2HQ8A

Crystal structure of coelenterazine-binding protein from renilla muelleri in the ca loaded apo form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
181
Chain Sequence
b'ITESERAYHLRKMKTRMQRVDVTGDGFISREDYELIAVRIAKIAKLSAEKAEETRQEFLRVADQLGLAPGVRISVEEAAVNATDSLLKMKGEEKAMAVIQSLIMYDCIDTDKDGYVSLPEFKAFLQAVGPDLTDDKAITCFNTLDFNKNGQISRDEFLVTVNDFLFGLEETALANAFYGDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coelenterazine-binding protein ca-bound apo form
publication title Crystal structure of coelenterazine-binding protein from Renilla muelleri at 1.7 A: why it is not a calcium-regulated photoprotein.
pubmed doi rcsb
source organism Renilla muelleri
molecule tags Structural genomics, unknown function
total genus 70
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hq8A00
1FI6A 1JC2A 1DF0A 2KI6C 2BBMA 2JOJA 4C0LA 1A29A 1PSRA 3GOFA 5HLOA 1TCOB 2BCXA 4DS7A 2E6WA 1EJ3A 4ZCVA 1CDNA 3BUXB 3TZ1A 2IS9A 4E68A 1JFJA 1CDMA 1U5IB 1YUUA 1YR5A 1KFXL 2JNXA 1XFVO 2QACA 3CGAA 3SG4A 4MVFA 5KSZA 4WQ2A 2MBXA 1KFUL 4YGAA 1XFUO 2KAXA 1PSBA 2KNEA 2F33A 1IGVA 2K2FA 4GUKA 2QPTA 3NSIA 5DKRA 5G08A 2CNPA 1PALA 3DVEA 4PE0A 1ALWA 1N2DA 1NSHA 3O78A 2AUCA 1YRTB 1MF8B 2JZIA 1M39A 1QLSA 4ORBB 1A2XA 3DF0B 5D69A 4CPVA 3VRRA 3TDIA 1LXFC 2L50A 4DRWA 2LC5A 2D8NA 1BODA 5B8IB 3IQOA 2OTGB 2LLSA 1XVJA 2JRFA 1MWNA 1DJGA 4GPLB 1NX0A 1QX7A 1FF1A 2Y5IA 1Y6WA 4QJ5B 1G8IA 2OTGC 2L4HA 3AAKA 1IKUA 1RTP1 2KI4B 3D0YB 2M7LA 1CM1A 1SR6B 3VRPA 1AUIB 1J7RA 2JWWA 3M0WA 1OMDA 1K94A 3SG7A 1SMGA 3EK8A 2SASA 2Q4UA 1KSOA 2JXLA 1SR6C 1S6IA 1N0YA 4GGFC 1F4OA 1QXPA 2Y4QA 1TNQA 1CMGA 2JXCA 1NYAA 3WXAA 2ZNEA 2KYCA 1K8UA 1NX1A 1J55A 2LVKA 4M2PA 5JJGA 1BR4B 1PVBA 1PK0D 1RWYA 1XK4C 4PE7A 4DIRA 1XFWO 2JTTA 2M7NA 4MEWA 4YGCB 2FJUB 1S6CA 3SG3A 2BKIB 2HF5A 2MLEC 1DJIA 2HETA 1J7OA 2JT0A 1KK8B 1JFKA 2WCEA 1SBJA 1Y1AA 2WCBA 1K9PA 2H61C 4GNKB 3VGOA 3IF7A 2RGIA 1M63B 4P2YB 1KK8C 1CLLA 1SY9A 1DMOA 1QVIZ 4MBEA 1PULA 1S26D 4I5NB 1FBVA 2GGZA 1NX3A 3C1VA 3OX6A 1ZUZA 1CFPA 2KI6D 1NIWA 1YUTA 2ZRSA 5DKQA 1EG4A 2O60A 1CTRA 1DTLA 1OMRA 2FCDA 3EK4A 5HKZA 1TNPA 1A75A 1UP5A 2LE9B 3JVTB 1OMVA 2F2OA 2LUCA 4GBAA 3I5GB 2Q91A 2LHIA 3GK4X 1B8LA 3EVUA 3JVTC 3LLEA 2CXJA 3VROA 2KFHA 2WCFA 3TDZA 1QIWA 3I5GC 1BOCA 1QV0A 4A4CA 3BOWA 1SRAA 2LLTA 2R2IA 3AKBA 2I7AA 3O6BA 4F0ZB 5PALA 3FWBA 2AMIA 2JULA 2M1KB 2WORA 3KPXA 4GFTA 1MR8A 4WQ3A 2A4JA 2M9GA 2ISDA 1WY9A 4OKHA 1B7TY 4CFRA 3SJSA 2LLUA 4JWQA 1D1OA 2JU0A 3EKJA 1DJZA 1CDLA 1SL7A 2MAZA 3AKAA 3GK2A 5TNCA 3CR5X 1YRUB 2JT3A 3WHTB 1OZOA 1CLBA 1DF0B 3ZNIA 1TIZA 3TS5B 1KSMA 2ZFDA 2BL0B 1Y1XA 2KGRA 3OHMB 5CSIA 3SG5A 5IBWA 1UHJA 1Q80A 3HCMA 4AOMA 4XJKA 2LANA 3TS5C 1KCYA 4PALA 4JQ0D 2BE4A 4MZKA 4JPZB 1F71A 3ICBA 1A4PA 1B47A 4HSZA 1IJ5A 1L2OB 3D10A 1HT9A 2K0JA 1XO5A 3MSEB 4CIDA 2LV7A 1L2OC 1F4QA 1RK9A 5HKYA 4Q04A 4YBHB 1XA5A 1EL4A 1M31A 5ER4X 4BY5A 1QX2A 4YGDB 5F6TA 4MZLA 1EXRA 3EVRA 1YVLA 1IJ6A 1W7JB 4FQOA 1YUSA 1JWDA 1KK7Y 1XFZO 1ZFSA 1JUOA 4M2QA 2WOSA 4OR9B 4WRIA 1PVAA 4CFQA 3O4YA 3NSOA 3RM1A 1QTXA 1DT7B 1SK6D 2KBIA 2LVJA 3FIAA 2I18A 2LMUA 2KQYA 3PALA 3SG2A 1RFJA 5K89A 5GQQC 1R2UA 3BUOB 4XYNA 2Y1MA 5KTYA 3PSRA 1IG5A 1YVHA 1BMOA 2KHNA 5AXIA 1J7QA 2LUXA 2MA2A 3BUWB 3FWCA 4R1EA 1CKKA 1XYDA 2FCEA 1OZSA 2NLNA 3PLFB 4HRGA 1WRLA 2EC6B 1DJWA 2FOTA 1G4YR 2GGMA 4PHKA 4HRHA 1S5GZ 2LAPA 2KI4C 1LA3A 2EC6C 1K2HA 1XFXO 1J1DA 2LHLA 2KOTA 4GAOA 1EG3A 1K96A 1K9KA 1NCZA 2F2PA 5AEQA 1FI5A 1S3PA 2VRGA 3CLNA 3I5HB 3KEVA 1TN4A 1MXEA 1IQ3A 1ZMZA 2I2RE 3F45A 1F8HA 4MRYA 5CSNA 5D7FA 1FW4A 3K21A 3DVJA 1V1GA 3LK1A 3I5HC 1DJYA 1SCVA 1RJVA 1YURA 4MN0A 2BCAA 4NDDA 3SG6A 1YX8A 1FPWA 3BUNB 3KF9A 1QS7A 3BXKA 1C07A 4YRUA 2M1UA 1DGUA 2ZRTA 3NSLA 1AK8A 1QASA 2BCBA 1SPYA 1SNLA 2HPSA 1TCFA 1TNWA 3EKHA 1B8RA 1RECA 3GK1A 4I5JA 4USLA 3JTDB 3LCPC 5KU1A 4OCIA 2ZN8A 1SKTA 3DD4A 2BBNA 1ZACA 1NPQA 3JTDC 2BE6A 2LVIA 2WC8A 1CFDA 4M2OA 3KHEA 3OB1B 5BPJA 4PE4A 2LP3A 2CTNA 2H2KA 3DVMA 1A75B 4N5XA 1CMFA 2K8MB 5AERA 4DUQA 1B4CA 2MRDA 1NCXA 2JPTA 3NXAA 2LVVA 4MZJA 1EH2A 4QJ4B 1N65A 2EHBA 1QLKA 5I8NA 2EGDA 2M97A 3PM8A 2KDHA 2Y1NA 1S36A 5ER5A 5FYXA 1A03A 3BOWB 3EK7A 4AQJA 1J7PA 3H4SE 4YGEB 1JF0A 1QVIY 2M8UA 1BG1A 1R6PA 1WDCB 2KFGA 1IWQA 2L2EA 4PDZA 1JSAA 2ZKMX 1KFXS 1QIVA 2K7OA 1WDCC 4C0JA 2GV5A 4MLWA 5AFPA 2G2BA 2KGBC 2M0RA 4N1GA 1M45A 1Y1UA 1KFUS 1NX2A 1LKJA 1QV1A 2JC2A 2BECA 2L5XB 3I5FB 2PSRA 1BF5A 3KO0A 4NDCA 1ODBA 2M29A 3PFVA 4XJKB 1C7WA 1PRWA 2BL0C 3PATA 1GGWA 5HYDA 3FS7A 2K7BA 1B8CA 3I5FC 1BT6A 3TDUA 1SL9A 1NWDA 2KBMA 2PASA 4OVNF 2NCOA 1QJTA 1OQPA 1GQMA 2KAVA 1KQMB 1SL8A 2NZ0A 5J3XA 3DVKA 4CLNA 3BYAA 2L4IA 1RROA 3OX5A 2L51A 1KQMC 1WLZA 2LMTA 1WRZA 2CT9A 3BUMB 2ZN9A 4TNCA 2MLFC 4BY4A 1TNXA 1K90D 1K93D 3CR4X 4D1EA 2KYFA 1KWOB 2M3WA 1ZOTB 2NCPA 5DKNA 2B1UA 4YI9A 1CFCA 4QJ3B 1LA0A 2K7CA 1TOPA 1KWOC 1MHOA 3CWGA 1U5IA 1HQVA 1GJYA 1K95A 1WLMA 1IH0A 2PALA 1UHKA 2ZNDA 2F8PA 3QRXA 1AVSA 1YTZC 3TUYB 2O5GA 2L98A 1XFYO 1NUBA 4PHJA 5I2QA 1LVCD 4I5KA 1CM4A 5I2OA 1SW8A 4ETOA 3TUYC 2KFFA 1OOJA 2MJWB 1JBAA 2LP2A 3OB2B 2K61A 3PN7B 4AQIA 1DGVA 1JF2A 1H8BA 2K7DA 4IL1A 4ORAB 1NP8A 1M46A 1S1EA 3PN7C 1BLQA 1VRKA 1IRJA 3DF0A 1V1FA 2JTZA 1UURA 3CZTX 4NDBA 3NSKA 3ZWHA 1E8AA 1QATA 4MRXA 4I5LB 1CFFA 2V53A 2K2AA 2I94A 2CCMA 2KQ6A 4NQGA 2HQWA 2LCPA 1F70A 3EVVA 1CB1A 2G9BA 1UHNA 2PVBA 4HREE 3D0YA 4ORCB 3E3RA 3SIBA 4GGFA 3WNXB 1SYMA 1J1EA 1B1GA 3IQQA 1XK4A 3O2PA 3LL8B 2F3ZA 3A8RA 4PHNA 3WHUB 4YI8A 2JT8A 1MUXA 1S5GY 2CBLA 1B9AA 5HKWA 2SCPA 4ICBA 2KSPA 1KQVA 5HLVA 2LM5A 4L9MA 5CSJA 2LMVA 1AP4A 1TTXA 1AHRA 1K9UA 1MQ1A 2H61A 3BQ3A 2WNDA 2E30A 2HQ8A 1ALVA 2JQ6A 2NXQA 3VRNA 5I2LA 4DCKA 1F55A 4UPGA 4PCWA 3SIAA 2PRUA 3VRQA 2OPOA 1QX5B 4PHMA 5CPVA 1DJXA 4PE1A 1UUSA 1BJFA 3RLZA 4A4BA 1L7ZA 1UHHA 4P5OE 1UHIA 1C7VA 1YX7A 2LNKA 1B7TZ 1CNPA 3AAJA 2PMYA 3HX4A 5AANA 2AAOA 4C0KA 3CS1A 1LINA 2COLB 3OP0A 1G33A 2P6BB 4ZCUA 4MSPA 3CTNA 1GGZA 1DJHA 1DVIA 1TRFA 1W7IB 1S6JA 1MXLC 3I5IB 2OS8B 2JNFA 4N1FA 1AJ4A 1WRKA 1X02A 1CLMA 2M49B 3I5IC 2F3YA 2TN4A 2OS8C 1CDPA 2MHHA 1BR1B 1SCMB 1AJ5A 4YGBB 2DOQA 1NCYA 5CSFA 4GGNA 1IQ5A 1OSAA 1BU3A 4FTGA 1SCMC 2BKHB 1H4BA 2L0PA 1OE9B 3CR2A 3A4UB 3LK0A 1KK7Z 2KAYA 4OV2A 4U8DA 5JOLA 1UWOA 1Y0VH 1F54A
chains in the Genus database with same CATH superfamily
2KPHA 1JC2A 1FI6A 1DF0A 2KI6C 3CZ0A 2BBMA 2JOJA 4C0LA 1A29A 1PSRA 3GOFA 5HLOA 1TCOB 2BCXA 4DS7A 2E6WA 1EJ3A 4ZCVA 1CDNA 3BUXB 3TZ1A 4INXA 2IS9A 4E68A 1JFJA 1CDMA 1Z2CB 1U5IB 1YUUA 1YR5A 1KFXL 2JNXA 2QEHA 1XFVO 2QACA 3CGAA 3SG4A 4MVFA 5KSZA 4WQ2A 4KYNA 2MBXA 1KFUL 4YGAA 1XFUO 4PT1A 2KAXA 1PSBA 2KNEA 2F33A 1IGVA 2K2FA 4GUKA 2QPTA 3NSIA 5DKRA 5G08A 5I94A 2CNPA 1PALA 3BFAA 3DVEA 4FQTA 4PE0A 1ALWA 1N2DA 1C3YA 1NSHA 2KLEA 3O78A 3R72A 2AUCA 1YRTB 1MF8B 1OOFA 2JZIA 1M39A 1QLSA 4ORBB 1A2XA 3DF0B 5D69A 4CPVA 3CYZA 3VRRA 3TDIA 1LXFC 2L50A 4DRWA 4U8DA 2LC5A 2D8NA 3S0FA 1BODA 5B8IB 3IQOA 2OTGB 2LLSA 1XVJA 2JRFA 1MWNA 1DJGA 4GPLB 1NX0A 1QX7A 1FF1A 2Y5IA 1Y6WA 4QJ5B 1G8IA 2OTGC 2L4HA 3AAKA 2QEOA 1IKUA 1RTP1 2KI4B 3D0YB 2M7LA 1CM1A 1SR6B 3VRPA 1AUIB 1J7RA 2JWWA 3M0WA 1OMDA 3FE8A 1K94A 3SG7A 1SMGA 3EK8A 3BFHA 2SASA 2Q4UA 1KSOA 2JXLA 1SR6C 1S6IA 3S0AA 1N0YA 4GGFC 2WCKA 1F4OA 1QXPA 2Y4QA 1TNQA 1CMGA 2JXCA 1NYAA 3WXAA 2ZNEA 2KYCA 1K8UA 1NX1A 1J55A 2LVKA 4M2PA 5JJGA 1BR4B 1PVBA 1PK0D 1RWYA 1XK4C 4PE7A 4DIRA 1XFWO 5FI2A 3N7HA 2JTTA 2M7NA 4MEWA 4YGCB 2FJUB 1S6CA 1DELA 2BKIB 3BFBA 2WC5A 2HF5A 2MLEC 3SG3A 1DJIA 2HETA 3B86A 5AFPA 1C3ZA 1J7OA 2JT0A 1KK8B 3D74A 1JFKA 2WCEA 1SBJA 1Y1AA 2WCBA 1K9PA 2H61C 4GNKB 3VGOA 3IF7A 2RGIA 1M63B 4P2YB 1KK8C 1CLLA 1SY9A 1DMOA 1QVIZ 2BNXA 2H8VA 4MBEA 3CZ1A 1PULA 1S26D 4I5NB 1FBVA 2GGZA 1NX3A 3C1VA 3OX6A 1ZUZA 1CFPA 2KI6D 2PYQA 1NIWA 1YUTA 3DYEA 2ZRSA 5DKQA 1EG4A 2O60A 1CTRA 1DTLA 1OMRA 2FCDA 3EK4A 5HKZA 1TNPA 1A75A 1UP5A 2LE9B 3JVTB 3Q8IA 1OMVA 2F2OA 2LUCA 4GBAA 3I5GB 3DXLA 2Q91A 2LHIA 3GK4X 1B8LA 3EVUA 3JVTC 3LLEA 2CXJA 3VROA 1OOHA 2KFHA 2WCFA 3TDZA 1QIWA 3I5GC 1BOCA 1TWOA 1FPWA 1QV0A 4A4CA 3BOWA 1SRAA 2LLTA 2P70A 3B87A 3SS3A 2R2IA 3AKBA 2I7AA 3O6BA 4F0ZB 5PALA 3FWBA 2AMIA 2JULA 2M1KB 2WORA 3KPXA 3DZTA 4GFTA 1MR8A 4WQ3A 2A4JA 2M9GA 2ISDA 1WY9A 4OKHA 1B7TY 4CFRA 3SJSA 3SS5A 2LLUA 4JWQA 1D1OA 2WCHA 2JU0A 1P28A 3EKJA 5FI7A 1DJZA 1CDLA 1ORGA 1SL7A 2MAZA 3AKAA 3GK2A 3CR5X 1YRUB 2JT3A 5TNCA 1OZOA 1CLBA 1DF0B 3ZNIA 1TIZA 3TS5B 1KSMA 2L2CA 2ZFDA 2BL0B 1Y1XA 2KGRA 3OHMB 5CSIA 3SG5A 5IBWA 1UHJA 1Q80A 3HCMA 4AOMA 4XJKA 2LANA 3TS5C 1KCYA 4PALA 4JQ0D 2BE4A 4MZKA 4JPZB 1F71A 2WCMA 3ICBA 1A4PA 1B47A 4HSZA 1IJ5A 1L2OB 3D10A 1HT9A 2K0JA 1XO5A 3MSEB 4CIDA 2LV7A 1L2OC 1F4QA 1RK9A 1W9ZA 4Q04A 4YBHB 1XA5A 1EL4A 1M31A 5ER4X 4BY5A 1QX2A 4YGDB 5F6TA 4MZLA 1EXRA 3EVRA 1YVLA 1IJ6A 1W7JB 2KLDA 4FQOA 1YUSA 1JWDA 1KK7Y 1XFZO 1ZFSA 3D77A 1JUOA 4M2QA 2WOSA 4OR9B 4WRIA 4F7FA 1PVAA 4CFQA 3O4YA 3NSOA 3RM1A 1QTXA 1DT7B 2PQLA 1SK6D 2KBIA 2LVJA 3FIAA 3NHIA 1Z4HA 2I18A 2LMUA 2KQYA 3PALA 3SG2A 3FE9A 1RFJA 3EG5B 5K89A 5GQQC 1R2UA 3BUOB 4XYNA 2Y1MA 2P71A 3PSRA 5KTYA 4JKTA 1IG5A 1YVHA 1BMOA 2KHNA 5AXIA 1J7QA 2LUXA 2MA2A 3BUWB 3FWCA 4R1EA 1CKKA 1XYDA 2FCEA 1OOGA 1OZSA 2NLNA 3PLFB 4HRGA 1WRLA 2EC6B 4INWA 1DJWA 2FOTA 1G4YR 2GGMA 4PHKA 3CZ2A 1S5GZ 4HRHA 2LAPA 2ERBA 2KI4C 1LA3A 2EC6C 1K2HA 1XFXO 1J1DA 2LHLA 2KOTA 3PJIA 1EG3A 1K96A 1K9KA 1NCZA 2F2PA 4GAOA 5AEQA 1FI5A 1S3PA 2VRGA 3CLNA 3I5HB 1GM0A 3KEVA 1TN4A 1MXEA 1IQ3A 1ZMZA 2I2RE 3F45A 1F8HA 4MRYA 5CSNA 5D7FA 1FW4A 3K21A 3DVJA 1V1GA 3LK1A 3I5HC 1DJYA 1DEKA 1RJVA 1SCVA 1YURA 2BCAA 4MN0A 4NDDA 1YX8A 3SG6A 3BUNB 3KF9A 1QS7A 3BXKA 1C07A 4YRUA 2M1UA 1DGUA 2ZRTA 3NSLA 1AK8A 1TUJA 1QASA 2BCBA 1SPYA 1SNLA 2HPSA 1LS8A 1TCFA 1TNWA 3EKHA 1IIOA 1B8RA 1RECA 3GK1A 4I5JA 4USLA 3UO9A 3JTDB 3LCPC 5KU1A 3L47A 4OCIA 2ZN8A 1SKTA 3DD4A 2BBNA 1ZACA 1NPQA 3JTDC 2BE6A 2LVIA 2WC8A 1CFDA 2FJYA 4M2OA 3NGVA 3KHEA 3OB1B 5BPJA 4PE4A 2LP3A 3D78A 2CTNA 2H2KA 3DVMA 1A75B 4N5XA 2WC6A 1CMFA 2K8MB 5AERA 4DUQA 1B4CA 3L4LA 2MRDA 1NCXA 2JPTA 3NXAA 2LVVA 4MZJA 1EH2A 4QJ4B 1N65A 2EHBA 3SS4A 1QLKA 2QEVA 5I8NA 2EGDA 1DC1A 2M97A 3UNWA 3PM8A 2KDHA 2Y1NA 1S36A 5ER5A 5FYXA 2QDIA 1A03A 3BOWB 3EK7A 4AQJA 1J7PA 2K60A 3H4SE 4YGEB 1JF0A 1QVIY 2M8UA 5HL1A 1BG1A 1R6PA 1WDCB 2KFGA 1IWQA 2L2EA 3S0GA 4PDZA 3D75A 1JSAA 2BAPA 2ZKMX 1KFXS 1QIVA 2K7OA 1QWVA 1WDCC 2GV5A 4MLWA 5D3OA 2G2BA 2KGBC 4C0JA 2M0RA 4N1GA 1M45A 3BJHA 1Y1UA 1KFUS 1NX2A 1LKJA 1QV1A 3CABA 2JC2A 2BECA 2L5XB 3I5FB 2PSRA 1BF5A 3KO0A 4NDCA 1ODBA 2M29A 3PFVA 3O4XA 4XJKB 1C7WA 3B6XA 1PRWA 2BL0C 3PATA 1GGWA 5HYDA 3FS7A 2K7BA 1B8CA 3I5FC 1BT6A 1TUZA 3TDUA 1SL9A 1NWDA 2KBMA 2PASA 4OVNF 2NCOA 1QJTA 3R1OA 1OQPA 1GQMA 1OW4A 2KAVA 3R1VA 3K1EA 1KQMB 5EL2A 3S0EA 1SL8A 2NZ0A 5J3XA 3DVKA 4CLNA 3B88A 3BYAA 2L4IA 1RROA 3OX5A 2L51A 1KQMC 1WLZA 2LMTA 1WRZA 2CT9A 3BUMB 2ZN9A 4TNCA 2MLFC 4BY4A 1TNXA 1K90D 1K93D 3CR4X 3L4AA 2KYFA 4D1EA 1KWOB 2M3WA 1ZOTB 2NCPA 3OBVA 2B1UA 4YI9A 5DKNA 1CFCA 4QJ3B 1LA0A 2K7CA 1TOPA 1KWOC 1MHOA 3CWGA 1U5IA 1HQVA 1GJYA 1K95A 1WLMA 3VB1A 2PALA 1UHKA 2ZNDA 3WHTB 2F8PA 1IH0A 3QRXA 1AVSA 1YTZC 3TUYB 2O5GA 2L98A 1XFYO 1NUBA 4PHJA 5I2QA 1LVCD 4I5KA 1CM4A 5I2OA 1SW8A 4ETOA 3TUYC 2KFFA 1OOJA 2MJWB 1JBAA 2LP2A 3B7AA 3OB2B 2K61A 3IVTA 3PN7B 4AQIA 1DGVA 1JF2A 1H8BA 2K7DA 4IL1A 4ORAB 1NP8A 1M46A 1S1EA 3PN7C 1BLQA 1VRKA 1IRJA 3DF0A 1V1FA 2JTZA 5DICA 4OZDA 1UURA 3CZTX 3PM2A 3OGNA 4NDBA 3NSKA 3S0BA 1E8AA 1QATA 4MRXA 4I5LB 3ZWHA 1CFFA 2V53A 2K2AA 2I94A 2CCMA 2KQ6A 3D76A 4NQGA 2HQWA 2LCPA 1F70A 3EVVA 1CB1A 2G9BA 1UHNA 2PVBA 4HREE 3D0YA 4ORCB 3E3RA 3SIBA 4GGFA 4JD9A 3WNXB 1SYMA 1J1EA 3D73A 4IJ7A 2GTEA 1B1GA 1T14A 3IQQA 2WCLA 3CDNA 1XK4A 3O2PA 3DY9A 2F3ZA 3A8RA 3LL8B 4PHNA 4YI8A 3WHUB 2JT8A 1MUXA 1S5GY 3RZSA 5HKYA 2CBLA 1B9AA 5HKWA 2SCPA 4ICBA 2KSPA 1KQVA 5HLVA 2LM5A 4L9MA 5CSJA 2LMVA 1AP4A 1TTXA 1AHRA 1K9UA 1MQ1A 2H61A 3BQ3A 2WNDA 2E30A 2HQ8A 1ALVA 2JQ6A 2NXQA 3VRNA 5I2LA 4DCKA 1F55A 4UPGA 4PCWA 2YGUA 3SIAA 2PRUA 3FE6A 3VRQA 1SSEB 1QX5B 2OPOA 4PHMA 5CPVA 1DJXA 4PE1A 1UUSA 1BJFA 3RLZA 4A4BA 1L7ZA 1UHHA 1DQEA 1UHIA 2JPOA 2L5YA 4P5OE 1C7VA 1YX7A 2LNKA 3V2LA 2QEBA 1B7TZ 1CNPA 5FI6A 3AAJA 3S0DA 2PMYA 3HX4A 5AANA 2AAOA 4C0KA 3CS1A 1LINA 2COLB 3NHTA 1G33A 3OP0A 2P6BB 4ZCUA 4MSPA 3CTNA 1DJHA 1GGZA 1DVIA 1TRFA 1W7IB 1S6JA 1MXLC 3I5IB 2OS8B 2JNFA 4N1FA 1AJ4A 1WRKA 1X02A 1CLMA 2M49B 3I5IC 2F3YA 2TN4A 2OS8C 1CDPA 2MHHA 1BR1B 1SCMB 1AJ5A 4YGBB 2DOQA 1OOIX 1NCYA 5CSFA 4GGNA 3QMEA 1IQ5A 2WCJA 1OSAA 1BU3A 3R1PA 4FTGA 1SCMC 2BKHB 1H4BA 2L0PA 1OE9B 3CR2A 3A4UB 3LK0A 1KK7Z 2KAYA 4OV2A 1XFRA 5JOLA 1UWOA 1Y0VH 1F54A
chains in the Genus database with same CATH topology
1FI6A 1JC2A 1DF0A 2KI6C 2BBMA 2JOJA 4C0LA 1A29A 1PSRA 3GOFA 5HLOA 1TCOB 2BCXA 4DS7A 2E6WA 1EJ3A 4ZCVA 1CDNA 3BUXB 3TZ1A 2IS9A 4E68A 1JFJA 1CDMA 1U5IB 1YUUA 1YR5A 1KFXL 2JNXA 1XFVO 2QACA 3CGAA 3SG4A 4MVFA 5KSZA 4WQ2A 2MBXA 1KFUL 4YGAA 1XFUO 2KAXA 1PSBA 2KNEA 2F33A 1IGVA 2K2FA 4GUKA 2QPTA 3NSIA 5DKRA 5G08A 2CNPA 1PALA 3DVEA 4PE0A 1ALWA 1N2DA 1NSHA 3O78A 2AUCA 1YRTB 1MF8B 2JZIA 1M39A 1QLSA 4ORBB 1A2XA 3DF0B 5D69A 4CPVA 3VRRA 3TDIA 1LXFC 2L50A 4DRWA 2LC5A 2D8NA 1BODA 5B8IB 3IQOA 2OTGB 2LLSA 1XVJA 2JRFA 1MWNA 1DJGA 4GPLB 1NX0A 1QX7A 1FF1A 2Y5IA 1Y6WA 4QJ5B 1G8IA 2OTGC 2L4HA 3AAKA 1IKUA 1RTP1 2KI4B 3D0YB 2M7LA 1CM1A 1SR6B 3VRPA 1AUIB 1J7RA 2JWWA 3M0WA 1OMDA 1K94A 3SG7A 1SMGA 3EK8A 2SASA 2Q4UA 1KSOA 2JXLA 1SR6C 1S6IA 1N0YA 4GGFC 1F4OA 1QXPA 2Y4QA 1TNQA 1CMGA 2JXCA 1NYAA 3WXAA 2ZNEA 2KYCA 1K8UA 1NX1A 1J55A 2LVKA 4M2PA 5JJGA 1BR4B 1PVBA 1PK0D 1RWYA 1XK4C 4PE7A 4DIRA 1XFWO 2JTTA 2M7NA 4MEWA 4YGCB 2FJUB 1S6CA 3SG3A 2BKIB 2HF5A 2MLEC 1DJIA 2HETA 1J7OA 2JT0A 1KK8B 1JFKA 2WCEA 1SBJA 1Y1AA 2WCBA 1K9PA 2H61C 4GNKB 3VGOA 3IF7A 2RGIA 1M63B 4P2YB 1KK8C 1CLLA 1SY9A 1DMOA 1QVIZ 4MBEA 1PULA 1S26D 4I5NB 1FBVA 2GGZA 1NX3A 3C1VA 3OX6A 1ZUZA 1CFPA 2KI6D 1NIWA 1YUTA 2ZRSA 5DKQA 1EG4A 2O60A 1CTRA 1DTLA 1OMRA 2FCDA 3EK4A 5HKZA 1TNPA 1A75A 1UP5A 2LE9B 3JVTB 1OMVA 2F2OA 2LUCA 4GBAA 3I5GB 2Q91A 2LHIA 3GK4X 1B8LA 3EVUA 3JVTC 3LLEA 2CXJA 3VROA 2KFHA 2WCFA 3TDZA 1QIWA 3I5GC 1BOCA 1QV0A 4A4CA 3BOWA 1SRAA 2LLTA 2R2IA 3AKBA 2I7AA 3O6BA 4F0ZB 5PALA 3FWBA 2AMIA 2JULA 2M1KB 2WORA 3KPXA 4GFTA 1MR8A 4WQ3A 2A4JA 2M9GA 2ISDA 1WY9A 4OKHA 1B7TY 4CFRA 3SJSA 2LLUA 4JWQA 1D1OA 2JU0A 3EKJA 1DJZA 1CDLA 1SL7A 2MAZA 3AKAA 3GK2A 5TNCA 3CR5X 1YRUB 2JT3A 3WHTB 1OZOA 1CLBA 1DF0B 3ZNIA 1TIZA 3TS5B 1KSMA 2ZFDA 2BL0B 1Y1XA 2KGRA 3OHMB 5CSIA 3SG5A 5IBWA 1UHJA 1Q80A 3HCMA 4AOMA 4XJKA 2LANA 3TS5C 1KCYA 4PALA 4JQ0D 2BE4A 4MZKA 4JPZB 1F71A 3ICBA 1A4PA 1B47A 4HSZA 1IJ5A 1L2OB 3D10A 1HT9A 2K0JA 1XO5A 3MSEB 4CIDA 2LV7A 1L2OC 1F4QA 1RK9A 5HKYA 4Q04A 4YBHB 1XA5A 1EL4A 1M31A 5ER4X 4BY5A 1QX2A 4YGDB 5F6TA 4MZLA 1EXRA 3EVRA 1YVLA 1IJ6A 1W7JB 4FQOA 1YUSA 1JWDA 1KK7Y 1XFZO 1ZFSA 1JUOA 4M2QA 2WOSA 4OR9B 4WRIA 1PVAA 4CFQA 3O4YA 3NSOA 3RM1A 1QTXA 1DT7B 1SK6D 2KBIA 2LVJA 3FIAA 2I18A 2LMUA 2KQYA 3PALA 3SG2A 1RFJA 5K89A 5GQQC 1R2UA 3BUOB 4XYNA 2Y1MA 5KTYA 3PSRA 1IG5A 1YVHA 1BMOA 2KHNA 5AXIA 1J7QA 2LUXA 2MA2A 3BUWB 3FWCA 4R1EA 1CKKA 1XYDA 2FCEA 1OZSA 2NLNA 3PLFB 4HRGA 1WRLA 2EC6B 1DJWA 2FOTA 1G4YR 2GGMA 4PHKA 4HRHA 1S5GZ 2LAPA 2KI4C 1LA3A 2EC6C 1K2HA 1XFXO 1J1DA 2LHLA 2KOTA 4GAOA 1EG3A 1K96A 1K9KA 1NCZA 2F2PA 5AEQA 1FI5A 1S3PA 2VRGA 3CLNA 3I5HB 3KEVA 1TN4A 1MXEA 1IQ3A 1ZMZA 2I2RE 3F45A 1F8HA 4MRYA 5CSNA 5D7FA 1FW4A 3K21A 3DVJA 1V1GA 3LK1A 3I5HC 1DJYA 1SCVA 1RJVA 1YURA 4MN0A 2BCAA 4NDDA 3SG6A 1YX8A 1FPWA 3BUNB 3KF9A 1QS7A 3BXKA 1C07A 4YRUA 2M1UA 1DGUA 2ZRTA 3NSLA 1AK8A 1QASA 2BCBA 1SPYA 1SNLA 2HPSA 1TCFA 1TNWA 3EKHA 1B8RA 1RECA 3GK1A 4I5JA 4USLA 3JTDB 3LCPC 5KU1A 4OCIA 2ZN8A 1SKTA 3DD4A 2BBNA 1ZACA 1NPQA 3JTDC 2BE6A 2LVIA 2WC8A 1CFDA 4M2OA 3KHEA 3OB1B 5BPJA 4PE4A 2LP3A 2CTNA 2H2KA 3DVMA 1A75B 4N5XA 1CMFA 2K8MB 5AERA 4DUQA 1B4CA 2MRDA 1NCXA 2JPTA 3NXAA 2LVVA 4MZJA 1EH2A 4QJ4B 1N65A 2EHBA 1QLKA 5I8NA 2EGDA 2M97A 3PM8A 2KDHA 2Y1NA 1S36A 5ER5A 5FYXA 1A03A 3BOWB 3EK7A 4AQJA 1J7PA 3H4SE 4YGEB 1JF0A 1QVIY 2M8UA 1BG1A 1R6PA 1WDCB 2KFGA 1IWQA 2L2EA 4PDZA 1JSAA 2ZKMX 1KFXS 1QIVA 2K7OA 1WDCC 4C0JA 2GV5A 4MLWA 5AFPA 2G2BA 2KGBC 2M0RA 4N1GA 1M45A 1Y1UA 1KFUS 1NX2A 1LKJA 1QV1A 2JC2A 2BECA 2L5XB 3I5FB 2PSRA 1BF5A 3KO0A 4NDCA 1ODBA 2M29A 3PFVA 4XJKB 1C7WA 1PRWA 2BL0C 3PATA 1GGWA 5HYDA 3FS7A 2K7BA 1B8CA 3I5FC 1BT6A 3TDUA 1SL9A 1NWDA 2KBMA 2PASA 4OVNF 2NCOA 1QJTA 1OQPA 1GQMA 2KAVA 1KQMB 1SL8A 2NZ0A 5J3XA 3DVKA 4CLNA 3BYAA 2L4IA 1RROA 3OX5A 2L51A 1KQMC 1WLZA 2LMTA 1WRZA 2CT9A 3BUMB 2ZN9A 4TNCA 2MLFC 4BY4A 1TNXA 1K90D 1K93D 3CR4X 4D1EA 2KYFA 1KWOB 2M3WA 1ZOTB 2NCPA 5DKNA 2B1UA 4YI9A 1CFCA 4QJ3B 1LA0A 2K7CA 1TOPA 1KWOC 1MHOA 3CWGA 1U5IA 1HQVA 1GJYA 1K95A 1WLMA 1IH0A 2PALA 1UHKA 2ZNDA 2F8PA 3QRXA 1AVSA 1YTZC 3TUYB 2O5GA 2L98A 1XFYO 1NUBA 4PHJA 5I2QA 1LVCD 4I5KA 1CM4A 5I2OA 1SW8A 4ETOA 3TUYC 2KFFA 1OOJA 2MJWB 1JBAA 2LP2A 3OB2B 2K61A 3PN7B 4AQIA 1DGVA 1JF2A 1H8BA 2K7DA 4IL1A 4ORAB 1NP8A 1M46A 1S1EA 3PN7C 1BLQA 1VRKA 1IRJA 3DF0A 1V1FA 2JTZA 1UURA 3CZTX 4NDBA 3NSKA 3ZWHA 1E8AA 1QATA 4MRXA 4I5LB 1CFFA 2V53A 2K2AA 2I94A 2CCMA 2KQ6A 4NQGA 2HQWA 2LCPA 1F70A 3EVVA 1CB1A 2G9BA 1UHNA 2PVBA 4HREE 3D0YA 4ORCB 3E3RA 3SIBA 4GGFA 3WNXB 1SYMA 1J1EA 1B1GA 3IQQA 1XK4A 3O2PA 3LL8B 2F3ZA 3A8RA 4PHNA 3WHUB 4YI8A 2JT8A 1MUXA 1S5GY 2CBLA 1B9AA 5HKWA 2SCPA 4ICBA 2KSPA 1KQVA 5HLVA 2LM5A 4L9MA 5CSJA 2LMVA 1AP4A 1TTXA 1AHRA 1K9UA 1MQ1A 2H61A 3BQ3A 2WNDA 2E30A 2HQ8A 1ALVA 2JQ6A 2NXQA 3VRNA 5I2LA 4DCKA 1F55A 4UPGA 4PCWA 3SIAA 2PRUA 3VRQA 2OPOA 1QX5B 4PHMA 5CPVA 1DJXA 4PE1A 1UUSA 1BJFA 3RLZA 4A4BA 1L7ZA 1UHHA 4P5OE 1UHIA 1C7VA 1YX7A 2LNKA 1B7TZ 1CNPA 3AAJA 2PMYA 3HX4A 5AANA 2AAOA 4C0KA 3CS1A 1LINA 2COLB 3OP0A 1G33A 2P6BB 4ZCUA 4MSPA 3CTNA 1GGZA 1DJHA 1DVIA 1TRFA 1W7IB 1S6JA 1MXLC 3I5IB 2OS8B 2JNFA 4N1FA 1AJ4A 1WRKA 1X02A 1CLMA 2M49B 3I5IC 2F3YA 2TN4A 2OS8C 1CDPA 2MHHA 1BR1B 1SCMB 1AJ5A 4YGBB 2DOQA 1NCYA 5CSFA 4GGNA 1IQ5A 1OSAA 1BU3A 4FTGA 1SCMC 2BKHB 1H4BA 2L0PA 1OE9B 3CR2A 3A4UB 3LK0A 1KK7Z 2KAYA 4OV2A 4U8DA 5JOLA 1UWOA 1Y0VH 1F54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FI6 A;  1JC2 A;  1DF0 A;  2KI6 C;  2BBM A;  2JOJ A;  4C0L A;  1A29 A;  1PSR A;  3GOF A;  5HLO A;  1TCO B;  2BCX A;  4DS7 A;  2E6W A;  1EJ3 A;  4ZCV A;  1CDN A;  3BUX B;  3TZ1 A;  2IS9 A;  4E68 A;  1JFJ A;  1CDM A;  1U5I B;  1YUU A;  1YR5 A;  1KFX L;  2JNX A;  1XFV O;  2QAC A;  3CGA A;  3SG4 A;  4MVF A;  5KSZ A;  4WQ2 A;  2MBX A;  1KFU L;  4YGA A;  1XFU O;  2KAX A;  1PSB A;  2KNE A;  2F33 A;  1IGV A;  2K2F A;  4GUK A;  2QPT A;  3NSI A;  5DKR A;  5G08 A;  2CNP A;  1PAL A;  3DVE A;  4PE0 A;  1ALW A;  1N2D A;  1NSH A;  3O78 A;  2AUC A;  1YRT B;  1MF8 B;  2JZI A;  1M39 A;  1QLS A;  4ORB B;  1A2X A;  3DF0 B;  5D69 A;  4CPV A;  3VRR A;  3TDI A;  1LXF C;  2L50 A;  4DRW A;  2LC5 A;  2D8N A;  1BOD A;  5B8I B;  3IQO A;  2OTG B;  2LLS A;  1XVJ A;  2JRF A;  1MWN A;  1DJG A;  4GPL B;  1NX0 A;  1QX7 A;  1FF1 A;  2Y5I A;  1Y6W A;  4QJ5 B;  1G8I A;  2OTG C;  2L4H A;  3AAK A;  1IKU A;  1RTP 1;  2KI4 B;  3D0Y B;  2M7L A;  1CM1 A;  1SR6 B;  3VRP A;  1AUI B;  1J7R A;  2JWW A;  3M0W A;  1OMD A;  1K94 A;  3SG7 A;  1SMG A;  3EK8 A;  2SAS A;  2Q4U A;  1KSO A;  2JXL A;  1SR6 C;  1S6I A;  1N0Y A;  4GGF C;  1F4O A;  1QXP A;  2Y4Q A;  1TNQ A;  1CMG A;  2JXC A;  1NYA A;  3WXA A;  2ZNE A;  2KYC A;  1K8U A;  1NX1 A;  1J55 A;  2LVK A;  4M2P A;  5JJG A;  1BR4 B;  1PVB A;  1PK0 D;  1RWY A;  1XK4 C;  4PE7 A;  4DIR A;  1XFW O;  2JTT A;  2M7N A;  4MEW A;  4YGC B;  2FJU B;  1S6C A;  3SG3 A;  2BKI B;  2HF5 A;  2MLE C;  1DJI A;  2HET A;  1J7O A;  2JT0 A;  1KK8 B;  1JFK A;  2WCE A;  1SBJ A;  1Y1A A;  2WCB A;  1K9P A;  2H61 C;  4GNK B;  3VGO A;  3IF7 A;  2RGI A;  1M63 B;  4P2Y B;  1KK8 C;  1CLL A;  1SY9 A;  1DMO A;  1QVI Z;  4MBE A;  1PUL A;  1S26 D;  4I5N B;  1FBV A;  2GGZ A;  1NX3 A;  3C1V A;  3OX6 A;  1ZUZ A;  1CFP A;  2KI6 D;  1NIW A;  1YUT A;  2ZRS A;  5DKQ A;  1EG4 A;  2O60 A;  1CTR A;  1DTL A;  1OMR A;  2FCD A;  3EK4 A;  5HKZ A;  1TNP A;  1A75 A;  1UP5 A;  2LE9 B;  3JVT B;  1OMV A;  2F2O A;  2LUC A;  4GBA A;  3I5G B;  2Q91 A;  2LHI A;  3GK4 X;  1B8L A;  3EVU A;  3JVT C;  3LLE A;  2CXJ A;  3VRO A;  2KFH A;  2WCF A;  3TDZ A;  1QIW A;  3I5G C;  1BOC A;  1QV0 A;  4A4C A;  3BOW A;  1SRA A;  2LLT A;  2R2I A;  3AKB A;  2I7A A;  3O6B A;  4F0Z B;  5PAL A;  3FWB A;  2AMI A;  2JUL A;  2M1K B;  2WOR A;  3KPX A;  4GFT A;  1MR8 A;  4WQ3 A;  2A4J A;  2M9G A;  2ISD A;  1WY9 A;  4OKH A;  1B7T Y;  4CFR A;  3SJS A;  2LLU A;  4JWQ A;  1D1O A;  2JU0 A;  3EKJ A;  1DJZ A;  1CDL A;  1SL7 A;  2MAZ A;  3AKA A;  3GK2 A;  5TNC A;  3CR5 X;  1YRU B;  2JT3 A;  3WHT B;  1OZO A;  1CLB A;  1DF0 B;  3ZNI A;  1TIZ A;  3TS5 B;  1KSM A;  2ZFD A;  2BL0 B;  1Y1X A;  2KGR A;  3OHM B;  5CSI A;  3SG5 A;  5IBW A;  1UHJ A;  1Q80 A;  3HCM A;  4AOM A;  4XJK A;  2LAN A;  3TS5 C;  1KCY A;  4PAL A;  4JQ0 D;  2BE4 A;  4MZK A;  4JPZ B;  1F71 A;  3ICB A;  1A4P A;  1B47 A;  4HSZ A;  1IJ5 A;  1L2O B;  3D10 A;  1HT9 A;  2K0J A;  1XO5 A;  3MSE B;  4CID A;  2LV7 A;  1L2O C;  1F4Q A;  1RK9 A;  5HKY A;  4Q04 A;  4YBH B;  1XA5 A;  1EL4 A;  1M31 A;  5ER4 X;  4BY5 A;  1QX2 A;  4YGD B;  5F6T A;  4MZL A;  1EXR A;  3EVR A;  1YVL A;  1IJ6 A;  1W7J B;  4FQO A;  1YUS A;  1JWD A;  1KK7 Y;  1XFZ O;  1ZFS A;  1JUO A;  4M2Q A;  2WOS A;  4OR9 B;  4WRI A;  1PVA A;  4CFQ A;  3O4Y A;  3NSO A;  3RM1 A;  1QTX A;  1DT7 B;  1SK6 D;  2KBI A;  2LVJ A;  3FIA A;  2I18 A;  2LMU A;  2KQY A;  3PAL A;  3SG2 A;  1RFJ A;  5K89 A;  5GQQ C;  1R2U A;  3BUO B;  4XYN A;  2Y1M A;  5KTY A;  3PSR A;  1IG5 A;  1YVH A;  1BMO A;  2KHN A;  5AXI A;  1J7Q A;  2LUX A;  2MA2 A;  3BUW B;  3FWC A;  4R1E A;  1CKK A;  1XYD A;  2FCE A;  1OZS A;  2NLN A;  3PLF B;  4HRG A;  1WRL A;  2EC6 B;  1DJW A;  2FOT A;  1G4Y R;  2GGM A;  4PHK A;  4HRH A;  1S5G Z;  2LAP A;  2KI4 C;  1LA3 A;  2EC6 C;  1K2H A;  1XFX O;  1J1D A;  2LHL A;  2KOT A;  4GAO A;  1EG3 A;  1K96 A;  1K9K A;  1NCZ A;  2F2P A;  5AEQ A;  1FI5 A;  1S3P A;  2VRG A;  3CLN A;  3I5H B;  3KEV A;  1TN4 A;  1MXE A;  1IQ3 A;  1ZMZ A;  2I2R E;  3F45 A;  1F8H A;  4MRY A;  5CSN A;  5D7F A;  1FW4 A;  3K21 A;  3DVJ A;  1V1G A;  3LK1 A;  3I5H C;  1DJY A;  1SCV A;  1RJV A;  1YUR A;  4MN0 A;  2BCA A;  4NDD A;  3SG6 A;  1YX8 A;  1FPW A;  3BUN B;  3KF9 A;  1QS7 A;  3BXK A;  1C07 A;  4YRU A;  2M1U A;  1DGU A;  2ZRT A;  3NSL A;  1AK8 A;  1QAS A;  2BCB A;  1SPY A;  1SNL A;  2HPS A;  1TCF A;  1TNW A;  3EKH A;  1B8R A;  1REC A;  3GK1 A;  4I5J A;  4USL A;  3JTD B;  3LCP C;  5KU1 A;  4OCI A;  2ZN8 A;  1SKT A;  3DD4 A;  2BBN A;  1ZAC A;  1NPQ A;  3JTD C;  2BE6 A;  2LVI A;  2WC8 A;  1CFD A;  4M2O A;  3KHE A;  3OB1 B;  5BPJ A;  4PE4 A;  2LP3 A;  2CTN A;  2H2K A;  3DVM A;  1A75 B;  4N5X A;  1CMF A;  2K8M B;  5AER A;  4DUQ A;  1B4C A;  2MRD A;  1NCX A;  2JPT A;  3NXA A;  2LVV A;  4MZJ A;  1EH2 A;  4QJ4 B;  1N65 A;  2EHB A;  1QLK A;  5I8N A;  2EGD A;  2M97 A;  3PM8 A;  2KDH A;  2Y1N A;  1S36 A;  5ER5 A;  5FYX A;  1A03 A;  3BOW B;  3EK7 A;  4AQJ A;  1J7P A;  3H4S E;  4YGE B;  1JF0 A;  1QVI Y;  2M8U A;  1BG1 A;  1R6P A;  1WDC B;  2KFG A;  1IWQ A;  2L2E A;  4PDZ A;  1JSA A;  2ZKM X;  1KFX S;  1QIV A;  2K7O A;  1WDC C;  4C0J A;  2GV5 A;  4MLW A;  5AFP A;  2G2B A;  2KGB C;  2M0R A;  4N1G A;  1M45 A;  1Y1U A;  1KFU S;  1NX2 A;  1LKJ A;  1QV1 A;  2JC2 A;  2BEC A;  2L5X B;  3I5F B;  2PSR A;  1BF5 A;  3KO0 A;  4NDC A;  1ODB A;  2M29 A;  3PFV A;  4XJK B;  1C7W A;  1PRW A;  2BL0 C;  3PAT A;  1GGW A;  5HYD A;  3FS7 A;  2K7B A;  1B8C A;  3I5F C;  1BT6 A;  3TDU A;  1SL9 A;  1NWD A;  2KBM A;  2PAS A;  4OVN F;  2NCO A;  1QJT A;  1OQP A;  1GQM A;  2KAV A;  1KQM B;  1SL8 A;  2NZ0 A;  5J3X A;  3DVK A;  4CLN A;  3BYA A;  2L4I A;  1RRO A;  3OX5 A;  2L51 A;  1KQM C;  1WLZ A;  2LMT A;  1WRZ A;  2CT9 A;  3BUM B;  2ZN9 A;  4TNC A;  2MLF C;  4BY4 A;  1TNX A;  1K90 D;  1K93 D;  3CR4 X;  4D1E A;  2KYF A;  1KWO B;  2M3W A;  1ZOT B;  2NCP A;  5DKN A;  2B1U A;  4YI9 A;  1CFC A;  4QJ3 B;  1LA0 A;  2K7C A;  1TOP A;  1KWO C;  1MHO A;  3CWG A;  1U5I A;  1HQV A;  1GJY A;  1K95 A;  1WLM A;  1IH0 A;  2PAL A;  1UHK A;  2ZND A;  2F8P A;  3QRX A;  1AVS A;  1YTZ C;  3TUY B;  2O5G A;  2L98 A;  1XFY O;  1NUB A;  4PHJ A;  5I2Q A;  1LVC D;  4I5K A;  1CM4 A;  5I2O A;  1SW8 A;  4ETO A;  3TUY C;  2KFF A;  1OOJ A;  2MJW B;  1JBA A;  2LP2 A;  3OB2 B;  2K61 A;  3PN7 B;  4AQI A;  1DGV A;  1JF2 A;  1H8B A;  2K7D A;  4IL1 A;  4ORA B;  1NP8 A;  1M46 A;  1S1E A;  3PN7 C;  1BLQ A;  1VRK A;  1IRJ A;  3DF0 A;  1V1F A;  2JTZ A;  1UUR A;  3CZT X;  4NDB A;  3NSK A;  3ZWH A;  1E8A A;  1QAT A;  4MRX A;  4I5L B;  1CFF A;  2V53 A;  2K2A A;  2I94 A;  2CCM A;  2KQ6 A;  4NQG A;  2HQW A;  2LCP A;  1F70 A;  3EVV A;  1CB1 A;  2G9B A;  1UHN A;  2PVB A;  4HRE E;  3D0Y A;  4ORC B;  3E3R A;  3SIB A;  4GGF A;  3WNX B;  1SYM A;  1J1E A;  1B1G A;  3IQQ A;  1XK4 A;  3O2P A;  3LL8 B;  2F3Z A;  3A8R A;  4PHN A;  3WHU B;  4YI8 A;  2JT8 A;  1MUX A;  1S5G Y;  2CBL A;  1B9A A;  5HKW A;  2SCP A;  4ICB A;  2KSP A;  1KQV A;  5HLV A;  2LM5 A;  4L9M A;  5CSJ A;  2LMV A;  1AP4 A;  1TTX A;  1AHR A;  1K9U A;  1MQ1 A;  2H61 A;  3BQ3 A;  2WND A;  2E30 A;  2HQ8 A;  1ALV A;  2JQ6 A;  2NXQ A;  3VRN A;  5I2L A;  4DCK A;  1F55 A;  4UPG A;  4PCW A;  3SIA A;  2PRU A;  3VRQ A;  2OPO A;  1QX5 B;  4PHM A;  5CPV A;  1DJX A;  4PE1 A;  1UUS A;  1BJF A;  3RLZ A;  4A4B A;  1L7Z A;  1UHH A;  4P5O E;  1UHI A;  1C7V A;  1YX7 A;  2LNK A;  1B7T Z;  1CNP A;  3AAJ A;  2PMY A;  3HX4 A;  5AAN A;  2AAO A;  4C0K A;  3CS1 A;  1LIN A;  2COL B;  3OP0 A;  1G33 A;  2P6B B;  4ZCU A;  4MSP A;  3CTN A;  1GGZ A;  1DJH A;  1DVI A;  1TRF A;  1W7I B;  1S6J A;  1MXL C;  3I5I B;  2OS8 B;  2JNF A;  4N1F A;  1AJ4 A;  1WRK A;  1X02 A;  1CLM A;  2M49 B;  3I5I C;  2F3Y A;  2TN4 A;  2OS8 C;  1CDP A;  2MHH A;  1BR1 B;  1SCM B;  1AJ5 A;  4YGB B;  2DOQ A;  1NCY A;  5CSF A;  4GGN A;  1IQ5 A;  1OSA A;  1BU3 A;  4FTG A;  1SCM C;  2BKH B;  1H4B A;  2L0P A;  1OE9 B;  3CR2 A;  3A4U B;  3LK0 A;  1KK7 Z;  2KAY A;  4OV2 A;  4U8D A;  5JOL A;  1UWO A;  1Y0V H;  1F54 A; 
#chains in the Genus database with same CATH topology
 2KPH A;  1JC2 A;  1FI6 A;  1DF0 A;  2KI6 C;  3CZ0 A;  2BBM A;  2JOJ A;  4C0L A;  1A29 A;  1PSR A;  3GOF A;  5HLO A;  1TCO B;  2BCX A;  4DS7 A;  2E6W A;  1EJ3 A;  4ZCV A;  1CDN A;  3BUX B;  3TZ1 A;  4INX A;  2IS9 A;  4E68 A;  1JFJ A;  1CDM A;  1Z2C B;  1U5I B;  1YUU A;  1YR5 A;  1KFX L;  2JNX A;  2QEH A;  1XFV O;  2QAC A;  3CGA A;  3SG4 A;  4MVF A;  5KSZ A;  4WQ2 A;  4KYN A;  2MBX A;  1KFU L;  4YGA A;  1XFU O;  4PT1 A;  2KAX A;  1PSB A;  2KNE A;  2F33 A;  1IGV A;  2K2F A;  4GUK A;  2QPT A;  3NSI A;  5DKR A;  5G08 A;  5I94 A;  2CNP A;  1PAL A;  3BFA A;  3DVE A;  4FQT A;  4PE0 A;  1ALW A;  1N2D A;  1C3Y A;  1NSH A;  2KLE A;  3O78 A;  3R72 A;  2AUC A;  1YRT B;  1MF8 B;  1OOF A;  2JZI A;  1M39 A;  1QLS A;  4ORB B;  1A2X A;  3DF0 B;  5D69 A;  4CPV A;  3CYZ A;  3VRR A;  3TDI A;  1LXF C;  2L50 A;  4DRW A;  4U8D A;  2LC5 A;  2D8N A;  3S0F A;  1BOD A;  5B8I B;  3IQO A;  2OTG B;  2LLS A;  1XVJ A;  2JRF A;  1MWN A;  1DJG A;  4GPL B;  1NX0 A;  1QX7 A;  1FF1 A;  2Y5I A;  1Y6W A;  4QJ5 B;  1G8I A;  2OTG C;  2L4H A;  3AAK A;  2QEO A;  1IKU A;  1RTP 1;  2KI4 B;  3D0Y B;  2M7L A;  1CM1 A;  1SR6 B;  3VRP A;  1AUI B;  1J7R A;  2JWW A;  3M0W A;  1OMD A;  3FE8 A;  1K94 A;  3SG7 A;  1SMG A;  3EK8 A;  3BFH A;  2SAS A;  2Q4U A;  1KSO A;  2JXL A;  1SR6 C;  1S6I A;  3S0A A;  1N0Y A;  4GGF C;  2WCK A;  1F4O A;  1QXP A;  2Y4Q A;  1TNQ A;  1CMG A;  2JXC A;  1NYA A;  3WXA A;  2ZNE A;  2KYC A;  1K8U A;  1NX1 A;  1J55 A;  2LVK A;  4M2P A;  5JJG A;  1BR4 B;  1PVB A;  1PK0 D;  1RWY A;  1XK4 C;  4PE7 A;  4DIR A;  1XFW O;  5FI2 A;  3N7H A;  2JTT A;  2M7N A;  4MEW A;  4YGC B;  2FJU B;  1S6C A;  1DEL A;  2BKI B;  3BFB A;  2WC5 A;  2HF5 A;  2MLE C;  3SG3 A;  1DJI A;  2HET A;  3B86 A;  5AFP A;  1C3Z A;  1J7O A;  2JT0 A;  1KK8 B;  3D74 A;  1JFK A;  2WCE A;  1SBJ A;  1Y1A A;  2WCB A;  1K9P A;  2H61 C;  4GNK B;  3VGO A;  3IF7 A;  2RGI A;  1M63 B;  4P2Y B;  1KK8 C;  1CLL A;  1SY9 A;  1DMO A;  1QVI Z;  2BNX A;  2H8V A;  4MBE A;  3CZ1 A;  1PUL A;  1S26 D;  4I5N B;  1FBV A;  2GGZ A;  1NX3 A;  3C1V A;  3OX6 A;  1ZUZ A;  1CFP A;  2KI6 D;  2PYQ A;  1NIW A;  1YUT A;  3DYE A;  2ZRS A;  5DKQ A;  1EG4 A;  2O60 A;  1CTR A;  1DTL A;  1OMR A;  2FCD A;  3EK4 A;  5HKZ A;  1TNP A;  1A75 A;  1UP5 A;  2LE9 B;  3JVT B;  3Q8I A;  1OMV A;  2F2O A;  2LUC A;  4GBA A;  3I5G B;  3DXL A;  2Q91 A;  2LHI A;  3GK4 X;  1B8L A;  3EVU A;  3JVT C;  3LLE A;  2CXJ A;  3VRO A;  1OOH A;  2KFH A;  2WCF A;  3TDZ A;  1QIW A;  3I5G C;  1BOC A;  1TWO A;  1FPW A;  1QV0 A;  4A4C A;  3BOW A;  1SRA A;  2LLT A;  2P70 A;  3B87 A;  3SS3 A;  2R2I A;  3AKB A;  2I7A A;  3O6B A;  4F0Z B;  5PAL A;  3FWB A;  2AMI A;  2JUL A;  2M1K B;  2WOR A;  3KPX A;  3DZT A;  4GFT A;  1MR8 A;  4WQ3 A;  2A4J A;  2M9G A;  2ISD A;  1WY9 A;  4OKH A;  1B7T Y;  4CFR A;  3SJS A;  3SS5 A;  2LLU A;  4JWQ A;  1D1O A;  2WCH A;  2JU0 A;  1P28 A;  3EKJ A;  5FI7 A;  1DJZ A;  1CDL A;  1ORG A;  1SL7 A;  2MAZ A;  3AKA A;  3GK2 A;  3CR5 X;  1YRU B;  2JT3 A;  5TNC A;  1OZO A;  1CLB A;  1DF0 B;  3ZNI A;  1TIZ A;  3TS5 B;  1KSM A;  2L2C A;  2ZFD A;  2BL0 B;  1Y1X A;  2KGR A;  3OHM B;  5CSI A;  3SG5 A;  5IBW A;  1UHJ A;  1Q80 A;  3HCM A;  4AOM A;  4XJK A;  2LAN A;  3TS5 C;  1KCY A;  4PAL A;  4JQ0 D;  2BE4 A;  4MZK A;  4JPZ B;  1F71 A;  2WCM A;  3ICB A;  1A4P A;  1B47 A;  4HSZ A;  1IJ5 A;  1L2O B;  3D10 A;  1HT9 A;  2K0J A;  1XO5 A;  3MSE B;  4CID A;  2LV7 A;  1L2O C;  1F4Q A;  1RK9 A;  1W9Z A;  4Q04 A;  4YBH B;  1XA5 A;  1EL4 A;  1M31 A;  5ER4 X;  4BY5 A;  1QX2 A;  4YGD B;  5F6T A;  4MZL A;  1EXR A;  3EVR A;  1YVL A;  1IJ6 A;  1W7J B;  2KLD A;  4FQO A;  1YUS A;  1JWD A;  1KK7 Y;  1XFZ O;  1ZFS A;  3D77 A;  1JUO A;  4M2Q A;  2WOS A;  4OR9 B;  4WRI A;  4F7F A;  1PVA A;  4CFQ A;  3O4Y A;  3NSO A;  3RM1 A;  1QTX A;  1DT7 B;  2PQL A;  1SK6 D;  2KBI A;  2LVJ A;  3FIA A;  3NHI A;  1Z4H A;  2I18 A;  2LMU A;  2KQY A;  3PAL A;  3SG2 A;  3FE9 A;  1RFJ A;  3EG5 B;  5K89 A;  5GQQ C;  1R2U A;  3BUO B;  4XYN A;  2Y1M A;  2P71 A;  3PSR A;  5KTY A;  4JKT A;  1IG5 A;  1YVH A;  1BMO A;  2KHN A;  5AXI A;  1J7Q A;  2LUX A;  2MA2 A;  3BUW B;  3FWC A;  4R1E A;  1CKK A;  1XYD A;  2FCE A;  1OOG A;  1OZS A;  2NLN A;  3PLF B;  4HRG A;  1WRL A;  2EC6 B;  4INW A;  1DJW A;  2FOT A;  1G4Y R;  2GGM A;  4PHK A;  3CZ2 A;  1S5G Z;  4HRH A;  2LAP A;  2ERB A;  2KI4 C;  1LA3 A;  2EC6 C;  1K2H A;  1XFX O;  1J1D A;  2LHL A;  2KOT A;  3PJI A;  1EG3 A;  1K96 A;  1K9K A;  1NCZ A;  2F2P A;  4GAO A;  5AEQ A;  1FI5 A;  1S3P A;  2VRG A;  3CLN A;  3I5H B;  1GM0 A;  3KEV A;  1TN4 A;  1MXE A;  1IQ3 A;  1ZMZ A;  2I2R E;  3F45 A;  1F8H A;  4MRY A;  5CSN A;  5D7F A;  1FW4 A;  3K21 A;  3DVJ A;  1V1G A;  3LK1 A;  3I5H C;  1DJY A;  1DEK A;  1RJV A;  1SCV A;  1YUR A;  2BCA A;  4MN0 A;  4NDD A;  1YX8 A;  3SG6 A;  3BUN B;  3KF9 A;  1QS7 A;  3BXK A;  1C07 A;  4YRU A;  2M1U A;  1DGU A;  2ZRT A;  3NSL A;  1AK8 A;  1TUJ A;  1QAS A;  2BCB A;  1SPY A;  1SNL A;  2HPS A;  1LS8 A;  1TCF A;  1TNW A;  3EKH A;  1IIO A;  1B8R A;  1REC A;  3GK1 A;  4I5J A;  4USL A;  3UO9 A;  3JTD B;  3LCP C;  5KU1 A;  3L47 A;  4OCI A;  2ZN8 A;  1SKT A;  3DD4 A;  2BBN A;  1ZAC A;  1NPQ A;  3JTD C;  2BE6 A;  2LVI A;  2WC8 A;  1CFD A;  2FJY A;  4M2O A;  3NGV A;  3KHE A;  3OB1 B;  5BPJ A;  4PE4 A;  2LP3 A;  3D78 A;  2CTN A;  2H2K A;  3DVM A;  1A75 B;  4N5X A;  2WC6 A;  1CMF A;  2K8M B;  5AER A;  4DUQ A;  1B4C A;  3L4L A;  2MRD A;  1NCX A;  2JPT A;  3NXA A;  2LVV A;  4MZJ A;  1EH2 A;  4QJ4 B;  1N65 A;  2EHB A;  3SS4 A;  1QLK A;  2QEV A;  5I8N A;  2EGD A;  1DC1 A;  2M97 A;  3UNW A;  3PM8 A;  2KDH A;  2Y1N A;  1S36 A;  5ER5 A;  5FYX A;  2QDI A;  1A03 A;  3BOW B;  3EK7 A;  4AQJ A;  1J7P A;  2K60 A;  3H4S E;  4YGE B;  1JF0 A;  1QVI Y;  2M8U A;  5HL1 A;  1BG1 A;  1R6P A;  1WDC B;  2KFG A;  1IWQ A;  2L2E A;  3S0G A;  4PDZ A;  3D75 A;  1JSA A;  2BAP A;  2ZKM X;  1KFX S;  1QIV A;  2K7O A;  1QWV A;  1WDC C;  2GV5 A;  4MLW A;  5D3O A;  2G2B A;  2KGB C;  4C0J A;  2M0R A;  4N1G A;  1M45 A;  3BJH A;  1Y1U A;  1KFU S;  1NX2 A;  1LKJ A;  1QV1 A;  3CAB A;  2JC2 A;  2BEC A;  2L5X B;  3I5F B;  2PSR A;  1BF5 A;  3KO0 A;  4NDC A;  1ODB A;  2M29 A;  3PFV A;  3O4X A;  4XJK B;  1C7W A;  3B6X A;  1PRW A;  2BL0 C;  3PAT A;  1GGW A;  5HYD A;  3FS7 A;  2K7B A;  1B8C A;  3I5F C;  1BT6 A;  1TUZ A;  3TDU A;  1SL9 A;  1NWD A;  2KBM A;  2PAS A;  4OVN F;  2NCO A;  1QJT A;  3R1O A;  1OQP A;  1GQM A;  1OW4 A;  2KAV A;  3R1V A;  3K1E A;  1KQM B;  5EL2 A;  3S0E A;  1SL8 A;  2NZ0 A;  5J3X A;  3DVK A;  4CLN A;  3B88 A;  3BYA A;  2L4I A;  1RRO A;  3OX5 A;  2L51 A;  1KQM C;  1WLZ A;  2LMT A;  1WRZ A;  2CT9 A;  3BUM B;  2ZN9 A;  4TNC A;  2MLF C;  4BY4 A;  1TNX A;  1K90 D;  1K93 D;  3CR4 X;  3L4A A;  2KYF A;  4D1E A;  1KWO B;  2M3W A;  1ZOT B;  2NCP A;  3OBV A;  2B1U A;  4YI9 A;  5DKN A;  1CFC A;  4QJ3 B;  1LA0 A;  2K7C A;  1TOP A;  1KWO C;  1MHO A;  3CWG A;  1U5I A;  1HQV A;  1GJY A;  1K95 A;  1WLM A;  3VB1 A;  2PAL A;  1UHK A;  2ZND A;  3WHT B;  2F8P A;  1IH0 A;  3QRX A;  1AVS A;  1YTZ C;  3TUY B;  2O5G A;  2L98 A;  1XFY O;  1NUB A;  4PHJ A;  5I2Q A;  1LVC D;  4I5K A;  1CM4 A;  5I2O A;  1SW8 A;  4ETO A;  3TUY C;  2KFF A;  1OOJ A;  2MJW B;  1JBA A;  2LP2 A;  3B7A A;  3OB2 B;  2K61 A;  3IVT A;  3PN7 B;  4AQI A;  1DGV A;  1JF2 A;  1H8B A;  2K7D A;  4IL1 A;  4ORA B;  1NP8 A;  1M46 A;  1S1E A;  3PN7 C;  1BLQ A;  1VRK A;  1IRJ A;  3DF0 A;  1V1F A;  2JTZ A;  5DIC A;  4OZD A;  1UUR A;  3CZT X;  3PM2 A;  3OGN A;  4NDB A;  3NSK A;  3S0B A;  1E8A A;  1QAT A;  4MRX A;  4I5L B;  3ZWH A;  1CFF A;  2V53 A;  2K2A A;  2I94 A;  2CCM A;  2KQ6 A;  3D76 A;  4NQG A;  2HQW A;  2LCP A;  1F70 A;  3EVV A;  1CB1 A;  2G9B A;  1UHN A;  2PVB A;  4HRE E;  3D0Y A;  4ORC B;  3E3R A;  3SIB A;  4GGF A;  4JD9 A;  3WNX B;  1SYM A;  1J1E A;  3D73 A;  4IJ7 A;  2GTE A;  1B1G A;  1T14 A;  3IQQ A;  2WCL A;  3CDN A;  1XK4 A;  3O2P A;  3DY9 A;  2F3Z A;  3A8R A;  3LL8 B;  4PHN A;  4YI8 A;  3WHU B;  2JT8 A;  1MUX A;  1S5G Y;  3RZS A;  5HKY A;  2CBL A;  1B9A A;  5HKW A;  2SCP A;  4ICB A;  2KSP A;  1KQV A;  5HLV A;  2LM5 A;  4L9M A;  5CSJ A;  2LMV A;  1AP4 A;  1TTX A;  1AHR A;  1K9U A;  1MQ1 A;  2H61 A;  3BQ3 A;  2WND A;  2E30 A;  2HQ8 A;  1ALV A;  2JQ6 A;  2NXQ A;  3VRN A;  5I2L A;  4DCK A;  1F55 A;  4UPG A;  4PCW A;  2YGU A;  3SIA A;  2PRU A;  3FE6 A;  3VRQ A;  1SSE B;  1QX5 B;  2OPO A;  4PHM A;  5CPV A;  1DJX A;  4PE1 A;  1UUS A;  1BJF A;  3RLZ A;  4A4B A;  1L7Z A;  1UHH A;  1DQE A;  1UHI A;  2JPO A;  2L5Y A;  4P5O E;  1C7V A;  1YX7 A;  2LNK A;  3V2L A;  2QEB A;  1B7T Z;  1CNP A;  5FI6 A;  3AAJ A;  3S0D A;  2PMY A;  3HX4 A;  5AAN A;  2AAO A;  4C0K A;  3CS1 A;  1LIN A;  2COL B;  3NHT A;  1G33 A;  3OP0 A;  2P6B B;  4ZCU A;  4MSP A;  3CTN A;  1DJH A;  1GGZ A;  1DVI A;  1TRF A;  1W7I B;  1S6J A;  1MXL C;  3I5I B;  2OS8 B;  2JNF A;  4N1F A;  1AJ4 A;  1WRK A;  1X02 A;  1CLM A;  2M49 B;  3I5I C;  2F3Y A;  2TN4 A;  2OS8 C;  1CDP A;  2MHH A;  1BR1 B;  1SCM B;  1AJ5 A;  4YGB B;  2DOQ A;  1OOI X;  1NCY A;  5CSF A;  4GGN A;  3QME A;  1IQ5 A;  2WCJ A;  1OSA A;  1BU3 A;  3R1P A;  4FTG A;  1SCM C;  2BKH B;  1H4B A;  2L0P A;  1OE9 B;  3CR2 A;  3A4U B;  3LK0 A;  1KK7 Z;  2KAY A;  4OV2 A;  1XFR A;  5JOL A;  1UWO A;  1Y0V H;  1F54 A; 
#chains in the Genus database with same CATH homology
 1FI6 A;  1JC2 A;  1DF0 A;  2KI6 C;  2BBM A;  2JOJ A;  4C0L A;  1A29 A;  1PSR A;  3GOF A;  5HLO A;  1TCO B;  2BCX A;  4DS7 A;  2E6W A;  1EJ3 A;  4ZCV A;  1CDN A;  3BUX B;  3TZ1 A;  2IS9 A;  4E68 A;  1JFJ A;  1CDM A;  1U5I B;  1YUU A;  1YR5 A;  1KFX L;  2JNX A;  1XFV O;  2QAC A;  3CGA A;  3SG4 A;  4MVF A;  5KSZ A;  4WQ2 A;  2MBX A;  1KFU L;  4YGA A;  1XFU O;  2KAX A;  1PSB A;  2KNE A;  2F33 A;  1IGV A;  2K2F A;  4GUK A;  2QPT A;  3NSI A;  5DKR A;  5G08 A;  2CNP A;  1PAL A;  3DVE A;  4PE0 A;  1ALW A;  1N2D A;  1NSH A;  3O78 A;  2AUC A;  1YRT B;  1MF8 B;  2JZI A;  1M39 A;  1QLS A;  4ORB B;  1A2X A;  3DF0 B;  5D69 A;  4CPV A;  3VRR A;  3TDI A;  1LXF C;  2L50 A;  4DRW A;  2LC5 A;  2D8N A;  1BOD A;  5B8I B;  3IQO A;  2OTG B;  2LLS A;  1XVJ A;  2JRF A;  1MWN A;  1DJG A;  4GPL B;  1NX0 A;  1QX7 A;  1FF1 A;  2Y5I A;  1Y6W A;  4QJ5 B;  1G8I A;  2OTG C;  2L4H A;  3AAK A;  1IKU A;  1RTP 1;  2KI4 B;  3D0Y B;  2M7L A;  1CM1 A;  1SR6 B;  3VRP A;  1AUI B;  1J7R A;  2JWW A;  3M0W A;  1OMD A;  1K94 A;  3SG7 A;  1SMG A;  3EK8 A;  2SAS A;  2Q4U A;  1KSO A;  2JXL A;  1SR6 C;  1S6I A;  1N0Y A;  4GGF C;  1F4O A;  1QXP A;  2Y4Q A;  1TNQ A;  1CMG A;  2JXC A;  1NYA A;  3WXA A;  2ZNE A;  2KYC A;  1K8U A;  1NX1 A;  1J55 A;  2LVK A;  4M2P A;  5JJG A;  1BR4 B;  1PVB A;  1PK0 D;  1RWY A;  1XK4 C;  4PE7 A;  4DIR A;  1XFW O;  2JTT A;  2M7N A;  4MEW A;  4YGC B;  2FJU B;  1S6C A;  3SG3 A;  2BKI B;  2HF5 A;  2MLE C;  1DJI A;  2HET A;  1J7O A;  2JT0 A;  1KK8 B;  1JFK A;  2WCE A;  1SBJ A;  1Y1A A;  2WCB A;  1K9P A;  2H61 C;  4GNK B;  3VGO A;  3IF7 A;  2RGI A;  1M63 B;  4P2Y B;  1KK8 C;  1CLL A;  1SY9 A;  1DMO A;  1QVI Z;  4MBE A;  1PUL A;  1S26 D;  4I5N B;  1FBV A;  2GGZ A;  1NX3 A;  3C1V A;  3OX6 A;  1ZUZ A;  1CFP A;  2KI6 D;  1NIW A;  1YUT A;  2ZRS A;  5DKQ A;  1EG4 A;  2O60 A;  1CTR A;  1DTL A;  1OMR A;  2FCD A;  3EK4 A;  5HKZ A;  1TNP A;  1A75 A;  1UP5 A;  2LE9 B;  3JVT B;  1OMV A;  2F2O A;  2LUC A;  4GBA A;  3I5G B;  2Q91 A;  2LHI A;  3GK4 X;  1B8L A;  3EVU A;  3JVT C;  3LLE A;  2CXJ A;  3VRO A;  2KFH A;  2WCF A;  3TDZ A;  1QIW A;  3I5G C;  1BOC A;  1QV0 A;  4A4C A;  3BOW A;  1SRA A;  2LLT A;  2R2I A;  3AKB A;  2I7A A;  3O6B A;  4F0Z B;  5PAL A;  3FWB A;  2AMI A;  2JUL A;  2M1K B;  2WOR A;  3KPX A;  4GFT A;  1MR8 A;  4WQ3 A;  2A4J A;  2M9G A;  2ISD A;  1WY9 A;  4OKH A;  1B7T Y;  4CFR A;  3SJS A;  2LLU A;  4JWQ A;  1D1O A;  2JU0 A;  3EKJ A;  1DJZ A;  1CDL A;  1SL7 A;  2MAZ A;  3AKA A;  3GK2 A;  5TNC A;  3CR5 X;  1YRU B;  2JT3 A;  3WHT B;  1OZO A;  1CLB A;  1DF0 B;  3ZNI A;  1TIZ A;  3TS5 B;  1KSM A;  2ZFD A;  2BL0 B;  1Y1X A;  2KGR A;  3OHM B;  5CSI A;  3SG5 A;  5IBW A;  1UHJ A;  1Q80 A;  3HCM A;  4AOM A;  4XJK A;  2LAN A;  3TS5 C;  1KCY A;  4PAL A;  4JQ0 D;  2BE4 A;  4MZK A;  4JPZ B;  1F71 A;  3ICB A;  1A4P A;  1B47 A;  4HSZ A;  1IJ5 A;  1L2O B;  3D10 A;  1HT9 A;  2K0J A;  1XO5 A;  3MSE B;  4CID A;  2LV7 A;  1L2O C;  1F4Q A;  1RK9 A;  5HKY A;  4Q04 A;  4YBH B;  1XA5 A;  1EL4 A;  1M31 A;  5ER4 X;  4BY5 A;  1QX2 A;  4YGD B;  5F6T A;  4MZL A;  1EXR A;  3EVR A;  1YVL A;  1IJ6 A;  1W7J B;  4FQO A;  1YUS A;  1JWD A;  1KK7 Y;  1XFZ O;  1ZFS A;  1JUO A;  4M2Q A;  2WOS A;  4OR9 B;  4WRI A;  1PVA A;  4CFQ A;  3O4Y A;  3NSO A;  3RM1 A;  1QTX A;  1DT7 B;  1SK6 D;  2KBI A;  2LVJ A;  3FIA A;  2I18 A;  2LMU A;  2KQY A;  3PAL A;  3SG2 A;  1RFJ A;  5K89 A;  5GQQ C;  1R2U A;  3BUO B;  4XYN A;  2Y1M A;  5KTY A;  3PSR A;  1IG5 A;  1YVH A;  1BMO A;  2KHN A;  5AXI A;  1J7Q A;  2LUX A;  2MA2 A;  3BUW B;  3FWC A;  4R1E A;  1CKK A;  1XYD A;  2FCE A;  1OZS A;  2NLN A;  3PLF B;  4HRG A;  1WRL A;  2EC6 B;  1DJW A;  2FOT A;  1G4Y R;  2GGM A;  4PHK A;  4HRH A;  1S5G Z;  2LAP A;  2KI4 C;  1LA3 A;  2EC6 C;  1K2H A;  1XFX O;  1J1D A;  2LHL A;  2KOT A;  4GAO A;  1EG3 A;  1K96 A;  1K9K A;  1NCZ A;  2F2P A;  5AEQ A;  1FI5 A;  1S3P A;  2VRG A;  3CLN A;  3I5H B;  3KEV A;  1TN4 A;  1MXE A;  1IQ3 A;  1ZMZ A;  2I2R E;  3F45 A;  1F8H A;  4MRY A;  5CSN A;  5D7F A;  1FW4 A;  3K21 A;  3DVJ A;  1V1G A;  3LK1 A;  3I5H C;  1DJY A;  1SCV A;  1RJV A;  1YUR A;  4MN0 A;  2BCA A;  4NDD A;  3SG6 A;  1YX8 A;  1FPW A;  3BUN B;  3KF9 A;  1QS7 A;  3BXK A;  1C07 A;  4YRU A;  2M1U A;  1DGU A;  2ZRT A;  3NSL A;  1AK8 A;  1QAS A;  2BCB A;  1SPY A;  1SNL A;  2HPS A;  1TCF A;  1TNW A;  3EKH A;  1B8R A;  1REC A;  3GK1 A;  4I5J A;  4USL A;  3JTD B;  3LCP C;  5KU1 A;  4OCI A;  2ZN8 A;  1SKT A;  3DD4 A;  2BBN A;  1ZAC A;  1NPQ A;  3JTD C;  2BE6 A;  2LVI A;  2WC8 A;  1CFD A;  4M2O A;  3KHE A;  3OB1 B;  5BPJ A;  4PE4 A;  2LP3 A;  2CTN A;  2H2K A;  3DVM A;  1A75 B;  4N5X A;  1CMF A;  2K8M B;  5AER A;  4DUQ A;  1B4C A;  2MRD A;  1NCX A;  2JPT A;  3NXA A;  2LVV A;  4MZJ A;  1EH2 A;  4QJ4 B;  1N65 A;  2EHB A;  1QLK A;  5I8N A;  2EGD A;  2M97 A;  3PM8 A;  2KDH A;  2Y1N A;  1S36 A;  5ER5 A;  5FYX A;  1A03 A;  3BOW B;  3EK7 A;  4AQJ A;  1J7P A;  3H4S E;  4YGE B;  1JF0 A;  1QVI Y;  2M8U A;  1BG1 A;  1R6P A;  1WDC B;  2KFG A;  1IWQ A;  2L2E A;  4PDZ A;  1JSA A;  2ZKM X;  1KFX S;  1QIV A;  2K7O A;  1WDC C;  4C0J A;  2GV5 A;  4MLW A;  5AFP A;  2G2B A;  2KGB C;  2M0R A;  4N1G A;  1M45 A;  1Y1U A;  1KFU S;  1NX2 A;  1LKJ A;  1QV1 A;  2JC2 A;  2BEC A;  2L5X B;  3I5F B;  2PSR A;  1BF5 A;  3KO0 A;  4NDC A;  1ODB A;  2M29 A;  3PFV A;  4XJK B;  1C7W A;  1PRW A;  2BL0 C;  3PAT A;  1GGW A;  5HYD A;  3FS7 A;  2K7B A;  1B8C A;  3I5F C;  1BT6 A;  3TDU A;  1SL9 A;  1NWD A;  2KBM A;  2PAS A;  4OVN F;  2NCO A;  1QJT A;  1OQP A;  1GQM A;  2KAV A;  1KQM B;  1SL8 A;  2NZ0 A;  5J3X A;  3DVK A;  4CLN A;  3BYA A;  2L4I A;  1RRO A;  3OX5 A;  2L51 A;  1KQM C;  1WLZ A;  2LMT A;  1WRZ A;  2CT9 A;  3BUM B;  2ZN9 A;  4TNC A;  2MLF C;  4BY4 A;  1TNX A;  1K90 D;  1K93 D;  3CR4 X;  4D1E A;  2KYF A;  1KWO B;  2M3W A;  1ZOT B;  2NCP A;  5DKN A;  2B1U A;  4YI9 A;  1CFC A;  4QJ3 B;  1LA0 A;  2K7C A;  1TOP A;  1KWO C;  1MHO A;  3CWG A;  1U5I A;  1HQV A;  1GJY A;  1K95 A;  1WLM A;  1IH0 A;  2PAL A;  1UHK A;  2ZND A;  2F8P A;  3QRX A;  1AVS A;  1YTZ C;  3TUY B;  2O5G A;  2L98 A;  1XFY O;  1NUB A;  4PHJ A;  5I2Q A;  1LVC D;  4I5K A;  1CM4 A;  5I2O A;  1SW8 A;  4ETO A;  3TUY C;  2KFF A;  1OOJ A;  2MJW B;  1JBA A;  2LP2 A;  3OB2 B;  2K61 A;  3PN7 B;  4AQI A;  1DGV A;  1JF2 A;  1H8B A;  2K7D A;  4IL1 A;  4ORA B;  1NP8 A;  1M46 A;  1S1E A;  3PN7 C;  1BLQ A;  1VRK A;  1IRJ A;  3DF0 A;  1V1F A;  2JTZ A;  1UUR A;  3CZT X;  4NDB A;  3NSK A;  3ZWH A;  1E8A A;  1QAT A;  4MRX A;  4I5L B;  1CFF A;  2V53 A;  2K2A A;  2I94 A;  2CCM A;  2KQ6 A;  4NQG A;  2HQW A;  2LCP A;  1F70 A;  3EVV A;  1CB1 A;  2G9B A;  1UHN A;  2PVB A;  4HRE E;  3D0Y A;  4ORC B;  3E3R A;  3SIB A;  4GGF A;  3WNX B;  1SYM A;  1J1E A;  1B1G A;  3IQQ A;  1XK4 A;  3O2P A;  3LL8 B;  2F3Z A;  3A8R A;  4PHN A;  3WHU B;  4YI8 A;  2JT8 A;  1MUX A;  1S5G Y;  2CBL A;  1B9A A;  5HKW A;  2SCP A;  4ICB A;  2KSP A;  1KQV A;  5HLV A;  2LM5 A;  4L9M A;  5CSJ A;  2LMV A;  1AP4 A;  1TTX A;  1AHR A;  1K9U A;  1MQ1 A;  2H61 A;  3BQ3 A;  2WND A;  2E30 A;  2HQ8 A;  1ALV A;  2JQ6 A;  2NXQ A;  3VRN A;  5I2L A;  4DCK A;  1F55 A;  4UPG A;  4PCW A;  3SIA A;  2PRU A;  3VRQ A;  2OPO A;  1QX5 B;  4PHM A;  5CPV A;  1DJX A;  4PE1 A;  1UUS A;  1BJF A;  3RLZ A;  4A4B A;  1L7Z A;  1UHH A;  4P5O E;  1UHI A;  1C7V A;  1YX7 A;  2LNK A;  1B7T Z;  1CNP A;  3AAJ A;  2PMY A;  3HX4 A;  5AAN A;  2AAO A;  4C0K A;  3CS1 A;  1LIN A;  2COL B;  3OP0 A;  1G33 A;  2P6B B;  4ZCU A;  4MSP A;  3CTN A;  1GGZ A;  1DJH A;  1DVI A;  1TRF A;  1W7I B;  1S6J A;  1MXL C;  3I5I B;  2OS8 B;  2JNF A;  4N1F A;  1AJ4 A;  1WRK A;  1X02 A;  1CLM A;  2M49 B;  3I5I C;  2F3Y A;  2TN4 A;  2OS8 C;  1CDP A;  2MHH A;  1BR1 B;  1SCM B;  1AJ5 A;  4YGB B;  2DOQ A;  1NCY A;  5CSF A;  4GGN A;  1IQ5 A;  1OSA A;  1BU3 A;  4FTG A;  1SCM C;  2BKH B;  1H4B A;  2L0P A;  1OE9 B;  3CR2 A;  3A4U B;  3LK0 A;  1KK7 Z;  2KAY A;  4OV2 A;  4U8D A;  5JOL A;  1UWO A;  1Y0V H;  1F54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...