2HQ8A

Crystal structure of coelenterazine-binding protein from renilla muelleri in the ca loaded apo form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
181
Chain Sequence
ITESERAYHLRKMKTRMQRVDVTGDGFISREDYELIAVRIAKIAKLSAEKAEETRQEFLRVADQLGLAPGVRISVEEAAVNATDSLLKMKGEEKAMAVIQSLIMYDCIDTDKDGYVSLPEFKAFLQAVGPDLTDDKAITCFNTLDFNKNGQISRDEFLVTVNDFLFGLEETALANAFYGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of coelenterazine-binding protein from Renilla muelleri at 1.7 A: why it is not a calcium-regulated photoprotein.
pubmed doi rcsb
source organism Renilla muelleri
molecule tags Structural genomics, unknown function
molecule keywords Coelenterazine-binding protein ca-bound apo form
total genus 70
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hq8A00
1IWQA 2LMTA 1GGWA 5HKZA 4C0KA 3CR5X 5CSIA 3BUXB 1UP5A 3VRQA 1MR8A 2KSPA 1CKKA 1S26D 2AUCA 4MZKA 1QIVA 4Q04A 4QJ3B 2ZRSA 1BODA 3AKAA 2BE6A 3HCMA 1K93D 3SG4A 3E3RA 3QRXA 5GQQC 2CXJA 1S6IA 1HQVA 4YGDB 5CPVA 2PSRA 2MRDA 2BCAA 2BKIB 4ZCUA 3VRPA 3PFVA 1QV1A 4GGFA 4JWQA 2FCDA 1CDMA 1SPYA 1UURA 4YGBB 1F8HA 1KK8C 2V53A 2HF5A 3I5HB 2BL0C 2G2BA 2KFHA 1BJFA 2JNFA 3PM8A 2CNPA 3DF0A 3IQQA 1L2OB 2KDHA 1TIZA 1H4BA 3JVTC 1NSHA 4E68A 1QVIZ 4PALA 2KFGA 1WY9A 1JFJA 2LHLA 1TNWA 1F54A 1J7RA 1Y1XA 1M39A 2SASA 2L5XB 2LUXA 1BOCA 1GQMA 1PSBA 1OMVA 1DJYA 3SG2A 2ZNEA 3SG7A 1FBVA 3BYAA 2LUCA 4GNKB 1OQPA 1PALA 2KGBC 1IH0A 1CFDA 2M3WA 3O2PA 2CTNA 3SG5A 1AK8A 1PK0D 1BR4B 1YVHA 3GK2A 2LVKA 3C1VA 5DKQA 1IKUA 4U8DA 1IJ6A 1B8CA 2LM5A 1WRZA 2WOSA 3NSOA 1SNLA 3NXAA 4MLWA 3TUYB 1NX2A 4AQIA 2TN4A 2KQYA 1B9AA 1XFUO 4N1FA 1CLBA 2RGIA 2WORA 1UHHA 1CM1A 1OE9B 3PALA 4PHJA 4A4BA 1H8BA 2L50A 1ZMZA 2LANA 5K89A 2CBLA 1L7ZA 2K2AA 4BY4A 4OKHA 5D69A 4PCWA 1IG5A 3KEVA 3ZNIA 1SKTA 3OB1B 1NWDA 2PRUA 1A29A 1F55A 4P2YB 2D8NA 3EKHA 4P5OE 1JBAA 5D7FA 1XFZO 1CDNA 2AAOA 3GOFA 3VROA 2JU0A 2H2KA 1QS7A 1UHIA 1VRKA 4FTGA 1OSAA 1NPQA 1KK7Y 2Y4QA 1SK6D 4FQOA 2L98A 4ICBA 1DGVA 1GGZA 2MLFC 3KPXA 2WC8A 1JUOA 1Y1AA 2Y1NA 4MBEA 4HRGA 4OCIA 5KU1A 1G8IA 2PALA 4NQGA 2ZRTA 1SL8A 3CZTX 1RWYA 2EC6C 1F4QA 4GGFC 2KFFA 1JWDA 1WDCB 4ORCB 3WXAA 3I5FB 4C0JA 4N1GA 1PULA 3SJSA 2M0RA 1K96A 1Y1UA 1IRJA 2GGZA 2L0PA 2KNEA 2NZ0A 1WRKA 2M7LA 2L4IA 2CT9A 2BCBA 1XFYO 3SIBA 1C7VA 1TNXA 3EK8A 3NSLA 1LINA 1S6JA 1XA5A 1FI5A 1NX1A 3JVTB 3CR4X 2BBMA 5HKYA 1DVIA 3KHEA 2LCPA 1NIWA 1EH2A 2MBXA 1KSMA 2OPOA 2OS8C 1QXPA 1S5GY 3FS7A 1SY9A 5G08A 4GAOA 4MRYA 1BG1A 2GV5A 1G4YR 4I5JA 2AMIA 3BXKA 1A03A 3H4SE 1SL7A 4AQJA 3KO0A 2LLUA 2M1UA 1D1OA 4DIRA 2JPTA 4XYNA 1S6CA 2HETA 3F45A 4L9MA 2IS9A 1QX2A 4CFQA 3PSRA 3TS5C 1NCZA 1F71A 4D1EA 1CFFA 1Y6WA 1ALVA 2OTGC 2F3YA 1C7WA 1S5GZ 2CCMA 1CLLA 2P6BB 5AERA 4GGNA 1S36A 5AANA 2Q91A 1XO5A 2G9BA 1JSAA 1KSOA 1J55A 5I2QA 2KBMA 3TDZA 2K7CA 2O60A 3LLEA 2BCXA 1A75B 2K8MB 2BE4A 1OMDA 1DJIA 3ZWHA 1EL4A 1Y0VH 5J3XA 3PN7B 2I7AA 1MXLC 3VRNA 3RM1A 3IQOA 3CGAA 1X02A 3PN7C 1SR6C 1TNPA 1UWOA 3EVVA 3JTDC 2LMVA 3ICBA 3MSEB 4YGCB 4ORAB 2JT3A 2NCPA 3OX6A 2KHNA 1TN4A 2L4HA 1B7TY 2M9GA 1LKJA 4ZCVA 1ODBA 2M1KB 1MXEA 4GFTA 3SG3A 3DVKA 4GBAA 5CSNA 2ZNDA 5B8IB 5ER4X 2LP2A 1SW8A 2LLTA 3O6BA 5I8NA 1FW4A 3NSKA 1RECA 1BR1B 1XFVO 1QTXA 2JZIA 4NDDA 3TS5B 3DD4A 1DJHA 3I5GB 2HQ8A 5BPJA 3BUOB 1F70A 4DUQA 2R2IA 2LMUA 1MUXA 1IJ5A 1QLKA 3A4UB 4JPZB 2GGMA 2JXCA 1AVSA 2LP3A 1KFXS 4CFRA 2H61C 1MQ1A 5I2LA 4QJ5B 1UUSA 3I5IB 3D10A 4R1EA 5ER5A 1XK4C 2K7DA 4I5KA 1QATA 1CTRA 1SMGA 3BUMB 1CNPA 2LC5A 1K9PA 4HSZA 1PVBA 5CSFA 2EHBA 1WDCC 2B1UA 1EG4A 1CM4A 2KI6C 3AKBA 1KK7Z 1BLQA 3GK1A 1K9UA 4PE7A 2WCEA 4ETOA 1EG3A 1YRTB 1SRAA 2E30A 3CLNA 1YUTA 4YRUA 3I5IC 1OOJA 1K8UA 1Q80A 4PHMA 1XK4A 1NX3A 2KBIA 1UHKA 3FIAA 5KTYA 5IBWA 1UHNA 3K21A 2VRGA 2LNKA 1FF1A 1OZOA 1R2UA 2LE9B 3FWBA 1GJYA 1J1EA 4TNCA 2SCPA 2JT0A 4MRXA 3CR2A 4YI8A 4GUKA 1KQMC 1SBJA 1MWNA 1YRUB 4XJKB 1AUIB 1CLMA 1RTP1 4I5NB 2PVBA 3OP0A 1G33A 2HPSA 1NYAA 1WLMA 1FPWA 5FYXA 2F8PA 1F4OA 3SIAA 1N0YA 1K2HA 1JC2A 1CDLA 1TCFA 3OB2B 1B8RA 1QASA 2COLB 4YI9A 2OTGB 2L2EA 1LVCD 2H61A 2BKHB 2M49B 2I2RE 3EK7A 3O4YA 3OHMB 2QPTA 4NDCA 1N2DA 2Y5IA 1SYMA 4CPVA 2KGRA 1KQMB 4HREE 3EK4A 1NP8A 1B4CA 1LA3A 2BECA 1J7QA 1AJ5A 3D0YB 4OV2A 2KOTA 5JJGA 2K0JA 1ZUZA 1J1DA 5HLOA 1RK9A 2MA2A 1V1FA 1YX7A 4ORBB 4MVFA 4USLA 1DF0B 1QLSA 1KQVA 1W7IB 4PE4A 1IGVA 3WHUB 3A8RA 3BOWB 4GPLB 1C07A 5F6TA 3TDUA 1CFPA 1SCMB 4CLNA 1RROA 4MN0A 1RJVA 2NCOA 3VRRA 1AP4A 1CMFA 1TRFA 3TDIA 2JQ6A 1AJ4A 4PE1A 4DS7A 1BF5A 4YGAA 4CIDA 4M2OA 2LVIA 1L2OC 1ZACA 3TUYC 3VGOA 2ZN9A 2O5GA 1JFKA 1K90D 2E6WA 2KAXA 3KF9A 3FWCA 1DT7B 2DOQA 5DKNA 3JTDB 4F0ZB 1M46A 1SCMC 1K9KA 3LCPC 2MAZA 2NLNA 4NDBA 2KQ6A 1SL9A 2KYCA 1KWOB 1LXFC 1CB1A 1NX0A 3DVEA 4BY5A 3EVRA 1YUUA 3I5GC 1NCXA 1QVIY 1YX8A 1SCVA 1CDPA 1LA0A 5HLVA 1DGUA 1SR6B 4JQ0D 1R6PA 1BMOA 2FOTA 2HQWA 5I2OA 1U5IA 2K7OA 3AAKA 1QIWA 4WRIA 1TOPA 1RFJA 1M63B 2K7BA 1KK8B 1QX5B 1DJZA 1TTXA 2LHIA 2LAPA 4MEWA 1B7TZ 1ALWA 1QV0A 4WQ2A 4PHNA 4A4CA 2JWWA 2M8UA 1J7OA 1KFXL 2EC6B 3WNXB 5AFPA 2FCEA 1XFXO 4OR9B 2F2PA 2L51A 4PE0A 1K95A 2JT8A 2Y1MA 4PHKA 2JXLA 3BQ3A 1DMOA 1ZFSA 1KFUL 3LK0A 1E8AA 5AXIA 2EGDA 1DJXA 3CS1A 2F33A 1CFCA 3TZ1A 3CTNA 3CWGA 5KSZA 2JOJA 3BOWA 1BU3A 2PMYA 4I5LB 1M31A 4DRWA 1V1GA 1XYDA 1A75A 1BT6A 3D0YA 1IQ5A 2JNXA 3M0WA 3NSIA 4M2PA 5HYDA 4N5XA 4HRHA 2MHHA 2KI4B 2LVJA 1MF8B 1CMGA 1HT9A 2JRFA 2OS8B 5DKRA 2ZKMX 2WNDA 1TCOB 4IL1A 4MZLA 1B8LA 1XVJA 3DVJA 4OVNF 2F3ZA 1S1EA 2K2FA 2ZN8A 2K61A 4MSPA 5HKWA 2FJUB 1M45A 3O78A 3IF7A 1AHRA 3OX5A 2M29A 3AAJA 1TNQA 2JTZA 2LVVA 1OMRA 2JC2A 2A4JA 2M7NA 2KI6D 1YTZC 1EXRA 4QJ4B 1KWOC 2JTTA 2WCBA 5PALA 3I5FC 4M2QA 1EJ3A 4XJKA 3EKJA 3I5HC 4PDZA 2KAVA 4C0LA 2F2OA 1ZOTB 1DJWA 2KAYA 3DF0B 4MZJA 4YGEB 4UPGA 1PVAA 5AEQA 2JULA 1KCYA 1YURA 1QX7A 3RLZA 4AOMA 4DCKA 1NUBA 2MJWB 1PSRA 1UHJA 5JOLA 2KI4C 1XFWO 5CSJA 2BL0B 2LLSA 3HX4A 1B47A 1A2XA 1DF0A 2ISDA 1YVLA 4YBHB 1A4PA 1DJGA 1MHOA 2PASA 3WHTB 1J7PA 1PRWA 2QACA 3LK1A 2LV7A 2NXQA 1NCYA 2I18A 3BUNB 3PLFB 1S3PA 1YR5A 2KYFA 1KFUS 1U5IB 2M97A 1DTLA 1OZSA 2ZFDA 3DVMA 5TNCA 1N65A 1YUSA 3SG6A 1K94A 1QJTA 2BBNA 2Q4UA 3EVUA 3GK4X 3PATA 1IQ3A 3LL8B 1B1GA 2WCFA 1WLZA 2I94A 3BUWB 1FI6A 4WQ3A 1WRLA 1W7JB 2MLEC 1JF0A 1JF2A
chains in the Genus database with same CATH superfamily
3K1EA 1IWQA 2LMTA 1GGWA 1TWOA 3NHIA 5HKZA 4C0KA 4F7FA 3CR5X 1QWVA 5CSIA 3BUXB 1UP5A 3VRQA 1MR8A 1OOHA 2KSPA 1CKKA 1S26D 2AUCA 4MZKA 1QIVA 3B6XA 3SS4A 4Q04A 4QJ3B 2ZRSA 1BODA 3R1PA 3AKAA 2BE6A 3HCMA 1K93D 3SG4A 3UO9A 3E3RA 3QRXA 5GQQC 2CXJA 1S6IA 1HQVA 1Z2CB 4YGDB 5CPVA 2PSRA 2MRDA 2BCAA 2BKIB 4ZCUA 3VRPA 3PFVA 1LS8A 1QV1A 4GGFA 4JWQA 2FCDA 3D76A 3BFHA 3BFAA 4C0JA 1CDMA 1SPYA 1UURA 4YGBB 1F8HA 1KK8C 2V53A 2HF5A 3I5HB 2BL0C 2G2BA 2KFHA 1BJFA 2JNFA 2WCHA 3PM8A 3PM2A 2CNPA 3DF0A 3IQQA 1L2OB 2KDHA 1TIZA 1H4BA 3JVTC 1NSHA 4E68A 1QVIZ 4PALA 2KFGA 1WY9A 1JFJA 2LHLA 1TNWA 1F54A 1J7RA 1Y1XA 1M39A 2SASA 3L4AA 4OZDA 2L5XB 2LUXA 1BOCA 1GQMA 1PSBA 1OMVA 1DJYA 3SG2A 2ZNEA 1TUJA 1FBVA 3SG7A 3BYAA 2LUCA 4GNKB 1OQPA 1PALA 2KGBC 1IH0A 1CFDA 2M3WA 3O2PA 2CTNA 3BFBA 3SG5A 1AK8A 5FI7A 1PK0D 1BR4B 1YVHA 3GK2A 2LVKA 3C1VA 5DKQA 1DQEA 1IKUA 4U8DA 1IJ6A 1B8CA 2LM5A 1WRZA 2WOSA 3NSOA 1SNLA 3NXAA 4MLWA 3TUYB 1NX2A 4AQIA 2TN4A 2KQYA 1B9AA 1XFUO 4N1FA 1CLBA 2RGIA 2WORA 1UHHA 1CM1A 1OE9B 3PALA 4PHJA 4A4BA 1H8BA 2L50A 1ZMZA 2LANA 2KPHA 5K89A 2CBLA 1L7ZA 2K2AA 4BY4A 4OKHA 3L4LA 5D69A 4FQTA 4PCWA 1DC1A 1IG5A 3KEVA 3ZNIA 1SKTA 2WCMA 1Z4HA 3OB1B 1NWDA 2PRUA 1A29A 1F55A 2KLDA 4P2YB 2D8NA 3EKHA 4INXA 4P5OE 1JBAA 5D7FA 1XFZO 3D78A 1CDNA 2AAOA 3GOFA 3VROA 2JU0A 2H2KA 1QS7A 1UHIA 1VRKA 3NHTA 2QEHA 4FTGA 1OSAA 1NPQA 1KK7Y 2Y4QA 1SK6D 4FQOA 2L98A 4ICBA 1DGVA 1GGZA 2MLFC 3KPXA 2WC8A 4PT1A 1JUOA 1IIOA 1Y1AA 2Y1NA 4MBEA 4HRGA 4OCIA 5KU1A 1G8IA 2PALA 4NQGA 2ZRTA 1SL8A 3CZTX 1RWYA 2EC6C 1F4QA 4GGFC 3CDNA 3L47A 2KFFA 5FI6A 1JWDA 1WDCB 4ORCB 3WXAA 1DELA 3I5FB 4N1GA 1PULA 3SJSA 2M0RA 3Q8IA 1K96A 1Y1UA 1GM0A 1IRJA 2GGZA 5FI2A 2L0PA 2KNEA 2NZ0A 1WRKA 2M7LA 2L4IA 2CT9A 2BCBA 1XFYO 3SIBA 1C7VA 1TNXA 3EK8A 3DYEA 3R1OA 2BNXA 3NSLA 1LINA 1S6JA 1XA5A 1FI5A 1NX1A 3JVTB 3CR4X 2BBMA 5HKYA 1DVIA 3KHEA 2LCPA 1NIWA 1EH2A 2MBXA 1KSMA 2OPOA 2OS8C 1QXPA 1S5GY 2H8VA 3B86A 3DXLA 3FS7A 3OGNA 1T14A 1SY9A 5G08A 4GAOA 4MRYA 1BG1A 2GV5A 1G4YR 4I5JA 2AMIA 3BXKA 1A03A 2YGUA 3CABA 3H4SE 1SL7A 2L5YA 4AQJA 3KO0A 2LLUA 2M1UA 1D1OA 4DIRA 2JPTA 4XYNA 1S6CA 2HETA 3F45A 4L9MA 2IS9A 1QX2A 3S0GA 4CFQA 3PSRA 3TS5C 1NCZA 1F71A 4D1EA 1CFFA 1Y6WA 1ALVA 2OTGC 2F3YA 1C7WA 1S5GZ 2CCMA 1CLLA 2P6BB 5AERA 4GGNA 1C3YA 1S36A 2P70A 5AANA 2Q91A 1XO5A 2G9BA 1JSAA 1KSOA 1J55A 5I2QA 2KBMA 3TDZA 2K7CA 2O60A 3LLEA 2BCXA 1A75B 2K8MB 2BE4A 1OMDA 1DJIA 3ZWHA 1EL4A 1Y0VH 5J3XA 1OOIX 3EG5B 3PN7B 2I7AA 1ORGA 1MXLC 3VRNA 3RM1A 3CZ1A 3IQOA 3CGAA 1X02A 2WC6A 3B7AA 3PN7C 1P28A 1SR6C 1TNPA 1UWOA 3EVVA 2LMVA 3ICBA 3JTDC 3MSEB 4YGCB 5HL1A 4ORAB 4JKTA 3SS3A 2JT3A 2NCPA 3N7HA 2KHNA 1TN4A 3OX6A 2L4HA 1B7TY 2M9GA 1LKJA 4ZCVA 1ODBA 3S0BA 2M1KB 1MXEA 2GTEA 4GFTA 3SG3A 3DVKA 4GBAA 5CSNA 2ZNDA 5B8IB 5ER4X 2LP2A 3VB1A 1SW8A 2LLTA 3O6BA 3SS5A 5I8NA 1FW4A 3NSKA 1RECA 1BR1B 1XFVO 1QTXA 2JZIA 4NDDA 3TS5B 3DD4A 1DJHA 3I5GB 2HQ8A 5BPJA 3BUOB 1F70A 4DUQA 2R2IA 2JPOA 2LMUA 1MUXA 1IJ5A 1QLKA 3A4UB 4JPZB 2GGMA 2JXCA 2WCLA 3V2LA 1AVSA 2LP3A 1KFXS 4CFRA 2H61C 3B88A 1MQ1A 5I2LA 4QJ5B 1UUSA 3FE8A 3I5IB 3D10A 4R1EA 5ER5A 1XK4C 2K7DA 4I5KA 1QATA 3R72A 1CTRA 1SMGA 3BUMB 1CNPA 2LC5A 1K9PA 4HSZA 1PVBA 5CSFA 2EHBA 1WDCC 2B1UA 1EG4A 3D75A 1CM4A 2KI6C 3AKBA 1KK7Z 1BLQA 3GK1A 1K9UA 4PE7A 2WCEA 4ETOA 5I94A 1EG3A 1YRTB 1SRAA 2E30A 3CLNA 1YUTA 4YRUA 3I5IC 1OOJA 1K8UA 1Q80A 4PHMA 1XK4A 1NX3A 2KBIA 1UHKA 3FIAA 5KTYA 5IBWA 1UHNA 3K21A 2VRGA 2LNKA 1FF1A 1OZOA 1R2UA 3QMEA 2LE9B 3FWBA 3S0FA 1GJYA 1J1EA 4TNCA 2SCPA 2JT0A 4MRXA 3CR2A 4YI8A 4GUKA 1KQMC 1SBJA 1MWNA 1YRUB 4XJKB 1AUIB 1CLMA 1RTP1 4I5NB 2PVBA 3OP0A 1G33A 2HPSA 1NYAA 1WLMA 1FPWA 5FYXA 2F8PA 1F4OA 2L2CA 3SIAA 1N0YA 1K2HA 1JC2A 1CDLA 1TCFA 3OB2B 1DEKA 1B8RA 1QASA 1TUZA 2COLB 2OTGB 3NGVA 2L2EA 1LVCD 4YI9A 2H61A 2BKHB 2M49B 2I2RE 3EK7A 3O4YA 3OHMB 2QPTA 4NDCA 1N2DA 2Y5IA 1SYMA 3OBVA 2KGRA 4CPVA 1KQMB 4HREE 3EK4A 1NP8A 1B4CA 1LA3A 2BECA 3CZ2A 1J7QA 1AJ5A 3D0YB 4OV2A 2KOTA 5JJGA 2K0JA 1ZUZA 1J1DA 5HLOA 1RK9A 2MA2A 4IJ7A 1V1FA 1YX7A 4ORBB 4MVFA 3PJIA 4USLA 1DF0B 1QLSA 1KQVA 1W7IB 4PE4A 1IGVA 3WHUB 3A8RA 3BOWB 4GPLB 1C07A 5F6TA 3TDUA 1CFPA 1SCMB 4CLNA 1RROA 4MN0A 1RJVA 2NCOA 3VRRA 3S0AA 1AP4A 1CMFA 1TRFA 3TDIA 2JQ6A 3CZ0A 1AJ4A 4PE1A 4DS7A 1BF5A 4YGAA 4CIDA 1OOFA 4M2OA 2LVIA 1L2OC 1ZACA 3TUYC 3VGOA 2PYQA 2O5GA 2ZN9A 1JFKA 1K90D 3D74A 2E6WA 2KAXA 3KF9A 3FWCA 1DT7B 2DOQA 5DKNA 3UNWA 1OOGA 3IVTA 3JTDB 4F0ZB 1M46A 1SCMC 1K9KA 3LCPC 3DZTA 2MAZA 2NLNA 4NDBA 2KQ6A 1SL9A 2KYCA 1KWOB 1LXFC 1CB1A 2WC5A 1NX0A 3DVEA 4BY5A 3EVRA 1YUUA 3I5GC 2QEBA 1NCXA 1QVIY 1YX8A 1SCVA 1CDPA 1LA0A 3O4XA 5HLVA 1DGUA 1SR6B 4JQ0D 1R6PA 3D77A 5D3OA 1BMOA 2FOTA 2HQWA 5I2OA 1U5IA 2K7OA 3AAKA 1QIWA 4WRIA 1TOPA 2WCJA 1RFJA 1M63B 2K7BA 1KK8B 1QX5B 1DJZA 1TTXA 2LHIA 2LAPA 3CYZA 4MEWA 5DICA 1B7TZ 1ALWA 1QV0A 4WQ2A 4PHNA 4A4CA 2JWWA 2M8UA 1J7OA 1KFXL 2EC6B 3WNXB 5AFPA 2FCEA 3BJHA 1XFRA 1XFXO 4JD9A 2F2PA 4OR9B 2L51A 2K60A 4PE0A 1K95A 2JT8A 2Y1MA 4PHKA 2JXLA 3BQ3A 1DMOA 1ZFSA 1KFUL 3LK0A 1E8AA 5AXIA 2EGDA 1DJXA 3CS1A 2F33A 1CFCA 3TZ1A 2BAPA 3CTNA 3CWGA 2JOJA 5KSZA 3BOWA 1BU3A 2PMYA 4I5LB 1M31A 4DRWA 1V1GA 1XYDA 1A75A 1BT6A 3D0YA 1IQ5A 2JNXA 3M0WA 3NSIA 4M2PA 5HYDA 4N5XA 4HRHA 2MHHA 2KI4B 2LVJA 1MF8B 1CMGA 1HT9A 2JRFA 2OS8B 5DKRA 2ZKMX 2WNDA 1OW4A 1TCOB 4IL1A 4MZLA 1B8LA 1XVJA 3DVJA 4OVNF 2F3ZA 4INWA 1S1EA 2K2FA 2ZN8A 2K61A 4MSPA 5HKWA 2FJUB 1M45A 3O78A 2FJYA 3IF7A 1AHRA 5EL2A 3OX5A 2M29A 3AAJA 1TNQA 2JTZA 2LVVA 1OMRA 2JC2A 2A4JA 3D73A 2M7NA 3S0EA 2KI6D 1YTZC 1EXRA 4QJ4B 1KWOC 2JTTA 2WCBA 3B87A 5PALA 3I5FC 4M2QA 1EJ3A 4XJKA 3EKJA 1C3ZA 3I5HC 4PDZA 2KAVA 4C0LA 2QEOA 2F2OA 1ZOTB 1DJWA 2ERBA 2KAYA 3DF0B 3R1VA 4MZJA 4YGEB 4UPGA 1PVAA 5AEQA 2JULA 1KCYA 1YURA 1QX7A 3RLZA 4AOMA 4DCKA 1SSEB 1NUBA 2MJWB 1PSRA 1UHJA 5JOLA 2KI4C 1XFWO 5CSJA 3RZSA 2BL0B 2LLSA 3HX4A 1B47A 1A2XA 1DF0A 2ISDA 2P71A 1YVLA 4YBHB 1A4PA 1DJGA 1MHOA 2PASA 3WHTB 1J7PA 1PRWA 2QACA 3LK1A 2LV7A 2NXQA 1NCYA 2KLEA 2I18A 3BUNB 3PLFB 1S3PA 1YR5A 2KYFA 1KFUS 1U5IB 2M97A 1DTLA 1OZSA 3S0DA 2ZFDA 3DVMA 3DY9A 5TNCA 1N65A 1YUSA 3SG6A 2PQLA 2QDIA 1K94A 1QJTA 2BBNA 2Q4UA 3FE6A 3FE9A 3EVUA 3GK4X 1W9ZA 3PATA 4KYNA 1IQ3A 3LL8B 1B1GA 2WCFA 1WLZA 2I94A 3BUWB 1FI6A 4WQ3A 1WRLA 1W7JB 2MLEC 1JF0A 2WCKA 2QEVA 1JF2A
chains in the Genus database with same CATH topology
1IWQA 2LMTA 1GGWA 5HKZA 4C0KA 3CR5X 5CSIA 3BUXB 1UP5A 3VRQA 1MR8A 2KSPA 1CKKA 1S26D 2AUCA 4MZKA 1QIVA 4Q04A 4QJ3B 2ZRSA 1BODA 3AKAA 2BE6A 3HCMA 1K93D 3SG4A 3E3RA 3QRXA 5GQQC 2CXJA 1S6IA 1HQVA 4YGDB 5CPVA 2PSRA 2MRDA 2BCAA 2BKIB 4ZCUA 3VRPA 3PFVA 1QV1A 4GGFA 4JWQA 2FCDA 1CDMA 1SPYA 1UURA 4YGBB 1F8HA 1KK8C 2V53A 2HF5A 3I5HB 2BL0C 2G2BA 2KFHA 1BJFA 2JNFA 3PM8A 2CNPA 3DF0A 3IQQA 1L2OB 2KDHA 1TIZA 1H4BA 3JVTC 1NSHA 4E68A 1QVIZ 4PALA 2KFGA 1WY9A 1JFJA 2LHLA 1TNWA 1F54A 1J7RA 1Y1XA 1M39A 2SASA 2L5XB 2LUXA 1BOCA 1GQMA 1PSBA 1OMVA 1DJYA 3SG2A 2ZNEA 3SG7A 1FBVA 3BYAA 2LUCA 4GNKB 1OQPA 1PALA 2KGBC 1IH0A 1CFDA 2M3WA 3O2PA 2CTNA 3SG5A 1AK8A 1PK0D 1BR4B 1YVHA 3GK2A 2LVKA 3C1VA 5DKQA 1IKUA 4U8DA 1IJ6A 1B8CA 2LM5A 1WRZA 2WOSA 3NSOA 1SNLA 3NXAA 4MLWA 3TUYB 1NX2A 4AQIA 2TN4A 2KQYA 1B9AA 1XFUO 4N1FA 1CLBA 2RGIA 2WORA 1UHHA 1CM1A 1OE9B 3PALA 4PHJA 4A4BA 1H8BA 2L50A 1ZMZA 2LANA 5K89A 2CBLA 1L7ZA 2K2AA 4BY4A 4OKHA 5D69A 4PCWA 1IG5A 3KEVA 3ZNIA 1SKTA 3OB1B 1NWDA 2PRUA 1A29A 1F55A 4P2YB 2D8NA 3EKHA 4P5OE 1JBAA 5D7FA 1XFZO 1CDNA 2AAOA 3GOFA 3VROA 2JU0A 2H2KA 1QS7A 1UHIA 1VRKA 4FTGA 1OSAA 1NPQA 1KK7Y 2Y4QA 1SK6D 4FQOA 2L98A 4ICBA 1DGVA 1GGZA 2MLFC 3KPXA 2WC8A 1JUOA 1Y1AA 2Y1NA 4MBEA 4HRGA 4OCIA 5KU1A 1G8IA 2PALA 4NQGA 2ZRTA 1SL8A 3CZTX 1RWYA 2EC6C 1F4QA 4GGFC 2KFFA 1JWDA 1WDCB 4ORCB 3WXAA 3I5FB 4C0JA 4N1GA 1PULA 3SJSA 2M0RA 1K96A 1Y1UA 1IRJA 2GGZA 2L0PA 2KNEA 2NZ0A 1WRKA 2M7LA 2L4IA 2CT9A 2BCBA 1XFYO 3SIBA 1C7VA 1TNXA 3EK8A 3NSLA 1LINA 1S6JA 1XA5A 1FI5A 1NX1A 3JVTB 3CR4X 2BBMA 5HKYA 1DVIA 3KHEA 2LCPA 1NIWA 1EH2A 2MBXA 1KSMA 2OPOA 2OS8C 1QXPA 1S5GY 3FS7A 1SY9A 5G08A 4GAOA 4MRYA 1BG1A 2GV5A 1G4YR 4I5JA 2AMIA 3BXKA 1A03A 3H4SE 1SL7A 4AQJA 3KO0A 2LLUA 2M1UA 1D1OA 4DIRA 2JPTA 4XYNA 1S6CA 2HETA 3F45A 4L9MA 2IS9A 1QX2A 4CFQA 3PSRA 3TS5C 1NCZA 1F71A 4D1EA 1CFFA 1Y6WA 1ALVA 2OTGC 2F3YA 1C7WA 1S5GZ 2CCMA 1CLLA 2P6BB 5AERA 4GGNA 1S36A 5AANA 2Q91A 1XO5A 2G9BA 1JSAA 1KSOA 1J55A 5I2QA 2KBMA 3TDZA 2K7CA 2O60A 3LLEA 2BCXA 1A75B 2K8MB 2BE4A 1OMDA 1DJIA 3ZWHA 1EL4A 1Y0VH 5J3XA 3PN7B 2I7AA 1MXLC 3VRNA 3RM1A 3IQOA 3CGAA 1X02A 3PN7C 1SR6C 1TNPA 1UWOA 3EVVA 3JTDC 2LMVA 3ICBA 3MSEB 4YGCB 4ORAB 2JT3A 2NCPA 3OX6A 2KHNA 1TN4A 2L4HA 1B7TY 2M9GA 1LKJA 4ZCVA 1ODBA 2M1KB 1MXEA 4GFTA 3SG3A 3DVKA 4GBAA 5CSNA 2ZNDA 5B8IB 5ER4X 2LP2A 1SW8A 2LLTA 3O6BA 5I8NA 1FW4A 3NSKA 1RECA 1BR1B 1XFVO 1QTXA 2JZIA 4NDDA 3TS5B 3DD4A 1DJHA 3I5GB 2HQ8A 5BPJA 3BUOB 1F70A 4DUQA 2R2IA 2LMUA 1MUXA 1IJ5A 1QLKA 3A4UB 4JPZB 2GGMA 2JXCA 1AVSA 2LP3A 1KFXS 4CFRA 2H61C 1MQ1A 5I2LA 4QJ5B 1UUSA 3I5IB 3D10A 4R1EA 5ER5A 1XK4C 2K7DA 4I5KA 1QATA 1CTRA 1SMGA 3BUMB 1CNPA 2LC5A 1K9PA 4HSZA 1PVBA 5CSFA 2EHBA 1WDCC 2B1UA 1EG4A 1CM4A 2KI6C 3AKBA 1KK7Z 1BLQA 3GK1A 1K9UA 4PE7A 2WCEA 4ETOA 1EG3A 1YRTB 1SRAA 2E30A 3CLNA 1YUTA 4YRUA 3I5IC 1OOJA 1K8UA 1Q80A 4PHMA 1XK4A 1NX3A 2KBIA 1UHKA 3FIAA 5KTYA 5IBWA 1UHNA 3K21A 2VRGA 2LNKA 1FF1A 1OZOA 1R2UA 2LE9B 3FWBA 1GJYA 1J1EA 4TNCA 2SCPA 2JT0A 4MRXA 3CR2A 4YI8A 4GUKA 1KQMC 1SBJA 1MWNA 1YRUB 4XJKB 1AUIB 1CLMA 1RTP1 4I5NB 2PVBA 3OP0A 1G33A 2HPSA 1NYAA 1WLMA 1FPWA 5FYXA 2F8PA 1F4OA 3SIAA 1N0YA 1K2HA 1JC2A 1CDLA 1TCFA 3OB2B 1B8RA 1QASA 2COLB 4YI9A 2OTGB 2L2EA 1LVCD 2H61A 2BKHB 2M49B 2I2RE 3EK7A 3O4YA 3OHMB 2QPTA 4NDCA 1N2DA 2Y5IA 1SYMA 4CPVA 2KGRA 1KQMB 4HREE 3EK4A 1NP8A 1B4CA 1LA3A 2BECA 1J7QA 1AJ5A 3D0YB 4OV2A 2KOTA 5JJGA 2K0JA 1ZUZA 1J1DA 5HLOA 1RK9A 2MA2A 1V1FA 1YX7A 4ORBB 4MVFA 4USLA 1DF0B 1QLSA 1KQVA 1W7IB 4PE4A 1IGVA 3WHUB 3A8RA 3BOWB 4GPLB 1C07A 5F6TA 3TDUA 1CFPA 1SCMB 4CLNA 1RROA 4MN0A 1RJVA 2NCOA 3VRRA 1AP4A 1CMFA 1TRFA 3TDIA 2JQ6A 1AJ4A 4PE1A 4DS7A 1BF5A 4YGAA 4CIDA 4M2OA 2LVIA 1L2OC 1ZACA 3TUYC 3VGOA 2ZN9A 2O5GA 1JFKA 1K90D 2E6WA 2KAXA 3KF9A 3FWCA 1DT7B 2DOQA 5DKNA 3JTDB 4F0ZB 1M46A 1SCMC 1K9KA 3LCPC 2MAZA 2NLNA 4NDBA 2KQ6A 1SL9A 2KYCA 1KWOB 1LXFC 1CB1A 1NX0A 3DVEA 4BY5A 3EVRA 1YUUA 3I5GC 1NCXA 1QVIY 1YX8A 1SCVA 1CDPA 1LA0A 5HLVA 1DGUA 1SR6B 4JQ0D 1R6PA 1BMOA 2FOTA 2HQWA 5I2OA 1U5IA 2K7OA 3AAKA 1QIWA 4WRIA 1TOPA 1RFJA 1M63B 2K7BA 1KK8B 1QX5B 1DJZA 1TTXA 2LHIA 2LAPA 4MEWA 1B7TZ 1ALWA 1QV0A 4WQ2A 4PHNA 4A4CA 2JWWA 2M8UA 1J7OA 1KFXL 2EC6B 3WNXB 5AFPA 2FCEA 1XFXO 4OR9B 2F2PA 2L51A 4PE0A 1K95A 2JT8A 2Y1MA 4PHKA 2JXLA 3BQ3A 1DMOA 1ZFSA 1KFUL 3LK0A 1E8AA 5AXIA 2EGDA 1DJXA 3CS1A 2F33A 1CFCA 3TZ1A 3CTNA 3CWGA 5KSZA 2JOJA 3BOWA 1BU3A 2PMYA 4I5LB 1M31A 4DRWA 1V1GA 1XYDA 1A75A 1BT6A 3D0YA 1IQ5A 2JNXA 3M0WA 3NSIA 4M2PA 5HYDA 4N5XA 4HRHA 2MHHA 2KI4B 2LVJA 1MF8B 1CMGA 1HT9A 2JRFA 2OS8B 5DKRA 2ZKMX 2WNDA 1TCOB 4IL1A 4MZLA 1B8LA 1XVJA 3DVJA 4OVNF 2F3ZA 1S1EA 2K2FA 2ZN8A 2K61A 4MSPA 5HKWA 2FJUB 1M45A 3O78A 3IF7A 1AHRA 3OX5A 2M29A 3AAJA 1TNQA 2JTZA 2LVVA 1OMRA 2JC2A 2A4JA 2M7NA 2KI6D 1YTZC 1EXRA 4QJ4B 1KWOC 2JTTA 2WCBA 5PALA 3I5FC 4M2QA 1EJ3A 4XJKA 3EKJA 3I5HC 4PDZA 2KAVA 4C0LA 2F2OA 1ZOTB 1DJWA 2KAYA 3DF0B 4MZJA 4YGEB 4UPGA 1PVAA 5AEQA 2JULA 1KCYA 1YURA 1QX7A 3RLZA 4AOMA 4DCKA 1NUBA 2MJWB 1PSRA 1UHJA 5JOLA 2KI4C 1XFWO 5CSJA 2BL0B 2LLSA 3HX4A 1B47A 1A2XA 1DF0A 2ISDA 1YVLA 4YBHB 1A4PA 1DJGA 1MHOA 2PASA 3WHTB 1J7PA 1PRWA 2QACA 3LK1A 2LV7A 2NXQA 1NCYA 2I18A 3BUNB 3PLFB 1S3PA 1YR5A 2KYFA 1KFUS 1U5IB 2M97A 1DTLA 1OZSA 2ZFDA 3DVMA 5TNCA 1N65A 1YUSA 3SG6A 1K94A 1QJTA 2BBNA 2Q4UA 3EVUA 3GK4X 3PATA 1IQ3A 3LL8B 1B1GA 2WCFA 1WLZA 2I94A 3BUWB 1FI6A 4WQ3A 1WRLA 1W7JB 2MLEC 1JF0A 1JF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IWQ A;  2LMT A;  1GGW A;  5HKZ A;  4C0K A;  3CR5 X;  5CSI A;  3BUX B;  1UP5 A;  3VRQ A;  1MR8 A;  2KSP A;  1CKK A;  1S26 D;  2AUC A;  4MZK A;  1QIV A;  4Q04 A;  4QJ3 B;  2ZRS A;  1BOD A;  3AKA A;  2BE6 A;  3HCM A;  1K93 D;  3SG4 A;  3E3R A;  3QRX A;  5GQQ C;  2CXJ A;  1S6I A;  1HQV A;  4YGD B;  5CPV A;  2PSR A;  2MRD A;  2BCA A;  2BKI B;  4ZCU A;  3VRP A;  3PFV A;  1QV1 A;  4GGF A;  4JWQ A;  2FCD A;  1CDM A;  1SPY A;  1UUR A;  4YGB B;  1F8H A;  1KK8 C;  2V53 A;  2HF5 A;  3I5H B;  2BL0 C;  2G2B A;  2KFH A;  1BJF A;  2JNF A;  3PM8 A;  2CNP A;  3DF0 A;  3IQQ A;  1L2O B;  2KDH A;  1TIZ A;  1H4B A;  3JVT C;  1NSH A;  4E68 A;  1QVI Z;  4PAL A;  2KFG A;  1WY9 A;  1JFJ A;  2LHL A;  1TNW A;  1F54 A;  1J7R A;  1Y1X A;  1M39 A;  2SAS A;  2L5X B;  2LUX A;  1BOC A;  1GQM A;  1PSB A;  1OMV A;  1DJY A;  3SG2 A;  2ZNE A;  3SG7 A;  1FBV A;  3BYA A;  2LUC A;  4GNK B;  1OQP A;  1PAL A;  2KGB C;  1IH0 A;  1CFD A;  2M3W A;  3O2P A;  2CTN A;  3SG5 A;  1AK8 A;  1PK0 D;  1BR4 B;  1YVH A;  3GK2 A;  2LVK A;  3C1V A;  5DKQ A;  1IKU A;  4U8D A;  1IJ6 A;  1B8C A;  2LM5 A;  1WRZ A;  2WOS A;  3NSO A;  1SNL A;  3NXA A;  4MLW A;  3TUY B;  1NX2 A;  4AQI A;  2TN4 A;  2KQY A;  1B9A A;  1XFU O;  4N1F A;  1CLB A;  2RGI A;  2WOR A;  1UHH A;  1CM1 A;  1OE9 B;  3PAL A;  4PHJ A;  4A4B A;  1H8B A;  2L50 A;  1ZMZ A;  2LAN A;  5K89 A;  2CBL A;  1L7Z A;  2K2A A;  4BY4 A;  4OKH A;  5D69 A;  4PCW A;  1IG5 A;  3KEV A;  3ZNI A;  1SKT A;  3OB1 B;  1NWD A;  2PRU A;  1A29 A;  1F55 A;  4P2Y B;  2D8N A;  3EKH A;  4P5O E;  1JBA A;  5D7F A;  1XFZ O;  1CDN A;  2AAO A;  3GOF A;  3VRO A;  2JU0 A;  2H2K A;  1QS7 A;  1UHI A;  1VRK A;  4FTG A;  1OSA A;  1NPQ A;  1KK7 Y;  2Y4Q A;  1SK6 D;  4FQO A;  2L98 A;  4ICB A;  1DGV A;  1GGZ A;  2MLF C;  3KPX A;  2WC8 A;  1JUO A;  1Y1A A;  2Y1N A;  4MBE A;  4HRG A;  4OCI A;  5KU1 A;  1G8I A;  2PAL A;  4NQG A;  2ZRT A;  1SL8 A;  3CZT X;  1RWY A;  2EC6 C;  1F4Q A;  4GGF C;  2KFF A;  1JWD A;  1WDC B;  4ORC B;  3WXA A;  3I5F B;  4C0J A;  4N1G A;  1PUL A;  3SJS A;  2M0R A;  1K96 A;  1Y1U A;  1IRJ A;  2GGZ A;  2L0P A;  2KNE A;  2NZ0 A;  1WRK A;  2M7L A;  2L4I A;  2CT9 A;  2BCB A;  1XFY O;  3SIB A;  1C7V A;  1TNX A;  3EK8 A;  3NSL A;  1LIN A;  1S6J A;  1XA5 A;  1FI5 A;  1NX1 A;  3JVT B;  3CR4 X;  2BBM A;  5HKY A;  1DVI A;  3KHE A;  2LCP A;  1NIW A;  1EH2 A;  2MBX A;  1KSM A;  2OPO A;  2OS8 C;  1QXP A;  1S5G Y;  3FS7 A;  1SY9 A;  5G08 A;  4GAO A;  4MRY A;  1BG1 A;  2GV5 A;  1G4Y R;  4I5J A;  2AMI A;  3BXK A;  1A03 A;  3H4S E;  1SL7 A;  4AQJ A;  3KO0 A;  2LLU A;  2M1U A;  1D1O A;  4DIR A;  2JPT A;  4XYN A;  1S6C A;  2HET A;  3F45 A;  4L9M A;  2IS9 A;  1QX2 A;  4CFQ A;  3PSR A;  3TS5 C;  1NCZ A;  1F71 A;  4D1E A;  1CFF A;  1Y6W A;  1ALV A;  2OTG C;  2F3Y A;  1C7W A;  1S5G Z;  2CCM A;  1CLL A;  2P6B B;  5AER A;  4GGN A;  1S36 A;  5AAN A;  2Q91 A;  1XO5 A;  2G9B A;  1JSA A;  1KSO A;  1J55 A;  5I2Q A;  2KBM A;  3TDZ A;  2K7C A;  2O60 A;  3LLE A;  2BCX A;  1A75 B;  2K8M B;  2BE4 A;  1OMD A;  1DJI A;  3ZWH A;  1EL4 A;  1Y0V H;  5J3X A;  3PN7 B;  2I7A A;  1MXL C;  3VRN A;  3RM1 A;  3IQO A;  3CGA A;  1X02 A;  3PN7 C;  1SR6 C;  1TNP A;  1UWO A;  3EVV A;  3JTD C;  2LMV A;  3ICB A;  3MSE B;  4YGC B;  4ORA B;  2JT3 A;  2NCP A;  3OX6 A;  2KHN A;  1TN4 A;  2L4H A;  1B7T Y;  2M9G A;  1LKJ A;  4ZCV A;  1ODB A;  2M1K B;  1MXE A;  4GFT A;  3SG3 A;  3DVK A;  4GBA A;  5CSN A;  2ZND A;  5B8I B;  5ER4 X;  2LP2 A;  1SW8 A;  2LLT A;  3O6B A;  5I8N A;  1FW4 A;  3NSK A;  1REC A;  1BR1 B;  1XFV O;  1QTX A;  2JZI A;  4NDD A;  3TS5 B;  3DD4 A;  1DJH A;  3I5G B;  2HQ8 A;  5BPJ A;  3BUO B;  1F70 A;  4DUQ A;  2R2I A;  2LMU A;  1MUX A;  1IJ5 A;  1QLK A;  3A4U B;  4JPZ B;  2GGM A;  2JXC A;  1AVS A;  2LP3 A;  1KFX S;  4CFR A;  2H61 C;  1MQ1 A;  5I2L A;  4QJ5 B;  1UUS A;  3I5I B;  3D10 A;  4R1E A;  5ER5 A;  1XK4 C;  2K7D A;  4I5K A;  1QAT A;  1CTR A;  1SMG A;  3BUM B;  1CNP A;  2LC5 A;  1K9P A;  4HSZ A;  1PVB A;  5CSF A;  2EHB A;  1WDC C;  2B1U A;  1EG4 A;  1CM4 A;  2KI6 C;  3AKB A;  1KK7 Z;  1BLQ A;  3GK1 A;  1K9U A;  4PE7 A;  2WCE A;  4ETO A;  1EG3 A;  1YRT B;  1SRA A;  2E30 A;  3CLN A;  1YUT A;  4YRU A;  3I5I C;  1OOJ A;  1K8U A;  1Q80 A;  4PHM A;  1XK4 A;  1NX3 A;  2KBI A;  1UHK A;  3FIA A;  5KTY A;  5IBW A;  1UHN A;  3K21 A;  2VRG A;  2LNK A;  1FF1 A;  1OZO A;  1R2U A;  2LE9 B;  3FWB A;  1GJY A;  1J1E A;  4TNC A;  2SCP A;  2JT0 A;  4MRX A;  3CR2 A;  4YI8 A;  4GUK A;  1KQM C;  1SBJ A;  1MWN A;  1YRU B;  4XJK B;  1AUI B;  1CLM A;  1RTP 1;  4I5N B;  2PVB A;  3OP0 A;  1G33 A;  2HPS A;  1NYA A;  1WLM A;  1FPW A;  5FYX A;  2F8P A;  1F4O A;  3SIA A;  1N0Y A;  1K2H A;  1JC2 A;  1CDL A;  1TCF A;  3OB2 B;  1B8R A;  1QAS A;  2COL B;  4YI9 A;  2OTG B;  2L2E A;  1LVC D;  2H61 A;  2BKH B;  2M49 B;  2I2R E;  3EK7 A;  3O4Y A;  3OHM B;  2QPT A;  4NDC A;  1N2D A;  2Y5I A;  1SYM A;  4CPV A;  2KGR A;  1KQM B;  4HRE E;  3EK4 A;  1NP8 A;  1B4C A;  1LA3 A;  2BEC A;  1J7Q A;  1AJ5 A;  3D0Y B;  4OV2 A;  2KOT A;  5JJG A;  2K0J A;  1ZUZ A;  1J1D A;  5HLO A;  1RK9 A;  2MA2 A;  1V1F A;  1YX7 A;  4ORB B;  4MVF A;  4USL A;  1DF0 B;  1QLS A;  1KQV A;  1W7I B;  4PE4 A;  1IGV A;  3WHU B;  3A8R A;  3BOW B;  4GPL B;  1C07 A;  5F6T A;  3TDU A;  1CFP A;  1SCM B;  4CLN A;  1RRO A;  4MN0 A;  1RJV A;  2NCO A;  3VRR A;  1AP4 A;  1CMF A;  1TRF A;  3TDI A;  2JQ6 A;  1AJ4 A;  4PE1 A;  4DS7 A;  1BF5 A;  4YGA A;  4CID A;  4M2O A;  2LVI A;  1L2O C;  1ZAC A;  3TUY C;  3VGO A;  2ZN9 A;  2O5G A;  1JFK A;  1K90 D;  2E6W A;  2KAX A;  3KF9 A;  3FWC A;  1DT7 B;  2DOQ A;  5DKN A;  3JTD B;  4F0Z B;  1M46 A;  1SCM C;  1K9K A;  3LCP C;  2MAZ A;  2NLN A;  4NDB A;  2KQ6 A;  1SL9 A;  2KYC A;  1KWO B;  1LXF C;  1CB1 A;  1NX0 A;  3DVE A;  4BY5 A;  3EVR A;  1YUU A;  3I5G C;  1NCX A;  1QVI Y;  1YX8 A;  1SCV A;  1CDP A;  1LA0 A;  5HLV A;  1DGU A;  1SR6 B;  4JQ0 D;  1R6P A;  1BMO A;  2FOT A;  2HQW A;  5I2O A;  1U5I A;  2K7O A;  3AAK A;  1QIW A;  4WRI A;  1TOP A;  1RFJ A;  1M63 B;  2K7B A;  1KK8 B;  1QX5 B;  1DJZ A;  1TTX A;  2LHI A;  2LAP A;  4MEW A;  1B7T Z;  1ALW A;  1QV0 A;  4WQ2 A;  4PHN A;  4A4C A;  2JWW A;  2M8U A;  1J7O A;  1KFX L;  2EC6 B;  3WNX B;  5AFP A;  2FCE A;  1XFX O;  4OR9 B;  2F2P A;  2L51 A;  4PE0 A;  1K95 A;  2JT8 A;  2Y1M A;  4PHK A;  2JXL A;  3BQ3 A;  1DMO A;  1ZFS A;  1KFU L;  3LK0 A;  1E8A A;  5AXI A;  2EGD A;  1DJX A;  3CS1 A;  2F33 A;  1CFC A;  3TZ1 A;  3CTN A;  3CWG A;  5KSZ A;  2JOJ A;  3BOW A;  1BU3 A;  2PMY A;  4I5L B;  1M31 A;  4DRW A;  1V1G A;  1XYD A;  1A75 A;  1BT6 A;  3D0Y A;  1IQ5 A;  2JNX A;  3M0W A;  3NSI A;  4M2P A;  5HYD A;  4N5X A;  4HRH A;  2MHH A;  2KI4 B;  2LVJ A;  1MF8 B;  1CMG A;  1HT9 A;  2JRF A;  2OS8 B;  5DKR A;  2ZKM X;  2WND A;  1TCO B;  4IL1 A;  4MZL A;  1B8L A;  1XVJ A;  3DVJ A;  4OVN F;  2F3Z A;  1S1E A;  2K2F A;  2ZN8 A;  2K61 A;  4MSP A;  5HKW A;  2FJU B;  1M45 A;  3O78 A;  3IF7 A;  1AHR A;  3OX5 A;  2M29 A;  3AAJ A;  1TNQ A;  2JTZ A;  2LVV A;  1OMR A;  2JC2 A;  2A4J A;  2M7N A;  2KI6 D;  1YTZ C;  1EXR A;  4QJ4 B;  1KWO C;  2JTT A;  2WCB A;  5PAL A;  3I5F C;  4M2Q A;  1EJ3 A;  4XJK A;  3EKJ A;  3I5H C;  4PDZ A;  2KAV A;  4C0L A;  2F2O A;  1ZOT B;  1DJW A;  2KAY A;  3DF0 B;  4MZJ A;  4YGE B;  4UPG A;  1PVA A;  5AEQ A;  2JUL A;  1KCY A;  1YUR A;  1QX7 A;  3RLZ A;  4AOM A;  4DCK A;  1NUB A;  2MJW B;  1PSR A;  1UHJ A;  5JOL A;  2KI4 C;  1XFW O;  5CSJ A;  2BL0 B;  2LLS A;  3HX4 A;  1B47 A;  1A2X A;  1DF0 A;  2ISD A;  1YVL A;  4YBH B;  1A4P A;  1DJG A;  1MHO A;  2PAS A;  3WHT B;  1J7P A;  1PRW A;  2QAC A;  3LK1 A;  2LV7 A;  2NXQ A;  1NCY A;  2I18 A;  3BUN B;  3PLF B;  1S3P A;  1YR5 A;  2KYF A;  1KFU S;  1U5I B;  2M97 A;  1DTL A;  1OZS A;  2ZFD A;  3DVM A;  5TNC A;  1N65 A;  1YUS A;  3SG6 A;  1K94 A;  1QJT A;  2BBN A;  2Q4U A;  3EVU A;  3GK4 X;  3PAT A;  1IQ3 A;  3LL8 B;  1B1G A;  2WCF A;  1WLZ A;  2I94 A;  3BUW B;  1FI6 A;  4WQ3 A;  1WRL A;  1W7J B;  2MLE C;  1JF0 A;  1JF2 A; 
#chains in the Genus database with same CATH topology
 3K1E A;  1IWQ A;  2LMT A;  1GGW A;  1TWO A;  3NHI A;  5HKZ A;  4C0K A;  4F7F A;  3CR5 X;  1QWV A;  5CSI A;  3BUX B;  1UP5 A;  3VRQ A;  1MR8 A;  1OOH A;  2KSP A;  1CKK A;  1S26 D;  2AUC A;  4MZK A;  1QIV A;  3B6X A;  3SS4 A;  4Q04 A;  4QJ3 B;  2ZRS A;  1BOD A;  3R1P A;  3AKA A;  2BE6 A;  3HCM A;  1K93 D;  3SG4 A;  3UO9 A;  3E3R A;  3QRX A;  5GQQ C;  2CXJ A;  1S6I A;  1HQV A;  1Z2C B;  4YGD B;  5CPV A;  2PSR A;  2MRD A;  2BCA A;  2BKI B;  4ZCU A;  3VRP A;  3PFV A;  1LS8 A;  1QV1 A;  4GGF A;  4JWQ A;  2FCD A;  3D76 A;  3BFH A;  3BFA A;  4C0J A;  1CDM A;  1SPY A;  1UUR A;  4YGB B;  1F8H A;  1KK8 C;  2V53 A;  2HF5 A;  3I5H B;  2BL0 C;  2G2B A;  2KFH A;  1BJF A;  2JNF A;  2WCH A;  3PM8 A;  3PM2 A;  2CNP A;  3DF0 A;  3IQQ A;  1L2O B;  2KDH A;  1TIZ A;  1H4B A;  3JVT C;  1NSH A;  4E68 A;  1QVI Z;  4PAL A;  2KFG A;  1WY9 A;  1JFJ A;  2LHL A;  1TNW A;  1F54 A;  1J7R A;  1Y1X A;  1M39 A;  2SAS A;  3L4A A;  4OZD A;  2L5X B;  2LUX A;  1BOC A;  1GQM A;  1PSB A;  1OMV A;  1DJY A;  3SG2 A;  2ZNE A;  1TUJ A;  1FBV A;  3SG7 A;  3BYA A;  2LUC A;  4GNK B;  1OQP A;  1PAL A;  2KGB C;  1IH0 A;  1CFD A;  2M3W A;  3O2P A;  2CTN A;  3BFB A;  3SG5 A;  1AK8 A;  5FI7 A;  1PK0 D;  1BR4 B;  1YVH A;  3GK2 A;  2LVK A;  3C1V A;  5DKQ A;  1DQE A;  1IKU A;  4U8D A;  1IJ6 A;  1B8C A;  2LM5 A;  1WRZ A;  2WOS A;  3NSO A;  1SNL A;  3NXA A;  4MLW A;  3TUY B;  1NX2 A;  4AQI A;  2TN4 A;  2KQY A;  1B9A A;  1XFU O;  4N1F A;  1CLB A;  2RGI A;  2WOR A;  1UHH A;  1CM1 A;  1OE9 B;  3PAL A;  4PHJ A;  4A4B A;  1H8B A;  2L50 A;  1ZMZ A;  2LAN A;  2KPH A;  5K89 A;  2CBL A;  1L7Z A;  2K2A A;  4BY4 A;  4OKH A;  3L4L A;  5D69 A;  4FQT A;  4PCW A;  1DC1 A;  1IG5 A;  3KEV A;  3ZNI A;  1SKT A;  2WCM A;  1Z4H A;  3OB1 B;  1NWD A;  2PRU A;  1A29 A;  1F55 A;  2KLD A;  4P2Y B;  2D8N A;  3EKH A;  4INX A;  4P5O E;  1JBA A;  5D7F A;  1XFZ O;  3D78 A;  1CDN A;  2AAO A;  3GOF A;  3VRO A;  2JU0 A;  2H2K A;  1QS7 A;  1UHI A;  1VRK A;  3NHT A;  2QEH A;  4FTG A;  1OSA A;  1NPQ A;  1KK7 Y;  2Y4Q A;  1SK6 D;  4FQO A;  2L98 A;  4ICB A;  1DGV A;  1GGZ A;  2MLF C;  3KPX A;  2WC8 A;  4PT1 A;  1JUO A;  1IIO A;  1Y1A A;  2Y1N A;  4MBE A;  4HRG A;  4OCI A;  5KU1 A;  1G8I A;  2PAL A;  4NQG A;  2ZRT A;  1SL8 A;  3CZT X;  1RWY A;  2EC6 C;  1F4Q A;  4GGF C;  3CDN A;  3L47 A;  2KFF A;  5FI6 A;  1JWD A;  1WDC B;  4ORC B;  3WXA A;  1DEL A;  3I5F B;  4N1G A;  1PUL A;  3SJS A;  2M0R A;  3Q8I A;  1K96 A;  1Y1U A;  1GM0 A;  1IRJ A;  2GGZ A;  5FI2 A;  2L0P A;  2KNE A;  2NZ0 A;  1WRK A;  2M7L A;  2L4I A;  2CT9 A;  2BCB A;  1XFY O;  3SIB A;  1C7V A;  1TNX A;  3EK8 A;  3DYE A;  3R1O A;  2BNX A;  3NSL A;  1LIN A;  1S6J A;  1XA5 A;  1FI5 A;  1NX1 A;  3JVT B;  3CR4 X;  2BBM A;  5HKY A;  1DVI A;  3KHE A;  2LCP A;  1NIW A;  1EH2 A;  2MBX A;  1KSM A;  2OPO A;  2OS8 C;  1QXP A;  1S5G Y;  2H8V A;  3B86 A;  3DXL A;  3FS7 A;  3OGN A;  1T14 A;  1SY9 A;  5G08 A;  4GAO A;  4MRY A;  1BG1 A;  2GV5 A;  1G4Y R;  4I5J A;  2AMI A;  3BXK A;  1A03 A;  2YGU A;  3CAB A;  3H4S E;  1SL7 A;  2L5Y A;  4AQJ A;  3KO0 A;  2LLU A;  2M1U A;  1D1O A;  4DIR A;  2JPT A;  4XYN A;  1S6C A;  2HET A;  3F45 A;  4L9M A;  2IS9 A;  1QX2 A;  3S0G A;  4CFQ A;  3PSR A;  3TS5 C;  1NCZ A;  1F71 A;  4D1E A;  1CFF A;  1Y6W A;  1ALV A;  2OTG C;  2F3Y A;  1C7W A;  1S5G Z;  2CCM A;  1CLL A;  2P6B B;  5AER A;  4GGN A;  1C3Y A;  1S36 A;  2P70 A;  5AAN A;  2Q91 A;  1XO5 A;  2G9B A;  1JSA A;  1KSO A;  1J55 A;  5I2Q A;  2KBM A;  3TDZ A;  2K7C A;  2O60 A;  3LLE A;  2BCX A;  1A75 B;  2K8M B;  2BE4 A;  1OMD A;  1DJI A;  3ZWH A;  1EL4 A;  1Y0V H;  5J3X A;  1OOI X;  3EG5 B;  3PN7 B;  2I7A A;  1ORG A;  1MXL C;  3VRN A;  3RM1 A;  3CZ1 A;  3IQO A;  3CGA A;  1X02 A;  2WC6 A;  3B7A A;  3PN7 C;  1P28 A;  1SR6 C;  1TNP A;  1UWO A;  3EVV A;  2LMV A;  3ICB A;  3JTD C;  3MSE B;  4YGC B;  5HL1 A;  4ORA B;  4JKT A;  3SS3 A;  2JT3 A;  2NCP A;  3N7H A;  2KHN A;  1TN4 A;  3OX6 A;  2L4H A;  1B7T Y;  2M9G A;  1LKJ A;  4ZCV A;  1ODB A;  3S0B A;  2M1K B;  1MXE A;  2GTE A;  4GFT A;  3SG3 A;  3DVK A;  4GBA A;  5CSN A;  2ZND A;  5B8I B;  5ER4 X;  2LP2 A;  3VB1 A;  1SW8 A;  2LLT A;  3O6B A;  3SS5 A;  5I8N A;  1FW4 A;  3NSK A;  1REC A;  1BR1 B;  1XFV O;  1QTX A;  2JZI A;  4NDD A;  3TS5 B;  3DD4 A;  1DJH A;  3I5G B;  2HQ8 A;  5BPJ A;  3BUO B;  1F70 A;  4DUQ A;  2R2I A;  2JPO A;  2LMU A;  1MUX A;  1IJ5 A;  1QLK A;  3A4U B;  4JPZ B;  2GGM A;  2JXC A;  2WCL A;  3V2L A;  1AVS A;  2LP3 A;  1KFX S;  4CFR A;  2H61 C;  3B88 A;  1MQ1 A;  5I2L A;  4QJ5 B;  1UUS A;  3FE8 A;  3I5I B;  3D10 A;  4R1E A;  5ER5 A;  1XK4 C;  2K7D A;  4I5K A;  1QAT A;  3R72 A;  1CTR A;  1SMG A;  3BUM B;  1CNP A;  2LC5 A;  1K9P A;  4HSZ A;  1PVB A;  5CSF A;  2EHB A;  1WDC C;  2B1U A;  1EG4 A;  3D75 A;  1CM4 A;  2KI6 C;  3AKB A;  1KK7 Z;  1BLQ A;  3GK1 A;  1K9U A;  4PE7 A;  2WCE A;  4ETO A;  5I94 A;  1EG3 A;  1YRT B;  1SRA A;  2E30 A;  3CLN A;  1YUT A;  4YRU A;  3I5I C;  1OOJ A;  1K8U A;  1Q80 A;  4PHM A;  1XK4 A;  1NX3 A;  2KBI A;  1UHK A;  3FIA A;  5KTY A;  5IBW A;  1UHN A;  3K21 A;  2VRG A;  2LNK A;  1FF1 A;  1OZO A;  1R2U A;  3QME A;  2LE9 B;  3FWB A;  3S0F A;  1GJY A;  1J1E A;  4TNC A;  2SCP A;  2JT0 A;  4MRX A;  3CR2 A;  4YI8 A;  4GUK A;  1KQM C;  1SBJ A;  1MWN A;  1YRU B;  4XJK B;  1AUI B;  1CLM A;  1RTP 1;  4I5N B;  2PVB A;  3OP0 A;  1G33 A;  2HPS A;  1NYA A;  1WLM A;  1FPW A;  5FYX A;  2F8P A;  1F4O A;  2L2C A;  3SIA A;  1N0Y A;  1K2H A;  1JC2 A;  1CDL A;  1TCF A;  3OB2 B;  1DEK A;  1B8R A;  1QAS A;  1TUZ A;  2COL B;  2OTG B;  3NGV A;  2L2E A;  1LVC D;  4YI9 A;  2H61 A;  2BKH B;  2M49 B;  2I2R E;  3EK7 A;  3O4Y A;  3OHM B;  2QPT A;  4NDC A;  1N2D A;  2Y5I A;  1SYM A;  3OBV A;  2KGR A;  4CPV A;  1KQM B;  4HRE E;  3EK4 A;  1NP8 A;  1B4C A;  1LA3 A;  2BEC A;  3CZ2 A;  1J7Q A;  1AJ5 A;  3D0Y B;  4OV2 A;  2KOT A;  5JJG A;  2K0J A;  1ZUZ A;  1J1D A;  5HLO A;  1RK9 A;  2MA2 A;  4IJ7 A;  1V1F A;  1YX7 A;  4ORB B;  4MVF A;  3PJI A;  4USL A;  1DF0 B;  1QLS A;  1KQV A;  1W7I B;  4PE4 A;  1IGV A;  3WHU B;  3A8R A;  3BOW B;  4GPL B;  1C07 A;  5F6T A;  3TDU A;  1CFP A;  1SCM B;  4CLN A;  1RRO A;  4MN0 A;  1RJV A;  2NCO A;  3VRR A;  3S0A A;  1AP4 A;  1CMF A;  1TRF A;  3TDI A;  2JQ6 A;  3CZ0 A;  1AJ4 A;  4PE1 A;  4DS7 A;  1BF5 A;  4YGA A;  4CID A;  1OOF A;  4M2O A;  2LVI A;  1L2O C;  1ZAC A;  3TUY C;  3VGO A;  2PYQ A;  2O5G A;  2ZN9 A;  1JFK A;  1K90 D;  3D74 A;  2E6W A;  2KAX A;  3KF9 A;  3FWC A;  1DT7 B;  2DOQ A;  5DKN A;  3UNW A;  1OOG A;  3IVT A;  3JTD B;  4F0Z B;  1M46 A;  1SCM C;  1K9K A;  3LCP C;  3DZT A;  2MAZ A;  2NLN A;  4NDB A;  2KQ6 A;  1SL9 A;  2KYC A;  1KWO B;  1LXF C;  1CB1 A;  2WC5 A;  1NX0 A;  3DVE A;  4BY5 A;  3EVR A;  1YUU A;  3I5G C;  2QEB A;  1NCX A;  1QVI Y;  1YX8 A;  1SCV A;  1CDP A;  1LA0 A;  3O4X A;  5HLV A;  1DGU A;  1SR6 B;  4JQ0 D;  1R6P A;  3D77 A;  5D3O A;  1BMO A;  2FOT A;  2HQW A;  5I2O A;  1U5I A;  2K7O A;  3AAK A;  1QIW A;  4WRI A;  1TOP A;  2WCJ A;  1RFJ A;  1M63 B;  2K7B A;  1KK8 B;  1QX5 B;  1DJZ A;  1TTX A;  2LHI A;  2LAP A;  3CYZ A;  4MEW A;  5DIC A;  1B7T Z;  1ALW A;  1QV0 A;  4WQ2 A;  4PHN A;  4A4C A;  2JWW A;  2M8U A;  1J7O A;  1KFX L;  2EC6 B;  3WNX B;  5AFP A;  2FCE A;  3BJH A;  1XFR A;  1XFX O;  4JD9 A;  2F2P A;  4OR9 B;  2L51 A;  2K60 A;  4PE0 A;  1K95 A;  2JT8 A;  2Y1M A;  4PHK A;  2JXL A;  3BQ3 A;  1DMO A;  1ZFS A;  1KFU L;  3LK0 A;  1E8A A;  5AXI A;  2EGD A;  1DJX A;  3CS1 A;  2F33 A;  1CFC A;  3TZ1 A;  2BAP A;  3CTN A;  3CWG A;  2JOJ A;  5KSZ A;  3BOW A;  1BU3 A;  2PMY A;  4I5L B;  1M31 A;  4DRW A;  1V1G A;  1XYD A;  1A75 A;  1BT6 A;  3D0Y A;  1IQ5 A;  2JNX A;  3M0W A;  3NSI A;  4M2P A;  5HYD A;  4N5X A;  4HRH A;  2MHH A;  2KI4 B;  2LVJ A;  1MF8 B;  1CMG A;  1HT9 A;  2JRF A;  2OS8 B;  5DKR A;  2ZKM X;  2WND A;  1OW4 A;  1TCO B;  4IL1 A;  4MZL A;  1B8L A;  1XVJ A;  3DVJ A;  4OVN F;  2F3Z A;  4INW A;  1S1E A;  2K2F A;  2ZN8 A;  2K61 A;  4MSP A;  5HKW A;  2FJU B;  1M45 A;  3O78 A;  2FJY A;  3IF7 A;  1AHR A;  5EL2 A;  3OX5 A;  2M29 A;  3AAJ A;  1TNQ A;  2JTZ A;  2LVV A;  1OMR A;  2JC2 A;  2A4J A;  3D73 A;  2M7N A;  3S0E A;  2KI6 D;  1YTZ C;  1EXR A;  4QJ4 B;  1KWO C;  2JTT A;  2WCB A;  3B87 A;  5PAL A;  3I5F C;  4M2Q A;  1EJ3 A;  4XJK A;  3EKJ A;  1C3Z A;  3I5H C;  4PDZ A;  2KAV A;  4C0L A;  2QEO A;  2F2O A;  1ZOT B;  1DJW A;  2ERB A;  2KAY A;  3DF0 B;  3R1V A;  4MZJ A;  4YGE B;  4UPG A;  1PVA A;  5AEQ A;  2JUL A;  1KCY A;  1YUR A;  1QX7 A;  3RLZ A;  4AOM A;  4DCK A;  1SSE B;  1NUB A;  2MJW B;  1PSR A;  1UHJ A;  5JOL A;  2KI4 C;  1XFW O;  5CSJ A;  3RZS A;  2BL0 B;  2LLS A;  3HX4 A;  1B47 A;  1A2X A;  1DF0 A;  2ISD A;  2P71 A;  1YVL A;  4YBH B;  1A4P A;  1DJG A;  1MHO A;  2PAS A;  3WHT B;  1J7P A;  1PRW A;  2QAC A;  3LK1 A;  2LV7 A;  2NXQ A;  1NCY A;  2KLE A;  2I18 A;  3BUN B;  3PLF B;  1S3P A;  1YR5 A;  2KYF A;  1KFU S;  1U5I B;  2M97 A;  1DTL A;  1OZS A;  3S0D A;  2ZFD A;  3DVM A;  3DY9 A;  5TNC A;  1N65 A;  1YUS A;  3SG6 A;  2PQL A;  2QDI A;  1K94 A;  1QJT A;  2BBN A;  2Q4U A;  3FE6 A;  3FE9 A;  3EVU A;  3GK4 X;  1W9Z A;  3PAT A;  4KYN A;  1IQ3 A;  3LL8 B;  1B1G A;  2WCF A;  1WLZ A;  2I94 A;  3BUW B;  1FI6 A;  4WQ3 A;  1WRL A;  1W7J B;  2MLE C;  1JF0 A;  2WCK A;  2QEV A;  1JF2 A; 
#chains in the Genus database with same CATH homology
 1IWQ A;  2LMT A;  1GGW A;  5HKZ A;  4C0K A;  3CR5 X;  5CSI A;  3BUX B;  1UP5 A;  3VRQ A;  1MR8 A;  2KSP A;  1CKK A;  1S26 D;  2AUC A;  4MZK A;  1QIV A;  4Q04 A;  4QJ3 B;  2ZRS A;  1BOD A;  3AKA A;  2BE6 A;  3HCM A;  1K93 D;  3SG4 A;  3E3R A;  3QRX A;  5GQQ C;  2CXJ A;  1S6I A;  1HQV A;  4YGD B;  5CPV A;  2PSR A;  2MRD A;  2BCA A;  2BKI B;  4ZCU A;  3VRP A;  3PFV A;  1QV1 A;  4GGF A;  4JWQ A;  2FCD A;  1CDM A;  1SPY A;  1UUR A;  4YGB B;  1F8H A;  1KK8 C;  2V53 A;  2HF5 A;  3I5H B;  2BL0 C;  2G2B A;  2KFH A;  1BJF A;  2JNF A;  3PM8 A;  2CNP A;  3DF0 A;  3IQQ A;  1L2O B;  2KDH A;  1TIZ A;  1H4B A;  3JVT C;  1NSH A;  4E68 A;  1QVI Z;  4PAL A;  2KFG A;  1WY9 A;  1JFJ A;  2LHL A;  1TNW A;  1F54 A;  1J7R A;  1Y1X A;  1M39 A;  2SAS A;  2L5X B;  2LUX A;  1BOC A;  1GQM A;  1PSB A;  1OMV A;  1DJY A;  3SG2 A;  2ZNE A;  3SG7 A;  1FBV A;  3BYA A;  2LUC A;  4GNK B;  1OQP A;  1PAL A;  2KGB C;  1IH0 A;  1CFD A;  2M3W A;  3O2P A;  2CTN A;  3SG5 A;  1AK8 A;  1PK0 D;  1BR4 B;  1YVH A;  3GK2 A;  2LVK A;  3C1V A;  5DKQ A;  1IKU A;  4U8D A;  1IJ6 A;  1B8C A;  2LM5 A;  1WRZ A;  2WOS A;  3NSO A;  1SNL A;  3NXA A;  4MLW A;  3TUY B;  1NX2 A;  4AQI A;  2TN4 A;  2KQY A;  1B9A A;  1XFU O;  4N1F A;  1CLB A;  2RGI A;  2WOR A;  1UHH A;  1CM1 A;  1OE9 B;  3PAL A;  4PHJ A;  4A4B A;  1H8B A;  2L50 A;  1ZMZ A;  2LAN A;  5K89 A;  2CBL A;  1L7Z A;  2K2A A;  4BY4 A;  4OKH A;  5D69 A;  4PCW A;  1IG5 A;  3KEV A;  3ZNI A;  1SKT A;  3OB1 B;  1NWD A;  2PRU A;  1A29 A;  1F55 A;  4P2Y B;  2D8N A;  3EKH A;  4P5O E;  1JBA A;  5D7F A;  1XFZ O;  1CDN A;  2AAO A;  3GOF A;  3VRO A;  2JU0 A;  2H2K A;  1QS7 A;  1UHI A;  1VRK A;  4FTG A;  1OSA A;  1NPQ A;  1KK7 Y;  2Y4Q A;  1SK6 D;  4FQO A;  2L98 A;  4ICB A;  1DGV A;  1GGZ A;  2MLF C;  3KPX A;  2WC8 A;  1JUO A;  1Y1A A;  2Y1N A;  4MBE A;  4HRG A;  4OCI A;  5KU1 A;  1G8I A;  2PAL A;  4NQG A;  2ZRT A;  1SL8 A;  3CZT X;  1RWY A;  2EC6 C;  1F4Q A;  4GGF C;  2KFF A;  1JWD A;  1WDC B;  4ORC B;  3WXA A;  3I5F B;  4C0J A;  4N1G A;  1PUL A;  3SJS A;  2M0R A;  1K96 A;  1Y1U A;  1IRJ A;  2GGZ A;  2L0P A;  2KNE A;  2NZ0 A;  1WRK A;  2M7L A;  2L4I A;  2CT9 A;  2BCB A;  1XFY O;  3SIB A;  1C7V A;  1TNX A;  3EK8 A;  3NSL A;  1LIN A;  1S6J A;  1XA5 A;  1FI5 A;  1NX1 A;  3JVT B;  3CR4 X;  2BBM A;  5HKY A;  1DVI A;  3KHE A;  2LCP A;  1NIW A;  1EH2 A;  2MBX A;  1KSM A;  2OPO A;  2OS8 C;  1QXP A;  1S5G Y;  3FS7 A;  1SY9 A;  5G08 A;  4GAO A;  4MRY A;  1BG1 A;  2GV5 A;  1G4Y R;  4I5J A;  2AMI A;  3BXK A;  1A03 A;  3H4S E;  1SL7 A;  4AQJ A;  3KO0 A;  2LLU A;  2M1U A;  1D1O A;  4DIR A;  2JPT A;  4XYN A;  1S6C A;  2HET A;  3F45 A;  4L9M A;  2IS9 A;  1QX2 A;  4CFQ A;  3PSR A;  3TS5 C;  1NCZ A;  1F71 A;  4D1E A;  1CFF A;  1Y6W A;  1ALV A;  2OTG C;  2F3Y A;  1C7W A;  1S5G Z;  2CCM A;  1CLL A;  2P6B B;  5AER A;  4GGN A;  1S36 A;  5AAN A;  2Q91 A;  1XO5 A;  2G9B A;  1JSA A;  1KSO A;  1J55 A;  5I2Q A;  2KBM A;  3TDZ A;  2K7C A;  2O60 A;  3LLE A;  2BCX A;  1A75 B;  2K8M B;  2BE4 A;  1OMD A;  1DJI A;  3ZWH A;  1EL4 A;  1Y0V H;  5J3X A;  3PN7 B;  2I7A A;  1MXL C;  3VRN A;  3RM1 A;  3IQO A;  3CGA A;  1X02 A;  3PN7 C;  1SR6 C;  1TNP A;  1UWO A;  3EVV A;  3JTD C;  2LMV A;  3ICB A;  3MSE B;  4YGC B;  4ORA B;  2JT3 A;  2NCP A;  3OX6 A;  2KHN A;  1TN4 A;  2L4H A;  1B7T Y;  2M9G A;  1LKJ A;  4ZCV A;  1ODB A;  2M1K B;  1MXE A;  4GFT A;  3SG3 A;  3DVK A;  4GBA A;  5CSN A;  2ZND A;  5B8I B;  5ER4 X;  2LP2 A;  1SW8 A;  2LLT A;  3O6B A;  5I8N A;  1FW4 A;  3NSK A;  1REC A;  1BR1 B;  1XFV O;  1QTX A;  2JZI A;  4NDD A;  3TS5 B;  3DD4 A;  1DJH A;  3I5G B;  2HQ8 A;  5BPJ A;  3BUO B;  1F70 A;  4DUQ A;  2R2I A;  2LMU A;  1MUX A;  1IJ5 A;  1QLK A;  3A4U B;  4JPZ B;  2GGM A;  2JXC A;  1AVS A;  2LP3 A;  1KFX S;  4CFR A;  2H61 C;  1MQ1 A;  5I2L A;  4QJ5 B;  1UUS A;  3I5I B;  3D10 A;  4R1E A;  5ER5 A;  1XK4 C;  2K7D A;  4I5K A;  1QAT A;  1CTR A;  1SMG A;  3BUM B;  1CNP A;  2LC5 A;  1K9P A;  4HSZ A;  1PVB A;  5CSF A;  2EHB A;  1WDC C;  2B1U A;  1EG4 A;  1CM4 A;  2KI6 C;  3AKB A;  1KK7 Z;  1BLQ A;  3GK1 A;  1K9U A;  4PE7 A;  2WCE A;  4ETO A;  1EG3 A;  1YRT B;  1SRA A;  2E30 A;  3CLN A;  1YUT A;  4YRU A;  3I5I C;  1OOJ A;  1K8U A;  1Q80 A;  4PHM A;  1XK4 A;  1NX3 A;  2KBI A;  1UHK A;  3FIA A;  5KTY A;  5IBW A;  1UHN A;  3K21 A;  2VRG A;  2LNK A;  1FF1 A;  1OZO A;  1R2U A;  2LE9 B;  3FWB A;  1GJY A;  1J1E A;  4TNC A;  2SCP A;  2JT0 A;  4MRX A;  3CR2 A;  4YI8 A;  4GUK A;  1KQM C;  1SBJ A;  1MWN A;  1YRU B;  4XJK B;  1AUI B;  1CLM A;  1RTP 1;  4I5N B;  2PVB A;  3OP0 A;  1G33 A;  2HPS A;  1NYA A;  1WLM A;  1FPW A;  5FYX A;  2F8P A;  1F4O A;  3SIA A;  1N0Y A;  1K2H A;  1JC2 A;  1CDL A;  1TCF A;  3OB2 B;  1B8R A;  1QAS A;  2COL B;  4YI9 A;  2OTG B;  2L2E A;  1LVC D;  2H61 A;  2BKH B;  2M49 B;  2I2R E;  3EK7 A;  3O4Y A;  3OHM B;  2QPT A;  4NDC A;  1N2D A;  2Y5I A;  1SYM A;  4CPV A;  2KGR A;  1KQM B;  4HRE E;  3EK4 A;  1NP8 A;  1B4C A;  1LA3 A;  2BEC A;  1J7Q A;  1AJ5 A;  3D0Y B;  4OV2 A;  2KOT A;  5JJG A;  2K0J A;  1ZUZ A;  1J1D A;  5HLO A;  1RK9 A;  2MA2 A;  1V1F A;  1YX7 A;  4ORB B;  4MVF A;  4USL A;  1DF0 B;  1QLS A;  1KQV A;  1W7I B;  4PE4 A;  1IGV A;  3WHU B;  3A8R A;  3BOW B;  4GPL B;  1C07 A;  5F6T A;  3TDU A;  1CFP A;  1SCM B;  4CLN A;  1RRO A;  4MN0 A;  1RJV A;  2NCO A;  3VRR A;  1AP4 A;  1CMF A;  1TRF A;  3TDI A;  2JQ6 A;  1AJ4 A;  4PE1 A;  4DS7 A;  1BF5 A;  4YGA A;  4CID A;  4M2O A;  2LVI A;  1L2O C;  1ZAC A;  3TUY C;  3VGO A;  2ZN9 A;  2O5G A;  1JFK A;  1K90 D;  2E6W A;  2KAX A;  3KF9 A;  3FWC A;  1DT7 B;  2DOQ A;  5DKN A;  3JTD B;  4F0Z B;  1M46 A;  1SCM C;  1K9K A;  3LCP C;  2MAZ A;  2NLN A;  4NDB A;  2KQ6 A;  1SL9 A;  2KYC A;  1KWO B;  1LXF C;  1CB1 A;  1NX0 A;  3DVE A;  4BY5 A;  3EVR A;  1YUU A;  3I5G C;  1NCX A;  1QVI Y;  1YX8 A;  1SCV A;  1CDP A;  1LA0 A;  5HLV A;  1DGU A;  1SR6 B;  4JQ0 D;  1R6P A;  1BMO A;  2FOT A;  2HQW A;  5I2O A;  1U5I A;  2K7O A;  3AAK A;  1QIW A;  4WRI A;  1TOP A;  1RFJ A;  1M63 B;  2K7B A;  1KK8 B;  1QX5 B;  1DJZ A;  1TTX A;  2LHI A;  2LAP A;  4MEW A;  1B7T Z;  1ALW A;  1QV0 A;  4WQ2 A;  4PHN A;  4A4C A;  2JWW A;  2M8U A;  1J7O A;  1KFX L;  2EC6 B;  3WNX B;  5AFP A;  2FCE A;  1XFX O;  4OR9 B;  2F2P A;  2L51 A;  4PE0 A;  1K95 A;  2JT8 A;  2Y1M A;  4PHK A;  2JXL A;  3BQ3 A;  1DMO A;  1ZFS A;  1KFU L;  3LK0 A;  1E8A A;  5AXI A;  2EGD A;  1DJX A;  3CS1 A;  2F33 A;  1CFC A;  3TZ1 A;  3CTN A;  3CWG A;  5KSZ A;  2JOJ A;  3BOW A;  1BU3 A;  2PMY A;  4I5L B;  1M31 A;  4DRW A;  1V1G A;  1XYD A;  1A75 A;  1BT6 A;  3D0Y A;  1IQ5 A;  2JNX A;  3M0W A;  3NSI A;  4M2P A;  5HYD A;  4N5X A;  4HRH A;  2MHH A;  2KI4 B;  2LVJ A;  1MF8 B;  1CMG A;  1HT9 A;  2JRF A;  2OS8 B;  5DKR A;  2ZKM X;  2WND A;  1TCO B;  4IL1 A;  4MZL A;  1B8L A;  1XVJ A;  3DVJ A;  4OVN F;  2F3Z A;  1S1E A;  2K2F A;  2ZN8 A;  2K61 A;  4MSP A;  5HKW A;  2FJU B;  1M45 A;  3O78 A;  3IF7 A;  1AHR A;  3OX5 A;  2M29 A;  3AAJ A;  1TNQ A;  2JTZ A;  2LVV A;  1OMR A;  2JC2 A;  2A4J A;  2M7N A;  2KI6 D;  1YTZ C;  1EXR A;  4QJ4 B;  1KWO C;  2JTT A;  2WCB A;  5PAL A;  3I5F C;  4M2Q A;  1EJ3 A;  4XJK A;  3EKJ A;  3I5H C;  4PDZ A;  2KAV A;  4C0L A;  2F2O A;  1ZOT B;  1DJW A;  2KAY A;  3DF0 B;  4MZJ A;  4YGE B;  4UPG A;  1PVA A;  5AEQ A;  2JUL A;  1KCY A;  1YUR A;  1QX7 A;  3RLZ A;  4AOM A;  4DCK A;  1NUB A;  2MJW B;  1PSR A;  1UHJ A;  5JOL A;  2KI4 C;  1XFW O;  5CSJ A;  2BL0 B;  2LLS A;  3HX4 A;  1B47 A;  1A2X A;  1DF0 A;  2ISD A;  1YVL A;  4YBH B;  1A4P A;  1DJG A;  1MHO A;  2PAS A;  3WHT B;  1J7P A;  1PRW A;  2QAC A;  3LK1 A;  2LV7 A;  2NXQ A;  1NCY A;  2I18 A;  3BUN B;  3PLF B;  1S3P A;  1YR5 A;  2KYF A;  1KFU S;  1U5I B;  2M97 A;  1DTL A;  1OZS A;  2ZFD A;  3DVM A;  5TNC A;  1N65 A;  1YUS A;  3SG6 A;  1K94 A;  1QJT A;  2BBN A;  2Q4U A;  3EVU A;  3GK4 X;  3PAT A;  1IQ3 A;  3LL8 B;  1B1G A;  2WCF A;  1WLZ A;  2I94 A;  3BUW B;  1FI6 A;  4WQ3 A;  1WRL A;  1W7J B;  2MLE C;  1JF0 A;  1JF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...