1JF2A

Crystal structure of w92f obelin mutant from obelia longissima at 1.72 angstrom resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
190
structure length
190
Chain Sequence
AVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGFKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords obelin
publication title Violet bioluminescence and fast kinetics from W92F obelin: structure-based proposals for the bioluminescence triggering and the identification of the emitting species.
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 73
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2001-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jf2A00
1TNXA 1XA5A 2Q4UA 2LNKA 2FOTA 1IH0A 1XFUO 1Y1UA 1KFXS 2LP3A 2OPOA 1PSBA 3SIAA 1A29A 4JQ0D 1FI6A 3IQQA 1HQVA 1SR6C 3HX4A 3CGAA 1B8LA 1SCVA 4GUKA 1OMDA 4XJKB 2F2OA 1M46A 4QJ5B 1F4QA 3GK1A 2JULA 5I2OA 3TZ1A 2M49B 4N1GA 1ZUZA 2LHIA 1B7TZ 2H61C 3PM8A 4HRGA 2K2AA 1MHOA 1U5IA 1A75A 1BOCA 2M29A 2L2EA 1X02A 1QVIZ 3EK8A 3DVMA 1S1EA 2JXLA 2NCPA 1NCZA 2K7OA 1D1OA 5HYDA 1GJYA 1BG1A 2M97A 3TDIA 1R2UA 1DJWA 3OX5A 1OMVA 1NPQA 2KI4B 4MZJA 3WHUB 2KFGA 1QS7A 1B1GA 5I8NA 1MUXA 1Q80A 1YR5A 2BL0C 2M8UA 3RLZA 5CSJA 1KSMA 2OS8C 1MQ1A 2JC2A 3M0WA 4Q04A 1LINA 1J55A 4C0JA 1G8IA 3OX6A 1BT6A 1SNLA 2BCBA 2ZNDA 1K9UA 2ZRSA 3LL8B 4GGFA 4DRWA 1K94A 2KAVA 1CM4A 2PALA 4ZCVA 3EK4A 1DJZA 4GPLB 1CKKA 2O5GA 1IJ5A 2LVIA 3TUYB 1H8BA 4XYNA 1K2HA 3I5HB 3AAJA 5K89A 2GGZA 2PSRA 2KGBC 1DF0A 1DJGA 1UHKA 1Y1AA 2Y1MA 4DCKA 1EG4A 1SCMC 1V1GA 1L7ZA 1XK4C 4OV2A 1B47A 1H4BA 1YRTB 2FCEA 4YGCB 4MRXA 1YVHA 2NLNA 3AKAA 2KNEA 1XFWO 2AUCA 2K8MB 1RK9A 2KHNA 2PVBA 1Y0VH 5FYXA 1J1DA 4CPVA 2BE4A 2JT8A 4ICBA 3I5IB 1F54A 1RTP1 2H61A 1ODBA 1KK8B 2KI6D 3EKJA 1Y1XA 2KQYA 2LUCA 3BOWA 3PN7B 2KDHA 3VRNA 1QLKA 2IS9A 1QXPA 2L98A 1QX5B 2JWWA 3D0YB 3DVKA 2LLTA 2FJUB 1TN4A 1YUTA 2L51A 1MR8A 1A4PA 2L50A 1SW8A 1QJTA 3PFVA 1WLZA 3A4UB 5HLVA 1YRUB 4U8DA 3DF0B 2M7NA 4PE0A 1AJ5A 3KPXA 3NSIA 5G08A 4PDZA 2LC5A 2QACA 1KSOA 3I5FB 5DKRA 3SJSA 1SL9A 2LVVA 3IQOA 5GQQC 2G2BA 3QRXA 2F8PA 4ORCB 1M31A 1TCOB 4MN0A 3PSRA 1EXRA 1XFVO 4YI8A 1KFUS 2K7CA 3KF9A 1RWYA 3EVVA 4CFQA 4M2QA 1CNPA 2OTGB 1J7PA 1KFUL 4OR9B 2M3WA 1RECA 1A75B 4AQJA 4OVNF 1K96A 1JUOA 1L2OB 1BMOA 3I5GB 4HRHA 1N0YA 1EJ3A 2HF5A 1XK4A 3DVEA 4GFTA 1CDLA 1PRWA 5AFPA 1KCYA 1KWOC 5CSIA 2FCDA 1K9KA 2BE6A 2I7AA 1EL4A 1UWOA 1ALWA 1XYDA 1MF8B 3VROA 3JVTB 5AXIA 4YGEB 1PALA 1CFFA 1BODA 3LK0A 2M1KB 1TOPA 1DJHA 2JT0A 3TS5B 1DTLA 3GK4X 2JRFA 1Y6WA 2JQ6A 2BBNA 2WNDA 1LA3A 1KFXL 1QIWA 1SKTA 1G4YR 2E30A 1CM1A 4BY5A 4MEWA 1NYAA 4CLNA 3D10A 1GQMA 1DF0B 2Y1NA 5JJGA 1VRKA 4N1FA 2TN4A 1WDCC 2WCEA 4NDBA 2JT3A 2K61A 4WRIA 3BUWB 1IGVA 5AANA 4D1EA 4PHMA 2ZFDA 2V53A 1C07A 1OSAA 1F55A 1QLSA 3BQ3A 1SYMA 2LUXA 1QV1A 2KBMA 2WC8A 2NXQA 4I5JA 1W7IB 4M2OA 1NWDA 1NX2A 3BOWB 2K7DA 3C1VA 3OP0A 2JU0A 1CLBA 4FQOA 2F3ZA 1BF5A 1XFXO 3JTDC 5F6TA 3AAKA 3SG7A 1TRFA 2M1UA 5ER4X 1SBJA 1TNPA 2B1UA 2BECA 1B8CA 2LV7A 5KSZA 2BL0B 4NQGA 3EK7A 2HQWA 1DGUA 2AAOA 3PATA 1K95A 1RROA 4ORBB 1YUUA 2OS8B 2KOTA 3GK2A 2WOSA 1DVIA 1UHNA 1SK6D 1MXEA 1SMGA 3CWGA 3SG4A 2LLSA 1DJYA 2I18A 1NSHA 3BUOB 3PLFB 1JF0A 2CXJA 3NXAA 4PCWA 4C0LA 2BCAA 3EVRA 2KYFA 3CR5X 5HKYA 3OB2B 2F3YA 1J1EA 1YTZC 3BYAA 5CSFA 5HKZA 2LMUA 1S5GZ 2JPTA 1TCFA 4ZCUA 2CNPA 2ZKMX 1S36A 1SCMB 2HQ8A 2LMTA 3EVUA 2Q91A 5AEQA 3SG5A 1QX7A 2BCXA 1PULA 3O2PA 2JNXA 2MA2A 4GAOA 2ZRTA 1ALVA 2EC6C 1IJ6A 2L4HA 1G33A 4HSZA 4YGDB 1NP8A 1N2DA 1XO5A 3ZWHA 1QATA 3LLEA 1F70A 1DT7B 1LKJA 2WORA 1PVBA 4OKHA 1DGVA 3WHTB 5HKWA 3LCPC 2LVJA 1NX0A 3SG6A 4PE4A 2G9BA 1PVAA 1BR1B 4FTGA 1LVCD 1J7RA 2COLB 1AUIB 1IRJA 2DOQA 3BUXB 1CDPA 3VRPA 4AOMA 4YI9A 1IKUA 2ZNEA 4JPZB 3FIAA 1CDMA 1U5IB 3DD4A 4I5LB 1SL8A 1JFJA 2CTNA 1AHRA 1CTRA 1BR4B 2BKIB 1DJIA 2LP2A 3CTNA 1DJXA 1UHJA 4P5OE 1NIWA 1V1FA 1L2OC 1BU3A 1UUSA 1B8RA 1AP4A 4P2YB 2KFFA 4OCIA 1OZOA 3CR4X 3LK1A 2LVKA 3F45A 4MLWA 2AMIA 5CSNA 4YRUA 4PALA 5KTYA 1KQMB 1BJFA 4NDDA 2L5XB 1HT9A 2A4JA 1F71A 2K2FA 2MLFC 1OOJA 5DKNA 4PE1A 3TDZA 1PK0D 1KWOB 2F2PA 2LMVA 4MZLA 2H2KA 1LA0A 2LLUA 2L4IA 2MBXA 1F8HA 4WQ3A 1ZMZA 3BUMB 3BXKA 5IBWA 2LM5A 2K0JA 3HCMA 4GGNA 2JTZA 2Y5IA 2O60A 1NX3A 1S6IA 2M0RA 4R1EA 3E3RA 3SG2A 4USLA 1AVSA 2LHLA 3H4SE 5I2LA 5J3XA 2ISDA 2LE9B 1K9PA 3DF0A 2LAPA 2MHHA 1CMFA 1ZACA 2BBMA 4MRYA 1SR6B 3CZTX 2KI6C 4CFRA 1UHIA 1F4OA 1C7VA 1GGWA 1WY9A 1S6CA 3SG3A 2GGMA 2WCBA 5D7FA 1SL7A 3CS1A 2ZN9A 1WDCB 2LANA 3PALA 1YUSA 1TIZA 2KI4C 3VRRA 4F0ZB 1AJ4A 1YVLA 1ZFSA 2M9GA 1JF2A 1M39A 4DUQA 4C0KA 1RJVA 2P6BB 1XVJA 2MRDA 2NZ0A 2M7LA 1A03A 1R6PA 1S5GY 4PHKA 3SIBA 1B4CA 1KQVA 1QTXA 3MSEB 1QV0A 1DMOA 4ORAB 1FF1A 5TNCA 4WQ2A 3O4YA 1CDNA 2QPTA 1K93D 1FBVA 1OE9B 1C7WA 2RGIA 1K8UA 3GOFA 2GV5A 1WRZA 3TUYC 1WLMA 3FWCA 4MBEA 2KAYA 1CB1A 3I5HC 3JTDB 3KHEA 4UPGA 1K90D 2I94A 4PHNA 4YGBB 1SPYA 4N5XA 2SCPA 1JC2A 1LXFC 2KBIA 1TTXA 1RFJA 3WNXB 1AK8A 3FS7A 3OHMB 3VGOA 3EKHA 2F33A 1CFCA 2EGDA 5I2QA 1TNQA 1IQ3A 1NCYA 2CCMA 2LCPA 3RM1A 1JWDA 5CPVA 1IWQA 1UHHA 4YGAA 2MJWB 3BUNB 1QASA 4XJKA 1UURA 4DS7A 2L0PA 2MLEC 4NDCA 3I5IC 2KYCA 3CR2A 4ETOA 1IQ5A 2MAZA 1NUBA 1S3PA 1KK8C 1MWNA 2WCFA 5D69A 4QJ4B 4E68A 2ZN8A 1S6JA 3PN7C 3VRQA 2KGRA 4AQIA 4MSPA 1QX2A 1B9AA 4BY4A 2K7BA 1NX1A 4IL1A 5BPJA 5KU1A 4MVFA 2HPSA 2KFHA 2JNFA 4GBAA 2JTTA 1KK7Y 2D8NA 1S26D 1CFDA 1JBAA 1FPWA 1J7OA 3ICBA 1YURA 1E8AA 3O6BA 3I5FC 3CLNA 4QJ3B 5ER5A 3WXAA 4GNKB 4M2PA 3A8RA 1YX8A 1UP5A 1XFYO 2EC6B 2SASA 4HREE 1CLLA 2KQ6A 1QIVA 2CBLA 1PSRA 2R2IA 2JZIA 1M63B 2PASA 1MXLC 1A2XA 2JOJA 2PMYA 1CMGA 1OQPA 2CT9A 2VRGA 2OTGC 3NSOA 4TNCA 1CLMA 2BKHB 1TNWA 1JFKA 3KEVA 1CFPA 2KSPA 1KK7Z 4A4BA 1WRLA 3I5GC 2Y4QA 5PALA 2E6WA 3O78A 1GGZA 5B8IB 2HETA 1FW4A 4DIRA 1M45A 3OB1B 3ZNIA 2PRUA 3FWBA 5HLOA 1OZSA 1EG3A 1SY9A 3JVTC 3NSLA 4PE7A 4JWQA 4I5KA 4YBHB 2JXCA 1JSAA 1BLQA 3IF7A 1KQMC 1IG5A 2I2RE 3DVJA 3TS5C 4CIDA 1XFZO 2EHBA 1N65A 3AKBA 4GGFC 3KO0A 4PHJA 1YX7A 1B7TY 4I5NB 5AERA 1J7QA 1W7JB 2NCOA 3D0YA 1EH2A 3NSKA 1OMRA 1WRKA 4A4CA 1ZOTB 1NCXA 4MZKA 2KAXA 1QVIY 3K21A 4L9MA 1SRAA 3TDUA 5JOLA 5DKQA 1FI5A
chains in the Genus database with same CATH superfamily
1TNXA 1XA5A 2Q4UA 2LNKA 2FOTA 1IH0A 1XFUO 1Y1UA 1KFXS 1LS8A 2LP3A 2OPOA 2H8VA 1PSBA 3SIAA 1A29A 2KLEA 4JQ0D 1TUJA 1FI6A 3IQQA 1HQVA 1SR6C 1TWOA 3CGAA 3HX4A 1B8LA 1SCVA 4GUKA 1OMDA 4XJKB 2F2OA 1M46A 4QJ5B 1F4QA 3GK1A 2JULA 5I2OA 3TZ1A 2M49B 4N1GA 1ZUZA 2LHIA 1B7TZ 2H61C 3PM8A 4HRGA 2K2AA 1MHOA 3FE8A 3QMEA 1U5IA 3Q8IA 1A75A 1BOCA 2M29A 2L2EA 1X02A 1QVIZ 3EK8A 2ERBA 3DVMA 1S1EA 2JXLA 1OOFA 2NCPA 1NCZA 2K7OA 1D1OA 5HYDA 1GJYA 1BG1A 2M97A 3TDIA 1R2UA 1DJWA 3OX5A 1OMVA 1NPQA 2KI4B 4MZJA 3WHUB 2KFGA 1QS7A 1B1GA 5I8NA 1MUXA 1Q80A 1YR5A 2BL0C 2M8UA 3RLZA 5CSJA 1KSMA 2OS8C 1MQ1A 2JC2A 3M0WA 4Q04A 1LINA 1J55A 4C0JA 5EL2A 3K1EA 1G8IA 3OX6A 1BT6A 1SNLA 2BCBA 3SS5A 2ZNDA 3L47A 1K9UA 2ZRSA 3LL8B 4GGFA 4DRWA 1K94A 2KAVA 1CM4A 2PALA 4ZCVA 3EK4A 1DJZA 4GPLB 3VB1A 1CKKA 2O5GA 1IJ5A 2LVIA 3TUYB 1H8BA 4XYNA 1K2HA 3I5HB 3AAJA 1C3ZA 5K89A 2GGZA 2PSRA 2KGBC 1DF0A 1DJGA 1UHKA 1Y1AA 4OZDA 2Y1MA 4DCKA 1EG4A 1SCMC 1V1GA 1L7ZA 1XK4C 4OV2A 1B47A 1H4BA 1YRTB 2FCEA 4YGCB 4MRXA 1YVHA 2NLNA 3AKAA 2KNEA 1XFWO 1GM0A 2AUCA 2K8MB 1RK9A 2KHNA 2PVBA 3UO9A 3DYEA 1Y0VH 5FYXA 1J1DA 4JD9A 4CPVA 2BE4A 2JT8A 4ICBA 3I5IB 1F54A 1RTP1 2H61A 1ODBA 1KK8B 2KI6D 3EKJA 1Y1XA 2KQYA 2LUCA 3BOWA 3PN7B 1ORGA 2KDHA 3VRNA 1QLKA 2IS9A 1QXPA 2L98A 1QX5B 2JWWA 3D0YB 3DVKA 2LLTA 2FJUB 1TN4A 1YUTA 2L51A 1MR8A 1A4PA 1P28A 2L50A 1SW8A 1QJTA 3PFVA 1WLZA 3A4UB 5HLVA 1YRUB 4U8DA 3DF0B 2M7NA 4PE0A 1AJ5A 5FI7A 3KPXA 3NSIA 5G08A 4PDZA 2LC5A 3NHIA 2QACA 1KSOA 3I5FB 5DKRA 3SJSA 1SL9A 2LVVA 3IQOA 5GQQC 2G2BA 3QRXA 2F8PA 4ORCB 1M31A 1TCOB 4MN0A 3PSRA 1EXRA 1XFVO 4YI8A 1KFUS 2K7CA 3KF9A 1RWYA 3EVVA 4CFQA 4M2QA 1CNPA 2WCMA 2OTGB 1J7PA 1KFUL 4OR9B 2M3WA 1RECA 3RZSA 1A75B 4AQJA 3CYZA 4OVNF 1K96A 1JUOA 1L2OB 1BMOA 3I5GB 4HRHA 1N0YA 1EJ3A 2HF5A 1XK4A 3DVEA 4GFTA 1CDLA 1PRWA 5AFPA 1KCYA 1KWOC 5CSIA 2FCDA 1K9KA 2BE6A 2I7AA 1EL4A 1UWOA 1ALWA 1XYDA 1MF8B 1OOIX 4INXA 3JVTB 3VROA 5AXIA 4YGEB 1PALA 1CFFA 3O4XA 1BODA 3LK0A 2M1KB 1TOPA 1DJHA 2JT0A 3TS5B 1DTLA 3GK4X 2JRFA 1Y6WA 2P71A 2JQ6A 3PM2A 2BBNA 2WNDA 1LA3A 1KFXL 1QIWA 1SKTA 3PJIA 1G4YR 2E30A 1CM1A 2JPOA 4BY5A 4MEWA 1NYAA 4CLNA 3D10A 1GQMA 1DF0B 2Y1NA 5JJGA 1VRKA 4N1FA 2TN4A 1WDCC 2WCEA 4NDBA 2JT3A 2K61A 4WRIA 3BUWB 1IGVA 5AANA 2K60A 4FQTA 4PHMA 4D1EA 2ZFDA 2V53A 1C07A 1OSAA 1F55A 1QLSA 3BQ3A 1SYMA 2LUXA 1QV1A 2KBMA 2WC8A 2NXQA 2WCHA 1W7IB 4I5JA 1NWDA 4M2OA 3N7HA 1NX2A 3BOWB 2K7DA 3C1VA 3OP0A 2JU0A 1CLBA 4FQOA 2F3ZA 1BF5A 1XFXO 3JTDC 5F6TA 3AAKA 3SG7A 1TRFA 2M1UA 5ER4X 1SBJA 1TNPA 2B1UA 2BECA 3IVTA 1B8CA 2LV7A 5KSZA 1Z2CB 2BL0B 3EK7A 4NQGA 2HQWA 1DGUA 2AAOA 3PATA 1K95A 1RROA 4ORBB 1YUUA 2OS8B 2KOTA 2GTEA 5I94A 3GK2A 2WOSA 1DVIA 1UHNA 1SK6D 1MXEA 1SMGA 3CWGA 3D73A 3SG4A 2LLSA 1DJYA 2I18A 1NSHA 3B6XA 3BUOB 1JF0A 2CXJA 3NXAA 3PLFB 4PCWA 4C0LA 3BFHA 2BCAA 3EVRA 2KYFA 3CR5X 3S0EA 5HKYA 3OB2B 2F3YA 1J1EA 1YTZC 3BYAA 5CSFA 5HKZA 2LMUA 1S5GZ 1DQEA 2JPTA 1TCFA 2QEVA 3R1PA 3B88A 4ZCUA 2CNPA 1C3YA 2ZKMX 1S36A 1SCMB 2HQ8A 1OOHA 2LMTA 3EVUA 2Q91A 5AEQA 3SG5A 1QX7A 2BCXA 1PULA 3O2PA 3S0FA 2JNXA 3S0BA 2MA2A 3BFBA 2YGUA 1ALVA 2EC6C 1IJ6A 2L4HA 2ZRTA 3OBVA 1G33A 4GAOA 4HSZA 4YGDB 1NP8A 1N2DA 1XO5A 3ZWHA 1QATA 3LLEA 3B86A 1F70A 1DT7B 1LKJA 2WORA 1PVBA 4OKHA 1TUZA 1DGVA 3WHTB 4INWA 5HKWA 3LCPC 2LVJA 1NX0A 3SG6A 4PE4A 2G9BA 1PVAA 1BR1B 2WC5A 4FTGA 1LVCD 1J7RA 2WCLA 2COLB 1AUIB 1IRJA 2DOQA 3BUXB 1CDPA 3VRPA 4AOMA 3L4LA 4YI9A 1IKUA 2ZNEA 4JPZB 3FIAA 1CDMA 1U5IB 3DD4A 4I5LB 1SL8A 3OGNA 1JFJA 2CTNA 1AHRA 1CTRA 1BR4B 2BKIB 1DJIA 2LP2A 3CTNA 1DJXA 1UHJA 2L2CA 1NIWA 4P5OE 2BAPA 1V1FA 3SS4A 1L2OC 1BU3A 3BJHA 1UUSA 1B8RA 2QDIA 1AP4A 4P2YB 1XFRA 2KFFA 4OCIA 1OZOA 3D75A 3S0DA 3CR4X 3LK1A 2LVKA 3F45A 4MLWA 2AMIA 5CSNA 4YRUA 4PALA 5KTYA 1KQMB 1BJFA 4NDDA 2L5XB 1HT9A 2A4JA 1F71A 2K2FA 5FI6A 1W9ZA 2MLFC 1DEKA 1OOJA 5DKNA 4PE1A 3TDZA 1PK0D 1KWOB 2F2PA 2LMVA 1DELA 4MZLA 2H2KA 1LA0A 2LLUA 2L4IA 2MBXA 1F8HA 4WQ3A 1ZMZA 3BUMB 3BXKA 5IBWA 2LM5A 2K0JA 3HCMA 4GGNA 2JTZA 2Y5IA 2O60A 3CDNA 1NX3A 1S6IA 2M0RA 4KYNA 3R1VA 4R1EA 3E3RA 3EG5B 3SG2A 4USLA 1AVSA 2LHLA 3H4SE 5I2LA 5J3XA 2ISDA 2LE9B 3B7AA 1K9PA 2FJYA 3DF0A 2LAPA 2MHHA 3D77A 1CMFA 1ZACA 2BBMA 4MRYA 1SR6B 3CZTX 2KI6C 4CFRA 1UHIA 3NHTA 1F4OA 1T14A 1IIOA 1C7VA 1GGWA 1WY9A 3DXLA 1S6CA 3SG3A 2GGMA 2WCBA 5D7FA 1SL7A 3CS1A 2QEBA 2ZN9A 1WDCB 2LANA 3PALA 1YUSA 1TIZA 2KI4C 3VRRA 3CZ2A 4F0ZB 1AJ4A 1YVLA 1ZFSA 2M9GA 1JF2A 1M39A 4DUQA 5HL1A 4C0KA 1RJVA 2P6BB 5DICA 1XVJA 2MRDA 2NZ0A 2M7LA 1A03A 1R6PA 1S5GY 4PHKA 3SIBA 1B4CA 1KQVA 1QTXA 3MSEB 1QV0A 2QEOA 1DMOA 4ORAB 1FF1A 5TNCA 2P70A 4WQ2A 3O4YA 1CDNA 2QPTA 1K93D 3D76A 1FBVA 1SSEB 1OE9B 1C7WA 2RGIA 1K8UA 2PYQA 2GV5A 3GOFA 1WRZA 3TUYC 1WLMA 3FWCA 4MBEA 2KAYA 1CB1A 3I5HC 3JTDB 3KHEA 4IJ7A 4UPGA 1K90D 2I94A 4PHNA 4YGBB 3V2LA 1SPYA 4N5XA 2SCPA 1JC2A 1LXFC 2KBIA 2WCJA 1TTXA 1RFJA 3WNXB 1DC1A 1AK8A 3FS7A 3OHMB 4PT1A 3VGOA 3UNWA 3EKHA 3DY9A 1OW4A 3R1OA 2F33A 2KLDA 2EGDA 5D3OA 1TNQA 5I2QA 1IQ3A 1CFCA 1NCYA 2CCMA 2LCPA 3RM1A 1JWDA 5CPVA 1IWQA 1UHHA 4YGAA 2MJWB 3BUNB 1QASA 4XJKA 1UURA 4DS7A 2BNXA 2L0PA 2MLEC 4NDCA 3I5IC 2KYCA 3CR2A 4ETOA 1IQ5A 2MAZA 1NUBA 1S3PA 1KK8C 1MWNA 2WCFA 5D69A 4QJ4B 4E68A 2ZN8A 1S6JA 3PN7C 3VRQA 2KGRA 4AQIA 4MSPA 1QX2A 1B9AA 3NGVA 4BY4A 2K7BA 1NX1A 1OOGA 4IL1A 5BPJA 5KU1A 4MVFA 2HPSA 2KFHA 2JNFA 3R72A 4GBAA 4JKTA 2JTTA 1KK7Y 2D8NA 1S26D 2L5YA 1CFDA 1QWVA 1JBAA 1FPWA 1J7OA 3ICBA 5FI2A 1YURA 3CABA 2KPHA 1E8AA 3O6BA 3D74A 3I5FC 3CLNA 4QJ3B 5ER5A 3WXAA 4GNKB 4M2PA 4F7FA 3A8RA 1YX8A 1UP5A 1XFYO 2EC6B 1Z4HA 2SASA 4HREE 1CLLA 2KQ6A 1QIVA 2CBLA 1PSRA 2R2IA 2JZIA 1M63B 2PQLA 2PASA 3S0AA 1MXLC 1A2XA 2JOJA 2PMYA 1CMGA 1OQPA 2CT9A 2VRGA 2OTGC 2WCKA 3D78A 3NSOA 1CLMA 2BKHB 3BFAA 1TNWA 4TNCA 3CZ1A 1JFKA 3KEVA 1CFPA 2KSPA 1KK7Z 4A4BA 1WRLA 3I5GC 2Y4QA 5PALA 2E6WA 3DZTA 3O78A 1GGZA 5B8IB 2HETA 1FW4A 4DIRA 3S0GA 1M45A 3OB1B 3ZNIA 2PRUA 3FWBA 3CZ0A 1OZSA 1EG3A 3FE9A 1SY9A 3JVTC 3NSLA 4PE7A 5HLOA 4JWQA 4I5KA 4YBHB 2JXCA 1JSAA 3SS3A 1BLQA 3IF7A 1KQMC 1IG5A 2I2RE 3DVJA 3TS5C 4CIDA 1XFZO 2EHBA 1N65A 3AKBA 2QEHA 4GGFC 3KO0A 4PHJA 1YX7A 1B7TY 4I5NB 5AERA 1J7QA 1W7JB 2NCOA 3L4AA 3D0YA 1EH2A 3NSKA 1OMRA 1WRKA 4A4CA 1ZOTB 1NCXA 3FE6A 2KAXA 2WC6A 1QVIY 3K21A 4MZKA 4L9MA 1SRAA 3TDUA 5JOLA 5DKQA 3B87A 1FI5A
chains in the Genus database with same CATH topology
1TNXA 1XA5A 2Q4UA 2LNKA 2FOTA 1IH0A 1XFUO 1Y1UA 1KFXS 2LP3A 2OPOA 1PSBA 3SIAA 1A29A 4JQ0D 1FI6A 3IQQA 1HQVA 1SR6C 3HX4A 3CGAA 1B8LA 1SCVA 4GUKA 1OMDA 4XJKB 2F2OA 1M46A 4QJ5B 1F4QA 3GK1A 2JULA 5I2OA 3TZ1A 2M49B 4N1GA 1ZUZA 2LHIA 1B7TZ 2H61C 3PM8A 4HRGA 2K2AA 1MHOA 1U5IA 1A75A 1BOCA 2M29A 2L2EA 1X02A 1QVIZ 3EK8A 3DVMA 1S1EA 2JXLA 2NCPA 1NCZA 2K7OA 1D1OA 5HYDA 1GJYA 1BG1A 2M97A 3TDIA 1R2UA 1DJWA 3OX5A 1OMVA 1NPQA 2KI4B 4MZJA 3WHUB 2KFGA 1QS7A 1B1GA 5I8NA 1MUXA 1Q80A 1YR5A 2BL0C 2M8UA 3RLZA 5CSJA 1KSMA 2OS8C 1MQ1A 2JC2A 3M0WA 4Q04A 1LINA 1J55A 4C0JA 1G8IA 3OX6A 1BT6A 1SNLA 2BCBA 2ZNDA 1K9UA 2ZRSA 3LL8B 4GGFA 4DRWA 1K94A 2KAVA 1CM4A 2PALA 4ZCVA 3EK4A 1DJZA 4GPLB 1CKKA 2O5GA 1IJ5A 2LVIA 3TUYB 1H8BA 4XYNA 1K2HA 3I5HB 3AAJA 5K89A 2GGZA 2PSRA 2KGBC 1DF0A 1DJGA 1UHKA 1Y1AA 2Y1MA 4DCKA 1EG4A 1SCMC 1V1GA 1L7ZA 1XK4C 4OV2A 1B47A 1H4BA 1YRTB 2FCEA 4YGCB 4MRXA 1YVHA 2NLNA 3AKAA 2KNEA 1XFWO 2AUCA 2K8MB 1RK9A 2KHNA 2PVBA 1Y0VH 5FYXA 1J1DA 4CPVA 2BE4A 2JT8A 4ICBA 3I5IB 1F54A 1RTP1 2H61A 1ODBA 1KK8B 2KI6D 3EKJA 1Y1XA 2KQYA 2LUCA 3BOWA 3PN7B 2KDHA 3VRNA 1QLKA 2IS9A 1QXPA 2L98A 1QX5B 2JWWA 3D0YB 3DVKA 2LLTA 2FJUB 1TN4A 1YUTA 2L51A 1MR8A 1A4PA 2L50A 1SW8A 1QJTA 3PFVA 1WLZA 3A4UB 5HLVA 1YRUB 4U8DA 3DF0B 2M7NA 4PE0A 1AJ5A 3KPXA 3NSIA 5G08A 4PDZA 2LC5A 2QACA 1KSOA 3I5FB 5DKRA 3SJSA 1SL9A 2LVVA 3IQOA 5GQQC 2G2BA 3QRXA 2F8PA 4ORCB 1M31A 1TCOB 4MN0A 3PSRA 1EXRA 1XFVO 4YI8A 1KFUS 2K7CA 3KF9A 1RWYA 3EVVA 4CFQA 4M2QA 1CNPA 2OTGB 1J7PA 1KFUL 4OR9B 2M3WA 1RECA 1A75B 4AQJA 4OVNF 1K96A 1JUOA 1L2OB 1BMOA 3I5GB 4HRHA 1N0YA 1EJ3A 2HF5A 1XK4A 3DVEA 4GFTA 1CDLA 1PRWA 5AFPA 1KCYA 1KWOC 5CSIA 2FCDA 1K9KA 2BE6A 2I7AA 1EL4A 1UWOA 1ALWA 1XYDA 1MF8B 3VROA 3JVTB 5AXIA 4YGEB 1PALA 1CFFA 1BODA 3LK0A 2M1KB 1TOPA 1DJHA 2JT0A 3TS5B 1DTLA 3GK4X 2JRFA 1Y6WA 2JQ6A 2BBNA 2WNDA 1LA3A 1KFXL 1QIWA 1SKTA 1G4YR 2E30A 1CM1A 4BY5A 4MEWA 1NYAA 4CLNA 3D10A 1GQMA 1DF0B 2Y1NA 5JJGA 1VRKA 4N1FA 2TN4A 1WDCC 2WCEA 4NDBA 2JT3A 2K61A 4WRIA 3BUWB 1IGVA 5AANA 4D1EA 4PHMA 2ZFDA 2V53A 1C07A 1OSAA 1F55A 1QLSA 3BQ3A 1SYMA 2LUXA 1QV1A 2KBMA 2WC8A 2NXQA 4I5JA 1W7IB 4M2OA 1NWDA 1NX2A 3BOWB 2K7DA 3C1VA 3OP0A 2JU0A 1CLBA 4FQOA 2F3ZA 1BF5A 1XFXO 3JTDC 5F6TA 3AAKA 3SG7A 1TRFA 2M1UA 5ER4X 1SBJA 1TNPA 2B1UA 2BECA 1B8CA 2LV7A 5KSZA 2BL0B 4NQGA 3EK7A 2HQWA 1DGUA 2AAOA 3PATA 1K95A 1RROA 4ORBB 1YUUA 2OS8B 2KOTA 3GK2A 2WOSA 1DVIA 1UHNA 1SK6D 1MXEA 1SMGA 3CWGA 3SG4A 2LLSA 1DJYA 2I18A 1NSHA 3BUOB 3PLFB 1JF0A 2CXJA 3NXAA 4PCWA 4C0LA 2BCAA 3EVRA 2KYFA 3CR5X 5HKYA 3OB2B 2F3YA 1J1EA 1YTZC 3BYAA 5CSFA 5HKZA 2LMUA 1S5GZ 2JPTA 1TCFA 4ZCUA 2CNPA 2ZKMX 1S36A 1SCMB 2HQ8A 2LMTA 3EVUA 2Q91A 5AEQA 3SG5A 1QX7A 2BCXA 1PULA 3O2PA 2JNXA 2MA2A 4GAOA 2ZRTA 1ALVA 2EC6C 1IJ6A 2L4HA 1G33A 4HSZA 4YGDB 1NP8A 1N2DA 1XO5A 3ZWHA 1QATA 3LLEA 1F70A 1DT7B 1LKJA 2WORA 1PVBA 4OKHA 1DGVA 3WHTB 5HKWA 3LCPC 2LVJA 1NX0A 3SG6A 4PE4A 2G9BA 1PVAA 1BR1B 4FTGA 1LVCD 1J7RA 2COLB 1AUIB 1IRJA 2DOQA 3BUXB 1CDPA 3VRPA 4AOMA 4YI9A 1IKUA 2ZNEA 4JPZB 3FIAA 1CDMA 1U5IB 3DD4A 4I5LB 1SL8A 1JFJA 2CTNA 1AHRA 1CTRA 1BR4B 2BKIB 1DJIA 2LP2A 3CTNA 1DJXA 1UHJA 4P5OE 1NIWA 1V1FA 1L2OC 1BU3A 1UUSA 1B8RA 1AP4A 4P2YB 2KFFA 4OCIA 1OZOA 3CR4X 3LK1A 2LVKA 3F45A 4MLWA 2AMIA 5CSNA 4YRUA 4PALA 5KTYA 1KQMB 1BJFA 4NDDA 2L5XB 1HT9A 2A4JA 1F71A 2K2FA 2MLFC 1OOJA 5DKNA 4PE1A 3TDZA 1PK0D 1KWOB 2F2PA 2LMVA 4MZLA 2H2KA 1LA0A 2LLUA 2L4IA 2MBXA 1F8HA 4WQ3A 1ZMZA 3BUMB 3BXKA 5IBWA 2LM5A 2K0JA 3HCMA 4GGNA 2JTZA 2Y5IA 2O60A 1NX3A 1S6IA 2M0RA 4R1EA 3E3RA 3SG2A 4USLA 1AVSA 2LHLA 3H4SE 5I2LA 5J3XA 2ISDA 2LE9B 1K9PA 3DF0A 2LAPA 2MHHA 1CMFA 1ZACA 2BBMA 4MRYA 1SR6B 3CZTX 2KI6C 4CFRA 1UHIA 1F4OA 1C7VA 1GGWA 1WY9A 1S6CA 3SG3A 2GGMA 2WCBA 5D7FA 1SL7A 3CS1A 2ZN9A 1WDCB 2LANA 3PALA 1YUSA 1TIZA 2KI4C 3VRRA 4F0ZB 1AJ4A 1YVLA 1ZFSA 2M9GA 1JF2A 1M39A 4DUQA 4C0KA 1RJVA 2P6BB 1XVJA 2MRDA 2NZ0A 2M7LA 1A03A 1R6PA 1S5GY 4PHKA 3SIBA 1B4CA 1KQVA 1QTXA 3MSEB 1QV0A 1DMOA 4ORAB 1FF1A 5TNCA 4WQ2A 3O4YA 1CDNA 2QPTA 1K93D 1FBVA 1OE9B 1C7WA 2RGIA 1K8UA 3GOFA 2GV5A 1WRZA 3TUYC 1WLMA 3FWCA 4MBEA 2KAYA 1CB1A 3I5HC 3JTDB 3KHEA 4UPGA 1K90D 2I94A 4PHNA 4YGBB 1SPYA 4N5XA 2SCPA 1JC2A 1LXFC 2KBIA 1TTXA 1RFJA 3WNXB 1AK8A 3FS7A 3OHMB 3VGOA 3EKHA 2F33A 1CFCA 2EGDA 5I2QA 1TNQA 1IQ3A 1NCYA 2CCMA 2LCPA 3RM1A 1JWDA 5CPVA 1IWQA 1UHHA 4YGAA 2MJWB 3BUNB 1QASA 4XJKA 1UURA 4DS7A 2L0PA 2MLEC 4NDCA 3I5IC 2KYCA 3CR2A 4ETOA 1IQ5A 2MAZA 1NUBA 1S3PA 1KK8C 1MWNA 2WCFA 5D69A 4QJ4B 4E68A 2ZN8A 1S6JA 3PN7C 3VRQA 2KGRA 4AQIA 4MSPA 1QX2A 1B9AA 4BY4A 2K7BA 1NX1A 4IL1A 5BPJA 5KU1A 4MVFA 2HPSA 2KFHA 2JNFA 4GBAA 2JTTA 1KK7Y 2D8NA 1S26D 1CFDA 1JBAA 1FPWA 1J7OA 3ICBA 1YURA 1E8AA 3O6BA 3I5FC 3CLNA 4QJ3B 5ER5A 3WXAA 4GNKB 4M2PA 3A8RA 1YX8A 1UP5A 1XFYO 2EC6B 2SASA 4HREE 1CLLA 2KQ6A 1QIVA 2CBLA 1PSRA 2R2IA 2JZIA 1M63B 2PASA 1MXLC 1A2XA 2JOJA 2PMYA 1CMGA 1OQPA 2CT9A 2VRGA 2OTGC 3NSOA 4TNCA 1CLMA 2BKHB 1TNWA 1JFKA 3KEVA 1CFPA 2KSPA 1KK7Z 4A4BA 1WRLA 3I5GC 2Y4QA 5PALA 2E6WA 3O78A 1GGZA 5B8IB 2HETA 1FW4A 4DIRA 1M45A 3OB1B 3ZNIA 2PRUA 3FWBA 5HLOA 1OZSA 1EG3A 1SY9A 3JVTC 3NSLA 4PE7A 4JWQA 4I5KA 4YBHB 2JXCA 1JSAA 1BLQA 3IF7A 1KQMC 1IG5A 2I2RE 3DVJA 3TS5C 4CIDA 1XFZO 2EHBA 1N65A 3AKBA 4GGFC 3KO0A 4PHJA 1YX7A 1B7TY 4I5NB 5AERA 1J7QA 1W7JB 2NCOA 3D0YA 1EH2A 3NSKA 1OMRA 1WRKA 4A4CA 1ZOTB 1NCXA 4MZKA 2KAXA 1QVIY 3K21A 4L9MA 1SRAA 3TDUA 5JOLA 5DKQA 1FI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNX A;  1XA5 A;  2Q4U A;  2LNK A;  2FOT A;  1IH0 A;  1XFU O;  1Y1U A;  1KFX S;  2LP3 A;  2OPO A;  1PSB A;  3SIA A;  1A29 A;  4JQ0 D;  1FI6 A;  3IQQ A;  1HQV A;  1SR6 C;  3HX4 A;  3CGA A;  1B8L A;  1SCV A;  4GUK A;  1OMD A;  4XJK B;  2F2O A;  1M46 A;  4QJ5 B;  1F4Q A;  3GK1 A;  2JUL A;  5I2O A;  3TZ1 A;  2M49 B;  4N1G A;  1ZUZ A;  2LHI A;  1B7T Z;  2H61 C;  3PM8 A;  4HRG A;  2K2A A;  1MHO A;  1U5I A;  1A75 A;  1BOC A;  2M29 A;  2L2E A;  1X02 A;  1QVI Z;  3EK8 A;  3DVM A;  1S1E A;  2JXL A;  2NCP A;  1NCZ A;  2K7O A;  1D1O A;  5HYD A;  1GJY A;  1BG1 A;  2M97 A;  3TDI A;  1R2U A;  1DJW A;  3OX5 A;  1OMV A;  1NPQ A;  2KI4 B;  4MZJ A;  3WHU B;  2KFG A;  1QS7 A;  1B1G A;  5I8N A;  1MUX A;  1Q80 A;  1YR5 A;  2BL0 C;  2M8U A;  3RLZ A;  5CSJ A;  1KSM A;  2OS8 C;  1MQ1 A;  2JC2 A;  3M0W A;  4Q04 A;  1LIN A;  1J55 A;  4C0J A;  1G8I A;  3OX6 A;  1BT6 A;  1SNL A;  2BCB A;  2ZND A;  1K9U A;  2ZRS A;  3LL8 B;  4GGF A;  4DRW A;  1K94 A;  2KAV A;  1CM4 A;  2PAL A;  4ZCV A;  3EK4 A;  1DJZ A;  4GPL B;  1CKK A;  2O5G A;  1IJ5 A;  2LVI A;  3TUY B;  1H8B A;  4XYN A;  1K2H A;  3I5H B;  3AAJ A;  5K89 A;  2GGZ A;  2PSR A;  2KGB C;  1DF0 A;  1DJG A;  1UHK A;  1Y1A A;  2Y1M A;  4DCK A;  1EG4 A;  1SCM C;  1V1G A;  1L7Z A;  1XK4 C;  4OV2 A;  1B47 A;  1H4B A;  1YRT B;  2FCE A;  4YGC B;  4MRX A;  1YVH A;  2NLN A;  3AKA A;  2KNE A;  1XFW O;  2AUC A;  2K8M B;  1RK9 A;  2KHN A;  2PVB A;  1Y0V H;  5FYX A;  1J1D A;  4CPV A;  2BE4 A;  2JT8 A;  4ICB A;  3I5I B;  1F54 A;  1RTP 1;  2H61 A;  1ODB A;  1KK8 B;  2KI6 D;  3EKJ A;  1Y1X A;  2KQY A;  2LUC A;  3BOW A;  3PN7 B;  2KDH A;  3VRN A;  1QLK A;  2IS9 A;  1QXP A;  2L98 A;  1QX5 B;  2JWW A;  3D0Y B;  3DVK A;  2LLT A;  2FJU B;  1TN4 A;  1YUT A;  2L51 A;  1MR8 A;  1A4P A;  2L50 A;  1SW8 A;  1QJT A;  3PFV A;  1WLZ A;  3A4U B;  5HLV A;  1YRU B;  4U8D A;  3DF0 B;  2M7N A;  4PE0 A;  1AJ5 A;  3KPX A;  3NSI A;  5G08 A;  4PDZ A;  2LC5 A;  2QAC A;  1KSO A;  3I5F B;  5DKR A;  3SJS A;  1SL9 A;  2LVV A;  3IQO A;  5GQQ C;  2G2B A;  3QRX A;  2F8P A;  4ORC B;  1M31 A;  1TCO B;  4MN0 A;  3PSR A;  1EXR A;  1XFV O;  4YI8 A;  1KFU S;  2K7C A;  3KF9 A;  1RWY A;  3EVV A;  4CFQ A;  4M2Q A;  1CNP A;  2OTG B;  1J7P A;  1KFU L;  4OR9 B;  2M3W A;  1REC A;  1A75 B;  4AQJ A;  4OVN F;  1K96 A;  1JUO A;  1L2O B;  1BMO A;  3I5G B;  4HRH A;  1N0Y A;  1EJ3 A;  2HF5 A;  1XK4 A;  3DVE A;  4GFT A;  1CDL A;  1PRW A;  5AFP A;  1KCY A;  1KWO C;  5CSI A;  2FCD A;  1K9K A;  2BE6 A;  2I7A A;  1EL4 A;  1UWO A;  1ALW A;  1XYD A;  1MF8 B;  3VRO A;  3JVT B;  5AXI A;  4YGE B;  1PAL A;  1CFF A;  1BOD A;  3LK0 A;  2M1K B;  1TOP A;  1DJH A;  2JT0 A;  3TS5 B;  1DTL A;  3GK4 X;  2JRF A;  1Y6W A;  2JQ6 A;  2BBN A;  2WND A;  1LA3 A;  1KFX L;  1QIW A;  1SKT A;  1G4Y R;  2E30 A;  1CM1 A;  4BY5 A;  4MEW A;  1NYA A;  4CLN A;  3D10 A;  1GQM A;  1DF0 B;  2Y1N A;  5JJG A;  1VRK A;  4N1F A;  2TN4 A;  1WDC C;  2WCE A;  4NDB A;  2JT3 A;  2K61 A;  4WRI A;  3BUW B;  1IGV A;  5AAN A;  4D1E A;  4PHM A;  2ZFD A;  2V53 A;  1C07 A;  1OSA A;  1F55 A;  1QLS A;  3BQ3 A;  1SYM A;  2LUX A;  1QV1 A;  2KBM A;  2WC8 A;  2NXQ A;  4I5J A;  1W7I B;  4M2O A;  1NWD A;  1NX2 A;  3BOW B;  2K7D A;  3C1V A;  3OP0 A;  2JU0 A;  1CLB A;  4FQO A;  2F3Z A;  1BF5 A;  1XFX O;  3JTD C;  5F6T A;  3AAK A;  3SG7 A;  1TRF A;  2M1U A;  5ER4 X;  1SBJ A;  1TNP A;  2B1U A;  2BEC A;  1B8C A;  2LV7 A;  5KSZ A;  2BL0 B;  4NQG A;  3EK7 A;  2HQW A;  1DGU A;  2AAO A;  3PAT A;  1K95 A;  1RRO A;  4ORB B;  1YUU A;  2OS8 B;  2KOT A;  3GK2 A;  2WOS A;  1DVI A;  1UHN A;  1SK6 D;  1MXE A;  1SMG A;  3CWG A;  3SG4 A;  2LLS A;  1DJY A;  2I18 A;  1NSH A;  3BUO B;  3PLF B;  1JF0 A;  2CXJ A;  3NXA A;  4PCW A;  4C0L A;  2BCA A;  3EVR A;  2KYF A;  3CR5 X;  5HKY A;  3OB2 B;  2F3Y A;  1J1E A;  1YTZ C;  3BYA A;  5CSF A;  5HKZ A;  2LMU A;  1S5G Z;  2JPT A;  1TCF A;  4ZCU A;  2CNP A;  2ZKM X;  1S36 A;  1SCM B;  2HQ8 A;  2LMT A;  3EVU A;  2Q91 A;  5AEQ A;  3SG5 A;  1QX7 A;  2BCX A;  1PUL A;  3O2P A;  2JNX A;  2MA2 A;  4GAO A;  2ZRT A;  1ALV A;  2EC6 C;  1IJ6 A;  2L4H A;  1G33 A;  4HSZ A;  4YGD B;  1NP8 A;  1N2D A;  1XO5 A;  3ZWH A;  1QAT A;  3LLE A;  1F70 A;  1DT7 B;  1LKJ A;  2WOR A;  1PVB A;  4OKH A;  1DGV A;  3WHT B;  5HKW A;  3LCP C;  2LVJ A;  1NX0 A;  3SG6 A;  4PE4 A;  2G9B A;  1PVA A;  1BR1 B;  4FTG A;  1LVC D;  1J7R A;  2COL B;  1AUI B;  1IRJ A;  2DOQ A;  3BUX B;  1CDP A;  3VRP A;  4AOM A;  4YI9 A;  1IKU A;  2ZNE A;  4JPZ B;  3FIA A;  1CDM A;  1U5I B;  3DD4 A;  4I5L B;  1SL8 A;  1JFJ A;  2CTN A;  1AHR A;  1CTR A;  1BR4 B;  2BKI B;  1DJI A;  2LP2 A;  3CTN A;  1DJX A;  1UHJ A;  4P5O E;  1NIW A;  1V1F A;  1L2O C;  1BU3 A;  1UUS A;  1B8R A;  1AP4 A;  4P2Y B;  2KFF A;  4OCI A;  1OZO A;  3CR4 X;  3LK1 A;  2LVK A;  3F45 A;  4MLW A;  2AMI A;  5CSN A;  4YRU A;  4PAL A;  5KTY A;  1KQM B;  1BJF A;  4NDD A;  2L5X B;  1HT9 A;  2A4J A;  1F71 A;  2K2F A;  2MLF C;  1OOJ A;  5DKN A;  4PE1 A;  3TDZ A;  1PK0 D;  1KWO B;  2F2P A;  2LMV A;  4MZL A;  2H2K A;  1LA0 A;  2LLU A;  2L4I A;  2MBX A;  1F8H A;  4WQ3 A;  1ZMZ A;  3BUM B;  3BXK A;  5IBW A;  2LM5 A;  2K0J A;  3HCM A;  4GGN A;  2JTZ A;  2Y5I A;  2O60 A;  1NX3 A;  1S6I A;  2M0R A;  4R1E A;  3E3R A;  3SG2 A;  4USL A;  1AVS A;  2LHL A;  3H4S E;  5I2L A;  5J3X A;  2ISD A;  2LE9 B;  1K9P A;  3DF0 A;  2LAP A;  2MHH A;  1CMF A;  1ZAC A;  2BBM A;  4MRY A;  1SR6 B;  3CZT X;  2KI6 C;  4CFR A;  1UHI A;  1F4O A;  1C7V A;  1GGW A;  1WY9 A;  1S6C A;  3SG3 A;  2GGM A;  2WCB A;  5D7F A;  1SL7 A;  3CS1 A;  2ZN9 A;  1WDC B;  2LAN A;  3PAL A;  1YUS A;  1TIZ A;  2KI4 C;  3VRR A;  4F0Z B;  1AJ4 A;  1YVL A;  1ZFS A;  2M9G A;  1JF2 A;  1M39 A;  4DUQ A;  4C0K A;  1RJV A;  2P6B B;  1XVJ A;  2MRD A;  2NZ0 A;  2M7L A;  1A03 A;  1R6P A;  1S5G Y;  4PHK A;  3SIB A;  1B4C A;  1KQV A;  1QTX A;  3MSE B;  1QV0 A;  1DMO A;  4ORA B;  1FF1 A;  5TNC A;  4WQ2 A;  3O4Y A;  1CDN A;  2QPT A;  1K93 D;  1FBV A;  1OE9 B;  1C7W A;  2RGI A;  1K8U A;  3GOF A;  2GV5 A;  1WRZ A;  3TUY C;  1WLM A;  3FWC A;  4MBE A;  2KAY A;  1CB1 A;  3I5H C;  3JTD B;  3KHE A;  4UPG A;  1K90 D;  2I94 A;  4PHN A;  4YGB B;  1SPY A;  4N5X A;  2SCP A;  1JC2 A;  1LXF C;  2KBI A;  1TTX A;  1RFJ A;  3WNX B;  1AK8 A;  3FS7 A;  3OHM B;  3VGO A;  3EKH A;  2F33 A;  1CFC A;  2EGD A;  5I2Q A;  1TNQ A;  1IQ3 A;  1NCY A;  2CCM A;  2LCP A;  3RM1 A;  1JWD A;  5CPV A;  1IWQ A;  1UHH A;  4YGA A;  2MJW B;  3BUN B;  1QAS A;  4XJK A;  1UUR A;  4DS7 A;  2L0P A;  2MLE C;  4NDC A;  3I5I C;  2KYC A;  3CR2 A;  4ETO A;  1IQ5 A;  2MAZ A;  1NUB A;  1S3P A;  1KK8 C;  1MWN A;  2WCF A;  5D69 A;  4QJ4 B;  4E68 A;  2ZN8 A;  1S6J A;  3PN7 C;  3VRQ A;  2KGR A;  4AQI A;  4MSP A;  1QX2 A;  1B9A A;  4BY4 A;  2K7B A;  1NX1 A;  4IL1 A;  5BPJ A;  5KU1 A;  4MVF A;  2HPS A;  2KFH A;  2JNF A;  4GBA A;  2JTT A;  1KK7 Y;  2D8N A;  1S26 D;  1CFD A;  1JBA A;  1FPW A;  1J7O A;  3ICB A;  1YUR A;  1E8A A;  3O6B A;  3I5F C;  3CLN A;  4QJ3 B;  5ER5 A;  3WXA A;  4GNK B;  4M2P A;  3A8R A;  1YX8 A;  1UP5 A;  1XFY O;  2EC6 B;  2SAS A;  4HRE E;  1CLL A;  2KQ6 A;  1QIV A;  2CBL A;  1PSR A;  2R2I A;  2JZI A;  1M63 B;  2PAS A;  1MXL C;  1A2X A;  2JOJ A;  2PMY A;  1CMG A;  1OQP A;  2CT9 A;  2VRG A;  2OTG C;  3NSO A;  4TNC A;  1CLM A;  2BKH B;  1TNW A;  1JFK A;  3KEV A;  1CFP A;  2KSP A;  1KK7 Z;  4A4B A;  1WRL A;  3I5G C;  2Y4Q A;  5PAL A;  2E6W A;  3O78 A;  1GGZ A;  5B8I B;  2HET A;  1FW4 A;  4DIR A;  1M45 A;  3OB1 B;  3ZNI A;  2PRU A;  3FWB A;  5HLO A;  1OZS A;  1EG3 A;  1SY9 A;  3JVT C;  3NSL A;  4PE7 A;  4JWQ A;  4I5K A;  4YBH B;  2JXC A;  1JSA A;  1BLQ A;  3IF7 A;  1KQM C;  1IG5 A;  2I2R E;  3DVJ A;  3TS5 C;  4CID A;  1XFZ O;  2EHB A;  1N65 A;  3AKB A;  4GGF C;  3KO0 A;  4PHJ A;  1YX7 A;  1B7T Y;  4I5N B;  5AER A;  1J7Q A;  1W7J B;  2NCO A;  3D0Y A;  1EH2 A;  3NSK A;  1OMR A;  1WRK A;  4A4C A;  1ZOT B;  1NCX A;  4MZK A;  2KAX A;  1QVI Y;  3K21 A;  4L9M A;  1SRA A;  3TDU A;  5JOL A;  5DKQ A;  1FI5 A; 
#chains in the Genus database with same CATH topology
 1TNX A;  1XA5 A;  2Q4U A;  2LNK A;  2FOT A;  1IH0 A;  1XFU O;  1Y1U A;  1KFX S;  1LS8 A;  2LP3 A;  2OPO A;  2H8V A;  1PSB A;  3SIA A;  1A29 A;  2KLE A;  4JQ0 D;  1TUJ A;  1FI6 A;  3IQQ A;  1HQV A;  1SR6 C;  1TWO A;  3CGA A;  3HX4 A;  1B8L A;  1SCV A;  4GUK A;  1OMD A;  4XJK B;  2F2O A;  1M46 A;  4QJ5 B;  1F4Q A;  3GK1 A;  2JUL A;  5I2O A;  3TZ1 A;  2M49 B;  4N1G A;  1ZUZ A;  2LHI A;  1B7T Z;  2H61 C;  3PM8 A;  4HRG A;  2K2A A;  1MHO A;  3FE8 A;  3QME A;  1U5I A;  3Q8I A;  1A75 A;  1BOC A;  2M29 A;  2L2E A;  1X02 A;  1QVI Z;  3EK8 A;  2ERB A;  3DVM A;  1S1E A;  2JXL A;  1OOF A;  2NCP A;  1NCZ A;  2K7O A;  1D1O A;  5HYD A;  1GJY A;  1BG1 A;  2M97 A;  3TDI A;  1R2U A;  1DJW A;  3OX5 A;  1OMV A;  1NPQ A;  2KI4 B;  4MZJ A;  3WHU B;  2KFG A;  1QS7 A;  1B1G A;  5I8N A;  1MUX A;  1Q80 A;  1YR5 A;  2BL0 C;  2M8U A;  3RLZ A;  5CSJ A;  1KSM A;  2OS8 C;  1MQ1 A;  2JC2 A;  3M0W A;  4Q04 A;  1LIN A;  1J55 A;  4C0J A;  5EL2 A;  3K1E A;  1G8I A;  3OX6 A;  1BT6 A;  1SNL A;  2BCB A;  3SS5 A;  2ZND A;  3L47 A;  1K9U A;  2ZRS A;  3LL8 B;  4GGF A;  4DRW A;  1K94 A;  2KAV A;  1CM4 A;  2PAL A;  4ZCV A;  3EK4 A;  1DJZ A;  4GPL B;  3VB1 A;  1CKK A;  2O5G A;  1IJ5 A;  2LVI A;  3TUY B;  1H8B A;  4XYN A;  1K2H A;  3I5H B;  3AAJ A;  1C3Z A;  5K89 A;  2GGZ A;  2PSR A;  2KGB C;  1DF0 A;  1DJG A;  1UHK A;  1Y1A A;  4OZD A;  2Y1M A;  4DCK A;  1EG4 A;  1SCM C;  1V1G A;  1L7Z A;  1XK4 C;  4OV2 A;  1B47 A;  1H4B A;  1YRT B;  2FCE A;  4YGC B;  4MRX A;  1YVH A;  2NLN A;  3AKA A;  2KNE A;  1XFW O;  1GM0 A;  2AUC A;  2K8M B;  1RK9 A;  2KHN A;  2PVB A;  3UO9 A;  3DYE A;  1Y0V H;  5FYX A;  1J1D A;  4JD9 A;  4CPV A;  2BE4 A;  2JT8 A;  4ICB A;  3I5I B;  1F54 A;  1RTP 1;  2H61 A;  1ODB A;  1KK8 B;  2KI6 D;  3EKJ A;  1Y1X A;  2KQY A;  2LUC A;  3BOW A;  3PN7 B;  1ORG A;  2KDH A;  3VRN A;  1QLK A;  2IS9 A;  1QXP A;  2L98 A;  1QX5 B;  2JWW A;  3D0Y B;  3DVK A;  2LLT A;  2FJU B;  1TN4 A;  1YUT A;  2L51 A;  1MR8 A;  1A4P A;  1P28 A;  2L50 A;  1SW8 A;  1QJT A;  3PFV A;  1WLZ A;  3A4U B;  5HLV A;  1YRU B;  4U8D A;  3DF0 B;  2M7N A;  4PE0 A;  1AJ5 A;  5FI7 A;  3KPX A;  3NSI A;  5G08 A;  4PDZ A;  2LC5 A;  3NHI A;  2QAC A;  1KSO A;  3I5F B;  5DKR A;  3SJS A;  1SL9 A;  2LVV A;  3IQO A;  5GQQ C;  2G2B A;  3QRX A;  2F8P A;  4ORC B;  1M31 A;  1TCO B;  4MN0 A;  3PSR A;  1EXR A;  1XFV O;  4YI8 A;  1KFU S;  2K7C A;  3KF9 A;  1RWY A;  3EVV A;  4CFQ A;  4M2Q A;  1CNP A;  2WCM A;  2OTG B;  1J7P A;  1KFU L;  4OR9 B;  2M3W A;  1REC A;  3RZS A;  1A75 B;  4AQJ A;  3CYZ A;  4OVN F;  1K96 A;  1JUO A;  1L2O B;  1BMO A;  3I5G B;  4HRH A;  1N0Y A;  1EJ3 A;  2HF5 A;  1XK4 A;  3DVE A;  4GFT A;  1CDL A;  1PRW A;  5AFP A;  1KCY A;  1KWO C;  5CSI A;  2FCD A;  1K9K A;  2BE6 A;  2I7A A;  1EL4 A;  1UWO A;  1ALW A;  1XYD A;  1MF8 B;  1OOI X;  4INX A;  3JVT B;  3VRO A;  5AXI A;  4YGE B;  1PAL A;  1CFF A;  3O4X A;  1BOD A;  3LK0 A;  2M1K B;  1TOP A;  1DJH A;  2JT0 A;  3TS5 B;  1DTL A;  3GK4 X;  2JRF A;  1Y6W A;  2P71 A;  2JQ6 A;  3PM2 A;  2BBN A;  2WND A;  1LA3 A;  1KFX L;  1QIW A;  1SKT A;  3PJI A;  1G4Y R;  2E30 A;  1CM1 A;  2JPO A;  4BY5 A;  4MEW A;  1NYA A;  4CLN A;  3D10 A;  1GQM A;  1DF0 B;  2Y1N A;  5JJG A;  1VRK A;  4N1F A;  2TN4 A;  1WDC C;  2WCE A;  4NDB A;  2JT3 A;  2K61 A;  4WRI A;  3BUW B;  1IGV A;  5AAN A;  2K60 A;  4FQT A;  4PHM A;  4D1E A;  2ZFD A;  2V53 A;  1C07 A;  1OSA A;  1F55 A;  1QLS A;  3BQ3 A;  1SYM A;  2LUX A;  1QV1 A;  2KBM A;  2WC8 A;  2NXQ A;  2WCH A;  1W7I B;  4I5J A;  1NWD A;  4M2O A;  3N7H A;  1NX2 A;  3BOW B;  2K7D A;  3C1V A;  3OP0 A;  2JU0 A;  1CLB A;  4FQO A;  2F3Z A;  1BF5 A;  1XFX O;  3JTD C;  5F6T A;  3AAK A;  3SG7 A;  1TRF A;  2M1U A;  5ER4 X;  1SBJ A;  1TNP A;  2B1U A;  2BEC A;  3IVT A;  1B8C A;  2LV7 A;  5KSZ A;  1Z2C B;  2BL0 B;  3EK7 A;  4NQG A;  2HQW A;  1DGU A;  2AAO A;  3PAT A;  1K95 A;  1RRO A;  4ORB B;  1YUU A;  2OS8 B;  2KOT A;  2GTE A;  5I94 A;  3GK2 A;  2WOS A;  1DVI A;  1UHN A;  1SK6 D;  1MXE A;  1SMG A;  3CWG A;  3D73 A;  3SG4 A;  2LLS A;  1DJY A;  2I18 A;  1NSH A;  3B6X A;  3BUO B;  1JF0 A;  2CXJ A;  3NXA A;  3PLF B;  4PCW A;  4C0L A;  3BFH A;  2BCA A;  3EVR A;  2KYF A;  3CR5 X;  3S0E A;  5HKY A;  3OB2 B;  2F3Y A;  1J1E A;  1YTZ C;  3BYA A;  5CSF A;  5HKZ A;  2LMU A;  1S5G Z;  1DQE A;  2JPT A;  1TCF A;  2QEV A;  3R1P A;  3B88 A;  4ZCU A;  2CNP A;  1C3Y A;  2ZKM X;  1S36 A;  1SCM B;  2HQ8 A;  1OOH A;  2LMT A;  3EVU A;  2Q91 A;  5AEQ A;  3SG5 A;  1QX7 A;  2BCX A;  1PUL A;  3O2P A;  3S0F A;  2JNX A;  3S0B A;  2MA2 A;  3BFB A;  2YGU A;  1ALV A;  2EC6 C;  1IJ6 A;  2L4H A;  2ZRT A;  3OBV A;  1G33 A;  4GAO A;  4HSZ A;  4YGD B;  1NP8 A;  1N2D A;  1XO5 A;  3ZWH A;  1QAT A;  3LLE A;  3B86 A;  1F70 A;  1DT7 B;  1LKJ A;  2WOR A;  1PVB A;  4OKH A;  1TUZ A;  1DGV A;  3WHT B;  4INW A;  5HKW A;  3LCP C;  2LVJ A;  1NX0 A;  3SG6 A;  4PE4 A;  2G9B A;  1PVA A;  1BR1 B;  2WC5 A;  4FTG A;  1LVC D;  1J7R A;  2WCL A;  2COL B;  1AUI B;  1IRJ A;  2DOQ A;  3BUX B;  1CDP A;  3VRP A;  4AOM A;  3L4L A;  4YI9 A;  1IKU A;  2ZNE A;  4JPZ B;  3FIA A;  1CDM A;  1U5I B;  3DD4 A;  4I5L B;  1SL8 A;  3OGN A;  1JFJ A;  2CTN A;  1AHR A;  1CTR A;  1BR4 B;  2BKI B;  1DJI A;  2LP2 A;  3CTN A;  1DJX A;  1UHJ A;  2L2C A;  1NIW A;  4P5O E;  2BAP A;  1V1F A;  3SS4 A;  1L2O C;  1BU3 A;  3BJH A;  1UUS A;  1B8R A;  2QDI A;  1AP4 A;  4P2Y B;  1XFR A;  2KFF A;  4OCI A;  1OZO A;  3D75 A;  3S0D A;  3CR4 X;  3LK1 A;  2LVK A;  3F45 A;  4MLW A;  2AMI A;  5CSN A;  4YRU A;  4PAL A;  5KTY A;  1KQM B;  1BJF A;  4NDD A;  2L5X B;  1HT9 A;  2A4J A;  1F71 A;  2K2F A;  5FI6 A;  1W9Z A;  2MLF C;  1DEK A;  1OOJ A;  5DKN A;  4PE1 A;  3TDZ A;  1PK0 D;  1KWO B;  2F2P A;  2LMV A;  1DEL A;  4MZL A;  2H2K A;  1LA0 A;  2LLU A;  2L4I A;  2MBX A;  1F8H A;  4WQ3 A;  1ZMZ A;  3BUM B;  3BXK A;  5IBW A;  2LM5 A;  2K0J A;  3HCM A;  4GGN A;  2JTZ A;  2Y5I A;  2O60 A;  3CDN A;  1NX3 A;  1S6I A;  2M0R A;  4KYN A;  3R1V A;  4R1E A;  3E3R A;  3EG5 B;  3SG2 A;  4USL A;  1AVS A;  2LHL A;  3H4S E;  5I2L A;  5J3X A;  2ISD A;  2LE9 B;  3B7A A;  1K9P A;  2FJY A;  3DF0 A;  2LAP A;  2MHH A;  3D77 A;  1CMF A;  1ZAC A;  2BBM A;  4MRY A;  1SR6 B;  3CZT X;  2KI6 C;  4CFR A;  1UHI A;  3NHT A;  1F4O A;  1T14 A;  1IIO A;  1C7V A;  1GGW A;  1WY9 A;  3DXL A;  1S6C A;  3SG3 A;  2GGM A;  2WCB A;  5D7F A;  1SL7 A;  3CS1 A;  2QEB A;  2ZN9 A;  1WDC B;  2LAN A;  3PAL A;  1YUS A;  1TIZ A;  2KI4 C;  3VRR A;  3CZ2 A;  4F0Z B;  1AJ4 A;  1YVL A;  1ZFS A;  2M9G A;  1JF2 A;  1M39 A;  4DUQ A;  5HL1 A;  4C0K A;  1RJV A;  2P6B B;  5DIC A;  1XVJ A;  2MRD A;  2NZ0 A;  2M7L A;  1A03 A;  1R6P A;  1S5G Y;  4PHK A;  3SIB A;  1B4C A;  1KQV A;  1QTX A;  3MSE B;  1QV0 A;  2QEO A;  1DMO A;  4ORA B;  1FF1 A;  5TNC A;  2P70 A;  4WQ2 A;  3O4Y A;  1CDN A;  2QPT A;  1K93 D;  3D76 A;  1FBV A;  1SSE B;  1OE9 B;  1C7W A;  2RGI A;  1K8U A;  2PYQ A;  2GV5 A;  3GOF A;  1WRZ A;  3TUY C;  1WLM A;  3FWC A;  4MBE A;  2KAY A;  1CB1 A;  3I5H C;  3JTD B;  3KHE A;  4IJ7 A;  4UPG A;  1K90 D;  2I94 A;  4PHN A;  4YGB B;  3V2L A;  1SPY A;  4N5X A;  2SCP A;  1JC2 A;  1LXF C;  2KBI A;  2WCJ A;  1TTX A;  1RFJ A;  3WNX B;  1DC1 A;  1AK8 A;  3FS7 A;  3OHM B;  4PT1 A;  3VGO A;  3UNW A;  3EKH A;  3DY9 A;  1OW4 A;  3R1O A;  2F33 A;  2KLD A;  2EGD A;  5D3O A;  1TNQ A;  5I2Q A;  1IQ3 A;  1CFC A;  1NCY A;  2CCM A;  2LCP A;  3RM1 A;  1JWD A;  5CPV A;  1IWQ A;  1UHH A;  4YGA A;  2MJW B;  3BUN B;  1QAS A;  4XJK A;  1UUR A;  4DS7 A;  2BNX A;  2L0P A;  2MLE C;  4NDC A;  3I5I C;  2KYC A;  3CR2 A;  4ETO A;  1IQ5 A;  2MAZ A;  1NUB A;  1S3P A;  1KK8 C;  1MWN A;  2WCF A;  5D69 A;  4QJ4 B;  4E68 A;  2ZN8 A;  1S6J A;  3PN7 C;  3VRQ A;  2KGR A;  4AQI A;  4MSP A;  1QX2 A;  1B9A A;  3NGV A;  4BY4 A;  2K7B A;  1NX1 A;  1OOG A;  4IL1 A;  5BPJ A;  5KU1 A;  4MVF A;  2HPS A;  2KFH A;  2JNF A;  3R72 A;  4GBA A;  4JKT A;  2JTT A;  1KK7 Y;  2D8N A;  1S26 D;  2L5Y A;  1CFD A;  1QWV A;  1JBA A;  1FPW A;  1J7O A;  3ICB A;  5FI2 A;  1YUR A;  3CAB A;  2KPH A;  1E8A A;  3O6B A;  3D74 A;  3I5F C;  3CLN A;  4QJ3 B;  5ER5 A;  3WXA A;  4GNK B;  4M2P A;  4F7F A;  3A8R A;  1YX8 A;  1UP5 A;  1XFY O;  2EC6 B;  1Z4H A;  2SAS A;  4HRE E;  1CLL A;  2KQ6 A;  1QIV A;  2CBL A;  1PSR A;  2R2I A;  2JZI A;  1M63 B;  2PQL A;  2PAS A;  3S0A A;  1MXL C;  1A2X A;  2JOJ A;  2PMY A;  1CMG A;  1OQP A;  2CT9 A;  2VRG A;  2OTG C;  2WCK A;  3D78 A;  3NSO A;  1CLM A;  2BKH B;  3BFA A;  1TNW A;  4TNC A;  3CZ1 A;  1JFK A;  3KEV A;  1CFP A;  2KSP A;  1KK7 Z;  4A4B A;  1WRL A;  3I5G C;  2Y4Q A;  5PAL A;  2E6W A;  3DZT A;  3O78 A;  1GGZ A;  5B8I B;  2HET A;  1FW4 A;  4DIR A;  3S0G A;  1M45 A;  3OB1 B;  3ZNI A;  2PRU A;  3FWB A;  3CZ0 A;  1OZS A;  1EG3 A;  3FE9 A;  1SY9 A;  3JVT C;  3NSL A;  4PE7 A;  5HLO A;  4JWQ A;  4I5K A;  4YBH B;  2JXC A;  1JSA A;  3SS3 A;  1BLQ A;  3IF7 A;  1KQM C;  1IG5 A;  2I2R E;  3DVJ A;  3TS5 C;  4CID A;  1XFZ O;  2EHB A;  1N65 A;  3AKB A;  2QEH A;  4GGF C;  3KO0 A;  4PHJ A;  1YX7 A;  1B7T Y;  4I5N B;  5AER A;  1J7Q A;  1W7J B;  2NCO A;  3L4A A;  3D0Y A;  1EH2 A;  3NSK A;  1OMR A;  1WRK A;  4A4C A;  1ZOT B;  1NCX A;  3FE6 A;  2KAX A;  2WC6 A;  1QVI Y;  3K21 A;  4MZK A;  4L9M A;  1SRA A;  3TDU A;  5JOL A;  5DKQ A;  3B87 A;  1FI5 A; 
#chains in the Genus database with same CATH homology
 1TNX A;  1XA5 A;  2Q4U A;  2LNK A;  2FOT A;  1IH0 A;  1XFU O;  1Y1U A;  1KFX S;  2LP3 A;  2OPO A;  1PSB A;  3SIA A;  1A29 A;  4JQ0 D;  1FI6 A;  3IQQ A;  1HQV A;  1SR6 C;  3HX4 A;  3CGA A;  1B8L A;  1SCV A;  4GUK A;  1OMD A;  4XJK B;  2F2O A;  1M46 A;  4QJ5 B;  1F4Q A;  3GK1 A;  2JUL A;  5I2O A;  3TZ1 A;  2M49 B;  4N1G A;  1ZUZ A;  2LHI A;  1B7T Z;  2H61 C;  3PM8 A;  4HRG A;  2K2A A;  1MHO A;  1U5I A;  1A75 A;  1BOC A;  2M29 A;  2L2E A;  1X02 A;  1QVI Z;  3EK8 A;  3DVM A;  1S1E A;  2JXL A;  2NCP A;  1NCZ A;  2K7O A;  1D1O A;  5HYD A;  1GJY A;  1BG1 A;  2M97 A;  3TDI A;  1R2U A;  1DJW A;  3OX5 A;  1OMV A;  1NPQ A;  2KI4 B;  4MZJ A;  3WHU B;  2KFG A;  1QS7 A;  1B1G A;  5I8N A;  1MUX A;  1Q80 A;  1YR5 A;  2BL0 C;  2M8U A;  3RLZ A;  5CSJ A;  1KSM A;  2OS8 C;  1MQ1 A;  2JC2 A;  3M0W A;  4Q04 A;  1LIN A;  1J55 A;  4C0J A;  1G8I A;  3OX6 A;  1BT6 A;  1SNL A;  2BCB A;  2ZND A;  1K9U A;  2ZRS A;  3LL8 B;  4GGF A;  4DRW A;  1K94 A;  2KAV A;  1CM4 A;  2PAL A;  4ZCV A;  3EK4 A;  1DJZ A;  4GPL B;  1CKK A;  2O5G A;  1IJ5 A;  2LVI A;  3TUY B;  1H8B A;  4XYN A;  1K2H A;  3I5H B;  3AAJ A;  5K89 A;  2GGZ A;  2PSR A;  2KGB C;  1DF0 A;  1DJG A;  1UHK A;  1Y1A A;  2Y1M A;  4DCK A;  1EG4 A;  1SCM C;  1V1G A;  1L7Z A;  1XK4 C;  4OV2 A;  1B47 A;  1H4B A;  1YRT B;  2FCE A;  4YGC B;  4MRX A;  1YVH A;  2NLN A;  3AKA A;  2KNE A;  1XFW O;  2AUC A;  2K8M B;  1RK9 A;  2KHN A;  2PVB A;  1Y0V H;  5FYX A;  1J1D A;  4CPV A;  2BE4 A;  2JT8 A;  4ICB A;  3I5I B;  1F54 A;  1RTP 1;  2H61 A;  1ODB A;  1KK8 B;  2KI6 D;  3EKJ A;  1Y1X A;  2KQY A;  2LUC A;  3BOW A;  3PN7 B;  2KDH A;  3VRN A;  1QLK A;  2IS9 A;  1QXP A;  2L98 A;  1QX5 B;  2JWW A;  3D0Y B;  3DVK A;  2LLT A;  2FJU B;  1TN4 A;  1YUT A;  2L51 A;  1MR8 A;  1A4P A;  2L50 A;  1SW8 A;  1QJT A;  3PFV A;  1WLZ A;  3A4U B;  5HLV A;  1YRU B;  4U8D A;  3DF0 B;  2M7N A;  4PE0 A;  1AJ5 A;  3KPX A;  3NSI A;  5G08 A;  4PDZ A;  2LC5 A;  2QAC A;  1KSO A;  3I5F B;  5DKR A;  3SJS A;  1SL9 A;  2LVV A;  3IQO A;  5GQQ C;  2G2B A;  3QRX A;  2F8P A;  4ORC B;  1M31 A;  1TCO B;  4MN0 A;  3PSR A;  1EXR A;  1XFV O;  4YI8 A;  1KFU S;  2K7C A;  3KF9 A;  1RWY A;  3EVV A;  4CFQ A;  4M2Q A;  1CNP A;  2OTG B;  1J7P A;  1KFU L;  4OR9 B;  2M3W A;  1REC A;  1A75 B;  4AQJ A;  4OVN F;  1K96 A;  1JUO A;  1L2O B;  1BMO A;  3I5G B;  4HRH A;  1N0Y A;  1EJ3 A;  2HF5 A;  1XK4 A;  3DVE A;  4GFT A;  1CDL A;  1PRW A;  5AFP A;  1KCY A;  1KWO C;  5CSI A;  2FCD A;  1K9K A;  2BE6 A;  2I7A A;  1EL4 A;  1UWO A;  1ALW A;  1XYD A;  1MF8 B;  3VRO A;  3JVT B;  5AXI A;  4YGE B;  1PAL A;  1CFF A;  1BOD A;  3LK0 A;  2M1K B;  1TOP A;  1DJH A;  2JT0 A;  3TS5 B;  1DTL A;  3GK4 X;  2JRF A;  1Y6W A;  2JQ6 A;  2BBN A;  2WND A;  1LA3 A;  1KFX L;  1QIW A;  1SKT A;  1G4Y R;  2E30 A;  1CM1 A;  4BY5 A;  4MEW A;  1NYA A;  4CLN A;  3D10 A;  1GQM A;  1DF0 B;  2Y1N A;  5JJG A;  1VRK A;  4N1F A;  2TN4 A;  1WDC C;  2WCE A;  4NDB A;  2JT3 A;  2K61 A;  4WRI A;  3BUW B;  1IGV A;  5AAN A;  4D1E A;  4PHM A;  2ZFD A;  2V53 A;  1C07 A;  1OSA A;  1F55 A;  1QLS A;  3BQ3 A;  1SYM A;  2LUX A;  1QV1 A;  2KBM A;  2WC8 A;  2NXQ A;  4I5J A;  1W7I B;  4M2O A;  1NWD A;  1NX2 A;  3BOW B;  2K7D A;  3C1V A;  3OP0 A;  2JU0 A;  1CLB A;  4FQO A;  2F3Z A;  1BF5 A;  1XFX O;  3JTD C;  5F6T A;  3AAK A;  3SG7 A;  1TRF A;  2M1U A;  5ER4 X;  1SBJ A;  1TNP A;  2B1U A;  2BEC A;  1B8C A;  2LV7 A;  5KSZ A;  2BL0 B;  4NQG A;  3EK7 A;  2HQW A;  1DGU A;  2AAO A;  3PAT A;  1K95 A;  1RRO A;  4ORB B;  1YUU A;  2OS8 B;  2KOT A;  3GK2 A;  2WOS A;  1DVI A;  1UHN A;  1SK6 D;  1MXE A;  1SMG A;  3CWG A;  3SG4 A;  2LLS A;  1DJY A;  2I18 A;  1NSH A;  3BUO B;  3PLF B;  1JF0 A;  2CXJ A;  3NXA A;  4PCW A;  4C0L A;  2BCA A;  3EVR A;  2KYF A;  3CR5 X;  5HKY A;  3OB2 B;  2F3Y A;  1J1E A;  1YTZ C;  3BYA A;  5CSF A;  5HKZ A;  2LMU A;  1S5G Z;  2JPT A;  1TCF A;  4ZCU A;  2CNP A;  2ZKM X;  1S36 A;  1SCM B;  2HQ8 A;  2LMT A;  3EVU A;  2Q91 A;  5AEQ A;  3SG5 A;  1QX7 A;  2BCX A;  1PUL A;  3O2P A;  2JNX A;  2MA2 A;  4GAO A;  2ZRT A;  1ALV A;  2EC6 C;  1IJ6 A;  2L4H A;  1G33 A;  4HSZ A;  4YGD B;  1NP8 A;  1N2D A;  1XO5 A;  3ZWH A;  1QAT A;  3LLE A;  1F70 A;  1DT7 B;  1LKJ A;  2WOR A;  1PVB A;  4OKH A;  1DGV A;  3WHT B;  5HKW A;  3LCP C;  2LVJ A;  1NX0 A;  3SG6 A;  4PE4 A;  2G9B A;  1PVA A;  1BR1 B;  4FTG A;  1LVC D;  1J7R A;  2COL B;  1AUI B;  1IRJ A;  2DOQ A;  3BUX B;  1CDP A;  3VRP A;  4AOM A;  4YI9 A;  1IKU A;  2ZNE A;  4JPZ B;  3FIA A;  1CDM A;  1U5I B;  3DD4 A;  4I5L B;  1SL8 A;  1JFJ A;  2CTN A;  1AHR A;  1CTR A;  1BR4 B;  2BKI B;  1DJI A;  2LP2 A;  3CTN A;  1DJX A;  1UHJ A;  4P5O E;  1NIW A;  1V1F A;  1L2O C;  1BU3 A;  1UUS A;  1B8R A;  1AP4 A;  4P2Y B;  2KFF A;  4OCI A;  1OZO A;  3CR4 X;  3LK1 A;  2LVK A;  3F45 A;  4MLW A;  2AMI A;  5CSN A;  4YRU A;  4PAL A;  5KTY A;  1KQM B;  1BJF A;  4NDD A;  2L5X B;  1HT9 A;  2A4J A;  1F71 A;  2K2F A;  2MLF C;  1OOJ A;  5DKN A;  4PE1 A;  3TDZ A;  1PK0 D;  1KWO B;  2F2P A;  2LMV A;  4MZL A;  2H2K A;  1LA0 A;  2LLU A;  2L4I A;  2MBX A;  1F8H A;  4WQ3 A;  1ZMZ A;  3BUM B;  3BXK A;  5IBW A;  2LM5 A;  2K0J A;  3HCM A;  4GGN A;  2JTZ A;  2Y5I A;  2O60 A;  1NX3 A;  1S6I A;  2M0R A;  4R1E A;  3E3R A;  3SG2 A;  4USL A;  1AVS A;  2LHL A;  3H4S E;  5I2L A;  5J3X A;  2ISD A;  2LE9 B;  1K9P A;  3DF0 A;  2LAP A;  2MHH A;  1CMF A;  1ZAC A;  2BBM A;  4MRY A;  1SR6 B;  3CZT X;  2KI6 C;  4CFR A;  1UHI A;  1F4O A;  1C7V A;  1GGW A;  1WY9 A;  1S6C A;  3SG3 A;  2GGM A;  2WCB A;  5D7F A;  1SL7 A;  3CS1 A;  2ZN9 A;  1WDC B;  2LAN A;  3PAL A;  1YUS A;  1TIZ A;  2KI4 C;  3VRR A;  4F0Z B;  1AJ4 A;  1YVL A;  1ZFS A;  2M9G A;  1JF2 A;  1M39 A;  4DUQ A;  4C0K A;  1RJV A;  2P6B B;  1XVJ A;  2MRD A;  2NZ0 A;  2M7L A;  1A03 A;  1R6P A;  1S5G Y;  4PHK A;  3SIB A;  1B4C A;  1KQV A;  1QTX A;  3MSE B;  1QV0 A;  1DMO A;  4ORA B;  1FF1 A;  5TNC A;  4WQ2 A;  3O4Y A;  1CDN A;  2QPT A;  1K93 D;  1FBV A;  1OE9 B;  1C7W A;  2RGI A;  1K8U A;  3GOF A;  2GV5 A;  1WRZ A;  3TUY C;  1WLM A;  3FWC A;  4MBE A;  2KAY A;  1CB1 A;  3I5H C;  3JTD B;  3KHE A;  4UPG A;  1K90 D;  2I94 A;  4PHN A;  4YGB B;  1SPY A;  4N5X A;  2SCP A;  1JC2 A;  1LXF C;  2KBI A;  1TTX A;  1RFJ A;  3WNX B;  1AK8 A;  3FS7 A;  3OHM B;  3VGO A;  3EKH A;  2F33 A;  1CFC A;  2EGD A;  5I2Q A;  1TNQ A;  1IQ3 A;  1NCY A;  2CCM A;  2LCP A;  3RM1 A;  1JWD A;  5CPV A;  1IWQ A;  1UHH A;  4YGA A;  2MJW B;  3BUN B;  1QAS A;  4XJK A;  1UUR A;  4DS7 A;  2L0P A;  2MLE C;  4NDC A;  3I5I C;  2KYC A;  3CR2 A;  4ETO A;  1IQ5 A;  2MAZ A;  1NUB A;  1S3P A;  1KK8 C;  1MWN A;  2WCF A;  5D69 A;  4QJ4 B;  4E68 A;  2ZN8 A;  1S6J A;  3PN7 C;  3VRQ A;  2KGR A;  4AQI A;  4MSP A;  1QX2 A;  1B9A A;  4BY4 A;  2K7B A;  1NX1 A;  4IL1 A;  5BPJ A;  5KU1 A;  4MVF A;  2HPS A;  2KFH A;  2JNF A;  4GBA A;  2JTT A;  1KK7 Y;  2D8N A;  1S26 D;  1CFD A;  1JBA A;  1FPW A;  1J7O A;  3ICB A;  1YUR A;  1E8A A;  3O6B A;  3I5F C;  3CLN A;  4QJ3 B;  5ER5 A;  3WXA A;  4GNK B;  4M2P A;  3A8R A;  1YX8 A;  1UP5 A;  1XFY O;  2EC6 B;  2SAS A;  4HRE E;  1CLL A;  2KQ6 A;  1QIV A;  2CBL A;  1PSR A;  2R2I A;  2JZI A;  1M63 B;  2PAS A;  1MXL C;  1A2X A;  2JOJ A;  2PMY A;  1CMG A;  1OQP A;  2CT9 A;  2VRG A;  2OTG C;  3NSO A;  4TNC A;  1CLM A;  2BKH B;  1TNW A;  1JFK A;  3KEV A;  1CFP A;  2KSP A;  1KK7 Z;  4A4B A;  1WRL A;  3I5G C;  2Y4Q A;  5PAL A;  2E6W A;  3O78 A;  1GGZ A;  5B8I B;  2HET A;  1FW4 A;  4DIR A;  1M45 A;  3OB1 B;  3ZNI A;  2PRU A;  3FWB A;  5HLO A;  1OZS A;  1EG3 A;  1SY9 A;  3JVT C;  3NSL A;  4PE7 A;  4JWQ A;  4I5K A;  4YBH B;  2JXC A;  1JSA A;  1BLQ A;  3IF7 A;  1KQM C;  1IG5 A;  2I2R E;  3DVJ A;  3TS5 C;  4CID A;  1XFZ O;  2EHB A;  1N65 A;  3AKB A;  4GGF C;  3KO0 A;  4PHJ A;  1YX7 A;  1B7T Y;  4I5N B;  5AER A;  1J7Q A;  1W7J B;  2NCO A;  3D0Y A;  1EH2 A;  3NSK A;  1OMR A;  1WRK A;  4A4C A;  1ZOT B;  1NCX A;  4MZK A;  2KAX A;  1QVI Y;  3K21 A;  4L9M A;  1SRA A;  3TDU A;  5JOL A;  5DKQ A;  1FI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...