1JF2A

Crystal structure of w92f obelin mutant from obelia longissima at 1.72 angstrom resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
190
structure length
190
Chain Sequence
b'AVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGFKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords obelin
publication title Violet bioluminescence and fast kinetics from W92F obelin: structure-based proposals for the bioluminescence triggering and the identification of the emitting species.
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 73
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2001-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jf2A00
4L9MA 2ZNEA 3A8RA 1K96A 4AQJA 4C0JA 1SCMB 2PSRA 3SJSA 5G08A 2KAYA 4TNCA 1G33A 3BUOB 1FI6A 2LLSA 1YRTB 2EGDA 2BCXA 2KYCA 1C7WA 1SL8A 3C1VA 1CM4A 1UHJA 2B1UA 1SPYA 1S26D 1XVJA 3F45A 1XA5A 1XK4A 3EVRA 4OV2A 1AJ4A 1K93D 1VRKA 4A4BA 3O6BA 2CXJA 1UHNA 2CNPA 1CKKA 2ZRSA 1K9KA 4MZJA 2BL0C 3SG5A 2F2OA 1IQ3A 3WXAA 2K7DA 2BCAA 1YTZC 1BJFA 3CS1A 1U5IB 1MF8B 4MVFA 4PE7A 2KFGA 1LKJA 2LNKA 1YX8A 5I8NA 2K2FA 1ALWA 1KK7Y 4MRYA 3CR2A 3AKBA 3DVMA 3PSRA 1XK4C 1BG1A 2JRFA 1B8LA 2SASA 3BOWB 3O2PA 2KFHA 1K94A 1UUSA 1QX5B 1NSHA 1PRWA 1CLBA 1NYAA 1QV1A 1QLSA 3EK4A 3KF9A 3KHEA 4DIRA 1S1EA 3DF0A 3FS7A 3NXAA 1AK8A 1NWDA 1J1EA 2KAXA 2KI4C 1D1OA 3IQOA 4N1GA 1CFCA 5CPVA 2LLUA 2TN4A 1DJIA 2JTTA 2Y1MA 2AAOA 5CSFA 1S3PA 2ZN9A 3EK7A 4GAOA 1PSBA 1RWYA 1ODBA 1Y1XA 1IGVA 5F6TA 1SMGA 4MLWA 2O60A 4OR9B 1H4BA 5HKWA 2FJUB 3I5HC 4QJ4B 4N1FA 1DF0B 2BL0B 3CTNA 1N2DA 2M3WA 1K2HA 1NPQA 5K89A 1SR6C 1TNQA 3EKJA 1B1GA 4GFTA 1CDPA 5FYXA 3VRRA 5TNCA 1OE9B 1J7PA 1CDLA 2WORA 2LLTA 1ZACA 5HYDA 1OMDA 4GGFA 4YRUA 1XFUO 3SG6A 5IBWA 3DVJA 5CSIA 1SNLA 1KCYA 3EVUA 5B8IB 1HT9A 2I2RE 2JZIA 2KNEA 1IQ5A 2JQ6A 1SL7A 2KDHA 2KOTA 1QIVA 1QATA 3O78A 4QJ3B 3TDIA 2LHLA 2PASA 2K61A 2LM5A 1NX1A 1FW4A 1GQMA 2KI4B 4OKHA 2QACA 2QPTA 3OB1B 1MHOA 4YBHB 1F70A 1EJ3A 1RROA 1SYMA 1TNWA 1TCOB 1UURA 2MAZA 3O4YA 4R1EA 3IF7A 2EC6C 2WOSA 1M31A 2M97A 4PHKA 1NCXA 4AQIA 1KQVA 2PRUA 1YUSA 1SK6D 2VRGA 3SG4A 3BUMB 3I5HB 3LK1A 1AJ5A 3DF0B 2F3ZA 2OPOA 3I5GC 1SY9A 4I5JA 3WNXB 1BODA 1SR6B 5AFPA 1S6JA 1M39A 4PE0A 1KFXL 1W7IB 3CR5X 2KHNA 4XYNA 2ZRTA 2L4HA 2L4IA 2WC8A 3SG3A 3TDUA 2LP2A 2Q4UA 3NSLA 4DRWA 4YGEB 2KAVA 1Q80A 1RK9A 3CGAA 5AERA 5D69A 1OZSA 2LUXA 3H4SE 4IL1A 2L50A 1FI5A 1WLZA 2F2PA 1DTLA 1A29A 1IJ6A 1OZOA 1B9AA 1WRKA 1A75A 1CDMA 2G9BA 3HX4A 1SKTA 1BLQA 2MHHA 4CFRA 3OB2B 1DJXA 1QASA 2RGIA 4N5XA 4DS7A 2FCDA 1L2OC 1QVIZ 1BOCA 4XJKA 2MRDA 1MQ1A 2PALA 2L98A 4FTGA 4HSZA 2JT8A 1BT6A 2Y5IA 2LVKA 5HLVA 1JSAA 2K7BA 5BPJA 1ZMZA 2JC2A 3D0YA 3TS5C 2JOJA 2HPSA 1PK0D 2JWWA 2OTGC 4NDBA 1RECA 1DMOA 1G4YR 2L51A 2JPTA 3BUNB 4WQ3A 3EKHA 3NSKA 1IJ5A 3NSIA 1NX0A 3CZTX 2WNDA 2CT9A 4MZKA 2LVJA 1RTP1 1OMRA 1K9PA 5JOLA 2L5XB 4E68A 1KFUL 3OP0A 4WQ2A 2JNXA 2H2KA 4PDZA 3TDZA 3DVEA 5DKRA 2KGRA 1PVBA 1WLMA 2M29A 1B7TY 2WCFA 2BECA 3KPXA 1XFYO 4CLNA 1NUBA 4F0ZB 1L2OB 4YGCB 3BYAA 3LL8B 1CDNA 2JTZA 1L7ZA 3FWCA 4D1EA 2JULA 3SIAA 1QX7A 1F4OA 1S6IA 1ZUZA 2KBMA 1JFJA 1YVLA 3TS5B 1A75B 3K21A 3DVKA 1JUOA 1KK8C 1YVHA 4CIDA 1TRFA 2H61A 1NCZA 1CB1A 1JFKA 1OMVA 1UHHA 3CWGA 1B7TZ 1DJYA 1Y1AA 1SBJA 2G2BA 2JU0A 2Q91A 3EK8A 1PVAA 1LINA 1DJHA 1S6CA 1SCVA 3LK0A 1EG4A 3KEVA 2M8UA 1CFPA 3BUWB 1PSRA 1YRUB 2GGMA 3I5IC 2E6WA 1NX2A 2JXCA 2BBNA 1N0YA 2MJWB 2CCMA 2LMVA 4OCIA 1IRJA 5DKQA 1B4CA 2Y4QA 1CLLA 1N65A 2NLNA 3PATA 4I5NB 2V53A 3ZWHA 1K9UA 2LVVA 3JVTC 4ORAB 4USLA 4BY5A 3PALA 2L0PA 1TTXA 1KFXS 3GK2A 4GNKB 1UWOA 3PLFB 5CSJA 2LUCA 4NQGA 4FQOA 1HQVA 3PFVA 4HRHA 5CSNA 1IH0A 1GGWA 4GGNA 4GGFC 1XO5A 1YUUA 3QRXA 2KBIA 2LE9B 3CLNA 2ZFDA 2IS9A 1F54A 1DJZA 2K0JA 1KSOA 1FPWA 1YX7A 1LXFC 1J7OA 4M2OA 4MBEA 1FF1A 1UHIA 2COLB 3GK1A 3DD4A 1DGUA 3I5IB 1TOPA 1R2UA 1LA0A 1QIWA 1TIZA 1S36A 4HRGA 1QVIY 4P5OE 2MBXA 1UHKA 4M2QA 1XYDA 1U5IA 2NCPA 3AKAA 1M46A 3JVTB 3AAKA 3CR4X 2KGBC 2ZN8A 2ISDA 1OQPA 2SCPA 4OVNF 4WRIA 1BU3A 2A4JA 4A4CA 1WRZA 1XFVO 3MSEB 2BKHB 1XFWO 1M63B 5AANA 3TUYC 1M45A 2EC6B 1AVSA 1XFXO 2HQWA 2NXQA 1EXRA 1TCFA 5HKZA 4C0KA 3SG7A 1JF0A 1E8AA 2R2IA 1MXLC 1MR8A 1KFUS 3LCPC 1TNXA 1BMOA 3BUXB 3I5GB 1BF5A 1K95A 4JPZB 3KO0A 1DT7B 4CFQA 1FBVA 1F55A 2KSPA 2BE6A 2ZKMX 4QJ5B 2KI6D 1SRAA 1KWOC 2ZNDA 2WCBA 1A2XA 2I18A 1MXEA 1NCYA 5I2QA 1DF0A 4PE1A 3VROA 4CPVA 1A03A 1J7RA 2M7NA 3JTDC 5AXIA 4YGDB 3VGOA 2HQ8A 2BKIB 2FCEA 1LA3A 4Q04A 3TZ1A 1OSAA 1TNPA 2JNFA 1ZFSA 1EL4A 2F3YA 2L2EA 2WCEA 5AEQA 4MRXA 3RM1A 3BXKA 4DUQA 4YI8A 2M49B 4PCWA 1IKUA 1NX3A 1JBAA 2M9GA 2KFFA 1SL9A 2I7AA 4HREE 3WHTB 3D10A 1YURA 4GPLB 1QV0A 2KYFA 4NDDA 1BR4B 5ER4X 3TUYB 1LVCD 3I5FC 1XFZO 1C07A 1DJGA 3SG2A 2LVIA 2AUCA 3FIAA 1IG5A 1SW8A 4AOMA 2BCBA 2GV5A 2OS8C 3OX5A 1CFDA 4DCKA 1J1DA 2KI6C 3IQQA 1QTXA 4PHNA 1DJWA 4MN0A 3VRPA 2JXLA 1JC2A 2K8MB 2D8NA 2OTGB 3FWBA 4PALA 3VRQA 2LV7A 1KWOB 1DGVA 1K8UA 2K7OA 1WRLA 5KU1A 2PMYA 1J55A 3NSOA 1JWDA 1UP5A 1QLKA 1YR5A 1ZOTB 4UPGA 4GBAA 2FOTA 3JTDB 4XJKB 4YGBB 1GJYA 5ER5A 2HETA 1KSMA 1JF2A 5HKYA 1CM1A 1TN4A 4MZLA 1C7VA 1KK7Z 3D0YB 1GGZA 4BY4A 3LLEA 4JQ0D 2K7CA 5KTYA 2E30A 2H61C 2MA2A 2HF5A 2O5GA 1CFFA 3PN7C 1CNPA 2NCOA 4ZCUA 4P2YB 1RFJA 3AAJA 3I5FB 1F8HA 2LMTA 5J3XA 1W7JB 2LP3A 4GUKA 1ALVA 2K2AA 4MSPA 3RLZA 2M0RA 1PULA 1H8BA 1B8CA 2OS8B 3EVVA 3ICBA 4I5LB 1Y1UA 2EHBA 1R6PA 4ICBA 1WDCC 1RJVA 4MEWA 5PALA 3GK4X 4YGAA 3SIBA 1AP4A 4M2PA 1B47A 4ORBB 1KK8B 2JT3A 1EG3A 2M1UA 2JT0A 2F33A 1BR1B 1QX2A 1KQMC 2KQYA 2M1KB 2I94A 5KSZA 1Y0VH 5I2LA 1CLMA 2CTNA 3BQ3A 3OX6A 2GGZA 3WHUB 1SCMC 4ORCB 2AMIA 2PVBA 1MWNA 4U8DA 4C0LA 2P6BB 1YUTA 4I5KA 4ZCVA 4ETOA 1V1FA 5I2OA 2NZ0A 2M7LA 2DOQA 1G8IA 1B8RA 2LANA 2MLEC 5HLOA 4PHJA 1CMGA 1QXPA 1S5GY 3PN7B 1DVIA 1WY9A 4JWQA 1IWQA 2LMUA 3GOFA 2LCPA 5D7FA 2LC5A 3OHMB 1OOJA 2KQ6A 4NDCA 3BOWA 1J7QA 1MUXA 1QS7A 4YI9A 3VRNA 1EH2A 2CBLA 3HCMA 2Y1NA 1NIWA 3E3RA 1NP8A 3ZNIA 3M0WA 1CTRA 3A4UB 5DKNA 1A4PA 1WDCB 2LHIA 4PHMA 1F4QA 1AHRA 1S5GZ 2F8PA 1CMFA 1AUIB 1QJTA 4PE4A 1X02A 3PM8A 1KQMB 1PALA 5GQQC 1K90D 2BBMA 1F71A 1V1GA 2MLFC 2BE4A 2LAPA 5JJGA 1Y6WA
chains in the Genus database with same CATH superfamily
4L9MA 2ZNEA 3A8RA 2KLEA 1K96A 2L5YA 4F7FA 4AQJA 4C0JA 1SCMB 3NGVA 2KLDA 2PSRA 3SJSA 5G08A 2KAYA 3B88A 3BFHA 4TNCA 1G33A 3BUOB 1FI6A 2LLSA 1YRTB 3R1VA 2EGDA 4OZDA 2BCXA 2KYCA 1TWOA 1C7WA 1SL8A 3C1VA 1CM4A 1UHJA 2B1UA 1SPYA 1S26D 1XVJA 3D75A 3F45A 1XA5A 1XK4A 3EVRA 4OV2A 1AJ4A 1K93D 1VRKA 4A4BA 2BE4A 2CXJA 1UHNA 2CNPA 3O6BA 1CKKA 2ZRSA 1K9KA 4MZJA 2BL0C 3SG5A 2F2OA 1IQ3A 3WXAA 2K7DA 2BCAA 1YTZC 1BJFA 3CS1A 2WCJA 1U5IB 1MF8B 4MVFA 4PE7A 2KFGA 3DYEA 1LKJA 2LNKA 1YX8A 5I8NA 2P71A 2K2FA 1ALWA 1KK7Y 2WCLA 4MRYA 3VB1A 3CR2A 3AKBA 3DVMA 3PSRA 1XK4C 1BG1A 2JRFA 1B8LA 2SASA 3BOWB 3O2PA 2KFHA 1W9ZA 1K94A 1UUSA 3DY9A 1QX5B 3R1PA 1NSHA 1PRWA 1CLBA 1NYAA 1QV1A 1QLSA 3EK4A 3KF9A 3KHEA 4DIRA 3S0GA 1S1EA 2H8VA 3DF0A 3FS7A 3NXAA 1AK8A 1NWDA 1J1EA 2KAXA 2KI4C 1D1OA 3IQOA 4N1GA 1CFCA 5CPVA 2LLUA 2TN4A 1DJIA 2JTTA 2Y1MA 3DZTA 2AAOA 5CSFA 1S3PA 2ZN9A 3D77A 3EK7A 4GAOA 1PSBA 1RWYA 1ODBA 3EG5B 1Y1XA 1IGVA 5F6TA 4MLWA 5EL2A 2O60A 4OR9B 1H4BA 5HKWA 2FJUB 3I5HC 4QJ4B 4N1FA 1DF0B 2BL0B 3CTNA 1N2DA 2M3WA 1K2HA 1NPQA 5K89A 1SR6C 2YGUA 1TNQA 3EKJA 1B1GA 4GFTA 1CDPA 5FYXA 3VRRA 5TNCA 1OE9B 5I94A 1J7PA 1OOIX 5FI2A 1CDLA 2WORA 2LLTA 1ZACA 5HYDA 1OOHA 1OMDA 3K1EA 4GGFA 4YRUA 1XFUO 3SG6A 5IBWA 3DVJA 5CSIA 1SNLA 1KCYA 3EVUA 5B8IB 1HT9A 2I2RE 2QEHA 2JZIA 2KNEA 1IQ5A 2JQ6A 1SL7A 2KDHA 2KOTA 1QIVA 1QATA 3O78A 4KYNA 4QJ3B 3TDIA 2BAPA 2LHLA 2PASA 2K61A 2LM5A 2K60A 1NX1A 1FW4A 1GQMA 1OOFA 2KI4B 4OKHA 2QACA 2QPTA 3OB1B 1MHOA 4YBHB 1F70A 1EJ3A 1RROA 1DQEA 1SYMA 1TNWA 1TCOB 1UURA 2MAZA 3CZ1A 3O4YA 4R1EA 5DICA 3QMEA 3IF7A 3NHTA 2EC6C 2WOSA 1M31A 2M97A 4PHKA 1NCXA 4AQIA 1KQVA 2PRUA 1YUSA 1SK6D 2VRGA 3SG4A 3BUMB 3L47A 3I5HB 3LK1A 1AJ5A 3DF0B 2F3ZA 2OPOA 2WCMA 1SY9A 3I5GC 4I5JA 3WNXB 1BODA 1SR6B 5AFPA 1S6JA 1M39A 4PE0A 1KFXL 1W7IB 3CR5X 2KHNA 4XYNA 2ZRTA 3S0FA 2L4HA 2L4IA 2WC8A 3SG3A 3TDUA 2LP2A 2Q4UA 3NSLA 4DRWA 4YGEB 2KAVA 1Q80A 1RK9A 3O4XA 2PYQA 3CGAA 5AERA 5D69A 1OZSA 3FE6A 2LUXA 3H4SE 4IL1A 2L50A 1FI5A 1WLZA 2F2PA 1DTLA 1A29A 1IJ6A 1Z2CB 1OZOA 1B9AA 1WRKA 1A75A 1CDMA 2G9BA 3HX4A 1SKTA 1BLQA 2MHHA 4CFRA 3OB2B 1DJXA 1QASA 2RGIA 4N5XA 4DS7A 2FCDA 1L2OC 1QVIZ 1BOCA 4XJKA 2MRDA 1MQ1A 2PALA 3L4LA 2L98A 4FTGA 4HSZA 2JT8A 1BT6A 2Y5IA 2LVKA 5HLVA 1JSAA 2K7BA 5BPJA 3D73A 1ZMZA 2JC2A 3D0YA 3OGNA 3TS5C 2JOJA 2HPSA 1PK0D 2JWWA 2OTGC 4NDBA 1ORGA 1RECA 1DMOA 4JD9A 3UNWA 1G4YR 2L51A 3UO9A 2JPTA 3BUNB 1IIOA 3B87A 4WQ3A 3EKHA 3NSKA 1IJ5A 3NSIA 1NX0A 3CZTX 2WNDA 2CT9A 4MZKA 2LVJA 1RTP1 1OMRA 1K9PA 5JOLA 2L5XB 4E68A 1KFUL 3OP0A 4WQ2A 2JNXA 2H2KA 2FJYA 1OW4A 4PDZA 3TDZA 3DVEA 5DKRA 2KGRA 1PVBA 1WLMA 2QDIA 2M29A 1B7TY 2WCFA 2BECA 2JPOA 3KPXA 1XFYO 4CLNA 1NUBA 4F0ZB 1L2OB 4YGCB 3BYAA 3LL8B 1CDNA 2JTZA 1L7ZA 3S0BA 3FWCA 4D1EA 2JULA 3SIAA 1QX7A 1F4OA 1S6IA 1ZUZA 2KBMA 1JFJA 1YVLA 3TS5B 1A75B 3K21A 3DVKA 1JUOA 1KK8C 1YVHA 4CIDA 1TRFA 2H61A 1NCZA 1CB1A 1JFKA 5FI6A 4FQTA 1OMVA 1UHHA 3CWGA 1B7TZ 1DJYA 1Y1AA 1SBJA 2G2BA 2JU0A 2Q91A 3EK8A 1PVAA 1LINA 1DJHA 1S6CA 1SCVA 3LK0A 1EG4A 3KEVA 2M8UA 1CFPA 3BUWB 1PSRA 1YRUB 2GGMA 3I5IC 1GM0A 2E6WA 3CABA 1NX2A 2JXCA 2BBNA 4INWA 1N0YA 2MJWB 2CCMA 2LMVA 4OCIA 1IRJA 5DKQA 1B4CA 2Y4QA 1CLLA 1N65A 2NLNA 3PATA 4I5NB 2V53A 3ZWHA 1K9UA 2PQLA 2LVVA 2P70A 3JVTC 4ORAB 1SSEB 4USLA 3B6XA 3SS3A 4BY5A 3PALA 2L0PA 1TTXA 1KFXS 3GK2A 4GNKB 1UWOA 3PLFB 5CSJA 2LUCA 4NQGA 3D74A 4FQOA 1HQVA 3PFVA 4HRHA 5CSNA 1IH0A 1GGWA 4GGNA 4GGFC 1XO5A 1YUUA 2BNXA 3CDNA 4JKTA 1DC1A 3QRXA 5FI7A 3L4AA 2KBIA 2LE9B 3CLNA 2WC6A 2ZFDA 3FE8A 2IS9A 1F54A 1DJZA 2K0JA 1KSOA 1FPWA 1YX7A 1LXFC 1J7OA 4M2OA 4MBEA 1FF1A 1UHIA 2COLB 3GK1A 3DD4A 1C3ZA 1DGUA 3CZ0A 3I5IB 1TOPA 1DEKA 1R2UA 1LA0A 1QIWA 1TIZA 1S36A 4HRGA 1QVIY 4P5OE 2MBXA 1UHKA 3V2LA 4M2QA 1XYDA 1U5IA 2NCPA 3AKAA 1M46A 3JVTB 3AAKA 5HL1A 3CR4X 2KGBC 2ZN8A 2ISDA 3D76A 1OQPA 2SCPA 2QEVA 4OVNF 4WRIA 1BU3A 2QEBA 2A4JA 4A4CA 1WRZA 1XFVO 1T14A 3MSEB 2BKHB 1XFWO 1M63B 5AANA 3TUYC 3S0DA 1M45A 1TUJA 2EC6B 1AVSA 1XFXO 2HQWA 2NXQA 1EXRA 1TCFA 5HKZA 4C0KA 3RZSA 3SG7A 1JF0A 1E8AA 2R2IA 1MXLC 1MR8A 1KFUS 3LCPC 1TNXA 1BMOA 3BUXB 3I5GB 1BF5A 1K95A 4JPZB 3KO0A 1DT7B 4CFQA 1FBVA 1F55A 2KSPA 2BE6A 2ZKMX 4QJ5B 2KI6D 1SRAA 1KWOC 2ZNDA 2WCBA 1A2XA 2I18A 1MXEA 3PJIA 5D3OA 1NCYA 5I2QA 3S0AA 1DF0A 4PE1A 3VROA 1TUZA 4CPVA 1A03A 3BJHA 3FE9A 1J7RA 2M7NA 3JTDC 4INXA 5AXIA 4YGDB 3VGOA 2HQ8A 2BKIB 2FCEA 1LA3A 4Q04A 3TZ1A 1OSAA 1TNPA 2JNFA 1ZFSA 1EL4A 2F3YA 2L2EA 2WCEA 5AEQA 4MRXA 3RM1A 3BXKA 4DUQA 4YI8A 2M49B 4PCWA 1IKUA 1NX3A 1JBAA 2M9GA 2KFFA 1SL9A 2I7AA 3B7AA 4HREE 3WHTB 3D10A 1YURA 4GPLB 1QV0A 2KYFA 4NDDA 1BR4B 5ER4X 3TUYB 1LVCD 3I5FC 1XFZO 1C07A 3BFBA 1DJGA 3SG2A 2LVIA 2AUCA 3FIAA 1IG5A 1SW8A 4AOMA 2BCBA 2GV5A 2OS8C 3OBVA 3OX5A 1CFDA 3D78A 4DCKA 1J1DA 2KI6C 3IQQA 1QTXA 4PHNA 1DJWA 4MN0A 3VRPA 2JXLA 1JC2A 2K8MB 2D8NA 2OTGB 3FWBA 4PALA 3VRQA 2LV7A 1KWOB 1DGVA 3Q8IA 3NHIA 1K8UA 1P28A 3R1OA 2K7OA 1WRLA 5KU1A 2PMYA 1J55A 3NSOA 1JWDA 1UP5A 1QLKA 1YR5A 1ZOTB 4UPGA 1C3YA 4GBAA 2FOTA 3JTDB 4XJKB 4YGBB 3S0EA 1GJYA 5ER5A 2HETA 1KSMA 1JF2A 3BFAA 5HKYA 2WCKA 1CM1A 1TN4A 4MZLA 1C7VA 1KK7Z 3D0YB 1GGZA 4BY4A 3LLEA 4JQ0D 2K7CA 5KTYA 2E30A 2H61C 2MA2A 2HF5A 2O5GA 1CFFA 3PN7C 1CNPA 2NCOA 4ZCUA 4P2YB 1RFJA 3AAJA 3I5FB 1F8HA 2LMTA 5J3XA 1W7JB 2QEOA 2LP3A 3PM2A 1ALVA 2K2AA 4GUKA 4MSPA 3RLZA 2M0RA 1PULA 1H8BA 1B8CA 2OS8B 3EVVA 3ICBA 4I5LB 1Y1UA 2EHBA 1R6PA 4ICBA 1WDCC 1RJVA 2ERBA 4MEWA 5PALA 4PT1A 3GK4X 4YGAA 3SIBA 1AP4A 4M2PA 1B47A 2WCHA 4ORBB 1KK8B 2JT3A 1EG3A 2M1UA 2JT0A 2F33A 1BR1B 1QX2A 1KQMC 2KQYA 2M1KB 2I94A 5KSZA 1Y0VH 5I2LA 3IVTA 1DELA 1CLMA 2CTNA 3BQ3A 3OX6A 3B86A 2GGZA 3SS5A 3WHUB 1OOGA 3N7HA 1SCMC 4ORCB 2AMIA 2PVBA 1MWNA 4U8DA 3SS4A 2P6BB 1YUTA 4I5KA 4ZCVA 4C0LA 4ETOA 1V1FA 5I2OA 2NZ0A 2M7LA 2DOQA 1G8IA 1B8RA 2LANA 2L2CA 2MLEC 4PHJA 5HLOA 1CMGA 1QXPA 1S5GY 3PN7B 1DVIA 1WY9A 4JWQA 1IWQA 2LMUA 3GOFA 1XFRA 2LCPA 3CYZA 5D7FA 2LC5A 3OHMB 1OOJA 2KQ6A 4NDCA 3BOWA 4IJ7A 1MUXA 1J7QA 1QS7A 4YI9A 3VRNA 2WC5A 2CBLA 3HCMA 1EH2A 2Y1NA 3R72A 1NIWA 1LS8A 3E3RA 1NP8A 3ZNIA 3M0WA 1CTRA 3A4UB 1QWVA 5DKNA 1A4PA 1WDCB 2GTEA 2LHIA 4PHMA 1F4QA 1AHRA 1S5GZ 2F8PA 1CMFA 3CZ2A 3DXLA 2KPHA 1AUIB 1QJTA 4PE4A 1X02A 3PM8A 1KQMB 1PALA 5GQQC 1K90D 2BBMA 1Z4HA 1F71A 1V1GA 2MLFC 1SMGA 2LAPA 5JJGA 1Y6WA
chains in the Genus database with same CATH topology
4L9MA 2ZNEA 3A8RA 1K96A 4AQJA 4C0JA 1SCMB 2PSRA 3SJSA 5G08A 2KAYA 4TNCA 1G33A 3BUOB 1FI6A 2LLSA 1YRTB 2EGDA 2BCXA 2KYCA 1C7WA 1SL8A 3C1VA 1CM4A 1UHJA 2B1UA 1SPYA 1S26D 1XVJA 3F45A 1XA5A 1XK4A 3EVRA 4OV2A 1AJ4A 1K93D 1VRKA 4A4BA 3O6BA 2CXJA 1UHNA 2CNPA 1CKKA 2ZRSA 1K9KA 4MZJA 2BL0C 3SG5A 2F2OA 1IQ3A 3WXAA 2K7DA 2BCAA 1YTZC 1BJFA 3CS1A 1U5IB 1MF8B 4MVFA 4PE7A 2KFGA 1LKJA 2LNKA 1YX8A 5I8NA 2K2FA 1ALWA 1KK7Y 4MRYA 3CR2A 3AKBA 3DVMA 3PSRA 1XK4C 1BG1A 2JRFA 1B8LA 2SASA 3BOWB 3O2PA 2KFHA 1K94A 1UUSA 1QX5B 1NSHA 1PRWA 1CLBA 1NYAA 1QV1A 1QLSA 3EK4A 3KF9A 3KHEA 4DIRA 1S1EA 3DF0A 3FS7A 3NXAA 1AK8A 1NWDA 1J1EA 2KAXA 2KI4C 1D1OA 3IQOA 4N1GA 1CFCA 5CPVA 2LLUA 2TN4A 1DJIA 2JTTA 2Y1MA 2AAOA 5CSFA 1S3PA 2ZN9A 3EK7A 4GAOA 1PSBA 1RWYA 1ODBA 1Y1XA 1IGVA 5F6TA 1SMGA 4MLWA 2O60A 4OR9B 1H4BA 5HKWA 2FJUB 3I5HC 4QJ4B 4N1FA 1DF0B 2BL0B 3CTNA 1N2DA 2M3WA 1K2HA 1NPQA 5K89A 1SR6C 1TNQA 3EKJA 1B1GA 4GFTA 1CDPA 5FYXA 3VRRA 5TNCA 1OE9B 1J7PA 1CDLA 2WORA 2LLTA 1ZACA 5HYDA 1OMDA 4GGFA 4YRUA 1XFUO 3SG6A 5IBWA 3DVJA 5CSIA 1SNLA 1KCYA 3EVUA 5B8IB 1HT9A 2I2RE 2JZIA 2KNEA 1IQ5A 2JQ6A 1SL7A 2KDHA 2KOTA 1QIVA 1QATA 3O78A 4QJ3B 3TDIA 2LHLA 2PASA 2K61A 2LM5A 1NX1A 1FW4A 1GQMA 2KI4B 4OKHA 2QACA 2QPTA 3OB1B 1MHOA 4YBHB 1F70A 1EJ3A 1RROA 1SYMA 1TNWA 1TCOB 1UURA 2MAZA 3O4YA 4R1EA 3IF7A 2EC6C 2WOSA 1M31A 2M97A 4PHKA 1NCXA 4AQIA 1KQVA 2PRUA 1YUSA 1SK6D 2VRGA 3SG4A 3BUMB 3I5HB 3LK1A 1AJ5A 3DF0B 2F3ZA 2OPOA 3I5GC 1SY9A 4I5JA 3WNXB 1BODA 1SR6B 5AFPA 1S6JA 1M39A 4PE0A 1KFXL 1W7IB 3CR5X 2KHNA 4XYNA 2ZRTA 2L4HA 2L4IA 2WC8A 3SG3A 3TDUA 2LP2A 2Q4UA 3NSLA 4DRWA 4YGEB 2KAVA 1Q80A 1RK9A 3CGAA 5AERA 5D69A 1OZSA 2LUXA 3H4SE 4IL1A 2L50A 1FI5A 1WLZA 2F2PA 1DTLA 1A29A 1IJ6A 1OZOA 1B9AA 1WRKA 1A75A 1CDMA 2G9BA 3HX4A 1SKTA 1BLQA 2MHHA 4CFRA 3OB2B 1DJXA 1QASA 2RGIA 4N5XA 4DS7A 2FCDA 1L2OC 1QVIZ 1BOCA 4XJKA 2MRDA 1MQ1A 2PALA 2L98A 4FTGA 4HSZA 2JT8A 1BT6A 2Y5IA 2LVKA 5HLVA 1JSAA 2K7BA 5BPJA 1ZMZA 2JC2A 3D0YA 3TS5C 2JOJA 2HPSA 1PK0D 2JWWA 2OTGC 4NDBA 1RECA 1DMOA 1G4YR 2L51A 2JPTA 3BUNB 4WQ3A 3EKHA 3NSKA 1IJ5A 3NSIA 1NX0A 3CZTX 2WNDA 2CT9A 4MZKA 2LVJA 1RTP1 1OMRA 1K9PA 5JOLA 2L5XB 4E68A 1KFUL 3OP0A 4WQ2A 2JNXA 2H2KA 4PDZA 3TDZA 3DVEA 5DKRA 2KGRA 1PVBA 1WLMA 2M29A 1B7TY 2WCFA 2BECA 3KPXA 1XFYO 4CLNA 1NUBA 4F0ZB 1L2OB 4YGCB 3BYAA 3LL8B 1CDNA 2JTZA 1L7ZA 3FWCA 4D1EA 2JULA 3SIAA 1QX7A 1F4OA 1S6IA 1ZUZA 2KBMA 1JFJA 1YVLA 3TS5B 1A75B 3K21A 3DVKA 1JUOA 1KK8C 1YVHA 4CIDA 1TRFA 2H61A 1NCZA 1CB1A 1JFKA 1OMVA 1UHHA 3CWGA 1B7TZ 1DJYA 1Y1AA 1SBJA 2G2BA 2JU0A 2Q91A 3EK8A 1PVAA 1LINA 1DJHA 1S6CA 1SCVA 3LK0A 1EG4A 3KEVA 2M8UA 1CFPA 3BUWB 1PSRA 1YRUB 2GGMA 3I5IC 2E6WA 1NX2A 2JXCA 2BBNA 1N0YA 2MJWB 2CCMA 2LMVA 4OCIA 1IRJA 5DKQA 1B4CA 2Y4QA 1CLLA 1N65A 2NLNA 3PATA 4I5NB 2V53A 3ZWHA 1K9UA 2LVVA 3JVTC 4ORAB 4USLA 4BY5A 3PALA 2L0PA 1TTXA 1KFXS 3GK2A 4GNKB 1UWOA 3PLFB 5CSJA 2LUCA 4NQGA 4FQOA 1HQVA 3PFVA 4HRHA 5CSNA 1IH0A 1GGWA 4GGNA 4GGFC 1XO5A 1YUUA 3QRXA 2KBIA 2LE9B 3CLNA 2ZFDA 2IS9A 1F54A 1DJZA 2K0JA 1KSOA 1FPWA 1YX7A 1LXFC 1J7OA 4M2OA 4MBEA 1FF1A 1UHIA 2COLB 3GK1A 3DD4A 1DGUA 3I5IB 1TOPA 1R2UA 1LA0A 1QIWA 1TIZA 1S36A 4HRGA 1QVIY 4P5OE 2MBXA 1UHKA 4M2QA 1XYDA 1U5IA 2NCPA 3AKAA 1M46A 3JVTB 3AAKA 3CR4X 2KGBC 2ZN8A 2ISDA 1OQPA 2SCPA 4OVNF 4WRIA 1BU3A 2A4JA 4A4CA 1WRZA 1XFVO 3MSEB 2BKHB 1XFWO 1M63B 5AANA 3TUYC 1M45A 2EC6B 1AVSA 1XFXO 2HQWA 2NXQA 1EXRA 1TCFA 5HKZA 4C0KA 3SG7A 1JF0A 1E8AA 2R2IA 1MXLC 1MR8A 1KFUS 3LCPC 1TNXA 1BMOA 3BUXB 3I5GB 1BF5A 1K95A 4JPZB 3KO0A 1DT7B 4CFQA 1FBVA 1F55A 2KSPA 2BE6A 2ZKMX 4QJ5B 2KI6D 1SRAA 1KWOC 2ZNDA 2WCBA 1A2XA 2I18A 1MXEA 1NCYA 5I2QA 1DF0A 4PE1A 3VROA 4CPVA 1A03A 1J7RA 2M7NA 3JTDC 5AXIA 4YGDB 3VGOA 2HQ8A 2BKIB 2FCEA 1LA3A 4Q04A 3TZ1A 1OSAA 1TNPA 2JNFA 1ZFSA 1EL4A 2F3YA 2L2EA 2WCEA 5AEQA 4MRXA 3RM1A 3BXKA 4DUQA 4YI8A 2M49B 4PCWA 1IKUA 1NX3A 1JBAA 2M9GA 2KFFA 1SL9A 2I7AA 4HREE 3WHTB 3D10A 1YURA 4GPLB 1QV0A 2KYFA 4NDDA 1BR4B 5ER4X 3TUYB 1LVCD 3I5FC 1XFZO 1C07A 1DJGA 3SG2A 2LVIA 2AUCA 3FIAA 1IG5A 1SW8A 4AOMA 2BCBA 2GV5A 2OS8C 3OX5A 1CFDA 4DCKA 1J1DA 2KI6C 3IQQA 1QTXA 4PHNA 1DJWA 4MN0A 3VRPA 2JXLA 1JC2A 2K8MB 2D8NA 2OTGB 3FWBA 4PALA 3VRQA 2LV7A 1KWOB 1DGVA 1K8UA 2K7OA 1WRLA 5KU1A 2PMYA 1J55A 3NSOA 1JWDA 1UP5A 1QLKA 1YR5A 1ZOTB 4UPGA 4GBAA 2FOTA 3JTDB 4XJKB 4YGBB 1GJYA 5ER5A 2HETA 1KSMA 1JF2A 5HKYA 1CM1A 1TN4A 4MZLA 1C7VA 1KK7Z 3D0YB 1GGZA 4BY4A 3LLEA 4JQ0D 2K7CA 5KTYA 2E30A 2H61C 2MA2A 2HF5A 2O5GA 1CFFA 3PN7C 1CNPA 2NCOA 4ZCUA 4P2YB 1RFJA 3AAJA 3I5FB 1F8HA 2LMTA 5J3XA 1W7JB 2LP3A 4GUKA 1ALVA 2K2AA 4MSPA 3RLZA 2M0RA 1PULA 1H8BA 1B8CA 2OS8B 3EVVA 3ICBA 4I5LB 1Y1UA 2EHBA 1R6PA 4ICBA 1WDCC 1RJVA 4MEWA 5PALA 3GK4X 4YGAA 3SIBA 1AP4A 4M2PA 1B47A 4ORBB 1KK8B 2JT3A 1EG3A 2M1UA 2JT0A 2F33A 1BR1B 1QX2A 1KQMC 2KQYA 2M1KB 2I94A 5KSZA 1Y0VH 5I2LA 1CLMA 2CTNA 3BQ3A 3OX6A 2GGZA 3WHUB 1SCMC 4ORCB 2AMIA 2PVBA 1MWNA 4U8DA 4C0LA 2P6BB 1YUTA 4I5KA 4ZCVA 4ETOA 1V1FA 5I2OA 2NZ0A 2M7LA 2DOQA 1G8IA 1B8RA 2LANA 2MLEC 5HLOA 4PHJA 1CMGA 1QXPA 1S5GY 3PN7B 1DVIA 1WY9A 4JWQA 1IWQA 2LMUA 3GOFA 2LCPA 5D7FA 2LC5A 3OHMB 1OOJA 2KQ6A 4NDCA 3BOWA 1J7QA 1MUXA 1QS7A 4YI9A 3VRNA 1EH2A 2CBLA 3HCMA 2Y1NA 1NIWA 3E3RA 1NP8A 3ZNIA 3M0WA 1CTRA 3A4UB 5DKNA 1A4PA 1WDCB 2LHIA 4PHMA 1F4QA 1AHRA 1S5GZ 2F8PA 1CMFA 1AUIB 1QJTA 4PE4A 1X02A 3PM8A 1KQMB 1PALA 5GQQC 1K90D 2BBMA 1F71A 1V1GA 2MLFC 2BE4A 2LAPA 5JJGA 1Y6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9M A;  2ZNE A;  3A8R A;  1K96 A;  4AQJ A;  4C0J A;  1SCM B;  2PSR A;  3SJS A;  5G08 A;  2KAY A;  4TNC A;  1G33 A;  3BUO B;  1FI6 A;  2LLS A;  1YRT B;  2EGD A;  2BCX A;  2KYC A;  1C7W A;  1SL8 A;  3C1V A;  1CM4 A;  1UHJ A;  2B1U A;  1SPY A;  1S26 D;  1XVJ A;  3F45 A;  1XA5 A;  1XK4 A;  3EVR A;  4OV2 A;  1AJ4 A;  1K93 D;  1VRK A;  4A4B A;  3O6B A;  2CXJ A;  1UHN A;  2CNP A;  1CKK A;  2ZRS A;  1K9K A;  4MZJ A;  2BL0 C;  3SG5 A;  2F2O A;  1IQ3 A;  3WXA A;  2K7D A;  2BCA A;  1YTZ C;  1BJF A;  3CS1 A;  1U5I B;  1MF8 B;  4MVF A;  4PE7 A;  2KFG A;  1LKJ A;  2LNK A;  1YX8 A;  5I8N A;  2K2F A;  1ALW A;  1KK7 Y;  4MRY A;  3CR2 A;  3AKB A;  3DVM A;  3PSR A;  1XK4 C;  1BG1 A;  2JRF A;  1B8L A;  2SAS A;  3BOW B;  3O2P A;  2KFH A;  1K94 A;  1UUS A;  1QX5 B;  1NSH A;  1PRW A;  1CLB A;  1NYA A;  1QV1 A;  1QLS A;  3EK4 A;  3KF9 A;  3KHE A;  4DIR A;  1S1E A;  3DF0 A;  3FS7 A;  3NXA A;  1AK8 A;  1NWD A;  1J1E A;  2KAX A;  2KI4 C;  1D1O A;  3IQO A;  4N1G A;  1CFC A;  5CPV A;  2LLU A;  2TN4 A;  1DJI A;  2JTT A;  2Y1M A;  2AAO A;  5CSF A;  1S3P A;  2ZN9 A;  3EK7 A;  4GAO A;  1PSB A;  1RWY A;  1ODB A;  1Y1X A;  1IGV A;  5F6T A;  1SMG A;  4MLW A;  2O60 A;  4OR9 B;  1H4B A;  5HKW A;  2FJU B;  3I5H C;  4QJ4 B;  4N1F A;  1DF0 B;  2BL0 B;  3CTN A;  1N2D A;  2M3W A;  1K2H A;  1NPQ A;  5K89 A;  1SR6 C;  1TNQ A;  3EKJ A;  1B1G A;  4GFT A;  1CDP A;  5FYX A;  3VRR A;  5TNC A;  1OE9 B;  1J7P A;  1CDL A;  2WOR A;  2LLT A;  1ZAC A;  5HYD A;  1OMD A;  4GGF A;  4YRU A;  1XFU O;  3SG6 A;  5IBW A;  3DVJ A;  5CSI A;  1SNL A;  1KCY A;  3EVU A;  5B8I B;  1HT9 A;  2I2R E;  2JZI A;  2KNE A;  1IQ5 A;  2JQ6 A;  1SL7 A;  2KDH A;  2KOT A;  1QIV A;  1QAT A;  3O78 A;  4QJ3 B;  3TDI A;  2LHL A;  2PAS A;  2K61 A;  2LM5 A;  1NX1 A;  1FW4 A;  1GQM A;  2KI4 B;  4OKH A;  2QAC A;  2QPT A;  3OB1 B;  1MHO A;  4YBH B;  1F70 A;  1EJ3 A;  1RRO A;  1SYM A;  1TNW A;  1TCO B;  1UUR A;  2MAZ A;  3O4Y A;  4R1E A;  3IF7 A;  2EC6 C;  2WOS A;  1M31 A;  2M97 A;  4PHK A;  1NCX A;  4AQI A;  1KQV A;  2PRU A;  1YUS A;  1SK6 D;  2VRG A;  3SG4 A;  3BUM B;  3I5H B;  3LK1 A;  1AJ5 A;  3DF0 B;  2F3Z A;  2OPO A;  3I5G C;  1SY9 A;  4I5J A;  3WNX B;  1BOD A;  1SR6 B;  5AFP A;  1S6J A;  1M39 A;  4PE0 A;  1KFX L;  1W7I B;  3CR5 X;  2KHN A;  4XYN A;  2ZRT A;  2L4H A;  2L4I A;  2WC8 A;  3SG3 A;  3TDU A;  2LP2 A;  2Q4U A;  3NSL A;  4DRW A;  4YGE B;  2KAV A;  1Q80 A;  1RK9 A;  3CGA A;  5AER A;  5D69 A;  1OZS A;  2LUX A;  3H4S E;  4IL1 A;  2L50 A;  1FI5 A;  1WLZ A;  2F2P A;  1DTL A;  1A29 A;  1IJ6 A;  1OZO A;  1B9A A;  1WRK A;  1A75 A;  1CDM A;  2G9B A;  3HX4 A;  1SKT A;  1BLQ A;  2MHH A;  4CFR A;  3OB2 B;  1DJX A;  1QAS A;  2RGI A;  4N5X A;  4DS7 A;  2FCD A;  1L2O C;  1QVI Z;  1BOC A;  4XJK A;  2MRD A;  1MQ1 A;  2PAL A;  2L98 A;  4FTG A;  4HSZ A;  2JT8 A;  1BT6 A;  2Y5I A;  2LVK A;  5HLV A;  1JSA A;  2K7B A;  5BPJ A;  1ZMZ A;  2JC2 A;  3D0Y A;  3TS5 C;  2JOJ A;  2HPS A;  1PK0 D;  2JWW A;  2OTG C;  4NDB A;  1REC A;  1DMO A;  1G4Y R;  2L51 A;  2JPT A;  3BUN B;  4WQ3 A;  3EKH A;  3NSK A;  1IJ5 A;  3NSI A;  1NX0 A;  3CZT X;  2WND A;  2CT9 A;  4MZK A;  2LVJ A;  1RTP 1;  1OMR A;  1K9P A;  5JOL A;  2L5X B;  4E68 A;  1KFU L;  3OP0 A;  4WQ2 A;  2JNX A;  2H2K A;  4PDZ A;  3TDZ A;  3DVE A;  5DKR A;  2KGR A;  1PVB A;  1WLM A;  2M29 A;  1B7T Y;  2WCF A;  2BEC A;  3KPX A;  1XFY O;  4CLN A;  1NUB A;  4F0Z B;  1L2O B;  4YGC B;  3BYA A;  3LL8 B;  1CDN A;  2JTZ A;  1L7Z A;  3FWC A;  4D1E A;  2JUL A;  3SIA A;  1QX7 A;  1F4O A;  1S6I A;  1ZUZ A;  2KBM A;  1JFJ A;  1YVL A;  3TS5 B;  1A75 B;  3K21 A;  3DVK A;  1JUO A;  1KK8 C;  1YVH A;  4CID A;  1TRF A;  2H61 A;  1NCZ A;  1CB1 A;  1JFK A;  1OMV A;  1UHH A;  3CWG A;  1B7T Z;  1DJY A;  1Y1A A;  1SBJ A;  2G2B A;  2JU0 A;  2Q91 A;  3EK8 A;  1PVA A;  1LIN A;  1DJH A;  1S6C A;  1SCV A;  3LK0 A;  1EG4 A;  3KEV A;  2M8U A;  1CFP A;  3BUW B;  1PSR A;  1YRU B;  2GGM A;  3I5I C;  2E6W A;  1NX2 A;  2JXC A;  2BBN A;  1N0Y A;  2MJW B;  2CCM A;  2LMV A;  4OCI A;  1IRJ A;  5DKQ A;  1B4C A;  2Y4Q A;  1CLL A;  1N65 A;  2NLN A;  3PAT A;  4I5N B;  2V53 A;  3ZWH A;  1K9U A;  2LVV A;  3JVT C;  4ORA B;  4USL A;  4BY5 A;  3PAL A;  2L0P A;  1TTX A;  1KFX S;  3GK2 A;  4GNK B;  1UWO A;  3PLF B;  5CSJ A;  2LUC A;  4NQG A;  4FQO A;  1HQV A;  3PFV A;  4HRH A;  5CSN A;  1IH0 A;  1GGW A;  4GGN A;  4GGF C;  1XO5 A;  1YUU A;  3QRX A;  2KBI A;  2LE9 B;  3CLN A;  2ZFD A;  2IS9 A;  1F54 A;  1DJZ A;  2K0J A;  1KSO A;  1FPW A;  1YX7 A;  1LXF C;  1J7O A;  4M2O A;  4MBE A;  1FF1 A;  1UHI A;  2COL B;  3GK1 A;  3DD4 A;  1DGU A;  3I5I B;  1TOP A;  1R2U A;  1LA0 A;  1QIW A;  1TIZ A;  1S36 A;  4HRG A;  1QVI Y;  4P5O E;  2MBX A;  1UHK A;  4M2Q A;  1XYD A;  1U5I A;  2NCP A;  3AKA A;  1M46 A;  3JVT B;  3AAK A;  3CR4 X;  2KGB C;  2ZN8 A;  2ISD A;  1OQP A;  2SCP A;  4OVN F;  4WRI A;  1BU3 A;  2A4J A;  4A4C A;  1WRZ A;  1XFV O;  3MSE B;  2BKH B;  1XFW O;  1M63 B;  5AAN A;  3TUY C;  1M45 A;  2EC6 B;  1AVS A;  1XFX O;  2HQW A;  2NXQ A;  1EXR A;  1TCF A;  5HKZ A;  4C0K A;  3SG7 A;  1JF0 A;  1E8A A;  2R2I A;  1MXL C;  1MR8 A;  1KFU S;  3LCP C;  1TNX A;  1BMO A;  3BUX B;  3I5G B;  1BF5 A;  1K95 A;  4JPZ B;  3KO0 A;  1DT7 B;  4CFQ A;  1FBV A;  1F55 A;  2KSP A;  2BE6 A;  2ZKM X;  4QJ5 B;  2KI6 D;  1SRA A;  1KWO C;  2ZND A;  2WCB A;  1A2X A;  2I18 A;  1MXE A;  1NCY A;  5I2Q A;  1DF0 A;  4PE1 A;  3VRO A;  4CPV A;  1A03 A;  1J7R A;  2M7N A;  3JTD C;  5AXI A;  4YGD B;  3VGO A;  2HQ8 A;  2BKI B;  2FCE A;  1LA3 A;  4Q04 A;  3TZ1 A;  1OSA A;  1TNP A;  2JNF A;  1ZFS A;  1EL4 A;  2F3Y A;  2L2E A;  2WCE A;  5AEQ A;  4MRX A;  3RM1 A;  3BXK A;  4DUQ A;  4YI8 A;  2M49 B;  4PCW A;  1IKU A;  1NX3 A;  1JBA A;  2M9G A;  2KFF A;  1SL9 A;  2I7A A;  4HRE E;  3WHT B;  3D10 A;  1YUR A;  4GPL B;  1QV0 A;  2KYF A;  4NDD A;  1BR4 B;  5ER4 X;  3TUY B;  1LVC D;  3I5F C;  1XFZ O;  1C07 A;  1DJG A;  3SG2 A;  2LVI A;  2AUC A;  3FIA A;  1IG5 A;  1SW8 A;  4AOM A;  2BCB A;  2GV5 A;  2OS8 C;  3OX5 A;  1CFD A;  4DCK A;  1J1D A;  2KI6 C;  3IQQ A;  1QTX A;  4PHN A;  1DJW A;  4MN0 A;  3VRP A;  2JXL A;  1JC2 A;  2K8M B;  2D8N A;  2OTG B;  3FWB A;  4PAL A;  3VRQ A;  2LV7 A;  1KWO B;  1DGV A;  1K8U A;  2K7O A;  1WRL A;  5KU1 A;  2PMY A;  1J55 A;  3NSO A;  1JWD A;  1UP5 A;  1QLK A;  1YR5 A;  1ZOT B;  4UPG A;  4GBA A;  2FOT A;  3JTD B;  4XJK B;  4YGB B;  1GJY A;  5ER5 A;  2HET A;  1KSM A;  1JF2 A;  5HKY A;  1CM1 A;  1TN4 A;  4MZL A;  1C7V A;  1KK7 Z;  3D0Y B;  1GGZ A;  4BY4 A;  3LLE A;  4JQ0 D;  2K7C A;  5KTY A;  2E30 A;  2H61 C;  2MA2 A;  2HF5 A;  2O5G A;  1CFF A;  3PN7 C;  1CNP A;  2NCO A;  4ZCU A;  4P2Y B;  1RFJ A;  3AAJ A;  3I5F B;  1F8H A;  2LMT A;  5J3X A;  1W7J B;  2LP3 A;  4GUK A;  1ALV A;  2K2A A;  4MSP A;  3RLZ A;  2M0R A;  1PUL A;  1H8B A;  1B8C A;  2OS8 B;  3EVV A;  3ICB A;  4I5L B;  1Y1U A;  2EHB A;  1R6P A;  4ICB A;  1WDC C;  1RJV A;  4MEW A;  5PAL A;  3GK4 X;  4YGA A;  3SIB A;  1AP4 A;  4M2P A;  1B47 A;  4ORB B;  1KK8 B;  2JT3 A;  1EG3 A;  2M1U A;  2JT0 A;  2F33 A;  1BR1 B;  1QX2 A;  1KQM C;  2KQY A;  2M1K B;  2I94 A;  5KSZ A;  1Y0V H;  5I2L A;  1CLM A;  2CTN A;  3BQ3 A;  3OX6 A;  2GGZ A;  3WHU B;  1SCM C;  4ORC B;  2AMI A;  2PVB A;  1MWN A;  4U8D A;  4C0L A;  2P6B B;  1YUT A;  4I5K A;  4ZCV A;  4ETO A;  1V1F A;  5I2O A;  2NZ0 A;  2M7L A;  2DOQ A;  1G8I A;  1B8R A;  2LAN A;  2MLE C;  5HLO A;  4PHJ A;  1CMG A;  1QXP A;  1S5G Y;  3PN7 B;  1DVI A;  1WY9 A;  4JWQ A;  1IWQ A;  2LMU A;  3GOF A;  2LCP A;  5D7F A;  2LC5 A;  3OHM B;  1OOJ A;  2KQ6 A;  4NDC A;  3BOW A;  1J7Q A;  1MUX A;  1QS7 A;  4YI9 A;  3VRN A;  1EH2 A;  2CBL A;  3HCM A;  2Y1N A;  1NIW A;  3E3R A;  1NP8 A;  3ZNI A;  3M0W A;  1CTR A;  3A4U B;  5DKN A;  1A4P A;  1WDC B;  2LHI A;  4PHM A;  1F4Q A;  1AHR A;  1S5G Z;  2F8P A;  1CMF A;  1AUI B;  1QJT A;  4PE4 A;  1X02 A;  3PM8 A;  1KQM B;  1PAL A;  5GQQ C;  1K90 D;  2BBM A;  1F71 A;  1V1G A;  2MLF C;  2BE4 A;  2LAP A;  5JJG A;  1Y6W A; 
#chains in the Genus database with same CATH topology
 4L9M A;  2ZNE A;  3A8R A;  2KLE A;  1K96 A;  2L5Y A;  4F7F A;  4AQJ A;  4C0J A;  1SCM B;  3NGV A;  2KLD A;  2PSR A;  3SJS A;  5G08 A;  2KAY A;  3B88 A;  3BFH A;  4TNC A;  1G33 A;  3BUO B;  1FI6 A;  2LLS A;  1YRT B;  3R1V A;  2EGD A;  4OZD A;  2BCX A;  2KYC A;  1TWO A;  1C7W A;  1SL8 A;  3C1V A;  1CM4 A;  1UHJ A;  2B1U A;  1SPY A;  1S26 D;  1XVJ A;  3D75 A;  3F45 A;  1XA5 A;  1XK4 A;  3EVR A;  4OV2 A;  1AJ4 A;  1K93 D;  1VRK A;  4A4B A;  2BE4 A;  2CXJ A;  1UHN A;  2CNP A;  3O6B A;  1CKK A;  2ZRS A;  1K9K A;  4MZJ A;  2BL0 C;  3SG5 A;  2F2O A;  1IQ3 A;  3WXA A;  2K7D A;  2BCA A;  1YTZ C;  1BJF A;  3CS1 A;  2WCJ A;  1U5I B;  1MF8 B;  4MVF A;  4PE7 A;  2KFG A;  3DYE A;  1LKJ A;  2LNK A;  1YX8 A;  5I8N A;  2P71 A;  2K2F A;  1ALW A;  1KK7 Y;  2WCL A;  4MRY A;  3VB1 A;  3CR2 A;  3AKB A;  3DVM A;  3PSR A;  1XK4 C;  1BG1 A;  2JRF A;  1B8L A;  2SAS A;  3BOW B;  3O2P A;  2KFH A;  1W9Z A;  1K94 A;  1UUS A;  3DY9 A;  1QX5 B;  3R1P A;  1NSH A;  1PRW A;  1CLB A;  1NYA A;  1QV1 A;  1QLS A;  3EK4 A;  3KF9 A;  3KHE A;  4DIR A;  3S0G A;  1S1E A;  2H8V A;  3DF0 A;  3FS7 A;  3NXA A;  1AK8 A;  1NWD A;  1J1E A;  2KAX A;  2KI4 C;  1D1O A;  3IQO A;  4N1G A;  1CFC A;  5CPV A;  2LLU A;  2TN4 A;  1DJI A;  2JTT A;  2Y1M A;  3DZT A;  2AAO A;  5CSF A;  1S3P A;  2ZN9 A;  3D77 A;  3EK7 A;  4GAO A;  1PSB A;  1RWY A;  1ODB A;  3EG5 B;  1Y1X A;  1IGV A;  5F6T A;  4MLW A;  5EL2 A;  2O60 A;  4OR9 B;  1H4B A;  5HKW A;  2FJU B;  3I5H C;  4QJ4 B;  4N1F A;  1DF0 B;  2BL0 B;  3CTN A;  1N2D A;  2M3W A;  1K2H A;  1NPQ A;  5K89 A;  1SR6 C;  2YGU A;  1TNQ A;  3EKJ A;  1B1G A;  4GFT A;  1CDP A;  5FYX A;  3VRR A;  5TNC A;  1OE9 B;  5I94 A;  1J7P A;  1OOI X;  5FI2 A;  1CDL A;  2WOR A;  2LLT A;  1ZAC A;  5HYD A;  1OOH A;  1OMD A;  3K1E A;  4GGF A;  4YRU A;  1XFU O;  3SG6 A;  5IBW A;  3DVJ A;  5CSI A;  1SNL A;  1KCY A;  3EVU A;  5B8I B;  1HT9 A;  2I2R E;  2QEH A;  2JZI A;  2KNE A;  1IQ5 A;  2JQ6 A;  1SL7 A;  2KDH A;  2KOT A;  1QIV A;  1QAT A;  3O78 A;  4KYN A;  4QJ3 B;  3TDI A;  2BAP A;  2LHL A;  2PAS A;  2K61 A;  2LM5 A;  2K60 A;  1NX1 A;  1FW4 A;  1GQM A;  1OOF A;  2KI4 B;  4OKH A;  2QAC A;  2QPT A;  3OB1 B;  1MHO A;  4YBH B;  1F70 A;  1EJ3 A;  1RRO A;  1DQE A;  1SYM A;  1TNW A;  1TCO B;  1UUR A;  2MAZ A;  3CZ1 A;  3O4Y A;  4R1E A;  5DIC A;  3QME A;  3IF7 A;  3NHT A;  2EC6 C;  2WOS A;  1M31 A;  2M97 A;  4PHK A;  1NCX A;  4AQI A;  1KQV A;  2PRU A;  1YUS A;  1SK6 D;  2VRG A;  3SG4 A;  3BUM B;  3L47 A;  3I5H B;  3LK1 A;  1AJ5 A;  3DF0 B;  2F3Z A;  2OPO A;  2WCM A;  1SY9 A;  3I5G C;  4I5J A;  3WNX B;  1BOD A;  1SR6 B;  5AFP A;  1S6J A;  1M39 A;  4PE0 A;  1KFX L;  1W7I B;  3CR5 X;  2KHN A;  4XYN A;  2ZRT A;  3S0F A;  2L4H A;  2L4I A;  2WC8 A;  3SG3 A;  3TDU A;  2LP2 A;  2Q4U A;  3NSL A;  4DRW A;  4YGE B;  2KAV A;  1Q80 A;  1RK9 A;  3O4X A;  2PYQ A;  3CGA A;  5AER A;  5D69 A;  1OZS A;  3FE6 A;  2LUX A;  3H4S E;  4IL1 A;  2L50 A;  1FI5 A;  1WLZ A;  2F2P A;  1DTL A;  1A29 A;  1IJ6 A;  1Z2C B;  1OZO A;  1B9A A;  1WRK A;  1A75 A;  1CDM A;  2G9B A;  3HX4 A;  1SKT A;  1BLQ A;  2MHH A;  4CFR A;  3OB2 B;  1DJX A;  1QAS A;  2RGI A;  4N5X A;  4DS7 A;  2FCD A;  1L2O C;  1QVI Z;  1BOC A;  4XJK A;  2MRD A;  1MQ1 A;  2PAL A;  3L4L A;  2L98 A;  4FTG A;  4HSZ A;  2JT8 A;  1BT6 A;  2Y5I A;  2LVK A;  5HLV A;  1JSA A;  2K7B A;  5BPJ A;  3D73 A;  1ZMZ A;  2JC2 A;  3D0Y A;  3OGN A;  3TS5 C;  2JOJ A;  2HPS A;  1PK0 D;  2JWW A;  2OTG C;  4NDB A;  1ORG A;  1REC A;  1DMO A;  4JD9 A;  3UNW A;  1G4Y R;  2L51 A;  3UO9 A;  2JPT A;  3BUN B;  1IIO A;  3B87 A;  4WQ3 A;  3EKH A;  3NSK A;  1IJ5 A;  3NSI A;  1NX0 A;  3CZT X;  2WND A;  2CT9 A;  4MZK A;  2LVJ A;  1RTP 1;  1OMR A;  1K9P A;  5JOL A;  2L5X B;  4E68 A;  1KFU L;  3OP0 A;  4WQ2 A;  2JNX A;  2H2K A;  2FJY A;  1OW4 A;  4PDZ A;  3TDZ A;  3DVE A;  5DKR A;  2KGR A;  1PVB A;  1WLM A;  2QDI A;  2M29 A;  1B7T Y;  2WCF A;  2BEC A;  2JPO A;  3KPX A;  1XFY O;  4CLN A;  1NUB A;  4F0Z B;  1L2O B;  4YGC B;  3BYA A;  3LL8 B;  1CDN A;  2JTZ A;  1L7Z A;  3S0B A;  3FWC A;  4D1E A;  2JUL A;  3SIA A;  1QX7 A;  1F4O A;  1S6I A;  1ZUZ A;  2KBM A;  1JFJ A;  1YVL A;  3TS5 B;  1A75 B;  3K21 A;  3DVK A;  1JUO A;  1KK8 C;  1YVH A;  4CID A;  1TRF A;  2H61 A;  1NCZ A;  1CB1 A;  1JFK A;  5FI6 A;  4FQT A;  1OMV A;  1UHH A;  3CWG A;  1B7T Z;  1DJY A;  1Y1A A;  1SBJ A;  2G2B A;  2JU0 A;  2Q91 A;  3EK8 A;  1PVA A;  1LIN A;  1DJH A;  1S6C A;  1SCV A;  3LK0 A;  1EG4 A;  3KEV A;  2M8U A;  1CFP A;  3BUW B;  1PSR A;  1YRU B;  2GGM A;  3I5I C;  1GM0 A;  2E6W A;  3CAB A;  1NX2 A;  2JXC A;  2BBN A;  4INW A;  1N0Y A;  2MJW B;  2CCM A;  2LMV A;  4OCI A;  1IRJ A;  5DKQ A;  1B4C A;  2Y4Q A;  1CLL A;  1N65 A;  2NLN A;  3PAT A;  4I5N B;  2V53 A;  3ZWH A;  1K9U A;  2PQL A;  2LVV A;  2P70 A;  3JVT C;  4ORA B;  1SSE B;  4USL A;  3B6X A;  3SS3 A;  4BY5 A;  3PAL A;  2L0P A;  1TTX A;  1KFX S;  3GK2 A;  4GNK B;  1UWO A;  3PLF B;  5CSJ A;  2LUC A;  4NQG A;  3D74 A;  4FQO A;  1HQV A;  3PFV A;  4HRH A;  5CSN A;  1IH0 A;  1GGW A;  4GGN A;  4GGF C;  1XO5 A;  1YUU A;  2BNX A;  3CDN A;  4JKT A;  1DC1 A;  3QRX A;  5FI7 A;  3L4A A;  2KBI A;  2LE9 B;  3CLN A;  2WC6 A;  2ZFD A;  3FE8 A;  2IS9 A;  1F54 A;  1DJZ A;  2K0J A;  1KSO A;  1FPW A;  1YX7 A;  1LXF C;  1J7O A;  4M2O A;  4MBE A;  1FF1 A;  1UHI A;  2COL B;  3GK1 A;  3DD4 A;  1C3Z A;  1DGU A;  3CZ0 A;  3I5I B;  1TOP A;  1DEK A;  1R2U A;  1LA0 A;  1QIW A;  1TIZ A;  1S36 A;  4HRG A;  1QVI Y;  4P5O E;  2MBX A;  1UHK A;  3V2L A;  4M2Q A;  1XYD A;  1U5I A;  2NCP A;  3AKA A;  1M46 A;  3JVT B;  3AAK A;  5HL1 A;  3CR4 X;  2KGB C;  2ZN8 A;  2ISD A;  3D76 A;  1OQP A;  2SCP A;  2QEV A;  4OVN F;  4WRI A;  1BU3 A;  2QEB A;  2A4J A;  4A4C A;  1WRZ A;  1XFV O;  1T14 A;  3MSE B;  2BKH B;  1XFW O;  1M63 B;  5AAN A;  3TUY C;  3S0D A;  1M45 A;  1TUJ A;  2EC6 B;  1AVS A;  1XFX O;  2HQW A;  2NXQ A;  1EXR A;  1TCF A;  5HKZ A;  4C0K A;  3RZS A;  3SG7 A;  1JF0 A;  1E8A A;  2R2I A;  1MXL C;  1MR8 A;  1KFU S;  3LCP C;  1TNX A;  1BMO A;  3BUX B;  3I5G B;  1BF5 A;  1K95 A;  4JPZ B;  3KO0 A;  1DT7 B;  4CFQ A;  1FBV A;  1F55 A;  2KSP A;  2BE6 A;  2ZKM X;  4QJ5 B;  2KI6 D;  1SRA A;  1KWO C;  2ZND A;  2WCB A;  1A2X A;  2I18 A;  1MXE A;  3PJI A;  5D3O A;  1NCY A;  5I2Q A;  3S0A A;  1DF0 A;  4PE1 A;  3VRO A;  1TUZ A;  4CPV A;  1A03 A;  3BJH A;  3FE9 A;  1J7R A;  2M7N A;  3JTD C;  4INX A;  5AXI A;  4YGD B;  3VGO A;  2HQ8 A;  2BKI B;  2FCE A;  1LA3 A;  4Q04 A;  3TZ1 A;  1OSA A;  1TNP A;  2JNF A;  1ZFS A;  1EL4 A;  2F3Y A;  2L2E A;  2WCE A;  5AEQ A;  4MRX A;  3RM1 A;  3BXK A;  4DUQ A;  4YI8 A;  2M49 B;  4PCW A;  1IKU A;  1NX3 A;  1JBA A;  2M9G A;  2KFF A;  1SL9 A;  2I7A A;  3B7A A;  4HRE E;  3WHT B;  3D10 A;  1YUR A;  4GPL B;  1QV0 A;  2KYF A;  4NDD A;  1BR4 B;  5ER4 X;  3TUY B;  1LVC D;  3I5F C;  1XFZ O;  1C07 A;  3BFB A;  1DJG A;  3SG2 A;  2LVI A;  2AUC A;  3FIA A;  1IG5 A;  1SW8 A;  4AOM A;  2BCB A;  2GV5 A;  2OS8 C;  3OBV A;  3OX5 A;  1CFD A;  3D78 A;  4DCK A;  1J1D A;  2KI6 C;  3IQQ A;  1QTX A;  4PHN A;  1DJW A;  4MN0 A;  3VRP A;  2JXL A;  1JC2 A;  2K8M B;  2D8N A;  2OTG B;  3FWB A;  4PAL A;  3VRQ A;  2LV7 A;  1KWO B;  1DGV A;  3Q8I A;  3NHI A;  1K8U A;  1P28 A;  3R1O A;  2K7O A;  1WRL A;  5KU1 A;  2PMY A;  1J55 A;  3NSO A;  1JWD A;  1UP5 A;  1QLK A;  1YR5 A;  1ZOT B;  4UPG A;  1C3Y A;  4GBA A;  2FOT A;  3JTD B;  4XJK B;  4YGB B;  3S0E A;  1GJY A;  5ER5 A;  2HET A;  1KSM A;  1JF2 A;  3BFA A;  5HKY A;  2WCK A;  1CM1 A;  1TN4 A;  4MZL A;  1C7V A;  1KK7 Z;  3D0Y B;  1GGZ A;  4BY4 A;  3LLE A;  4JQ0 D;  2K7C A;  5KTY A;  2E30 A;  2H61 C;  2MA2 A;  2HF5 A;  2O5G A;  1CFF A;  3PN7 C;  1CNP A;  2NCO A;  4ZCU A;  4P2Y B;  1RFJ A;  3AAJ A;  3I5F B;  1F8H A;  2LMT A;  5J3X A;  1W7J B;  2QEO A;  2LP3 A;  3PM2 A;  1ALV A;  2K2A A;  4GUK A;  4MSP A;  3RLZ A;  2M0R A;  1PUL A;  1H8B A;  1B8C A;  2OS8 B;  3EVV A;  3ICB A;  4I5L B;  1Y1U A;  2EHB A;  1R6P A;  4ICB A;  1WDC C;  1RJV A;  2ERB A;  4MEW A;  5PAL A;  4PT1 A;  3GK4 X;  4YGA A;  3SIB A;  1AP4 A;  4M2P A;  1B47 A;  2WCH A;  4ORB B;  1KK8 B;  2JT3 A;  1EG3 A;  2M1U A;  2JT0 A;  2F33 A;  1BR1 B;  1QX2 A;  1KQM C;  2KQY A;  2M1K B;  2I94 A;  5KSZ A;  1Y0V H;  5I2L A;  3IVT A;  1DEL A;  1CLM A;  2CTN A;  3BQ3 A;  3OX6 A;  3B86 A;  2GGZ A;  3SS5 A;  3WHU B;  1OOG A;  3N7H A;  1SCM C;  4ORC B;  2AMI A;  2PVB A;  1MWN A;  4U8D A;  3SS4 A;  2P6B B;  1YUT A;  4I5K A;  4ZCV A;  4C0L A;  4ETO A;  1V1F A;  5I2O A;  2NZ0 A;  2M7L A;  2DOQ A;  1G8I A;  1B8R A;  2LAN A;  2L2C A;  2MLE C;  4PHJ A;  5HLO A;  1CMG A;  1QXP A;  1S5G Y;  3PN7 B;  1DVI A;  1WY9 A;  4JWQ A;  1IWQ A;  2LMU A;  3GOF A;  1XFR A;  2LCP A;  3CYZ A;  5D7F A;  2LC5 A;  3OHM B;  1OOJ A;  2KQ6 A;  4NDC A;  3BOW A;  4IJ7 A;  1MUX A;  1J7Q A;  1QS7 A;  4YI9 A;  3VRN A;  2WC5 A;  2CBL A;  3HCM A;  1EH2 A;  2Y1N A;  3R72 A;  1NIW A;  1LS8 A;  3E3R A;  1NP8 A;  3ZNI A;  3M0W A;  1CTR A;  3A4U B;  1QWV A;  5DKN A;  1A4P A;  1WDC B;  2GTE A;  2LHI A;  4PHM A;  1F4Q A;  1AHR A;  1S5G Z;  2F8P A;  1CMF A;  3CZ2 A;  3DXL A;  2KPH A;  1AUI B;  1QJT A;  4PE4 A;  1X02 A;  3PM8 A;  1KQM B;  1PAL A;  5GQQ C;  1K90 D;  2BBM A;  1Z4H A;  1F71 A;  1V1G A;  2MLF C;  1SMG A;  2LAP A;  5JJG A;  1Y6W A; 
#chains in the Genus database with same CATH homology
 4L9M A;  2ZNE A;  3A8R A;  1K96 A;  4AQJ A;  4C0J A;  1SCM B;  2PSR A;  3SJS A;  5G08 A;  2KAY A;  4TNC A;  1G33 A;  3BUO B;  1FI6 A;  2LLS A;  1YRT B;  2EGD A;  2BCX A;  2KYC A;  1C7W A;  1SL8 A;  3C1V A;  1CM4 A;  1UHJ A;  2B1U A;  1SPY A;  1S26 D;  1XVJ A;  3F45 A;  1XA5 A;  1XK4 A;  3EVR A;  4OV2 A;  1AJ4 A;  1K93 D;  1VRK A;  4A4B A;  3O6B A;  2CXJ A;  1UHN A;  2CNP A;  1CKK A;  2ZRS A;  1K9K A;  4MZJ A;  2BL0 C;  3SG5 A;  2F2O A;  1IQ3 A;  3WXA A;  2K7D A;  2BCA A;  1YTZ C;  1BJF A;  3CS1 A;  1U5I B;  1MF8 B;  4MVF A;  4PE7 A;  2KFG A;  1LKJ A;  2LNK A;  1YX8 A;  5I8N A;  2K2F A;  1ALW A;  1KK7 Y;  4MRY A;  3CR2 A;  3AKB A;  3DVM A;  3PSR A;  1XK4 C;  1BG1 A;  2JRF A;  1B8L A;  2SAS A;  3BOW B;  3O2P A;  2KFH A;  1K94 A;  1UUS A;  1QX5 B;  1NSH A;  1PRW A;  1CLB A;  1NYA A;  1QV1 A;  1QLS A;  3EK4 A;  3KF9 A;  3KHE A;  4DIR A;  1S1E A;  3DF0 A;  3FS7 A;  3NXA A;  1AK8 A;  1NWD A;  1J1E A;  2KAX A;  2KI4 C;  1D1O A;  3IQO A;  4N1G A;  1CFC A;  5CPV A;  2LLU A;  2TN4 A;  1DJI A;  2JTT A;  2Y1M A;  2AAO A;  5CSF A;  1S3P A;  2ZN9 A;  3EK7 A;  4GAO A;  1PSB A;  1RWY A;  1ODB A;  1Y1X A;  1IGV A;  5F6T A;  1SMG A;  4MLW A;  2O60 A;  4OR9 B;  1H4B A;  5HKW A;  2FJU B;  3I5H C;  4QJ4 B;  4N1F A;  1DF0 B;  2BL0 B;  3CTN A;  1N2D A;  2M3W A;  1K2H A;  1NPQ A;  5K89 A;  1SR6 C;  1TNQ A;  3EKJ A;  1B1G A;  4GFT A;  1CDP A;  5FYX A;  3VRR A;  5TNC A;  1OE9 B;  1J7P A;  1CDL A;  2WOR A;  2LLT A;  1ZAC A;  5HYD A;  1OMD A;  4GGF A;  4YRU A;  1XFU O;  3SG6 A;  5IBW A;  3DVJ A;  5CSI A;  1SNL A;  1KCY A;  3EVU A;  5B8I B;  1HT9 A;  2I2R E;  2JZI A;  2KNE A;  1IQ5 A;  2JQ6 A;  1SL7 A;  2KDH A;  2KOT A;  1QIV A;  1QAT A;  3O78 A;  4QJ3 B;  3TDI A;  2LHL A;  2PAS A;  2K61 A;  2LM5 A;  1NX1 A;  1FW4 A;  1GQM A;  2KI4 B;  4OKH A;  2QAC A;  2QPT A;  3OB1 B;  1MHO A;  4YBH B;  1F70 A;  1EJ3 A;  1RRO A;  1SYM A;  1TNW A;  1TCO B;  1UUR A;  2MAZ A;  3O4Y A;  4R1E A;  3IF7 A;  2EC6 C;  2WOS A;  1M31 A;  2M97 A;  4PHK A;  1NCX A;  4AQI A;  1KQV A;  2PRU A;  1YUS A;  1SK6 D;  2VRG A;  3SG4 A;  3BUM B;  3I5H B;  3LK1 A;  1AJ5 A;  3DF0 B;  2F3Z A;  2OPO A;  3I5G C;  1SY9 A;  4I5J A;  3WNX B;  1BOD A;  1SR6 B;  5AFP A;  1S6J A;  1M39 A;  4PE0 A;  1KFX L;  1W7I B;  3CR5 X;  2KHN A;  4XYN A;  2ZRT A;  2L4H A;  2L4I A;  2WC8 A;  3SG3 A;  3TDU A;  2LP2 A;  2Q4U A;  3NSL A;  4DRW A;  4YGE B;  2KAV A;  1Q80 A;  1RK9 A;  3CGA A;  5AER A;  5D69 A;  1OZS A;  2LUX A;  3H4S E;  4IL1 A;  2L50 A;  1FI5 A;  1WLZ A;  2F2P A;  1DTL A;  1A29 A;  1IJ6 A;  1OZO A;  1B9A A;  1WRK A;  1A75 A;  1CDM A;  2G9B A;  3HX4 A;  1SKT A;  1BLQ A;  2MHH A;  4CFR A;  3OB2 B;  1DJX A;  1QAS A;  2RGI A;  4N5X A;  4DS7 A;  2FCD A;  1L2O C;  1QVI Z;  1BOC A;  4XJK A;  2MRD A;  1MQ1 A;  2PAL A;  2L98 A;  4FTG A;  4HSZ A;  2JT8 A;  1BT6 A;  2Y5I A;  2LVK A;  5HLV A;  1JSA A;  2K7B A;  5BPJ A;  1ZMZ A;  2JC2 A;  3D0Y A;  3TS5 C;  2JOJ A;  2HPS A;  1PK0 D;  2JWW A;  2OTG C;  4NDB A;  1REC A;  1DMO A;  1G4Y R;  2L51 A;  2JPT A;  3BUN B;  4WQ3 A;  3EKH A;  3NSK A;  1IJ5 A;  3NSI A;  1NX0 A;  3CZT X;  2WND A;  2CT9 A;  4MZK A;  2LVJ A;  1RTP 1;  1OMR A;  1K9P A;  5JOL A;  2L5X B;  4E68 A;  1KFU L;  3OP0 A;  4WQ2 A;  2JNX A;  2H2K A;  4PDZ A;  3TDZ A;  3DVE A;  5DKR A;  2KGR A;  1PVB A;  1WLM A;  2M29 A;  1B7T Y;  2WCF A;  2BEC A;  3KPX A;  1XFY O;  4CLN A;  1NUB A;  4F0Z B;  1L2O B;  4YGC B;  3BYA A;  3LL8 B;  1CDN A;  2JTZ A;  1L7Z A;  3FWC A;  4D1E A;  2JUL A;  3SIA A;  1QX7 A;  1F4O A;  1S6I A;  1ZUZ A;  2KBM A;  1JFJ A;  1YVL A;  3TS5 B;  1A75 B;  3K21 A;  3DVK A;  1JUO A;  1KK8 C;  1YVH A;  4CID A;  1TRF A;  2H61 A;  1NCZ A;  1CB1 A;  1JFK A;  1OMV A;  1UHH A;  3CWG A;  1B7T Z;  1DJY A;  1Y1A A;  1SBJ A;  2G2B A;  2JU0 A;  2Q91 A;  3EK8 A;  1PVA A;  1LIN A;  1DJH A;  1S6C A;  1SCV A;  3LK0 A;  1EG4 A;  3KEV A;  2M8U A;  1CFP A;  3BUW B;  1PSR A;  1YRU B;  2GGM A;  3I5I C;  2E6W A;  1NX2 A;  2JXC A;  2BBN A;  1N0Y A;  2MJW B;  2CCM A;  2LMV A;  4OCI A;  1IRJ A;  5DKQ A;  1B4C A;  2Y4Q A;  1CLL A;  1N65 A;  2NLN A;  3PAT A;  4I5N B;  2V53 A;  3ZWH A;  1K9U A;  2LVV A;  3JVT C;  4ORA B;  4USL A;  4BY5 A;  3PAL A;  2L0P A;  1TTX A;  1KFX S;  3GK2 A;  4GNK B;  1UWO A;  3PLF B;  5CSJ A;  2LUC A;  4NQG A;  4FQO A;  1HQV A;  3PFV A;  4HRH A;  5CSN A;  1IH0 A;  1GGW A;  4GGN A;  4GGF C;  1XO5 A;  1YUU A;  3QRX A;  2KBI A;  2LE9 B;  3CLN A;  2ZFD A;  2IS9 A;  1F54 A;  1DJZ A;  2K0J A;  1KSO A;  1FPW A;  1YX7 A;  1LXF C;  1J7O A;  4M2O A;  4MBE A;  1FF1 A;  1UHI A;  2COL B;  3GK1 A;  3DD4 A;  1DGU A;  3I5I B;  1TOP A;  1R2U A;  1LA0 A;  1QIW A;  1TIZ A;  1S36 A;  4HRG A;  1QVI Y;  4P5O E;  2MBX A;  1UHK A;  4M2Q A;  1XYD A;  1U5I A;  2NCP A;  3AKA A;  1M46 A;  3JVT B;  3AAK A;  3CR4 X;  2KGB C;  2ZN8 A;  2ISD A;  1OQP A;  2SCP A;  4OVN F;  4WRI A;  1BU3 A;  2A4J A;  4A4C A;  1WRZ A;  1XFV O;  3MSE B;  2BKH B;  1XFW O;  1M63 B;  5AAN A;  3TUY C;  1M45 A;  2EC6 B;  1AVS A;  1XFX O;  2HQW A;  2NXQ A;  1EXR A;  1TCF A;  5HKZ A;  4C0K A;  3SG7 A;  1JF0 A;  1E8A A;  2R2I A;  1MXL C;  1MR8 A;  1KFU S;  3LCP C;  1TNX A;  1BMO A;  3BUX B;  3I5G B;  1BF5 A;  1K95 A;  4JPZ B;  3KO0 A;  1DT7 B;  4CFQ A;  1FBV A;  1F55 A;  2KSP A;  2BE6 A;  2ZKM X;  4QJ5 B;  2KI6 D;  1SRA A;  1KWO C;  2ZND A;  2WCB A;  1A2X A;  2I18 A;  1MXE A;  1NCY A;  5I2Q A;  1DF0 A;  4PE1 A;  3VRO A;  4CPV A;  1A03 A;  1J7R A;  2M7N A;  3JTD C;  5AXI A;  4YGD B;  3VGO A;  2HQ8 A;  2BKI B;  2FCE A;  1LA3 A;  4Q04 A;  3TZ1 A;  1OSA A;  1TNP A;  2JNF A;  1ZFS A;  1EL4 A;  2F3Y A;  2L2E A;  2WCE A;  5AEQ A;  4MRX A;  3RM1 A;  3BXK A;  4DUQ A;  4YI8 A;  2M49 B;  4PCW A;  1IKU A;  1NX3 A;  1JBA A;  2M9G A;  2KFF A;  1SL9 A;  2I7A A;  4HRE E;  3WHT B;  3D10 A;  1YUR A;  4GPL B;  1QV0 A;  2KYF A;  4NDD A;  1BR4 B;  5ER4 X;  3TUY B;  1LVC D;  3I5F C;  1XFZ O;  1C07 A;  1DJG A;  3SG2 A;  2LVI A;  2AUC A;  3FIA A;  1IG5 A;  1SW8 A;  4AOM A;  2BCB A;  2GV5 A;  2OS8 C;  3OX5 A;  1CFD A;  4DCK A;  1J1D A;  2KI6 C;  3IQQ A;  1QTX A;  4PHN A;  1DJW A;  4MN0 A;  3VRP A;  2JXL A;  1JC2 A;  2K8M B;  2D8N A;  2OTG B;  3FWB A;  4PAL A;  3VRQ A;  2LV7 A;  1KWO B;  1DGV A;  1K8U A;  2K7O A;  1WRL A;  5KU1 A;  2PMY A;  1J55 A;  3NSO A;  1JWD A;  1UP5 A;  1QLK A;  1YR5 A;  1ZOT B;  4UPG A;  4GBA A;  2FOT A;  3JTD B;  4XJK B;  4YGB B;  1GJY A;  5ER5 A;  2HET A;  1KSM A;  1JF2 A;  5HKY A;  1CM1 A;  1TN4 A;  4MZL A;  1C7V A;  1KK7 Z;  3D0Y B;  1GGZ A;  4BY4 A;  3LLE A;  4JQ0 D;  2K7C A;  5KTY A;  2E30 A;  2H61 C;  2MA2 A;  2HF5 A;  2O5G A;  1CFF A;  3PN7 C;  1CNP A;  2NCO A;  4ZCU A;  4P2Y B;  1RFJ A;  3AAJ A;  3I5F B;  1F8H A;  2LMT A;  5J3X A;  1W7J B;  2LP3 A;  4GUK A;  1ALV A;  2K2A A;  4MSP A;  3RLZ A;  2M0R A;  1PUL A;  1H8B A;  1B8C A;  2OS8 B;  3EVV A;  3ICB A;  4I5L B;  1Y1U A;  2EHB A;  1R6P A;  4ICB A;  1WDC C;  1RJV A;  4MEW A;  5PAL A;  3GK4 X;  4YGA A;  3SIB A;  1AP4 A;  4M2P A;  1B47 A;  4ORB B;  1KK8 B;  2JT3 A;  1EG3 A;  2M1U A;  2JT0 A;  2F33 A;  1BR1 B;  1QX2 A;  1KQM C;  2KQY A;  2M1K B;  2I94 A;  5KSZ A;  1Y0V H;  5I2L A;  1CLM A;  2CTN A;  3BQ3 A;  3OX6 A;  2GGZ A;  3WHU B;  1SCM C;  4ORC B;  2AMI A;  2PVB A;  1MWN A;  4U8D A;  4C0L A;  2P6B B;  1YUT A;  4I5K A;  4ZCV A;  4ETO A;  1V1F A;  5I2O A;  2NZ0 A;  2M7L A;  2DOQ A;  1G8I A;  1B8R A;  2LAN A;  2MLE C;  5HLO A;  4PHJ A;  1CMG A;  1QXP A;  1S5G Y;  3PN7 B;  1DVI A;  1WY9 A;  4JWQ A;  1IWQ A;  2LMU A;  3GOF A;  2LCP A;  5D7F A;  2LC5 A;  3OHM B;  1OOJ A;  2KQ6 A;  4NDC A;  3BOW A;  1J7Q A;  1MUX A;  1QS7 A;  4YI9 A;  3VRN A;  1EH2 A;  2CBL A;  3HCM A;  2Y1N A;  1NIW A;  3E3R A;  1NP8 A;  3ZNI A;  3M0W A;  1CTR A;  3A4U B;  5DKN A;  1A4P A;  1WDC B;  2LHI A;  4PHM A;  1F4Q A;  1AHR A;  1S5G Z;  2F8P A;  1CMF A;  1AUI B;  1QJT A;  4PE4 A;  1X02 A;  3PM8 A;  1KQM B;  1PAL A;  5GQQ C;  1K90 D;  2BBM A;  1F71 A;  1V1G A;  2MLF C;  2BE4 A;  2LAP A;  5JJG A;  1Y6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...