1F8HA

Structure of the second eps15 homology domain of human eps15 in complex with ptgssstnpfr
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR SUBSTRATE 15
publication title Molecular mechanism of NPF recognition by EH domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2000-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f8hA00
1SBJA 3AAJA 1RJVA 4NDCA 3CR2A 2L98A 4MRXA 3KO0A 4XYNA 3PSRA 5D7FA 2LM5A 2E30A 1RWYA 1QXPA 4L9MA 1B4CA 1LKJA 2LC5A 2FJUB 1NP8A 1YVHA 2JOJA 4GAOA 4M2OA 5ER4X 4DS7A 1CLMA 1M31A 1MR8A 1H8BA 3MSEB 3FS7A 4PE0A 2FCDA 2MA2A 1MQ1A 2P6BB 3VRRA 5KTYA 1S26D 2M3WA 4C0LA 1WRLA 2GGZA 1KQMC 2KFGA 2JRFA 4MN0A 4ORCB 1IWQA 3EK4A 4DRWA 2Y5IA 5GQQC 4ETOA 1IQ3A 1TCFA 3SJSA 1J7QA 5FYXA 1F8HA 4I5KA 1QLSA 1R6PA 1UWOA 4C0KA 1BODA 1BJFA 2LHLA 2B1UA 1CM4A 2EGDA 1L2OC 3O78A 5BPJA 1HQVA 3LLEA 1JUOA 3BUWB 1YTZC 1NYAA 2QPTA 2TN4A 3K21A 4MZLA 2M29A 2OTGC 1K9PA 1PSRA 2LUXA 3KEVA 3BUNB 1FPWA 2KI4B 1MUXA 2JT3A 5G08A 1DJZA 1B7TY 1ZUZA 3I5GB 3AKAA 2I18A 1B8LA 2KGRA 4Q04A 2M97A 3CWGA 2L4IA 1A29A 2SASA 2L51A 2K7DA 3I5FC 3HCMA 1BT6A 3GOFA 1KCYA 1TCOB 2LAPA 1F4OA 1NPQA 1YVLA 1CDPA 5DKQA 1SR6C 2M1KB 1QVIZ 2BKHB 4HREE 2RGIA 1C7WA 1WY9A 2F8PA 4PHMA 3AKBA 2CNPA 4GBAA 3VROA 2BKIB 2WOSA 3EVVA 3LK1A 4I5LB 1XFVO 4PCWA 3BUOB 5K89A 2LE9B 3HX4A 2L50A 2PALA 1FI5A 4P5OE 3I5HC 3QRXA 1F55A 1CM1A 5HKYA 1G4YR 1IKUA 2JWWA 3EK8A 4PDZA 1TTXA 1SCMB 4OCIA 2JU0A 1KK7Z 1MXLC 2KAVA 1M45A 1TIZA 2LNKA 1A03A 3O2PA 5JOLA 2GV5A 5I2OA 3VRPA 2BCBA 2KYCA 2LHIA 2WCBA 3TDIA 1BOCA 1WRKA 2EC6B 1L7ZA 1WLZA 4YGCB 1A2XA 1JF2A 2ZN9A 3JVTC 5AANA 3LCPC 1PVBA 1GQMA 1N65A 1DJXA 4FQOA 3TS5C 3SG3A 1GJYA 2LANA 2G9BA 3NXAA 1CLLA 2M7LA 2EC6C 3CTNA 2KHNA 1ZOTB 2JZIA 1DGVA 1WDCC 2JXLA 1PRWA 4ZCUA 2KOTA 2Y1MA 2BE4A 4I5JA 1SNLA 1J7RA 2M1UA 2NXQA 1ALVA 1RK9A 1CMGA 1IH0A 5PALA 1F71A 1K2HA 4AOMA 2HQWA 1KFUL 1PULA 1NX0A 1LVCD 2AUCA 2KGBC 3OB2B 2LUCA 3PLFB 4OV2A 1F70A 1NX3A 2HETA 1S6CA 1VRKA 1XK4C 2CBLA 1IG5A 4NDDA 5I2QA 1WLMA 1B8CA 1AP4A 4PE7A 4A4CA 4AQIA 4CIDA 3A8RA 3CZTX 4MVFA 2NLNA 4QJ5B 2VRGA 3IQQA 2A4JA 5AFPA 2H61A 4YI9A 1B1GA 4YRUA 2MJWB 2KBMA 1QATA 2Q91A 2KNEA 1K94A 1XYDA 4DIRA 1KQMB 2CXJA 2LLTA 4PE1A 5ER5A 5J3XA 5CSIA 5HLOA 1D1OA 4HRGA 1DJGA 4PHNA 2MLEC 1SL7A 2WNDA 1KSMA 4YGBB 1CNPA 2HF5A 1L2OB 5HKZA 1OQPA 1OMDA 3I5IB 3M0WA 1KK7Y 3CR4X 3PALA 1BU3A 1QV0A 5CSJA 4UPGA 3OP0A 1QX7A 2LCPA 5KSZA 2LVVA 2L2EA 1F4QA 1CFDA 1DF0B 2OTGB 1ZACA 1WRZA 3BOWA 4XJKA 1Y1XA 2KAYA 1ZFSA 2L5XB 2MHHA 1J7OA 2E6WA 3OHMB 1NX1A 1CFCA 2EHBA 1NUBA 3FWCA 3NSKA 1DTLA 1YUTA 3I5IC 1OMRA 1Y0VH 3D0YB 1JF0A 1C07A 4OVNF 3WHTB 3C1VA 3GK1A 4QJ4B 2FOTA 2K2FA 3I5FB 1TNXA 2JTZA 4MLWA 1EG3A 3BUXB 4U8DA 2F2OA 2WCEA 1QTXA 4MEWA 1TNWA 1QV1A 1KFXL 5CSNA 1M63B 1SR6B 2JPTA 2K7CA 3DF0B 2I2RE 1KK8C 1QIWA 1NX2A 1S6JA 1H4BA 1FBVA 3D10A 2PSRA 4ORAB 4GNKB 1KFUS 2KQYA 1M46A 2LLSA 1DJYA 1M39A 2K0JA 4ZCVA 2SCPA 1SL8A 4C0JA 3IQOA 2O60A 1DT7B 4GUKA 2PMYA 1NCZA 1QIVA 2BCAA 2KFFA 1XVJA 1NCXA 1QASA 1U5IB 2OS8C 2I7AA 3I5HB 1KSOA 5HLVA 1MWNA 1OZOA 2DOQA 1BF5A 2M8UA 3FIAA 1YRTB 3EK7A 2LV7A 4JWQA 1PVAA 1S5GY 4N5XA 1E8AA 1V1GA 1SW8A 3NSLA 1DMOA 2F33A 1YURA 3DD4A 4ORBB 2JT0A 3JVTB 1UUSA 2BECA 1JFJA 1G33A 3TDZA 3TS5B 1DJWA 2LMTA 2KBIA 1LINA 1CDLA 1CDNA 2LLUA 1SL9A 1MXEA 1UHIA 1FF1A 4P2YB 2M9GA 5AERA 1UHKA 1WDCB 3SIBA 2MAZA 1TNQA 2BCXA 5F6TA 4CLNA 2KDHA 1QS7A 3CGAA 1PALA 1XO5A 3TUYC 4GGFC 4PALA 4R1EA 1QX5B 1A75B 4N1GA 1W7IB 5B8IB 1JSAA 2O5GA 1JC2A 5TNCA 3O4YA 1KFXS 4YGDB 3ZNIA 1B8RA 1UHNA 1RFJA 1TRFA 5D69A 1C7VA 3VGOA 4CFRA 1CKKA 3NSIA 1AJ4A 5HYDA 3FWBA 1OZSA 1EJ3A 1RTP1 3LK0A 1XFUO 2LVKA 1J1EA 2KYFA 1ALWA 1RROA 1AK8A 5AEQA 2LMVA 4CPVA 1K9UA 1XFZO 4N1FA 2JT8A 3PFVA 4YBHB 3H4SE 2JQ6A 1KWOC 2H61C 3BUMB 1B47A 4JQ0D 4WQ2A 2K8MB 1Q80A 1DJHA 1IGVA 3WXAA 1UHHA 1DVIA 1UURA 3WHUB 1CMFA 4PE4A 1AHRA 1S5GZ 5IBWA 3SIAA 1LA3A 2AMIA 1J7PA 1YUUA 2HQ8A 2WCFA 2L4HA 1DJIA 3EKJA 1MHOA 4OKHA 1K93D 1XFWO 1ODBA 2MBXA 1BR1B 2JNFA 1QLKA 1YR5A 2HPSA 4TNCA 2JC2A 2D8NA 3A4UB 1JBAA 2FCEA 4CFQA 1V1FA 1IJ6A 4JPZB 5JJGA 1YUSA 3O6BA 2QACA 3NSOA 2K2AA 1EL4A 1SYMA 1Y1UA 1PK0D 4DUQA 1N0YA 1OMVA 2V53A 3DVJA 3PM8A 1R2UA 1SRAA 3JTDC 1CB1A 4BY5A 1JWDA 1LA0A 3PATA 4USLA 5HKWA 3CLNA 1KK8B 1UP5A 1XA5A 2F3ZA 2LVIA 3SG7A 2CT9A 4NDBA 5CSFA 1SY9A 4QJ3B 2BBNA 1SPYA 1PSBA 2IS9A 3GK2A 1ZMZA 2PASA 3DVKA 1KQVA 1JFKA 2K7BA 2MLFC 2ZRTA 2LVJA 4MZJA 4I5NB 2K61A 3EVUA 2M7NA 4YI8A 4PHJA 4GPLB 1OSAA 3OB1B 2OPOA 3IF7A 1S1EA 1XFYO 2OS8B 1G8IA 1K8UA 1HT9A 4DCKA 3DVEA 2L0PA 3LL8B 1BG1A 1K90D 4F0ZB 2Y4QA 4A4BA 1DF0A 2F3YA 2NCOA 1J1DA 2G2BA 1GGWA 2ISDA 2CTNA 5I2LA 1S3PA 3VRQA 3VRNA 4BY4A 1DGUA 4M2PA 1S36A 4GGNA 1TNPA 1FW4A 2CCMA 3D0YA 2KI4C 1QX2A 2JULA 2COLB 3DVMA 4M2QA 2ZRSA 4WRIA 3I5GC 5DKNA 3TZ1A 2R2IA 2LP3A 1K96A 2ZFDA 3F45A 5CPVA 3GK4X 1AUIB 1CTRA 3PN7B 2Y1NA 2ZKMX 1MF8B 2WC8A 4FTGA 1AVSA 1TN4A 3DF0A 2BBMA 3RM1A 2KSPA 2MRDA 1CDMA 2KQ6A 2WORA 2BL0B 3TUYB 1GGZA 4D1EA 1XFXO 1TOPA 1X02A 2JTTA 2ZN8A 1YX8A 3ICBA 1UHJA 2JXCA 1NIWA 2Q4UA 3PN7C 1W7JB 3E3RA 3SG5A 1J55A 3SG4A 3BQ3A 3CR5X 4GFTA 2BL0C 1IJ5A 2I94A 2NZ0A 1U5IA 2M0RA 3AAKA 1A4PA 4HRHA 2ZNDA 2H2KA 1SCVA 2F2PA 4OR9B 3WNXB 1CFPA 1K95A 2KAXA 4HSZA 1CLBA 1YX7A 1SKTA 2KI6C 3OX6A 3CS1A 2LMUA 3BYAA 1Y1AA 2PVBA 4AQJA 1SCMC 1KWOB 3OX5A 2KFHA 2JNXA 1B9AA 1QJTA 4WQ3A 4MRYA 3RLZA 3ZWHA 1S6IA 3SG2A 2BE6A 1F54A 4MBEA 1LXFC 1IQ5A 1Y6WA 2K7OA 2PRUA 2NCPA 3KF9A 2M49B 1N2DA 4MZKA 5DKRA 3KHEA 1SMGA 4E68A 3SG6A 1B7TZ 4PHKA 5KU1A 4GGFA 4ICBA 1RECA 4MSPA 1IRJA 1AJ5A 3EVRA 2LP2A 2AAOA 3KPXA 1NCYA 1NSHA 1BLQA 3TDUA 1BR4B 1BMOA 1YRUB 1OOJA 1SK6D 4IL1A 3BXKA 1EH2A 3BOWB 4XJKB 1K9KA 5I8NA 4YGAA 1EXRA 1FI6A 1CFFA 1A75A 4NQGA 1XK4A 5AXIA 1QVIY 1OE9B 2GGMA 3EKHA 3JTDB 2KI6D 4YGEB 1EG4A 2ZNEA 1NWDA
chains in the Genus database with same CATH superfamily
1DC1A 1SBJA 3AAJA 1RJVA 4NDCA 3CR2A 3BFBA 2L98A 4MRXA 3KO0A 4XYNA 3PSRA 5D7FA 2LM5A 3L47A 2E30A 1RWYA 1QXPA 4L9MA 1B4CA 1LKJA 2LC5A 2FJUB 4OZDA 1NP8A 1YVHA 2JOJA 4GAOA 4M2OA 5ER4X 4DS7A 1CLMA 1M31A 1MR8A 1H8BA 3MSEB 3FS7A 4PE0A 2FCDA 2MA2A 1MQ1A 2P6BB 3B7AA 4IJ7A 3VRRA 1S26D 2FJYA 2M3WA 4C0LA 5KTYA 1WRLA 2GGZA 3QMEA 1OOIX 1KQMC 2KFGA 2JRFA 4MN0A 4INWA 1IWQA 3EK4A 4ORCB 2Y5IA 5GQQC 4DRWA 4ETOA 5I94A 1IQ3A 1TCFA 1Z4HA 3SJSA 5FYXA 1J7QA 4I5KA 1QLSA 1R6PA 1UWOA 5EL2A 4C0KA 1BJFA 2LHLA 1BODA 2B1UA 1CM4A 2EGDA 1L2OC 3O4XA 3O78A 5BPJA 1HQVA 3LLEA 1JUOA 3N7HA 2WC5A 1DQEA 1YTZC 3BUWB 1NYAA 2QPTA 2TN4A 3K21A 4MZLA 2M29A 1TUJA 2OTGC 1K9PA 1PSRA 2LUXA 3KEVA 3BUNB 1FPWA 2KI4B 1MUXA 2JT3A 5G08A 1DJZA 1B7TY 1ZUZA 2BAPA 3I5GB 3AKAA 2I18A 1B8LA 2KGRA 2KLEA 4FQTA 4Q04A 2M97A 3CWGA 2L4IA 3PM2A 1A29A 2SASA 2L51A 2K7DA 3I5FC 3HCMA 1BT6A 3GOFA 1KCYA 3CZ0A 1TCOB 2LAPA 4JKTA 1F4OA 1NPQA 1YVLA 1CDPA 5DKQA 1SR6C 2M1KB 1QVIZ 2BKHB 4HREE 2RGIA 1C3ZA 1C7WA 1T14A 1WY9A 2F8PA 3CYZA 4PHMA 3AKBA 1C3YA 2CNPA 2P71A 2QDIA 4GBAA 3VROA 2BKIB 2WOSA 3EVVA 3LK1A 4I5LB 1XFVO 4PCWA 3BUOB 5K89A 2WCJA 2LE9B 3HX4A 2L50A 2PALA 1FI5A 4P5OE 2P70A 3I5HC 3QRXA 1F55A 1SSEB 1CM1A 5HKYA 1G4YR 1IKUA 2JWWA 3EK8A 4PDZA 1SCMB 1TTXA 1Z2CB 1LS8A 3DZTA 4OCIA 2JU0A 1KK7Z 1MXLC 2KAVA 1M45A 1TIZA 2LNKA 1A03A 3O2PA 5JOLA 2GV5A 5I2OA 3VRPA 2BCBA 2KYCA 2BNXA 2LHIA 3NHTA 2WCBA 3TDIA 1BOCA 1WRKA 2EC6B 1L7ZA 1WLZA 4YGCB 1A2XA 1JF2A 2ZN9A 3JVTC 5AANA 3LCPC 1PVBA 1GQMA 3Q8IA 1N65A 1DJXA 4FQOA 3TS5C 3SG3A 1GJYA 3K1EA 2LANA 2KPHA 2G9BA 3D74A 3NXAA 1CLLA 3R72A 5FI2A 2M7LA 2EC6C 3CTNA 2KHNA 1ZOTB 2JZIA 1DGVA 1WDCC 2JXLA 1PRWA 4F7FA 2ERBA 4ZCUA 2KOTA 2Y1MA 2BE4A 4I5JA 1SNLA 1J7RA 2M1UA 2JPOA 2H8VA 2NXQA 1ALVA 1RK9A 1CMGA 1IH0A 5PALA 1F71A 1K2HA 3R1VA 3DYEA 4AOMA 2HQWA 1KFUL 1PULA 1NX0A 1LVCD 2AUCA 2KGBC 3OB2B 2LUCA 3CABA 3PLFB 4OV2A 3IVTA 3S0EA 1F70A 1NX3A 2HETA 1S6CA 1VRKA 1XK4C 3D78A 2CBLA 1IG5A 4NDDA 5I2QA 1WLMA 1B8CA 1AP4A 3S0BA 4PE7A 4A4CA 3PJIA 4AQIA 4CIDA 3A8RA 3CZTX 4MVFA 2NLNA 4QJ5B 2VRGA 3IQQA 2A4JA 5AFPA 2H61A 4YI9A 1B1GA 4YRUA 2MJWB 3S0FA 2KBMA 1QATA 2Q91A 2KNEA 2WCMA 4INXA 1K94A 1XYDA 4DIRA 1KQMB 2CXJA 2LLTA 4PE1A 5ER5A 5J3XA 5CSIA 5HLOA 1D1OA 4HRGA 1DJGA 2GTEA 4PHNA 2MLEC 1SL7A 5FI7A 2WCLA 2WNDA 1KSMA 4YGBB 1CNPA 2HF5A 1L2OB 2QEBA 5HKZA 1OQPA 3D77A 1OMDA 3I5IB 3M0WA 1KK7Y 3CR4X 3PALA 1BU3A 1QV0A 5CSJA 4UPGA 3OP0A 1QX7A 2LCPA 5KSZA 2LVVA 2L2EA 1F4QA 1CFDA 1DF0B 2OTGB 1ZACA 1WRZA 3BOWA 4XJKA 1Y1XA 2KAYA 1ZFSA 2L5XB 2MHHA 3SS3A 1J7OA 2E6WA 3OHMB 1NX1A 2WCHA 1CFCA 2EHBA 1NUBA 3FWCA 3NSKA 1DTLA 1YUTA 3I5IC 1OMRA 1Y0VH 3D0YB 1JF0A 3FE9A 1C07A 4OVNF 3B86A 3WHTB 3C1VA 3GK1A 4QJ4B 2FOTA 2K2FA 3I5FB 1TNXA 2JTZA 4MLWA 1EG3A 3BUXB 4U8DA 1IIOA 2F2OA 2WCEA 1QTXA 4MEWA 1QWVA 1TNWA 3UNWA 1QV1A 1KFXL 5CSNA 1M63B 1SR6B 2JPTA 2K7CA 3DF0B 3R1OA 2I2RE 1KK8C 1QIWA 1NX2A 1S6JA 1H4BA 1FBVA 3S0AA 3D10A 2PSRA 4ORAB 4GNKB 1KFUS 2KQYA 1M46A 2LLSA 1DJYA 1M39A 2K0JA 4ZCVA 2SCPA 1SL8A 4C0JA 3IQOA 2O60A 1DT7B 4GUKA 1XFRA 2PMYA 1F8HA 1NCZA 1QIVA 2BCAA 2KFFA 1XVJA 1NCXA 1QASA 1U5IB 2OS8C 2I7AA 3I5HB 1KSOA 3OBVA 5HLVA 1MWNA 1OZOA 2DOQA 1BF5A 2M8UA 1OOFA 3FIAA 1YRTB 3EK7A 2LV7A 1ORGA 2KLDA 4JWQA 3L4LA 1PVAA 1S5GY 4JD9A 4N5XA 1E8AA 1V1GA 1SW8A 3NSLA 3DY9A 1GM0A 1DMOA 2F33A 1YURA 3DD4A 4ORBB 3SS5A 2JT0A 3JVTB 1UUSA 2BECA 1JFJA 1G33A 3TDZA 3TS5B 1DJWA 2LMTA 2KBIA 3CDNA 1LINA 1CDLA 1CDNA 3DXLA 2LLUA 1SL9A 3CZ1A 1MXEA 1UHIA 1FF1A 4P2YB 2M9GA 5AERA 1UHKA 1WDCB 3D75A 3SIBA 2MAZA 1TNQA 2BCXA 5F6TA 4CLNA 2KDHA 1QS7A 3CGAA 1PALA 1XO5A 3TUYC 5D3OA 3UO9A 4GGFC 4PALA 4R1EA 1QX5B 1A75B 5DICA 3D73A 4PT1A 4N1GA 1W7IB 5B8IB 1JSAA 2O5GA 1JC2A 5TNCA 3O4YA 3V2LA 1KFXS 4YGDB 3ZNIA 1B8RA 1UHNA 2WCKA 1RFJA 1TRFA 5D69A 1C7VA 3VGOA 4CFRA 1CKKA 3NSIA 1AJ4A 5HYDA 3FWBA 1OZSA 1EJ3A 1RTP1 3LK0A 1XFUO 2LVKA 3B88A 1J1EA 3B87A 2KYFA 1ALWA 1RROA 1AK8A 5AEQA 2LMVA 4CPVA 1K9UA 1XFZO 4N1FA 2JT8A 3PFVA 4YBHB 3H4SE 2JQ6A 1KWOC 2H61C 3BUMB 1B47A 4JQ0D 4WQ2A 2K8MB 1Q80A 3OGNA 1DJHA 1IGVA 3WXAA 1UHHA 1DVIA 1UURA 3WHUB 1CMFA 4PE4A 1AHRA 1S5GZ 5IBWA 3SIAA 1LA3A 2AMIA 1J7PA 1TUZA 1YUUA 2HQ8A 2WCFA 2L4HA 1DJIA 3EKJA 1MHOA 4OKHA 1K93D 1XFWO 1ODBA 3EG5B 2MBXA 1BR1B 2JNFA 1QLKA 1YR5A 2HPSA 4TNCA 2JC2A 2D8NA 3A4UB 1JBAA 2FCEA 4CFQA 1V1FA 1IJ6A 4JPZB 5JJGA 1YUSA 3O6BA 2QACA 3NSOA 2K2AA 1EL4A 1SYMA 1W9ZA 1Y1UA 1PK0D 5FI6A 3VB1A 1TWOA 3NGVA 4DUQA 1N0YA 1DELA 1OMVA 2V53A 2L2CA 3DVJA 1R2UA 1SRAA 3PM8A 3JTDC 1CB1A 4BY5A 1JWDA 1LA0A 3PATA 3CZ2A 4USLA 5HKWA 1OOHA 1KK8B 3CLNA 1UP5A 1XA5A 2F3ZA 2LVIA 3SG7A 2CT9A 2QEHA 4NDBA 5CSFA 1SY9A 4QJ3B 3L4AA 2BBNA 1SPYA 1PSBA 2IS9A 3GK2A 1ZMZA 2PASA 3DVKA 1KQVA 1JFKA 2K7BA 2MLFC 2ZRTA 2LVJA 4MZJA 4I5NB 2K61A 3EVUA 2M7NA 4YI8A 2YGUA 4PHJA 4GPLB 1OSAA 3OB1B 2OPOA 3IF7A 1S1EA 1XFYO 2OS8B 1G8IA 1K8UA 1HT9A 2K60A 4DCKA 3DVEA 2L0PA 3LL8B 1BG1A 1K90D 4F0ZB 2Y4QA 4A4BA 1DF0A 2F3YA 2NCOA 1J1DA 2G2BA 1GGWA 2ISDA 2CTNA 5I2LA 1S3PA 3VRQA 3VRNA 3FE6A 4BY4A 1DGUA 4M2PA 1S36A 4GGNA 1TNPA 1FW4A 2CCMA 3D0YA 2KI4C 1QX2A 2JULA 2COLB 3DVMA 4M2QA 2ZRSA 4WRIA 3RZSA 3I5GC 5DKNA 3TZ1A 2R2IA 2LP3A 1K96A 2ZFDA 3F45A 5CPVA 3GK4X 1AUIB 1CTRA 3PN7B 2Y1NA 2ZKMX 1MF8B 2WC8A 4FTGA 1AVSA 1TN4A 3DF0A 2BBMA 3RM1A 2KSPA 2MRDA 1CDMA 2KQ6A 2WORA 2BL0B 4KYNA 3TUYB 1GGZA 4D1EA 1XFXO 1TOPA 1X02A 2JTTA 2ZN8A 1YX8A 3ICBA 1UHJA 2JXCA 5HL1A 1NIWA 2Q4UA 3PN7C 1W7JB 1OOGA 3E3RA 1J55A 3SG5A 3SG4A 3BQ3A 3CR5X 4GFTA 2BL0C 1IJ5A 2I94A 2NZ0A 3D76A 1U5IA 3BFHA 3S0GA 2M0RA 3AAKA 1A4PA 4HRHA 2ZNDA 2H2KA 1SCVA 2F2PA 4OR9B 3WNXB 1CFPA 1K95A 2KAXA 4HSZA 1CLBA 1YX7A 1SKTA 2KI6C 3OX6A 3CS1A 2L5YA 3SS4A 2LMUA 3BYAA 1Y1AA 2PVBA 4AQJA 1SCMC 1KWOB 3OX5A 2KFHA 2JNXA 1B9AA 1QJTA 4WQ3A 3S0DA 3BJHA 4MRYA 3FE8A 3RLZA 3ZWHA 1P28A 1S6IA 3SG2A 2BE6A 2WC6A 1F54A 4MBEA 1LXFC 1IQ5A 1Y6WA 2K7OA 2PRUA 2NCPA 2PYQA 2M49B 1N2DA 3KF9A 4MZKA 3KHEA 1SMGA 5DKRA 1OW4A 1B7TZ 4PHKA 3SG6A 4E68A 5KU1A 4GGFA 4ICBA 1RECA 2QEVA 4MSPA 1IRJA 1AJ5A 3EVRA 2LP2A 2AAOA 3KPXA 1NCYA 1NSHA 2QEOA 1BLQA 3TDUA 1BR4B 1BMOA 1YRUB 1OOJA 1SK6D 4IL1A 3BXKA 1EH2A 3BOWB 4XJKB 1K9KA 5I8NA 4YGAA 1EXRA 1FI6A 1CFFA 1A75A 4NQGA 1DEKA 1XK4A 3B6XA 1QVIY 5AXIA 3NHIA 1OE9B 2GGMA 3R1PA 3EKHA 3BFAA 2KI6D 3JTDB 4YGEB 1EG4A 2PQLA 2ZNEA 1NWDA
chains in the Genus database with same CATH topology
1SBJA 3AAJA 1RJVA 4NDCA 3CR2A 2L98A 4MRXA 3KO0A 4XYNA 3PSRA 5D7FA 2LM5A 2E30A 1RWYA 1QXPA 4L9MA 1B4CA 1LKJA 2LC5A 2FJUB 1NP8A 1YVHA 2JOJA 4GAOA 4M2OA 5ER4X 4DS7A 1CLMA 1M31A 1MR8A 1H8BA 3MSEB 3FS7A 4PE0A 2FCDA 2MA2A 1MQ1A 2P6BB 3VRRA 5KTYA 1S26D 2M3WA 4C0LA 1WRLA 2GGZA 1KQMC 2KFGA 2JRFA 4MN0A 4ORCB 1IWQA 3EK4A 4DRWA 2Y5IA 5GQQC 4ETOA 1IQ3A 1TCFA 3SJSA 1J7QA 5FYXA 1F8HA 4I5KA 1QLSA 1R6PA 1UWOA 4C0KA 1BODA 1BJFA 2LHLA 2B1UA 1CM4A 2EGDA 1L2OC 3O78A 5BPJA 1HQVA 3LLEA 1JUOA 3BUWB 1YTZC 1NYAA 2QPTA 2TN4A 3K21A 4MZLA 2M29A 2OTGC 1K9PA 1PSRA 2LUXA 3KEVA 3BUNB 1FPWA 2KI4B 1MUXA 2JT3A 5G08A 1DJZA 1B7TY 1ZUZA 3I5GB 3AKAA 2I18A 1B8LA 2KGRA 4Q04A 2M97A 3CWGA 2L4IA 1A29A 2SASA 2L51A 2K7DA 3I5FC 3HCMA 1BT6A 3GOFA 1KCYA 1TCOB 2LAPA 1F4OA 1NPQA 1YVLA 1CDPA 5DKQA 1SR6C 2M1KB 1QVIZ 2BKHB 4HREE 2RGIA 1C7WA 1WY9A 2F8PA 4PHMA 3AKBA 2CNPA 4GBAA 3VROA 2BKIB 2WOSA 3EVVA 3LK1A 4I5LB 1XFVO 4PCWA 3BUOB 5K89A 2LE9B 3HX4A 2L50A 2PALA 1FI5A 4P5OE 3I5HC 3QRXA 1F55A 1CM1A 5HKYA 1G4YR 1IKUA 2JWWA 3EK8A 4PDZA 1TTXA 1SCMB 4OCIA 2JU0A 1KK7Z 1MXLC 2KAVA 1M45A 1TIZA 2LNKA 1A03A 3O2PA 5JOLA 2GV5A 5I2OA 3VRPA 2BCBA 2KYCA 2LHIA 2WCBA 3TDIA 1BOCA 1WRKA 2EC6B 1L7ZA 1WLZA 4YGCB 1A2XA 1JF2A 2ZN9A 3JVTC 5AANA 3LCPC 1PVBA 1GQMA 1N65A 1DJXA 4FQOA 3TS5C 3SG3A 1GJYA 2LANA 2G9BA 3NXAA 1CLLA 2M7LA 2EC6C 3CTNA 2KHNA 1ZOTB 2JZIA 1DGVA 1WDCC 2JXLA 1PRWA 4ZCUA 2KOTA 2Y1MA 2BE4A 4I5JA 1SNLA 1J7RA 2M1UA 2NXQA 1ALVA 1RK9A 1CMGA 1IH0A 5PALA 1F71A 1K2HA 4AOMA 2HQWA 1KFUL 1PULA 1NX0A 1LVCD 2AUCA 2KGBC 3OB2B 2LUCA 3PLFB 4OV2A 1F70A 1NX3A 2HETA 1S6CA 1VRKA 1XK4C 2CBLA 1IG5A 4NDDA 5I2QA 1WLMA 1B8CA 1AP4A 4PE7A 4A4CA 4AQIA 4CIDA 3A8RA 3CZTX 4MVFA 2NLNA 4QJ5B 2VRGA 3IQQA 2A4JA 5AFPA 2H61A 4YI9A 1B1GA 4YRUA 2MJWB 2KBMA 1QATA 2Q91A 2KNEA 1K94A 1XYDA 4DIRA 1KQMB 2CXJA 2LLTA 4PE1A 5ER5A 5J3XA 5CSIA 5HLOA 1D1OA 4HRGA 1DJGA 4PHNA 2MLEC 1SL7A 2WNDA 1KSMA 4YGBB 1CNPA 2HF5A 1L2OB 5HKZA 1OQPA 1OMDA 3I5IB 3M0WA 1KK7Y 3CR4X 3PALA 1BU3A 1QV0A 5CSJA 4UPGA 3OP0A 1QX7A 2LCPA 5KSZA 2LVVA 2L2EA 1F4QA 1CFDA 1DF0B 2OTGB 1ZACA 1WRZA 3BOWA 4XJKA 1Y1XA 2KAYA 1ZFSA 2L5XB 2MHHA 1J7OA 2E6WA 3OHMB 1NX1A 1CFCA 2EHBA 1NUBA 3FWCA 3NSKA 1DTLA 1YUTA 3I5IC 1OMRA 1Y0VH 3D0YB 1JF0A 1C07A 4OVNF 3WHTB 3C1VA 3GK1A 4QJ4B 2FOTA 2K2FA 3I5FB 1TNXA 2JTZA 4MLWA 1EG3A 3BUXB 4U8DA 2F2OA 2WCEA 1QTXA 4MEWA 1TNWA 1QV1A 1KFXL 5CSNA 1M63B 1SR6B 2JPTA 2K7CA 3DF0B 2I2RE 1KK8C 1QIWA 1NX2A 1S6JA 1H4BA 1FBVA 3D10A 2PSRA 4ORAB 4GNKB 1KFUS 2KQYA 1M46A 2LLSA 1DJYA 1M39A 2K0JA 4ZCVA 2SCPA 1SL8A 4C0JA 3IQOA 2O60A 1DT7B 4GUKA 2PMYA 1NCZA 1QIVA 2BCAA 2KFFA 1XVJA 1NCXA 1QASA 1U5IB 2OS8C 2I7AA 3I5HB 1KSOA 5HLVA 1MWNA 1OZOA 2DOQA 1BF5A 2M8UA 3FIAA 1YRTB 3EK7A 2LV7A 4JWQA 1PVAA 1S5GY 4N5XA 1E8AA 1V1GA 1SW8A 3NSLA 1DMOA 2F33A 1YURA 3DD4A 4ORBB 2JT0A 3JVTB 1UUSA 2BECA 1JFJA 1G33A 3TDZA 3TS5B 1DJWA 2LMTA 2KBIA 1LINA 1CDLA 1CDNA 2LLUA 1SL9A 1MXEA 1UHIA 1FF1A 4P2YB 2M9GA 5AERA 1UHKA 1WDCB 3SIBA 2MAZA 1TNQA 2BCXA 5F6TA 4CLNA 2KDHA 1QS7A 3CGAA 1PALA 1XO5A 3TUYC 4GGFC 4PALA 4R1EA 1QX5B 1A75B 4N1GA 1W7IB 5B8IB 1JSAA 2O5GA 1JC2A 5TNCA 3O4YA 1KFXS 4YGDB 3ZNIA 1B8RA 1UHNA 1RFJA 1TRFA 5D69A 1C7VA 3VGOA 4CFRA 1CKKA 3NSIA 1AJ4A 5HYDA 3FWBA 1OZSA 1EJ3A 1RTP1 3LK0A 1XFUO 2LVKA 1J1EA 2KYFA 1ALWA 1RROA 1AK8A 5AEQA 2LMVA 4CPVA 1K9UA 1XFZO 4N1FA 2JT8A 3PFVA 4YBHB 3H4SE 2JQ6A 1KWOC 2H61C 3BUMB 1B47A 4JQ0D 4WQ2A 2K8MB 1Q80A 1DJHA 1IGVA 3WXAA 1UHHA 1DVIA 1UURA 3WHUB 1CMFA 4PE4A 1AHRA 1S5GZ 5IBWA 3SIAA 1LA3A 2AMIA 1J7PA 1YUUA 2HQ8A 2WCFA 2L4HA 1DJIA 3EKJA 1MHOA 4OKHA 1K93D 1XFWO 1ODBA 2MBXA 1BR1B 2JNFA 1QLKA 1YR5A 2HPSA 4TNCA 2JC2A 2D8NA 3A4UB 1JBAA 2FCEA 4CFQA 1V1FA 1IJ6A 4JPZB 5JJGA 1YUSA 3O6BA 2QACA 3NSOA 2K2AA 1EL4A 1SYMA 1Y1UA 1PK0D 4DUQA 1N0YA 1OMVA 2V53A 3DVJA 3PM8A 1R2UA 1SRAA 3JTDC 1CB1A 4BY5A 1JWDA 1LA0A 3PATA 4USLA 5HKWA 3CLNA 1KK8B 1UP5A 1XA5A 2F3ZA 2LVIA 3SG7A 2CT9A 4NDBA 5CSFA 1SY9A 4QJ3B 2BBNA 1SPYA 1PSBA 2IS9A 3GK2A 1ZMZA 2PASA 3DVKA 1KQVA 1JFKA 2K7BA 2MLFC 2ZRTA 2LVJA 4MZJA 4I5NB 2K61A 3EVUA 2M7NA 4YI8A 4PHJA 4GPLB 1OSAA 3OB1B 2OPOA 3IF7A 1S1EA 1XFYO 2OS8B 1G8IA 1K8UA 1HT9A 4DCKA 3DVEA 2L0PA 3LL8B 1BG1A 1K90D 4F0ZB 2Y4QA 4A4BA 1DF0A 2F3YA 2NCOA 1J1DA 2G2BA 1GGWA 2ISDA 2CTNA 5I2LA 1S3PA 3VRQA 3VRNA 4BY4A 1DGUA 4M2PA 1S36A 4GGNA 1TNPA 1FW4A 2CCMA 3D0YA 2KI4C 1QX2A 2JULA 2COLB 3DVMA 4M2QA 2ZRSA 4WRIA 3I5GC 5DKNA 3TZ1A 2R2IA 2LP3A 1K96A 2ZFDA 3F45A 5CPVA 3GK4X 1AUIB 1CTRA 3PN7B 2Y1NA 2ZKMX 1MF8B 2WC8A 4FTGA 1AVSA 1TN4A 3DF0A 2BBMA 3RM1A 2KSPA 2MRDA 1CDMA 2KQ6A 2WORA 2BL0B 3TUYB 1GGZA 4D1EA 1XFXO 1TOPA 1X02A 2JTTA 2ZN8A 1YX8A 3ICBA 1UHJA 2JXCA 1NIWA 2Q4UA 3PN7C 1W7JB 3E3RA 3SG5A 1J55A 3SG4A 3BQ3A 3CR5X 4GFTA 2BL0C 1IJ5A 2I94A 2NZ0A 1U5IA 2M0RA 3AAKA 1A4PA 4HRHA 2ZNDA 2H2KA 1SCVA 2F2PA 4OR9B 3WNXB 1CFPA 1K95A 2KAXA 4HSZA 1CLBA 1YX7A 1SKTA 2KI6C 3OX6A 3CS1A 2LMUA 3BYAA 1Y1AA 2PVBA 4AQJA 1SCMC 1KWOB 3OX5A 2KFHA 2JNXA 1B9AA 1QJTA 4WQ3A 4MRYA 3RLZA 3ZWHA 1S6IA 3SG2A 2BE6A 1F54A 4MBEA 1LXFC 1IQ5A 1Y6WA 2K7OA 2PRUA 2NCPA 3KF9A 2M49B 1N2DA 4MZKA 5DKRA 3KHEA 1SMGA 4E68A 3SG6A 1B7TZ 4PHKA 5KU1A 4GGFA 4ICBA 1RECA 4MSPA 1IRJA 1AJ5A 3EVRA 2LP2A 2AAOA 3KPXA 1NCYA 1NSHA 1BLQA 3TDUA 1BR4B 1BMOA 1YRUB 1OOJA 1SK6D 4IL1A 3BXKA 1EH2A 3BOWB 4XJKB 1K9KA 5I8NA 4YGAA 1EXRA 1FI6A 1CFFA 1A75A 4NQGA 1XK4A 5AXIA 1QVIY 1OE9B 2GGMA 3EKHA 3JTDB 2KI6D 4YGEB 1EG4A 2ZNEA 1NWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SBJ A;  3AAJ A;  1RJV A;  4NDC A;  3CR2 A;  2L98 A;  4MRX A;  3KO0 A;  4XYN A;  3PSR A;  5D7F A;  2LM5 A;  2E30 A;  1RWY A;  1QXP A;  4L9M A;  1B4C A;  1LKJ A;  2LC5 A;  2FJU B;  1NP8 A;  1YVH A;  2JOJ A;  4GAO A;  4M2O A;  5ER4 X;  4DS7 A;  1CLM A;  1M31 A;  1MR8 A;  1H8B A;  3MSE B;  3FS7 A;  4PE0 A;  2FCD A;  2MA2 A;  1MQ1 A;  2P6B B;  3VRR A;  5KTY A;  1S26 D;  2M3W A;  4C0L A;  1WRL A;  2GGZ A;  1KQM C;  2KFG A;  2JRF A;  4MN0 A;  4ORC B;  1IWQ A;  3EK4 A;  4DRW A;  2Y5I A;  5GQQ C;  4ETO A;  1IQ3 A;  1TCF A;  3SJS A;  1J7Q A;  5FYX A;  1F8H A;  4I5K A;  1QLS A;  1R6P A;  1UWO A;  4C0K A;  1BOD A;  1BJF A;  2LHL A;  2B1U A;  1CM4 A;  2EGD A;  1L2O C;  3O78 A;  5BPJ A;  1HQV A;  3LLE A;  1JUO A;  3BUW B;  1YTZ C;  1NYA A;  2QPT A;  2TN4 A;  3K21 A;  4MZL A;  2M29 A;  2OTG C;  1K9P A;  1PSR A;  2LUX A;  3KEV A;  3BUN B;  1FPW A;  2KI4 B;  1MUX A;  2JT3 A;  5G08 A;  1DJZ A;  1B7T Y;  1ZUZ A;  3I5G B;  3AKA A;  2I18 A;  1B8L A;  2KGR A;  4Q04 A;  2M97 A;  3CWG A;  2L4I A;  1A29 A;  2SAS A;  2L51 A;  2K7D A;  3I5F C;  3HCM A;  1BT6 A;  3GOF A;  1KCY A;  1TCO B;  2LAP A;  1F4O A;  1NPQ A;  1YVL A;  1CDP A;  5DKQ A;  1SR6 C;  2M1K B;  1QVI Z;  2BKH B;  4HRE E;  2RGI A;  1C7W A;  1WY9 A;  2F8P A;  4PHM A;  3AKB A;  2CNP A;  4GBA A;  3VRO A;  2BKI B;  2WOS A;  3EVV A;  3LK1 A;  4I5L B;  1XFV O;  4PCW A;  3BUO B;  5K89 A;  2LE9 B;  3HX4 A;  2L50 A;  2PAL A;  1FI5 A;  4P5O E;  3I5H C;  3QRX A;  1F55 A;  1CM1 A;  5HKY A;  1G4Y R;  1IKU A;  2JWW A;  3EK8 A;  4PDZ A;  1TTX A;  1SCM B;  4OCI A;  2JU0 A;  1KK7 Z;  1MXL C;  2KAV A;  1M45 A;  1TIZ A;  2LNK A;  1A03 A;  3O2P A;  5JOL A;  2GV5 A;  5I2O A;  3VRP A;  2BCB A;  2KYC A;  2LHI A;  2WCB A;  3TDI A;  1BOC A;  1WRK A;  2EC6 B;  1L7Z A;  1WLZ A;  4YGC B;  1A2X A;  1JF2 A;  2ZN9 A;  3JVT C;  5AAN A;  3LCP C;  1PVB A;  1GQM A;  1N65 A;  1DJX A;  4FQO A;  3TS5 C;  3SG3 A;  1GJY A;  2LAN A;  2G9B A;  3NXA A;  1CLL A;  2M7L A;  2EC6 C;  3CTN A;  2KHN A;  1ZOT B;  2JZI A;  1DGV A;  1WDC C;  2JXL A;  1PRW A;  4ZCU A;  2KOT A;  2Y1M A;  2BE4 A;  4I5J A;  1SNL A;  1J7R A;  2M1U A;  2NXQ A;  1ALV A;  1RK9 A;  1CMG A;  1IH0 A;  5PAL A;  1F71 A;  1K2H A;  4AOM A;  2HQW A;  1KFU L;  1PUL A;  1NX0 A;  1LVC D;  2AUC A;  2KGB C;  3OB2 B;  2LUC A;  3PLF B;  4OV2 A;  1F70 A;  1NX3 A;  2HET A;  1S6C A;  1VRK A;  1XK4 C;  2CBL A;  1IG5 A;  4NDD A;  5I2Q A;  1WLM A;  1B8C A;  1AP4 A;  4PE7 A;  4A4C A;  4AQI A;  4CID A;  3A8R A;  3CZT X;  4MVF A;  2NLN A;  4QJ5 B;  2VRG A;  3IQQ A;  2A4J A;  5AFP A;  2H61 A;  4YI9 A;  1B1G A;  4YRU A;  2MJW B;  2KBM A;  1QAT A;  2Q91 A;  2KNE A;  1K94 A;  1XYD A;  4DIR A;  1KQM B;  2CXJ A;  2LLT A;  4PE1 A;  5ER5 A;  5J3X A;  5CSI A;  5HLO A;  1D1O A;  4HRG A;  1DJG A;  4PHN A;  2MLE C;  1SL7 A;  2WND A;  1KSM A;  4YGB B;  1CNP A;  2HF5 A;  1L2O B;  5HKZ A;  1OQP A;  1OMD A;  3I5I B;  3M0W A;  1KK7 Y;  3CR4 X;  3PAL A;  1BU3 A;  1QV0 A;  5CSJ A;  4UPG A;  3OP0 A;  1QX7 A;  2LCP A;  5KSZ A;  2LVV A;  2L2E A;  1F4Q A;  1CFD A;  1DF0 B;  2OTG B;  1ZAC A;  1WRZ A;  3BOW A;  4XJK A;  1Y1X A;  2KAY A;  1ZFS A;  2L5X B;  2MHH A;  1J7O A;  2E6W A;  3OHM B;  1NX1 A;  1CFC A;  2EHB A;  1NUB A;  3FWC A;  3NSK A;  1DTL A;  1YUT A;  3I5I C;  1OMR A;  1Y0V H;  3D0Y B;  1JF0 A;  1C07 A;  4OVN F;  3WHT B;  3C1V A;  3GK1 A;  4QJ4 B;  2FOT A;  2K2F A;  3I5F B;  1TNX A;  2JTZ A;  4MLW A;  1EG3 A;  3BUX B;  4U8D A;  2F2O A;  2WCE A;  1QTX A;  4MEW A;  1TNW A;  1QV1 A;  1KFX L;  5CSN A;  1M63 B;  1SR6 B;  2JPT A;  2K7C A;  3DF0 B;  2I2R E;  1KK8 C;  1QIW A;  1NX2 A;  1S6J A;  1H4B A;  1FBV A;  3D10 A;  2PSR A;  4ORA B;  4GNK B;  1KFU S;  2KQY A;  1M46 A;  2LLS A;  1DJY A;  1M39 A;  2K0J A;  4ZCV A;  2SCP A;  1SL8 A;  4C0J A;  3IQO A;  2O60 A;  1DT7 B;  4GUK A;  2PMY A;  1NCZ A;  1QIV A;  2BCA A;  2KFF A;  1XVJ A;  1NCX A;  1QAS A;  1U5I B;  2OS8 C;  2I7A A;  3I5H B;  1KSO A;  5HLV A;  1MWN A;  1OZO A;  2DOQ A;  1BF5 A;  2M8U A;  3FIA A;  1YRT B;  3EK7 A;  2LV7 A;  4JWQ A;  1PVA A;  1S5G Y;  4N5X A;  1E8A A;  1V1G A;  1SW8 A;  3NSL A;  1DMO A;  2F33 A;  1YUR A;  3DD4 A;  4ORB B;  2JT0 A;  3JVT B;  1UUS A;  2BEC A;  1JFJ A;  1G33 A;  3TDZ A;  3TS5 B;  1DJW A;  2LMT A;  2KBI A;  1LIN A;  1CDL A;  1CDN A;  2LLU A;  1SL9 A;  1MXE A;  1UHI A;  1FF1 A;  4P2Y B;  2M9G A;  5AER A;  1UHK A;  1WDC B;  3SIB A;  2MAZ A;  1TNQ A;  2BCX A;  5F6T A;  4CLN A;  2KDH A;  1QS7 A;  3CGA A;  1PAL A;  1XO5 A;  3TUY C;  4GGF C;  4PAL A;  4R1E A;  1QX5 B;  1A75 B;  4N1G A;  1W7I B;  5B8I B;  1JSA A;  2O5G A;  1JC2 A;  5TNC A;  3O4Y A;  1KFX S;  4YGD B;  3ZNI A;  1B8R A;  1UHN A;  1RFJ A;  1TRF A;  5D69 A;  1C7V A;  3VGO A;  4CFR A;  1CKK A;  3NSI A;  1AJ4 A;  5HYD A;  3FWB A;  1OZS A;  1EJ3 A;  1RTP 1;  3LK0 A;  1XFU O;  2LVK A;  1J1E A;  2KYF A;  1ALW A;  1RRO A;  1AK8 A;  5AEQ A;  2LMV A;  4CPV A;  1K9U A;  1XFZ O;  4N1F A;  2JT8 A;  3PFV A;  4YBH B;  3H4S E;  2JQ6 A;  1KWO C;  2H61 C;  3BUM B;  1B47 A;  4JQ0 D;  4WQ2 A;  2K8M B;  1Q80 A;  1DJH A;  1IGV A;  3WXA A;  1UHH A;  1DVI A;  1UUR A;  3WHU B;  1CMF A;  4PE4 A;  1AHR A;  1S5G Z;  5IBW A;  3SIA A;  1LA3 A;  2AMI A;  1J7P A;  1YUU A;  2HQ8 A;  2WCF A;  2L4H A;  1DJI A;  3EKJ A;  1MHO A;  4OKH A;  1K93 D;  1XFW O;  1ODB A;  2MBX A;  1BR1 B;  2JNF A;  1QLK A;  1YR5 A;  2HPS A;  4TNC A;  2JC2 A;  2D8N A;  3A4U B;  1JBA A;  2FCE A;  4CFQ A;  1V1F A;  1IJ6 A;  4JPZ B;  5JJG A;  1YUS A;  3O6B A;  2QAC A;  3NSO A;  2K2A A;  1EL4 A;  1SYM A;  1Y1U A;  1PK0 D;  4DUQ A;  1N0Y A;  1OMV A;  2V53 A;  3DVJ A;  3PM8 A;  1R2U A;  1SRA A;  3JTD C;  1CB1 A;  4BY5 A;  1JWD A;  1LA0 A;  3PAT A;  4USL A;  5HKW A;  3CLN A;  1KK8 B;  1UP5 A;  1XA5 A;  2F3Z A;  2LVI A;  3SG7 A;  2CT9 A;  4NDB A;  5CSF A;  1SY9 A;  4QJ3 B;  2BBN A;  1SPY A;  1PSB A;  2IS9 A;  3GK2 A;  1ZMZ A;  2PAS A;  3DVK A;  1KQV A;  1JFK A;  2K7B A;  2MLF C;  2ZRT A;  2LVJ A;  4MZJ A;  4I5N B;  2K61 A;  3EVU A;  2M7N A;  4YI8 A;  4PHJ A;  4GPL B;  1OSA A;  3OB1 B;  2OPO A;  3IF7 A;  1S1E A;  1XFY O;  2OS8 B;  1G8I A;  1K8U A;  1HT9 A;  4DCK A;  3DVE A;  2L0P A;  3LL8 B;  1BG1 A;  1K90 D;  4F0Z B;  2Y4Q A;  4A4B A;  1DF0 A;  2F3Y A;  2NCO A;  1J1D A;  2G2B A;  1GGW A;  2ISD A;  2CTN A;  5I2L A;  1S3P A;  3VRQ A;  3VRN A;  4BY4 A;  1DGU A;  4M2P A;  1S36 A;  4GGN A;  1TNP A;  1FW4 A;  2CCM A;  3D0Y A;  2KI4 C;  1QX2 A;  2JUL A;  2COL B;  3DVM A;  4M2Q A;  2ZRS A;  4WRI A;  3I5G C;  5DKN A;  3TZ1 A;  2R2I A;  2LP3 A;  1K96 A;  2ZFD A;  3F45 A;  5CPV A;  3GK4 X;  1AUI B;  1CTR A;  3PN7 B;  2Y1N A;  2ZKM X;  1MF8 B;  2WC8 A;  4FTG A;  1AVS A;  1TN4 A;  3DF0 A;  2BBM A;  3RM1 A;  2KSP A;  2MRD A;  1CDM A;  2KQ6 A;  2WOR A;  2BL0 B;  3TUY B;  1GGZ A;  4D1E A;  1XFX O;  1TOP A;  1X02 A;  2JTT A;  2ZN8 A;  1YX8 A;  3ICB A;  1UHJ A;  2JXC A;  1NIW A;  2Q4U A;  3PN7 C;  1W7J B;  3E3R A;  3SG5 A;  1J55 A;  3SG4 A;  3BQ3 A;  3CR5 X;  4GFT A;  2BL0 C;  1IJ5 A;  2I94 A;  2NZ0 A;  1U5I A;  2M0R A;  3AAK A;  1A4P A;  4HRH A;  2ZND A;  2H2K A;  1SCV A;  2F2P A;  4OR9 B;  3WNX B;  1CFP A;  1K95 A;  2KAX A;  4HSZ A;  1CLB A;  1YX7 A;  1SKT A;  2KI6 C;  3OX6 A;  3CS1 A;  2LMU A;  3BYA A;  1Y1A A;  2PVB A;  4AQJ A;  1SCM C;  1KWO B;  3OX5 A;  2KFH A;  2JNX A;  1B9A A;  1QJT A;  4WQ3 A;  4MRY A;  3RLZ A;  3ZWH A;  1S6I A;  3SG2 A;  2BE6 A;  1F54 A;  4MBE A;  1LXF C;  1IQ5 A;  1Y6W A;  2K7O A;  2PRU A;  2NCP A;  3KF9 A;  2M49 B;  1N2D A;  4MZK A;  5DKR A;  3KHE A;  1SMG A;  4E68 A;  3SG6 A;  1B7T Z;  4PHK A;  5KU1 A;  4GGF A;  4ICB A;  1REC A;  4MSP A;  1IRJ A;  1AJ5 A;  3EVR A;  2LP2 A;  2AAO A;  3KPX A;  1NCY A;  1NSH A;  1BLQ A;  3TDU A;  1BR4 B;  1BMO A;  1YRU B;  1OOJ A;  1SK6 D;  4IL1 A;  3BXK A;  1EH2 A;  3BOW B;  4XJK B;  1K9K A;  5I8N A;  4YGA A;  1EXR A;  1FI6 A;  1CFF A;  1A75 A;  4NQG A;  1XK4 A;  5AXI A;  1QVI Y;  1OE9 B;  2GGM A;  3EKH A;  3JTD B;  2KI6 D;  4YGE B;  1EG4 A;  2ZNE A;  1NWD A; 
#chains in the Genus database with same CATH topology
 1DC1 A;  1SBJ A;  3AAJ A;  1RJV A;  4NDC A;  3CR2 A;  3BFB A;  2L98 A;  4MRX A;  3KO0 A;  4XYN A;  3PSR A;  5D7F A;  2LM5 A;  3L47 A;  2E30 A;  1RWY A;  1QXP A;  4L9M A;  1B4C A;  1LKJ A;  2LC5 A;  2FJU B;  4OZD A;  1NP8 A;  1YVH A;  2JOJ A;  4GAO A;  4M2O A;  5ER4 X;  4DS7 A;  1CLM A;  1M31 A;  1MR8 A;  1H8B A;  3MSE B;  3FS7 A;  4PE0 A;  2FCD A;  2MA2 A;  1MQ1 A;  2P6B B;  3B7A A;  4IJ7 A;  3VRR A;  1S26 D;  2FJY A;  2M3W A;  4C0L A;  5KTY A;  1WRL A;  2GGZ A;  3QME A;  1OOI X;  1KQM C;  2KFG A;  2JRF A;  4MN0 A;  4INW A;  1IWQ A;  3EK4 A;  4ORC B;  2Y5I A;  5GQQ C;  4DRW A;  4ETO A;  5I94 A;  1IQ3 A;  1TCF A;  1Z4H A;  3SJS A;  5FYX A;  1J7Q A;  4I5K A;  1QLS A;  1R6P A;  1UWO A;  5EL2 A;  4C0K A;  1BJF A;  2LHL A;  1BOD A;  2B1U A;  1CM4 A;  2EGD A;  1L2O C;  3O4X A;  3O78 A;  5BPJ A;  1HQV A;  3LLE A;  1JUO A;  3N7H A;  2WC5 A;  1DQE A;  1YTZ C;  3BUW B;  1NYA A;  2QPT A;  2TN4 A;  3K21 A;  4MZL A;  2M29 A;  1TUJ A;  2OTG C;  1K9P A;  1PSR A;  2LUX A;  3KEV A;  3BUN B;  1FPW A;  2KI4 B;  1MUX A;  2JT3 A;  5G08 A;  1DJZ A;  1B7T Y;  1ZUZ A;  2BAP A;  3I5G B;  3AKA A;  2I18 A;  1B8L A;  2KGR A;  2KLE A;  4FQT A;  4Q04 A;  2M97 A;  3CWG A;  2L4I A;  3PM2 A;  1A29 A;  2SAS A;  2L51 A;  2K7D A;  3I5F C;  3HCM A;  1BT6 A;  3GOF A;  1KCY A;  3CZ0 A;  1TCO B;  2LAP A;  4JKT A;  1F4O A;  1NPQ A;  1YVL A;  1CDP A;  5DKQ A;  1SR6 C;  2M1K B;  1QVI Z;  2BKH B;  4HRE E;  2RGI A;  1C3Z A;  1C7W A;  1T14 A;  1WY9 A;  2F8P A;  3CYZ A;  4PHM A;  3AKB A;  1C3Y A;  2CNP A;  2P71 A;  2QDI A;  4GBA A;  3VRO A;  2BKI B;  2WOS A;  3EVV A;  3LK1 A;  4I5L B;  1XFV O;  4PCW A;  3BUO B;  5K89 A;  2WCJ A;  2LE9 B;  3HX4 A;  2L50 A;  2PAL A;  1FI5 A;  4P5O E;  2P70 A;  3I5H C;  3QRX A;  1F55 A;  1SSE B;  1CM1 A;  5HKY A;  1G4Y R;  1IKU A;  2JWW A;  3EK8 A;  4PDZ A;  1SCM B;  1TTX A;  1Z2C B;  1LS8 A;  3DZT A;  4OCI A;  2JU0 A;  1KK7 Z;  1MXL C;  2KAV A;  1M45 A;  1TIZ A;  2LNK A;  1A03 A;  3O2P A;  5JOL A;  2GV5 A;  5I2O A;  3VRP A;  2BCB A;  2KYC A;  2BNX A;  2LHI A;  3NHT A;  2WCB A;  3TDI A;  1BOC A;  1WRK A;  2EC6 B;  1L7Z A;  1WLZ A;  4YGC B;  1A2X A;  1JF2 A;  2ZN9 A;  3JVT C;  5AAN A;  3LCP C;  1PVB A;  1GQM A;  3Q8I A;  1N65 A;  1DJX A;  4FQO A;  3TS5 C;  3SG3 A;  1GJY A;  3K1E A;  2LAN A;  2KPH A;  2G9B A;  3D74 A;  3NXA A;  1CLL A;  3R72 A;  5FI2 A;  2M7L A;  2EC6 C;  3CTN A;  2KHN A;  1ZOT B;  2JZI A;  1DGV A;  1WDC C;  2JXL A;  1PRW A;  4F7F A;  2ERB A;  4ZCU A;  2KOT A;  2Y1M A;  2BE4 A;  4I5J A;  1SNL A;  1J7R A;  2M1U A;  2JPO A;  2H8V A;  2NXQ A;  1ALV A;  1RK9 A;  1CMG A;  1IH0 A;  5PAL A;  1F71 A;  1K2H A;  3R1V A;  3DYE A;  4AOM A;  2HQW A;  1KFU L;  1PUL A;  1NX0 A;  1LVC D;  2AUC A;  2KGB C;  3OB2 B;  2LUC A;  3CAB A;  3PLF B;  4OV2 A;  3IVT A;  3S0E A;  1F70 A;  1NX3 A;  2HET A;  1S6C A;  1VRK A;  1XK4 C;  3D78 A;  2CBL A;  1IG5 A;  4NDD A;  5I2Q A;  1WLM A;  1B8C A;  1AP4 A;  3S0B A;  4PE7 A;  4A4C A;  3PJI A;  4AQI A;  4CID A;  3A8R A;  3CZT X;  4MVF A;  2NLN A;  4QJ5 B;  2VRG A;  3IQQ A;  2A4J A;  5AFP A;  2H61 A;  4YI9 A;  1B1G A;  4YRU A;  2MJW B;  3S0F A;  2KBM A;  1QAT A;  2Q91 A;  2KNE A;  2WCM A;  4INX A;  1K94 A;  1XYD A;  4DIR A;  1KQM B;  2CXJ A;  2LLT A;  4PE1 A;  5ER5 A;  5J3X A;  5CSI A;  5HLO A;  1D1O A;  4HRG A;  1DJG A;  2GTE A;  4PHN A;  2MLE C;  1SL7 A;  5FI7 A;  2WCL A;  2WND A;  1KSM A;  4YGB B;  1CNP A;  2HF5 A;  1L2O B;  2QEB A;  5HKZ A;  1OQP A;  3D77 A;  1OMD A;  3I5I B;  3M0W A;  1KK7 Y;  3CR4 X;  3PAL A;  1BU3 A;  1QV0 A;  5CSJ A;  4UPG A;  3OP0 A;  1QX7 A;  2LCP A;  5KSZ A;  2LVV A;  2L2E A;  1F4Q A;  1CFD A;  1DF0 B;  2OTG B;  1ZAC A;  1WRZ A;  3BOW A;  4XJK A;  1Y1X A;  2KAY A;  1ZFS A;  2L5X B;  2MHH A;  3SS3 A;  1J7O A;  2E6W A;  3OHM B;  1NX1 A;  2WCH A;  1CFC A;  2EHB A;  1NUB A;  3FWC A;  3NSK A;  1DTL A;  1YUT A;  3I5I C;  1OMR A;  1Y0V H;  3D0Y B;  1JF0 A;  3FE9 A;  1C07 A;  4OVN F;  3B86 A;  3WHT B;  3C1V A;  3GK1 A;  4QJ4 B;  2FOT A;  2K2F A;  3I5F B;  1TNX A;  2JTZ A;  4MLW A;  1EG3 A;  3BUX B;  4U8D A;  1IIO A;  2F2O A;  2WCE A;  1QTX A;  4MEW A;  1QWV A;  1TNW A;  3UNW A;  1QV1 A;  1KFX L;  5CSN A;  1M63 B;  1SR6 B;  2JPT A;  2K7C A;  3DF0 B;  3R1O A;  2I2R E;  1KK8 C;  1QIW A;  1NX2 A;  1S6J A;  1H4B A;  1FBV A;  3S0A A;  3D10 A;  2PSR A;  4ORA B;  4GNK B;  1KFU S;  2KQY A;  1M46 A;  2LLS A;  1DJY A;  1M39 A;  2K0J A;  4ZCV A;  2SCP A;  1SL8 A;  4C0J A;  3IQO A;  2O60 A;  1DT7 B;  4GUK A;  1XFR A;  2PMY A;  1F8H A;  1NCZ A;  1QIV A;  2BCA A;  2KFF A;  1XVJ A;  1NCX A;  1QAS A;  1U5I B;  2OS8 C;  2I7A A;  3I5H B;  1KSO A;  3OBV A;  5HLV A;  1MWN A;  1OZO A;  2DOQ A;  1BF5 A;  2M8U A;  1OOF A;  3FIA A;  1YRT B;  3EK7 A;  2LV7 A;  1ORG A;  2KLD A;  4JWQ A;  3L4L A;  1PVA A;  1S5G Y;  4JD9 A;  4N5X A;  1E8A A;  1V1G A;  1SW8 A;  3NSL A;  3DY9 A;  1GM0 A;  1DMO A;  2F33 A;  1YUR A;  3DD4 A;  4ORB B;  3SS5 A;  2JT0 A;  3JVT B;  1UUS A;  2BEC A;  1JFJ A;  1G33 A;  3TDZ A;  3TS5 B;  1DJW A;  2LMT A;  2KBI A;  3CDN A;  1LIN A;  1CDL A;  1CDN A;  3DXL A;  2LLU A;  1SL9 A;  3CZ1 A;  1MXE A;  1UHI A;  1FF1 A;  4P2Y B;  2M9G A;  5AER A;  1UHK A;  1WDC B;  3D75 A;  3SIB A;  2MAZ A;  1TNQ A;  2BCX A;  5F6T A;  4CLN A;  2KDH A;  1QS7 A;  3CGA A;  1PAL A;  1XO5 A;  3TUY C;  5D3O A;  3UO9 A;  4GGF C;  4PAL A;  4R1E A;  1QX5 B;  1A75 B;  5DIC A;  3D73 A;  4PT1 A;  4N1G A;  1W7I B;  5B8I B;  1JSA A;  2O5G A;  1JC2 A;  5TNC A;  3O4Y A;  3V2L A;  1KFX S;  4YGD B;  3ZNI A;  1B8R A;  1UHN A;  2WCK A;  1RFJ A;  1TRF A;  5D69 A;  1C7V A;  3VGO A;  4CFR A;  1CKK A;  3NSI A;  1AJ4 A;  5HYD A;  3FWB A;  1OZS A;  1EJ3 A;  1RTP 1;  3LK0 A;  1XFU O;  2LVK A;  3B88 A;  1J1E A;  3B87 A;  2KYF A;  1ALW A;  1RRO A;  1AK8 A;  5AEQ A;  2LMV A;  4CPV A;  1K9U A;  1XFZ O;  4N1F A;  2JT8 A;  3PFV A;  4YBH B;  3H4S E;  2JQ6 A;  1KWO C;  2H61 C;  3BUM B;  1B47 A;  4JQ0 D;  4WQ2 A;  2K8M B;  1Q80 A;  3OGN A;  1DJH A;  1IGV A;  3WXA A;  1UHH A;  1DVI A;  1UUR A;  3WHU B;  1CMF A;  4PE4 A;  1AHR A;  1S5G Z;  5IBW A;  3SIA A;  1LA3 A;  2AMI A;  1J7P A;  1TUZ A;  1YUU A;  2HQ8 A;  2WCF A;  2L4H A;  1DJI A;  3EKJ A;  1MHO A;  4OKH A;  1K93 D;  1XFW O;  1ODB A;  3EG5 B;  2MBX A;  1BR1 B;  2JNF A;  1QLK A;  1YR5 A;  2HPS A;  4TNC A;  2JC2 A;  2D8N A;  3A4U B;  1JBA A;  2FCE A;  4CFQ A;  1V1F A;  1IJ6 A;  4JPZ B;  5JJG A;  1YUS A;  3O6B A;  2QAC A;  3NSO A;  2K2A A;  1EL4 A;  1SYM A;  1W9Z A;  1Y1U A;  1PK0 D;  5FI6 A;  3VB1 A;  1TWO A;  3NGV A;  4DUQ A;  1N0Y A;  1DEL A;  1OMV A;  2V53 A;  2L2C A;  3DVJ A;  1R2U A;  1SRA A;  3PM8 A;  3JTD C;  1CB1 A;  4BY5 A;  1JWD A;  1LA0 A;  3PAT A;  3CZ2 A;  4USL A;  5HKW A;  1OOH A;  1KK8 B;  3CLN A;  1UP5 A;  1XA5 A;  2F3Z A;  2LVI A;  3SG7 A;  2CT9 A;  2QEH A;  4NDB A;  5CSF A;  1SY9 A;  4QJ3 B;  3L4A A;  2BBN A;  1SPY A;  1PSB A;  2IS9 A;  3GK2 A;  1ZMZ A;  2PAS A;  3DVK A;  1KQV A;  1JFK A;  2K7B A;  2MLF C;  2ZRT A;  2LVJ A;  4MZJ A;  4I5N B;  2K61 A;  3EVU A;  2M7N A;  4YI8 A;  2YGU A;  4PHJ A;  4GPL B;  1OSA A;  3OB1 B;  2OPO A;  3IF7 A;  1S1E A;  1XFY O;  2OS8 B;  1G8I A;  1K8U A;  1HT9 A;  2K60 A;  4DCK A;  3DVE A;  2L0P A;  3LL8 B;  1BG1 A;  1K90 D;  4F0Z B;  2Y4Q A;  4A4B A;  1DF0 A;  2F3Y A;  2NCO A;  1J1D A;  2G2B A;  1GGW A;  2ISD A;  2CTN A;  5I2L A;  1S3P A;  3VRQ A;  3VRN A;  3FE6 A;  4BY4 A;  1DGU A;  4M2P A;  1S36 A;  4GGN A;  1TNP A;  1FW4 A;  2CCM A;  3D0Y A;  2KI4 C;  1QX2 A;  2JUL A;  2COL B;  3DVM A;  4M2Q A;  2ZRS A;  4WRI A;  3RZS A;  3I5G C;  5DKN A;  3TZ1 A;  2R2I A;  2LP3 A;  1K96 A;  2ZFD A;  3F45 A;  5CPV A;  3GK4 X;  1AUI B;  1CTR A;  3PN7 B;  2Y1N A;  2ZKM X;  1MF8 B;  2WC8 A;  4FTG A;  1AVS A;  1TN4 A;  3DF0 A;  2BBM A;  3RM1 A;  2KSP A;  2MRD A;  1CDM A;  2KQ6 A;  2WOR A;  2BL0 B;  4KYN A;  3TUY B;  1GGZ A;  4D1E A;  1XFX O;  1TOP A;  1X02 A;  2JTT A;  2ZN8 A;  1YX8 A;  3ICB A;  1UHJ A;  2JXC A;  5HL1 A;  1NIW A;  2Q4U A;  3PN7 C;  1W7J B;  1OOG A;  3E3R A;  1J55 A;  3SG5 A;  3SG4 A;  3BQ3 A;  3CR5 X;  4GFT A;  2BL0 C;  1IJ5 A;  2I94 A;  2NZ0 A;  3D76 A;  1U5I A;  3BFH A;  3S0G A;  2M0R A;  3AAK A;  1A4P A;  4HRH A;  2ZND A;  2H2K A;  1SCV A;  2F2P A;  4OR9 B;  3WNX B;  1CFP A;  1K95 A;  2KAX A;  4HSZ A;  1CLB A;  1YX7 A;  1SKT A;  2KI6 C;  3OX6 A;  3CS1 A;  2L5Y A;  3SS4 A;  2LMU A;  3BYA A;  1Y1A A;  2PVB A;  4AQJ A;  1SCM C;  1KWO B;  3OX5 A;  2KFH A;  2JNX A;  1B9A A;  1QJT A;  4WQ3 A;  3S0D A;  3BJH A;  4MRY A;  3FE8 A;  3RLZ A;  3ZWH A;  1P28 A;  1S6I A;  3SG2 A;  2BE6 A;  2WC6 A;  1F54 A;  4MBE A;  1LXF C;  1IQ5 A;  1Y6W A;  2K7O A;  2PRU A;  2NCP A;  2PYQ A;  2M49 B;  1N2D A;  3KF9 A;  4MZK A;  3KHE A;  1SMG A;  5DKR A;  1OW4 A;  1B7T Z;  4PHK A;  3SG6 A;  4E68 A;  5KU1 A;  4GGF A;  4ICB A;  1REC A;  2QEV A;  4MSP A;  1IRJ A;  1AJ5 A;  3EVR A;  2LP2 A;  2AAO A;  3KPX A;  1NCY A;  1NSH A;  2QEO A;  1BLQ A;  3TDU A;  1BR4 B;  1BMO A;  1YRU B;  1OOJ A;  1SK6 D;  4IL1 A;  3BXK A;  1EH2 A;  3BOW B;  4XJK B;  1K9K A;  5I8N A;  4YGA A;  1EXR A;  1FI6 A;  1CFF A;  1A75 A;  4NQG A;  1DEK A;  1XK4 A;  3B6X A;  1QVI Y;  5AXI A;  3NHI A;  1OE9 B;  2GGM A;  3R1P A;  3EKH A;  3BFA A;  2KI6 D;  3JTD B;  4YGE B;  1EG4 A;  2PQL A;  2ZNE A;  1NWD A; 
#chains in the Genus database with same CATH homology
 1SBJ A;  3AAJ A;  1RJV A;  4NDC A;  3CR2 A;  2L98 A;  4MRX A;  3KO0 A;  4XYN A;  3PSR A;  5D7F A;  2LM5 A;  2E30 A;  1RWY A;  1QXP A;  4L9M A;  1B4C A;  1LKJ A;  2LC5 A;  2FJU B;  1NP8 A;  1YVH A;  2JOJ A;  4GAO A;  4M2O A;  5ER4 X;  4DS7 A;  1CLM A;  1M31 A;  1MR8 A;  1H8B A;  3MSE B;  3FS7 A;  4PE0 A;  2FCD A;  2MA2 A;  1MQ1 A;  2P6B B;  3VRR A;  5KTY A;  1S26 D;  2M3W A;  4C0L A;  1WRL A;  2GGZ A;  1KQM C;  2KFG A;  2JRF A;  4MN0 A;  4ORC B;  1IWQ A;  3EK4 A;  4DRW A;  2Y5I A;  5GQQ C;  4ETO A;  1IQ3 A;  1TCF A;  3SJS A;  1J7Q A;  5FYX A;  1F8H A;  4I5K A;  1QLS A;  1R6P A;  1UWO A;  4C0K A;  1BOD A;  1BJF A;  2LHL A;  2B1U A;  1CM4 A;  2EGD A;  1L2O C;  3O78 A;  5BPJ A;  1HQV A;  3LLE A;  1JUO A;  3BUW B;  1YTZ C;  1NYA A;  2QPT A;  2TN4 A;  3K21 A;  4MZL A;  2M29 A;  2OTG C;  1K9P A;  1PSR A;  2LUX A;  3KEV A;  3BUN B;  1FPW A;  2KI4 B;  1MUX A;  2JT3 A;  5G08 A;  1DJZ A;  1B7T Y;  1ZUZ A;  3I5G B;  3AKA A;  2I18 A;  1B8L A;  2KGR A;  4Q04 A;  2M97 A;  3CWG A;  2L4I A;  1A29 A;  2SAS A;  2L51 A;  2K7D A;  3I5F C;  3HCM A;  1BT6 A;  3GOF A;  1KCY A;  1TCO B;  2LAP A;  1F4O A;  1NPQ A;  1YVL A;  1CDP A;  5DKQ A;  1SR6 C;  2M1K B;  1QVI Z;  2BKH B;  4HRE E;  2RGI A;  1C7W A;  1WY9 A;  2F8P A;  4PHM A;  3AKB A;  2CNP A;  4GBA A;  3VRO A;  2BKI B;  2WOS A;  3EVV A;  3LK1 A;  4I5L B;  1XFV O;  4PCW A;  3BUO B;  5K89 A;  2LE9 B;  3HX4 A;  2L50 A;  2PAL A;  1FI5 A;  4P5O E;  3I5H C;  3QRX A;  1F55 A;  1CM1 A;  5HKY A;  1G4Y R;  1IKU A;  2JWW A;  3EK8 A;  4PDZ A;  1TTX A;  1SCM B;  4OCI A;  2JU0 A;  1KK7 Z;  1MXL C;  2KAV A;  1M45 A;  1TIZ A;  2LNK A;  1A03 A;  3O2P A;  5JOL A;  2GV5 A;  5I2O A;  3VRP A;  2BCB A;  2KYC A;  2LHI A;  2WCB A;  3TDI A;  1BOC A;  1WRK A;  2EC6 B;  1L7Z A;  1WLZ A;  4YGC B;  1A2X A;  1JF2 A;  2ZN9 A;  3JVT C;  5AAN A;  3LCP C;  1PVB A;  1GQM A;  1N65 A;  1DJX A;  4FQO A;  3TS5 C;  3SG3 A;  1GJY A;  2LAN A;  2G9B A;  3NXA A;  1CLL A;  2M7L A;  2EC6 C;  3CTN A;  2KHN A;  1ZOT B;  2JZI A;  1DGV A;  1WDC C;  2JXL A;  1PRW A;  4ZCU A;  2KOT A;  2Y1M A;  2BE4 A;  4I5J A;  1SNL A;  1J7R A;  2M1U A;  2NXQ A;  1ALV A;  1RK9 A;  1CMG A;  1IH0 A;  5PAL A;  1F71 A;  1K2H A;  4AOM A;  2HQW A;  1KFU L;  1PUL A;  1NX0 A;  1LVC D;  2AUC A;  2KGB C;  3OB2 B;  2LUC A;  3PLF B;  4OV2 A;  1F70 A;  1NX3 A;  2HET A;  1S6C A;  1VRK A;  1XK4 C;  2CBL A;  1IG5 A;  4NDD A;  5I2Q A;  1WLM A;  1B8C A;  1AP4 A;  4PE7 A;  4A4C A;  4AQI A;  4CID A;  3A8R A;  3CZT X;  4MVF A;  2NLN A;  4QJ5 B;  2VRG A;  3IQQ A;  2A4J A;  5AFP A;  2H61 A;  4YI9 A;  1B1G A;  4YRU A;  2MJW B;  2KBM A;  1QAT A;  2Q91 A;  2KNE A;  1K94 A;  1XYD A;  4DIR A;  1KQM B;  2CXJ A;  2LLT A;  4PE1 A;  5ER5 A;  5J3X A;  5CSI A;  5HLO A;  1D1O A;  4HRG A;  1DJG A;  4PHN A;  2MLE C;  1SL7 A;  2WND A;  1KSM A;  4YGB B;  1CNP A;  2HF5 A;  1L2O B;  5HKZ A;  1OQP A;  1OMD A;  3I5I B;  3M0W A;  1KK7 Y;  3CR4 X;  3PAL A;  1BU3 A;  1QV0 A;  5CSJ A;  4UPG A;  3OP0 A;  1QX7 A;  2LCP A;  5KSZ A;  2LVV A;  2L2E A;  1F4Q A;  1CFD A;  1DF0 B;  2OTG B;  1ZAC A;  1WRZ A;  3BOW A;  4XJK A;  1Y1X A;  2KAY A;  1ZFS A;  2L5X B;  2MHH A;  1J7O A;  2E6W A;  3OHM B;  1NX1 A;  1CFC A;  2EHB A;  1NUB A;  3FWC A;  3NSK A;  1DTL A;  1YUT A;  3I5I C;  1OMR A;  1Y0V H;  3D0Y B;  1JF0 A;  1C07 A;  4OVN F;  3WHT B;  3C1V A;  3GK1 A;  4QJ4 B;  2FOT A;  2K2F A;  3I5F B;  1TNX A;  2JTZ A;  4MLW A;  1EG3 A;  3BUX B;  4U8D A;  2F2O A;  2WCE A;  1QTX A;  4MEW A;  1TNW A;  1QV1 A;  1KFX L;  5CSN A;  1M63 B;  1SR6 B;  2JPT A;  2K7C A;  3DF0 B;  2I2R E;  1KK8 C;  1QIW A;  1NX2 A;  1S6J A;  1H4B A;  1FBV A;  3D10 A;  2PSR A;  4ORA B;  4GNK B;  1KFU S;  2KQY A;  1M46 A;  2LLS A;  1DJY A;  1M39 A;  2K0J A;  4ZCV A;  2SCP A;  1SL8 A;  4C0J A;  3IQO A;  2O60 A;  1DT7 B;  4GUK A;  2PMY A;  1NCZ A;  1QIV A;  2BCA A;  2KFF A;  1XVJ A;  1NCX A;  1QAS A;  1U5I B;  2OS8 C;  2I7A A;  3I5H B;  1KSO A;  5HLV A;  1MWN A;  1OZO A;  2DOQ A;  1BF5 A;  2M8U A;  3FIA A;  1YRT B;  3EK7 A;  2LV7 A;  4JWQ A;  1PVA A;  1S5G Y;  4N5X A;  1E8A A;  1V1G A;  1SW8 A;  3NSL A;  1DMO A;  2F33 A;  1YUR A;  3DD4 A;  4ORB B;  2JT0 A;  3JVT B;  1UUS A;  2BEC A;  1JFJ A;  1G33 A;  3TDZ A;  3TS5 B;  1DJW A;  2LMT A;  2KBI A;  1LIN A;  1CDL A;  1CDN A;  2LLU A;  1SL9 A;  1MXE A;  1UHI A;  1FF1 A;  4P2Y B;  2M9G A;  5AER A;  1UHK A;  1WDC B;  3SIB A;  2MAZ A;  1TNQ A;  2BCX A;  5F6T A;  4CLN A;  2KDH A;  1QS7 A;  3CGA A;  1PAL A;  1XO5 A;  3TUY C;  4GGF C;  4PAL A;  4R1E A;  1QX5 B;  1A75 B;  4N1G A;  1W7I B;  5B8I B;  1JSA A;  2O5G A;  1JC2 A;  5TNC A;  3O4Y A;  1KFX S;  4YGD B;  3ZNI A;  1B8R A;  1UHN A;  1RFJ A;  1TRF A;  5D69 A;  1C7V A;  3VGO A;  4CFR A;  1CKK A;  3NSI A;  1AJ4 A;  5HYD A;  3FWB A;  1OZS A;  1EJ3 A;  1RTP 1;  3LK0 A;  1XFU O;  2LVK A;  1J1E A;  2KYF A;  1ALW A;  1RRO A;  1AK8 A;  5AEQ A;  2LMV A;  4CPV A;  1K9U A;  1XFZ O;  4N1F A;  2JT8 A;  3PFV A;  4YBH B;  3H4S E;  2JQ6 A;  1KWO C;  2H61 C;  3BUM B;  1B47 A;  4JQ0 D;  4WQ2 A;  2K8M B;  1Q80 A;  1DJH A;  1IGV A;  3WXA A;  1UHH A;  1DVI A;  1UUR A;  3WHU B;  1CMF A;  4PE4 A;  1AHR A;  1S5G Z;  5IBW A;  3SIA A;  1LA3 A;  2AMI A;  1J7P A;  1YUU A;  2HQ8 A;  2WCF A;  2L4H A;  1DJI A;  3EKJ A;  1MHO A;  4OKH A;  1K93 D;  1XFW O;  1ODB A;  2MBX A;  1BR1 B;  2JNF A;  1QLK A;  1YR5 A;  2HPS A;  4TNC A;  2JC2 A;  2D8N A;  3A4U B;  1JBA A;  2FCE A;  4CFQ A;  1V1F A;  1IJ6 A;  4JPZ B;  5JJG A;  1YUS A;  3O6B A;  2QAC A;  3NSO A;  2K2A A;  1EL4 A;  1SYM A;  1Y1U A;  1PK0 D;  4DUQ A;  1N0Y A;  1OMV A;  2V53 A;  3DVJ A;  3PM8 A;  1R2U A;  1SRA A;  3JTD C;  1CB1 A;  4BY5 A;  1JWD A;  1LA0 A;  3PAT A;  4USL A;  5HKW A;  3CLN A;  1KK8 B;  1UP5 A;  1XA5 A;  2F3Z A;  2LVI A;  3SG7 A;  2CT9 A;  4NDB A;  5CSF A;  1SY9 A;  4QJ3 B;  2BBN A;  1SPY A;  1PSB A;  2IS9 A;  3GK2 A;  1ZMZ A;  2PAS A;  3DVK A;  1KQV A;  1JFK A;  2K7B A;  2MLF C;  2ZRT A;  2LVJ A;  4MZJ A;  4I5N B;  2K61 A;  3EVU A;  2M7N A;  4YI8 A;  4PHJ A;  4GPL B;  1OSA A;  3OB1 B;  2OPO A;  3IF7 A;  1S1E A;  1XFY O;  2OS8 B;  1G8I A;  1K8U A;  1HT9 A;  4DCK A;  3DVE A;  2L0P A;  3LL8 B;  1BG1 A;  1K90 D;  4F0Z B;  2Y4Q A;  4A4B A;  1DF0 A;  2F3Y A;  2NCO A;  1J1D A;  2G2B A;  1GGW A;  2ISD A;  2CTN A;  5I2L A;  1S3P A;  3VRQ A;  3VRN A;  4BY4 A;  1DGU A;  4M2P A;  1S36 A;  4GGN A;  1TNP A;  1FW4 A;  2CCM A;  3D0Y A;  2KI4 C;  1QX2 A;  2JUL A;  2COL B;  3DVM A;  4M2Q A;  2ZRS A;  4WRI A;  3I5G C;  5DKN A;  3TZ1 A;  2R2I A;  2LP3 A;  1K96 A;  2ZFD A;  3F45 A;  5CPV A;  3GK4 X;  1AUI B;  1CTR A;  3PN7 B;  2Y1N A;  2ZKM X;  1MF8 B;  2WC8 A;  4FTG A;  1AVS A;  1TN4 A;  3DF0 A;  2BBM A;  3RM1 A;  2KSP A;  2MRD A;  1CDM A;  2KQ6 A;  2WOR A;  2BL0 B;  3TUY B;  1GGZ A;  4D1E A;  1XFX O;  1TOP A;  1X02 A;  2JTT A;  2ZN8 A;  1YX8 A;  3ICB A;  1UHJ A;  2JXC A;  1NIW A;  2Q4U A;  3PN7 C;  1W7J B;  3E3R A;  3SG5 A;  1J55 A;  3SG4 A;  3BQ3 A;  3CR5 X;  4GFT A;  2BL0 C;  1IJ5 A;  2I94 A;  2NZ0 A;  1U5I A;  2M0R A;  3AAK A;  1A4P A;  4HRH A;  2ZND A;  2H2K A;  1SCV A;  2F2P A;  4OR9 B;  3WNX B;  1CFP A;  1K95 A;  2KAX A;  4HSZ A;  1CLB A;  1YX7 A;  1SKT A;  2KI6 C;  3OX6 A;  3CS1 A;  2LMU A;  3BYA A;  1Y1A A;  2PVB A;  4AQJ A;  1SCM C;  1KWO B;  3OX5 A;  2KFH A;  2JNX A;  1B9A A;  1QJT A;  4WQ3 A;  4MRY A;  3RLZ A;  3ZWH A;  1S6I A;  3SG2 A;  2BE6 A;  1F54 A;  4MBE A;  1LXF C;  1IQ5 A;  1Y6W A;  2K7O A;  2PRU A;  2NCP A;  3KF9 A;  2M49 B;  1N2D A;  4MZK A;  5DKR A;  3KHE A;  1SMG A;  4E68 A;  3SG6 A;  1B7T Z;  4PHK A;  5KU1 A;  4GGF A;  4ICB A;  1REC A;  4MSP A;  1IRJ A;  1AJ5 A;  3EVR A;  2LP2 A;  2AAO A;  3KPX A;  1NCY A;  1NSH A;  1BLQ A;  3TDU A;  1BR4 B;  1BMO A;  1YRU B;  1OOJ A;  1SK6 D;  4IL1 A;  3BXK A;  1EH2 A;  3BOW B;  4XJK B;  1K9K A;  5I8N A;  4YGA A;  1EXR A;  1FI6 A;  1CFF A;  1A75 A;  4NQG A;  1XK4 A;  5AXI A;  1QVI Y;  1OE9 B;  2GGM A;  3EKH A;  3JTD B;  2KI6 D;  4YGE B;  1EG4 A;  2ZNE A;  1NWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...