1F8HA

Structure of the second eps15 homology domain of human eps15 in complex with ptgssstnpfr
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR SUBSTRATE 15
publication title Molecular mechanism of NPF recognition by EH domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2000-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f8hA00
1KQVA 3KHEA 2BL0B 3SG5A 1QVIY 2KI4B 2LAPA 2NLNA 2BCBA 3WHUB 1CMGA 1RK9A 2M7LA 1KK8C 2KFGA 4N1GA 1NX0A 2JTTA 1XFVO 2ZFDA 2KAVA 2NXQA 2F3YA 2Q91A 3WHTB 1EH2A 2F3ZA 1YUSA 1XVJA 2ISDA 2VRGA 1OE9B 1ALVA 1OSAA 5CSFA 1IRJA 1WDCC 1J7RA 3A4UB 5KTYA 3OHMB 4E68A 1NX2A 1CDMA 1RJVA 2LUXA 1KSOA 3K21A 4XJKB 1S1EA 1KQMC 3LK0A 4AQIA 1GJYA 1X02A 1A75A 1AJ4A 1RTP1 2Q4UA 2BL0C 1MF8B 1PRWA 1QTXA 2F2OA 4WRIA 2KI4C 3PLFB 5ER4X 3NSKA 3BOWB 2Y5IA 1DMOA 3FWCA 1FI5A 4PE0A 3SG6A 3EK8A 1SMGA 2M0RA 3CR2A 3SG3A 3O2PA 1TTXA 3I5GB 3SG2A 2KQYA 3C1VA 3HCMA 1J7QA 1SL9A 3LL8B 1OZSA 3PFVA 2JNXA 1ALWA 1QLSA 2JZIA 1JBAA 1DF0A 1U5IA 1V1GA 4ZCVA 5CSJA 1L7ZA 3CR5X 4HRGA 5J3XA 5AFPA 1S36A 1LVCD 5I2QA 2Y4QA 2ZRSA 3IF7A 3GK1A 4OVNF 1JWDA 5AERA 1W7JB 1DJXA 4DIRA 1WY9A 4HSZA 2K2AA 2LHIA 2ZNEA 2PSRA 2P6BB 2BECA 3EKJA 1SYMA 2EC6B 2I18A 4GGFC 1QXPA 1LKJA 2JT3A 1B8CA 1CFCA 2L4IA 2KBMA 3O78A 2R2IA 1B4CA 2KDHA 1SR6B 3NSLA 4HRHA 5CSIA 2M29A 3A8RA 5HKZA 2GGZA 1F55A 3TDIA 1OOJA 2LVKA 2BBNA 1DJWA 1AK8A 2LMVA 2HQWA 3EK4A 4PE7A 2LP2A 2KGRA 1DJZA 1LA3A 1NIWA 4MZLA 2L51A 1J1EA 3OB2B 1SL7A 1YTZC 2H2KA 2JT8A 1Q80A 4A4CA 1MUXA 2EC6C 1QJTA 3CGAA 1SNLA 1FBVA 1QIWA 1RROA 1TNWA 1UP5A 5F6TA 2LP3A 1SR6C 2OS8B 4D1EA 1JFJA 4ICBA 2K2FA 1BMOA 1NP8A 1K9UA 3D10A 1TNPA 1QS7A 3TS5B 1A29A 4QJ3B 4YGBB 4ORAB 2CTNA 5TNCA 2SASA 2DOQA 1BU3A 1IH0A 4GBAA 3AAKA 4JQ0D 1A75B 1R2UA 1PSRA 3OX5A 4YGCB 3EVVA 2LVIA 4JPZB 1B1GA 1TCFA 2QACA 1YURA 3ZNIA 2OS8C 4XYNA 2MAZA 1AJ5A 1KWOC 2GGMA 2JXLA 1PULA 3TS5C 4YGEB 3TDUA 1QX2A 2JC2A 2LVVA 4GGNA 3PALA 2L4HA 3SJSA 4I5KA 1RWYA 2TN4A 3FS7A 1A2XA 2F8PA 2H61A 4MZJA 4PE1A 1OZOA 5GQQC 1EG4A 1XFZO 1SL8A 3VRPA 1DF0B 1U5IB 1K95A 3FIAA 3WXAA 1MR8A 1NWDA 2LV7A 1F71A 1S3PA 1CLBA 4FTGA 5D69A 4L9MA 1M63B 2COLB 1CM4A 1LXFC 5KU1A 1SW8A 4Q04A 5HLOA 1DJGA 3CZTX 1WRKA 3GOFA 4USLA 2LNKA 2FOTA 4JWQA 3DVJA 3LLEA 1XFUO 1NCXA 1BOCA 2ZN9A 1CNPA 1EL4A 1K90D 1M46A 2KYFA 1S6IA 4IL1A 2KGBC 1NCYA 4QJ4B 1XYDA 3NXAA 1DJIA 2I7AA 1KK7Y 2MBXA 4DUQA 3VGOA 2JU0A 1UHNA 4NDBA 1XA5A 2OTGB 2KHNA 3ZWHA 5HYDA 1PSBA 4PALA 4PHKA 3O4YA 1IKUA 4MBEA 3SG4A 1BR1B 1S5GZ 3DVEA 1UHHA 2L98A 4MVFA 3KPXA 1B7TZ 5FYXA 2LLSA 2NCOA 4P5OE 1ZOTB 5HLVA 2MLFC 2WC8A 2OPOA 1J1DA 2L50A 2AUCA 2M97A 1GQMA 1YRUB 2CXJA 2BCAA 2EHBA 1F4QA 4GFTA 2LMUA 3BUWB 3EK7A 4MRXA 3VRRA 2BBMA 2OTGC 1EG3A 2JULA 3DF0A 1JSAA 1B8RA 4BY5A 4I5JA 1R6PA 1YRTB 2ZN8A 3DVKA 4NDCA 4HREE 1K2HA 2F2PA 1BJFA 5G08A 1IJ6A 1TN4A 3FWBA 2LMTA 2CNPA 2NZ0A 4YI9A 1XFWO 1G33A 5DKNA 2EGDA 4BY4A 1AVSA 2FJUB 2HF5A 2WCFA 1S5GY 4NDDA 5I2OA 1DT7B 1NUBA 4MRYA 1JF2A 2Y1NA 1NSHA 1Y0VH 1Y1XA 1OMDA 1DJYA 4ETOA 1JC2A 1D1OA 2JTZA 1CM1A 2LLUA 5D7FA 1J55A 1MHOA 3SIBA 1DGUA 3BUOB 1WLMA 2LCPA 5HKWA 1F4OA 3PSRA 3LK1A 3DD4A 4FQOA 2K61A 3VRQA 3IQOA 1H8BA 3QRXA 3MSEB 4C0JA 2KAXA 4AOMA 3HX4A 1NPQA 1WRZA 1QX7A 2WNDA 4OKHA 5I2LA 1UHJA 4PCWA 5KSZA 3EVRA 2AAOA 3JVTB 1FPWA 4NQGA 2M9GA 1Y1AA 3WNXB 2H61C 1KWOB 2K7CA 2Y1MA 2E30A 1CDLA 1CDPA 1YR5A 1L2OB 2G2BA 1TCOB 1IQ3A 1CLLA 1CLMA 1YX7A 3D0YA 1G8IA 2L5XB 1XK4A 1XFXO 2JPTA 1QIVA 4DS7A 2ZNDA 4TNCA 2BKHB 2O60A 1TNQA 2B1UA 3I5FB 3I5HB 1UURA 3PN7B 1C7VA 2WOSA 3OB1B 4R1EA 3JVTC 1J7OA 1OQPA 1YX8A 2KOTA 1XO5A 3DVMA 3KO0A 3NSIA 1NCZA 2LUCA 4WQ3A 2I2RE 1L2OC 4ORCB 1BF5A 2ZRTA 1DTLA 5PALA 1J7PA 1NX1A 1KFUS 1SBJA 4YGDB 1B9AA 3AKAA 2RGIA 1F54A 1FW4A 2KQ6A 2BKIB 1N0YA 2MLEC 2FCEA 4PHMA 3TDZA 2KAYA 4QJ5B 3RM1A 3GK4X 1MXEA 3DF0B 3I5FC 1FF1A 4GUKA 3I5HC 5DKQA 2BE4A 3PN7C 3EKHA 3LCPC 1TOPA 2NCPA 3CWGA 4AQJA 2HQ8A 1GGWA 2KBIA 4U8DA 3ICBA 3H4SE 1E8AA 2FCDA 1KCYA 1TIZA 5I8NA 3M0WA 4M2OA 1K96A 1DGVA 1RECA 5B8IB 1SRAA 1AHRA 1BG1A 2K7DA 1CKKA 4C0LA 2KNEA 3AKBA 2D8NA 2K7BA 4MLWA 2WCEA 3TUYB 2PMYA 5K89A 1BT6A 2KYCA 4A4BA 1TNXA 4I5NB 1VRKA 1CFPA 4PHNA 1SY9A 2JQ6A 2LVJA 1QASA 1IGVA 4GNKB 1WRLA 2KFHA 2ZKMX 1SKTA 1AP4A 1DJHA 2K7OA 1JF0A 1ZMZA 2CCMA 2PALA 2JRFA 2AMIA 1YVLA 1KFUL 1MWNA 2M8UA 5CPVA 3TUYC 1ZACA 1KFXS 1B47A 1XFYO 3PATA 1Y6WA 5ER5A 3OX6A 1M39A 2MRDA 1UHKA 3KEVA 2CBLA 1S6CA 3D0YB 2IS9A 4CFQA 2K8MB 4P2YB 5JOLA 3KF9A 4GAOA 4CLNA 1K8UA 3BYAA 2M49B 3I5IB 1B8LA 1PK0D 4CFRA 1RFJA 3AAJA 4YI8A 1YVHA 4MSPA 1C07A 1UHIA 1KSMA 1SCVA 1K93D 1UWOA 4YRUA 4ORBB 2JOJA 4PE4A 3TZ1A 1A4PA 2F33A 2JWWA 1QV1A 3CS1A 1JFKA 3E3RA 4OR9B 1N2DA 3SIAA 2K0JA 2JXCA 1B7TY 1XK4C 2LE9B 1NX3A 1K94A 1LINA 1V1FA 5HKYA 1MQ1A 3I5IC 4GPLB 1QLKA 1MXLC 5CSNA 1QATA 2BCXA 1PALA 1ZFSA 4M2QA 1ZUZA 4I5LB 5AEQA 4PHJA 4UPGA 2MJWB 1IG5A 1K9KA 1OMRA 2MHHA 2V53A 3VROA 2LANA 3BUNB 3I5GC 1FI6A 2PASA 3CTNA 3BUXB 1EJ3A 2HETA 1CFFA 1CTRA 1CMFA 1Y1UA 4YBHB 1WLZA 1IJ5A 3NSOA 1CB1A 2LM5A 1KFXL 2KFFA 1F70A 4CPVA 4XJKA 1F8HA 5AXIA 1HT9A 2JNFA 1G4YR 4MN0A 4F0ZB 3RLZA 1NYAA 2BE6A 2KI6C 5AANA 3BOWA 2I94A 1HQVA 2LC5A 1PVBA 1CFDA 1LA0A 4OV2A 1UUSA 1EXRA 4DRWA 1AUIB 5BPJA 3O6BA 1PVAA 3CLNA 3JTDB 3GK2A 4GGFA 1OMVA 1DVIA 1H4BA 2M7NA 2WORA 5JJGA 4N5XA 2L0PA 1BODA 1TRFA 4M2PA 1K9PA 4DCKA 2M1UA 4ZCUA 5IBWA 4MZKA 2M1KB 4PDZA 2GV5A 2M3WA 4N1FA 1JUOA 2A4JA 1CDNA 4WQ2A 1BR4B 1QVIZ 1S6JA 2QPTA 3BQ3A 1GGZA 2O5GA 5DKRA 1C7WA 2LLTA 1SK6D 2CT9A 3EVUA 3PM8A 3JTDC 1SCMB 3CR4X 1YUUA 1M45A 4CIDA 2MA2A 3VRNA 2WCBA 1M31A 1W7IB 4OCIA 4MEWA 1KK8B 1KK7Z 3F45A 3SG7A 2G9BA 2L2EA 3IQQA 1QX5B 1IQ5A 1SPYA 2LHLA 2HPSA 4YGAA 1YUTA 2JT0A 2PRUA 3BXKA 1BLQA 2PVBA 1ODBA 1IWQA 2E6WA 1N65A 1WDCB 3BUMB 2KSPA 1A03A 2KI6D 1KQMB 1SCMC 1QV0A 3OP0A 1S26D 2SCPA 4C0KA
chains in the Genus database with same CATH superfamily
1KQVA 3KHEA 2BL0B 4INXA 3DYEA 1QVIY 3SG5A 2KI4B 2LAPA 2NLNA 2BCBA 2GTEA 2WCLA 3WHUB 1CMGA 1RK9A 2M7LA 1KK8C 2KFGA 4N1GA 1NX0A 2JTTA 1XFVO 2ZFDA 2KAVA 2NXQA 2F3YA 2Q91A 3WHTB 1EH2A 2F3ZA 1YUSA 1XVJA 2ISDA 2VRGA 1OE9B 1ALVA 1OSAA 5CSFA 1IRJA 1WDCC 1J7RA 3A4UB 3B7AA 5KTYA 3OHMB 4E68A 1NX2A 1CDMA 1RJVA 2LUXA 1KSOA 3K21A 4XJKB 1S1EA 1KQMC 3LK0A 4AQIA 1GJYA 1X02A 1A75A 1AJ4A 1RTP1 2Q4UA 2BL0C 1MF8B 1PRWA 1QTXA 2F2OA 4WRIA 2KI4C 3PLFB 5ER4X 3NSKA 3BOWB 2Y5IA 1DMOA 3FWCA 1FI5A 4PE0A 3SG6A 3EK8A 1SMGA 3S0BA 2M0RA 3CR2A 3SG3A 3O2PA 3UO9A 1TTXA 3I5GB 3SG2A 2KQYA 3C1VA 3HCMA 1J7QA 5I94A 1SL9A 3LL8B 1OZSA 3PFVA 2JNXA 1ALWA 2KLDA 1QLSA 2JZIA 1JBAA 1DF0A 1U5IA 1V1GA 3S0AA 4ZCVA 3CZ1A 2PYQA 5CSJA 3SS3A 1L7ZA 3CR5X 4HRGA 5J3XA 5AFPA 1S36A 1LVCD 5I2QA 2Y4QA 2ZRSA 3IF7A 3GK1A 4OVNF 1JWDA 5AERA 1W7JB 1DJXA 5DICA 4DIRA 1WY9A 4HSZA 2K2AA 2LHIA 2ZNEA 2PSRA 2P6BB 2BECA 3OBVA 3EKJA 1SYMA 2EC6B 2I18A 3PM2A 1QXPA 1LKJA 2JT3A 4GGFC 1B8CA 2QDIA 3R1VA 1CFCA 2L4IA 4JD9A 3S0DA 2KBMA 3O78A 2R2IA 1B4CA 2KDHA 1SR6B 3NSLA 4HRHA 5CSIA 3SS4A 2M29A 3A8RA 5HKZA 2GGZA 1F55A 3TDIA 1OOJA 2LVKA 2BBNA 1DJWA 1AK8A 2LMVA 2HQWA 3EK4A 4PE7A 2LP2A 2KGRA 1DJZA 1LA3A 1NIWA 4MZLA 2L51A 1J1EA 3OB2B 1SL7A 1YTZC 2H2KA 2JT8A 1Q80A 2WCKA 4A4CA 1MUXA 2EC6C 1QJTA 3CGAA 1SNLA 1FBVA 1QIWA 1RROA 1TNWA 1UP5A 3CYZA 5FI2A 5F6TA 2LP3A 1SR6C 2OS8B 4D1EA 1JFJA 3Q8IA 4ICBA 2K2FA 1BMOA 3B87A 1NP8A 1K9UA 3D10A 3L4LA 2ERBA 1TNPA 1QS7A 3TS5B 1A29A 4QJ3B 4YGBB 2FJYA 3BJHA 4ORAB 2CTNA 5TNCA 1LS8A 2SASA 2DOQA 1SSEB 4IJ7A 1BU3A 1IH0A 4GBAA 3AAKA 3PJIA 1A75B 1R2UA 4JQ0D 1PSRA 3OX5A 4YGCB 3EVVA 2LVIA 4JPZB 1B1GA 1TCFA 2QACA 1YURA 3ZNIA 3CDNA 2OS8C 1Z2CB 4XYNA 2MAZA 3DXLA 1AJ5A 1KWOC 2GGMA 2JXLA 1GM0A 1PULA 1DELA 4YGEB 3TS5C 3TDUA 1QX2A 2JC2A 2LVVA 4GGNA 3PALA 2L4HA 4OZDA 4I5KA 3SJSA 1RWYA 2TN4A 3FS7A 1A2XA 2F8PA 2H61A 4MZJA 4PE1A 1OZOA 5GQQC 1EG4A 1XFZO 1SL8A 2BAPA 3VRPA 1DF0B 1U5IB 1K95A 3FIAA 3WXAA 1MR8A 1NWDA 2LV7A 1F71A 1S3PA 1CLBA 3B88A 4FTGA 4F7FA 5D69A 4L9MA 3VB1A 1M63B 2COLB 1CM4A 1LXFC 5KU1A 1SW8A 4Q04A 5HLOA 1DJGA 3CZTX 1WRKA 3GOFA 4USLA 2LNKA 2FOTA 4JWQA 3DVJA 3LLEA 1XFUO 1NCXA 1BOCA 1P28A 2ZN9A 1EL4A 1CNPA 1K90D 1M46A 2KYFA 1S6IA 1DC1A 4IL1A 2KGBC 1NCYA 4QJ4B 1XYDA 3NXAA 1DJIA 2I7AA 1KK7Y 2MBXA 4DUQA 3VGOA 2JU0A 1UHNA 4NDBA 1XA5A 2OTGB 2KHNA 3ZWHA 5HYDA 1PSBA 4PALA 2BNXA 4PHKA 3O4YA 1IKUA 4MBEA 2QEHA 3SG4A 2P71A 1OW4A 1BR1B 1S5GZ 3DVEA 1UHHA 2L98A 2QEBA 4JKTA 4MVFA 3KPXA 1B7TZ 5FYXA 2LLSA 2NCOA 4P5OE 1ZOTB 5D3OA 2MLFC 5HLVA 2WC8A 2OPOA 1J1DA 2L50A 3NGVA 2AUCA 3D77A 2M97A 3UNWA 1GQMA 1YRUB 2CXJA 2BCAA 2EHBA 1F4QA 4GFTA 2LMUA 3BUWB 3EK7A 4MRXA 3VRRA 1C3ZA 2BBMA 2OTGC 3S0GA 1EG3A 2JULA 3DF0A 1JSAA 1B8RA 4BY5A 4I5JA 1R6PA 1YRTB 2ZN8A 3DVKA 4NDCA 4HREE 1K2HA 5EL2A 2F2PA 1BJFA 5G08A 1IJ6A 1TN4A 3FWBA 2LMTA 2CNPA 2NZ0A 4YI9A 1XFWO 1G33A 5DKNA 2JPOA 2EGDA 2P70A 4BY4A 1AVSA 2FJUB 2HF5A 2WCFA 1S5GY 4NDDA 5I2OA 1XFRA 1NUBA 4MRYA 1DT7B 1JF2A 2Y1NA 1NSHA 1Y0VH 1OOIX 1Y1XA 1OMDA 2H8VA 1OOFA 1DJYA 4ETOA 1JC2A 1D1OA 2JTZA 1CM1A 2LLUA 3CABA 5D7FA 1J55A 1MHOA 3SIBA 1W9ZA 1DGUA 3BUOB 1WLMA 2LCPA 5HKWA 1F4OA 3PSRA 3LK1A 3DD4A 3CZ2A 4FQOA 2K61A 3QMEA 3VRQA 3IQOA 1H8BA 3QRXA 3MSEB 4C0JA 2KAXA 4AOMA 3HX4A 1NPQA 1WRZA 3R72A 1QX7A 2WNDA 4OKHA 5I2LA 1UHJA 4PCWA 5KSZA 3EVRA 2AAOA 3JVTB 1FPWA 4NQGA 2M9GA 2WC5A 4FQTA 1Y1AA 3WNXB 2H61C 1KWOB 2K7CA 2Y1MA 2E30A 1CDLA 1CDPA 1YR5A 1L2OB 2G2BA 1TCOB 1IQ3A 1CLLA 1CLMA 1YX7A 3D0YA 1G8IA 2KPHA 2L5XB 1XK4A 1XFXO 3FE8A 2JPTA 1QIVA 4DS7A 2ZNDA 4TNCA 2BKHB 2O60A 3D78A 1TNQA 2B1UA 3D74A 3I5FB 2WCMA 3I5HB 1DQEA 1UURA 1T14A 3PN7B 1C7VA 2WOSA 3IVTA 3OB1B 3D76A 4R1EA 3JVTC 1J7OA 1OQPA 1YX8A 2KOTA 1XO5A 3DVMA 3NHTA 3KO0A 3NSIA 1NCZA 2LUCA 4WQ3A 2PQLA 2I2RE 1L2OC 4ORCB 1BF5A 2ZRTA 1DTLA 5PALA 1J7PA 1NX1A 1KFUS 3RZSA 1SBJA 4YGDB 1B9AA 3AKAA 2RGIA 1F54A 1FW4A 2KQ6A 2BKIB 1N0YA 2MLEC 2FCEA 4PHMA 3TDZA 2K60A 2KAYA 4QJ5B 3RM1A 3GK4X 1MXEA 3DF0B 3D73A 3I5FC 1FF1A 4GUKA 3I5HC 5DKQA 2BE4A 3PN7C 3EKHA 3LCPC 1TOPA 2WCHA 2NCPA 3CWGA 4AQJA 2HQ8A 1GGWA 2KBIA 4U8DA 3ICBA 3H4SE 1E8AA 2FCDA 1KCYA 1TIZA 5I8NA 3M0WA 4M2OA 1K96A 1DGVA 1RECA 5B8IB 1SRAA 1AHRA 1BG1A 2K7DA 2WC6A 1CKKA 4C0LA 2KNEA 3AKBA 2D8NA 2K7BA 3K1EA 3B86A 4MLWA 3R1OA 2WCEA 3CZ0A 3TUYB 1ORGA 2PMYA 5K89A 1BT6A 2KYCA 4A4BA 1TNXA 4I5NB 1Z4HA 1VRKA 1CFPA 4PHNA 1SY9A 2JQ6A 2YGUA 2LVJA 4PT1A 1QASA 1IGVA 2L5YA 3BFAA 4GNKB 1IIOA 1TUJA 1WRLA 1DEKA 2KFHA 2ZKMX 5FI6A 1SKTA 1AP4A 1DJHA 2K7OA 1JF0A 1ZMZA 2CCMA 2PALA 2JRFA 3S0EA 2AMIA 1YVLA 1KFUL 1MWNA 2M8UA 5CPVA 3TUYC 3O4XA 4INWA 3B6XA 1ZACA 1KFXS 1B47A 1XFYO 3PATA 1Y6WA 5ER5A 3OX6A 1M39A 2MRDA 1UHKA 3KEVA 2CBLA 1S6CA 3D0YB 2IS9A 4CFQA 2K8MB 4P2YB 5JOLA 3KF9A 4GAOA 4CLNA 1K8UA 3BYAA 2M49B 3I5IB 1B8LA 1PK0D 4CFRA 1RFJA 3AAJA 1C3YA 4YI8A 1YVHA 3V2LA 4MSPA 1C07A 1UHIA 1KSMA 1SCVA 1K93D 1UWOA 3DZTA 4YRUA 4ORBB 2JOJA 4PE4A 3TZ1A 1A4PA 2F33A 2JWWA 1QV1A 3CS1A 1JFKA 3E3RA 4KYNA 4OR9B 1N2DA 3NHIA 3SIAA 2K0JA 2JXCA 5HL1A 1TUZA 1B7TY 1XK4C 3DY9A 2LE9B 1NX3A 1K94A 1LINA 1V1FA 5HKYA 1MQ1A 3I5IC 4GPLB 1QLKA 1MXLC 5CSNA 1QATA 2BCXA 1PALA 1ZFSA 4M2QA 1ZUZA 2QEOA 4I5LB 4PHJA 5AEQA 4UPGA 2MJWB 1IG5A 1K9KA 1OMRA 2MHHA 2V53A 3R1PA 3VROA 2LANA 3EG5B 3BUNB 3I5GC 1FI6A 2PASA 2QEVA 3CTNA 3OGNA 3BUXB 1EJ3A 2HETA 1CFFA 1CTRA 1CMFA 1TWOA 1Y1UA 4YBHB 1WLZA 1IJ5A 3NSOA 1CB1A 2LM5A 1KFXL 2KFFA 1F70A 4CPVA 3S0FA 4XJKA 1F8HA 3L4AA 5AXIA 1QWVA 1HT9A 2JNFA 1G4YR 4MN0A 4F0ZB 3RLZA 1NYAA 2BE6A 2KI6C 5AANA 3BOWA 2I94A 1HQVA 2LC5A 1PVBA 1CFDA 2KLEA 1LA0A 4OV2A 1UUSA 1EXRA 4DRWA 1AUIB 5BPJA 3O6BA 1PVAA 3CLNA 3JTDB 1OOHA 3GK2A 4GGFA 1OMVA 3L47A 1DVIA 1H4BA 2M7NA 2WORA 5JJGA 2L2CA 4N5XA 2L0PA 3N7HA 1BODA 1TRFA 4M2PA 3SS5A 1K9PA 4DCKA 2M1UA 4ZCUA 5IBWA 4MZKA 2M1KB 4PDZA 2GV5A 2M3WA 4N1FA 1JUOA 2A4JA 1CDNA 4WQ2A 1BR4B 1QVIZ 1S6JA 2QPTA 3BQ3A 1GGZA 2O5GA 5DKRA 1C7WA 2LLTA 1SK6D 2CT9A 3EVUA 3PM8A 3JTDC 1SCMB 5FI7A 3CR4X 2WCJA 1YUUA 1M45A 3D75A 4CIDA 2MA2A 3BFBA 3VRNA 2WCBA 1OOGA 1M31A 1W7IB 4OCIA 4MEWA 1KK8B 1KK7Z 3BFHA 3F45A 3SG7A 2G9BA 2L2EA 3IQQA 1QX5B 1IQ5A 1SPYA 2LHLA 2HPSA 4YGAA 1YUTA 2JT0A 2PRUA 3BXKA 1BLQA 2PVBA 3FE6A 1ODBA 1IWQA 2E6WA 1N65A 1WDCB 3BUMB 2KSPA 1A03A 2KI6D 3FE9A 1KQMB 1SCMC 1QV0A 3OP0A 1S26D 2SCPA 4C0KA
chains in the Genus database with same CATH topology
1KQVA 3KHEA 2BL0B 3SG5A 1QVIY 2KI4B 2LAPA 2NLNA 2BCBA 3WHUB 1CMGA 1RK9A 2M7LA 1KK8C 2KFGA 4N1GA 1NX0A 2JTTA 1XFVO 2ZFDA 2KAVA 2NXQA 2F3YA 2Q91A 3WHTB 1EH2A 2F3ZA 1YUSA 1XVJA 2ISDA 2VRGA 1OE9B 1ALVA 1OSAA 5CSFA 1IRJA 1WDCC 1J7RA 3A4UB 5KTYA 3OHMB 4E68A 1NX2A 1CDMA 1RJVA 2LUXA 1KSOA 3K21A 4XJKB 1S1EA 1KQMC 3LK0A 4AQIA 1GJYA 1X02A 1A75A 1AJ4A 1RTP1 2Q4UA 2BL0C 1MF8B 1PRWA 1QTXA 2F2OA 4WRIA 2KI4C 3PLFB 5ER4X 3NSKA 3BOWB 2Y5IA 1DMOA 3FWCA 1FI5A 4PE0A 3SG6A 3EK8A 1SMGA 2M0RA 3CR2A 3SG3A 3O2PA 1TTXA 3I5GB 3SG2A 2KQYA 3C1VA 3HCMA 1J7QA 1SL9A 3LL8B 1OZSA 3PFVA 2JNXA 1ALWA 1QLSA 2JZIA 1JBAA 1DF0A 1U5IA 1V1GA 4ZCVA 5CSJA 1L7ZA 3CR5X 4HRGA 5J3XA 5AFPA 1S36A 1LVCD 5I2QA 2Y4QA 2ZRSA 3IF7A 3GK1A 4OVNF 1JWDA 5AERA 1W7JB 1DJXA 4DIRA 1WY9A 4HSZA 2K2AA 2LHIA 2ZNEA 2PSRA 2P6BB 2BECA 3EKJA 1SYMA 2EC6B 2I18A 4GGFC 1QXPA 1LKJA 2JT3A 1B8CA 1CFCA 2L4IA 2KBMA 3O78A 2R2IA 1B4CA 2KDHA 1SR6B 3NSLA 4HRHA 5CSIA 2M29A 3A8RA 5HKZA 2GGZA 1F55A 3TDIA 1OOJA 2LVKA 2BBNA 1DJWA 1AK8A 2LMVA 2HQWA 3EK4A 4PE7A 2LP2A 2KGRA 1DJZA 1LA3A 1NIWA 4MZLA 2L51A 1J1EA 3OB2B 1SL7A 1YTZC 2H2KA 2JT8A 1Q80A 4A4CA 1MUXA 2EC6C 1QJTA 3CGAA 1SNLA 1FBVA 1QIWA 1RROA 1TNWA 1UP5A 5F6TA 2LP3A 1SR6C 2OS8B 4D1EA 1JFJA 4ICBA 2K2FA 1BMOA 1NP8A 1K9UA 3D10A 1TNPA 1QS7A 3TS5B 1A29A 4QJ3B 4YGBB 4ORAB 2CTNA 5TNCA 2SASA 2DOQA 1BU3A 1IH0A 4GBAA 3AAKA 4JQ0D 1A75B 1R2UA 1PSRA 3OX5A 4YGCB 3EVVA 2LVIA 4JPZB 1B1GA 1TCFA 2QACA 1YURA 3ZNIA 2OS8C 4XYNA 2MAZA 1AJ5A 1KWOC 2GGMA 2JXLA 1PULA 3TS5C 4YGEB 3TDUA 1QX2A 2JC2A 2LVVA 4GGNA 3PALA 2L4HA 3SJSA 4I5KA 1RWYA 2TN4A 3FS7A 1A2XA 2F8PA 2H61A 4MZJA 4PE1A 1OZOA 5GQQC 1EG4A 1XFZO 1SL8A 3VRPA 1DF0B 1U5IB 1K95A 3FIAA 3WXAA 1MR8A 1NWDA 2LV7A 1F71A 1S3PA 1CLBA 4FTGA 5D69A 4L9MA 1M63B 2COLB 1CM4A 1LXFC 5KU1A 1SW8A 4Q04A 5HLOA 1DJGA 3CZTX 1WRKA 3GOFA 4USLA 2LNKA 2FOTA 4JWQA 3DVJA 3LLEA 1XFUO 1NCXA 1BOCA 2ZN9A 1CNPA 1EL4A 1K90D 1M46A 2KYFA 1S6IA 4IL1A 2KGBC 1NCYA 4QJ4B 1XYDA 3NXAA 1DJIA 2I7AA 1KK7Y 2MBXA 4DUQA 3VGOA 2JU0A 1UHNA 4NDBA 1XA5A 2OTGB 2KHNA 3ZWHA 5HYDA 1PSBA 4PALA 4PHKA 3O4YA 1IKUA 4MBEA 3SG4A 1BR1B 1S5GZ 3DVEA 1UHHA 2L98A 4MVFA 3KPXA 1B7TZ 5FYXA 2LLSA 2NCOA 4P5OE 1ZOTB 5HLVA 2MLFC 2WC8A 2OPOA 1J1DA 2L50A 2AUCA 2M97A 1GQMA 1YRUB 2CXJA 2BCAA 2EHBA 1F4QA 4GFTA 2LMUA 3BUWB 3EK7A 4MRXA 3VRRA 2BBMA 2OTGC 1EG3A 2JULA 3DF0A 1JSAA 1B8RA 4BY5A 4I5JA 1R6PA 1YRTB 2ZN8A 3DVKA 4NDCA 4HREE 1K2HA 2F2PA 1BJFA 5G08A 1IJ6A 1TN4A 3FWBA 2LMTA 2CNPA 2NZ0A 4YI9A 1XFWO 1G33A 5DKNA 2EGDA 4BY4A 1AVSA 2FJUB 2HF5A 2WCFA 1S5GY 4NDDA 5I2OA 1DT7B 1NUBA 4MRYA 1JF2A 2Y1NA 1NSHA 1Y0VH 1Y1XA 1OMDA 1DJYA 4ETOA 1JC2A 1D1OA 2JTZA 1CM1A 2LLUA 5D7FA 1J55A 1MHOA 3SIBA 1DGUA 3BUOB 1WLMA 2LCPA 5HKWA 1F4OA 3PSRA 3LK1A 3DD4A 4FQOA 2K61A 3VRQA 3IQOA 1H8BA 3QRXA 3MSEB 4C0JA 2KAXA 4AOMA 3HX4A 1NPQA 1WRZA 1QX7A 2WNDA 4OKHA 5I2LA 1UHJA 4PCWA 5KSZA 3EVRA 2AAOA 3JVTB 1FPWA 4NQGA 2M9GA 1Y1AA 3WNXB 2H61C 1KWOB 2K7CA 2Y1MA 2E30A 1CDLA 1CDPA 1YR5A 1L2OB 2G2BA 1TCOB 1IQ3A 1CLLA 1CLMA 1YX7A 3D0YA 1G8IA 2L5XB 1XK4A 1XFXO 2JPTA 1QIVA 4DS7A 2ZNDA 4TNCA 2BKHB 2O60A 1TNQA 2B1UA 3I5FB 3I5HB 1UURA 3PN7B 1C7VA 2WOSA 3OB1B 4R1EA 3JVTC 1J7OA 1OQPA 1YX8A 2KOTA 1XO5A 3DVMA 3KO0A 3NSIA 1NCZA 2LUCA 4WQ3A 2I2RE 1L2OC 4ORCB 1BF5A 2ZRTA 1DTLA 5PALA 1J7PA 1NX1A 1KFUS 1SBJA 4YGDB 1B9AA 3AKAA 2RGIA 1F54A 1FW4A 2KQ6A 2BKIB 1N0YA 2MLEC 2FCEA 4PHMA 3TDZA 2KAYA 4QJ5B 3RM1A 3GK4X 1MXEA 3DF0B 3I5FC 1FF1A 4GUKA 3I5HC 5DKQA 2BE4A 3PN7C 3EKHA 3LCPC 1TOPA 2NCPA 3CWGA 4AQJA 2HQ8A 1GGWA 2KBIA 4U8DA 3ICBA 3H4SE 1E8AA 2FCDA 1KCYA 1TIZA 5I8NA 3M0WA 4M2OA 1K96A 1DGVA 1RECA 5B8IB 1SRAA 1AHRA 1BG1A 2K7DA 1CKKA 4C0LA 2KNEA 3AKBA 2D8NA 2K7BA 4MLWA 2WCEA 3TUYB 2PMYA 5K89A 1BT6A 2KYCA 4A4BA 1TNXA 4I5NB 1VRKA 1CFPA 4PHNA 1SY9A 2JQ6A 2LVJA 1QASA 1IGVA 4GNKB 1WRLA 2KFHA 2ZKMX 1SKTA 1AP4A 1DJHA 2K7OA 1JF0A 1ZMZA 2CCMA 2PALA 2JRFA 2AMIA 1YVLA 1KFUL 1MWNA 2M8UA 5CPVA 3TUYC 1ZACA 1KFXS 1B47A 1XFYO 3PATA 1Y6WA 5ER5A 3OX6A 1M39A 2MRDA 1UHKA 3KEVA 2CBLA 1S6CA 3D0YB 2IS9A 4CFQA 2K8MB 4P2YB 5JOLA 3KF9A 4GAOA 4CLNA 1K8UA 3BYAA 2M49B 3I5IB 1B8LA 1PK0D 4CFRA 1RFJA 3AAJA 4YI8A 1YVHA 4MSPA 1C07A 1UHIA 1KSMA 1SCVA 1K93D 1UWOA 4YRUA 4ORBB 2JOJA 4PE4A 3TZ1A 1A4PA 2F33A 2JWWA 1QV1A 3CS1A 1JFKA 3E3RA 4OR9B 1N2DA 3SIAA 2K0JA 2JXCA 1B7TY 1XK4C 2LE9B 1NX3A 1K94A 1LINA 1V1FA 5HKYA 1MQ1A 3I5IC 4GPLB 1QLKA 1MXLC 5CSNA 1QATA 2BCXA 1PALA 1ZFSA 4M2QA 1ZUZA 4I5LB 5AEQA 4PHJA 4UPGA 2MJWB 1IG5A 1K9KA 1OMRA 2MHHA 2V53A 3VROA 2LANA 3BUNB 3I5GC 1FI6A 2PASA 3CTNA 3BUXB 1EJ3A 2HETA 1CFFA 1CTRA 1CMFA 1Y1UA 4YBHB 1WLZA 1IJ5A 3NSOA 1CB1A 2LM5A 1KFXL 2KFFA 1F70A 4CPVA 4XJKA 1F8HA 5AXIA 1HT9A 2JNFA 1G4YR 4MN0A 4F0ZB 3RLZA 1NYAA 2BE6A 2KI6C 5AANA 3BOWA 2I94A 1HQVA 2LC5A 1PVBA 1CFDA 1LA0A 4OV2A 1UUSA 1EXRA 4DRWA 1AUIB 5BPJA 3O6BA 1PVAA 3CLNA 3JTDB 3GK2A 4GGFA 1OMVA 1DVIA 1H4BA 2M7NA 2WORA 5JJGA 4N5XA 2L0PA 1BODA 1TRFA 4M2PA 1K9PA 4DCKA 2M1UA 4ZCUA 5IBWA 4MZKA 2M1KB 4PDZA 2GV5A 2M3WA 4N1FA 1JUOA 2A4JA 1CDNA 4WQ2A 1BR4B 1QVIZ 1S6JA 2QPTA 3BQ3A 1GGZA 2O5GA 5DKRA 1C7WA 2LLTA 1SK6D 2CT9A 3EVUA 3PM8A 3JTDC 1SCMB 3CR4X 1YUUA 1M45A 4CIDA 2MA2A 3VRNA 2WCBA 1M31A 1W7IB 4OCIA 4MEWA 1KK8B 1KK7Z 3F45A 3SG7A 2G9BA 2L2EA 3IQQA 1QX5B 1IQ5A 1SPYA 2LHLA 2HPSA 4YGAA 1YUTA 2JT0A 2PRUA 3BXKA 1BLQA 2PVBA 1ODBA 1IWQA 2E6WA 1N65A 1WDCB 3BUMB 2KSPA 1A03A 2KI6D 1KQMB 1SCMC 1QV0A 3OP0A 1S26D 2SCPA 4C0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQV A;  3KHE A;  2BL0 B;  3SG5 A;  1QVI Y;  2KI4 B;  2LAP A;  2NLN A;  2BCB A;  3WHU B;  1CMG A;  1RK9 A;  2M7L A;  1KK8 C;  2KFG A;  4N1G A;  1NX0 A;  2JTT A;  1XFV O;  2ZFD A;  2KAV A;  2NXQ A;  2F3Y A;  2Q91 A;  3WHT B;  1EH2 A;  2F3Z A;  1YUS A;  1XVJ A;  2ISD A;  2VRG A;  1OE9 B;  1ALV A;  1OSA A;  5CSF A;  1IRJ A;  1WDC C;  1J7R A;  3A4U B;  5KTY A;  3OHM B;  4E68 A;  1NX2 A;  1CDM A;  1RJV A;  2LUX A;  1KSO A;  3K21 A;  4XJK B;  1S1E A;  1KQM C;  3LK0 A;  4AQI A;  1GJY A;  1X02 A;  1A75 A;  1AJ4 A;  1RTP 1;  2Q4U A;  2BL0 C;  1MF8 B;  1PRW A;  1QTX A;  2F2O A;  4WRI A;  2KI4 C;  3PLF B;  5ER4 X;  3NSK A;  3BOW B;  2Y5I A;  1DMO A;  3FWC A;  1FI5 A;  4PE0 A;  3SG6 A;  3EK8 A;  1SMG A;  2M0R A;  3CR2 A;  3SG3 A;  3O2P A;  1TTX A;  3I5G B;  3SG2 A;  2KQY A;  3C1V A;  3HCM A;  1J7Q A;  1SL9 A;  3LL8 B;  1OZS A;  3PFV A;  2JNX A;  1ALW A;  1QLS A;  2JZI A;  1JBA A;  1DF0 A;  1U5I A;  1V1G A;  4ZCV A;  5CSJ A;  1L7Z A;  3CR5 X;  4HRG A;  5J3X A;  5AFP A;  1S36 A;  1LVC D;  5I2Q A;  2Y4Q A;  2ZRS A;  3IF7 A;  3GK1 A;  4OVN F;  1JWD A;  5AER A;  1W7J B;  1DJX A;  4DIR A;  1WY9 A;  4HSZ A;  2K2A A;  2LHI A;  2ZNE A;  2PSR A;  2P6B B;  2BEC A;  3EKJ A;  1SYM A;  2EC6 B;  2I18 A;  4GGF C;  1QXP A;  1LKJ A;  2JT3 A;  1B8C A;  1CFC A;  2L4I A;  2KBM A;  3O78 A;  2R2I A;  1B4C A;  2KDH A;  1SR6 B;  3NSL A;  4HRH A;  5CSI A;  2M29 A;  3A8R A;  5HKZ A;  2GGZ A;  1F55 A;  3TDI A;  1OOJ A;  2LVK A;  2BBN A;  1DJW A;  1AK8 A;  2LMV A;  2HQW A;  3EK4 A;  4PE7 A;  2LP2 A;  2KGR A;  1DJZ A;  1LA3 A;  1NIW A;  4MZL A;  2L51 A;  1J1E A;  3OB2 B;  1SL7 A;  1YTZ C;  2H2K A;  2JT8 A;  1Q80 A;  4A4C A;  1MUX A;  2EC6 C;  1QJT A;  3CGA A;  1SNL A;  1FBV A;  1QIW A;  1RRO A;  1TNW A;  1UP5 A;  5F6T A;  2LP3 A;  1SR6 C;  2OS8 B;  4D1E A;  1JFJ A;  4ICB A;  2K2F A;  1BMO A;  1NP8 A;  1K9U A;  3D10 A;  1TNP A;  1QS7 A;  3TS5 B;  1A29 A;  4QJ3 B;  4YGB B;  4ORA B;  2CTN A;  5TNC A;  2SAS A;  2DOQ A;  1BU3 A;  1IH0 A;  4GBA A;  3AAK A;  4JQ0 D;  1A75 B;  1R2U A;  1PSR A;  3OX5 A;  4YGC B;  3EVV A;  2LVI A;  4JPZ B;  1B1G A;  1TCF A;  2QAC A;  1YUR A;  3ZNI A;  2OS8 C;  4XYN A;  2MAZ A;  1AJ5 A;  1KWO C;  2GGM A;  2JXL A;  1PUL A;  3TS5 C;  4YGE B;  3TDU A;  1QX2 A;  2JC2 A;  2LVV A;  4GGN A;  3PAL A;  2L4H A;  3SJS A;  4I5K A;  1RWY A;  2TN4 A;  3FS7 A;  1A2X A;  2F8P A;  2H61 A;  4MZJ A;  4PE1 A;  1OZO A;  5GQQ C;  1EG4 A;  1XFZ O;  1SL8 A;  3VRP A;  1DF0 B;  1U5I B;  1K95 A;  3FIA A;  3WXA A;  1MR8 A;  1NWD A;  2LV7 A;  1F71 A;  1S3P A;  1CLB A;  4FTG A;  5D69 A;  4L9M A;  1M63 B;  2COL B;  1CM4 A;  1LXF C;  5KU1 A;  1SW8 A;  4Q04 A;  5HLO A;  1DJG A;  3CZT X;  1WRK A;  3GOF A;  4USL A;  2LNK A;  2FOT A;  4JWQ A;  3DVJ A;  3LLE A;  1XFU O;  1NCX A;  1BOC A;  2ZN9 A;  1CNP A;  1EL4 A;  1K90 D;  1M46 A;  2KYF A;  1S6I A;  4IL1 A;  2KGB C;  1NCY A;  4QJ4 B;  1XYD A;  3NXA A;  1DJI A;  2I7A A;  1KK7 Y;  2MBX A;  4DUQ A;  3VGO A;  2JU0 A;  1UHN A;  4NDB A;  1XA5 A;  2OTG B;  2KHN A;  3ZWH A;  5HYD A;  1PSB A;  4PAL A;  4PHK A;  3O4Y A;  1IKU A;  4MBE A;  3SG4 A;  1BR1 B;  1S5G Z;  3DVE A;  1UHH A;  2L98 A;  4MVF A;  3KPX A;  1B7T Z;  5FYX A;  2LLS A;  2NCO A;  4P5O E;  1ZOT B;  5HLV A;  2MLF C;  2WC8 A;  2OPO A;  1J1D A;  2L50 A;  2AUC A;  2M97 A;  1GQM A;  1YRU B;  2CXJ A;  2BCA A;  2EHB A;  1F4Q A;  4GFT A;  2LMU A;  3BUW B;  3EK7 A;  4MRX A;  3VRR A;  2BBM A;  2OTG C;  1EG3 A;  2JUL A;  3DF0 A;  1JSA A;  1B8R A;  4BY5 A;  4I5J A;  1R6P A;  1YRT B;  2ZN8 A;  3DVK A;  4NDC A;  4HRE E;  1K2H A;  2F2P A;  1BJF A;  5G08 A;  1IJ6 A;  1TN4 A;  3FWB A;  2LMT A;  2CNP A;  2NZ0 A;  4YI9 A;  1XFW O;  1G33 A;  5DKN A;  2EGD A;  4BY4 A;  1AVS A;  2FJU B;  2HF5 A;  2WCF A;  1S5G Y;  4NDD A;  5I2O A;  1DT7 B;  1NUB A;  4MRY A;  1JF2 A;  2Y1N A;  1NSH A;  1Y0V H;  1Y1X A;  1OMD A;  1DJY A;  4ETO A;  1JC2 A;  1D1O A;  2JTZ A;  1CM1 A;  2LLU A;  5D7F A;  1J55 A;  1MHO A;  3SIB A;  1DGU A;  3BUO B;  1WLM A;  2LCP A;  5HKW A;  1F4O A;  3PSR A;  3LK1 A;  3DD4 A;  4FQO A;  2K61 A;  3VRQ A;  3IQO A;  1H8B A;  3QRX A;  3MSE B;  4C0J A;  2KAX A;  4AOM A;  3HX4 A;  1NPQ A;  1WRZ A;  1QX7 A;  2WND A;  4OKH A;  5I2L A;  1UHJ A;  4PCW A;  5KSZ A;  3EVR A;  2AAO A;  3JVT B;  1FPW A;  4NQG A;  2M9G A;  1Y1A A;  3WNX B;  2H61 C;  1KWO B;  2K7C A;  2Y1M A;  2E30 A;  1CDL A;  1CDP A;  1YR5 A;  1L2O B;  2G2B A;  1TCO B;  1IQ3 A;  1CLL A;  1CLM A;  1YX7 A;  3D0Y A;  1G8I A;  2L5X B;  1XK4 A;  1XFX O;  2JPT A;  1QIV A;  4DS7 A;  2ZND A;  4TNC A;  2BKH B;  2O60 A;  1TNQ A;  2B1U A;  3I5F B;  3I5H B;  1UUR A;  3PN7 B;  1C7V A;  2WOS A;  3OB1 B;  4R1E A;  3JVT C;  1J7O A;  1OQP A;  1YX8 A;  2KOT A;  1XO5 A;  3DVM A;  3KO0 A;  3NSI A;  1NCZ A;  2LUC A;  4WQ3 A;  2I2R E;  1L2O C;  4ORC B;  1BF5 A;  2ZRT A;  1DTL A;  5PAL A;  1J7P A;  1NX1 A;  1KFU S;  1SBJ A;  4YGD B;  1B9A A;  3AKA A;  2RGI A;  1F54 A;  1FW4 A;  2KQ6 A;  2BKI B;  1N0Y A;  2MLE C;  2FCE A;  4PHM A;  3TDZ A;  2KAY A;  4QJ5 B;  3RM1 A;  3GK4 X;  1MXE A;  3DF0 B;  3I5F C;  1FF1 A;  4GUK A;  3I5H C;  5DKQ A;  2BE4 A;  3PN7 C;  3EKH A;  3LCP C;  1TOP A;  2NCP A;  3CWG A;  4AQJ A;  2HQ8 A;  1GGW A;  2KBI A;  4U8D A;  3ICB A;  3H4S E;  1E8A A;  2FCD A;  1KCY A;  1TIZ A;  5I8N A;  3M0W A;  4M2O A;  1K96 A;  1DGV A;  1REC A;  5B8I B;  1SRA A;  1AHR A;  1BG1 A;  2K7D A;  1CKK A;  4C0L A;  2KNE A;  3AKB A;  2D8N A;  2K7B A;  4MLW A;  2WCE A;  3TUY B;  2PMY A;  5K89 A;  1BT6 A;  2KYC A;  4A4B A;  1TNX A;  4I5N B;  1VRK A;  1CFP A;  4PHN A;  1SY9 A;  2JQ6 A;  2LVJ A;  1QAS A;  1IGV A;  4GNK B;  1WRL A;  2KFH A;  2ZKM X;  1SKT A;  1AP4 A;  1DJH A;  2K7O A;  1JF0 A;  1ZMZ A;  2CCM A;  2PAL A;  2JRF A;  2AMI A;  1YVL A;  1KFU L;  1MWN A;  2M8U A;  5CPV A;  3TUY C;  1ZAC A;  1KFX S;  1B47 A;  1XFY O;  3PAT A;  1Y6W A;  5ER5 A;  3OX6 A;  1M39 A;  2MRD A;  1UHK A;  3KEV A;  2CBL A;  1S6C A;  3D0Y B;  2IS9 A;  4CFQ A;  2K8M B;  4P2Y B;  5JOL A;  3KF9 A;  4GAO A;  4CLN A;  1K8U A;  3BYA A;  2M49 B;  3I5I B;  1B8L A;  1PK0 D;  4CFR A;  1RFJ A;  3AAJ A;  4YI8 A;  1YVH A;  4MSP A;  1C07 A;  1UHI A;  1KSM A;  1SCV A;  1K93 D;  1UWO A;  4YRU A;  4ORB B;  2JOJ A;  4PE4 A;  3TZ1 A;  1A4P A;  2F33 A;  2JWW A;  1QV1 A;  3CS1 A;  1JFK A;  3E3R A;  4OR9 B;  1N2D A;  3SIA A;  2K0J A;  2JXC A;  1B7T Y;  1XK4 C;  2LE9 B;  1NX3 A;  1K94 A;  1LIN A;  1V1F A;  5HKY A;  1MQ1 A;  3I5I C;  4GPL B;  1QLK A;  1MXL C;  5CSN A;  1QAT A;  2BCX A;  1PAL A;  1ZFS A;  4M2Q A;  1ZUZ A;  4I5L B;  5AEQ A;  4PHJ A;  4UPG A;  2MJW B;  1IG5 A;  1K9K A;  1OMR A;  2MHH A;  2V53 A;  3VRO A;  2LAN A;  3BUN B;  3I5G C;  1FI6 A;  2PAS A;  3CTN A;  3BUX B;  1EJ3 A;  2HET A;  1CFF A;  1CTR A;  1CMF A;  1Y1U A;  4YBH B;  1WLZ A;  1IJ5 A;  3NSO A;  1CB1 A;  2LM5 A;  1KFX L;  2KFF A;  1F70 A;  4CPV A;  4XJK A;  1F8H A;  5AXI A;  1HT9 A;  2JNF A;  1G4Y R;  4MN0 A;  4F0Z B;  3RLZ A;  1NYA A;  2BE6 A;  2KI6 C;  5AAN A;  3BOW A;  2I94 A;  1HQV A;  2LC5 A;  1PVB A;  1CFD A;  1LA0 A;  4OV2 A;  1UUS A;  1EXR A;  4DRW A;  1AUI B;  5BPJ A;  3O6B A;  1PVA A;  3CLN A;  3JTD B;  3GK2 A;  4GGF A;  1OMV A;  1DVI A;  1H4B A;  2M7N A;  2WOR A;  5JJG A;  4N5X A;  2L0P A;  1BOD A;  1TRF A;  4M2P A;  1K9P A;  4DCK A;  2M1U A;  4ZCU A;  5IBW A;  4MZK A;  2M1K B;  4PDZ A;  2GV5 A;  2M3W A;  4N1F A;  1JUO A;  2A4J A;  1CDN A;  4WQ2 A;  1BR4 B;  1QVI Z;  1S6J A;  2QPT A;  3BQ3 A;  1GGZ A;  2O5G A;  5DKR A;  1C7W A;  2LLT A;  1SK6 D;  2CT9 A;  3EVU A;  3PM8 A;  3JTD C;  1SCM B;  3CR4 X;  1YUU A;  1M45 A;  4CID A;  2MA2 A;  3VRN A;  2WCB A;  1M31 A;  1W7I B;  4OCI A;  4MEW A;  1KK8 B;  1KK7 Z;  3F45 A;  3SG7 A;  2G9B A;  2L2E A;  3IQQ A;  1QX5 B;  1IQ5 A;  1SPY A;  2LHL A;  2HPS A;  4YGA A;  1YUT A;  2JT0 A;  2PRU A;  3BXK A;  1BLQ A;  2PVB A;  1ODB A;  1IWQ A;  2E6W A;  1N65 A;  1WDC B;  3BUM B;  2KSP A;  1A03 A;  2KI6 D;  1KQM B;  1SCM C;  1QV0 A;  3OP0 A;  1S26 D;  2SCP A;  4C0K A; 
#chains in the Genus database with same CATH topology
 1KQV A;  3KHE A;  2BL0 B;  4INX A;  3DYE A;  1QVI Y;  3SG5 A;  2KI4 B;  2LAP A;  2NLN A;  2BCB A;  2GTE A;  2WCL A;  3WHU B;  1CMG A;  1RK9 A;  2M7L A;  1KK8 C;  2KFG A;  4N1G A;  1NX0 A;  2JTT A;  1XFV O;  2ZFD A;  2KAV A;  2NXQ A;  2F3Y A;  2Q91 A;  3WHT B;  1EH2 A;  2F3Z A;  1YUS A;  1XVJ A;  2ISD A;  2VRG A;  1OE9 B;  1ALV A;  1OSA A;  5CSF A;  1IRJ A;  1WDC C;  1J7R A;  3A4U B;  3B7A A;  5KTY A;  3OHM B;  4E68 A;  1NX2 A;  1CDM A;  1RJV A;  2LUX A;  1KSO A;  3K21 A;  4XJK B;  1S1E A;  1KQM C;  3LK0 A;  4AQI A;  1GJY A;  1X02 A;  1A75 A;  1AJ4 A;  1RTP 1;  2Q4U A;  2BL0 C;  1MF8 B;  1PRW A;  1QTX A;  2F2O A;  4WRI A;  2KI4 C;  3PLF B;  5ER4 X;  3NSK A;  3BOW B;  2Y5I A;  1DMO A;  3FWC A;  1FI5 A;  4PE0 A;  3SG6 A;  3EK8 A;  1SMG A;  3S0B A;  2M0R A;  3CR2 A;  3SG3 A;  3O2P A;  3UO9 A;  1TTX A;  3I5G B;  3SG2 A;  2KQY A;  3C1V A;  3HCM A;  1J7Q A;  5I94 A;  1SL9 A;  3LL8 B;  1OZS A;  3PFV A;  2JNX A;  1ALW A;  2KLD A;  1QLS A;  2JZI A;  1JBA A;  1DF0 A;  1U5I A;  1V1G A;  3S0A A;  4ZCV A;  3CZ1 A;  2PYQ A;  5CSJ A;  3SS3 A;  1L7Z A;  3CR5 X;  4HRG A;  5J3X A;  5AFP A;  1S36 A;  1LVC D;  5I2Q A;  2Y4Q A;  2ZRS A;  3IF7 A;  3GK1 A;  4OVN F;  1JWD A;  5AER A;  1W7J B;  1DJX A;  5DIC A;  4DIR A;  1WY9 A;  4HSZ A;  2K2A A;  2LHI A;  2ZNE A;  2PSR A;  2P6B B;  2BEC A;  3OBV A;  3EKJ A;  1SYM A;  2EC6 B;  2I18 A;  3PM2 A;  1QXP A;  1LKJ A;  2JT3 A;  4GGF C;  1B8C A;  2QDI A;  3R1V A;  1CFC A;  2L4I A;  4JD9 A;  3S0D A;  2KBM A;  3O78 A;  2R2I A;  1B4C A;  2KDH A;  1SR6 B;  3NSL A;  4HRH A;  5CSI A;  3SS4 A;  2M29 A;  3A8R A;  5HKZ A;  2GGZ A;  1F55 A;  3TDI A;  1OOJ A;  2LVK A;  2BBN A;  1DJW A;  1AK8 A;  2LMV A;  2HQW A;  3EK4 A;  4PE7 A;  2LP2 A;  2KGR A;  1DJZ A;  1LA3 A;  1NIW A;  4MZL A;  2L51 A;  1J1E A;  3OB2 B;  1SL7 A;  1YTZ C;  2H2K A;  2JT8 A;  1Q80 A;  2WCK A;  4A4C A;  1MUX A;  2EC6 C;  1QJT A;  3CGA A;  1SNL A;  1FBV A;  1QIW A;  1RRO A;  1TNW A;  1UP5 A;  3CYZ A;  5FI2 A;  5F6T A;  2LP3 A;  1SR6 C;  2OS8 B;  4D1E A;  1JFJ A;  3Q8I A;  4ICB A;  2K2F A;  1BMO A;  3B87 A;  1NP8 A;  1K9U A;  3D10 A;  3L4L A;  2ERB A;  1TNP A;  1QS7 A;  3TS5 B;  1A29 A;  4QJ3 B;  4YGB B;  2FJY A;  3BJH A;  4ORA B;  2CTN A;  5TNC A;  1LS8 A;  2SAS A;  2DOQ A;  1SSE B;  4IJ7 A;  1BU3 A;  1IH0 A;  4GBA A;  3AAK A;  3PJI A;  1A75 B;  1R2U A;  4JQ0 D;  1PSR A;  3OX5 A;  4YGC B;  3EVV A;  2LVI A;  4JPZ B;  1B1G A;  1TCF A;  2QAC A;  1YUR A;  3ZNI A;  3CDN A;  2OS8 C;  1Z2C B;  4XYN A;  2MAZ A;  3DXL A;  1AJ5 A;  1KWO C;  2GGM A;  2JXL A;  1GM0 A;  1PUL A;  1DEL A;  4YGE B;  3TS5 C;  3TDU A;  1QX2 A;  2JC2 A;  2LVV A;  4GGN A;  3PAL A;  2L4H A;  4OZD A;  4I5K A;  3SJS A;  1RWY A;  2TN4 A;  3FS7 A;  1A2X A;  2F8P A;  2H61 A;  4MZJ A;  4PE1 A;  1OZO A;  5GQQ C;  1EG4 A;  1XFZ O;  1SL8 A;  2BAP A;  3VRP A;  1DF0 B;  1U5I B;  1K95 A;  3FIA A;  3WXA A;  1MR8 A;  1NWD A;  2LV7 A;  1F71 A;  1S3P A;  1CLB A;  3B88 A;  4FTG A;  4F7F A;  5D69 A;  4L9M A;  3VB1 A;  1M63 B;  2COL B;  1CM4 A;  1LXF C;  5KU1 A;  1SW8 A;  4Q04 A;  5HLO A;  1DJG A;  3CZT X;  1WRK A;  3GOF A;  4USL A;  2LNK A;  2FOT A;  4JWQ A;  3DVJ A;  3LLE A;  1XFU O;  1NCX A;  1BOC A;  1P28 A;  2ZN9 A;  1EL4 A;  1CNP A;  1K90 D;  1M46 A;  2KYF A;  1S6I A;  1DC1 A;  4IL1 A;  2KGB C;  1NCY A;  4QJ4 B;  1XYD A;  3NXA A;  1DJI A;  2I7A A;  1KK7 Y;  2MBX A;  4DUQ A;  3VGO A;  2JU0 A;  1UHN A;  4NDB A;  1XA5 A;  2OTG B;  2KHN A;  3ZWH A;  5HYD A;  1PSB A;  4PAL A;  2BNX A;  4PHK A;  3O4Y A;  1IKU A;  4MBE A;  2QEH A;  3SG4 A;  2P71 A;  1OW4 A;  1BR1 B;  1S5G Z;  3DVE A;  1UHH A;  2L98 A;  2QEB A;  4JKT A;  4MVF A;  3KPX A;  1B7T Z;  5FYX A;  2LLS A;  2NCO A;  4P5O E;  1ZOT B;  5D3O A;  2MLF C;  5HLV A;  2WC8 A;  2OPO A;  1J1D A;  2L50 A;  3NGV A;  2AUC A;  3D77 A;  2M97 A;  3UNW A;  1GQM A;  1YRU B;  2CXJ A;  2BCA A;  2EHB A;  1F4Q A;  4GFT A;  2LMU A;  3BUW B;  3EK7 A;  4MRX A;  3VRR A;  1C3Z A;  2BBM A;  2OTG C;  3S0G A;  1EG3 A;  2JUL A;  3DF0 A;  1JSA A;  1B8R A;  4BY5 A;  4I5J A;  1R6P A;  1YRT B;  2ZN8 A;  3DVK A;  4NDC A;  4HRE E;  1K2H A;  5EL2 A;  2F2P A;  1BJF A;  5G08 A;  1IJ6 A;  1TN4 A;  3FWB A;  2LMT A;  2CNP A;  2NZ0 A;  4YI9 A;  1XFW O;  1G33 A;  5DKN A;  2JPO A;  2EGD A;  2P70 A;  4BY4 A;  1AVS A;  2FJU B;  2HF5 A;  2WCF A;  1S5G Y;  4NDD A;  5I2O A;  1XFR A;  1NUB A;  4MRY A;  1DT7 B;  1JF2 A;  2Y1N A;  1NSH A;  1Y0V H;  1OOI X;  1Y1X A;  1OMD A;  2H8V A;  1OOF A;  1DJY A;  4ETO A;  1JC2 A;  1D1O A;  2JTZ A;  1CM1 A;  2LLU A;  3CAB A;  5D7F A;  1J55 A;  1MHO A;  3SIB A;  1W9Z A;  1DGU A;  3BUO B;  1WLM A;  2LCP A;  5HKW A;  1F4O A;  3PSR A;  3LK1 A;  3DD4 A;  3CZ2 A;  4FQO A;  2K61 A;  3QME A;  3VRQ A;  3IQO A;  1H8B A;  3QRX A;  3MSE B;  4C0J A;  2KAX A;  4AOM A;  3HX4 A;  1NPQ A;  1WRZ A;  3R72 A;  1QX7 A;  2WND A;  4OKH A;  5I2L A;  1UHJ A;  4PCW A;  5KSZ A;  3EVR A;  2AAO A;  3JVT B;  1FPW A;  4NQG A;  2M9G A;  2WC5 A;  4FQT A;  1Y1A A;  3WNX B;  2H61 C;  1KWO B;  2K7C A;  2Y1M A;  2E30 A;  1CDL A;  1CDP A;  1YR5 A;  1L2O B;  2G2B A;  1TCO B;  1IQ3 A;  1CLL A;  1CLM A;  1YX7 A;  3D0Y A;  1G8I A;  2KPH A;  2L5X B;  1XK4 A;  1XFX O;  3FE8 A;  2JPT A;  1QIV A;  4DS7 A;  2ZND A;  4TNC A;  2BKH B;  2O60 A;  3D78 A;  1TNQ A;  2B1U A;  3D74 A;  3I5F B;  2WCM A;  3I5H B;  1DQE A;  1UUR A;  1T14 A;  3PN7 B;  1C7V A;  2WOS A;  3IVT A;  3OB1 B;  3D76 A;  4R1E A;  3JVT C;  1J7O A;  1OQP A;  1YX8 A;  2KOT A;  1XO5 A;  3DVM A;  3NHT A;  3KO0 A;  3NSI A;  1NCZ A;  2LUC A;  4WQ3 A;  2PQL A;  2I2R E;  1L2O C;  4ORC B;  1BF5 A;  2ZRT A;  1DTL A;  5PAL A;  1J7P A;  1NX1 A;  1KFU S;  3RZS A;  1SBJ A;  4YGD B;  1B9A A;  3AKA A;  2RGI A;  1F54 A;  1FW4 A;  2KQ6 A;  2BKI B;  1N0Y A;  2MLE C;  2FCE A;  4PHM A;  3TDZ A;  2K60 A;  2KAY A;  4QJ5 B;  3RM1 A;  3GK4 X;  1MXE A;  3DF0 B;  3D73 A;  3I5F C;  1FF1 A;  4GUK A;  3I5H C;  5DKQ A;  2BE4 A;  3PN7 C;  3EKH A;  3LCP C;  1TOP A;  2WCH A;  2NCP A;  3CWG A;  4AQJ A;  2HQ8 A;  1GGW A;  2KBI A;  4U8D A;  3ICB A;  3H4S E;  1E8A A;  2FCD A;  1KCY A;  1TIZ A;  5I8N A;  3M0W A;  4M2O A;  1K96 A;  1DGV A;  1REC A;  5B8I B;  1SRA A;  1AHR A;  1BG1 A;  2K7D A;  2WC6 A;  1CKK A;  4C0L A;  2KNE A;  3AKB A;  2D8N A;  2K7B A;  3K1E A;  3B86 A;  4MLW A;  3R1O A;  2WCE A;  3CZ0 A;  3TUY B;  1ORG A;  2PMY A;  5K89 A;  1BT6 A;  2KYC A;  4A4B A;  1TNX A;  4I5N B;  1Z4H A;  1VRK A;  1CFP A;  4PHN A;  1SY9 A;  2JQ6 A;  2YGU A;  2LVJ A;  4PT1 A;  1QAS A;  1IGV A;  2L5Y A;  3BFA A;  4GNK B;  1IIO A;  1TUJ A;  1WRL A;  1DEK A;  2KFH A;  2ZKM X;  5FI6 A;  1SKT A;  1AP4 A;  1DJH A;  2K7O A;  1JF0 A;  1ZMZ A;  2CCM A;  2PAL A;  2JRF A;  3S0E A;  2AMI A;  1YVL A;  1KFU L;  1MWN A;  2M8U A;  5CPV A;  3TUY C;  3O4X A;  4INW A;  3B6X A;  1ZAC A;  1KFX S;  1B47 A;  1XFY O;  3PAT A;  1Y6W A;  5ER5 A;  3OX6 A;  1M39 A;  2MRD A;  1UHK A;  3KEV A;  2CBL A;  1S6C A;  3D0Y B;  2IS9 A;  4CFQ A;  2K8M B;  4P2Y B;  5JOL A;  3KF9 A;  4GAO A;  4CLN A;  1K8U A;  3BYA A;  2M49 B;  3I5I B;  1B8L A;  1PK0 D;  4CFR A;  1RFJ A;  3AAJ A;  1C3Y A;  4YI8 A;  1YVH A;  3V2L A;  4MSP A;  1C07 A;  1UHI A;  1KSM A;  1SCV A;  1K93 D;  1UWO A;  3DZT A;  4YRU A;  4ORB B;  2JOJ A;  4PE4 A;  3TZ1 A;  1A4P A;  2F33 A;  2JWW A;  1QV1 A;  3CS1 A;  1JFK A;  3E3R A;  4KYN A;  4OR9 B;  1N2D A;  3NHI A;  3SIA A;  2K0J A;  2JXC A;  5HL1 A;  1TUZ A;  1B7T Y;  1XK4 C;  3DY9 A;  2LE9 B;  1NX3 A;  1K94 A;  1LIN A;  1V1F A;  5HKY A;  1MQ1 A;  3I5I C;  4GPL B;  1QLK A;  1MXL C;  5CSN A;  1QAT A;  2BCX A;  1PAL A;  1ZFS A;  4M2Q A;  1ZUZ A;  2QEO A;  4I5L B;  4PHJ A;  5AEQ A;  4UPG A;  2MJW B;  1IG5 A;  1K9K A;  1OMR A;  2MHH A;  2V53 A;  3R1P A;  3VRO A;  2LAN A;  3EG5 B;  3BUN B;  3I5G C;  1FI6 A;  2PAS A;  2QEV A;  3CTN A;  3OGN A;  3BUX B;  1EJ3 A;  2HET A;  1CFF A;  1CTR A;  1CMF A;  1TWO A;  1Y1U A;  4YBH B;  1WLZ A;  1IJ5 A;  3NSO A;  1CB1 A;  2LM5 A;  1KFX L;  2KFF A;  1F70 A;  4CPV A;  3S0F A;  4XJK A;  1F8H A;  3L4A A;  5AXI A;  1QWV A;  1HT9 A;  2JNF A;  1G4Y R;  4MN0 A;  4F0Z B;  3RLZ A;  1NYA A;  2BE6 A;  2KI6 C;  5AAN A;  3BOW A;  2I94 A;  1HQV A;  2LC5 A;  1PVB A;  1CFD A;  2KLE A;  1LA0 A;  4OV2 A;  1UUS A;  1EXR A;  4DRW A;  1AUI B;  5BPJ A;  3O6B A;  1PVA A;  3CLN A;  3JTD B;  1OOH A;  3GK2 A;  4GGF A;  1OMV A;  3L47 A;  1DVI A;  1H4B A;  2M7N A;  2WOR A;  5JJG A;  2L2C A;  4N5X A;  2L0P A;  3N7H A;  1BOD A;  1TRF A;  4M2P A;  3SS5 A;  1K9P A;  4DCK A;  2M1U A;  4ZCU A;  5IBW A;  4MZK A;  2M1K B;  4PDZ A;  2GV5 A;  2M3W A;  4N1F A;  1JUO A;  2A4J A;  1CDN A;  4WQ2 A;  1BR4 B;  1QVI Z;  1S6J A;  2QPT A;  3BQ3 A;  1GGZ A;  2O5G A;  5DKR A;  1C7W A;  2LLT A;  1SK6 D;  2CT9 A;  3EVU A;  3PM8 A;  3JTD C;  1SCM B;  5FI7 A;  3CR4 X;  2WCJ A;  1YUU A;  1M45 A;  3D75 A;  4CID A;  2MA2 A;  3BFB A;  3VRN A;  2WCB A;  1OOG A;  1M31 A;  1W7I B;  4OCI A;  4MEW A;  1KK8 B;  1KK7 Z;  3BFH A;  3F45 A;  3SG7 A;  2G9B A;  2L2E A;  3IQQ A;  1QX5 B;  1IQ5 A;  1SPY A;  2LHL A;  2HPS A;  4YGA A;  1YUT A;  2JT0 A;  2PRU A;  3BXK A;  1BLQ A;  2PVB A;  3FE6 A;  1ODB A;  1IWQ A;  2E6W A;  1N65 A;  1WDC B;  3BUM B;  2KSP A;  1A03 A;  2KI6 D;  3FE9 A;  1KQM B;  1SCM C;  1QV0 A;  3OP0 A;  1S26 D;  2SCP A;  4C0K A; 
#chains in the Genus database with same CATH homology
 1KQV A;  3KHE A;  2BL0 B;  3SG5 A;  1QVI Y;  2KI4 B;  2LAP A;  2NLN A;  2BCB A;  3WHU B;  1CMG A;  1RK9 A;  2M7L A;  1KK8 C;  2KFG A;  4N1G A;  1NX0 A;  2JTT A;  1XFV O;  2ZFD A;  2KAV A;  2NXQ A;  2F3Y A;  2Q91 A;  3WHT B;  1EH2 A;  2F3Z A;  1YUS A;  1XVJ A;  2ISD A;  2VRG A;  1OE9 B;  1ALV A;  1OSA A;  5CSF A;  1IRJ A;  1WDC C;  1J7R A;  3A4U B;  5KTY A;  3OHM B;  4E68 A;  1NX2 A;  1CDM A;  1RJV A;  2LUX A;  1KSO A;  3K21 A;  4XJK B;  1S1E A;  1KQM C;  3LK0 A;  4AQI A;  1GJY A;  1X02 A;  1A75 A;  1AJ4 A;  1RTP 1;  2Q4U A;  2BL0 C;  1MF8 B;  1PRW A;  1QTX A;  2F2O A;  4WRI A;  2KI4 C;  3PLF B;  5ER4 X;  3NSK A;  3BOW B;  2Y5I A;  1DMO A;  3FWC A;  1FI5 A;  4PE0 A;  3SG6 A;  3EK8 A;  1SMG A;  2M0R A;  3CR2 A;  3SG3 A;  3O2P A;  1TTX A;  3I5G B;  3SG2 A;  2KQY A;  3C1V A;  3HCM A;  1J7Q A;  1SL9 A;  3LL8 B;  1OZS A;  3PFV A;  2JNX A;  1ALW A;  1QLS A;  2JZI A;  1JBA A;  1DF0 A;  1U5I A;  1V1G A;  4ZCV A;  5CSJ A;  1L7Z A;  3CR5 X;  4HRG A;  5J3X A;  5AFP A;  1S36 A;  1LVC D;  5I2Q A;  2Y4Q A;  2ZRS A;  3IF7 A;  3GK1 A;  4OVN F;  1JWD A;  5AER A;  1W7J B;  1DJX A;  4DIR A;  1WY9 A;  4HSZ A;  2K2A A;  2LHI A;  2ZNE A;  2PSR A;  2P6B B;  2BEC A;  3EKJ A;  1SYM A;  2EC6 B;  2I18 A;  4GGF C;  1QXP A;  1LKJ A;  2JT3 A;  1B8C A;  1CFC A;  2L4I A;  2KBM A;  3O78 A;  2R2I A;  1B4C A;  2KDH A;  1SR6 B;  3NSL A;  4HRH A;  5CSI A;  2M29 A;  3A8R A;  5HKZ A;  2GGZ A;  1F55 A;  3TDI A;  1OOJ A;  2LVK A;  2BBN A;  1DJW A;  1AK8 A;  2LMV A;  2HQW A;  3EK4 A;  4PE7 A;  2LP2 A;  2KGR A;  1DJZ A;  1LA3 A;  1NIW A;  4MZL A;  2L51 A;  1J1E A;  3OB2 B;  1SL7 A;  1YTZ C;  2H2K A;  2JT8 A;  1Q80 A;  4A4C A;  1MUX A;  2EC6 C;  1QJT A;  3CGA A;  1SNL A;  1FBV A;  1QIW A;  1RRO A;  1TNW A;  1UP5 A;  5F6T A;  2LP3 A;  1SR6 C;  2OS8 B;  4D1E A;  1JFJ A;  4ICB A;  2K2F A;  1BMO A;  1NP8 A;  1K9U A;  3D10 A;  1TNP A;  1QS7 A;  3TS5 B;  1A29 A;  4QJ3 B;  4YGB B;  4ORA B;  2CTN A;  5TNC A;  2SAS A;  2DOQ A;  1BU3 A;  1IH0 A;  4GBA A;  3AAK A;  4JQ0 D;  1A75 B;  1R2U A;  1PSR A;  3OX5 A;  4YGC B;  3EVV A;  2LVI A;  4JPZ B;  1B1G A;  1TCF A;  2QAC A;  1YUR A;  3ZNI A;  2OS8 C;  4XYN A;  2MAZ A;  1AJ5 A;  1KWO C;  2GGM A;  2JXL A;  1PUL A;  3TS5 C;  4YGE B;  3TDU A;  1QX2 A;  2JC2 A;  2LVV A;  4GGN A;  3PAL A;  2L4H A;  3SJS A;  4I5K A;  1RWY A;  2TN4 A;  3FS7 A;  1A2X A;  2F8P A;  2H61 A;  4MZJ A;  4PE1 A;  1OZO A;  5GQQ C;  1EG4 A;  1XFZ O;  1SL8 A;  3VRP A;  1DF0 B;  1U5I B;  1K95 A;  3FIA A;  3WXA A;  1MR8 A;  1NWD A;  2LV7 A;  1F71 A;  1S3P A;  1CLB A;  4FTG A;  5D69 A;  4L9M A;  1M63 B;  2COL B;  1CM4 A;  1LXF C;  5KU1 A;  1SW8 A;  4Q04 A;  5HLO A;  1DJG A;  3CZT X;  1WRK A;  3GOF A;  4USL A;  2LNK A;  2FOT A;  4JWQ A;  3DVJ A;  3LLE A;  1XFU O;  1NCX A;  1BOC A;  2ZN9 A;  1CNP A;  1EL4 A;  1K90 D;  1M46 A;  2KYF A;  1S6I A;  4IL1 A;  2KGB C;  1NCY A;  4QJ4 B;  1XYD A;  3NXA A;  1DJI A;  2I7A A;  1KK7 Y;  2MBX A;  4DUQ A;  3VGO A;  2JU0 A;  1UHN A;  4NDB A;  1XA5 A;  2OTG B;  2KHN A;  3ZWH A;  5HYD A;  1PSB A;  4PAL A;  4PHK A;  3O4Y A;  1IKU A;  4MBE A;  3SG4 A;  1BR1 B;  1S5G Z;  3DVE A;  1UHH A;  2L98 A;  4MVF A;  3KPX A;  1B7T Z;  5FYX A;  2LLS A;  2NCO A;  4P5O E;  1ZOT B;  5HLV A;  2MLF C;  2WC8 A;  2OPO A;  1J1D A;  2L50 A;  2AUC A;  2M97 A;  1GQM A;  1YRU B;  2CXJ A;  2BCA A;  2EHB A;  1F4Q A;  4GFT A;  2LMU A;  3BUW B;  3EK7 A;  4MRX A;  3VRR A;  2BBM A;  2OTG C;  1EG3 A;  2JUL A;  3DF0 A;  1JSA A;  1B8R A;  4BY5 A;  4I5J A;  1R6P A;  1YRT B;  2ZN8 A;  3DVK A;  4NDC A;  4HRE E;  1K2H A;  2F2P A;  1BJF A;  5G08 A;  1IJ6 A;  1TN4 A;  3FWB A;  2LMT A;  2CNP A;  2NZ0 A;  4YI9 A;  1XFW O;  1G33 A;  5DKN A;  2EGD A;  4BY4 A;  1AVS A;  2FJU B;  2HF5 A;  2WCF A;  1S5G Y;  4NDD A;  5I2O A;  1DT7 B;  1NUB A;  4MRY A;  1JF2 A;  2Y1N A;  1NSH A;  1Y0V H;  1Y1X A;  1OMD A;  1DJY A;  4ETO A;  1JC2 A;  1D1O A;  2JTZ A;  1CM1 A;  2LLU A;  5D7F A;  1J55 A;  1MHO A;  3SIB A;  1DGU A;  3BUO B;  1WLM A;  2LCP A;  5HKW A;  1F4O A;  3PSR A;  3LK1 A;  3DD4 A;  4FQO A;  2K61 A;  3VRQ A;  3IQO A;  1H8B A;  3QRX A;  3MSE B;  4C0J A;  2KAX A;  4AOM A;  3HX4 A;  1NPQ A;  1WRZ A;  1QX7 A;  2WND A;  4OKH A;  5I2L A;  1UHJ A;  4PCW A;  5KSZ A;  3EVR A;  2AAO A;  3JVT B;  1FPW A;  4NQG A;  2M9G A;  1Y1A A;  3WNX B;  2H61 C;  1KWO B;  2K7C A;  2Y1M A;  2E30 A;  1CDL A;  1CDP A;  1YR5 A;  1L2O B;  2G2B A;  1TCO B;  1IQ3 A;  1CLL A;  1CLM A;  1YX7 A;  3D0Y A;  1G8I A;  2L5X B;  1XK4 A;  1XFX O;  2JPT A;  1QIV A;  4DS7 A;  2ZND A;  4TNC A;  2BKH B;  2O60 A;  1TNQ A;  2B1U A;  3I5F B;  3I5H B;  1UUR A;  3PN7 B;  1C7V A;  2WOS A;  3OB1 B;  4R1E A;  3JVT C;  1J7O A;  1OQP A;  1YX8 A;  2KOT A;  1XO5 A;  3DVM A;  3KO0 A;  3NSI A;  1NCZ A;  2LUC A;  4WQ3 A;  2I2R E;  1L2O C;  4ORC B;  1BF5 A;  2ZRT A;  1DTL A;  5PAL A;  1J7P A;  1NX1 A;  1KFU S;  1SBJ A;  4YGD B;  1B9A A;  3AKA A;  2RGI A;  1F54 A;  1FW4 A;  2KQ6 A;  2BKI B;  1N0Y A;  2MLE C;  2FCE A;  4PHM A;  3TDZ A;  2KAY A;  4QJ5 B;  3RM1 A;  3GK4 X;  1MXE A;  3DF0 B;  3I5F C;  1FF1 A;  4GUK A;  3I5H C;  5DKQ A;  2BE4 A;  3PN7 C;  3EKH A;  3LCP C;  1TOP A;  2NCP A;  3CWG A;  4AQJ A;  2HQ8 A;  1GGW A;  2KBI A;  4U8D A;  3ICB A;  3H4S E;  1E8A A;  2FCD A;  1KCY A;  1TIZ A;  5I8N A;  3M0W A;  4M2O A;  1K96 A;  1DGV A;  1REC A;  5B8I B;  1SRA A;  1AHR A;  1BG1 A;  2K7D A;  1CKK A;  4C0L A;  2KNE A;  3AKB A;  2D8N A;  2K7B A;  4MLW A;  2WCE A;  3TUY B;  2PMY A;  5K89 A;  1BT6 A;  2KYC A;  4A4B A;  1TNX A;  4I5N B;  1VRK A;  1CFP A;  4PHN A;  1SY9 A;  2JQ6 A;  2LVJ A;  1QAS A;  1IGV A;  4GNK B;  1WRL A;  2KFH A;  2ZKM X;  1SKT A;  1AP4 A;  1DJH A;  2K7O A;  1JF0 A;  1ZMZ A;  2CCM A;  2PAL A;  2JRF A;  2AMI A;  1YVL A;  1KFU L;  1MWN A;  2M8U A;  5CPV A;  3TUY C;  1ZAC A;  1KFX S;  1B47 A;  1XFY O;  3PAT A;  1Y6W A;  5ER5 A;  3OX6 A;  1M39 A;  2MRD A;  1UHK A;  3KEV A;  2CBL A;  1S6C A;  3D0Y B;  2IS9 A;  4CFQ A;  2K8M B;  4P2Y B;  5JOL A;  3KF9 A;  4GAO A;  4CLN A;  1K8U A;  3BYA A;  2M49 B;  3I5I B;  1B8L A;  1PK0 D;  4CFR A;  1RFJ A;  3AAJ A;  4YI8 A;  1YVH A;  4MSP A;  1C07 A;  1UHI A;  1KSM A;  1SCV A;  1K93 D;  1UWO A;  4YRU A;  4ORB B;  2JOJ A;  4PE4 A;  3TZ1 A;  1A4P A;  2F33 A;  2JWW A;  1QV1 A;  3CS1 A;  1JFK A;  3E3R A;  4OR9 B;  1N2D A;  3SIA A;  2K0J A;  2JXC A;  1B7T Y;  1XK4 C;  2LE9 B;  1NX3 A;  1K94 A;  1LIN A;  1V1F A;  5HKY A;  1MQ1 A;  3I5I C;  4GPL B;  1QLK A;  1MXL C;  5CSN A;  1QAT A;  2BCX A;  1PAL A;  1ZFS A;  4M2Q A;  1ZUZ A;  4I5L B;  5AEQ A;  4PHJ A;  4UPG A;  2MJW B;  1IG5 A;  1K9K A;  1OMR A;  2MHH A;  2V53 A;  3VRO A;  2LAN A;  3BUN B;  3I5G C;  1FI6 A;  2PAS A;  3CTN A;  3BUX B;  1EJ3 A;  2HET A;  1CFF A;  1CTR A;  1CMF A;  1Y1U A;  4YBH B;  1WLZ A;  1IJ5 A;  3NSO A;  1CB1 A;  2LM5 A;  1KFX L;  2KFF A;  1F70 A;  4CPV A;  4XJK A;  1F8H A;  5AXI A;  1HT9 A;  2JNF A;  1G4Y R;  4MN0 A;  4F0Z B;  3RLZ A;  1NYA A;  2BE6 A;  2KI6 C;  5AAN A;  3BOW A;  2I94 A;  1HQV A;  2LC5 A;  1PVB A;  1CFD A;  1LA0 A;  4OV2 A;  1UUS A;  1EXR A;  4DRW A;  1AUI B;  5BPJ A;  3O6B A;  1PVA A;  3CLN A;  3JTD B;  3GK2 A;  4GGF A;  1OMV A;  1DVI A;  1H4B A;  2M7N A;  2WOR A;  5JJG A;  4N5X A;  2L0P A;  1BOD A;  1TRF A;  4M2P A;  1K9P A;  4DCK A;  2M1U A;  4ZCU A;  5IBW A;  4MZK A;  2M1K B;  4PDZ A;  2GV5 A;  2M3W A;  4N1F A;  1JUO A;  2A4J A;  1CDN A;  4WQ2 A;  1BR4 B;  1QVI Z;  1S6J A;  2QPT A;  3BQ3 A;  1GGZ A;  2O5G A;  5DKR A;  1C7W A;  2LLT A;  1SK6 D;  2CT9 A;  3EVU A;  3PM8 A;  3JTD C;  1SCM B;  3CR4 X;  1YUU A;  1M45 A;  4CID A;  2MA2 A;  3VRN A;  2WCB A;  1M31 A;  1W7I B;  4OCI A;  4MEW A;  1KK8 B;  1KK7 Z;  3F45 A;  3SG7 A;  2G9B A;  2L2E A;  3IQQ A;  1QX5 B;  1IQ5 A;  1SPY A;  2LHL A;  2HPS A;  4YGA A;  1YUT A;  2JT0 A;  2PRU A;  3BXK A;  1BLQ A;  2PVB A;  1ODB A;  1IWQ A;  2E6W A;  1N65 A;  1WDC B;  3BUM B;  2KSP A;  1A03 A;  2KI6 D;  1KQM B;  1SCM C;  1QV0 A;  3OP0 A;  1S26 D;  2SCP A;  4C0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...