHHA 4MBEA 1TIZA 1DJYA 1CFPA 1R6PA 1ZACA 1QX2A 1WDCC 5DKNA 2MBXA 4ORBB 4XJKA 4JQ0D 2L0PA 1YVLA 5HYDA 3EK7A 1LA3A 3I5IC 4PE7A 3FIAA 2BCBA 5JJGA 3CZTX 3OX6A 1S36A 1YX7A 2JRFA 5F6TA 4MZJA 2WC8A 3I5HC 1L7ZA 1S6IA 3ICBA 2BKIB 2PRUA 2AAOA 2R2IA 4I5KA 1SNLA 1DVIA 2CBLA 3E3RA 1CDNA 1KSMA 1SR6C 5KSZA 3SG5A 1WDCB 1SMGA 1WRLA 4NDCA 2RGIA 1S5GY 5ER5A 2OTGC 1IJ6A 1TRFA 4PCWA 1CFCA 3I5IB 1V1FA 4C0JA 5FYXA 1ALWA 1JUOA 1PVAA 2K2FA 4TNCA 4YGCB 2KAYA 3BUOB 1UWOA 2JPTA 2KFHA 2SASA 1LXFC 1QJTA 3EVUA 5K89A 1S3PA 1JF0A 1KFUL 2MHHA 2F2PA 5CSJA 1TOPA 4YI9A 1SR6B 4DCKA 1QV1A 3TDUA 1AK8A 1TNQA 1K9KA 2BCAA 2PASA 1YX8A 2OTGB 3LK0A 3GK2A 2CNPA 1UHJA 1MXLC 2MRDA 5B8IB 1RK9A 2F3YA 1NSHA 2M7LA 3JTDC 2NXQA 3JVTC 4PHNA 1S6CA 4GGFA 1XFYO 2I94A 3C1VA 3EVVA 4FQOA 1GGWA 1SKTA 1J7RA 4L9MA 4Q04A 2OS8C 1QLSA 1JC2A 4U8DA 1SCVA 1LKJA 3PATA 1YRUB 1QIWA 3TZ1A 2L50A 4DS7A 1CLLA 3BOWA 4MRYA 2VRGA 1XK4C 3A4UB 3O2PA 2AUCA 3O78A 3JTDB 3JVTB 4MZKA 2LUCA 1OOJA 4OV2A 2BKHB 2MLFC 1TN4A 1YUTA 5ER4X 1Y1XA 2KYFA 2OS8B 3I5GC 3HX4A 2JNFA 2LVVA 5G08A 1DJHA 1NX1A 2IS9A 2KI4C 4FTGA 1DMOA 2KQYA 3OX5A 2LLUA 2LMVA 3DVEA 1CFDA 3SG7A 2F8PA 2L4HA 3TUYC 3H4SE 1ALVA 4GPLB 2M1KB 3SIBA 1EH2A 4P5OE 1SCMC 2M8UA 5BPJA 1S6JA 3VGOA 3WHUB 4R1EA 1J7OA 2FCEA 2F2OA 1RROA 3I5GB 3IQOA 3D0YB 1W7IB 2KI4B 2CCMA 4YRUA 1DT7B 3ZWHA 2ZRSA 4MVFA 5D7FA 1XFXO 3TUYB 2KAXA 1M39A 1PULA 2JT3A 2LE9B 1R2UA 1CM1A 4AQJA 5D69A 3FWBA 2L98A 1A03A 4OCIA 3BUWB 3BYAA 1UHNA 1UP5A 4YGDB 1KQMC 1BR1B 4E68A 1BG1A 2LHIA 1WY9A 1CNPA 2E30A 3AKBA 1XVJA 3CTNA 3NSKA 4ETOA 2G9BA 4ORAB 5DKRA 3PFVA 4JPZB 2JT8A 1VRKA 2EHBA 3CR5X 3DVKA 5AXIA 1JFJA 4AOMA 1F55A 4A4BA 5GQQC 3EK8A 5KU1A 1KQMB 1BU3A 2KGRA 2Y1MA 3OB2B 4C0LA 2LV7A 2WORA 5KTYA 3BXKA 1CMGA 2P6BB 3AKAA 3FS7A 4PDZA 3ZNIA 2CXJA 2M9GA 3VROA 4NDBA 5HKZA 5CSNA 4DRWA 2O5GA 4C0KA 3FWCA 1J7QA 3F45A 1BR4B 1DJGA 1G33A 2H2KA 1IRJA 1PSRA 1QS7A 1RTP1 2LANA 1CM4A 1KK7Z 3TDIA 1C7VA 1HT9A 1YR5A 4YBHB 4UPGA 1HQVA 1ODBA 2KBMA 1W7JB 2BE6A 3PLFB 3EK4A 1NX2A 3I5HB 2KOTA 3DF0B 3IF7A 1S1EA 2D8NA 2BECA 3LL8B 3M0WA 4GUKA 4MZLA 4ICBA 1IQ5A 1QTXA 5HKYA 1SBJA 2KDHA 1EXRA 1IQ3A 2LP3A 3NXAA 2ZN9A 3VRQA 2G2BA 1K96A 4PHMA 4YGEB 1SL9A 1A75B 1J1DA 2L2EA 3D10A 2MJWB 1PSBA 3OHMB 2L4IA 1F8HA 1K8UA 2EC6C 1MUXA 1NIWA 2HPSA 4PHJA 1LINA 3LCPC 5PALA 1QX5B 2DOQA 1OSAA 2FJUB 3KPXA 3NSOA 1FI6A 1JSAA 2LMUA 1MR8A 2LLTA 2M49B 2I2RE 1CLBA 2M7NA 1C07A 1L2OC 2ZN8A 1LVCD 2BL0C 4YGAA 1IJ5A 1NX0A 3LK1A 2ZKMX 4M2OA 1XFWO 2OPOA 1M63B 1CFFA 3PN7C 1FF1A 2KBIA 3GK4X 3O4YA 1AVSA 4HRHA 1N2DA 3SJSA 2EC6B 3RLZA 1ZMZA 2K0JA 4QJ4B 1RFJA 2LVJA 4ZCVA 2M97A 2PMYA 3LLEA 1KK7Y 2BBNA 1L2OB 2PALA 1FBVA 1XFUO 5AFPA 4PALA 2BL0B 2LUXA 1EL4A 4YI8A 2AMIA 1CDLA 5JOLA 2L51A 2LP2A 4N1GA
chains in the Genus database with same CATH superfamily
3PN7B 2WC5A 1AJ4A 1QV0A 2WNDA 3EVRA 1CDPA 3CWGA 1TNXA 2JTTA 3D73A 1DELA 4PE1A 4DIRA 2JT0A 2H61C 1JWDA 1KCYA 1CB1A 2O60A 2K61A 3VRPA 1Y6WA 1X02A 1J55A 2Q4UA 3N7HA 1OW4A 2LLSA 3CGAA 1GM0A 1K9UA 1SYMA 1YURA 3V2LA 2BBMA 1SK6D 2WOSA 1PVBA 1V1GA 5FI7A 4IL1A 1BLQA 3WXAA 2KAVA 2K7DA 2I7AA 3QMEA 1KK8C 3BUMB 2TN4A 2JOJA 1DJWA 1XK4A 1OQPA 2JU0A 1MWNA 1SRAA 1F71A 2QDIA 1DF0B 4N5XA 1BOCA 2K8MB 3VRRA 3CS1A 1U5IB 3TS5C 1NCYA 1SCMB 3MSEB 2M0RA 1DGUA 1S26D 2LHLA 1GQMA 2SCPA 2K7BA 4F0ZB 2JZIA 1F4OA 4OR9B 2NLNA 3D0YA 3S0EA 1B4CA 3A8RA 1FPWA 1KFXS 1IGVA 1KK8B 1TUJA 2BE4A 4FQTA 4PHKA 1Q80A 1YUSA 3NSIA 2BNXA 1C3YA 3GOFA 4CIDA 4F7FA 1PRWA 1DGVA 1EJ3A 2K7CA 2KFFA 1IG5A 4M2QA 1Y1UA 2BCXA 2LCPA 2ZRTA 4IJ7A 4INXA 4WQ3A 3SS5A 3TS5B 1CKKA 1NUBA 2L2CA 3DY9A 3BFAA 1K9PA 4NQGA 4I5NB 3KEVA 1KWOC 2GGMA 1WRZA 2NCPA 3AAJA 1M46A 1MHOA 3AAKA 4D1EA 2K2AA 2NCOA 2LVKA 3DVJA 3K21A 2KNEA 4CFRA 1YUUA 2M29A 1DJXA 1ZOTB 4GAOA 3DD4A 3D78A 4MSPA 5TNCA 2B1UA 5CSIA 1NP8A 1JFKA 3D75A 4BY4A 1SL8A 1EG3A 2MAZA 2ZFDA 3KHEA 3S0GA 1W9ZA 1D1OA 4M2PA 1OMRA 1MXEA 1PK0D 2MA2A 1Z4HA 3KO0A 5I8NA 1ZFSA 3CR2A 3O6BA 1NCXA 1QX7A 1KWOB 2FCDA 1QATA 3DZTA 1F54A 2GTEA 1TNPA 1UURA 4I5LB 2KHNA 4JWQA 1TCFA 1YRTB 2F33A 3WHTB 2WCEA 3EKHA 1K94A 4QJ3B 1B47A 4GGFC 2F3ZA 2GGZA 4HSZA 1B8RA 1CLMA 1OOIX 2ZNDA 1DC1A 1XA5A 1AJ5A 3BUNB 1PALA 4BY5A 1WLMA 1SL7A 1JBAA 1F70A 2E6WA 2HF5A 1Y1AA 1SY9A 3PSRA 1QASA 2CTNA 1IWQA 1UHKA 3GK1A 4GGNA 5CSFA 4ORCB 1A2XA 1G4YR 5HLVA 4CFQA 4NDDA 4WRIA 1J7PA 4CLNA 2LAPA 3DF0A 1N0YA 2JNXA 1B7TZ 4OVNF 1OZSA 3S0BA 1B8CA 3IQQA 2PYQA 3I5FC 2QEHA 1KSOA 1TCOB 4WQ2A 4DUQA 1BJFA 1SPYA 1KQVA 3TDZA 2PVBA 3HCMA 2CT9A 1A75A 5J3XA 1JF2A 1DQEA 2HQ8A 1BT6A 3BOWB 2V53A 4ZCUA 1F4QA 2JC2A 3B87A 2K7OA 3PM2A 4QJ5B 5AEQA 2FOTA 2JXLA 1NWDA 1M31A 2EGDA 1SSEB 2LVIA 5AANA 2WCBA 3FE8A 4PT1A 3I5FB 1DJZA 2M1UA 4MEWA 1XFRA 4CPVA 1LA0A 2QPTA 1TTXA 1N65A 3SG4A 3B6XA 1QLKA 2HQWA 2P71A 4MN0A 2LNKA 1K93D 1CDMA 1KFUS 2Y4QA 1QVIZ 2A4JA 2KYCA 3CR4X 2ISDA 1K2HA 3DXLA 1MF8B 4MRXA 4OZDA 3SIAA 1YTZC 1NX3A 2MLEC 3OB1B 4AQIA 5I2OA 1CMFA 4YGBB 3SG2A 3CZ0A 2WCHA 1UUSA 3PM8A 1B8LA 4HREE 3EG5B 1WRKA 1KFXL 2KSPA 1B1GA 1M45A 2KQ6A 5CPVA 1FW4A 4XYNA 1XYDA 5HKWA 1K95A 2JULA 1DTLA 1OZOA 1QIVA 1H4BA 3NHTA 5DKQA 1SW8A 3BQ3A 1UHIA 1AHRA 2WCKA 3RM1A 5FI2A 1B7TY 2QEVA 4I5JA 1H8BA 5AERA 2NZ0A 1OMVA 4PE0A 3UO9A 2JTZA 3NSLA 2LM5A 1RJVA 3KF9A 5HLOA 1B9AA 1NCZA 5DICA 1ZUZA 2QACA 3SG3A 2JQ6A 1QXPA 1MQ1A 3VRNA 1OMDA 2HETA 1G8IA 1CTRA 2LC5A 3BFBA 4MLWA 1TNWA 2M3WA 1E8AA 1S5GZ 3EKJA 1XFZO 1OE9B 2QEBA 2JXCA 2KGBC 4P2YB 5IBWA 1DF0A 1J1EA 2H61A 1BF5A 1IH0A 1GJYA 4USLA 4A4CA 1TUZA 2H8VA 1C7WA 1DJIA 1GGZA 2KI6D 1U5IA 1BMOA 2WCFA 3BUXB 2Q91A 4JD9A 2Y5IA 2Y1NA 1NYAA 4GFTA 3VB1A 1A4PA 3WNXB 1AP4A 2PSRA 1YVHA 3L4LA 5I2QA 4XJKB 1RECA 1AUIB 3OP0A 4N1FA 2GV5A 1WLZA 3DVMA 1QVIY 2JWWA 1BODA 4PE4A 1Y0VH 3PALA 4OKHA 3SG6A 1IKUA 1K90D 3QRXA 4GNKB 1EG4A 2LMTA 2COLB 1A29A 2I18A 5I2LA 2ZNEA 2L5XB 4GBAA 1RWYA 1NPQA 2KI6C 1XO5A 1XFVO 3CLNA 4HRGA 2KFGA 1UHHA 4MBEA 1TIZA 1DJYA 2P70A 1CFPA 1R6PA 1ZACA 1QX2A 1WDCC 5DKNA 3CYZA 2MBXA 4ORBB 4XJKA 3SS3A 4JQ0D 2L0PA 1YVLA 5HYDA 3EK7A 1LA3A 2KLDA 3B88A 3CZ2A 3I5IC 4PE7A 3FIAA 2BCBA 5JJGA 3CZTX 3OX6A 1S36A 1YX7A 2JRFA 5F6TA 3CABA 4MZJA 2WC8A 3I5HC 1L7ZA 1S6IA 3ICBA 2BKIB 2PRUA 2AAOA 2K60A 2R2IA 4I5KA 1SNLA 2KPHA 1DVIA 3R1OA 2CBLA 3E3RA 1ORGA 1CDNA 1KSMA 1SR6C 5KSZA 3SG5A 1WDCB 1SMGA 1WRLA 4NDCA 2RGIA 1S5GY 5ER5A 2OTGC 1IJ6A 1TRFA 4PCWA 1CFCA 3I5IB 1V1FA 4C0JA 1C3ZA 5FYXA 1ALWA 1JUOA 1PVAA 2K2FA 4TNCA 4YGCB 2KAYA 3BUOB 1UWOA 1DEKA 2JPTA 2KFHA 2SASA 3SS4A 1LXFC 1QJTA 3EVUA 5K89A 1OOFA 1S3PA 1JF0A 1KFUL 2MHHA 3OBVA 2F2PA 5CSJA 1TOPA 4YI9A 1SR6B 4DCKA 1QV1A 3TDUA 1AK8A 1TNQA 1K9KA 2BCAA 2PASA 1YX8A 2OTGB 3LK0A 3GK2A 2CNPA 1UHJA 2PQLA 1MXLC 2MRDA 5B8IB 1RK9A 3O4XA 2F3YA 3NGVA 1NSHA 2M7LA 1P28A 3JTDC 2NXQA 3JVTC 4PHNA 1S6CA 4GGFA 1XFYO 2I94A 3C1VA 3EVVA 4FQOA 1GGWA 1SKTA 1J7RA 3OGNA 3Q8IA 4L9MA 4Q04A 2OS8C 1QLSA 1JC2A 4U8DA 1SCVA 1LKJA 3PATA 5HL1A 1YRUB 1QIWA 3TZ1A 2L50A 4DS7A 1CLLA 3BOWA 4MRYA 2VRGA 1XK4C 3A4UB 3O2PA 2AUCA 3O78A 1OOHA 5D3OA 3JTDB 3JVTB 3D76A 4MZKA 2LUCA 1OOJA 4OV2A 2BKHB 2MLFC 1TN4A 1YUTA 5ER4X 1Y1XA 2KYFA 2OS8B 3I5GC 3HX4A 2JNFA 2LVVA 5G08A 1DJHA 1NX1A 2IS9A 2KI4C 4FTGA 1DMOA 2KQYA 3OX5A 2LLUA 2LMVA 3DVEA 1CFDA 3R1VA 3SG7A 2F8PA 4JKTA 2L4HA 3TUYC 3H4SE 3CZ1A 1ALVA 4GPLB 2M1KB 3SIBA 1EH2A 2WCJA 4P5OE 1SCMC 2M8UA 5BPJA 1S6JA 3VGOA 3WHUB 2QEOA 4R1EA 1J7OA 2FCEA 3DYEA 2F2OA 1RROA 3I5GB 3IQOA 3D0YB 1W7IB 2KI4B 1LS8A 2YGUA 2CCMA 3R1PA 4YRUA 1DT7B 3ZWHA 2ZRSA 4MVFA 5D7FA 1XFXO 3TUYB 2KAXA 5EL2A 1M39A 1PULA 2JT3A 3FE9A 2LE9B 1R2UA 1CM1A 4AQJA 1TWOA 5D69A 3FWBA 2L98A 1A03A 4OCIA 3BUWB 3BYAA 1UHNA 1UP5A 3B86A 1KQMC 3D77A 1BR1B 4YGDB 4E68A 1BG1A 2LHIA 1WY9A 2WC6A 5I94A 1CNPA 2E30A 3AKBA 1XVJA 3CTNA 3NSKA 4ETOA 2G9BA 4ORAB 5DKRA 3K1EA 2L5YA 3PFVA 1IIOA 1QWVA 4JPZB 3S0DA 2JT8A 1VRKA 2EHBA 3CR5X 3DVKA 5AXIA 1JFJA 4AOMA 1F55A 4A4BA 5GQQC 3EK8A 3L47A 5KU1A 1KQMB 1BU3A 2KGRA 2Y1MA 3OB2B 4C0LA 2LV7A 2WORA 5KTYA 2KLEA 3BXKA 1CMGA 2P6BB 3AKAA 3FS7A 4PDZA 3ZNIA 2CXJA 1Z2CB 2M9GA 4INWA 3VROA 4NDBA 5HKZA 5CSNA 4DRWA 2O5GA 4C0KA 3FWCA 1J7QA 3F45A 1BR4B 1DJGA 1G33A 2H2KA 4KYNA 2ERBA 1IRJA 3S0AA 1PSRA 1QS7A 2JPOA 1RTP1 2LANA 1KK7Z 3TDIA 1OOGA 1C7VA 1HT9A 1YR5A 4YBHB 4UPGA 1HQVA 1ODBA 5FI6A 2KBMA 1W7JB 2BE6A 2FJYA 3PLFB 3EK4A 1NX2A 3I5HB 2KOTA 3DF0B 3IF7A 1S1EA 2D8NA 2BECA 3LL8B 2AMIA 3M0WA 4GUKA 4MZLA 4ICBA 1IQ5A 1QTXA 3NHIA 1SBJA 2KDHA 5HKYA 1EXRA 1IQ3A 2LP3A 2WCLA 2ZN9A 3NXAA 2G2BA 3VRQA 1K96A 4PHMA 4YGEB 1SL9A 3B7AA 1A75B 2BAPA 1J1DA 2L2EA 1T14A 3D10A 2MJWB 1PSBA 3OHMB 2L4IA 1F8HA 1K8UA 2EC6C 3R72A 1MUXA 1NIWA 2HPSA 4PHJA 3CDNA 1LINA 3RZSA 3LCPC 5PALA 1QX5B 2DOQA 1OSAA 2FJUB 3BJHA 3KPXA 3NSOA 1FI6A 1JSAA 2LMUA 1MR8A 2LLTA 2M49B 2I2RE 3D74A 2M7NA 1CLBA 1C07A 3S0FA 1L2OC 2ZN8A 1LVCD 2BL0C 4YGAA 1IJ5A 1NX0A 3LK1A 2ZKMX 3FE6A 4M2OA 1XFWO 2OPOA 1M63B 1CFFA 3PN7C 1FF1A 2KBIA 1FI5A 3GK4X 3L4AA 1AVSA 3O4YA 1N2DA 4HRHA 3SJSA 2EC6B 2WCMA 3RLZA 1ZMZA 2K0JA 4QJ4B 3UNWA 1RFJA 3IVTA 3BFHA 2LVJA 4ZCVA 2M97A 2PMYA 3PJIA 3LLEA 1KK7Y 2BBNA 1L2OB 2PALA 1FBVA 1XFUO 5AFPA 4PALA 2BL0B 2LUXA 1EL4A 4YI8A 1CM4A 1CDLA 5JOLA 2L51A 2LP2A 4N1GA
chains in the Genus database with same CATH topology
3PN7B 1AJ4A 1QV0A 2WNDA 3EVRA 1CDPA 3CWGA 1TNXA 2JTTA 4PE1A 4DIRA 2JT0A 2H61C 1JWDA 1KCYA 1CB1A 2O60A 2K61A 3VRPA 1Y6WA 1X02A 1J55A 2Q4UA 2LLSA 3CGAA 1K9UA 1SYMA 1YURA 2BBMA 1SK6D 2WOSA 1PVBA 1V1GA 1BLQA 4IL1A 3WXAA 2KAVA 2K7DA 2I7AA 1KK8C 3BUMB 2TN4A 2JOJA 1DJWA 1XK4A 1OQPA 2JU0A 1MWNA 1SRAA 1F71A 1DF0B 4N5XA 1BOCA 2K8MB 3VRRA 3CS1A 1U5IB 3TS5C 1NCYA 1SCMB 3MSEB 2M0RA 1DGUA 1S26D 2LHLA 1GQMA 2SCPA 2K7BA 4F0ZB 2JZIA 1F4OA 4OR9B 2NLNA 3D0YA 1B4CA 3A8RA 1FPWA 1KFXS 1IGVA 1KK8B 2BE4A 4PHKA 1Q80A 1YUSA 3NSIA 3GOFA 4CIDA 1PRWA 1DGVA 1EJ3A 2K7CA 2KFFA 1IG5A 4M2QA 1Y1UA 2BCXA 2LCPA 2ZRTA 4WQ3A 1CKKA 3TS5B 1NUBA 1K9PA 4NQGA 4I5NB 3KEVA 1KWOC 2GGMA 1WRZA 2NCPA 3AAJA 1M46A 1MHOA 3AAKA 4D1EA 2K2AA 2NCOA 2LVKA 3DVJA 3K21A 2KNEA 4CFRA 1YUUA 2M29A 1DJXA 1ZOTB 4GAOA 3DD4A 4MSPA 5TNCA 2B1UA 5CSIA 1NP8A 1JFKA 4BY4A 1SL8A 1EG3A 2MAZA 2ZFDA 3KHEA 1D1OA 4M2PA 1OMRA 1MXEA 1PK0D 2MA2A 3KO0A 5I8NA 1ZFSA 3CR2A 3O6BA 1NCXA 1QX7A 1KWOB 2FCDA 1QATA 1F54A 1TNPA 1UURA 4I5LB 2KHNA 4JWQA 1TCFA 1YRTB 2F33A 3WHTB 2WCEA 3EKHA 1K94A 4QJ3B 1B47A 4GGFC 2F3ZA 2GGZA 4HSZA 1B8RA 1CLMA 2ZNDA 1XA5A 1AJ5A 3BUNB 1PALA 4BY5A 1WLMA 1SL7A 1JBAA 1F70A 2E6WA 2HF5A 1Y1AA 1SY9A 3PSRA 1QASA 2CTNA 1IWQA 1UHKA 3GK1A 4GGNA 5CSFA 4ORCB 1A2XA 1G4YR 5HLVA 4CFQA 4NDDA 4WRIA 1J7PA 4CLNA 2LAPA 3DF0A 1N0YA 2JNXA 1B7TZ 4OVNF 1OZSA 1B8CA 3IQQA 3I5FC 1KSOA 1TCOB 4WQ2A 4DUQA 1BJFA 1SPYA 1KQVA 3TDZA 2PVBA 3HCMA 2CT9A 1A75A 5J3XA 1JF2A 2HQ8A 1BT6A 3BOWB 2V53A 4ZCUA 1F4QA 2JC2A 4QJ5B 2K7OA 5AEQA 2FOTA 2JXLA 1NWDA 1M31A 2EGDA 2LVIA 5AANA 2WCBA 3I5FB 1DJZA 2M1UA 4MEWA 4CPVA 1LA0A 2QPTA 1TTXA 1N65A 3SG4A 1QLKA 2HQWA 4MN0A 2LNKA 1K93D 1CDMA 1KFUS 2Y4QA 1QVIZ 2A4JA 2KYCA 3CR4X 2ISDA 1K2HA 1MF8B 4MRXA 3SIAA 1YTZC 1NX3A 2MLEC 3OB1B 4AQIA 5I2OA 1CMFA 4YGBB 3SG2A 1UUSA 3PM8A 1B8LA 4HREE 1WRKA 1KFXL 2KSPA 1B1GA 1M45A 2KQ6A 5CPVA 1FW4A 4XYNA 1XYDA 5HKWA 1K95A 2JULA 1DTLA 1OZOA 1QIVA 1H4BA 5DKQA 1SW8A 3BQ3A 1UHIA 1AHRA 3RM1A 1B7TY 1H8BA 4I5JA 5AERA 2NZ0A 1OMVA 4PE0A 2JTZA 3NSLA 2LM5A 1RJVA 3KF9A 5HLOA 1B9AA 1NCZA 1ZUZA 2QACA 3SG3A 2JQ6A 1QXPA 1MQ1A 3VRNA 1OMDA 2HETA 1G8IA 1CTRA 2LC5A 4MLWA 1TNWA 2M3WA 1E8AA 1S5GZ 3EKJA 1XFZO 1OE9B 2JXCA 2KGBC 4P2YB 5IBWA 1DF0A 1J1EA 2H61A 1BF5A 1IH0A 1GJYA 4USLA 4A4CA 2KI6D 1FI5A 1C7WA 1DJIA 1GGZA 1U5IA 1BMOA 2WCFA 3BUXB 2Q91A 2Y5IA 2Y1NA 1NYAA 4GFTA 1A4PA 3WNXB 1AP4A 2PSRA 1YVHA 5I2QA 4XJKB 1RECA 1AUIB 3OP0A 4N1FA 2GV5A 1WLZA 3DVMA 1QVIY 2JWWA 1BODA 4PE4A 1Y0VH 3PALA 4OKHA 3SG6A 1IKUA 1K90D 3QRXA 4GNKB 1EG4A 2LMTA 2COLB 1A29A 2I18A 5I2LA 2ZNEA 2L5XB 4GBAA 1RWYA 1NPQA 2KI6C 1XO5A 1XFVO 3CLNA 4HRGA 2KFGA 1UHHA 4MBEA 1TIZA 1DJYA 1CFPA 1R6PA 1ZACA 1QX2A 1WDCC 5DKNA 2MBXA 4ORBB 4XJKA 4JQ0D 2L0PA 1YVLA 5HYDA 3EK7A 1LA3A 3I5IC 4PE7A 3FIAA 2BCBA 5JJGA 3CZTX 3OX6A 1S36A 1YX7A 2JRFA 5F6TA 4MZJA 2WC8A 3I5HC 1L7ZA 1S6IA 3ICBA 2BKIB 2PRUA 2AAOA 2R2IA 4I5KA 1SNLA 1DVIA 2CBLA 3E3RA 1CDNA 1KSMA 1SR6C 5KSZA 3SG5A 1WDCB 1SMGA 1WRLA 4NDCA 2RGIA 1S5GY 5ER5A 2OTGC 1IJ6A 1TRFA 4PCWA 1CFCA 3I5IB 1V1FA 4C0JA 5FYXA 1ALWA 1JUOA 1PVAA 2K2FA 4TNCA 4YGCB 2KAYA 3BUOB 1UWOA 2JPTA 2KFHA 2SASA 1LXFC 1QJTA 3EVUA 5K89A 1S3PA 1JF0A 1KFUL 2MHHA 2F2PA 5CSJA 1TOPA 4YI9A 1SR6B 4DCKA 1QV1A 3TDUA 1AK8A 1TNQA 1K9KA 2BCAA 2PASA 1YX8A 2OTGB 3LK0A 3GK2A 2CNPA 1UHJA 1MXLC 2MRDA 5B8IB 1RK9A 2F3YA 1NSHA 2M7LA 3JTDC 2NXQA 3JVTC 4PHNA 1S6CA 4GGFA 1XFYO 2I94A 3C1VA 3EVVA 4FQOA 1GGWA 1SKTA 1J7RA 4L9MA 4Q04A 2OS8C 1QLSA 1JC2A 4U8DA 1SCVA 1LKJA 3PATA 1YRUB 1QIWA 3TZ1A 2L50A 4DS7A 1CLLA 3BOWA 4MRYA 2VRGA 1XK4C 3A4UB 3O2PA 2AUCA 3O78A 3JTDB 3JVTB 4MZKA 2LUCA 1OOJA 4OV2A 2BKHB 2MLFC 1TN4A 1YUTA 5ER4X 1Y1XA 2KYFA 2OS8B 3I5GC 3HX4A 2JNFA 2LVVA 5G08A 1DJHA 1NX1A 2IS9A 2KI4C 4FTGA 1DMOA 2KQYA 3OX5A 2LLUA 2LMVA 3DVEA 1CFDA 3SG7A 2F8PA 2L4HA 3TUYC 3H4SE 1ALVA 4GPLB 2M1KB 3SIBA 1EH2A 4P5OE 1SCMC 2M8UA 5BPJA 1S6JA 3VGOA 3WHUB 4R1EA 1J7OA 2FCEA 2F2OA 1RROA 3I5GB 3IQOA 3D0YB 1W7IB 2KI4B 2CCMA 4YRUA 1DT7B 3ZWHA 2ZRSA 4MVFA 5D7FA 1XFXO 3TUYB 2KAXA 1M39A 1PULA 2JT3A 2LE9B 1R2UA 1CM1A 4AQJA 5D69A 3FWBA 2L98A 1A03A 4OCIA 3BUWB 3BYAA 1UHNA 1UP5A 4YGDB 1KQMC 1BR1B 4E68A 1BG1A 2LHIA 1WY9A 1CNPA 2E30A 3AKBA 1XVJA 3CTNA 3NSKA 4ETOA 2G9BA 4ORAB 5DKRA 3PFVA 4JPZB 2JT8A 1VRKA 2EHBA 3CR5X 3DVKA 5AXIA 1JFJA 4AOMA 1F55A 4A4BA 5GQQC 3EK8A 5KU1A 1KQMB 1BU3A 2KGRA 2Y1MA 3OB2B 4C0LA 2LV7A 2WORA 5KTYA 3BXKA 1CMGA 2P6BB 3AKAA 3FS7A 4PDZA 3ZNIA 2CXJA 2M9GA 3VROA 4NDBA 5HKZA 5CSNA 4DRWA 2O5GA 4C0KA 3FWCA 1J7QA 3F45A 1BR4B 1DJGA 1G33A 2H2KA 1IRJA 1PSRA 1QS7A 1RTP1 2LANA 1CM4A 1KK7Z 3TDIA 1C7VA 1HT9A 1YR5A 4YBHB 4UPGA 1HQVA 1ODBA 2KBMA 1W7JB 2BE6A 3PLFB 3EK4A 1NX2A 3I5HB 2KOTA 3DF0B 3IF7A 1S1EA 2D8NA 2BECA 3LL8B 3M0WA 4GUKA 4MZLA 4ICBA 1IQ5A 1QTXA 5HKYA 1SBJA 2KDHA 1EXRA 1IQ3A 2LP3A 3NXAA 2ZN9A 3VRQA 2G2BA 1K96A 4PHMA 4YGEB 1SL9A 1A75B 1J1DA 2L2EA 3D10A 2MJWB 1PSBA 3OHMB 2L4IA 1F8HA 1K8UA 2EC6C 1MUXA 1NIWA 2HPSA 4PHJA 1LINA 3LCPC 5PALA 1QX5B 2DOQA 1OSAA 2FJUB 3KPXA 3NSOA 1FI6A 1JSAA 2LMUA 1MR8A 2LLTA 2M49B 2I2RE 1CLBA 2M7NA 1C07A 1L2OC 2ZN8A 1LVCD 2BL0C 4YGAA 1IJ5A 1NX0A 3LK1A 2ZKMX 4M2OA 1XFWO 2OPOA 1M63B 1CFFA 3PN7C 1FF1A 2KBIA 3GK4X 3O4YA 1AVSA 4HRHA 1N2DA 3SJSA 2EC6B 3RLZA 1ZMZA 2K0JA 4QJ4B 1RFJA 2LVJA 4ZCVA 2M97A 2PMYA 3LLEA 1KK7Y 2BBNA 1L2OB 2PALA 1FBVA 1XFUO 5AFPA 4PALA 2BL0B 2LUXA 1EL4A 4YI8A 2AMIA 1CDLA 5JOLA 2L51A 2LP2A 4N1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN7 B;  1AJ4 A;  1QV0 A;  2WND A;  3EVR A;  1CDP A;  3CWG A;  1TNX A;  2JTT A;  4PE1 A;  4DIR A;  2JT0 A;  2H61 C;  1JWD A;  1KCY A;  1CB1 A;  2O60 A;  2K61 A;  3VRP A;  1Y6W A;  1X02 A;  1J55 A;  2Q4U A;  2LLS A;  3CGA A;  1K9U A;  1SYM A;  1YUR A;  2BBM A;  1SK6 D;  2WOS A;  1PVB A;  1V1G A;  1BLQ A;  4IL1 A;  3WXA A;  2KAV A;  2K7D A;  2I7A A;  1KK8 C;  3BUM B;  2TN4 A;  2JOJ A;  1DJW A;  1XK4 A;  1OQP A;  2JU0 A;  1MWN A;  1SRA A;  1F71 A;  1DF0 B;  4N5X A;  1BOC A;  2K8M B;  3VRR A;  3CS1 A;  1U5I B;  3TS5 C;  1NCY A;  1SCM B;  3MSE B;  2M0R A;  1DGU A;  1S26 D;  2LHL A;  1GQM A;  2SCP A;  2K7B A;  4F0Z B;  2JZI A;  1F4O A;  4OR9 B;  2NLN A;  3D0Y A;  1B4C A;  3A8R A;  1FPW A;  1KFX S;  1IGV A;  1KK8 B;  2BE4 A;  4PHK A;  1Q80 A;  1YUS A;  3NSI A;  3GOF A;  4CID A;  1PRW A;  1DGV A;  1EJ3 A;  2K7C A;  2KFF A;  1IG5 A;  4M2Q A;  1Y1U A;  2BCX A;  2LCP A;  2ZRT A;  4WQ3 A;  1CKK A;  3TS5 B;  1NUB A;  1K9P A;  4NQG A;  4I5N B;  3KEV A;  1KWO C;  2GGM A;  1WRZ A;  2NCP A;  3AAJ A;  1M46 A;  1MHO A;  3AAK A;  4D1E A;  2K2A A;  2NCO A;  2LVK A;  3DVJ A;  3K21 A;  2KNE A;  4CFR A;  1YUU A;  2M29 A;  1DJX A;  1ZOT B;  4GAO A;  3DD4 A;  4MSP A;  5TNC A;  2B1U A;  5CSI A;  1NP8 A;  1JFK A;  4BY4 A;  1SL8 A;  1EG3 A;  2MAZ A;  2ZFD A;  3KHE A;  1D1O A;  4M2P A;  1OMR A;  1MXE A;  1PK0 D;  2MA2 A;  3KO0 A;  5I8N A;  1ZFS A;  3CR2 A;  3O6B A;  1NCX A;  1QX7 A;  1KWO B;  2FCD A;  1QAT A;  1F54 A;  1TNP A;  1UUR A;  4I5L B;  2KHN A;  4JWQ A;  1TCF A;  1YRT B;  2F33 A;  3WHT B;  2WCE A;  3EKH A;  1K94 A;  4QJ3 B;  1B47 A;  4GGF C;  2F3Z A;  2GGZ A;  4HSZ A;  1B8R A;  1CLM A;  2ZND A;  1XA5 A;  1AJ5 A;  3BUN B;  1PAL A;  4BY5 A;  1WLM A;  1SL7 A;  1JBA A;  1F70 A;  2E6W A;  2HF5 A;  1Y1A A;  1SY9 A;  3PSR A;  1QAS A;  2CTN A;  1IWQ A;  1UHK A;  3GK1 A;  4GGN A;  5CSF A;  4ORC B;  1A2X A;  1G4Y R;  5HLV A;  4CFQ A;  4NDD A;  4WRI A;  1J7P A;  4CLN A;  2LAP A;  3DF0 A;  1N0Y A;  2JNX A;  1B7T Z;  4OVN F;  1OZS A;  1B8C A;  3IQQ A;  3I5F C;  1KSO A;  1TCO B;  4WQ2 A;  4DUQ A;  1BJF A;  1SPY A;  1KQV A;  3TDZ A;  2PVB A;  3HCM A;  2CT9 A;  1A75 A;  5J3X A;  1JF2 A;  2HQ8 A;  1BT6 A;  3BOW B;  2V53 A;  4ZCU A;  1F4Q A;  2JC2 A;  4QJ5 B;  2K7O A;  5AEQ A;  2FOT A;  2JXL A;  1NWD A;  1M31 A;  2EGD A;  2LVI A;  5AAN A;  2WCB A;  3I5F B;  1DJZ A;  2M1U A;  4MEW A;  4CPV A;  1LA0 A;  2QPT A;  1TTX A;  1N65 A;  3SG4 A;  1QLK A;  2HQW A;  4MN0 A;  2LNK A;  1K93 D;  1CDM A;  1KFU S;  2Y4Q A;  1QVI Z;  2A4J A;  2KYC A;  3CR4 X;  2ISD A;  1K2H A;  1MF8 B;  4MRX A;  3SIA A;  1YTZ C;  1NX3 A;  2MLE C;  3OB1 B;  4AQI A;  5I2O A;  1CMF A;  4YGB B;  3SG2 A;  1UUS A;  3PM8 A;  1B8L A;  4HRE E;  1WRK A;  1KFX L;  2KSP A;  1B1G A;  1M45 A;  2KQ6 A;  5CPV A;  1FW4 A;  4XYN A;  1XYD A;  5HKW A;  1K95 A;  2JUL A;  1DTL A;  1OZO A;  1QIV A;  1H4B A;  5DKQ A;  1SW8 A;  3BQ3 A;  1UHI A;  1AHR A;  3RM1 A;  1B7T Y;  1H8B A;  4I5J A;  5AER A;  2NZ0 A;  1OMV A;  4PE0 A;  2JTZ A;  3NSL A;  2LM5 A;  1RJV A;  3KF9 A;  5HLO A;  1B9A A;  1NCZ A;  1ZUZ A;  2QAC A;  3SG3 A;  2JQ6 A;  1QXP A;  1MQ1 A;  3VRN A;  1OMD A;  2HET A;  1G8I A;  1CTR A;  2LC5 A;  4MLW A;  1TNW A;  2M3W A;  1E8A A;  1S5G Z;  3EKJ A;  1XFZ O;  1OE9 B;  2JXC A;  2KGB C;  4P2Y B;  5IBW A;  1DF0 A;  1J1E A;  2H61 A;  1BF5 A;  1IH0 A;  1GJY A;  4USL A;  4A4C A;  2KI6 D;  1FI5 A;  1C7W A;  1DJI A;  1GGZ A;  1U5I A;  1BMO A;  2WCF A;  3BUX B;  2Q91 A;  2Y5I A;  2Y1N A;  1NYA A;  4GFT A;  1A4P A;  3WNX B;  1AP4 A;  2PSR A;  1YVH A;  5I2Q A;  4XJK B;  1REC A;  1AUI B;  3OP0 A;  4N1F A;  2GV5 A;  1WLZ A;  3DVM A;  1QVI Y;  2JWW A;  1BOD A;  4PE4 A;  1Y0V H;  3PAL A;  4OKH A;  3SG6 A;  1IKU A;  1K90 D;  3QRX A;  4GNK B;  1EG4 A;  2LMT A;  2COL B;  1A29 A;  2I18 A;  5I2L A;  2ZNE A;  2L5X B;  4GBA A;  1RWY A;  1NPQ A;  2KI6 C;  1XO5 A;  1XFV O;  3CLN A;  4HRG A;  2KFG A;  1UHH A;  4MBE A;  1TIZ A;  1DJY A;  1CFP A;  1R6P A;  1ZAC A;  1QX2 A;  1WDC C;  5DKN A;  2MBX A;  4ORB B;  4XJK A;  4JQ0 D;  2L0P A;  1YVL A;  5HYD A;  3EK7 A;  1LA3 A;  3I5I C;  4PE7 A;  3FIA A;  2BCB A;  5JJG A;  3CZT X;  3OX6 A;  1S36 A;  1YX7 A;  2JRF A;  5F6T A;  4MZJ A;  2WC8 A;  3I5H C;  1L7Z A;  1S6I A;  3ICB A;  2BKI B;  2PRU A;  2AAO A;  2R2I A;  4I5K A;  1SNL A;  1DVI A;  2CBL A;  3E3R A;  1CDN A;  1KSM A;  1SR6 C;  5KSZ A;  3SG5 A;  1WDC B;  1SMG A;  1WRL A;  4NDC A;  2RGI A;  1S5G Y;  5ER5 A;  2OTG C;  1IJ6 A;  1TRF A;  4PCW A;  1CFC A;  3I5I B;  1V1F A;  4C0J A;  5FYX A;  1ALW A;  1JUO A;  1PVA A;  2K2F A;  4TNC A;  4YGC B;  2KAY A;  3BUO B;  1UWO A;  2JPT A;  2KFH A;  2SAS A;  1LXF C;  1QJT A;  3EVU A;  5K89 A;  1S3P A;  1JF0 A;  1KFU L;  2MHH A;  2F2P A;  5CSJ A;  1TOP A;  4YI9 A;  1SR6 B;  4DCK A;  1QV1 A;  3TDU A;  1AK8 A;  1TNQ A;  1K9K A;  2BCA A;  2PAS A;  1YX8 A;  2OTG B;  3LK0 A;  3GK2 A;  2CNP A;  1UHJ A;  1MXL C;  2MRD A;  5B8I B;  1RK9 A;  2F3Y A;  1NSH A;  2M7L A;  3JTD C;  2NXQ A;  3JVT C;  4PHN A;  1S6C A;  4GGF A;  1XFY O;  2I94 A;  3C1V A;  3EVV A;  4FQO A;  1GGW A;  1SKT A;  1J7R A;  4L9M A;  4Q04 A;  2OS8 C;  1QLS A;  1JC2 A;  4U8D A;  1SCV A;  1LKJ A;  3PAT A;  1YRU B;  1QIW A;  3TZ1 A;  2L50 A;  4DS7 A;  1CLL A;  3BOW A;  4MRY A;  2VRG A;  1XK4 C;  3A4U B;  3O2P A;  2AUC A;  3O78 A;  3JTD B;  3JVT B;  4MZK A;  2LUC A;  1OOJ A;  4OV2 A;  2BKH B;  2MLF C;  1TN4 A;  1YUT A;  5ER4 X;  1Y1X A;  2KYF A;  2OS8 B;  3I5G C;  3HX4 A;  2JNF A;  2LVV A;  5G08 A;  1DJH A;  1NX1 A;  2IS9 A;  2KI4 C;  4FTG A;  1DMO A;  2KQY A;  3OX5 A;  2LLU A;  2LMV A;  3DVE A;  1CFD A;  3SG7 A;  2F8P A;  2L4H A;  3TUY C;  3H4S E;  1ALV A;  4GPL B;  2M1K B;  3SIB A;  1EH2 A;  4P5O E;  1SCM C;  2M8U A;  5BPJ A;  1S6J A;  3VGO A;  3WHU B;  4R1E A;  1J7O A;  2FCE A;  2F2O A;  1RRO A;  3I5G B;  3IQO A;  3D0Y B;  1W7I B;  2KI4 B;  2CCM A;  4YRU A;  1DT7 B;  3ZWH A;  2ZRS A;  4MVF A;  5D7F A;  1XFX O;  3TUY B;  2KAX A;  1M39 A;  1PUL A;  2JT3 A;  2LE9 B;  1R2U A;  1CM1 A;  4AQJ A;  5D69 A;  3FWB A;  2L98 A;  1A03 A;  4OCI A;  3BUW B;  3BYA A;  1UHN A;  1UP5 A;  4YGD B;  1KQM C;  1BR1 B;  4E68 A;  1BG1 A;  2LHI A;  1WY9 A;  1CNP A;  2E30 A;  3AKB A;  1XVJ A;  3CTN A;  3NSK A;  4ETO A;  2G9B A;  4ORA B;  5DKR A;  3PFV A;  4JPZ B;  2JT8 A;  1VRK A;  2EHB A;  3CR5 X;  3DVK A;  5AXI A;  1JFJ A;  4AOM A;  1F55 A;  4A4B A;  5GQQ C;  3EK8 A;  5KU1 A;  1KQM B;  1BU3 A;  2KGR A;  2Y1M A;  3OB2 B;  4C0L A;  2LV7 A;  2WOR A;  5KTY A;  3BXK A;  1CMG A;  2P6B B;  3AKA A;  3FS7 A;  4PDZ A;  3ZNI A;  2CXJ A;  2M9G A;  3VRO A;  4NDB A;  5HKZ A;  5CSN A;  4DRW A;  2O5G A;  4C0K A;  3FWC A;  1J7Q A;  3F45 A;  1BR4 B;  1DJG A;  1G33 A;  2H2K A;  1IRJ A;  1PSR A;  1QS7 A;  1RTP 1;  2LAN A;  1CM4 A;  1KK7 Z;  3TDI A;  1C7V A;  1HT9 A;  1YR5 A;  4YBH B;  4UPG A;  1HQV A;  1ODB A;  2KBM A;  1W7J B;  2BE6 A;  3PLF B;  3EK4 A;  1NX2 A;  3I5H B;  2KOT A;  3DF0 B;  3IF7 A;  1S1E A;  2D8N A;  2BEC A;  3LL8 B;  3M0W A;  4GUK A;  4MZL A;  4ICB A;  1IQ5 A;  1QTX A;  5HKY A;  1SBJ A;  2KDH A;  1EXR A;  1IQ3 A;  2LP3 A;  3NXA A;  2ZN9 A;  3VRQ A;  2G2B A;  1K96 A;  4PHM A;  4YGE B;  1SL9 A;  1A75 B;  1J1D A;  2L2E A;  3D10 A;  2MJW B;  1PSB A;  3OHM B;  2L4I A;  1F8H A;  1K8U A;  2EC6 C;  1MUX A;  1NIW A;  2HPS A;  4PHJ A;  1LIN A;  3LCP C;  5PAL A;  1QX5 B;  2DOQ A;  1OSA A;  2FJU B;  3KPX A;  3NSO A;  1FI6 A;  1JSA A;  2LMU A;  1MR8 A;  2LLT A;  2M49 B;  2I2R E;  1CLB A;  2M7N A;  1C07 A;  1L2O C;  2ZN8 A;  1LVC D;  2BL0 C;  4YGA A;  1IJ5 A;  1NX0 A;  3LK1 A;  2ZKM X;  4M2O A;  1XFW O;  2OPO A;  1M63 B;  1CFF A;  3PN7 C;  1FF1 A;  2KBI A;  3GK4 X;  3O4Y A;  1AVS A;  4HRH A;  1N2D A;  3SJS A;  2EC6 B;  3RLZ A;  1ZMZ A;  2K0J A;  4QJ4 B;  1RFJ A;  2LVJ A;  4ZCV A;  2M97 A;  2PMY A;  3LLE A;  1KK7 Y;  2BBN A;  1L2O B;  2PAL A;  1FBV A;  1XFU O;  5AFP A;  4PAL A;  2BL0 B;  2LUX A;  1EL4 A;  4YI8 A;  2AMI A;  1CDL A;  5JOL A;  2L51 A;  2LP2 A;  4N1G A; 
#chains in the Genus database with same CATH topology
 3PN7 B;  2WC5 A;  1AJ4 A;  1QV0 A;  2WND A;  3EVR A;  1CDP A;  3CWG A;  1TNX A;  2JTT A;  3D73 A;  1DEL A;  4PE1 A;  4DIR A;  2JT0 A;  2H61 C;  1JWD A;  1KCY A;  1CB1 A;  2O60 A;  2K61 A;  3VRP A;  1Y6W A;  1X02 A;  1J55 A;  2Q4U A;  3N7H A;  1OW4 A;  2LLS A;  3CGA A;  1GM0 A;  1K9U A;  1SYM A;  1YUR A;  3V2L A;  2BBM A;  1SK6 D;  2WOS A;  1PVB A;  1V1G A;  5FI7 A;  4IL1 A;  1BLQ A;  3WXA A;  2KAV A;  2K7D A;  2I7A A;  3QME A;  1KK8 C;  3BUM B;  2TN4 A;  2JOJ A;  1DJW A;  1XK4 A;  1OQP A;  2JU0 A;  1MWN A;  1SRA A;  1F71 A;  2QDI A;  1DF0 B;  4N5X A;  1BOC A;  2K8M B;  3VRR A;  3CS1 A;  1U5I B;  3TS5 C;  1NCY A;  1SCM B;  3MSE B;  2M0R A;  1DGU A;  1S26 D;  2LHL A;  1GQM A;  2SCP A;  2K7B A;  4F0Z B;  2JZI A;  1F4O A;  4OR9 B;  2NLN A;  3D0Y A;  3S0E A;  1B4C A;  3A8R A;  1FPW A;  1KFX S;  1IGV A;  1KK8 B;  1TUJ A;  2BE4 A;  4FQT A;  4PHK A;  1Q80 A;  1YUS A;  3NSI A;  2BNX A;  1C3Y A;  3GOF A;  4CID A;  4F7F A;  1PRW A;  1DGV A;  1EJ3 A;  2K7C A;  2KFF A;  1IG5 A;  4M2Q A;  1Y1U A;  2BCX A;  2LCP A;  2ZRT A;  4IJ7 A;  4INX A;  4WQ3 A;  3SS5 A;  3TS5 B;  1CKK A;  1NUB A;  2L2C A;  3DY9 A;  3BFA A;  1K9P A;  4NQG A;  4I5N B;  3KEV A;  1KWO C;  2GGM A;  1WRZ A;  2NCP A;  3AAJ A;  1M46 A;  1MHO A;  3AAK A;  4D1E A;  2K2A A;  2NCO A;  2LVK A;  3DVJ A;  3K21 A;  2KNE A;  4CFR A;  1YUU A;  2M29 A;  1DJX A;  1ZOT B;  4GAO A;  3DD4 A;  3D78 A;  4MSP A;  5TNC A;  2B1U A;  5CSI A;  1NP8 A;  1JFK A;  3D75 A;  4BY4 A;  1SL8 A;  1EG3 A;  2MAZ A;  2ZFD A;  3KHE A;  3S0G A;  1W9Z A;  1D1O A;  4M2P A;  1OMR A;  1MXE A;  1PK0 D;  2MA2 A;  1Z4H A;  3KO0 A;  5I8N A;  1ZFS A;  3CR2 A;  3O6B A;  1NCX A;  1QX7 A;  1KWO B;  2FCD A;  1QAT A;  3DZT A;  1F54 A;  2GTE A;  1TNP A;  1UUR A;  4I5L B;  2KHN A;  4JWQ A;  1TCF A;  1YRT B;  2F33 A;  3WHT B;  2WCE A;  3EKH A;  1K94 A;  4QJ3 B;  1B47 A;  4GGF C;  2F3Z A;  2GGZ A;  4HSZ A;  1B8R A;  1CLM A;  1OOI X;  2ZND A;  1DC1 A;  1XA5 A;  1AJ5 A;  3BUN B;  1PAL A;  4BY5 A;  1WLM A;  1SL7 A;  1JBA A;  1F70 A;  2E6W A;  2HF5 A;  1Y1A A;  1SY9 A;  3PSR A;  1QAS A;  2CTN A;  1IWQ A;  1UHK A;  3GK1 A;  4GGN A;  5CSF A;  4ORC B;  1A2X A;  1G4Y R;  5HLV A;  4CFQ A;  4NDD A;  4WRI A;  1J7P A;  4CLN A;  2LAP A;  3DF0 A;  1N0Y A;  2JNX A;  1B7T Z;  4OVN F;  1OZS A;  3S0B A;  1B8C A;  3IQQ A;  2PYQ A;  3I5F C;  2QEH A;  1KSO A;  1TCO B;  4WQ2 A;  4DUQ A;  1BJF A;  1SPY A;  1KQV A;  3TDZ A;  2PVB A;  3HCM A;  2CT9 A;  1A75 A;  5J3X A;  1JF2 A;  1DQE A;  2HQ8 A;  1BT6 A;  3BOW B;  2V53 A;  4ZCU A;  1F4Q A;  2JC2 A;  3B87 A;  2K7O A;  3PM2 A;  4QJ5 B;  5AEQ A;  2FOT A;  2JXL A;  1NWD A;  1M31 A;  2EGD A;  1SSE B;  2LVI A;  5AAN A;  2WCB A;  3FE8 A;  4PT1 A;  3I5F B;  1DJZ A;  2M1U A;  4MEW A;  1XFR A;  4CPV A;  1LA0 A;  2QPT A;  1TTX A;  1N65 A;  3SG4 A;  3B6X A;  1QLK A;  2HQW A;  2P71 A;  4MN0 A;  2LNK A;  1K93 D;  1CDM A;  1KFU S;  2Y4Q A;  1QVI Z;  2A4J A;  2KYC A;  3CR4 X;  2ISD A;  1K2H A;  3DXL A;  1MF8 B;  4MRX A;  4OZD A;  3SIA A;  1YTZ C;  1NX3 A;  2MLE C;  3OB1 B;  4AQI A;  5I2O A;  1CMF A;  4YGB B;  3SG2 A;  3CZ0 A;  2WCH A;  1UUS A;  3PM8 A;  1B8L A;  4HRE E;  3EG5 B;  1WRK A;  1KFX L;  2KSP A;  1B1G A;  1M45 A;  2KQ6 A;  5CPV A;  1FW4 A;  4XYN A;  1XYD A;  5HKW A;  1K95 A;  2JUL A;  1DTL A;  1OZO A;  1QIV A;  1H4B A;  3NHT A;  5DKQ A;  1SW8 A;  3BQ3 A;  1UHI A;  1AHR A;  2WCK A;  3RM1 A;  5FI2 A;  1B7T Y;  2QEV A;  4I5J A;  1H8B A;  5AER A;  2NZ0 A;  1OMV A;  4PE0 A;  3UO9 A;  2JTZ A;  3NSL A;  2LM5 A;  1RJV A;  3KF9 A;  5HLO A;  1B9A A;  1NCZ A;  5DIC A;  1ZUZ A;  2QAC A;  3SG3 A;  2JQ6 A;  1QXP A;  1MQ1 A;  3VRN A;  1OMD A;  2HET A;  1G8I A;  1CTR A;  2LC5 A;  3BFB A;  4MLW A;  1TNW A;  2M3W A;  1E8A A;  1S5G Z;  3EKJ A;  1XFZ O;  1OE9 B;  2QEB A;  2JXC A;  2KGB C;  4P2Y B;  5IBW A;  1DF0 A;  1J1E A;  2H61 A;  1BF5 A;  1IH0 A;  1GJY A;  4USL A;  4A4C A;  1TUZ A;  2H8V A;  1C7W A;  1DJI A;  1GGZ A;  2KI6 D;  1U5I A;  1BMO A;  2WCF A;  3BUX B;  2Q91 A;  4JD9 A;  2Y5I A;  2Y1N A;  1NYA A;  4GFT A;  3VB1 A;  1A4P A;  3WNX B;  1AP4 A;  2PSR A;  1YVH A;  3L4L A;  5I2Q A;  4XJK B;  1REC A;  1AUI B;  3OP0 A;  4N1F A;  2GV5 A;  1WLZ A;  3DVM A;  1QVI Y;  2JWW A;  1BOD A;  4PE4 A;  1Y0V H;  3PAL A;  4OKH A;  3SG6 A;  1IKU A;  1K90 D;  3QRX A;  4GNK B;  1EG4 A;  2LMT A;  2COL B;  1A29 A;  2I18 A;  5I2L A;  2ZNE A;  2L5X B;  4GBA A;  1RWY A;  1NPQ A;  2KI6 C;  1XO5 A;  1XFV O;  3CLN A;  4HRG A;  2KFG A;  1UHH A;  4MBE A;  1TIZ A;  1DJY A;  2P70 A;  1CFP A;  1R6P A;  1ZAC A;  1QX2 A;  1WDC C;  5DKN A;  3CYZ A;  2MBX A;  4ORB B;  4XJK A;  3SS3 A;  4JQ0 D;  2L0P A;  1YVL A;  5HYD A;  3EK7 A;  1LA3 A;  2KLD A;  3B88 A;  3CZ2 A;  3I5I C;  4PE7 A;  3FIA A;  2BCB A;  5JJG A;  3CZT X;  3OX6 A;  1S36 A;  1YX7 A;  2JRF A;  5F6T A;  3CAB A;  4MZJ A;  2WC8 A;  3I5H C;  1L7Z A;  1S6I A;  3ICB A;  2BKI B;  2PRU A;  2AAO A;  2K60 A;  2R2I A;  4I5K A;  1SNL A;  2KPH A;  1DVI A;  3R1O A;  2CBL A;  3E3R A;  1ORG A;  1CDN A;  1KSM A;  1SR6 C;  5KSZ A;  3SG5 A;  1WDC B;  1SMG A;  1WRL A;  4NDC A;  2RGI A;  1S5G Y;  5ER5 A;  2OTG C;  1IJ6 A;  1TRF A;  4PCW A;  1CFC A;  3I5I B;  1V1F A;  4C0J A;  1C3Z A;  5FYX A;  1ALW A;  1JUO A;  1PVA A;  2K2F A;  4TNC A;  4YGC B;  2KAY A;  3BUO B;  1UWO A;  1DEK A;  2JPT A;  2KFH A;  2SAS A;  3SS4 A;  1LXF C;  1QJT A;  3EVU A;  5K89 A;  1OOF A;  1S3P A;  1JF0 A;  1KFU L;  2MHH A;  3OBV A;  2F2P A;  5CSJ A;  1TOP A;  4YI9 A;  1SR6 B;  4DCK A;  1QV1 A;  3TDU A;  1AK8 A;  1TNQ A;  1K9K A;  2BCA A;  2PAS A;  1YX8 A;  2OTG B;  3LK0 A;  3GK2 A;  2CNP A;  1UHJ A;  2PQL A;  1MXL C;  2MRD A;  5B8I B;  1RK9 A;  3O4X A;  2F3Y A;  3NGV A;  1NSH A;  2M7L A;  1P28 A;  3JTD C;  2NXQ A;  3JVT C;  4PHN A;  1S6C A;  4GGF A;  1XFY O;  2I94 A;  3C1V A;  3EVV A;  4FQO A;  1GGW A;  1SKT A;  1J7R A;  3OGN A;  3Q8I A;  4L9M A;  4Q04 A;  2OS8 C;  1QLS A;  1JC2 A;  4U8D A;  1SCV A;  1LKJ A;  3PAT A;  5HL1 A;  1YRU B;  1QIW A;  3TZ1 A;  2L50 A;  4DS7 A;  1CLL A;  3BOW A;  4MRY A;  2VRG A;  1XK4 C;  3A4U B;  3O2P A;  2AUC A;  3O78 A;  1OOH A;  5D3O A;  3JTD B;  3JVT B;  3D76 A;  4MZK A;  2LUC A;  1OOJ A;  4OV2 A;  2BKH B;  2MLF C;  1TN4 A;  1YUT A;  5ER4 X;  1Y1X A;  2KYF A;  2OS8 B;  3I5G C;  3HX4 A;  2JNF A;  2LVV A;  5G08 A;  1DJH A;  1NX1 A;  2IS9 A;  2KI4 C;  4FTG A;  1DMO A;  2KQY A;  3OX5 A;  2LLU A;  2LMV A;  3DVE A;  1CFD A;  3R1V A;  3SG7 A;  2F8P A;  4JKT A;  2L4H A;  3TUY C;  3H4S E;  3CZ1 A;  1ALV A;  4GPL B;  2M1K B;  3SIB A;  1EH2 A;  2WCJ A;  4P5O E;  1SCM C;  2M8U A;  5BPJ A;  1S6J A;  3VGO A;  3WHU B;  2QEO A;  4R1E A;  1J7O A;  2FCE A;  3DYE A;  2F2O A;  1RRO A;  3I5G B;  3IQO A;  3D0Y B;  1W7I B;  2KI4 B;  1LS8 A;  2YGU A;  2CCM A;  3R1P A;  4YRU A;  1DT7 B;  3ZWH A;  2ZRS A;  4MVF A;  5D7F A;  1XFX O;  3TUY B;  2KAX A;  5EL2 A;  1M39 A;  1PUL A;  2JT3 A;  3FE9 A;  2LE9 B;  1R2U A;  1CM1 A;  4AQJ A;  1TWO A;  5D69 A;  3FWB A;  2L98 A;  1A03 A;  4OCI A;  3BUW B;  3BYA A;  1UHN A;  1UP5 A;  3B86 A;  1KQM C;  3D77 A;  1BR1 B;  4YGD B;  4E68 A;  1BG1 A;  2LHI A;  1WY9 A;  2WC6 A;  5I94 A;  1CNP A;  2E30 A;  3AKB A;  1XVJ A;  3CTN A;  3NSK A;  4ETO A;  2G9B A;  4ORA B;  5DKR A;  3K1E A;  2L5Y A;  3PFV A;  1IIO A;  1QWV A;  4JPZ B;  3S0D A;  2JT8 A;  1VRK A;  2EHB A;  3CR5 X;  3DVK A;  5AXI A;  1JFJ A;  4AOM A;  1F55 A;  4A4B A;  5GQQ C;  3EK8 A;  3L47 A;  5KU1 A;  1KQM B;  1BU3 A;  2KGR A;  2Y1M A;  3OB2 B;  4C0L A;  2LV7 A;  2WOR A;  5KTY A;  2KLE A;  3BXK A;  1CMG A;  2P6B B;  3AKA A;  3FS7 A;  4PDZ A;  3ZNI A;  2CXJ A;  1Z2C B;  2M9G A;  4INW A;  3VRO A;  4NDB A;  5HKZ A;  5CSN A;  4DRW A;  2O5G A;  4C0K A;  3FWC A;  1J7Q A;  3F45 A;  1BR4 B;  1DJG A;  1G33 A;  2H2K A;  4KYN A;  2ERB A;  1IRJ A;  3S0A A;  1PSR A;  1QS7 A;  2JPO A;  1RTP 1;  2LAN A;  1KK7 Z;  3TDI A;  1OOG A;  1C7V A;  1HT9 A;  1YR5 A;  4YBH B;  4UPG A;  1HQV A;  1ODB A;  5FI6 A;  2KBM A;  1W7J B;  2BE6 A;  2FJY A;  3PLF B;  3EK4 A;  1NX2 A;  3I5H B;  2KOT A;  3DF0 B;  3IF7 A;  1S1E A;  2D8N A;  2BEC A;  3LL8 B;  2AMI A;  3M0W A;  4GUK A;  4MZL A;  4ICB A;  1IQ5 A;  1QTX A;  3NHI A;  1SBJ A;  2KDH A;  5HKY A;  1EXR A;  1IQ3 A;  2LP3 A;  2WCL A;  2ZN9 A;  3NXA A;  2G2B A;  3VRQ A;  1K96 A;  4PHM A;  4YGE B;  1SL9 A;  3B7A A;  1A75 B;  2BAP A;  1J1D A;  2L2E A;  1T14 A;  3D10 A;  2MJW B;  1PSB A;  3OHM B;  2L4I A;  1F8H A;  1K8U A;  2EC6 C;  3R72 A;  1MUX A;  1NIW A;  2HPS A;  4PHJ A;  3CDN A;  1LIN A;  3RZS A;  3LCP C;  5PAL A;  1QX5 B;  2DOQ A;  1OSA A;  2FJU B;  3BJH A;  3KPX A;  3NSO A;  1FI6 A;  1JSA A;  2LMU A;  1MR8 A;  2LLT A;  2M49 B;  2I2R E;  3D74 A;  2M7N A;  1CLB A;  1C07 A;  3S0F A;  1L2O C;  2ZN8 A;  1LVC D;  2BL0 C;  4YGA A;  1IJ5 A;  1NX0 A;  3LK1 A;  2ZKM X;  3FE6 A;  4M2O A;  1XFW O;  2OPO A;  1M63 B;  1CFF A;  3PN7 C;  1FF1 A;  2KBI A;  1FI5 A;  3GK4 X;  3L4A A;  1AVS A;  3O4Y A;  1N2D A;  4HRH A;  3SJS A;  2EC6 B;  2WCM A;  3RLZ A;  1ZMZ A;  2K0J A;  4QJ4 B;  3UNW A;  1RFJ A;  3IVT A;  3BFH A;  2LVJ A;  4ZCV A;  2M97 A;  2PMY A;  3PJI A;  3LLE A;  1KK7 Y;  2BBN A;  1L2O B;  2PAL A;  1FBV A;  1XFU O;  5AFP A;  4PAL A;  2BL0 B;  2LUX A;  1EL4 A;  4YI8 A;  1CM4 A;  1CDL A;  5JOL A;  2L51 A;  2LP2 A;  4N1G A; 
#chains in the Genus database with same CATH homology
 3PN7 B;  1AJ4 A;  1QV0 A;  2WND A;  3EVR A;  1CDP A;  3CWG A;  1TNX A;  2JTT A;  4PE1 A;  4DIR A;  2JT0 A;  2H61 C;  1JWD A;  1KCY A;  1CB1 A;  2O60 A;  2K61 A;  3VRP A;  1Y6W A;  1X02 A;  1J55 A;  2Q4U A;  2LLS A;  3CGA A;  1K9U A;  1SYM A;  1YUR A;  2BBM A;  1SK6 D;  2WOS A;  1PVB A;  1V1G A;  1BLQ A;  4IL1 A;  3WXA A;  2KAV A;  2K7D A;  2I7A A;  1KK8 C;  3BUM B;  2TN4 A;  2JOJ A;  1DJW A;  1XK4 A;  1OQP A;  2JU0 A;  1MWN A;  1SRA A;  1F71 A;  1DF0 B;  4N5X A;  1BOC A;  2K8M B;  3VRR A;  3CS1 A;  1U5I B;  3TS5 C;  1NCY A;  1SCM B;  3MSE B;  2M0R A;  1DGU A;  1S26 D;  2LHL A;  1GQM A;  2SCP A;  2K7B A;  4F0Z B;  2JZI A;  1F4O A;  4OR9 B;  2NLN A;  3D0Y A;  1B4C A;  3A8R A;  1FPW A;  1KFX S;  1IGV A;  1KK8 B;  2BE4 A;  4PHK A;  1Q80 A;  1YUS A;  3NSI A;  3GOF A;  4CID A;  1PRW A;  1DGV A;  1EJ3 A;  2K7C A;  2KFF A;  1IG5 A;  4M2Q A;  1Y1U A;  2BCX A;  2LCP A;  2ZRT A;  4WQ3 A;  1CKK A;  3TS5 B;  1NUB A;  1K9P A;  4NQG A;  4I5N B;  3KEV A;  1KWO C;  2GGM A;  1WRZ A;  2NCP A;  3AAJ A;  1M46 A;  1MHO A;  3AAK A;  4D1E A;  2K2A A;  2NCO A;  2LVK A;  3DVJ A;  3K21 A;  2KNE A;  4CFR A;  1YUU A;  2M29 A;  1DJX A;  1ZOT B;  4GAO A;  3DD4 A;  4MSP A;  5TNC A;  2B1U A;  5CSI A;  1NP8 A;  1JFK A;  4BY4 A;  1SL8 A;  1EG3 A;  2MAZ A;  2ZFD A;  3KHE A;  1D1O A;  4M2P A;  1OMR A;  1MXE A;  1PK0 D;  2MA2 A;  3KO0 A;  5I8N A;  1ZFS A;  3CR2 A;  3O6B A;  1NCX A;  1QX7 A;  1KWO B;  2FCD A;  1QAT A;  1F54 A;  1TNP A;  1UUR A;  4I5L B;  2KHN A;  4JWQ A;  1TCF A;  1YRT B;  2F33 A;  3WHT B;  2WCE A;  3EKH A;  1K94 A;  4QJ3 B;  1B47 A;  4GGF C;  2F3Z A;  2GGZ A;  4HSZ A;  1B8R A;  1CLM A;  2ZND A;  1XA5 A;  1AJ5 A;  3BUN B;  1PAL A;  4BY5 A;  1WLM A;  1SL7 A;  1JBA A;  1F70 A;  2E6W A;  2HF5 A;  1Y1A A;  1SY9 A;  3PSR A;  1QAS A;  2CTN A;  1IWQ A;  1UHK A;  3GK1 A;  4GGN A;  5CSF A;  4ORC B;  1A2X A;  1G4Y R;  5HLV A;  4CFQ A;  4NDD A;  4WRI A;  1J7P A;  4CLN A;  2LAP A;  3DF0 A;  1N0Y A;  2JNX A;  1B7T Z;  4OVN F;  1OZS A;  1B8C A;  3IQQ A;  3I5F C;  1KSO A;  1TCO B;  4WQ2 A;  4DUQ A;  1BJF A;  1SPY A;  1KQV A;  3TDZ A;  2PVB A;  3HCM A;  2CT9 A;  1A75 A;  5J3X A;  1JF2 A;  2HQ8 A;  1BT6 A;  3BOW B;  2V53 A;  4ZCU A;  1F4Q A;  2JC2 A;  4QJ5 B;  2K7O A;  5AEQ A;  2FOT A;  2JXL A;  1NWD A;  1M31 A;  2EGD A;  2LVI A;  5AAN A;  2WCB A;  3I5F B;  1DJZ A;  2M1U A;  4MEW A;  4CPV A;  1LA0 A;  2QPT A;  1TTX A;  1N65 A;  3SG4 A;  1QLK A;  2HQW A;  4MN0 A;  2LNK A;  1K93 D;  1CDM A;  1KFU S;  2Y4Q A;  1QVI Z;  2A4J A;  2KYC A;  3CR4 X;  2ISD A;  1K2H A;  1MF8 B;  4MRX A;  3SIA A;  1YTZ C;  1NX3 A;  2MLE C;  3OB1 B;  4AQI A;  5I2O A;  1CMF A;  4YGB B;  3SG2 A;  1UUS A;  3PM8 A;  1B8L A;  4HRE E;  1WRK A;  1KFX L;  2KSP A;  1B1G A;  1M45 A;  2KQ6 A;  5CPV A;  1FW4 A;  4XYN A;  1XYD A;  5HKW A;  1K95 A;  2JUL A;  1DTL A;  1OZO A;  1QIV A;  1H4B A;  5DKQ A;  1SW8 A;  3BQ3 A;  1UHI A;  1AHR A;  3RM1 A;  1B7T Y;  1H8B A;  4I5J A;  5AER A;  2NZ0 A;  1OMV A;  4PE0 A;  2JTZ A;  3NSL A;  2LM5 A;  1RJV A;  3KF9 A;  5HLO A;  1B9A A;  1NCZ A;  1ZUZ A;  2QAC A;  3SG3 A;  2JQ6 A;  1QXP A;  1MQ1 A;  3VRN A;  1OMD A;  2HET A;  1G8I A;  1CTR A;  2LC5 A;  4MLW A;  1TNW A;  2M3W A;  1E8A A;  1S5G Z;  3EKJ A;  1XFZ O;  1OE9 B;  2JXC A;  2KGB C;  4P2Y B;  5IBW A;  1DF0 A;  1J1E A;  2H61 A;  1BF5 A;  1IH0 A;  1GJY A;  4USL A;  4A4C A;  2KI6 D;  1FI5 A;  1C7W A;  1DJI A;  1GGZ A;  1U5I A;  1BMO A;  2WCF A;  3BUX B;  2Q91 A;  2Y5I A;  2Y1N A;  1NYA A;  4GFT A;  1A4P A;  3WNX B;  1AP4 A;  2PSR A;  1YVH A;  5I2Q A;  4XJK B;  1REC A;  1AUI B;  3OP0 A;  4N1F A;  2GV5 A;  1WLZ A;  3DVM A;  1QVI Y;  2JWW A;  1BOD A;  4PE4 A;  1Y0V H;  3PAL A;  4OKH A;  3SG6 A;  1IKU A;  1K90 D;  3QRX A;  4GNK B;  1EG4 A;  2LMT A;  2COL B;  1A29 A;  2I18 A;  5I2L A;  2ZNE A;  2L5X B;  4GBA A;  1RWY A;  1NPQ A;  2KI6 C;  1XO5 A;  1XFV O;  3CLN A;  4HRG A;  2KFG A;  1UHH A;  4MBE A;  1TIZ A;  1DJY A;  1CFP A;  1R6P A;  1ZAC A;  1QX2 A;  1WDC C;  5DKN A;  2MBX A;  4ORB B;  4XJK A;  4JQ0 D;  2L0P A;  1YVL A;  5HYD A;  3EK7 A;  1LA3 A;  3I5I C;  4PE7 A;  3FIA A;  2BCB A;  5JJG A;  3CZT X;  3OX6 A;  1S36 A;  1YX7 A;  2JRF A;  5F6T A;  4MZJ A;  2WC8 A;  3I5H C;  1L7Z A;  1S6I A;  3ICB A;  2BKI B;  2PRU A;  2AAO A;  2R2I A;  4I5K A;  1SNL A;  1DVI A;  2CBL A;  3E3R A;  1CDN A;  1KSM A;  1SR6 C;  5KSZ A;  3SG5 A;  1WDC B;  1SMG A;  1WRL A;  4NDC A;  2RGI A;  1S5G Y;  5ER5 A;  2OTG C;  1IJ6 A;  1TRF A;  4PCW A;  1CFC A;  3I5I B;  1V1F A;  4C0J A;  5FYX A;  1ALW A;  1JUO A;  1PVA A;  2K2F A;  4TNC A;  4YGC B;  2KAY A;  3BUO B;  1UWO A;  2JPT A;  2KFH A;  2SAS A;  1LXF C;  1QJT A;  3EVU A;  5K89 A;  1S3P A;  1JF0 A;  1KFU L;  2MHH A;  2F2P A;  5CSJ A;  1TOP A;  4YI9 A;  1SR6 B;  4DCK A;  1QV1 A;  3TDU A;  1AK8 A;  1TNQ A;  1K9K A;  2BCA A;  2PAS A;  1YX8 A;  2OTG B;  3LK0 A;  3GK2 A;  2CNP A;  1UHJ A;  1MXL C;  2MRD A;  5B8I B;  1RK9 A;  2F3Y A;  1NSH A;  2M7L A;  3JTD C;  2NXQ A;  3JVT C;  4PHN A;  1S6C A;  4GGF A;  1XFY O;  2I94 A;  3C1V A;  3EVV A;  4FQO A;  1GGW A;  1SKT A;  1J7R A;  4L9M A;  4Q04 A;  2OS8 C;  1QLS A;  1JC2 A;  4U8D A;  1SCV A;  1LKJ A;  3PAT A;  1YRU B;  1QIW A;  3TZ1 A;  2L50 A;  4DS7 A;  1CLL A;  3BOW A;  4MRY A;  2VRG A;  1XK4 C;  3A4U B;  3O2P A;  2AUC A;  3O78 A;  3JTD B;  3JVT B;  4MZK A;  2LUC A;  1OOJ A;  4OV2 A;  2BKH B;  2MLF C;  1TN4 A;  1YUT A;  5ER4 X;  1Y1X A;  2KYF A;  2OS8 B;  3I5G C;  3HX4 A;  2JNF A;  2LVV A;  5G08 A;  1DJH A;  1NX1 A;  2IS9 A;  2KI4 C;  4FTG A;  1DMO A;  2KQY A;  3OX5 A;  2LLU A;  2LMV A;  3DVE A;  1CFD A;  3SG7 A;  2F8P A;  2L4H A;  3TUY C;  3H4S E;  1ALV A;  4GPL B;  2M1K B;  3SIB A;  1EH2 A;  4P5O E;  1SCM C;  2M8U A;  5BPJ A;  1S6J A;  3VGO A;  3WHU B;  4R1E A;  1J7O A;  2FCE A;  2F2O A;  1RRO A;  3I5G B;  3IQO A;  3D0Y B;  1W7I B;  2KI4 B;  2CCM A;  4YRU A;  1DT7 B;  3ZWH A;  2ZRS A;  4MVF A;  5D7F A;  1XFX O;  3TUY B;  2KAX A;  1M39 A;  1PUL A;  2JT3 A;  2LE9 B;  1R2U A;  1CM1 A;  4AQJ A;  5D69 A;  3FWB A;  2L98 A;  1A03 A;  4OCI A;  3BUW B;  3BYA A;  1UHN A;  1UP5 A;  4YGD B;  1KQM C;  1BR1 B;  4E68 A;  1BG1 A;  2LHI A;  1WY9 A;  1CNP A;  2E30 A;  3AKB A;  1XVJ A;  3CTN A;  3NSK A;  4ETO A;  2G9B A;  4ORA B;  5DKR A;  3PFV A;  4JPZ B;  2JT8 A;  1VRK A;  2EHB A;  3CR5 X;  3DVK A;  5AXI A;  1JFJ A;  4AOM A;  1F55 A;  4A4B A;  5GQQ C;  3EK8 A;  5KU1 A;  1KQM B;  1BU3 A;  2KGR A;  2Y1M A;  3OB2 B;  4C0L A;  2LV7 A;  2WOR A;  5KTY A;  3BXK A;  1CMG A;  2P6B B;  3AKA A;  3FS7 A;  4PDZ A;  3ZNI A;  2CXJ A;  2M9G A;  3VRO A;  4NDB A;  5HKZ A;  5CSN A;  4DRW A;  2O5G A;  4C0K A;  3FWC A;  1J7Q A;  3F45 A;  1BR4 B;  1DJG A;  1G33 A;  2H2K A;  1IRJ A;  1PSR A;  1QS7 A;  1RTP 1;  2LAN A;  1CM4 A;  1KK7 Z;  3TDI A;  1C7V A;  1HT9 A;  1YR5 A;  4YBH B;  4UPG A;  1HQV A;  1ODB A;  2KBM A;  1W7J B;  2BE6 A;  3PLF B;  3EK4 A;  1NX2 A;  3I5H B;  2KOT A;  3DF0 B;  3IF7 A;  1S1E A;  2D8N A;  2BEC A;  3LL8 B;  3M0W A;  4GUK A;  4MZL A;  4ICB A;  1IQ5 A;  1QTX A;  5HKY A;  1SBJ A;  2KDH A;  1EXR A;  1IQ3 A;  2LP3 A;  3NXA A;  2ZN9 A;  3VRQ A;  2G2B A;  1K96 A;  4PHM A;  4YGE B;  1SL9 A;  1A75 B;  1J1D A;  2L2E A;  3D10 A;  2MJW B;  1PSB A;  3OHM B;  2L4I A;  1F8H A;  1K8U A;  2EC6 C;  1MUX A;  1NIW A;  2HPS A;  4PHJ A;  1LIN A;  3LCP C;  5PAL A;  1QX5 B;  2DOQ A;  1OSA A;  2FJU B;  3KPX A;  3NSO A;  1FI6 A;  1JSA A;  2LMU A;  1MR8 A;  2LLT A;  2M49 B;  2I2R E;  1CLB A;  2M7N A;  1C07 A;  1L2O C;  2ZN8 A;  1LVC D;  2BL0 C;  4YGA A;  1IJ5 A;  1NX0 A;  3LK1 A;  2ZKM X;  4M2O A;  1XFW O;  2OPO A;  1M63 B;  1CFF A;  3PN7 C;  1FF1 A;  2KBI A;  3GK4 X;  3O4Y A;  1AVS A;  4HRH A;  1N2D A;  3SJS A;  2EC6 B;  3RLZ A;  1ZMZ A;  2K0J A;  4QJ4 B;  1RFJ A;  2LVJ A;  4ZCV A;  2M97 A;  2PMY A;  3LLE A;  1KK7 Y;  2BBN A;  1L2O B;  2PAL A;  1FBV A;  1XFU O;  5AFP A;  4PAL A;  2BL0 B;  2LUX A;  1EL4 A;  4YI8 A;  2AMI A;  1CDL A;  5JOL A;  2L51 A;  2LP2 A;  4N1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...