1JF2A

Crystal structure of w92f obelin mutant from obelia longissima at 1.72 angstrom resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
190
structure length
190
Chain Sequence
AVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGFKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords obelin
publication title Violet bioluminescence and fast kinetics from W92F obelin: structure-based proposals for the bioluminescence triggering and the identification of the emitting species.
pubmed doi rcsb
source organism Obelia longissima
total genus 73
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2001-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jf2A00
1QIVA 1Q80A 1BR4B 2HPSA 1S5GZ 5FYXA 1S6CA 4A4BA 1AUIB 3D10A 1JFJA 3MSEB 2KDHA 4PHMA 2KSPA 1PVAA 2KBIA 4YBHB 3DF0A 4I5NB 1F71A 4ICBA 2L0PA 3NXAA 2K7BA 2LP2A 2JXCA 2LMVA 3NSOA 5CSNA 1KK8B 5I8NA 5AERA 1YRUB 1NPQA 4M2OA 3HCMA 1WLZA 1SBJA 4YRUA 2EHBA 1QXPA 1M45A 1QATA 5HKZA 1AJ5A 4CFRA 5CPVA 1OQPA 3AKBA 2KAYA 5CSJA 1KFXL 1TNQA 2G2BA 2WORA 1SCMC 1UHIA 1UHHA 1PSBA 3CLNA 3O2PA 4HRHA 5HKYA 1ZMZA 2M7NA 1QTXA 3O6BA 1MR8A 1EG3A 4MZLA 1LA0A 2OS8C 1U5IB 4AOMA 1NWDA 1DMOA 2H2KA 4DRWA 2KFGA 1L2OC 2GV5A 3WHTB 1XFXO 2LM5A 3I5HC 1J7QA 1E8AA 2F33A 1CDNA 5KTYA 4USLA 1NSHA 3LK1A 3TS5B 4E68A 1S3PA 2CTNA 2JWWA 3WHUB 2BCXA 1SK6D 1TRFA 2K7CA 1CFFA 1TNWA 1DJXA 2KAXA 2JRFA 1KQMB 2KGRA 1RK9A 1TNPA 1J55A 2Q91A 5AXIA 2Y5IA 1XFWO 3HX4A 3LCPC 4WRIA 3H4SE 4NDDA 1ZUZA 1F54A 1KK7Y 2M0RA 4JPZB 4C0KA 1ALVA 4DCKA 1WLMA 4M2QA 4N1FA 3QRXA 4N1GA 2MHHA 1NCZA 2LP3A 1CDLA 2O5GA 3PLFB 4HSZA 1DJZA 4XYNA 2L4HA 2SASA 1CFDA 5ER5A 1BU3A 1XA5A 1XYDA 2BCAA 2ISDA 4PE0A 1IKUA 1A4PA 2ZRTA 3EVUA 1C7VA 1JWDA 1CLLA 3PN7C 3WNXB 1PALA 2BL0B 2RGIA 4OV2A 5G08A 3TDUA 1N65A 1SPYA 1F4OA 3FWCA 2E30A 1S6JA 3SG6A 2KBMA 2L98A 2I2RE 3JTDC 2LLTA 1B7TZ 1PSRA 1ZFSA 3BYAA 2WOSA 1TTXA 1QIWA 2JT0A 3DVMA 1SMGA 4PHKA 3GK4X 2AAOA 3CR4X 2IS9A 1UHNA 2EGDA 1JUOA 1WRZA 2LE9B 1D1OA 2K7OA 3OHMB 2E6WA 1NX2A 1M39A 3LLEA 1JSAA 1BMOA 2ZKMX 3EK8A 2LV7A 2Y1NA 2JOJA 1FI5A 3IQOA 2JTZA 4PE1A 2K61A 1CFCA 2AMIA 1C07A 1QVIY 1SL8A 1OMVA 2ZN8A 1R6PA 2PMYA 1EH2A 3VRRA 1CLBA 2JZIA 1NX0A 3CR2A 3I5IC 2PALA 1N0YA 5CSIA 2PVBA 3EK7A 1TOPA 1JBAA 3NSIA 1G4YR 1CM4A 1EL4A 2BL0C 1IWQA 3AAJA 1KCYA 1PK0D 1NP8A 1SCMB 2FCDA 2LCPA 3CGAA 2F2OA 5HLVA 1V1GA 2Y4QA 3AKAA 4GGFA 1YX7A 5AANA 5DKQA 1J1EA 1XK4C 4MSPA 4YGDB 3TDZA 1BR1B 1PULA 4HREE 4ORBB 1A03A 3RLZA 2OS8B 4NQGA 2ZN9A 1IGVA 2WCEA 1LKJA 3I5FC 3PALA 4OR9B 5ER4X 1XFVO 2MJWB 2JTTA 1L2OB 1XVJA 2ZNEA 4WQ3A 3I5HB 1GGWA 2LVJA 2OPOA 1F8HA 4C0LA 2FOTA 1GJYA 1A75B 1S36A 4M2PA 2L5XB 2BKHB 3BUOB 1DGVA 2R2IA 4ORAB 2M1KB 1F70A 3VROA 3FS7A 2HQ8A 2AUCA 1G8IA 1A2XA 1EXRA 2DOQA 2L2EA 4AQJA 1Y0VH 1CTRA 4PHJA 5CSFA 2EC6C 2GGMA 4BY5A 4QJ5B 1QX5B 4PE7A 2LHIA 1YX8A 1J1DA 2ZFDA 1MF8B 4OVNF 1K9UA 4CLNA 4ETOA 3CTNA 1UP5A 1DTLA 4PHNA 2MRDA 3I5GC 1DGUA 2F2PA 4XJKB 1EG4A 1KK7Z 3CWGA 1IH0A 3O78A 2LLSA 2JULA 1CNPA 1KWOC 2BKIB 2KHNA 1CDMA 1GQMA 1TNXA 3E3RA 1K9KA 2G9BA 4MN0A 3SIBA 3PN7B 3OB1B 3BUWB 3D0YA 5I2QA 3SG5A 1VRKA 2V53A 3GK1A 1XO5A 3JTDB 1CB1A 2QPTA 2L51A 3SG3A 3VRPA 2JC2A 1UURA 1RWYA 2JXLA 1UUSA 2BECA 2LVIA 1BODA 1WDCC 2B1UA 2OTGC 5DKRA 4BY4A 4MRYA 4D1EA 4I5KA 1PVBA 4C0JA 1B1GA 2ZRSA 1K93D 2JNFA 1OMDA 1DF0A 1FBVA 2KQ6A 1G33A 5KSZA 1YUTA 3BOWB 2L4IA 1RTP1 3DVKA 1KFUS 1IQ3A 3ZNIA 1S6IA 3DVJA 1YURA 2FJUB 1ZACA 2NXQA 5HLOA 1WY9A 5F6TA 1S1EA 1QX2A 4P2YB 1V1FA 1DT7B 1QLSA 1TN4A 2SCPA 3I5IB 1XFUO 1K94A 1X02A 2M3WA 3KPXA 4GNKB 5I2LA 2M9GA 1IJ6A 2MLEC 1QVIZ 1UWOA 2M97A 2WCBA 4N5XA 1FW4A 2LHLA 2LVKA 3VRQA 1QX7A 1BT6A 5KU1A 1OZOA 3FWBA 4MZKA 1C7WA 1BF5A 2KQYA 2TN4A 1U5IA 1F55A 2MBXA 1AHRA 1NUBA 1RROA 1FPWA 1DJYA 2H61A 4MLWA 1MXEA 3ICBA 3PM8A 1WRKA 2CBLA 2I94A 4L9MA 2K7DA 3TDIA 2H61C 2KNEA 3I5FB 4PE4A 4DIRA 2JT3A 4MVFA 4YGCB 2KFHA 2LUXA 2FCEA 1DJHA 1FI6A 1DJIA 2WCFA 3DF0B 1AVSA 1JF2A 1GGZA 1TCFA 1WRLA 4JQ0D 2MAZA 4I5LB 3CR5X 5IBWA 1JC2A 2KI6C 4OCIA 2K8MB 1SRAA 4GBAA 3TUYC 1OOJA 1LA3A 1M46A 3F45A 4IL1A 1J7OA 2COLB 4AQIA 1CKKA 1OE9B 2BCBA 3GK2A 2NLNA 2M1UA 2P6BB 4PDZA 1B4CA 2K0JA 3NSLA 5HYDA 4NDCA 1SR6C 1YR5A 2EC6B 1TIZA 3BQ3A 4U8DA 4YGEB 1QV0A 2M8UA 3A4UB 4GGFC 4MRXA 1RJVA 2LMTA 1AK8A 5K89A 1BG1A 3CZTX 1YUSA 2K2FA 4QJ4B 2O60A 2LAPA 3I5GB 3O4YA 3RM1A 1HT9A 3KF9A 5TNCA 5B8IB 1J7PA 1Y6WA 4PALA 1KWOB 1SL9A 3DD4A 1MWNA 2BBMA 2F8PA 4GPLB 1N2DA 3A8RA 4MEWA 2I18A 2WC8A 3EKJA 1OZSA 4I5JA 1DJWA 3C1VA 4UPGA 1R2UA 1W7IB 1WDCB 2OTGB 1SL7A 4ZCVA 3VRNA 2PSRA 1CFPA 1LVCD 1B47A 1B8RA 1NX3A 1KFXS 2QACA 4YGBB 2M49B 2L50A 3CS1A 2JU0A 1MXLC 2CT9A 2NCOA 3JVTC 1K90D 2JQ6A 5JJGA 1DF0B 3OX6A 1IQ5A 1QASA 1RECA 1UHKA 1NCYA 4NDBA 1QS7A 2LVVA 1YRTB 3EKHA 3OX5A 5J3XA 5BPJA 1SCVA 4PCWA 2CXJA 1H8BA 1FF1A 1W7JB 2WNDA 1M31A 4ORCB 2KYCA 1ZOTB 3FIAA 4GGNA 2JT8A 4HRGA 1S5GY 2Y1MA 4CIDA 1QJTA 1EJ3A 3KHEA 2CCMA 1M63B 2KOTA 3SIAA 1SW8A 4MZJA 2LNKA 5JOLA 2LANA 2BE6A 2KI4C 2LLUA 3IF7A 1MHOA 3LK0A 1IRJA 3GOFA 2GGZA 3PSRA 1XFZO 1A75A 1A29A 2F3ZA 4YGAA 1CMFA 1Y1UA 1QV1A 4DS7A 1DVIA 1DJGA 1YUUA 2D8NA 2PRUA 4GUKA 1K9PA 4P5OE 1KK8C 2F3YA 3KO0A 1CMGA 1JFKA 4DUQA 1B8CA 3ZWHA 2KYFA 3BXKA 1ODBA 3PFVA 2A4JA 3AAKA 4OKHA 3TUYB 4Q04A 5DKNA 4TNCA 1LINA 5PALA 5AFPA 1Y1AA 4GFTA 2PASA 4JWQA 2JPTA 2K2AA 2M29A 5D7FA 4QJ3B 1NYAA 1KFUL 3EVVA 1YVLA 1KSMA 1SR6B 1B8LA 3SG2A 1AJ4A 3OP0A 1J7RA 2HQWA 2KI6D 4WQ2A 1SY9A 2JNXA 5GQQC 4XJKA 3PATA 4GAOA 1H4BA 1YVHA 4MBEA 2NZ0A 2HETA 3OB2B 4A4CA 1RFJA 1NX1A 2M7LA 1S26D 4CFQA 1MQ1A 1KQVA 5D69A 1K2HA 1K8UA 4F0ZB 3TS5C 1SYMA 1ALWA 1PRWA 1JF0A 2Q4UA 2LC5A 1F4QA 1XFYO 3BUMB 2NCPA 1CM1A 1L7ZA 1OSAA 2VRGA 3EK4A 1QLKA 3IQQA 3NSKA 4YI8A 1AP4A 3M0WA 4CPVA 1KQMC 3BUXB 2CNPA 4FQOA 2KGBC 5I2OA 3K21A 3BOWA 1SNLA 4R1EA 3KEVA 2KFFA 2BBNA 2MA2A 1B9AA 1CDPA 2KAVA 1SKTA 2ZNDA 3BUNB 1LXFC 3SG4A 1UHJA 3JVTB 3SJSA 1NCXA 1OMRA 1HQVA 1KSOA 1MUXA 3DVEA 1IJ5A 1YTZC 4ZCUA 3EVRA 1IG5A 5HKWA 1Y1XA 2HF5A 2MLFC 3WXAA 1B7TY 1BOCA 4YI9A 2I7AA 3SG7A 2BE4A 1K96A 1BJFA 3LL8B 1BLQA 2LMUA 4FTGA 1K95A 1XK4A 1TCOB 3TZ1A 2LUCA 3VGOA 3D0YB 5AEQA 1NIWA 2KI4B 1CLMA
chains in the Genus database with same CATH superfamily
1QIVA 1Q80A 1BR4B 2HPSA 1S5GZ 5FYXA 3V2LA 1S6CA 4A4BA 1AUIB 3D10A 1JFJA 3MSEB 2KDHA 4PHMA 2KSPA 1PVAA 2KBIA 4YBHB 3DF0A 4I5NB 2BAPA 4ICBA 2L0PA 3NXAA 1F71A 2K7BA 2KLDA 2LP2A 2JXCA 2LMVA 3BFHA 3NHTA 3NSOA 5CSNA 3UNWA 1TWOA 1KK8B 5I8NA 5AERA 1YRUB 1NPQA 4M2OA 3HCMA 1WLZA 1SBJA 4YRUA 2EHBA 1QXPA 1M45A 1QATA 5HKZA 1AJ5A 4CFRA 5CPVA 1OQPA 3AKBA 2KAYA 5CSJA 1KFXL 1TNQA 2G2BA 2WORA 1SCMC 1UHIA 1UHHA 1PSBA 3CLNA 3O2PA 4HRHA 5HKYA 2BNXA 1ZMZA 2M7NA 1QTXA 3O6BA 3SS4A 2H8VA 1MR8A 1DC1A 1EG3A 4MZLA 1LA0A 2OS8C 1U5IB 4AOMA 1NWDA 1DMOA 2H2KA 4DRWA 2KFGA 1L2OC 2GV5A 3WHTB 1XFXO 2LM5A 3I5HC 1J7QA 1E8AA 2F33A 1CDNA 5KTYA 5DICA 4USLA 1NSHA 3IVTA 3LK1A 2KPHA 3TS5B 4E68A 1S3PA 2CTNA 5EL2A 3QMEA 2JWWA 3WHUB 2BCXA 1SK6D 1TRFA 2K7CA 1CFFA 1OOIX 1TNWA 1DJXA 2KAXA 2JRFA 1KQMB 2KGRA 1RK9A 1TNPA 1J55A 2Q91A 5AXIA 2Y5IA 1XFWO 3HX4A 5FI7A 3LCPC 4WRIA 3H4SE 4NDDA 1ZUZA 1F54A 4INWA 1KK7Y 2M0RA 3D78A 4F7FA 4JPZB 4C0KA 1ALVA 3BFAA 4DCKA 1WLMA 4M2QA 4N1FA 3QRXA 4N1GA 2MHHA 1NCZA 2LP3A 1CDLA 2O5GA 3PLFB 4HSZA 1DJZA 4XYNA 2L4HA 2SASA 1CFDA 5ER5A 3EG5B 3PM2A 1BU3A 1XA5A 1XYDA 2BCAA 4OZDA 4PE0A 2ISDA 1IKUA 1A4PA 2ZRTA 3EVUA 1C7VA 1JWDA 1CLLA 3PN7C 3WNXB 1PALA 2BL0B 2RGIA 4OV2A 5G08A 3TDUA 1N65A 1SPYA 1F4OA 3CDNA 2E30A 1S6JA 3FWCA 2KBMA 2L98A 2I2RE 3JTDC 3SG6A 2LLTA 3B87A 1B7TZ 1PSRA 1ZFSA 3BYAA 3B7AA 2WOSA 1TTXA 1QIWA 2JT0A 3DVMA 1SMGA 4PHKA 3GK4X 2AAOA 2QDIA 3CR4X 2IS9A 1UHNA 2EGDA 1JUOA 1WRZA 2LE9B 2PQLA 1D1OA 2K7OA 3OHMB 2E6WA 1NX2A 1M39A 3DYEA 3L4LA 1W9ZA 3LLEA 3N7HA 1BMOA 2ZKMX 3EK8A 2LV7A 1JSAA 2Y1NA 2WC5A 2JOJA 1FI5A 3IQOA 2JTZA 4PE1A 2K61A 3DY9A 1CFCA 2AMIA 1C07A 1QVIY 1SL8A 1OMVA 2ZN8A 1R6PA 2PMYA 1EH2A 3VRRA 1CLBA 3B6XA 2JZIA 1NX0A 3CR2A 3I5IC 2PALA 1N0YA 3D77A 3R1PA 2PVBA 3EK7A 1TOPA 5CSIA 1JBAA 3NSIA 1G4YR 1CM4A 1EL4A 2BL0C 1IWQA 2QEHA 3AAJA 1KCYA 1PK0D 1NP8A 1SCMB 2FCDA 2LCPA 2WCJA 2F2OA 1OOGA 1V1GA 2WCMA 2Y4QA 3AKAA 3CGAA 4GGFA 1YX7A 5AANA 3BJHA 5DKQA 1J1EA 1XK4C 4MSPA 4YGDB 3TDZA 1BR1B 1PULA 4HREE 4ORBB 1A03A 3RLZA 2OS8B 4NQGA 2ZN9A 1IGVA 2WCEA 1LKJA 3I5FC 3PALA 4OR9B 5ER4X 1XFVO 2MJWB 2JTTA 1L2OB 1XVJA 3DXLA 2ZNEA 4WQ3A 3I5HB 1GGWA 2LVJA 2OPOA 1F8HA 4C0LA 2FOTA 1GJYA 1A75B 2WCHA 1S36A 4M2PA 2L5XB 2BKHB 3R1VA 3D74A 3BUOB 1DGVA 2R2IA 3O4XA 4ORAB 2M1KB 2WCLA 2QEVA 1F70A 3VROA 3FS7A 2HQ8A 2AUCA 1G8IA 1A2XA 1EXRA 2DOQA 2L2EA 4AQJA 1Y0VH 1CTRA 4PHJA 5CSFA 2EC6C 2GGMA 4BY5A 4QJ5B 1QX5B 3K1EA 4PE7A 2LHIA 1YX8A 1J1DA 2PYQA 2ZFDA 1MF8B 4OVNF 1K9UA 4CLNA 4ETOA 3CTNA 1UP5A 3RZSA 1DTLA 4PHNA 2MRDA 3I5GC 1IIOA 1DGUA 2F2PA 4XJKB 1EG4A 1KK7Z 1TUZA 3PJIA 3CWGA 1IH0A 1DELA 3O78A 2LLSA 2JULA 1CNPA 1LS8A 1KWOC 2BKIB 2KHNA 1CDMA 1GQMA 1TNXA 3E3RA 1K9KA 2G9BA 4MN0A 3SIBA 3CABA 1OOHA 3PN7B 3OB1B 3BUWB 3D0YA 2L5YA 3NGVA 5I2QA 3SG5A 3Q8IA 1C3YA 1ORGA 1VRKA 2V53A 3GK1A 1XO5A 3JTDB 1CB1A 2QPTA 2L51A 3SG3A 3VRPA 2JC2A 1UURA 1RWYA 2JXLA 2K60A 1UUSA 2BECA 2LVIA 1BODA 1WDCC 2B1UA 2OTGC 5DKRA 4BY4A 4MRYA 4D1EA 4I5KA 1PVBA 4C0JA 1B1GA 2ZRSA 1K93D 2JNFA 1OMDA 1DF0A 1FBVA 2KQ6A 1G33A 5KSZA 1YUTA 3BOWB 2L4IA 1RTP1 3DVKA 1KFUS 1IQ3A 3ZNIA 1S6IA 3DVJA 4IJ7A 1YURA 2FJUB 1DEKA 1ZACA 2NXQA 4INXA 5HLOA 1WY9A 5F6TA 1S1EA 1QX2A 4P2YB 3SS3A 1V1FA 1DT7B 3S0EA 1OW4A 2GTEA 1QLSA 1TN4A 2SCPA 3I5IB 1XFUO 1K94A 1X02A 2M3WA 3KPXA 1QWVA 4GNKB 5I2LA 2M9GA 1IJ6A 3S0GA 2MLEC 1QVIZ 1UWOA 2M97A 2ERBA 2WCBA 1FW4A 2LHLA 2LVKA 4N5XA 3VRQA 1QX7A 1BT6A 5KU1A 1OZOA 3FWBA 4MZKA 1C7WA 1BF5A 5D3OA 2KQYA 2TN4A 1U5IA 1F55A 2MBXA 1AHRA 3CYZA 1NUBA 1RROA 1FPWA 1DJYA 2H61A 4MLWA 1MXEA 3BFBA 3ICBA 3PM8A 1WRKA 3FE8A 2CBLA 2I94A 4L9MA 2K7DA 3TDIA 3VB1A 2H61C 2KNEA 3I5FB 4PE4A 4KYNA 4DIRA 2JT3A 1C3ZA 4MVFA 4YGCB 2KFHA 2LUXA 2FCEA 1DJHA 1FI6A 1DJIA 2WCFA 3DF0B 1AVSA 1JF2A 1GGZA 1TCFA 1WRLA 4JQ0D 2MAZA 4I5LB 3CR5X 5IBWA 1JC2A 3UO9A 2KI6C 4OCIA 2K8MB 1SRAA 4GBAA 3TUYC 1OOJA 1LA3A 1M46A 3F45A 4IL1A 1J7OA 2COLB 5HL1A 4AQIA 1CKKA 1OE9B 2BCBA 3GK2A 2NLNA 2M1UA 2P6BB 4PDZA 1B4CA 2K0JA 3NSLA 5HYDA 4NDCA 1SR6C 1YR5A 3B86A 2EC6B 1TIZA 3BQ3A 4U8DA 4YGEB 1Z4HA 1QV0A 2M8UA 1Z2CB 3A4UB 4GGFC 1RJVA 2LMTA 4MRXA 3SS5A 5K89A 1BG1A 1AK8A 3CZTX 1GM0A 1YUSA 2K2FA 2QEOA 4QJ4B 2O60A 2LAPA 3I5GB 3O4YA 3RM1A 1HT9A 3KF9A 3D76A 4JKTA 5TNCA 5B8IB 1J7PA 1Y6WA 4PALA 1KWOB 1SL9A 3DD4A 1MWNA 2BBMA 2F8PA 4GPLB 1N2DA 3A8RA 4MEWA 2I18A 2WC8A 3EKJA 1OZSA 4I5JA 1DJWA 3C1VA 4UPGA 3S0BA 1R2UA 1W7IB 1WDCB 2OTGB 1SL7A 4ZCVA 2YGUA 3VRNA 2PSRA 4FQTA 1CFPA 1LVCD 4JD9A 1B47A 1B8RA 1NX3A 1KFXS 2QACA 4YGBB 2M49B 2L50A 3CS1A 2JU0A 1MXLC 3CZ1A 2CT9A 2NCOA 3JVTC 1K90D 2JQ6A 3R72A 1DF0B 5JJGA 3OX6A 1IQ5A 1QASA 1RECA 1UHKA 3S0DA 1NCYA 2WC6A 4NDBA 4PT1A 3FE9A 3L4AA 1QS7A 2LVVA 1YRTB 1TUJA 3EKHA 3OX5A 5J3XA 1SCVA 4PCWA 2CXJA 5BPJA 1FF1A 1W7JB 2WNDA 1M31A 4ORCB 2KYCA 1ZOTB 3FIAA 5I94A 4GGNA 2JT8A 4HRGA 1S5GY 2Y1MA 1XFRA 4CIDA 1QJTA 1EJ3A 3KHEA 2CCMA 1M63B 2KOTA 3SIAA 1SW8A 3S0FA 4MZJA 2LNKA 5JOLA 2LANA 2BE6A 2KI4C 2LLUA 3IF7A 3S0AA 1MHOA 3LK0A 3OBVA 1IRJA 3D75A 3GOFA 2GGZA 3B88A 3PSRA 1XFZO 1A75A 1A29A 2F3ZA 4YGAA 2QEBA 1CMFA 1Y1UA 1QV1A 4DS7A 1DVIA 1DJGA 1YUUA 2D8NA 2PRUA 4GUKA 1K9PA 4P5OE 1KK8C 1H8BA 2KLEA 2F3YA 3KO0A 1SSEB 1CMGA 1JFKA 4DUQA 1B8CA 3ZWHA 2KYFA 3BXKA 1ODBA 2FJYA 3PFVA 3OGNA 2A4JA 3AAKA 4OKHA 3TUYB 4Q04A 5DKNA 4TNCA 1LINA 5PALA 5AFPA 1Y1AA 4GFTA 2PASA 4JWQA 2JPTA 2K2AA 2M29A 5D7FA 4QJ3B 1NYAA 1KFUL 3EVVA 1YVLA 1KSMA 1SR6B 1B8LA 3SG2A 1AJ4A 3OP0A 1J7RA 2HQWA 2KI6D 4WQ2A 1SY9A 2JNXA 5GQQC 1T14A 4XJKA 3PATA 4GAOA 1H4BA 3CZ0A 1YVHA 3CZ2A 2NZ0A 4MBEA 3DZTA 2HETA 3OB2B 2P71A 3FE6A 4A4CA 1RFJA 1NX1A 2M7LA 1S26D 4CFQA 1MQ1A 1KQVA 3D73A 5D69A 1K2HA 1K8UA 2JPOA 4F0ZB 3TS5C 1SYMA 1ALWA 1PRWA 1JF0A 2Q4UA 2LC5A 1F4QA 1XFYO 3BUMB 2NCPA 1CM1A 1L7ZA 1OSAA 2VRGA 3EK4A 1QLKA 3IQQA 3NSKA 4YI8A 5FI6A 1AP4A 3M0WA 4CPVA 1KQMC 3BUXB 2CNPA 4FQOA 2KGBC 5I2OA 3K21A 3BOWA 1SNLA 4R1EA 3KEVA 2KFFA 2BBNA 2MA2A 5FI2A 1B9AA 1CDPA 2KAVA 1SKTA 2ZNDA 3BUNB 1LXFC 3SG4A 1UHJA 3JVTB 3SJSA 1NCXA 1OMRA 1HQVA 1KSOA 1MUXA 3DVEA 1IJ5A 1YTZC 4ZCUA 2WCKA 3EVRA 1IG5A 5HKWA 1Y1XA 2HF5A 2MLFC 3WXAA 5HLVA 1B7TY 1BOCA 4YI9A 1OOFA 2I7AA 3SG7A 1DQEA 2BE4A 1K96A 1BJFA 3LL8B 1BLQA 2LMUA 2P70A 4FTGA 1K95A 1XK4A 2L2CA 1TCOB 3L47A 1P28A 3R1OA 2LUCA 3TZ1A 3VGOA 3D0YB 5AEQA 1NIWA 3NHIA 2KI4B 1CLMA
chains in the Genus database with same CATH topology
1QIVA 1Q80A 1BR4B 2HPSA 1S5GZ 5FYXA 1S6CA 4A4BA 1AUIB 3D10A 1JFJA 3MSEB 2KDHA 4PHMA 2KSPA 1PVAA 2KBIA 4YBHB 3DF0A 4I5NB 1F71A 4ICBA 2L0PA 3NXAA 2K7BA 2LP2A 2JXCA 2LMVA 3NSOA 5CSNA 1KK8B 5I8NA 5AERA 1YRUB 1NPQA 4M2OA 3HCMA 1WLZA 1SBJA 4YRUA 2EHBA 1QXPA 1M45A 1QATA 5HKZA 1AJ5A 4CFRA 5CPVA 1OQPA 3AKBA 2KAYA 5CSJA 1KFXL 1TNQA 2G2BA 2WORA 1SCMC 1UHIA 1UHHA 1PSBA 3CLNA 3O2PA 4HRHA 5HKYA 1ZMZA 2M7NA 1QTXA 3O6BA 1MR8A 1EG3A 4MZLA 1LA0A 2OS8C 1U5IB 4AOMA 1NWDA 1DMOA 2H2KA 4DRWA 2KFGA 1L2OC 2GV5A 3WHTB 1XFXO 2LM5A 3I5HC 1J7QA 1E8AA 2F33A 1CDNA 5KTYA 4USLA 1NSHA 3LK1A 3TS5B 4E68A 1S3PA 2CTNA 2JWWA 3WHUB 2BCXA 1SK6D 1TRFA 2K7CA 1CFFA 1TNWA 1DJXA 2KAXA 2JRFA 1KQMB 2KGRA 1RK9A 1TNPA 1J55A 2Q91A 5AXIA 2Y5IA 1XFWO 3HX4A 3LCPC 4WRIA 3H4SE 4NDDA 1ZUZA 1F54A 1KK7Y 2M0RA 4JPZB 4C0KA 1ALVA 4DCKA 1WLMA 4M2QA 4N1FA 3QRXA 4N1GA 2MHHA 1NCZA 2LP3A 1CDLA 2O5GA 3PLFB 4HSZA 1DJZA 4XYNA 2L4HA 2SASA 1CFDA 5ER5A 1BU3A 1XA5A 1XYDA 2BCAA 2ISDA 4PE0A 1IKUA 1A4PA 2ZRTA 3EVUA 1C7VA 1JWDA 1CLLA 3PN7C 3WNXB 1PALA 2BL0B 2RGIA 4OV2A 5G08A 3TDUA 1N65A 1SPYA 1F4OA 3FWCA 2E30A 1S6JA 3SG6A 2KBMA 2L98A 2I2RE 3JTDC 2LLTA 1B7TZ 1PSRA 1ZFSA 3BYAA 2WOSA 1TTXA 1QIWA 2JT0A 3DVMA 1SMGA 4PHKA 3GK4X 2AAOA 3CR4X 2IS9A 1UHNA 2EGDA 1JUOA 1WRZA 2LE9B 1D1OA 2K7OA 3OHMB 2E6WA 1NX2A 1M39A 3LLEA 1JSAA 1BMOA 2ZKMX 3EK8A 2LV7A 2Y1NA 2JOJA 1FI5A 3IQOA 2JTZA 4PE1A 2K61A 1CFCA 2AMIA 1C07A 1QVIY 1SL8A 1OMVA 2ZN8A 1R6PA 2PMYA 1EH2A 3VRRA 1CLBA 2JZIA 1NX0A 3CR2A 3I5IC 2PALA 1N0YA 5CSIA 2PVBA 3EK7A 1TOPA 1JBAA 3NSIA 1G4YR 1CM4A 1EL4A 2BL0C 1IWQA 3AAJA 1KCYA 1PK0D 1NP8A 1SCMB 2FCDA 2LCPA 3CGAA 2F2OA 5HLVA 1V1GA 2Y4QA 3AKAA 4GGFA 1YX7A 5AANA 5DKQA 1J1EA 1XK4C 4MSPA 4YGDB 3TDZA 1BR1B 1PULA 4HREE 4ORBB 1A03A 3RLZA 2OS8B 4NQGA 2ZN9A 1IGVA 2WCEA 1LKJA 3I5FC 3PALA 4OR9B 5ER4X 1XFVO 2MJWB 2JTTA 1L2OB 1XVJA 2ZNEA 4WQ3A 3I5HB 1GGWA 2LVJA 2OPOA 1F8HA 4C0LA 2FOTA 1GJYA 1A75B 1S36A 4M2PA 2L5XB 2BKHB 3BUOB 1DGVA 2R2IA 4ORAB 2M1KB 1F70A 3VROA 3FS7A 2HQ8A 2AUCA 1G8IA 1A2XA 1EXRA 2DOQA 2L2EA 4AQJA 1Y0VH 1CTRA 4PHJA 5CSFA 2EC6C 2GGMA 4BY5A 4QJ5B 1QX5B 4PE7A 2LHIA 1YX8A 1J1DA 2ZFDA 1MF8B 4OVNF 1K9UA 4CLNA 4ETOA 3CTNA 1UP5A 1DTLA 4PHNA 2MRDA 3I5GC 1DGUA 2F2PA 4XJKB 1EG4A 1KK7Z 3CWGA 1IH0A 3O78A 2LLSA 2JULA 1CNPA 1KWOC 2BKIB 2KHNA 1CDMA 1GQMA 1TNXA 3E3RA 1K9KA 2G9BA 4MN0A 3SIBA 3PN7B 3OB1B 3BUWB 3D0YA 5I2QA 3SG5A 1VRKA 2V53A 3GK1A 1XO5A 3JTDB 1CB1A 2QPTA 2L51A 3SG3A 3VRPA 2JC2A 1UURA 1RWYA 2JXLA 1UUSA 2BECA 2LVIA 1BODA 1WDCC 2B1UA 2OTGC 5DKRA 4BY4A 4MRYA 4D1EA 4I5KA 1PVBA 4C0JA 1B1GA 2ZRSA 1K93D 2JNFA 1OMDA 1DF0A 1FBVA 2KQ6A 1G33A 5KSZA 1YUTA 3BOWB 2L4IA 1RTP1 3DVKA 1KFUS 1IQ3A 3ZNIA 1S6IA 3DVJA 1YURA 2FJUB 1ZACA 2NXQA 5HLOA 1WY9A 5F6TA 1S1EA 1QX2A 4P2YB 1V1FA 1DT7B 1QLSA 1TN4A 2SCPA 3I5IB 1XFUO 1K94A 1X02A 2M3WA 3KPXA 4GNKB 5I2LA 2M9GA 1IJ6A 2MLEC 1QVIZ 1UWOA 2M97A 2WCBA 4N5XA 1FW4A 2LHLA 2LVKA 3VRQA 1QX7A 1BT6A 5KU1A 1OZOA 3FWBA 4MZKA 1C7WA 1BF5A 2KQYA 2TN4A 1U5IA 1F55A 2MBXA 1AHRA 1NUBA 1RROA 1FPWA 1DJYA 2H61A 4MLWA 1MXEA 3ICBA 3PM8A 1WRKA 2CBLA 2I94A 4L9MA 2K7DA 3TDIA 2H61C 2KNEA 3I5FB 4PE4A 4DIRA 2JT3A 4MVFA 4YGCB 2KFHA 2LUXA 2FCEA 1DJHA 1FI6A 1DJIA 2WCFA 3DF0B 1AVSA 1JF2A 1GGZA 1TCFA 1WRLA 4JQ0D 2MAZA 4I5LB 3CR5X 5IBWA 1JC2A 2KI6C 4OCIA 2K8MB 1SRAA 4GBAA 3TUYC 1OOJA 1LA3A 1M46A 3F45A 4IL1A 1J7OA 2COLB 4AQIA 1CKKA 1OE9B 2BCBA 3GK2A 2NLNA 2M1UA 2P6BB 4PDZA 1B4CA 2K0JA 3NSLA 5HYDA 4NDCA 1SR6C 1YR5A 2EC6B 1TIZA 3BQ3A 4U8DA 4YGEB 1QV0A 2M8UA 3A4UB 4GGFC 4MRXA 1RJVA 2LMTA 1AK8A 5K89A 1BG1A 3CZTX 1YUSA 2K2FA 4QJ4B 2O60A 2LAPA 3I5GB 3O4YA 3RM1A 1HT9A 3KF9A 5TNCA 5B8IB 1J7PA 1Y6WA 4PALA 1KWOB 1SL9A 3DD4A 1MWNA 2BBMA 2F8PA 4GPLB 1N2DA 3A8RA 4MEWA 2I18A 2WC8A 3EKJA 1OZSA 4I5JA 1DJWA 3C1VA 4UPGA 1R2UA 1W7IB 1WDCB 2OTGB 1SL7A 4ZCVA 3VRNA 2PSRA 1CFPA 1LVCD 1B47A 1B8RA 1NX3A 1KFXS 2QACA 4YGBB 2M49B 2L50A 3CS1A 2JU0A 1MXLC 2CT9A 2NCOA 3JVTC 1K90D 2JQ6A 5JJGA 1DF0B 3OX6A 1IQ5A 1QASA 1RECA 1UHKA 1NCYA 4NDBA 1QS7A 2LVVA 1YRTB 3EKHA 3OX5A 5J3XA 5BPJA 1SCVA 4PCWA 2CXJA 1H8BA 1FF1A 1W7JB 2WNDA 1M31A 4ORCB 2KYCA 1ZOTB 3FIAA 4GGNA 2JT8A 4HRGA 1S5GY 2Y1MA 4CIDA 1QJTA 1EJ3A 3KHEA 2CCMA 1M63B 2KOTA 3SIAA 1SW8A 4MZJA 2LNKA 5JOLA 2LANA 2BE6A 2KI4C 2LLUA 3IF7A 1MHOA 3LK0A 1IRJA 3GOFA 2GGZA 3PSRA 1XFZO 1A75A 1A29A 2F3ZA 4YGAA 1CMFA 1Y1UA 1QV1A 4DS7A 1DVIA 1DJGA 1YUUA 2D8NA 2PRUA 4GUKA 1K9PA 4P5OE 1KK8C 2F3YA 3KO0A 1CMGA 1JFKA 4DUQA 1B8CA 3ZWHA 2KYFA 3BXKA 1ODBA 3PFVA 2A4JA 3AAKA 4OKHA 3TUYB 4Q04A 5DKNA 4TNCA 1LINA 5PALA 5AFPA 1Y1AA 4GFTA 2PASA 4JWQA 2JPTA 2K2AA 2M29A 5D7FA 4QJ3B 1NYAA 1KFUL 3EVVA 1YVLA 1KSMA 1SR6B 1B8LA 3SG2A 1AJ4A 3OP0A 1J7RA 2HQWA 2KI6D 4WQ2A 1SY9A 2JNXA 5GQQC 4XJKA 3PATA 4GAOA 1H4BA 1YVHA 4MBEA 2NZ0A 2HETA 3OB2B 4A4CA 1RFJA 1NX1A 2M7LA 1S26D 4CFQA 1MQ1A 1KQVA 5D69A 1K2HA 1K8UA 4F0ZB 3TS5C 1SYMA 1ALWA 1PRWA 1JF0A 2Q4UA 2LC5A 1F4QA 1XFYO 3BUMB 2NCPA 1CM1A 1L7ZA 1OSAA 2VRGA 3EK4A 1QLKA 3IQQA 3NSKA 4YI8A 1AP4A 3M0WA 4CPVA 1KQMC 3BUXB 2CNPA 4FQOA 2KGBC 5I2OA 3K21A 3BOWA 1SNLA 4R1EA 3KEVA 2KFFA 2BBNA 2MA2A 1B9AA 1CDPA 2KAVA 1SKTA 2ZNDA 3BUNB 1LXFC 3SG4A 1UHJA 3JVTB 3SJSA 1NCXA 1OMRA 1HQVA 1KSOA 1MUXA 3DVEA 1IJ5A 1YTZC 4ZCUA 3EVRA 1IG5A 5HKWA 1Y1XA 2HF5A 2MLFC 3WXAA 1B7TY 1BOCA 4YI9A 2I7AA 3SG7A 2BE4A 1K96A 1BJFA 3LL8B 1BLQA 2LMUA 4FTGA 1K95A 1XK4A 1TCOB 3TZ1A 2LUCA 3VGOA 3D0YB 5AEQA 1NIWA 2KI4B 1CLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QIV A;  1Q80 A;  1BR4 B;  2HPS A;  1S5G Z;  5FYX A;  1S6C A;  4A4B A;  1AUI B;  3D10 A;  1JFJ A;  3MSE B;  2KDH A;  4PHM A;  2KSP A;  1PVA A;  2KBI A;  4YBH B;  3DF0 A;  4I5N B;  1F71 A;  4ICB A;  2L0P A;  3NXA A;  2K7B A;  2LP2 A;  2JXC A;  2LMV A;  3NSO A;  5CSN A;  1KK8 B;  5I8N A;  5AER A;  1YRU B;  1NPQ A;  4M2O A;  3HCM A;  1WLZ A;  1SBJ A;  4YRU A;  2EHB A;  1QXP A;  1M45 A;  1QAT A;  5HKZ A;  1AJ5 A;  4CFR A;  5CPV A;  1OQP A;  3AKB A;  2KAY A;  5CSJ A;  1KFX L;  1TNQ A;  2G2B A;  2WOR A;  1SCM C;  1UHI A;  1UHH A;  1PSB A;  3CLN A;  3O2P A;  4HRH A;  5HKY A;  1ZMZ A;  2M7N A;  1QTX A;  3O6B A;  1MR8 A;  1EG3 A;  4MZL A;  1LA0 A;  2OS8 C;  1U5I B;  4AOM A;  1NWD A;  1DMO A;  2H2K A;  4DRW A;  2KFG A;  1L2O C;  2GV5 A;  3WHT B;  1XFX O;  2LM5 A;  3I5H C;  1J7Q A;  1E8A A;  2F33 A;  1CDN A;  5KTY A;  4USL A;  1NSH A;  3LK1 A;  3TS5 B;  4E68 A;  1S3P A;  2CTN A;  2JWW A;  3WHU B;  2BCX A;  1SK6 D;  1TRF A;  2K7C A;  1CFF A;  1TNW A;  1DJX A;  2KAX A;  2JRF A;  1KQM B;  2KGR A;  1RK9 A;  1TNP A;  1J55 A;  2Q91 A;  5AXI A;  2Y5I A;  1XFW O;  3HX4 A;  3LCP C;  4WRI A;  3H4S E;  4NDD A;  1ZUZ A;  1F54 A;  1KK7 Y;  2M0R A;  4JPZ B;  4C0K A;  1ALV A;  4DCK A;  1WLM A;  4M2Q A;  4N1F A;  3QRX A;  4N1G A;  2MHH A;  1NCZ A;  2LP3 A;  1CDL A;  2O5G A;  3PLF B;  4HSZ A;  1DJZ A;  4XYN A;  2L4H A;  2SAS A;  1CFD A;  5ER5 A;  1BU3 A;  1XA5 A;  1XYD A;  2BCA A;  2ISD A;  4PE0 A;  1IKU A;  1A4P A;  2ZRT A;  3EVU A;  1C7V A;  1JWD A;  1CLL A;  3PN7 C;  3WNX B;  1PAL A;  2BL0 B;  2RGI A;  4OV2 A;  5G08 A;  3TDU A;  1N65 A;  1SPY A;  1F4O A;  3FWC A;  2E30 A;  1S6J A;  3SG6 A;  2KBM A;  2L98 A;  2I2R E;  3JTD C;  2LLT A;  1B7T Z;  1PSR A;  1ZFS A;  3BYA A;  2WOS A;  1TTX A;  1QIW A;  2JT0 A;  3DVM A;  1SMG A;  4PHK A;  3GK4 X;  2AAO A;  3CR4 X;  2IS9 A;  1UHN A;  2EGD A;  1JUO A;  1WRZ A;  2LE9 B;  1D1O A;  2K7O A;  3OHM B;  2E6W A;  1NX2 A;  1M39 A;  3LLE A;  1JSA A;  1BMO A;  2ZKM X;  3EK8 A;  2LV7 A;  2Y1N A;  2JOJ A;  1FI5 A;  3IQO A;  2JTZ A;  4PE1 A;  2K61 A;  1CFC A;  2AMI A;  1C07 A;  1QVI Y;  1SL8 A;  1OMV A;  2ZN8 A;  1R6P A;  2PMY A;  1EH2 A;  3VRR A;  1CLB A;  2JZI A;  1NX0 A;  3CR2 A;  3I5I C;  2PAL A;  1N0Y A;  5CSI A;  2PVB A;  3EK7 A;  1TOP A;  1JBA A;  3NSI A;  1G4Y R;  1CM4 A;  1EL4 A;  2BL0 C;  1IWQ A;  3AAJ A;  1KCY A;  1PK0 D;  1NP8 A;  1SCM B;  2FCD A;  2LCP A;  3CGA A;  2F2O A;  5HLV A;  1V1G A;  2Y4Q A;  3AKA A;  4GGF A;  1YX7 A;  5AAN A;  5DKQ A;  1J1E A;  1XK4 C;  4MSP A;  4YGD B;  3TDZ A;  1BR1 B;  1PUL A;  4HRE E;  4ORB B;  1A03 A;  3RLZ A;  2OS8 B;  4NQG A;  2ZN9 A;  1IGV A;  2WCE A;  1LKJ A;  3I5F C;  3PAL A;  4OR9 B;  5ER4 X;  1XFV O;  2MJW B;  2JTT A;  1L2O B;  1XVJ A;  2ZNE A;  4WQ3 A;  3I5H B;  1GGW A;  2LVJ A;  2OPO A;  1F8H A;  4C0L A;  2FOT A;  1GJY A;  1A75 B;  1S36 A;  4M2P A;  2L5X B;  2BKH B;  3BUO B;  1DGV A;  2R2I A;  4ORA B;  2M1K B;  1F70 A;  3VRO A;  3FS7 A;  2HQ8 A;  2AUC A;  1G8I A;  1A2X A;  1EXR A;  2DOQ A;  2L2E A;  4AQJ A;  1Y0V H;  1CTR A;  4PHJ A;  5CSF A;  2EC6 C;  2GGM A;  4BY5 A;  4QJ5 B;  1QX5 B;  4PE7 A;  2LHI A;  1YX8 A;  1J1D A;  2ZFD A;  1MF8 B;  4OVN F;  1K9U A;  4CLN A;  4ETO A;  3CTN A;  1UP5 A;  1DTL A;  4PHN A;  2MRD A;  3I5G C;  1DGU A;  2F2P A;  4XJK B;  1EG4 A;  1KK7 Z;  3CWG A;  1IH0 A;  3O78 A;  2LLS A;  2JUL A;  1CNP A;  1KWO C;  2BKI B;  2KHN A;  1CDM A;  1GQM A;  1TNX A;  3E3R A;  1K9K A;  2G9B A;  4MN0 A;  3SIB A;  3PN7 B;  3OB1 B;  3BUW B;  3D0Y A;  5I2Q A;  3SG5 A;  1VRK A;  2V53 A;  3GK1 A;  1XO5 A;  3JTD B;  1CB1 A;  2QPT A;  2L51 A;  3SG3 A;  3VRP A;  2JC2 A;  1UUR A;  1RWY A;  2JXL A;  1UUS A;  2BEC A;  2LVI A;  1BOD A;  1WDC C;  2B1U A;  2OTG C;  5DKR A;  4BY4 A;  4MRY A;  4D1E A;  4I5K A;  1PVB A;  4C0J A;  1B1G A;  2ZRS A;  1K93 D;  2JNF A;  1OMD A;  1DF0 A;  1FBV A;  2KQ6 A;  1G33 A;  5KSZ A;  1YUT A;  3BOW B;  2L4I A;  1RTP 1;  3DVK A;  1KFU S;  1IQ3 A;  3ZNI A;  1S6I A;  3DVJ A;  1YUR A;  2FJU B;  1ZAC A;  2NXQ A;  5HLO A;  1WY9 A;  5F6T A;  1S1E A;  1QX2 A;  4P2Y B;  1V1F A;  1DT7 B;  1QLS A;  1TN4 A;  2SCP A;  3I5I B;  1XFU O;  1K94 A;  1X02 A;  2M3W A;  3KPX A;  4GNK B;  5I2L A;  2M9G A;  1IJ6 A;  2MLE C;  1QVI Z;  1UWO A;  2M97 A;  2WCB A;  4N5X A;  1FW4 A;  2LHL A;  2LVK A;  3VRQ A;  1QX7 A;  1BT6 A;  5KU1 A;  1OZO A;  3FWB A;  4MZK A;  1C7W A;  1BF5 A;  2KQY A;  2TN4 A;  1U5I A;  1F55 A;  2MBX A;  1AHR A;  1NUB A;  1RRO A;  1FPW A;  1DJY A;  2H61 A;  4MLW A;  1MXE A;  3ICB A;  3PM8 A;  1WRK A;  2CBL A;  2I94 A;  4L9M A;  2K7D A;  3TDI A;  2H61 C;  2KNE A;  3I5F B;  4PE4 A;  4DIR A;  2JT3 A;  4MVF A;  4YGC B;  2KFH A;  2LUX A;  2FCE A;  1DJH A;  1FI6 A;  1DJI A;  2WCF A;  3DF0 B;  1AVS A;  1JF2 A;  1GGZ A;  1TCF A;  1WRL A;  4JQ0 D;  2MAZ A;  4I5L B;  3CR5 X;  5IBW A;  1JC2 A;  2KI6 C;  4OCI A;  2K8M B;  1SRA A;  4GBA A;  3TUY C;  1OOJ A;  1LA3 A;  1M46 A;  3F45 A;  4IL1 A;  1J7O A;  2COL B;  4AQI A;  1CKK A;  1OE9 B;  2BCB A;  3GK2 A;  2NLN A;  2M1U A;  2P6B B;  4PDZ A;  1B4C A;  2K0J A;  3NSL A;  5HYD A;  4NDC A;  1SR6 C;  1YR5 A;  2EC6 B;  1TIZ A;  3BQ3 A;  4U8D A;  4YGE B;  1QV0 A;  2M8U A;  3A4U B;  4GGF C;  4MRX A;  1RJV A;  2LMT A;  1AK8 A;  5K89 A;  1BG1 A;  3CZT X;  1YUS A;  2K2F A;  4QJ4 B;  2O60 A;  2LAP A;  3I5G B;  3O4Y A;  3RM1 A;  1HT9 A;  3KF9 A;  5TNC A;  5B8I B;  1J7P A;  1Y6W A;  4PAL A;  1KWO B;  1SL9 A;  3DD4 A;  1MWN A;  2BBM A;  2F8P A;  4GPL B;  1N2D A;  3A8R A;  4MEW A;  2I18 A;  2WC8 A;  3EKJ A;  1OZS A;  4I5J A;  1DJW A;  3C1V A;  4UPG A;  1R2U A;  1W7I B;  1WDC B;  2OTG B;  1SL7 A;  4ZCV A;  3VRN A;  2PSR A;  1CFP A;  1LVC D;  1B47 A;  1B8R A;  1NX3 A;  1KFX S;  2QAC A;  4YGB B;  2M49 B;  2L50 A;  3CS1 A;  2JU0 A;  1MXL C;  2CT9 A;  2NCO A;  3JVT C;  1K90 D;  2JQ6 A;  5JJG A;  1DF0 B;  3OX6 A;  1IQ5 A;  1QAS A;  1REC A;  1UHK A;  1NCY A;  4NDB A;  1QS7 A;  2LVV A;  1YRT B;  3EKH A;  3OX5 A;  5J3X A;  5BPJ A;  1SCV A;  4PCW A;  2CXJ A;  1H8B A;  1FF1 A;  1W7J B;  2WND A;  1M31 A;  4ORC B;  2KYC A;  1ZOT B;  3FIA A;  4GGN A;  2JT8 A;  4HRG A;  1S5G Y;  2Y1M A;  4CID A;  1QJT A;  1EJ3 A;  3KHE A;  2CCM A;  1M63 B;  2KOT A;  3SIA A;  1SW8 A;  4MZJ A;  2LNK A;  5JOL A;  2LAN A;  2BE6 A;  2KI4 C;  2LLU A;  3IF7 A;  1MHO A;  3LK0 A;  1IRJ A;  3GOF A;  2GGZ A;  3PSR A;  1XFZ O;  1A75 A;  1A29 A;  2F3Z A;  4YGA A;  1CMF A;  1Y1U A;  1QV1 A;  4DS7 A;  1DVI A;  1DJG A;  1YUU A;  2D8N A;  2PRU A;  4GUK A;  1K9P A;  4P5O E;  1KK8 C;  2F3Y A;  3KO0 A;  1CMG A;  1JFK A;  4DUQ A;  1B8C A;  3ZWH A;  2KYF A;  3BXK A;  1ODB A;  3PFV A;  2A4J A;  3AAK A;  4OKH A;  3TUY B;  4Q04 A;  5DKN A;  4TNC A;  1LIN A;  5PAL A;  5AFP A;  1Y1A A;  4GFT A;  2PAS A;  4JWQ A;  2JPT A;  2K2A A;  2M29 A;  5D7F A;  4QJ3 B;  1NYA A;  1KFU L;  3EVV A;  1YVL A;  1KSM A;  1SR6 B;  1B8L A;  3SG2 A;  1AJ4 A;  3OP0 A;  1J7R A;  2HQW A;  2KI6 D;  4WQ2 A;  1SY9 A;  2JNX A;  5GQQ C;  4XJK A;  3PAT A;  4GAO A;  1H4B A;  1YVH A;  4MBE A;  2NZ0 A;  2HET A;  3OB2 B;  4A4C A;  1RFJ A;  1NX1 A;  2M7L A;  1S26 D;  4CFQ A;  1MQ1 A;  1KQV A;  5D69 A;  1K2H A;  1K8U A;  4F0Z B;  3TS5 C;  1SYM A;  1ALW A;  1PRW A;  1JF0 A;  2Q4U A;  2LC5 A;  1F4Q A;  1XFY O;  3BUM B;  2NCP A;  1CM1 A;  1L7Z A;  1OSA A;  2VRG A;  3EK4 A;  1QLK A;  3IQQ A;  3NSK A;  4YI8 A;  1AP4 A;  3M0W A;  4CPV A;  1KQM C;  3BUX B;  2CNP A;  4FQO A;  2KGB C;  5I2O A;  3K21 A;  3BOW A;  1SNL A;  4R1E A;  3KEV A;  2KFF A;  2BBN A;  2MA2 A;  1B9A A;  1CDP A;  2KAV A;  1SKT A;  2ZND A;  3BUN B;  1LXF C;  3SG4 A;  1UHJ A;  3JVT B;  3SJS A;  1NCX A;  1OMR A;  1HQV A;  1KSO A;  1MUX A;  3DVE A;  1IJ5 A;  1YTZ C;  4ZCU A;  3EVR A;  1IG5 A;  5HKW A;  1Y1X A;  2HF5 A;  2MLF C;  3WXA A;  1B7T Y;  1BOC A;  4YI9 A;  2I7A A;  3SG7 A;  2BE4 A;  1K96 A;  1BJF A;  3LL8 B;  1BLQ A;  2LMU A;  4FTG A;  1K95 A;  1XK4 A;  1TCO B;  3TZ1 A;  2LUC A;  3VGO A;  3D0Y B;  5AEQ A;  1NIW A;  2KI4 B;  1CLM A; 
#chains in the Genus database with same CATH topology
 1QIV A;  1Q80 A;  1BR4 B;  2HPS A;  1S5G Z;  5FYX A;  3V2L A;  1S6C A;  4A4B A;  1AUI B;  3D10 A;  1JFJ A;  3MSE B;  2KDH A;  4PHM A;  2KSP A;  1PVA A;  2KBI A;  4YBH B;  3DF0 A;  4I5N B;  2BAP A;  4ICB A;  2L0P A;  3NXA A;  1F71 A;  2K7B A;  2KLD A;  2LP2 A;  2JXC A;  2LMV A;  3BFH A;  3NHT A;  3NSO A;  5CSN A;  3UNW A;  1TWO A;  1KK8 B;  5I8N A;  5AER A;  1YRU B;  1NPQ A;  4M2O A;  3HCM A;  1WLZ A;  1SBJ A;  4YRU A;  2EHB A;  1QXP A;  1M45 A;  1QAT A;  5HKZ A;  1AJ5 A;  4CFR A;  5CPV A;  1OQP A;  3AKB A;  2KAY A;  5CSJ A;  1KFX L;  1TNQ A;  2G2B A;  2WOR A;  1SCM C;  1UHI A;  1UHH A;  1PSB A;  3CLN A;  3O2P A;  4HRH A;  5HKY A;  2BNX A;  1ZMZ A;  2M7N A;  1QTX A;  3O6B A;  3SS4 A;  2H8V A;  1MR8 A;  1DC1 A;  1EG3 A;  4MZL A;  1LA0 A;  2OS8 C;  1U5I B;  4AOM A;  1NWD A;  1DMO A;  2H2K A;  4DRW A;  2KFG A;  1L2O C;  2GV5 A;  3WHT B;  1XFX O;  2LM5 A;  3I5H C;  1J7Q A;  1E8A A;  2F33 A;  1CDN A;  5KTY A;  5DIC A;  4USL A;  1NSH A;  3IVT A;  3LK1 A;  2KPH A;  3TS5 B;  4E68 A;  1S3P A;  2CTN A;  5EL2 A;  3QME A;  2JWW A;  3WHU B;  2BCX A;  1SK6 D;  1TRF A;  2K7C A;  1CFF A;  1OOI X;  1TNW A;  1DJX A;  2KAX A;  2JRF A;  1KQM B;  2KGR A;  1RK9 A;  1TNP A;  1J55 A;  2Q91 A;  5AXI A;  2Y5I A;  1XFW O;  3HX4 A;  5FI7 A;  3LCP C;  4WRI A;  3H4S E;  4NDD A;  1ZUZ A;  1F54 A;  4INW A;  1KK7 Y;  2M0R A;  3D78 A;  4F7F A;  4JPZ B;  4C0K A;  1ALV A;  3BFA A;  4DCK A;  1WLM A;  4M2Q A;  4N1F A;  3QRX A;  4N1G A;  2MHH A;  1NCZ A;  2LP3 A;  1CDL A;  2O5G A;  3PLF B;  4HSZ A;  1DJZ A;  4XYN A;  2L4H A;  2SAS A;  1CFD A;  5ER5 A;  3EG5 B;  3PM2 A;  1BU3 A;  1XA5 A;  1XYD A;  2BCA A;  4OZD A;  4PE0 A;  2ISD A;  1IKU A;  1A4P A;  2ZRT A;  3EVU A;  1C7V A;  1JWD A;  1CLL A;  3PN7 C;  3WNX B;  1PAL A;  2BL0 B;  2RGI A;  4OV2 A;  5G08 A;  3TDU A;  1N65 A;  1SPY A;  1F4O A;  3CDN A;  2E30 A;  1S6J A;  3FWC A;  2KBM A;  2L98 A;  2I2R E;  3JTD C;  3SG6 A;  2LLT A;  3B87 A;  1B7T Z;  1PSR A;  1ZFS A;  3BYA A;  3B7A A;  2WOS A;  1TTX A;  1QIW A;  2JT0 A;  3DVM A;  1SMG A;  4PHK A;  3GK4 X;  2AAO A;  2QDI A;  3CR4 X;  2IS9 A;  1UHN A;  2EGD A;  1JUO A;  1WRZ A;  2LE9 B;  2PQL A;  1D1O A;  2K7O A;  3OHM B;  2E6W A;  1NX2 A;  1M39 A;  3DYE A;  3L4L A;  1W9Z A;  3LLE A;  3N7H A;  1BMO A;  2ZKM X;  3EK8 A;  2LV7 A;  1JSA A;  2Y1N A;  2WC5 A;  2JOJ A;  1FI5 A;  3IQO A;  2JTZ A;  4PE1 A;  2K61 A;  3DY9 A;  1CFC A;  2AMI A;  1C07 A;  1QVI Y;  1SL8 A;  1OMV A;  2ZN8 A;  1R6P A;  2PMY A;  1EH2 A;  3VRR A;  1CLB A;  3B6X A;  2JZI A;  1NX0 A;  3CR2 A;  3I5I C;  2PAL A;  1N0Y A;  3D77 A;  3R1P A;  2PVB A;  3EK7 A;  1TOP A;  5CSI A;  1JBA A;  3NSI A;  1G4Y R;  1CM4 A;  1EL4 A;  2BL0 C;  1IWQ A;  2QEH A;  3AAJ A;  1KCY A;  1PK0 D;  1NP8 A;  1SCM B;  2FCD A;  2LCP A;  2WCJ A;  2F2O A;  1OOG A;  1V1G A;  2WCM A;  2Y4Q A;  3AKA A;  3CGA A;  4GGF A;  1YX7 A;  5AAN A;  3BJH A;  5DKQ A;  1J1E A;  1XK4 C;  4MSP A;  4YGD B;  3TDZ A;  1BR1 B;  1PUL A;  4HRE E;  4ORB B;  1A03 A;  3RLZ A;  2OS8 B;  4NQG A;  2ZN9 A;  1IGV A;  2WCE A;  1LKJ A;  3I5F C;  3PAL A;  4OR9 B;  5ER4 X;  1XFV O;  2MJW B;  2JTT A;  1L2O B;  1XVJ A;  3DXL A;  2ZNE A;  4WQ3 A;  3I5H B;  1GGW A;  2LVJ A;  2OPO A;  1F8H A;  4C0L A;  2FOT A;  1GJY A;  1A75 B;  2WCH A;  1S36 A;  4M2P A;  2L5X B;  2BKH B;  3R1V A;  3D74 A;  3BUO B;  1DGV A;  2R2I A;  3O4X A;  4ORA B;  2M1K B;  2WCL A;  2QEV A;  1F70 A;  3VRO A;  3FS7 A;  2HQ8 A;  2AUC A;  1G8I A;  1A2X A;  1EXR A;  2DOQ A;  2L2E A;  4AQJ A;  1Y0V H;  1CTR A;  4PHJ A;  5CSF A;  2EC6 C;  2GGM A;  4BY5 A;  4QJ5 B;  1QX5 B;  3K1E A;  4PE7 A;  2LHI A;  1YX8 A;  1J1D A;  2PYQ A;  2ZFD A;  1MF8 B;  4OVN F;  1K9U A;  4CLN A;  4ETO A;  3CTN A;  1UP5 A;  3RZS A;  1DTL A;  4PHN A;  2MRD A;  3I5G C;  1IIO A;  1DGU A;  2F2P A;  4XJK B;  1EG4 A;  1KK7 Z;  1TUZ A;  3PJI A;  3CWG A;  1IH0 A;  1DEL A;  3O78 A;  2LLS A;  2JUL A;  1CNP A;  1LS8 A;  1KWO C;  2BKI B;  2KHN A;  1CDM A;  1GQM A;  1TNX A;  3E3R A;  1K9K A;  2G9B A;  4MN0 A;  3SIB A;  3CAB A;  1OOH A;  3PN7 B;  3OB1 B;  3BUW B;  3D0Y A;  2L5Y A;  3NGV A;  5I2Q A;  3SG5 A;  3Q8I A;  1C3Y A;  1ORG A;  1VRK A;  2V53 A;  3GK1 A;  1XO5 A;  3JTD B;  1CB1 A;  2QPT A;  2L51 A;  3SG3 A;  3VRP A;  2JC2 A;  1UUR A;  1RWY A;  2JXL A;  2K60 A;  1UUS A;  2BEC A;  2LVI A;  1BOD A;  1WDC C;  2B1U A;  2OTG C;  5DKR A;  4BY4 A;  4MRY A;  4D1E A;  4I5K A;  1PVB A;  4C0J A;  1B1G A;  2ZRS A;  1K93 D;  2JNF A;  1OMD A;  1DF0 A;  1FBV A;  2KQ6 A;  1G33 A;  5KSZ A;  1YUT A;  3BOW B;  2L4I A;  1RTP 1;  3DVK A;  1KFU S;  1IQ3 A;  3ZNI A;  1S6I A;  3DVJ A;  4IJ7 A;  1YUR A;  2FJU B;  1DEK A;  1ZAC A;  2NXQ A;  4INX A;  5HLO A;  1WY9 A;  5F6T A;  1S1E A;  1QX2 A;  4P2Y B;  3SS3 A;  1V1F A;  1DT7 B;  3S0E A;  1OW4 A;  2GTE A;  1QLS A;  1TN4 A;  2SCP A;  3I5I B;  1XFU O;  1K94 A;  1X02 A;  2M3W A;  3KPX A;  1QWV A;  4GNK B;  5I2L A;  2M9G A;  1IJ6 A;  3S0G A;  2MLE C;  1QVI Z;  1UWO A;  2M97 A;  2ERB A;  2WCB A;  1FW4 A;  2LHL A;  2LVK A;  4N5X A;  3VRQ A;  1QX7 A;  1BT6 A;  5KU1 A;  1OZO A;  3FWB A;  4MZK A;  1C7W A;  1BF5 A;  5D3O A;  2KQY A;  2TN4 A;  1U5I A;  1F55 A;  2MBX A;  1AHR A;  3CYZ A;  1NUB A;  1RRO A;  1FPW A;  1DJY A;  2H61 A;  4MLW A;  1MXE A;  3BFB A;  3ICB A;  3PM8 A;  1WRK A;  3FE8 A;  2CBL A;  2I94 A;  4L9M A;  2K7D A;  3TDI A;  3VB1 A;  2H61 C;  2KNE A;  3I5F B;  4PE4 A;  4KYN A;  4DIR A;  2JT3 A;  1C3Z A;  4MVF A;  4YGC B;  2KFH A;  2LUX A;  2FCE A;  1DJH A;  1FI6 A;  1DJI A;  2WCF A;  3DF0 B;  1AVS A;  1JF2 A;  1GGZ A;  1TCF A;  1WRL A;  4JQ0 D;  2MAZ A;  4I5L B;  3CR5 X;  5IBW A;  1JC2 A;  3UO9 A;  2KI6 C;  4OCI A;  2K8M B;  1SRA A;  4GBA A;  3TUY C;  1OOJ A;  1LA3 A;  1M46 A;  3F45 A;  4IL1 A;  1J7O A;  2COL B;  5HL1 A;  4AQI A;  1CKK A;  1OE9 B;  2BCB A;  3GK2 A;  2NLN A;  2M1U A;  2P6B B;  4PDZ A;  1B4C A;  2K0J A;  3NSL A;  5HYD A;  4NDC A;  1SR6 C;  1YR5 A;  3B86 A;  2EC6 B;  1TIZ A;  3BQ3 A;  4U8D A;  4YGE B;  1Z4H A;  1QV0 A;  2M8U A;  1Z2C B;  3A4U B;  4GGF C;  1RJV A;  2LMT A;  4MRX A;  3SS5 A;  5K89 A;  1BG1 A;  1AK8 A;  3CZT X;  1GM0 A;  1YUS A;  2K2F A;  2QEO A;  4QJ4 B;  2O60 A;  2LAP A;  3I5G B;  3O4Y A;  3RM1 A;  1HT9 A;  3KF9 A;  3D76 A;  4JKT A;  5TNC A;  5B8I B;  1J7P A;  1Y6W A;  4PAL A;  1KWO B;  1SL9 A;  3DD4 A;  1MWN A;  2BBM A;  2F8P A;  4GPL B;  1N2D A;  3A8R A;  4MEW A;  2I18 A;  2WC8 A;  3EKJ A;  1OZS A;  4I5J A;  1DJW A;  3C1V A;  4UPG A;  3S0B A;  1R2U A;  1W7I B;  1WDC B;  2OTG B;  1SL7 A;  4ZCV A;  2YGU A;  3VRN A;  2PSR A;  4FQT A;  1CFP A;  1LVC D;  4JD9 A;  1B47 A;  1B8R A;  1NX3 A;  1KFX S;  2QAC A;  4YGB B;  2M49 B;  2L50 A;  3CS1 A;  2JU0 A;  1MXL C;  3CZ1 A;  2CT9 A;  2NCO A;  3JVT C;  1K90 D;  2JQ6 A;  3R72 A;  1DF0 B;  5JJG A;  3OX6 A;  1IQ5 A;  1QAS A;  1REC A;  1UHK A;  3S0D A;  1NCY A;  2WC6 A;  4NDB A;  4PT1 A;  3FE9 A;  3L4A A;  1QS7 A;  2LVV A;  1YRT B;  1TUJ A;  3EKH A;  3OX5 A;  5J3X A;  1SCV A;  4PCW A;  2CXJ A;  5BPJ A;  1FF1 A;  1W7J B;  2WND A;  1M31 A;  4ORC B;  2KYC A;  1ZOT B;  3FIA A;  5I94 A;  4GGN A;  2JT8 A;  4HRG A;  1S5G Y;  2Y1M A;  1XFR A;  4CID A;  1QJT A;  1EJ3 A;  3KHE A;  2CCM A;  1M63 B;  2KOT A;  3SIA A;  1SW8 A;  3S0F A;  4MZJ A;  2LNK A;  5JOL A;  2LAN A;  2BE6 A;  2KI4 C;  2LLU A;  3IF7 A;  3S0A A;  1MHO A;  3LK0 A;  3OBV A;  1IRJ A;  3D75 A;  3GOF A;  2GGZ A;  3B88 A;  3PSR A;  1XFZ O;  1A75 A;  1A29 A;  2F3Z A;  4YGA A;  2QEB A;  1CMF A;  1Y1U A;  1QV1 A;  4DS7 A;  1DVI A;  1DJG A;  1YUU A;  2D8N A;  2PRU A;  4GUK A;  1K9P A;  4P5O E;  1KK8 C;  1H8B A;  2KLE A;  2F3Y A;  3KO0 A;  1SSE B;  1CMG A;  1JFK A;  4DUQ A;  1B8C A;  3ZWH A;  2KYF A;  3BXK A;  1ODB A;  2FJY A;  3PFV A;  3OGN A;  2A4J A;  3AAK A;  4OKH A;  3TUY B;  4Q04 A;  5DKN A;  4TNC A;  1LIN A;  5PAL A;  5AFP A;  1Y1A A;  4GFT A;  2PAS A;  4JWQ A;  2JPT A;  2K2A A;  2M29 A;  5D7F A;  4QJ3 B;  1NYA A;  1KFU L;  3EVV A;  1YVL A;  1KSM A;  1SR6 B;  1B8L A;  3SG2 A;  1AJ4 A;  3OP0 A;  1J7R A;  2HQW A;  2KI6 D;  4WQ2 A;  1SY9 A;  2JNX A;  5GQQ C;  1T14 A;  4XJK A;  3PAT A;  4GAO A;  1H4B A;  3CZ0 A;  1YVH A;  3CZ2 A;  2NZ0 A;  4MBE A;  3DZT A;  2HET A;  3OB2 B;  2P71 A;  3FE6 A;  4A4C A;  1RFJ A;  1NX1 A;  2M7L A;  1S26 D;  4CFQ A;  1MQ1 A;  1KQV A;  3D73 A;  5D69 A;  1K2H A;  1K8U A;  2JPO A;  4F0Z B;  3TS5 C;  1SYM A;  1ALW A;  1PRW A;  1JF0 A;  2Q4U A;  2LC5 A;  1F4Q A;  1XFY O;  3BUM B;  2NCP A;  1CM1 A;  1L7Z A;  1OSA A;  2VRG A;  3EK4 A;  1QLK A;  3IQQ A;  3NSK A;  4YI8 A;  5FI6 A;  1AP4 A;  3M0W A;  4CPV A;  1KQM C;  3BUX B;  2CNP A;  4FQO A;  2KGB C;  5I2O A;  3K21 A;  3BOW A;  1SNL A;  4R1E A;  3KEV A;  2KFF A;  2BBN A;  2MA2 A;  5FI2 A;  1B9A A;  1CDP A;  2KAV A;  1SKT A;  2ZND A;  3BUN B;  1LXF C;  3SG4 A;  1UHJ A;  3JVT B;  3SJS A;  1NCX A;  1OMR A;  1HQV A;  1KSO A;  1MUX A;  3DVE A;  1IJ5 A;  1YTZ C;  4ZCU A;  2WCK A;  3EVR A;  1IG5 A;  5HKW A;  1Y1X A;  2HF5 A;  2MLF C;  3WXA A;  5HLV A;  1B7T Y;  1BOC A;  4YI9 A;  1OOF A;  2I7A A;  3SG7 A;  1DQE A;  2BE4 A;  1K96 A;  1BJF A;  3LL8 B;  1BLQ A;  2LMU A;  2P70 A;  4FTG A;  1K95 A;  1XK4 A;  2L2C A;  1TCO B;  3L47 A;  1P28 A;  3R1O A;  2LUC A;  3TZ1 A;  3VGO A;  3D0Y B;  5AEQ A;  1NIW A;  3NHI A;  2KI4 B;  1CLM A; 
#chains in the Genus database with same CATH homology
 1QIV A;  1Q80 A;  1BR4 B;  2HPS A;  1S5G Z;  5FYX A;  1S6C A;  4A4B A;  1AUI B;  3D10 A;  1JFJ A;  3MSE B;  2KDH A;  4PHM A;  2KSP A;  1PVA A;  2KBI A;  4YBH B;  3DF0 A;  4I5N B;  1F71 A;  4ICB A;  2L0P A;  3NXA A;  2K7B A;  2LP2 A;  2JXC A;  2LMV A;  3NSO A;  5CSN A;  1KK8 B;  5I8N A;  5AER A;  1YRU B;  1NPQ A;  4M2O A;  3HCM A;  1WLZ A;  1SBJ A;  4YRU A;  2EHB A;  1QXP A;  1M45 A;  1QAT A;  5HKZ A;  1AJ5 A;  4CFR A;  5CPV A;  1OQP A;  3AKB A;  2KAY A;  5CSJ A;  1KFX L;  1TNQ A;  2G2B A;  2WOR A;  1SCM C;  1UHI A;  1UHH A;  1PSB A;  3CLN A;  3O2P A;  4HRH A;  5HKY A;  1ZMZ A;  2M7N A;  1QTX A;  3O6B A;  1MR8 A;  1EG3 A;  4MZL A;  1LA0 A;  2OS8 C;  1U5I B;  4AOM A;  1NWD A;  1DMO A;  2H2K A;  4DRW A;  2KFG A;  1L2O C;  2GV5 A;  3WHT B;  1XFX O;  2LM5 A;  3I5H C;  1J7Q A;  1E8A A;  2F33 A;  1CDN A;  5KTY A;  4USL A;  1NSH A;  3LK1 A;  3TS5 B;  4E68 A;  1S3P A;  2CTN A;  2JWW A;  3WHU B;  2BCX A;  1SK6 D;  1TRF A;  2K7C A;  1CFF A;  1TNW A;  1DJX A;  2KAX A;  2JRF A;  1KQM B;  2KGR A;  1RK9 A;  1TNP A;  1J55 A;  2Q91 A;  5AXI A;  2Y5I A;  1XFW O;  3HX4 A;  3LCP C;  4WRI A;  3H4S E;  4NDD A;  1ZUZ A;  1F54 A;  1KK7 Y;  2M0R A;  4JPZ B;  4C0K A;  1ALV A;  4DCK A;  1WLM A;  4M2Q A;  4N1F A;  3QRX A;  4N1G A;  2MHH A;  1NCZ A;  2LP3 A;  1CDL A;  2O5G A;  3PLF B;  4HSZ A;  1DJZ A;  4XYN A;  2L4H A;  2SAS A;  1CFD A;  5ER5 A;  1BU3 A;  1XA5 A;  1XYD A;  2BCA A;  2ISD A;  4PE0 A;  1IKU A;  1A4P A;  2ZRT A;  3EVU A;  1C7V A;  1JWD A;  1CLL A;  3PN7 C;  3WNX B;  1PAL A;  2BL0 B;  2RGI A;  4OV2 A;  5G08 A;  3TDU A;  1N65 A;  1SPY A;  1F4O A;  3FWC A;  2E30 A;  1S6J A;  3SG6 A;  2KBM A;  2L98 A;  2I2R E;  3JTD C;  2LLT A;  1B7T Z;  1PSR A;  1ZFS A;  3BYA A;  2WOS A;  1TTX A;  1QIW A;  2JT0 A;  3DVM A;  1SMG A;  4PHK A;  3GK4 X;  2AAO A;  3CR4 X;  2IS9 A;  1UHN A;  2EGD A;  1JUO A;  1WRZ A;  2LE9 B;  1D1O A;  2K7O A;  3OHM B;  2E6W A;  1NX2 A;  1M39 A;  3LLE A;  1JSA A;  1BMO A;  2ZKM X;  3EK8 A;  2LV7 A;  2Y1N A;  2JOJ A;  1FI5 A;  3IQO A;  2JTZ A;  4PE1 A;  2K61 A;  1CFC A;  2AMI A;  1C07 A;  1QVI Y;  1SL8 A;  1OMV A;  2ZN8 A;  1R6P A;  2PMY A;  1EH2 A;  3VRR A;  1CLB A;  2JZI A;  1NX0 A;  3CR2 A;  3I5I C;  2PAL A;  1N0Y A;  5CSI A;  2PVB A;  3EK7 A;  1TOP A;  1JBA A;  3NSI A;  1G4Y R;  1CM4 A;  1EL4 A;  2BL0 C;  1IWQ A;  3AAJ A;  1KCY A;  1PK0 D;  1NP8 A;  1SCM B;  2FCD A;  2LCP A;  3CGA A;  2F2O A;  5HLV A;  1V1G A;  2Y4Q A;  3AKA A;  4GGF A;  1YX7 A;  5AAN A;  5DKQ A;  1J1E A;  1XK4 C;  4MSP A;  4YGD B;  3TDZ A;  1BR1 B;  1PUL A;  4HRE E;  4ORB B;  1A03 A;  3RLZ A;  2OS8 B;  4NQG A;  2ZN9 A;  1IGV A;  2WCE A;  1LKJ A;  3I5F C;  3PAL A;  4OR9 B;  5ER4 X;  1XFV O;  2MJW B;  2JTT A;  1L2O B;  1XVJ A;  2ZNE A;  4WQ3 A;  3I5H B;  1GGW A;  2LVJ A;  2OPO A;  1F8H A;  4C0L A;  2FOT A;  1GJY A;  1A75 B;  1S36 A;  4M2P A;  2L5X B;  2BKH B;  3BUO B;  1DGV A;  2R2I A;  4ORA B;  2M1K B;  1F70 A;  3VRO A;  3FS7 A;  2HQ8 A;  2AUC A;  1G8I A;  1A2X A;  1EXR A;  2DOQ A;  2L2E A;  4AQJ A;  1Y0V H;  1CTR A;  4PHJ A;  5CSF A;  2EC6 C;  2GGM A;  4BY5 A;  4QJ5 B;  1QX5 B;  4PE7 A;  2LHI A;  1YX8 A;  1J1D A;  2ZFD A;  1MF8 B;  4OVN F;  1K9U A;  4CLN A;  4ETO A;  3CTN A;  1UP5 A;  1DTL A;  4PHN A;  2MRD A;  3I5G C;  1DGU A;  2F2P A;  4XJK B;  1EG4 A;  1KK7 Z;  3CWG A;  1IH0 A;  3O78 A;  2LLS A;  2JUL A;  1CNP A;  1KWO C;  2BKI B;  2KHN A;  1CDM A;  1GQM A;  1TNX A;  3E3R A;  1K9K A;  2G9B A;  4MN0 A;  3SIB A;  3PN7 B;  3OB1 B;  3BUW B;  3D0Y A;  5I2Q A;  3SG5 A;  1VRK A;  2V53 A;  3GK1 A;  1XO5 A;  3JTD B;  1CB1 A;  2QPT A;  2L51 A;  3SG3 A;  3VRP A;  2JC2 A;  1UUR A;  1RWY A;  2JXL A;  1UUS A;  2BEC A;  2LVI A;  1BOD A;  1WDC C;  2B1U A;  2OTG C;  5DKR A;  4BY4 A;  4MRY A;  4D1E A;  4I5K A;  1PVB A;  4C0J A;  1B1G A;  2ZRS A;  1K93 D;  2JNF A;  1OMD A;  1DF0 A;  1FBV A;  2KQ6 A;  1G33 A;  5KSZ A;  1YUT A;  3BOW B;  2L4I A;  1RTP 1;  3DVK A;  1KFU S;  1IQ3 A;  3ZNI A;  1S6I A;  3DVJ A;  1YUR A;  2FJU B;  1ZAC A;  2NXQ A;  5HLO A;  1WY9 A;  5F6T A;  1S1E A;  1QX2 A;  4P2Y B;  1V1F A;  1DT7 B;  1QLS A;  1TN4 A;  2SCP A;  3I5I B;  1XFU O;  1K94 A;  1X02 A;  2M3W A;  3KPX A;  4GNK B;  5I2L A;  2M9G A;  1IJ6 A;  2MLE C;  1QVI Z;  1UWO A;  2M97 A;  2WCB A;  4N5X A;  1FW4 A;  2LHL A;  2LVK A;  3VRQ A;  1QX7 A;  1BT6 A;  5KU1 A;  1OZO A;  3FWB A;  4MZK A;  1C7W A;  1BF5 A;  2KQY A;  2TN4 A;  1U5I A;  1F55 A;  2MBX A;  1AHR A;  1NUB A;  1RRO A;  1FPW A;  1DJY A;  2H61 A;  4MLW A;  1MXE A;  3ICB A;  3PM8 A;  1WRK A;  2CBL A;  2I94 A;  4L9M A;  2K7D A;  3TDI A;  2H61 C;  2KNE A;  3I5F B;  4PE4 A;  4DIR A;  2JT3 A;  4MVF A;  4YGC B;  2KFH A;  2LUX A;  2FCE A;  1DJH A;  1FI6 A;  1DJI A;  2WCF A;  3DF0 B;  1AVS A;  1JF2 A;  1GGZ A;  1TCF A;  1WRL A;  4JQ0 D;  2MAZ A;  4I5L B;  3CR5 X;  5IBW A;  1JC2 A;  2KI6 C;  4OCI A;  2K8M B;  1SRA A;  4GBA A;  3TUY C;  1OOJ A;  1LA3 A;  1M46 A;  3F45 A;  4IL1 A;  1J7O A;  2COL B;  4AQI A;  1CKK A;  1OE9 B;  2BCB A;  3GK2 A;  2NLN A;  2M1U A;  2P6B B;  4PDZ A;  1B4C A;  2K0J A;  3NSL A;  5HYD A;  4NDC A;  1SR6 C;  1YR5 A;  2EC6 B;  1TIZ A;  3BQ3 A;  4U8D A;  4YGE B;  1QV0 A;  2M8U A;  3A4U B;  4GGF C;  4MRX A;  1RJV A;  2LMT A;  1AK8 A;  5K89 A;  1BG1 A;  3CZT X;  1YUS A;  2K2F A;  4QJ4 B;  2O60 A;  2LAP A;  3I5G B;  3O4Y A;  3RM1 A;  1HT9 A;  3KF9 A;  5TNC A;  5B8I B;  1J7P A;  1Y6W A;  4PAL A;  1KWO B;  1SL9 A;  3DD4 A;  1MWN A;  2BBM A;  2F8P A;  4GPL B;  1N2D A;  3A8R A;  4MEW A;  2I18 A;  2WC8 A;  3EKJ A;  1OZS A;  4I5J A;  1DJW A;  3C1V A;  4UPG A;  1R2U A;  1W7I B;  1WDC B;  2OTG B;  1SL7 A;  4ZCV A;  3VRN A;  2PSR A;  1CFP A;  1LVC D;  1B47 A;  1B8R A;  1NX3 A;  1KFX S;  2QAC A;  4YGB B;  2M49 B;  2L50 A;  3CS1 A;  2JU0 A;  1MXL C;  2CT9 A;  2NCO A;  3JVT C;  1K90 D;  2JQ6 A;  5JJG A;  1DF0 B;  3OX6 A;  1IQ5 A;  1QAS A;  1REC A;  1UHK A;  1NCY A;  4NDB A;  1QS7 A;  2LVV A;  1YRT B;  3EKH A;  3OX5 A;  5J3X A;  5BPJ A;  1SCV A;  4PCW A;  2CXJ A;  1H8B A;  1FF1 A;  1W7J B;  2WND A;  1M31 A;  4ORC B;  2KYC A;  1ZOT B;  3FIA A;  4GGN A;  2JT8 A;  4HRG A;  1S5G Y;  2Y1M A;  4CID A;  1QJT A;  1EJ3 A;  3KHE A;  2CCM A;  1M63 B;  2KOT A;  3SIA A;  1SW8 A;  4MZJ A;  2LNK A;  5JOL A;  2LAN A;  2BE6 A;  2KI4 C;  2LLU A;  3IF7 A;  1MHO A;  3LK0 A;  1IRJ A;  3GOF A;  2GGZ A;  3PSR A;  1XFZ O;  1A75 A;  1A29 A;  2F3Z A;  4YGA A;  1CMF A;  1Y1U A;  1QV1 A;  4DS7 A;  1DVI A;  1DJG A;  1YUU A;  2D8N A;  2PRU A;  4GUK A;  1K9P A;  4P5O E;  1KK8 C;  2F3Y A;  3KO0 A;  1CMG A;  1JFK A;  4DUQ A;  1B8C A;  3ZWH A;  2KYF A;  3BXK A;  1ODB A;  3PFV A;  2A4J A;  3AAK A;  4OKH A;  3TUY B;  4Q04 A;  5DKN A;  4TNC A;  1LIN A;  5PAL A;  5AFP A;  1Y1A A;  4GFT A;  2PAS A;  4JWQ A;  2JPT A;  2K2A A;  2M29 A;  5D7F A;  4QJ3 B;  1NYA A;  1KFU L;  3EVV A;  1YVL A;  1KSM A;  1SR6 B;  1B8L A;  3SG2 A;  1AJ4 A;  3OP0 A;  1J7R A;  2HQW A;  2KI6 D;  4WQ2 A;  1SY9 A;  2JNX A;  5GQQ C;  4XJK A;  3PAT A;  4GAO A;  1H4B A;  1YVH A;  4MBE A;  2NZ0 A;  2HET A;  3OB2 B;  4A4C A;  1RFJ A;  1NX1 A;  2M7L A;  1S26 D;  4CFQ A;  1MQ1 A;  1KQV A;  5D69 A;  1K2H A;  1K8U A;  4F0Z B;  3TS5 C;  1SYM A;  1ALW A;  1PRW A;  1JF0 A;  2Q4U A;  2LC5 A;  1F4Q A;  1XFY O;  3BUM B;  2NCP A;  1CM1 A;  1L7Z A;  1OSA A;  2VRG A;  3EK4 A;  1QLK A;  3IQQ A;  3NSK A;  4YI8 A;  1AP4 A;  3M0W A;  4CPV A;  1KQM C;  3BUX B;  2CNP A;  4FQO A;  2KGB C;  5I2O A;  3K21 A;  3BOW A;  1SNL A;  4R1E A;  3KEV A;  2KFF A;  2BBN A;  2MA2 A;  1B9A A;  1CDP A;  2KAV A;  1SKT A;  2ZND A;  3BUN B;  1LXF C;  3SG4 A;  1UHJ A;  3JVT B;  3SJS A;  1NCX A;  1OMR A;  1HQV A;  1KSO A;  1MUX A;  3DVE A;  1IJ5 A;  1YTZ C;  4ZCU A;  3EVR A;  1IG5 A;  5HKW A;  1Y1X A;  2HF5 A;  2MLF C;  3WXA A;  1B7T Y;  1BOC A;  4YI9 A;  2I7A A;  3SG7 A;  2BE4 A;  1K96 A;  1BJF A;  3LL8 B;  1BLQ A;  2LMU A;  4FTG A;  1K95 A;  1XK4 A;  1TCO B;  3TZ1 A;  2LUC A;  3VGO A;  3D0Y B;  5AEQ A;  1NIW A;  2KI4 B;  1CLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...