1JF2A

Crystal structure of w92f obelin mutant from obelia longissima at 1.72 angstrom resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
190
structure length
190
Chain Sequence
AVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGFKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords obelin
publication title Violet bioluminescence and fast kinetics from W92F obelin: structure-based proposals for the bioluminescence triggering and the identification of the emitting species.
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 73
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2001-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jf2A00
1M45A 1B4CA 4YGDB 4HREE 2BCXA 5HKWA 1G4YR 1YVHA 2WC8A 1Y1UA 2CBLA 3FS7A 1SL7A 2K7CA 1K9PA 2ZN8A 4CLNA 1IGVA 1L2OB 1K9UA 1K95A 1XFXO 1UHNA 1QV0A 4PE1A 1HQVA 1ODBA 2MLFC 4ORBB 1NCYA 2F2PA 4MRXA 1YURA 2Y1MA 1W7JB 1GQMA 2M7LA 5I2LA 2MLEC 4USLA 1S6JA 3I5IB 2G2BA 3EKHA 2K7DA 1V1GA 1K90D 1C7VA 3BUWB 5I2OA 1BLQA 3EKJA 1OE9B 3CR2A 3OB1B 3WHUB 1E8AA 3JVTC 1FW4A 3HX4A 3NSOA 3SG6A 2SCPA 3I5FB 1UURA 4OKHA 4CIDA 2O5GA 2BCBA 2CNPA 5KTYA 3KF9A 4M2PA 1DTLA 2JTTA 1IJ5A 3EVUA 1QJTA 2SASA 4PE7A 4Q04A 1UP5A 1QIWA 1PSRA 2JPTA 3WXAA 1WRZA 1CKKA 1CFDA 1CDPA 3BUNB 4FQOA 4WQ3A 5CPVA 1BR4B 2PRUA 1CLLA 1F70A 1IJ6A 2QACA 2Q4UA 3MSEB 2OTGC 2OPOA 2K8MB 1UHKA 1AP4A 2E30A 3DVKA 2M1KB 2EHBA 1BU3A 1NIWA 1QASA 3KHEA 2LMTA 1QLKA 3BQ3A 1U5IA 1SBJA 4CPVA 3DVEA 1NCZA 1NX0A 3LK1A 2K2FA 1DF0B 2BKIB 5K89A 1J7OA 4CFRA 2WCEA 4PE0A 1IQ5A 3D0YB 1FI5A 2OS8C 2NXQA 1JFJA 2PALA 2I7AA 4P2YB 1U5IB 4PDZA 4DRWA 4I5NB 1Y0VH 3SG5A 4AQIA 3TDUA 1F4OA 2WOSA 4UPGA 4OR9B 3CR5X 2LMUA 5JJGA 3AAJA 3EK4A 2M0RA 2H61C 1LXFC 2ISDA 1IQ3A 5HKYA 1IKUA 4QJ3B 4PHKA 3VGOA 1QLSA 2K7OA 3LCPC 1MR8A 1TOPA 1XO5A 2NLNA 1DJGA 2V53A 1TN4A 2KGBC 1FPWA 1KQVA 1B47A 4NDDA 1VRKA 2L50A 2LLUA 2LMVA 2LV7A 4JWQA 1YUSA 3GK4X 3PLFB 4JQ0D 3VRQA 4F0ZB 4MLWA 3BUOB 1BT6A 2KBMA 1NSHA 4DCKA 4YGCB 1YX8A 1AVSA 3IF7A 4M2QA 1OMDA 5F6TA 4AQJA 1JUOA 3CZTX 3TDZA 1XFVO 3JVTB 3KO0A 2D8NA 4MBEA 1IG5A 1AK8A 1XFZO 2KAXA 4MZJA 1BOCA 3OP0A 3DVJA 2WCBA 2LAPA 1BMOA 2F3ZA 3A8RA 1OSAA 4M2OA 1ALVA 3H4SE 2KBIA 5IBWA 1F71A 2M29A 4OCIA 1WRLA 1CMFA 1J55A 4YBHB 1BG1A 2LC5A 2KYCA 1MWNA 3DD4A 3PFVA 1CFPA 1LINA 3PALA 3SIBA 1YX7A 1EXRA 2BBNA 2G9BA 2R2IA 2ZRTA 4U8DA 2OTGB 2KI4C 1K96A 3SG7A 1SYMA 2I18A 3BXKA 1QS7A 1CTRA 4GUKA 3PSRA 4C0JA 3SG3A 3AKBA 4TNCA 2NCOA 4C0KA 1G33A 2L98A 1GGZA 1QV1A 3OB2B 3NSLA 1DJYA 1R2UA 3F45A 4OV2A 4GPLB 1KFXL 1XYDA 1KK7Y 3BOWA 4MVFA 1CLBA 2H61A 1A4PA 1M46A 1PVAA 1UHIA 1MUXA 3PM8A 1B8LA 1KFUL 1NX3A 2OS8B 3LL8B 2LM5A 1YTZC 1OZSA 1YVLA 5HKZA 2LHIA 2FCDA 2Y5IA 2P6BB 1IWQA 1X02A 1DJHA 3NSKA 5D7FA 2NZ0A 3RLZA 1PRWA 3KPXA 1QIVA 2AAOA 1RFJA 1CDLA 2PMYA 1G8IA 2FOTA 3BOWB 2FJUB 2KAVA 4I5JA 3WHTB 1AUIB 4GAOA 1CMGA 1B7TZ 1QATA 2KHNA 2M1UA 1A29A 2LVIA 1BODA 1GJYA 1WY9A 1J1EA 1N0YA 4I5KA 4HSZA 1F55A 3EK8A 1ALWA 3JTDC 2LCPA 2B1UA 2Y4QA 2PASA 2MRDA 3OHMB 2CTNA 2COLB 2LLTA 2CT9A 4PHJA 2I94A 1PVBA 2Y1NA 1JSAA 1QX2A 4QJ5B 1YUTA 1XK4C 1KSOA 2JC2A 1TNQA 1B7TY 1K94A 5FYXA 1C07A 2WNDA 5KSZA 3WNXB 2L0PA 5PALA 1F4QA 2JT3A 2K0JA 2L5XB 1SL8A 4ORCB 1KFXS 1RK9A 1DJWA 4DS7A 1PULA 5I8NA 2L4HA 2LANA 1KFUS 1B1GA 5CSIA 2GV5A 2H2KA 5AANA 1SR6C 1QX7A 3QRXA 4GGNA 5GQQC 3IQQA 2M49B 2KI4B 1DJZA 1ZMZA 2EGDA 4N5XA 1Y1XA 3CR4X 5I2QA 3AAKA 1LKJA 1TCFA 3DF0A 1LA0A 1NCXA 2L4IA 2JT8A 2GGMA 1S26D 3DVMA 1FF1A 2CCMA 2HF5A 2E6WA 4I5LB 2JT0A 3OX6A 5TNCA 1OOJA 4YGEB 1B9AA 1B8CA 1A03A 3EK7A 3FIAA 2M97A 3NXAA 5DKNA 4GNKB 3EVVA 3TS5C 2ZKMX 2MJWB 3DF0B 3E3RA 5DKRA 5J3XA 4NQGA 4C0LA 4A4CA 2KYFA 1EH2A 1CFCA 1CM4A 3CLNA 2JXCA 1AHRA 3M0WA 4YGBB 2FCEA 3SJSA 2KSPA 2LVKA 1TNPA 4ORAB 3I5GC 4PHMA 1UUSA 1S5GZ 2JTZA 4MEWA 1SL9A 4D1EA 4A4BA 2LUCA 4GBAA 1XK4A 2K2AA 2LVJA 3HCMA 1DVIA 3ZNIA 2HPSA 1F54A 1YR5A 2K61A 1QVIZ 3JTDB 1Y1AA 1RTP1 3RM1A 1KK8C 1A75A 1YRTB 5G08A 1OZOA 2KNEA 5AFPA 2KFFA 1LVCD 2MA2A 3SG4A 1YUUA 5JOLA 2O60A 2K7BA 2KFGA 5AEQA 1SW8A 3C1VA 1SPYA 2HQ8A 2M7NA 1DJXA 1WDCC 1Y6WA 1KCYA 4P5OE 2JNFA 1QVIY 2EC6C 2WCFA 3O4YA 4NDBA 2F8PA 2LNKA 3CTNA 1XVJA 1PALA 1J1DA 4MZLA 1QXPA 2QPTA 1SKTA 2KFHA 3TUYC 1K9KA 2JULA 4XJKA 1ZFSA 2HQWA 5D69A 3VRNA 1JWDA 2MAZA 4AOMA 2KAYA 2BE4A 1DGUA 2JWWA 1OMRA 4R1EA 2JZIA 3PN7C 2BL0C 1TTXA 2LP3A 2PSRA 2BBMA 3D10A 1XFYO 4XJKB 1WRKA 3BUMB 1S36A 2M8UA 2AMIA 4ZCVA 3SIAA 3FWBA 3BYAA 4GFTA 4DIRA 1M39A 2KI6C 1ZUZA 2ZN9A 3O2PA 3PATA 3TS5B 3TZ1A 4DUQA 4PHNA 2RGIA 1CDMA 1HT9A 1KWOC 2WORA 1SNLA 2KDHA 1N2DA 4YGAA 4ZCUA 1MHOA 1PSBA 1CFFA 3O6BA 1CM1A 1S3PA 3I5HC 2AUCA 1DMOA 2KGRA 1UHHA 2JQ6A 1EG3A 2A4JA 3VROA 4JPZB 1S1EA 5CSFA 4MSPA 3CGAA 1F8HA 1MXEA 3I5GB 5B8IB 1JFKA 4OVNF 1XFWO 1LA3A 2LUXA 2I2RE 2DOQA 2PVBA 3LK0A 1N65A 3VRRA 1ZOTB 1SMGA 1WLMA 4YI9A 1TNXA 1MXLC 5ER5A 1M31A 3CWGA 1KK8B 4MN0A 1SRAA 1BR1B 1TRFA 5BPJA 4L9MA 1M63B 1S6IA 1PK0D 1SCMC 3A4UB 1KQMC 4BY5A 2ZRSA 3O78A 1WDCB 2M3WA 4XYNA 1DT7B 1AJ4A 2KQ6A 4ICBA 1NX1A 2F2OA 2ZNEA 1XFUO 4YRUA 1DF0A 2TN4A 2EC6B 1CDNA 2CXJA 3D0YA 1S6CA 2JU0A 3CS1A 3EVRA 4GGFC 2BECA 1K8UA 1K93D 3OX5A 1B8RA 1EJ3A 2KI6D 3TUYB 4QJ4B 1RJVA 4MRYA 1W7IB 2IS9A 1NUBA 1TNWA 3GOFA 1K2HA 4N1FA 1H4BA 1L2OC 3PN7B 2BL0B 3FWCA 3VRPA 5HLOA 3IQOA 2JRFA 1JBAA 1R6PA 4ETOA 2Q91A 1J7PA 1J7QA 4N1GA 2BE6A 5DKQA 1JF0A 1FBVA 1XA5A 1KSMA 2BCAA 1IH0A 4WRIA 1H8BA 3I5IC 5AXIA 1AJ5A 1FI6A 2M9GA 1C7WA 1KWOB 1V1FA 4WQ2A 1NPQA 4MZKA 3AKAA 4YI8A 2MBXA 4NDCA 1YRUB 1ZACA 1TIZA 2GGZA 1RWYA 3SG2A 2L51A 5CSNA 3I5HB 1DJIA 2LLSA 4CFQA 3I5FC 4HRHA 3ZWHA 2HETA 1NP8A 3TDIA 4E68A 2VRGA 1EL4A 5HLVA 3GK2A 1SK6D 1CNPA 2F3YA 5CSJA 3ICBA 1J7RA 1IRJA 2MHHA 2KOTA 4HRGA 1MQ1A 1S5GY 1CB1A 1JF2A 4PE4A 2NCPA 1A2XA 1DGVA 1NWDA 1A75B 4PCWA 1CLMA 1BJFA 1BF5A 1L7ZA 1OQPA 3LLEA 1MF8B 1Q80A 3BUXB 5HYDA 2LVVA 1NX2A 2ZFDA 1QTXA 1SR6B 1UHJA 2KQYA 4GGFA 1OMVA 2JOJA 4PALA 2L2EA 1WLZA 1KK7Z 2ZNDA 1EG4A 1SCMB 4FTGA 1GGWA 1SY9A 1KQMB 1UWOA 2BKHB 2LP2A 2JXLA 4IL1A 4BY4A 2F33A 1RECA 2LE9B 5AERA 2JNXA 3NSIA 1JC2A 1TCOB 3KEVA 5ER4X 1QX5B 5KU1A 1SCVA 3GK1A 1NYAA 3K21A 1D1OA 1RROA 2LHLA
chains in the Genus database with same CATH superfamily
1M45A 1B4CA 4YGDB 2PQLA 4HREE 2BCXA 5HKWA 1G4YR 1YVHA 3NHIA 2WC8A 1Y1UA 2CBLA 3FS7A 1SL7A 2K7CA 1K9PA 2ZN8A 4CLNA 3B87A 1IGVA 1L2OB 1K9UA 1K95A 1XFXO 1UHNA 1QV0A 3BJHA 4PE1A 3S0DA 1HQVA 1ODBA 2MLFC 4ORBB 1NCYA 2F2PA 4MRXA 1YURA 5FI7A 4FQTA 2Y1MA 1W7JB 1GQMA 2M7LA 5I2LA 2MLEC 4USLA 3S0GA 2WC6A 1S6JA 3I5IB 2G2BA 3EKHA 2K7DA 1V1GA 1K90D 1C7VA 3BUWB 5I2OA 3IVTA 3EKJA 1BLQA 1OE9B 3CR2A 3OB1B 3WHUB 2WCLA 1E8AA 3JVTC 1FW4A 1OOHA 3HX4A 3NSOA 3SG6A 2SCPA 3I5FB 1UURA 2H8VA 4OKHA 4CIDA 2O5GA 2BCBA 2CNPA 3OGNA 5KTYA 1Z4HA 3R1VA 3KF9A 3NGVA 4M2PA 1DTLA 2JTTA 1IJ5A 3BFHA 3EVUA 1QJTA 2SASA 2WC5A 4KYNA 4PE7A 4Q04A 1UP5A 1QIWA 1PSRA 2JPTA 3WXAA 1WRZA 1CKKA 1CFDA 1CDPA 3BUNB 4FQOA 4WQ3A 5CPVA 1BR4B 2PRUA 2P71A 3UNWA 1CLLA 1F70A 1IJ6A 2QACA 2Q4UA 3MSEB 2OTGC 2OPOA 2K8MB 1UHKA 1AP4A 3SS4A 2E30A 3DVKA 2M1KB 2EHBA 1BU3A 1NIWA 1QASA 1QWVA 3KHEA 2LMTA 1QLKA 3BQ3A 1U5IA 1SBJA 4CPVA 3DVEA 1NCZA 1NX0A 2BAPA 2K60A 3LK1A 2K2FA 1DF0B 2BKIB 5K89A 1J7OA 4CFRA 2WCEA 4PE0A 1IQ5A 3D0YB 1FI5A 2OS8C 3CZ1A 2NXQA 1JFJA 2PALA 2I7AA 4P2YB 1U5IB 3BFAA 4PDZA 4DRWA 4I5NB 1Y0VH 3SG5A 4AQIA 3TDUA 1F4OA 2WOSA 4UPGA 4OR9B 3CR5X 3S0AA 2LMUA 5JJGA 3AAJA 3CZ0A 3EK4A 3K1EA 2M0RA 2H61C 1LXFC 2ISDA 1IQ3A 5HKYA 1IKUA 4QJ3B 4JD9A 4PHKA 3VGOA 1QLSA 2K7OA 3UO9A 3LCPC 1MR8A 1TOPA 1XO5A 2NLNA 1DJGA 2WCHA 2V53A 5FI2A 1TN4A 2KGBC 1FPWA 1KQVA 3PJIA 1B47A 4NDDA 1VRKA 2L50A 2LLUA 2LMVA 2LV7A 4JWQA 1YUSA 3GK4X 3PLFB 4JQ0D 3VRQA 4F0ZB 5HL1A 4MLWA 3BUOB 1BT6A 2KBMA 1NSHA 4DCKA 4YGCB 1YX8A 1AVSA 3IF7A 3D78A 4M2QA 1OMDA 5F6TA 4AQJA 1JUOA 3CZTX 3TDZA 1XFVO 3JVTB 3KO0A 2D8NA 4MBEA 1IG5A 1AK8A 1XFZO 2KAXA 4MZJA 1BOCA 3OP0A 3DVJA 2WCBA 2LAPA 1BMOA 2F3ZA 3A8RA 1OSAA 3FE8A 1ALVA 4M2OA 3H4SE 2KBIA 5IBWA 1F71A 2M29A 4OCIA 3L4LA 1WRLA 1CMFA 3OBVA 1GM0A 1J55A 4YBHB 1BG1A 2LC5A 3PM2A 2KYCA 1MWNA 3DD4A 3PFVA 1CFPA 1LINA 3PALA 3SIBA 1YX7A 1EXRA 1P28A 2BBNA 2G9BA 2R2IA 2ZRTA 4U8DA 2OTGB 2KI4C 3DXLA 1K96A 3SG7A 1SYMA 2I18A 3BXKA 1QS7A 1CTRA 4GUKA 3PSRA 4C0JA 3SG3A 3AKBA 4TNCA 2NCOA 4C0KA 1G33A 2L98A 1GGZA 1QV1A 3OB2B 3NSLA 1DJYA 1R2UA 3F45A 4OV2A 4GPLB 3NHTA 1KFXL 1XYDA 1KK7Y 3BOWA 4MVFA 1CLBA 2H61A 1A4PA 1M46A 1PVAA 1UHIA 1MUXA 2QEBA 1B8LA 1KFUL 1NX3A 2OS8B 3LL8B 3PM8A 2LM5A 1YTZC 1OZSA 1YVLA 5HKZA 2LHIA 2FCDA 2Y5IA 2P6BB 1DC1A 1IWQA 1X02A 1DJHA 3NSKA 5D7FA 2NZ0A 3RLZA 1PRWA 3KPXA 1QIVA 2AAOA 1RFJA 5EL2A 2P70A 1CDLA 2PMYA 1G8IA 2FOTA 3BOWB 3CZ2A 3DZTA 2FJUB 2KAVA 4I5JA 3WHTB 1AUIB 1W9ZA 4GAOA 3DY9A 1CMGA 1B7TZ 2BNXA 1QATA 2KHNA 4INXA 3B6XA 2M1UA 1A29A 3D76A 1C3ZA 2LVIA 1BODA 3L4AA 1GJYA 1WY9A 1J1EA 1N0YA 4I5KA 2KLEA 4HSZA 1F55A 3EK8A 1ALWA 3JTDC 2LCPA 4PT1A 2B1UA 1LS8A 3S0BA 2Y4QA 2PASA 3B86A 2MRDA 3OHMB 2CTNA 2COLB 2ERBA 2LLTA 2CT9A 4PHJA 2I94A 2PYQA 1PVBA 3L47A 1XFRA 2Y1NA 1JSAA 1QX2A 4QJ5B 1YUTA 1XK4C 1KSOA 2JC2A 1TNQA 1B7TY 1K94A 5FYXA 1C07A 2WNDA 5KSZA 3WNXB 2L0PA 5PALA 1F4QA 2JT3A 2K0JA 2L5XB 1SL8A 4ORCB 1KFXS 1RK9A 1DJWA 4DS7A 1PULA 5I8NA 2L4HA 2LANA 1KFUS 1B1GA 5CSIA 2GV5A 2H2KA 5AANA 1SR6C 5DICA 1QX7A 3QRXA 4GGNA 5GQQC 3IQQA 2M49B 2WCMA 2KI4B 1DJZA 1ZMZA 2EGDA 4N5XA 1Y1XA 3CR4X 5I2QA 3V2LA 3AAKA 1LKJA 1TCFA 1T14A 3DF0A 1LA0A 1NCXA 2L4IA 2JT8A 3R1PA 2GGMA 1S26D 3DVMA 1FF1A 2CCMA 1TUZA 2HF5A 2E6WA 4I5LB 2JT0A 3OX6A 5TNCA 1OOJA 4YGEB 1B9AA 2KPHA 3VB1A 1B8CA 1A03A 3B88A 2WCKA 2M97A 3EK7A 3FIAA 3NXAA 3EVVA 4GNKB 2ZKMX 5DKNA 3TS5C 2MJWB 3DF0B 3E3RA 2QEHA 5DKRA 5J3XA 4NQGA 4C0LA 4A4CA 2KYFA 4INWA 3O4XA 1EH2A 3DYEA 1CFCA 1CM4A 3CLNA 2JXCA 1AHRA 3M0WA 4YGBB 2FCEA 3SJSA 2GTEA 2KSPA 2LVKA 1TNPA 4ORAB 3D74A 3I5GC 4PHMA 3Q8IA 1UUSA 3RZSA 1S5GZ 2JTZA 4MEWA 1DQEA 1SL9A 4D1EA 4A4BA 2LUCA 4GBAA 1XK4A 2K2AA 2LVJA 3HCMA 1DVIA 3ZNIA 2HPSA 1F54A 1YR5A 2K61A 1QVIZ 3B7AA 3JTDB 1Y1AA 1RTP1 3RM1A 1KK8C 4OZDA 1A75A 1YRTB 5G08A 1OZOA 3R72A 3N7HA 2KNEA 5AFPA 2KFFA 1LVCD 2MA2A 1OW4A 1TUJA 3SG4A 1YUUA 5JOLA 2O60A 2K7BA 2KFGA 5AEQA 1SW8A 3C1VA 1SPYA 2FJYA 2HQ8A 2M7NA 1DJXA 1WDCC 1DELA 1Y6WA 1KCYA 4P5OE 2JNFA 1QVIY 2EC6C 2WCFA 3O4YA 4NDBA 2F8PA 2LNKA 3CTNA 1XVJA 1PALA 1J1DA 4MZLA 1QXPA 2QPTA 1SKTA 2KFHA 3TUYC 1K9KA 2JULA 4XJKA 1ZFSA 2HQWA 5D69A 3VRNA 3FE9A 1JWDA 2MAZA 4AOMA 2KAYA 2BE4A 1DGUA 2JWWA 1OMRA 4R1EA 2JZIA 3PN7C 2BL0C 1TTXA 2LP3A 2PSRA 1OOFA 2BBMA 3D10A 1XFYO 4XJKB 1WRKA 3BUMB 1S36A 2M8UA 2AMIA 4ZCVA 3SIAA 3FWBA 3BYAA 4GFTA 4DIRA 1M39A 2KI6C 3EG5B 1ZUZA 1OOIX 2ZN9A 3O2PA 3PATA 3TS5B 3TZ1A 4DUQA 4PHNA 2RGIA 1CDMA 1HT9A 1KWOC 2WORA 1SNLA 2KDHA 1N2DA 4YGAA 4ZCUA 1MHOA 1PSBA 1CFFA 3D73A 3O6BA 1CM1A 1S3PA 3I5HC 2AUCA 1DMOA 2KGRA 1UHHA 2JQ6A 1EG3A 2A4JA 3VROA 4JPZB 1S1EA 5CSFA 4MSPA 3CGAA 1F8HA 1MXEA 3I5GB 1TWOA 5B8IB 1JFKA 4OVNF 5FI6A 1XFWO 2QEOA 1LA3A 2LUXA 3QMEA 2I2RE 2DOQA 2PVBA 1Z2CB 3LK0A 1DEKA 1N65A 1ZOTB 1SMGA 3VRRA 1WLMA 4YI9A 1TNXA 1MXLC 5ER5A 1M31A 3CWGA 1KK8B 4MN0A 1SRAA 1BR1B 1TRFA 1ORGA 5BPJA 4L9MA 2JPOA 4JKTA 1M63B 1S6IA 1PK0D 1SCMC 3A4UB 1KQMC 4BY5A 2ZRSA 3O78A 1WDCB 2M3WA 4XYNA 1DT7B 1AJ4A 2KQ6A 4ICBA 1NX1A 2F2OA 3CABA 2ZNEA 1XFUO 4YRUA 1DF0A 2TN4A 2EC6B 1CDNA 2CXJA 4IJ7A 3D0YA 1S6CA 1OOGA 2JU0A 3CS1A 3EVRA 3D77A 4GGFC 2BECA 1K8UA 1K93D 3OX5A 1B8RA 1EJ3A 2KI6D 3TUYB 4QJ4B 1RJVA 3BFBA 4MRYA 1C3YA 1W7IB 2IS9A 1NUBA 2QDIA 1TNWA 3GOFA 4F7FA 1K2HA 4N1FA 3CDNA 1H4BA 1L2OC 3PN7B 2BL0B 3FWCA 3VRPA 5HLOA 1IIOA 3IQOA 2JRFA 1JBAA 1R6PA 4ETOA 2Q91A 1J7PA 1J7QA 4N1GA 2BE6A 5DKQA 1JF0A 2WCJA 1FBVA 1XA5A 1KSMA 2BCAA 1IH0A 4WRIA 1H8BA 3I5IC 5AXIA 1AJ5A 1FI6A 2L2CA 2M9GA 1C7WA 1KWOB 1V1FA 4WQ2A 1NPQA 3R1OA 3AKAA 4MZKA 4YI8A 4NDCA 2MBXA 1YRUB 1ZACA 1TIZA 2GGZA 1RWYA 3S0EA 3SG2A 2L51A 5CSNA 3I5HB 1DJIA 2LLSA 4CFQA 3SS3A 3I5FC 4HRHA 3ZWHA 2HETA 1NP8A 3TDIA 4E68A 2VRGA 1EL4A 5HLVA 3GK2A 1SK6D 2YGUA 1CNPA 2F3YA 3D75A 5CSJA 3ICBA 1J7RA 1IRJA 2MHHA 2KOTA 4HRGA 1MQ1A 1S5GY 1SSEB 1CB1A 2L5YA 1JF2A 4PE4A 2NCPA 5D3OA 1A2XA 1DGVA 1NWDA 1A75B 4PCWA 1CLMA 1BJFA 1BF5A 1L7ZA 3S0FA 3SS5A 1OQPA 2QEVA 3LLEA 1MF8B 1Q80A 3BUXB 5HYDA 2LVVA 3FE6A 1NX2A 2ZFDA 1QTXA 1SR6B 1UHJA 2KQYA 4GGFA 1OMVA 2JOJA 4PALA 2L2EA 1WLZA 1KK7Z 2ZNDA 1EG4A 1SCMB 4FTGA 1GGWA 1SY9A 1KQMB 1UWOA 2BKHB 2LP2A 2JXLA 4IL1A 4BY4A 2F33A 1RECA 2KLDA 2LE9B 5AERA 2JNXA 3NSIA 1JC2A 1TCOB 3KEVA 3CYZA 1QX5B 5ER4X 5KU1A 1SCVA 5I94A 3GK1A 1NYAA 3K21A 1D1OA 1RROA 2LHLA
chains in the Genus database with same CATH topology
1M45A 1B4CA 4YGDB 4HREE 2BCXA 5HKWA 1G4YR 1YVHA 2WC8A 1Y1UA 2CBLA 3FS7A 1SL7A 2K7CA 1K9PA 2ZN8A 4CLNA 1IGVA 1L2OB 1K9UA 1K95A 1XFXO 1UHNA 1QV0A 4PE1A 1HQVA 1ODBA 2MLFC 4ORBB 1NCYA 2F2PA 4MRXA 1YURA 2Y1MA 1W7JB 1GQMA 2M7LA 5I2LA 2MLEC 4USLA 1S6JA 3I5IB 2G2BA 3EKHA 2K7DA 1V1GA 1K90D 1C7VA 3BUWB 5I2OA 1BLQA 3EKJA 1OE9B 3CR2A 3OB1B 3WHUB 1E8AA 3JVTC 1FW4A 3HX4A 3NSOA 3SG6A 2SCPA 3I5FB 1UURA 4OKHA 4CIDA 2O5GA 2BCBA 2CNPA 5KTYA 3KF9A 4M2PA 1DTLA 2JTTA 1IJ5A 3EVUA 1QJTA 2SASA 4PE7A 4Q04A 1UP5A 1QIWA 1PSRA 2JPTA 3WXAA 1WRZA 1CKKA 1CFDA 1CDPA 3BUNB 4FQOA 4WQ3A 5CPVA 1BR4B 2PRUA 1CLLA 1F70A 1IJ6A 2QACA 2Q4UA 3MSEB 2OTGC 2OPOA 2K8MB 1UHKA 1AP4A 2E30A 3DVKA 2M1KB 2EHBA 1BU3A 1NIWA 1QASA 3KHEA 2LMTA 1QLKA 3BQ3A 1U5IA 1SBJA 4CPVA 3DVEA 1NCZA 1NX0A 3LK1A 2K2FA 1DF0B 2BKIB 5K89A 1J7OA 4CFRA 2WCEA 4PE0A 1IQ5A 3D0YB 1FI5A 2OS8C 2NXQA 1JFJA 2PALA 2I7AA 4P2YB 1U5IB 4PDZA 4DRWA 4I5NB 1Y0VH 3SG5A 4AQIA 3TDUA 1F4OA 2WOSA 4UPGA 4OR9B 3CR5X 2LMUA 5JJGA 3AAJA 3EK4A 2M0RA 2H61C 1LXFC 2ISDA 1IQ3A 5HKYA 1IKUA 4QJ3B 4PHKA 3VGOA 1QLSA 2K7OA 3LCPC 1MR8A 1TOPA 1XO5A 2NLNA 1DJGA 2V53A 1TN4A 2KGBC 1FPWA 1KQVA 1B47A 4NDDA 1VRKA 2L50A 2LLUA 2LMVA 2LV7A 4JWQA 1YUSA 3GK4X 3PLFB 4JQ0D 3VRQA 4F0ZB 4MLWA 3BUOB 1BT6A 2KBMA 1NSHA 4DCKA 4YGCB 1YX8A 1AVSA 3IF7A 4M2QA 1OMDA 5F6TA 4AQJA 1JUOA 3CZTX 3TDZA 1XFVO 3JVTB 3KO0A 2D8NA 4MBEA 1IG5A 1AK8A 1XFZO 2KAXA 4MZJA 1BOCA 3OP0A 3DVJA 2WCBA 2LAPA 1BMOA 2F3ZA 3A8RA 1OSAA 4M2OA 1ALVA 3H4SE 2KBIA 5IBWA 1F71A 2M29A 4OCIA 1WRLA 1CMFA 1J55A 4YBHB 1BG1A 2LC5A 2KYCA 1MWNA 3DD4A 3PFVA 1CFPA 1LINA 3PALA 3SIBA 1YX7A 1EXRA 2BBNA 2G9BA 2R2IA 2ZRTA 4U8DA 2OTGB 2KI4C 1K96A 3SG7A 1SYMA 2I18A 3BXKA 1QS7A 1CTRA 4GUKA 3PSRA 4C0JA 3SG3A 3AKBA 4TNCA 2NCOA 4C0KA 1G33A 2L98A 1GGZA 1QV1A 3OB2B 3NSLA 1DJYA 1R2UA 3F45A 4OV2A 4GPLB 1KFXL 1XYDA 1KK7Y 3BOWA 4MVFA 1CLBA 2H61A 1A4PA 1M46A 1PVAA 1UHIA 1MUXA 3PM8A 1B8LA 1KFUL 1NX3A 2OS8B 3LL8B 2LM5A 1YTZC 1OZSA 1YVLA 5HKZA 2LHIA 2FCDA 2Y5IA 2P6BB 1IWQA 1X02A 1DJHA 3NSKA 5D7FA 2NZ0A 3RLZA 1PRWA 3KPXA 1QIVA 2AAOA 1RFJA 1CDLA 2PMYA 1G8IA 2FOTA 3BOWB 2FJUB 2KAVA 4I5JA 3WHTB 1AUIB 4GAOA 1CMGA 1B7TZ 1QATA 2KHNA 2M1UA 1A29A 2LVIA 1BODA 1GJYA 1WY9A 1J1EA 1N0YA 4I5KA 4HSZA 1F55A 3EK8A 1ALWA 3JTDC 2LCPA 2B1UA 2Y4QA 2PASA 2MRDA 3OHMB 2CTNA 2COLB 2LLTA 2CT9A 4PHJA 2I94A 1PVBA 2Y1NA 1JSAA 1QX2A 4QJ5B 1YUTA 1XK4C 1KSOA 2JC2A 1TNQA 1B7TY 1K94A 5FYXA 1C07A 2WNDA 5KSZA 3WNXB 2L0PA 5PALA 1F4QA 2JT3A 2K0JA 2L5XB 1SL8A 4ORCB 1KFXS 1RK9A 1DJWA 4DS7A 1PULA 5I8NA 2L4HA 2LANA 1KFUS 1B1GA 5CSIA 2GV5A 2H2KA 5AANA 1SR6C 1QX7A 3QRXA 4GGNA 5GQQC 3IQQA 2M49B 2KI4B 1DJZA 1ZMZA 2EGDA 4N5XA 1Y1XA 3CR4X 5I2QA 3AAKA 1LKJA 1TCFA 3DF0A 1LA0A 1NCXA 2L4IA 2JT8A 2GGMA 1S26D 3DVMA 1FF1A 2CCMA 2HF5A 2E6WA 4I5LB 2JT0A 3OX6A 5TNCA 1OOJA 4YGEB 1B9AA 1B8CA 1A03A 3EK7A 3FIAA 2M97A 3NXAA 5DKNA 4GNKB 3EVVA 3TS5C 2ZKMX 2MJWB 3DF0B 3E3RA 5DKRA 5J3XA 4NQGA 4C0LA 4A4CA 2KYFA 1EH2A 1CFCA 1CM4A 3CLNA 2JXCA 1AHRA 3M0WA 4YGBB 2FCEA 3SJSA 2KSPA 2LVKA 1TNPA 4ORAB 3I5GC 4PHMA 1UUSA 1S5GZ 2JTZA 4MEWA 1SL9A 4D1EA 4A4BA 2LUCA 4GBAA 1XK4A 2K2AA 2LVJA 3HCMA 1DVIA 3ZNIA 2HPSA 1F54A 1YR5A 2K61A 1QVIZ 3JTDB 1Y1AA 1RTP1 3RM1A 1KK8C 1A75A 1YRTB 5G08A 1OZOA 2KNEA 5AFPA 2KFFA 1LVCD 2MA2A 3SG4A 1YUUA 5JOLA 2O60A 2K7BA 2KFGA 5AEQA 1SW8A 3C1VA 1SPYA 2HQ8A 2M7NA 1DJXA 1WDCC 1Y6WA 1KCYA 4P5OE 2JNFA 1QVIY 2EC6C 2WCFA 3O4YA 4NDBA 2F8PA 2LNKA 3CTNA 1XVJA 1PALA 1J1DA 4MZLA 1QXPA 2QPTA 1SKTA 2KFHA 3TUYC 1K9KA 2JULA 4XJKA 1ZFSA 2HQWA 5D69A 3VRNA 1JWDA 2MAZA 4AOMA 2KAYA 2BE4A 1DGUA 2JWWA 1OMRA 4R1EA 2JZIA 3PN7C 2BL0C 1TTXA 2LP3A 2PSRA 2BBMA 3D10A 1XFYO 4XJKB 1WRKA 3BUMB 1S36A 2M8UA 2AMIA 4ZCVA 3SIAA 3FWBA 3BYAA 4GFTA 4DIRA 1M39A 2KI6C 1ZUZA 2ZN9A 3O2PA 3PATA 3TS5B 3TZ1A 4DUQA 4PHNA 2RGIA 1CDMA 1HT9A 1KWOC 2WORA 1SNLA 2KDHA 1N2DA 4YGAA 4ZCUA 1MHOA 1PSBA 1CFFA 3O6BA 1CM1A 1S3PA 3I5HC 2AUCA 1DMOA 2KGRA 1UHHA 2JQ6A 1EG3A 2A4JA 3VROA 4JPZB 1S1EA 5CSFA 4MSPA 3CGAA 1F8HA 1MXEA 3I5GB 5B8IB 1JFKA 4OVNF 1XFWO 1LA3A 2LUXA 2I2RE 2DOQA 2PVBA 3LK0A 1N65A 3VRRA 1ZOTB 1SMGA 1WLMA 4YI9A 1TNXA 1MXLC 5ER5A 1M31A 3CWGA 1KK8B 4MN0A 1SRAA 1BR1B 1TRFA 5BPJA 4L9MA 1M63B 1S6IA 1PK0D 1SCMC 3A4UB 1KQMC 4BY5A 2ZRSA 3O78A 1WDCB 2M3WA 4XYNA 1DT7B 1AJ4A 2KQ6A 4ICBA 1NX1A 2F2OA 2ZNEA 1XFUO 4YRUA 1DF0A 2TN4A 2EC6B 1CDNA 2CXJA 3D0YA 1S6CA 2JU0A 3CS1A 3EVRA 4GGFC 2BECA 1K8UA 1K93D 3OX5A 1B8RA 1EJ3A 2KI6D 3TUYB 4QJ4B 1RJVA 4MRYA 1W7IB 2IS9A 1NUBA 1TNWA 3GOFA 1K2HA 4N1FA 1H4BA 1L2OC 3PN7B 2BL0B 3FWCA 3VRPA 5HLOA 3IQOA 2JRFA 1JBAA 1R6PA 4ETOA 2Q91A 1J7PA 1J7QA 4N1GA 2BE6A 5DKQA 1JF0A 1FBVA 1XA5A 1KSMA 2BCAA 1IH0A 4WRIA 1H8BA 3I5IC 5AXIA 1AJ5A 1FI6A 2M9GA 1C7WA 1KWOB 1V1FA 4WQ2A 1NPQA 4MZKA 3AKAA 4YI8A 2MBXA 4NDCA 1YRUB 1ZACA 1TIZA 2GGZA 1RWYA 3SG2A 2L51A 5CSNA 3I5HB 1DJIA 2LLSA 4CFQA 3I5FC 4HRHA 3ZWHA 2HETA 1NP8A 3TDIA 4E68A 2VRGA 1EL4A 5HLVA 3GK2A 1SK6D 1CNPA 2F3YA 5CSJA 3ICBA 1J7RA 1IRJA 2MHHA 2KOTA 4HRGA 1MQ1A 1S5GY 1CB1A 1JF2A 4PE4A 2NCPA 1A2XA 1DGVA 1NWDA 1A75B 4PCWA 1CLMA 1BJFA 1BF5A 1L7ZA 1OQPA 3LLEA 1MF8B 1Q80A 3BUXB 5HYDA 2LVVA 1NX2A 2ZFDA 1QTXA 1SR6B 1UHJA 2KQYA 4GGFA 1OMVA 2JOJA 4PALA 2L2EA 1WLZA 1KK7Z 2ZNDA 1EG4A 1SCMB 4FTGA 1GGWA 1SY9A 1KQMB 1UWOA 2BKHB 2LP2A 2JXLA 4IL1A 4BY4A 2F33A 1RECA 2LE9B 5AERA 2JNXA 3NSIA 1JC2A 1TCOB 3KEVA 5ER4X 1QX5B 5KU1A 1SCVA 3GK1A 1NYAA 3K21A 1D1OA 1RROA 2LHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M45 A;  1B4C A;  4YGD B;  4HRE E;  2BCX A;  5HKW A;  1G4Y R;  1YVH A;  2WC8 A;  1Y1U A;  2CBL A;  3FS7 A;  1SL7 A;  2K7C A;  1K9P A;  2ZN8 A;  4CLN A;  1IGV A;  1L2O B;  1K9U A;  1K95 A;  1XFX O;  1UHN A;  1QV0 A;  4PE1 A;  1HQV A;  1ODB A;  2MLF C;  4ORB B;  1NCY A;  2F2P A;  4MRX A;  1YUR A;  2Y1M A;  1W7J B;  1GQM A;  2M7L A;  5I2L A;  2MLE C;  4USL A;  1S6J A;  3I5I B;  2G2B A;  3EKH A;  2K7D A;  1V1G A;  1K90 D;  1C7V A;  3BUW B;  5I2O A;  1BLQ A;  3EKJ A;  1OE9 B;  3CR2 A;  3OB1 B;  3WHU B;  1E8A A;  3JVT C;  1FW4 A;  3HX4 A;  3NSO A;  3SG6 A;  2SCP A;  3I5F B;  1UUR A;  4OKH A;  4CID A;  2O5G A;  2BCB A;  2CNP A;  5KTY A;  3KF9 A;  4M2P A;  1DTL A;  2JTT A;  1IJ5 A;  3EVU A;  1QJT A;  2SAS A;  4PE7 A;  4Q04 A;  1UP5 A;  1QIW A;  1PSR A;  2JPT A;  3WXA A;  1WRZ A;  1CKK A;  1CFD A;  1CDP A;  3BUN B;  4FQO A;  4WQ3 A;  5CPV A;  1BR4 B;  2PRU A;  1CLL A;  1F70 A;  1IJ6 A;  2QAC A;  2Q4U A;  3MSE B;  2OTG C;  2OPO A;  2K8M B;  1UHK A;  1AP4 A;  2E30 A;  3DVK A;  2M1K B;  2EHB A;  1BU3 A;  1NIW A;  1QAS A;  3KHE A;  2LMT A;  1QLK A;  3BQ3 A;  1U5I A;  1SBJ A;  4CPV A;  3DVE A;  1NCZ A;  1NX0 A;  3LK1 A;  2K2F A;  1DF0 B;  2BKI B;  5K89 A;  1J7O A;  4CFR A;  2WCE A;  4PE0 A;  1IQ5 A;  3D0Y B;  1FI5 A;  2OS8 C;  2NXQ A;  1JFJ A;  2PAL A;  2I7A A;  4P2Y B;  1U5I B;  4PDZ A;  4DRW A;  4I5N B;  1Y0V H;  3SG5 A;  4AQI A;  3TDU A;  1F4O A;  2WOS A;  4UPG A;  4OR9 B;  3CR5 X;  2LMU A;  5JJG A;  3AAJ A;  3EK4 A;  2M0R A;  2H61 C;  1LXF C;  2ISD A;  1IQ3 A;  5HKY A;  1IKU A;  4QJ3 B;  4PHK A;  3VGO A;  1QLS A;  2K7O A;  3LCP C;  1MR8 A;  1TOP A;  1XO5 A;  2NLN A;  1DJG A;  2V53 A;  1TN4 A;  2KGB C;  1FPW A;  1KQV A;  1B47 A;  4NDD A;  1VRK A;  2L50 A;  2LLU A;  2LMV A;  2LV7 A;  4JWQ A;  1YUS A;  3GK4 X;  3PLF B;  4JQ0 D;  3VRQ A;  4F0Z B;  4MLW A;  3BUO B;  1BT6 A;  2KBM A;  1NSH A;  4DCK A;  4YGC B;  1YX8 A;  1AVS A;  3IF7 A;  4M2Q A;  1OMD A;  5F6T A;  4AQJ A;  1JUO A;  3CZT X;  3TDZ A;  1XFV O;  3JVT B;  3KO0 A;  2D8N A;  4MBE A;  1IG5 A;  1AK8 A;  1XFZ O;  2KAX A;  4MZJ A;  1BOC A;  3OP0 A;  3DVJ A;  2WCB A;  2LAP A;  1BMO A;  2F3Z A;  3A8R A;  1OSA A;  4M2O A;  1ALV A;  3H4S E;  2KBI A;  5IBW A;  1F71 A;  2M29 A;  4OCI A;  1WRL A;  1CMF A;  1J55 A;  4YBH B;  1BG1 A;  2LC5 A;  2KYC A;  1MWN A;  3DD4 A;  3PFV A;  1CFP A;  1LIN A;  3PAL A;  3SIB A;  1YX7 A;  1EXR A;  2BBN A;  2G9B A;  2R2I A;  2ZRT A;  4U8D A;  2OTG B;  2KI4 C;  1K96 A;  3SG7 A;  1SYM A;  2I18 A;  3BXK A;  1QS7 A;  1CTR A;  4GUK A;  3PSR A;  4C0J A;  3SG3 A;  3AKB A;  4TNC A;  2NCO A;  4C0K A;  1G33 A;  2L98 A;  1GGZ A;  1QV1 A;  3OB2 B;  3NSL A;  1DJY A;  1R2U A;  3F45 A;  4OV2 A;  4GPL B;  1KFX L;  1XYD A;  1KK7 Y;  3BOW A;  4MVF A;  1CLB A;  2H61 A;  1A4P A;  1M46 A;  1PVA A;  1UHI A;  1MUX A;  3PM8 A;  1B8L A;  1KFU L;  1NX3 A;  2OS8 B;  3LL8 B;  2LM5 A;  1YTZ C;  1OZS A;  1YVL A;  5HKZ A;  2LHI A;  2FCD A;  2Y5I A;  2P6B B;  1IWQ A;  1X02 A;  1DJH A;  3NSK A;  5D7F A;  2NZ0 A;  3RLZ A;  1PRW A;  3KPX A;  1QIV A;  2AAO A;  1RFJ A;  1CDL A;  2PMY A;  1G8I A;  2FOT A;  3BOW B;  2FJU B;  2KAV A;  4I5J A;  3WHT B;  1AUI B;  4GAO A;  1CMG A;  1B7T Z;  1QAT A;  2KHN A;  2M1U A;  1A29 A;  2LVI A;  1BOD A;  1GJY A;  1WY9 A;  1J1E A;  1N0Y A;  4I5K A;  4HSZ A;  1F55 A;  3EK8 A;  1ALW A;  3JTD C;  2LCP A;  2B1U A;  2Y4Q A;  2PAS A;  2MRD A;  3OHM B;  2CTN A;  2COL B;  2LLT A;  2CT9 A;  4PHJ A;  2I94 A;  1PVB A;  2Y1N A;  1JSA A;  1QX2 A;  4QJ5 B;  1YUT A;  1XK4 C;  1KSO A;  2JC2 A;  1TNQ A;  1B7T Y;  1K94 A;  5FYX A;  1C07 A;  2WND A;  5KSZ A;  3WNX B;  2L0P A;  5PAL A;  1F4Q A;  2JT3 A;  2K0J A;  2L5X B;  1SL8 A;  4ORC B;  1KFX S;  1RK9 A;  1DJW A;  4DS7 A;  1PUL A;  5I8N A;  2L4H A;  2LAN A;  1KFU S;  1B1G A;  5CSI A;  2GV5 A;  2H2K A;  5AAN A;  1SR6 C;  1QX7 A;  3QRX A;  4GGN A;  5GQQ C;  3IQQ A;  2M49 B;  2KI4 B;  1DJZ A;  1ZMZ A;  2EGD A;  4N5X A;  1Y1X A;  3CR4 X;  5I2Q A;  3AAK A;  1LKJ A;  1TCF A;  3DF0 A;  1LA0 A;  1NCX A;  2L4I A;  2JT8 A;  2GGM A;  1S26 D;  3DVM A;  1FF1 A;  2CCM A;  2HF5 A;  2E6W A;  4I5L B;  2JT0 A;  3OX6 A;  5TNC A;  1OOJ A;  4YGE B;  1B9A A;  1B8C A;  1A03 A;  3EK7 A;  3FIA A;  2M97 A;  3NXA A;  5DKN A;  4GNK B;  3EVV A;  3TS5 C;  2ZKM X;  2MJW B;  3DF0 B;  3E3R A;  5DKR A;  5J3X A;  4NQG A;  4C0L A;  4A4C A;  2KYF A;  1EH2 A;  1CFC A;  1CM4 A;  3CLN A;  2JXC A;  1AHR A;  3M0W A;  4YGB B;  2FCE A;  3SJS A;  2KSP A;  2LVK A;  1TNP A;  4ORA B;  3I5G C;  4PHM A;  1UUS A;  1S5G Z;  2JTZ A;  4MEW A;  1SL9 A;  4D1E A;  4A4B A;  2LUC A;  4GBA A;  1XK4 A;  2K2A A;  2LVJ A;  3HCM A;  1DVI A;  3ZNI A;  2HPS A;  1F54 A;  1YR5 A;  2K61 A;  1QVI Z;  3JTD B;  1Y1A A;  1RTP 1;  3RM1 A;  1KK8 C;  1A75 A;  1YRT B;  5G08 A;  1OZO A;  2KNE A;  5AFP A;  2KFF A;  1LVC D;  2MA2 A;  3SG4 A;  1YUU A;  5JOL A;  2O60 A;  2K7B A;  2KFG A;  5AEQ A;  1SW8 A;  3C1V A;  1SPY A;  2HQ8 A;  2M7N A;  1DJX A;  1WDC C;  1Y6W A;  1KCY A;  4P5O E;  2JNF A;  1QVI Y;  2EC6 C;  2WCF A;  3O4Y A;  4NDB A;  2F8P A;  2LNK A;  3CTN A;  1XVJ A;  1PAL A;  1J1D A;  4MZL A;  1QXP A;  2QPT A;  1SKT A;  2KFH A;  3TUY C;  1K9K A;  2JUL A;  4XJK A;  1ZFS A;  2HQW A;  5D69 A;  3VRN A;  1JWD A;  2MAZ A;  4AOM A;  2KAY A;  2BE4 A;  1DGU A;  2JWW A;  1OMR A;  4R1E A;  2JZI A;  3PN7 C;  2BL0 C;  1TTX A;  2LP3 A;  2PSR A;  2BBM A;  3D10 A;  1XFY O;  4XJK B;  1WRK A;  3BUM B;  1S36 A;  2M8U A;  2AMI A;  4ZCV A;  3SIA A;  3FWB A;  3BYA A;  4GFT A;  4DIR A;  1M39 A;  2KI6 C;  1ZUZ A;  2ZN9 A;  3O2P A;  3PAT A;  3TS5 B;  3TZ1 A;  4DUQ A;  4PHN A;  2RGI A;  1CDM A;  1HT9 A;  1KWO C;  2WOR A;  1SNL A;  2KDH A;  1N2D A;  4YGA A;  4ZCU A;  1MHO A;  1PSB A;  1CFF A;  3O6B A;  1CM1 A;  1S3P A;  3I5H C;  2AUC A;  1DMO A;  2KGR A;  1UHH A;  2JQ6 A;  1EG3 A;  2A4J A;  3VRO A;  4JPZ B;  1S1E A;  5CSF A;  4MSP A;  3CGA A;  1F8H A;  1MXE A;  3I5G B;  5B8I B;  1JFK A;  4OVN F;  1XFW O;  1LA3 A;  2LUX A;  2I2R E;  2DOQ A;  2PVB A;  3LK0 A;  1N65 A;  3VRR A;  1ZOT B;  1SMG A;  1WLM A;  4YI9 A;  1TNX A;  1MXL C;  5ER5 A;  1M31 A;  3CWG A;  1KK8 B;  4MN0 A;  1SRA A;  1BR1 B;  1TRF A;  5BPJ A;  4L9M A;  1M63 B;  1S6I A;  1PK0 D;  1SCM C;  3A4U B;  1KQM C;  4BY5 A;  2ZRS A;  3O78 A;  1WDC B;  2M3W A;  4XYN A;  1DT7 B;  1AJ4 A;  2KQ6 A;  4ICB A;  1NX1 A;  2F2O A;  2ZNE A;  1XFU O;  4YRU A;  1DF0 A;  2TN4 A;  2EC6 B;  1CDN A;  2CXJ A;  3D0Y A;  1S6C A;  2JU0 A;  3CS1 A;  3EVR A;  4GGF C;  2BEC A;  1K8U A;  1K93 D;  3OX5 A;  1B8R A;  1EJ3 A;  2KI6 D;  3TUY B;  4QJ4 B;  1RJV A;  4MRY A;  1W7I B;  2IS9 A;  1NUB A;  1TNW A;  3GOF A;  1K2H A;  4N1F A;  1H4B A;  1L2O C;  3PN7 B;  2BL0 B;  3FWC A;  3VRP A;  5HLO A;  3IQO A;  2JRF A;  1JBA A;  1R6P A;  4ETO A;  2Q91 A;  1J7P A;  1J7Q A;  4N1G A;  2BE6 A;  5DKQ A;  1JF0 A;  1FBV A;  1XA5 A;  1KSM A;  2BCA A;  1IH0 A;  4WRI A;  1H8B A;  3I5I C;  5AXI A;  1AJ5 A;  1FI6 A;  2M9G A;  1C7W A;  1KWO B;  1V1F A;  4WQ2 A;  1NPQ A;  4MZK A;  3AKA A;  4YI8 A;  2MBX A;  4NDC A;  1YRU B;  1ZAC A;  1TIZ A;  2GGZ A;  1RWY A;  3SG2 A;  2L51 A;  5CSN A;  3I5H B;  1DJI A;  2LLS A;  4CFQ A;  3I5F C;  4HRH A;  3ZWH A;  2HET A;  1NP8 A;  3TDI A;  4E68 A;  2VRG A;  1EL4 A;  5HLV A;  3GK2 A;  1SK6 D;  1CNP A;  2F3Y A;  5CSJ A;  3ICB A;  1J7R A;  1IRJ A;  2MHH A;  2KOT A;  4HRG A;  1MQ1 A;  1S5G Y;  1CB1 A;  1JF2 A;  4PE4 A;  2NCP A;  1A2X A;  1DGV A;  1NWD A;  1A75 B;  4PCW A;  1CLM A;  1BJF A;  1BF5 A;  1L7Z A;  1OQP A;  3LLE A;  1MF8 B;  1Q80 A;  3BUX B;  5HYD A;  2LVV A;  1NX2 A;  2ZFD A;  1QTX A;  1SR6 B;  1UHJ A;  2KQY A;  4GGF A;  1OMV A;  2JOJ A;  4PAL A;  2L2E A;  1WLZ A;  1KK7 Z;  2ZND A;  1EG4 A;  1SCM B;  4FTG A;  1GGW A;  1SY9 A;  1KQM B;  1UWO A;  2BKH B;  2LP2 A;  2JXL A;  4IL1 A;  4BY4 A;  2F33 A;  1REC A;  2LE9 B;  5AER A;  2JNX A;  3NSI A;  1JC2 A;  1TCO B;  3KEV A;  5ER4 X;  1QX5 B;  5KU1 A;  1SCV A;  3GK1 A;  1NYA A;  3K21 A;  1D1O A;  1RRO A;  2LHL A; 
#chains in the Genus database with same CATH topology
 1M45 A;  1B4C A;  4YGD B;  2PQL A;  4HRE E;  2BCX A;  5HKW A;  1G4Y R;  1YVH A;  3NHI A;  2WC8 A;  1Y1U A;  2CBL A;  3FS7 A;  1SL7 A;  2K7C A;  1K9P A;  2ZN8 A;  4CLN A;  3B87 A;  1IGV A;  1L2O B;  1K9U A;  1K95 A;  1XFX O;  1UHN A;  1QV0 A;  3BJH A;  4PE1 A;  3S0D A;  1HQV A;  1ODB A;  2MLF C;  4ORB B;  1NCY A;  2F2P A;  4MRX A;  1YUR A;  5FI7 A;  4FQT A;  2Y1M A;  1W7J B;  1GQM A;  2M7L A;  5I2L A;  2MLE C;  4USL A;  3S0G A;  2WC6 A;  1S6J A;  3I5I B;  2G2B A;  3EKH A;  2K7D A;  1V1G A;  1K90 D;  1C7V A;  3BUW B;  5I2O A;  3IVT A;  3EKJ A;  1BLQ A;  1OE9 B;  3CR2 A;  3OB1 B;  3WHU B;  2WCL A;  1E8A A;  3JVT C;  1FW4 A;  1OOH A;  3HX4 A;  3NSO A;  3SG6 A;  2SCP A;  3I5F B;  1UUR A;  2H8V A;  4OKH A;  4CID A;  2O5G A;  2BCB A;  2CNP A;  3OGN A;  5KTY A;  1Z4H A;  3R1V A;  3KF9 A;  3NGV A;  4M2P A;  1DTL A;  2JTT A;  1IJ5 A;  3BFH A;  3EVU A;  1QJT A;  2SAS A;  2WC5 A;  4KYN A;  4PE7 A;  4Q04 A;  1UP5 A;  1QIW A;  1PSR A;  2JPT A;  3WXA A;  1WRZ A;  1CKK A;  1CFD A;  1CDP A;  3BUN B;  4FQO A;  4WQ3 A;  5CPV A;  1BR4 B;  2PRU A;  2P71 A;  3UNW A;  1CLL A;  1F70 A;  1IJ6 A;  2QAC A;  2Q4U A;  3MSE B;  2OTG C;  2OPO A;  2K8M B;  1UHK A;  1AP4 A;  3SS4 A;  2E30 A;  3DVK A;  2M1K B;  2EHB A;  1BU3 A;  1NIW A;  1QAS A;  1QWV A;  3KHE A;  2LMT A;  1QLK A;  3BQ3 A;  1U5I A;  1SBJ A;  4CPV A;  3DVE A;  1NCZ A;  1NX0 A;  2BAP A;  2K60 A;  3LK1 A;  2K2F A;  1DF0 B;  2BKI B;  5K89 A;  1J7O A;  4CFR A;  2WCE A;  4PE0 A;  1IQ5 A;  3D0Y B;  1FI5 A;  2OS8 C;  3CZ1 A;  2NXQ A;  1JFJ A;  2PAL A;  2I7A A;  4P2Y B;  1U5I B;  3BFA A;  4PDZ A;  4DRW A;  4I5N B;  1Y0V H;  3SG5 A;  4AQI A;  3TDU A;  1F4O A;  2WOS A;  4UPG A;  4OR9 B;  3CR5 X;  3S0A A;  2LMU A;  5JJG A;  3AAJ A;  3CZ0 A;  3EK4 A;  3K1E A;  2M0R A;  2H61 C;  1LXF C;  2ISD A;  1IQ3 A;  5HKY A;  1IKU A;  4QJ3 B;  4JD9 A;  4PHK A;  3VGO A;  1QLS A;  2K7O A;  3UO9 A;  3LCP C;  1MR8 A;  1TOP A;  1XO5 A;  2NLN A;  1DJG A;  2WCH A;  2V53 A;  5FI2 A;  1TN4 A;  2KGB C;  1FPW A;  1KQV A;  3PJI A;  1B47 A;  4NDD A;  1VRK A;  2L50 A;  2LLU A;  2LMV A;  2LV7 A;  4JWQ A;  1YUS A;  3GK4 X;  3PLF B;  4JQ0 D;  3VRQ A;  4F0Z B;  5HL1 A;  4MLW A;  3BUO B;  1BT6 A;  2KBM A;  1NSH A;  4DCK A;  4YGC B;  1YX8 A;  1AVS A;  3IF7 A;  3D78 A;  4M2Q A;  1OMD A;  5F6T A;  4AQJ A;  1JUO A;  3CZT X;  3TDZ A;  1XFV O;  3JVT B;  3KO0 A;  2D8N A;  4MBE A;  1IG5 A;  1AK8 A;  1XFZ O;  2KAX A;  4MZJ A;  1BOC A;  3OP0 A;  3DVJ A;  2WCB A;  2LAP A;  1BMO A;  2F3Z A;  3A8R A;  1OSA A;  3FE8 A;  1ALV A;  4M2O A;  3H4S E;  2KBI A;  5IBW A;  1F71 A;  2M29 A;  4OCI A;  3L4L A;  1WRL A;  1CMF A;  3OBV A;  1GM0 A;  1J55 A;  4YBH B;  1BG1 A;  2LC5 A;  3PM2 A;  2KYC A;  1MWN A;  3DD4 A;  3PFV A;  1CFP A;  1LIN A;  3PAL A;  3SIB A;  1YX7 A;  1EXR A;  1P28 A;  2BBN A;  2G9B A;  2R2I A;  2ZRT A;  4U8D A;  2OTG B;  2KI4 C;  3DXL A;  1K96 A;  3SG7 A;  1SYM A;  2I18 A;  3BXK A;  1QS7 A;  1CTR A;  4GUK A;  3PSR A;  4C0J A;  3SG3 A;  3AKB A;  4TNC A;  2NCO A;  4C0K A;  1G33 A;  2L98 A;  1GGZ A;  1QV1 A;  3OB2 B;  3NSL A;  1DJY A;  1R2U A;  3F45 A;  4OV2 A;  4GPL B;  3NHT A;  1KFX L;  1XYD A;  1KK7 Y;  3BOW A;  4MVF A;  1CLB A;  2H61 A;  1A4P A;  1M46 A;  1PVA A;  1UHI A;  1MUX A;  2QEB A;  1B8L A;  1KFU L;  1NX3 A;  2OS8 B;  3LL8 B;  3PM8 A;  2LM5 A;  1YTZ C;  1OZS A;  1YVL A;  5HKZ A;  2LHI A;  2FCD A;  2Y5I A;  2P6B B;  1DC1 A;  1IWQ A;  1X02 A;  1DJH A;  3NSK A;  5D7F A;  2NZ0 A;  3RLZ A;  1PRW A;  3KPX A;  1QIV A;  2AAO A;  1RFJ A;  5EL2 A;  2P70 A;  1CDL A;  2PMY A;  1G8I A;  2FOT A;  3BOW B;  3CZ2 A;  3DZT A;  2FJU B;  2KAV A;  4I5J A;  3WHT B;  1AUI B;  1W9Z A;  4GAO A;  3DY9 A;  1CMG A;  1B7T Z;  2BNX A;  1QAT A;  2KHN A;  4INX A;  3B6X A;  2M1U A;  1A29 A;  3D76 A;  1C3Z A;  2LVI A;  1BOD A;  3L4A A;  1GJY A;  1WY9 A;  1J1E A;  1N0Y A;  4I5K A;  2KLE A;  4HSZ A;  1F55 A;  3EK8 A;  1ALW A;  3JTD C;  2LCP A;  4PT1 A;  2B1U A;  1LS8 A;  3S0B A;  2Y4Q A;  2PAS A;  3B86 A;  2MRD A;  3OHM B;  2CTN A;  2COL B;  2ERB A;  2LLT A;  2CT9 A;  4PHJ A;  2I94 A;  2PYQ A;  1PVB A;  3L47 A;  1XFR A;  2Y1N A;  1JSA A;  1QX2 A;  4QJ5 B;  1YUT A;  1XK4 C;  1KSO A;  2JC2 A;  1TNQ A;  1B7T Y;  1K94 A;  5FYX A;  1C07 A;  2WND A;  5KSZ A;  3WNX B;  2L0P A;  5PAL A;  1F4Q A;  2JT3 A;  2K0J A;  2L5X B;  1SL8 A;  4ORC B;  1KFX S;  1RK9 A;  1DJW A;  4DS7 A;  1PUL A;  5I8N A;  2L4H A;  2LAN A;  1KFU S;  1B1G A;  5CSI A;  2GV5 A;  2H2K A;  5AAN A;  1SR6 C;  5DIC A;  1QX7 A;  3QRX A;  4GGN A;  5GQQ C;  3IQQ A;  2M49 B;  2WCM A;  2KI4 B;  1DJZ A;  1ZMZ A;  2EGD A;  4N5X A;  1Y1X A;  3CR4 X;  5I2Q A;  3V2L A;  3AAK A;  1LKJ A;  1TCF A;  1T14 A;  3DF0 A;  1LA0 A;  1NCX A;  2L4I A;  2JT8 A;  3R1P A;  2GGM A;  1S26 D;  3DVM A;  1FF1 A;  2CCM A;  1TUZ A;  2HF5 A;  2E6W A;  4I5L B;  2JT0 A;  3OX6 A;  5TNC A;  1OOJ A;  4YGE B;  1B9A A;  2KPH A;  3VB1 A;  1B8C A;  1A03 A;  3B88 A;  2WCK A;  2M97 A;  3EK7 A;  3FIA A;  3NXA A;  3EVV A;  4GNK B;  2ZKM X;  5DKN A;  3TS5 C;  2MJW B;  3DF0 B;  3E3R A;  2QEH A;  5DKR A;  5J3X A;  4NQG A;  4C0L A;  4A4C A;  2KYF A;  4INW A;  3O4X A;  1EH2 A;  3DYE A;  1CFC A;  1CM4 A;  3CLN A;  2JXC A;  1AHR A;  3M0W A;  4YGB B;  2FCE A;  3SJS A;  2GTE A;  2KSP A;  2LVK A;  1TNP A;  4ORA B;  3D74 A;  3I5G C;  4PHM A;  3Q8I A;  1UUS A;  3RZS A;  1S5G Z;  2JTZ A;  4MEW A;  1DQE A;  1SL9 A;  4D1E A;  4A4B A;  2LUC A;  4GBA A;  1XK4 A;  2K2A A;  2LVJ A;  3HCM A;  1DVI A;  3ZNI A;  2HPS A;  1F54 A;  1YR5 A;  2K61 A;  1QVI Z;  3B7A A;  3JTD B;  1Y1A A;  1RTP 1;  3RM1 A;  1KK8 C;  4OZD A;  1A75 A;  1YRT B;  5G08 A;  1OZO A;  3R72 A;  3N7H A;  2KNE A;  5AFP A;  2KFF A;  1LVC D;  2MA2 A;  1OW4 A;  1TUJ A;  3SG4 A;  1YUU A;  5JOL A;  2O60 A;  2K7B A;  2KFG A;  5AEQ A;  1SW8 A;  3C1V A;  1SPY A;  2FJY A;  2HQ8 A;  2M7N A;  1DJX A;  1WDC C;  1DEL A;  1Y6W A;  1KCY A;  4P5O E;  2JNF A;  1QVI Y;  2EC6 C;  2WCF A;  3O4Y A;  4NDB A;  2F8P A;  2LNK A;  3CTN A;  1XVJ A;  1PAL A;  1J1D A;  4MZL A;  1QXP A;  2QPT A;  1SKT A;  2KFH A;  3TUY C;  1K9K A;  2JUL A;  4XJK A;  1ZFS A;  2HQW A;  5D69 A;  3VRN A;  3FE9 A;  1JWD A;  2MAZ A;  4AOM A;  2KAY A;  2BE4 A;  1DGU A;  2JWW A;  1OMR A;  4R1E A;  2JZI A;  3PN7 C;  2BL0 C;  1TTX A;  2LP3 A;  2PSR A;  1OOF A;  2BBM A;  3D10 A;  1XFY O;  4XJK B;  1WRK A;  3BUM B;  1S36 A;  2M8U A;  2AMI A;  4ZCV A;  3SIA A;  3FWB A;  3BYA A;  4GFT A;  4DIR A;  1M39 A;  2KI6 C;  3EG5 B;  1ZUZ A;  1OOI X;  2ZN9 A;  3O2P A;  3PAT A;  3TS5 B;  3TZ1 A;  4DUQ A;  4PHN A;  2RGI A;  1CDM A;  1HT9 A;  1KWO C;  2WOR A;  1SNL A;  2KDH A;  1N2D A;  4YGA A;  4ZCU A;  1MHO A;  1PSB A;  1CFF A;  3D73 A;  3O6B A;  1CM1 A;  1S3P A;  3I5H C;  2AUC A;  1DMO A;  2KGR A;  1UHH A;  2JQ6 A;  1EG3 A;  2A4J A;  3VRO A;  4JPZ B;  1S1E A;  5CSF A;  4MSP A;  3CGA A;  1F8H A;  1MXE A;  3I5G B;  1TWO A;  5B8I B;  1JFK A;  4OVN F;  5FI6 A;  1XFW O;  2QEO A;  1LA3 A;  2LUX A;  3QME A;  2I2R E;  2DOQ A;  2PVB A;  1Z2C B;  3LK0 A;  1DEK A;  1N65 A;  1ZOT B;  1SMG A;  3VRR A;  1WLM A;  4YI9 A;  1TNX A;  1MXL C;  5ER5 A;  1M31 A;  3CWG A;  1KK8 B;  4MN0 A;  1SRA A;  1BR1 B;  1TRF A;  1ORG A;  5BPJ A;  4L9M A;  2JPO A;  4JKT A;  1M63 B;  1S6I A;  1PK0 D;  1SCM C;  3A4U B;  1KQM C;  4BY5 A;  2ZRS A;  3O78 A;  1WDC B;  2M3W A;  4XYN A;  1DT7 B;  1AJ4 A;  2KQ6 A;  4ICB A;  1NX1 A;  2F2O A;  3CAB A;  2ZNE A;  1XFU O;  4YRU A;  1DF0 A;  2TN4 A;  2EC6 B;  1CDN A;  2CXJ A;  4IJ7 A;  3D0Y A;  1S6C A;  1OOG A;  2JU0 A;  3CS1 A;  3EVR A;  3D77 A;  4GGF C;  2BEC A;  1K8U A;  1K93 D;  3OX5 A;  1B8R A;  1EJ3 A;  2KI6 D;  3TUY B;  4QJ4 B;  1RJV A;  3BFB A;  4MRY A;  1C3Y A;  1W7I B;  2IS9 A;  1NUB A;  2QDI A;  1TNW A;  3GOF A;  4F7F A;  1K2H A;  4N1F A;  3CDN A;  1H4B A;  1L2O C;  3PN7 B;  2BL0 B;  3FWC A;  3VRP A;  5HLO A;  1IIO A;  3IQO A;  2JRF A;  1JBA A;  1R6P A;  4ETO A;  2Q91 A;  1J7P A;  1J7Q A;  4N1G A;  2BE6 A;  5DKQ A;  1JF0 A;  2WCJ A;  1FBV A;  1XA5 A;  1KSM A;  2BCA A;  1IH0 A;  4WRI A;  1H8B A;  3I5I C;  5AXI A;  1AJ5 A;  1FI6 A;  2L2C A;  2M9G A;  1C7W A;  1KWO B;  1V1F A;  4WQ2 A;  1NPQ A;  3R1O A;  3AKA A;  4MZK A;  4YI8 A;  4NDC A;  2MBX A;  1YRU B;  1ZAC A;  1TIZ A;  2GGZ A;  1RWY A;  3S0E A;  3SG2 A;  2L51 A;  5CSN A;  3I5H B;  1DJI A;  2LLS A;  4CFQ A;  3SS3 A;  3I5F C;  4HRH A;  3ZWH A;  2HET A;  1NP8 A;  3TDI A;  4E68 A;  2VRG A;  1EL4 A;  5HLV A;  3GK2 A;  1SK6 D;  2YGU A;  1CNP A;  2F3Y A;  3D75 A;  5CSJ A;  3ICB A;  1J7R A;  1IRJ A;  2MHH A;  2KOT A;  4HRG A;  1MQ1 A;  1S5G Y;  1SSE B;  1CB1 A;  2L5Y A;  1JF2 A;  4PE4 A;  2NCP A;  5D3O A;  1A2X A;  1DGV A;  1NWD A;  1A75 B;  4PCW A;  1CLM A;  1BJF A;  1BF5 A;  1L7Z A;  3S0F A;  3SS5 A;  1OQP A;  2QEV A;  3LLE A;  1MF8 B;  1Q80 A;  3BUX B;  5HYD A;  2LVV A;  3FE6 A;  1NX2 A;  2ZFD A;  1QTX A;  1SR6 B;  1UHJ A;  2KQY A;  4GGF A;  1OMV A;  2JOJ A;  4PAL A;  2L2E A;  1WLZ A;  1KK7 Z;  2ZND A;  1EG4 A;  1SCM B;  4FTG A;  1GGW A;  1SY9 A;  1KQM B;  1UWO A;  2BKH B;  2LP2 A;  2JXL A;  4IL1 A;  4BY4 A;  2F33 A;  1REC A;  2KLD A;  2LE9 B;  5AER A;  2JNX A;  3NSI A;  1JC2 A;  1TCO B;  3KEV A;  3CYZ A;  1QX5 B;  5ER4 X;  5KU1 A;  1SCV A;  5I94 A;  3GK1 A;  1NYA A;  3K21 A;  1D1O A;  1RRO A;  2LHL A; 
#chains in the Genus database with same CATH homology
 1M45 A;  1B4C A;  4YGD B;  4HRE E;  2BCX A;  5HKW A;  1G4Y R;  1YVH A;  2WC8 A;  1Y1U A;  2CBL A;  3FS7 A;  1SL7 A;  2K7C A;  1K9P A;  2ZN8 A;  4CLN A;  1IGV A;  1L2O B;  1K9U A;  1K95 A;  1XFX O;  1UHN A;  1QV0 A;  4PE1 A;  1HQV A;  1ODB A;  2MLF C;  4ORB B;  1NCY A;  2F2P A;  4MRX A;  1YUR A;  2Y1M A;  1W7J B;  1GQM A;  2M7L A;  5I2L A;  2MLE C;  4USL A;  1S6J A;  3I5I B;  2G2B A;  3EKH A;  2K7D A;  1V1G A;  1K90 D;  1C7V A;  3BUW B;  5I2O A;  1BLQ A;  3EKJ A;  1OE9 B;  3CR2 A;  3OB1 B;  3WHU B;  1E8A A;  3JVT C;  1FW4 A;  3HX4 A;  3NSO A;  3SG6 A;  2SCP A;  3I5F B;  1UUR A;  4OKH A;  4CID A;  2O5G A;  2BCB A;  2CNP A;  5KTY A;  3KF9 A;  4M2P A;  1DTL A;  2JTT A;  1IJ5 A;  3EVU A;  1QJT A;  2SAS A;  4PE7 A;  4Q04 A;  1UP5 A;  1QIW A;  1PSR A;  2JPT A;  3WXA A;  1WRZ A;  1CKK A;  1CFD A;  1CDP A;  3BUN B;  4FQO A;  4WQ3 A;  5CPV A;  1BR4 B;  2PRU A;  1CLL A;  1F70 A;  1IJ6 A;  2QAC A;  2Q4U A;  3MSE B;  2OTG C;  2OPO A;  2K8M B;  1UHK A;  1AP4 A;  2E30 A;  3DVK A;  2M1K B;  2EHB A;  1BU3 A;  1NIW A;  1QAS A;  3KHE A;  2LMT A;  1QLK A;  3BQ3 A;  1U5I A;  1SBJ A;  4CPV A;  3DVE A;  1NCZ A;  1NX0 A;  3LK1 A;  2K2F A;  1DF0 B;  2BKI B;  5K89 A;  1J7O A;  4CFR A;  2WCE A;  4PE0 A;  1IQ5 A;  3D0Y B;  1FI5 A;  2OS8 C;  2NXQ A;  1JFJ A;  2PAL A;  2I7A A;  4P2Y B;  1U5I B;  4PDZ A;  4DRW A;  4I5N B;  1Y0V H;  3SG5 A;  4AQI A;  3TDU A;  1F4O A;  2WOS A;  4UPG A;  4OR9 B;  3CR5 X;  2LMU A;  5JJG A;  3AAJ A;  3EK4 A;  2M0R A;  2H61 C;  1LXF C;  2ISD A;  1IQ3 A;  5HKY A;  1IKU A;  4QJ3 B;  4PHK A;  3VGO A;  1QLS A;  2K7O A;  3LCP C;  1MR8 A;  1TOP A;  1XO5 A;  2NLN A;  1DJG A;  2V53 A;  1TN4 A;  2KGB C;  1FPW A;  1KQV A;  1B47 A;  4NDD A;  1VRK A;  2L50 A;  2LLU A;  2LMV A;  2LV7 A;  4JWQ A;  1YUS A;  3GK4 X;  3PLF B;  4JQ0 D;  3VRQ A;  4F0Z B;  4MLW A;  3BUO B;  1BT6 A;  2KBM A;  1NSH A;  4DCK A;  4YGC B;  1YX8 A;  1AVS A;  3IF7 A;  4M2Q A;  1OMD A;  5F6T A;  4AQJ A;  1JUO A;  3CZT X;  3TDZ A;  1XFV O;  3JVT B;  3KO0 A;  2D8N A;  4MBE A;  1IG5 A;  1AK8 A;  1XFZ O;  2KAX A;  4MZJ A;  1BOC A;  3OP0 A;  3DVJ A;  2WCB A;  2LAP A;  1BMO A;  2F3Z A;  3A8R A;  1OSA A;  4M2O A;  1ALV A;  3H4S E;  2KBI A;  5IBW A;  1F71 A;  2M29 A;  4OCI A;  1WRL A;  1CMF A;  1J55 A;  4YBH B;  1BG1 A;  2LC5 A;  2KYC A;  1MWN A;  3DD4 A;  3PFV A;  1CFP A;  1LIN A;  3PAL A;  3SIB A;  1YX7 A;  1EXR A;  2BBN A;  2G9B A;  2R2I A;  2ZRT A;  4U8D A;  2OTG B;  2KI4 C;  1K96 A;  3SG7 A;  1SYM A;  2I18 A;  3BXK A;  1QS7 A;  1CTR A;  4GUK A;  3PSR A;  4C0J A;  3SG3 A;  3AKB A;  4TNC A;  2NCO A;  4C0K A;  1G33 A;  2L98 A;  1GGZ A;  1QV1 A;  3OB2 B;  3NSL A;  1DJY A;  1R2U A;  3F45 A;  4OV2 A;  4GPL B;  1KFX L;  1XYD A;  1KK7 Y;  3BOW A;  4MVF A;  1CLB A;  2H61 A;  1A4P A;  1M46 A;  1PVA A;  1UHI A;  1MUX A;  3PM8 A;  1B8L A;  1KFU L;  1NX3 A;  2OS8 B;  3LL8 B;  2LM5 A;  1YTZ C;  1OZS A;  1YVL A;  5HKZ A;  2LHI A;  2FCD A;  2Y5I A;  2P6B B;  1IWQ A;  1X02 A;  1DJH A;  3NSK A;  5D7F A;  2NZ0 A;  3RLZ A;  1PRW A;  3KPX A;  1QIV A;  2AAO A;  1RFJ A;  1CDL A;  2PMY A;  1G8I A;  2FOT A;  3BOW B;  2FJU B;  2KAV A;  4I5J A;  3WHT B;  1AUI B;  4GAO A;  1CMG A;  1B7T Z;  1QAT A;  2KHN A;  2M1U A;  1A29 A;  2LVI A;  1BOD A;  1GJY A;  1WY9 A;  1J1E A;  1N0Y A;  4I5K A;  4HSZ A;  1F55 A;  3EK8 A;  1ALW A;  3JTD C;  2LCP A;  2B1U A;  2Y4Q A;  2PAS A;  2MRD A;  3OHM B;  2CTN A;  2COL B;  2LLT A;  2CT9 A;  4PHJ A;  2I94 A;  1PVB A;  2Y1N A;  1JSA A;  1QX2 A;  4QJ5 B;  1YUT A;  1XK4 C;  1KSO A;  2JC2 A;  1TNQ A;  1B7T Y;  1K94 A;  5FYX A;  1C07 A;  2WND A;  5KSZ A;  3WNX B;  2L0P A;  5PAL A;  1F4Q A;  2JT3 A;  2K0J A;  2L5X B;  1SL8 A;  4ORC B;  1KFX S;  1RK9 A;  1DJW A;  4DS7 A;  1PUL A;  5I8N A;  2L4H A;  2LAN A;  1KFU S;  1B1G A;  5CSI A;  2GV5 A;  2H2K A;  5AAN A;  1SR6 C;  1QX7 A;  3QRX A;  4GGN A;  5GQQ C;  3IQQ A;  2M49 B;  2KI4 B;  1DJZ A;  1ZMZ A;  2EGD A;  4N5X A;  1Y1X A;  3CR4 X;  5I2Q A;  3AAK A;  1LKJ A;  1TCF A;  3DF0 A;  1LA0 A;  1NCX A;  2L4I A;  2JT8 A;  2GGM A;  1S26 D;  3DVM A;  1FF1 A;  2CCM A;  2HF5 A;  2E6W A;  4I5L B;  2JT0 A;  3OX6 A;  5TNC A;  1OOJ A;  4YGE B;  1B9A A;  1B8C A;  1A03 A;  3EK7 A;  3FIA A;  2M97 A;  3NXA A;  5DKN A;  4GNK B;  3EVV A;  3TS5 C;  2ZKM X;  2MJW B;  3DF0 B;  3E3R A;  5DKR A;  5J3X A;  4NQG A;  4C0L A;  4A4C A;  2KYF A;  1EH2 A;  1CFC A;  1CM4 A;  3CLN A;  2JXC A;  1AHR A;  3M0W A;  4YGB B;  2FCE A;  3SJS A;  2KSP A;  2LVK A;  1TNP A;  4ORA B;  3I5G C;  4PHM A;  1UUS A;  1S5G Z;  2JTZ A;  4MEW A;  1SL9 A;  4D1E A;  4A4B A;  2LUC A;  4GBA A;  1XK4 A;  2K2A A;  2LVJ A;  3HCM A;  1DVI A;  3ZNI A;  2HPS A;  1F54 A;  1YR5 A;  2K61 A;  1QVI Z;  3JTD B;  1Y1A A;  1RTP 1;  3RM1 A;  1KK8 C;  1A75 A;  1YRT B;  5G08 A;  1OZO A;  2KNE A;  5AFP A;  2KFF A;  1LVC D;  2MA2 A;  3SG4 A;  1YUU A;  5JOL A;  2O60 A;  2K7B A;  2KFG A;  5AEQ A;  1SW8 A;  3C1V A;  1SPY A;  2HQ8 A;  2M7N A;  1DJX A;  1WDC C;  1Y6W A;  1KCY A;  4P5O E;  2JNF A;  1QVI Y;  2EC6 C;  2WCF A;  3O4Y A;  4NDB A;  2F8P A;  2LNK A;  3CTN A;  1XVJ A;  1PAL A;  1J1D A;  4MZL A;  1QXP A;  2QPT A;  1SKT A;  2KFH A;  3TUY C;  1K9K A;  2JUL A;  4XJK A;  1ZFS A;  2HQW A;  5D69 A;  3VRN A;  1JWD A;  2MAZ A;  4AOM A;  2KAY A;  2BE4 A;  1DGU A;  2JWW A;  1OMR A;  4R1E A;  2JZI A;  3PN7 C;  2BL0 C;  1TTX A;  2LP3 A;  2PSR A;  2BBM A;  3D10 A;  1XFY O;  4XJK B;  1WRK A;  3BUM B;  1S36 A;  2M8U A;  2AMI A;  4ZCV A;  3SIA A;  3FWB A;  3BYA A;  4GFT A;  4DIR A;  1M39 A;  2KI6 C;  1ZUZ A;  2ZN9 A;  3O2P A;  3PAT A;  3TS5 B;  3TZ1 A;  4DUQ A;  4PHN A;  2RGI A;  1CDM A;  1HT9 A;  1KWO C;  2WOR A;  1SNL A;  2KDH A;  1N2D A;  4YGA A;  4ZCU A;  1MHO A;  1PSB A;  1CFF A;  3O6B A;  1CM1 A;  1S3P A;  3I5H C;  2AUC A;  1DMO A;  2KGR A;  1UHH A;  2JQ6 A;  1EG3 A;  2A4J A;  3VRO A;  4JPZ B;  1S1E A;  5CSF A;  4MSP A;  3CGA A;  1F8H A;  1MXE A;  3I5G B;  5B8I B;  1JFK A;  4OVN F;  1XFW O;  1LA3 A;  2LUX A;  2I2R E;  2DOQ A;  2PVB A;  3LK0 A;  1N65 A;  3VRR A;  1ZOT B;  1SMG A;  1WLM A;  4YI9 A;  1TNX A;  1MXL C;  5ER5 A;  1M31 A;  3CWG A;  1KK8 B;  4MN0 A;  1SRA A;  1BR1 B;  1TRF A;  5BPJ A;  4L9M A;  1M63 B;  1S6I A;  1PK0 D;  1SCM C;  3A4U B;  1KQM C;  4BY5 A;  2ZRS A;  3O78 A;  1WDC B;  2M3W A;  4XYN A;  1DT7 B;  1AJ4 A;  2KQ6 A;  4ICB A;  1NX1 A;  2F2O A;  2ZNE A;  1XFU O;  4YRU A;  1DF0 A;  2TN4 A;  2EC6 B;  1CDN A;  2CXJ A;  3D0Y A;  1S6C A;  2JU0 A;  3CS1 A;  3EVR A;  4GGF C;  2BEC A;  1K8U A;  1K93 D;  3OX5 A;  1B8R A;  1EJ3 A;  2KI6 D;  3TUY B;  4QJ4 B;  1RJV A;  4MRY A;  1W7I B;  2IS9 A;  1NUB A;  1TNW A;  3GOF A;  1K2H A;  4N1F A;  1H4B A;  1L2O C;  3PN7 B;  2BL0 B;  3FWC A;  3VRP A;  5HLO A;  3IQO A;  2JRF A;  1JBA A;  1R6P A;  4ETO A;  2Q91 A;  1J7P A;  1J7Q A;  4N1G A;  2BE6 A;  5DKQ A;  1JF0 A;  1FBV A;  1XA5 A;  1KSM A;  2BCA A;  1IH0 A;  4WRI A;  1H8B A;  3I5I C;  5AXI A;  1AJ5 A;  1FI6 A;  2M9G A;  1C7W A;  1KWO B;  1V1F A;  4WQ2 A;  1NPQ A;  4MZK A;  3AKA A;  4YI8 A;  2MBX A;  4NDC A;  1YRU B;  1ZAC A;  1TIZ A;  2GGZ A;  1RWY A;  3SG2 A;  2L51 A;  5CSN A;  3I5H B;  1DJI A;  2LLS A;  4CFQ A;  3I5F C;  4HRH A;  3ZWH A;  2HET A;  1NP8 A;  3TDI A;  4E68 A;  2VRG A;  1EL4 A;  5HLV A;  3GK2 A;  1SK6 D;  1CNP A;  2F3Y A;  5CSJ A;  3ICB A;  1J7R A;  1IRJ A;  2MHH A;  2KOT A;  4HRG A;  1MQ1 A;  1S5G Y;  1CB1 A;  1JF2 A;  4PE4 A;  2NCP A;  1A2X A;  1DGV A;  1NWD A;  1A75 B;  4PCW A;  1CLM A;  1BJF A;  1BF5 A;  1L7Z A;  1OQP A;  3LLE A;  1MF8 B;  1Q80 A;  3BUX B;  5HYD A;  2LVV A;  1NX2 A;  2ZFD A;  1QTX A;  1SR6 B;  1UHJ A;  2KQY A;  4GGF A;  1OMV A;  2JOJ A;  4PAL A;  2L2E A;  1WLZ A;  1KK7 Z;  2ZND A;  1EG4 A;  1SCM B;  4FTG A;  1GGW A;  1SY9 A;  1KQM B;  1UWO A;  2BKH B;  2LP2 A;  2JXL A;  4IL1 A;  4BY4 A;  2F33 A;  1REC A;  2LE9 B;  5AER A;  2JNX A;  3NSI A;  1JC2 A;  1TCO B;  3KEV A;  5ER4 X;  1QX5 B;  5KU1 A;  1SCV A;  3GK1 A;  1NYA A;  3K21 A;  1D1O A;  1RRO A;  2LHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...