2HQ8A

Crystal structure of coelenterazine-binding protein from renilla muelleri in the ca loaded apo form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
181
Chain Sequence
ITESERAYHLRKMKTRMQRVDVTGDGFISREDYELIAVRIAKIAKLSAEKAEETRQEFLRVADQLGLAPGVRISVEEAAVNATDSLLKMKGEEKAMAVIQSLIMYDCIDTDKDGYVSLPEFKAFLQAVGPDLTDDKAITCFNTLDFNKNGQISRDEFLVTVNDFLFGLEETALANAFYGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of coelenterazine-binding protein from Renilla muelleri at 1.7 A: why it is not a calcium-regulated photoprotein.
pubmed doi rcsb
source organism Renilla muelleri
molecule tags Structural genomics, unknown function
molecule keywords Coelenterazine-binding protein ca-bound apo form
total genus 70
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hq8A00
3TUYC 1K2HA 1QTXA 2ZFDA 1CDPA 1XFYO 2G9BA 1IGVA 1SL9A 3TDIA 2GV5A 1ZMZA 1J1DA 3JTDB 2BE6A 2BCBA 3AKAA 5D7FA 4I5JA 3SIBA 3SG4A 3GK4X 2LC5A 2KI4B 1NYAA 3PM8A 1KFUL 1LVCD 4YI9A 1JF2A 1NX0A 1GGWA 2BKIB 3KF9A 2A4JA 1QV0A 1DF0B 1UHHA 1WY9A 3DVKA 1ZOTB 2MJWB 4FQOA 1QJTA 1KFUS 2LM5A 1ALVA 1TNWA 4USLA 1PVBA 2M9GA 1NX1A 1IKUA 1B4CA 1M63B 1YRTB 3WHUB 1TIZA 2FJUB 2LHIA 1HQVA 1N65A 2AUCA 2GGMA 1AVSA 2ZRTA 3BOWA 4ORCB 3IQQA 2JXCA 4A4BA 1R6PA 3EVRA 2KI6D 1CFFA 3VRRA 4QJ4B 3D0YA 3LK1A 1WRKA 3TDZA 3KO0A 3PALA 1N0YA 3CGAA 3GOFA 1SYMA 4DCKA 1J55A 4XJKA 2ZRSA 2K61A 1CLMA 4I5NB 1ODBA 2SASA 1SR6C 1NWDA 1MF8B 1CMGA 3EKHA 1NP8A 1GQMA 1MXEA 1AJ5A 1NPQA 2CCMA 1NUBA 1K93D 2HF5A 2KQ6A 3CLNA 3SG7A 1SMGA 1DF0A 1N2DA 1SL7A 2LVIA 1EL4A 1NX2A 3BQ3A 4CFQA 2LAPA 2QPTA 1J7OA 1SNLA 1LINA 2L5XB 1TNPA 3SIAA 3O2PA 3EKJA 1KK7Y 3DF0B 2JZIA 4YGDB 3MSEB 1CDLA 1SBJA 1JC2A 1QXPA 1UHIA 2IS9A 1TOPA 1CB1A 2KI6C 5AFPA 1WDCB 1IJ6A 1XFXO 1DJZA 1LA0A 1CKKA 1BR1B 1B9AA 1IJ5A 2PSRA 1FI6A 3FS7A 1SCMC 1XA5A 5IBWA 2ISDA 1CDMA 2LCPA 1OQPA 4XJKB 2M29A 1J7RA 3SG5A 2BKHB 2CXJA 4MZLA 4DS7A 2JRFA 1DJGA 1WLZA 2GGZA 4M2OA 1JWDA 3EK4A 1S5GZ 2I2RE 4ZCVA 3A8RA 4NDCA 5D69A 2LMTA 1S6CA 1TNQA 2JOJA 4HRHA 2EGDA 1DGUA 3CWGA 2WCBA 2MRDA 1XYDA 1RECA 1ZFSA 1CLBA 4GAOA 1TRFA 4C0LA 5I2OA 5FYXA 5CSIA 3GK2A 5GQQC 3VROA 4PE7A 3RLZA 1XFUO 2F33A 4YRUA 5HKYA 1Q80A 3PFVA 4QJ5B 1OOJA 3SG3A 3HCMA 1NSHA 2BCAA 2KGBC 1C07A 3H4SE 1A4PA 2MAZA 3VRNA 1YUSA 4GNKB 1KQMC 1K9KA 2KFHA 3OHMB 2KGRA 2Y1MA 1KFXL 3BXKA 4I5KA 5KTYA 2WCFA 1K95A 1MHOA 4QJ3B 3PN7B 4ZCUA 3CTNA 1K8UA 5J3XA 2LP3A 1U5IB 1PSRA 2KQYA 3PN7C 4DUQA 2CNPA 4MN0A 1BJFA 1KFXS 2LVJA 4GGFA 1RWYA 3LK0A 1EJ3A 1BLQA 4YGAA 2LLSA 1IQ3A 4HREE 2K2FA 5B8IB 3LLEA 1WRLA 1KWOB 1B7TY 1QX7A 2AAOA 2ZNDA 3AAJA 1F4OA 1BT6A 3K21A 1S26D 2JNXA 3I5IB 2HQWA 2EHBA 3WHTB 4M2QA 1B8RA 2M97A 2KNEA 3O6BA 4DRWA 1S36A 3I5HC 1QLSA 3GK1A 1AK8A 1G33A 1OSAA 5HKZA 1XFVO 2JQ6A 2B1UA 4OKHA 1JFKA 1MWNA 2F3ZA 1UHNA 5AEQA 1CFPA 1C7WA 1ZACA 2K0JA 2JXLA 1JUOA 1S6IA 1U5IA 1IRJA 4GUKA 2H2KA 4R1EA 4U8DA 5I2QA 3KEVA 3NSIA 1E8AA 2P6BB 2Y4QA 3AKBA 3JTDC 5G08A 1OZSA 2LMUA 2ZNEA 1IH0A 1B7TZ 3JVTB 2F2OA 4CPVA 3NSKA 2KYFA 2NZ0A 2PALA 3BUXB 3BYAA 3OB2B 2M7LA 2Y5IA 5HLOA 4MZJA 2L98A 1DJHA 2TN4A 1S1EA 5CPVA 1FPWA 1YUTA 1UUSA 1SL8A 1PSBA 2FCEA 2O5GA 3O4YA 4NQGA 3DD4A 1M45A 2R2IA 4N1GA 3IQOA 2WORA 1KK7Z 1QS7A 1F71A 1SRAA 3DVJA 2E30A 1NCYA 2JWWA 3BUNB 1K9PA 1A75B 4FTGA 4E68A 2EC6C 1B8CA 1G4YR 1UURA 1IWQA 5HLVA 3EK7A 5JJGA 2BE4A 4PE0A 1NIWA 2FCDA 3EVUA 2LP2A 2I18A 4C0JA 1Y0VH 2MLFC 1ZUZA 1BF5A 1RK9A 2KI4C 4UPGA 2KHNA 2WCEA 2JC2A 5I2LA 1J7PA 4MLWA 1TN4A 1KCYA 4P5OE 1YX7A 2KAXA 1IG5A 1F70A 3NSOA 2KSPA 5K89A 5CSFA 2KOTA 1CLLA 3EK8A 1IQ5A 1B47A 3VRQA 2LE9B 4ORBB 3O78A 1A2XA 4MBEA 1QLKA 1QX2A 3FWCA 3PATA 1FF1A 1ALWA 1KSMA 1LKJA 2K7DA 3PSRA 2FOTA 3TDUA 2JU0A 1K96A 3JVTC 1OMRA 1TTXA 4CLNA 1RROA 2Y1NA 1M31A 4PALA 1JF0A 3I5HB 1PRWA 1PVAA 1XFWO 2JTTA 3ICBA 1XVJA 3IF7A 2LV7A 1QIVA 1DGVA 3WXAA 1R2UA 1SCMB 2MBXA 4YGEB 1EH2A 2NCOA 2LUCA 5DKQA 2M8UA 2LVKA 2I94A 1X02A 1QX5B 1YRUB 1M39A 2COLB 2OTGB 1NCZA 4GFTA 5AXIA 2JTZA 1GJYA 2SCPA 4C0KA 1K94A 2WNDA 3KHEA 3OB1B 4YBHB 4AOMA 3I5GB 2NCPA 3BUMB 1PULA 1DJYA 2L50A 3PLFB 3ZNIA 4PDZA 3HX4A 1QATA 2VRGA 2ZKMX 2JPTA 1FW4A 2M1KB 3OX6A 3I5IC 2MA2A 4HSZA 5DKRA 2JT0A 4NDBA 4AQIA 1CMFA 2PRUA 3AAKA 2M1UA 1Y6WA 1QVIZ 2K7CA 1G8IA 2NLNA 4MVFA 5AANA 1UWOA 2HETA 2M0RA 1KK8B 3VGOA 2K7OA 4P2YB 3WNXB 1CDNA 1WDCC 3NXAA 1SY9A 1YTZC 1MQ1A 3I5FB 2OS8C 4JWQA 4YGCB 1WRZA 1L2OB 2Q4UA 1BR4B 5ER4X 1C7VA 1JBAA 1S5GY 1YR5A 2KYCA 1A29A 1TCFA 1H4BA 5CSJA 2ZN8A 1J1EA 2H61A 4PHJA 1BOCA 4GBAA 1DJXA 2I7AA 4YGBB 4OR9B 3D10A 4I5LB 1GGZA 1F54A 3I5GC 1YX8A 1KWOC 1Y1XA 5AERA 1JFJA 1KSOA 2LMVA 1DT7B 1B8LA 4MEWA 4PHKA 2LLTA 1W7JB 3KPXA 2MHHA 5CSNA 5HKWA 1LXFC 1L7ZA 2M3WA 1CFDA 4BY5A 4PHNA 2LUXA 1UHJA 3TS5C 2KBIA 3QRXA 1FI5A 1DJIA 2LNKA 2L51A 1YURA 1NCXA 1OMVA 4OCIA 4A4CA 3C1VA 1D1OA 2AMIA 2KFFA 1XK4A 4TNCA 4ICBA 3LCPC 1Y1AA 4XYNA 4WRIA 5I8NA 2BL0C 2LLUA 1AJ4A 3DVEA 2K7BA 1A75A 1MR8A 2BL0B 1EG4A 2KDHA 3SG6A 1NX3A 5F6TA 3OP0A 4N1FA 4N5XA 2MLEC 2BBMA 2M7NA 5DKNA 2KBMA 1S3PA 1A03A 2PASA 1OZOA 2QACA 2BBNA 1CTRA 3OX5A 1DJWA 3TS5B 1F55A 4GPLB 4WQ3A 1RTP1 1UHKA 5JOLA 4GGFC 1EG3A 1WLMA 1KQVA 2ZN9A 3BUOB 2PVBA 1QV1A 1SK6D 2L4HA 1VRKA 4IL1A 1F4QA 1SKTA 2L4IA 3CR5X 1F8HA 1LA3A 1CM1A 1H8BA 2K8MB 3CS1A 2LHLA 1BMOA 1RFJA 2L0PA 1HT9A 3EVVA 2LANA 2EC6B 1MUXA 3NSLA 1AP4A 1SR6B 3DVMA 1DMOA 1OMDA 1K9UA 3F45A 2BECA 1SW8A 1FBVA 1AUIB 2HPSA 4Q04A 2F3YA 1SCVA 2WOSA 3CR2A 3E3RA 4OVNF 3RM1A 2G2BA 1CM4A 4F0ZB 3I5FC 3FWBA 2CTNA 5ER5A 3VRPA 1BU3A 2JULA 1W7IB 4JPZB 4MRYA 4DIRA 5HYDA 2PMYA 1DTLA 4GGNA 4CFRA 3BUWB 2JNFA 1BODA 3TZ1A 2JT3A 1RJVA 1XFZO 1YVLA 2LVVA 2BCXA 1TCOB 2CBLA 1K90D 2V53A 2K2AA 4HRGA 4MSPA 1QIWA 2NXQA 2RGIA 4JQ0D 4PE4A 2OS8B 1JSAA 4AQJA 1QASA 1Y1UA 1UP5A 1TNXA 2DOQA 4BY4A 2HQ8A 5KSZA 1BG1A 2OTGC 3D0YB 1PK0D 1XK4C 3A4UB 4L9MA 1M46A 1SPYA 4PHMA 3TUYB 2OPOA 5KU1A 1B1GA 5BPJA 1EXRA 1CFCA 3LL8B 2WC8A 2E6WA 1DVIA 2CT9A 1L2OC 1S6JA 1YUUA 2L2EA 1KQMB 1YVHA 1OE9B 1XO5A 1QVIY 2F2PA 3M0WA 3ZWHA 1KK8C 5TNCA 2Q91A 1J7QA 2F8PA 1MXLC 3SJSA 1V1GA 4MZKA 2KAVA 4NDDA 4YI8A 1AHRA 4PCWA 2M49B 4ORAB 3CZTX 3BOWB 1V1FA 3CR4X 1CNPA 4D1EA 4M2PA 2KAYA 3SG2A 2H61C 4PE1A 2KFGA 2D8NA 2JT8A 3DF0A 4MRXA 1PALA 2O60A 4CIDA 4ETOA 3FIAA 4WQ2A 4OV2A 5PALA
chains in the Genus database with same CATH superfamily
3TUYC 1K2HA 1QTXA 2KLDA 2ZFDA 1CDPA 1XFYO 2G9BA 1IGVA 1SL9A 3TDIA 2GV5A 1ZMZA 1J1DA 3JTDB 2BE6A 2BCBA 3AKAA 5D7FA 4I5JA 3VB1A 3SIBA 3SG4A 3GK4X 4FQTA 2LC5A 2KI4B 1NYAA 3PM8A 1KFUL 1GM0A 1LVCD 4YI9A 3S0FA 3S0GA 1JF2A 1NX0A 1GGWA 2BKIB 3D78A 3KF9A 2A4JA 3CZ1A 2WCLA 1QV0A 1DF0B 1UHHA 2ERBA 1WY9A 3DVKA 1ZOTB 2MJWB 4FQOA 1QJTA 1KFUS 2LM5A 3S0BA 1ALVA 1SSEB 3DYEA 1TNWA 4USLA 1PVBA 2M9GA 1NX1A 3CABA 1IKUA 1B4CA 1M63B 1YRTB 3WHUB 1TIZA 2FJUB 2LHIA 1HQVA 4KYNA 1N65A 2AUCA 2GGMA 1AVSA 2ZRTA 5HL1A 3BOWA 4ORCB 3IQQA 1DEKA 2JXCA 1R6PA 4A4BA 3EVRA 2KI6D 1CFFA 3VRRA 3S0DA 4QJ4B 3D0YA 3LK1A 1WRKA 3TDZA 3KO0A 3PALA 1TUJA 1W9ZA 3PJIA 1N0YA 3CGAA 3GOFA 1SYMA 4DCKA 1J55A 4XJKA 2ZRSA 2K61A 1CLMA 4I5NB 1ODBA 2SASA 1SR6C 1NWDA 1MF8B 1CMGA 1DELA 3EKHA 1NP8A 1GQMA 1MXEA 1AJ5A 1NPQA 2CCMA 1NUBA 1K93D 2HF5A 2KQ6A 3CLNA 3SG7A 1SMGA 1DF0A 1N2DA 1SL7A 2LVIA 1EL4A 1NX2A 3BQ3A 1DC1A 4CFQA 2LAPA 1TWOA 2QPTA 1J7OA 1SNLA 1LINA 2L5XB 1TNPA 3SIAA 3O2PA 3EKJA 2WCMA 4IJ7A 1KK7Y 3DF0B 2JZIA 4YGDB 3MSEB 1CDLA 1SBJA 2H8VA 1QXPA 1UHIA 2IS9A 1TOPA 1CB1A 1JC2A 2KI6C 5AFPA 1WDCB 1IJ6A 1XFXO 1DJZA 1LA0A 1CKKA 1BR1B 1B9AA 1IJ5A 2PSRA 2WCHA 1FI6A 3FS7A 1SCMC 3R1PA 1XA5A 5IBWA 2ISDA 1CDMA 2LCPA 1OQPA 3OBVA 4XJKB 2M29A 1J7RA 3SG5A 2BKHB 1TUZA 2CXJA 3R1VA 4MZLA 2JRFA 4DS7A 1DJGA 1WLZA 2GGZA 4M2OA 3B87A 1JWDA 3EK4A 3SS4A 1S5GZ 2I2RE 4ZCVA 3A8RA 2QEBA 4NDCA 5D69A 2LMTA 1S6CA 1TNQA 2JOJA 4HRHA 2EGDA 3S0AA 1DGUA 3CWGA 2WCBA 2MRDA 1XYDA 1RECA 1ZFSA 1CLBA 4GAOA 1TRFA 4C0LA 5I2OA 5FYXA 5CSIA 3GK2A 5GQQC 3VROA 4PE7A 3RLZA 1XFUO 2F33A 4YRUA 5HKYA 1Q80A 3PFVA 4QJ5B 1OOJA 3SG3A 3HCMA 1NSHA 2BCAA 2KGBC 1C07A 2KLEA 3H4SE 1A4PA 2MAZA 3VRNA 1YUSA 4GNKB 1KQMC 1K9KA 2KFHA 3OHMB 2KGRA 2Y1MA 1KFXL 2PQLA 2WC5A 3BXKA 4I5KA 1C3YA 2WCFA 1K95A 1MHOA 4QJ3B 3PN7B 4ZCUA 3CTNA 1K8UA 5J3XA 1XFRA 2LP3A 1U5IB 3R1OA 1PSRA 2KQYA 3PN7C 4DUQA 2CNPA 4MN0A 1BJFA 1KFXS 2LVJA 4GGFA 1ORGA 3QMEA 1RWYA 2WCJA 3LK0A 1EJ3A 1BLQA 4YGAA 2LLSA 1IQ3A 4HREE 2K2FA 5B8IB 3LLEA 1WRLA 1KWOB 1B7TY 1QX7A 2AAOA 2ZNDA 3AAJA 1F4OA 1BT6A 3K21A 1S26D 2JNXA 2QDIA 3I5IB 3NGVA 2HQWA 3UNWA 2EHBA 3WHTB 3L4AA 4M2QA 1B8RA 2M97A 2FJYA 2KNEA 3O6BA 1S36A 3I5HC 1QLSA 4DRWA 3GK1A 1AK8A 1G33A 1OSAA 5HKZA 1XFVO 2JQ6A 2B1UA 4OKHA 1OOFA 1JFKA 1MWNA 2F3ZA 1UHNA 5AEQA 1CFPA 1C7WA 1ZACA 2K0JA 2JXLA 1JUOA 1S6IA 1U5IA 1IRJA 3K1EA 4GUKA 2H2KA 1OOIX 4R1EA 4U8DA 5I2QA 3KEVA 3NSIA 1E8AA 2P6BB 3N7HA 2Y4QA 3D75A 3AKBA 3JTDC 5G08A 1OZSA 2LMUA 2ZNEA 3UO9A 1IH0A 1B7TZ 3JVTB 2F2OA 4CPVA 3NSKA 5D3OA 2KYFA 2NZ0A 2PALA 3BFAA 3BUXB 3BYAA 3OB2B 2M7LA 2Y5IA 5HLOA 4MZJA 2L98A 1DJHA 2TN4A 1OW4A 1S1EA 5CPVA 1FPWA 1YUTA 1UUSA 1SL8A 1PSBA 2FCEA 2O5GA 3O4YA 4NQGA 3DD4A 1M45A 2R2IA 3RZSA 4N1GA 3IQOA 2WORA 1KK7Z 1QS7A 1F71A 1SRAA 3DVJA 1IIOA 2E30A 1QWVA 1NCYA 3B6XA 2JWWA 3BUNB 1K9PA 1A75B 4FTGA 4E68A 2EC6C 1B8CA 1G4YR 1UURA 1IWQA 1OOHA 3EK7A 1OOGA 5HLVA 2BE4A 5JJGA 4PE0A 1NIWA 2FCDA 3EVUA 2LP2A 2I18A 4C0JA 1Y0VH 2MLFC 1ZUZA 1BF5A 1RK9A 2KI4C 4UPGA 2KHNA 2BNXA 2WCEA 2JC2A 5I2LA 1J7PA 4MLWA 1TN4A 1KCYA 4P5OE 1YX7A 2KAXA 1IG5A 2BAPA 1F70A 3NSOA 2KSPA 3L4LA 3EG5B 4JKTA 5K89A 5CSFA 2KOTA 1CLLA 3D77A 3EK8A 1IQ5A 1B47A 3L47A 3Q8IA 3VRQA 5KTYA 2LE9B 4ORBB 3O78A 1A2XA 4MBEA 1QLKA 1QX2A 3FWCA 3PATA 1FF1A 1ALWA 1KSMA 1LKJA 2P70A 3BFBA 2K7DA 3PSRA 2FOTA 3TDUA 2JU0A 1K96A 3JVTC 1OMRA 1TTXA 4CLNA 1RROA 2Y1NA 1M31A 4PALA 3OGNA 1JF0A 2QEVA 3I5HB 2K60A 2JPOA 1PRWA 1PVAA 1XFWO 2JTTA 3ICBA 1XVJA 3IF7A 2LV7A 5FI6A 1QIVA 1DGVA 3WXAA 1R2UA 1SCMB 2KPHA 4YGEB 2MBXA 1EH2A 2NCOA 2LUCA 5DKQA 2M8UA 2LVKA 2I94A 1X02A 1QX5B 1YRUB 1M39A 2COLB 2OTGB 1NCZA 3DY9A 4GFTA 5AXIA 3B86A 2JTZA 1GJYA 2SCPA 4C0KA 1P28A 1K94A 2WNDA 3B88A 3KHEA 3OB1B 4YBHB 4AOMA 3I5GB 2NCPA 3BUMB 1PULA 1DJYA 2L50A 2WC6A 3O4XA 3PLFB 3ZNIA 4PDZA 3HX4A 1QATA 2L5YA 2VRGA 2ZKMX 2JPTA 1FW4A 3S0EA 2M1KB 3OX6A 3I5IC 2MA2A 4HSZA 5DKRA 2JT0A 4NDBA 4AQIA 1CMFA 2PRUA 3AAKA 3CZ2A 2M1UA 1Y6WA 1QVIZ 2K7CA 1G8IA 2NLNA 4MVFA 5AANA 1UWOA 2HETA 2M0RA 1KK8B 3VGOA 2K7OA 4P2YB 1C3ZA 3WNXB 1CDNA 1WDCC 3NXAA 1LS8A 1SY9A 1YTZC 1MQ1A 3I5FB 2OS8C 2YGUA 4JWQA 4YGCB 1WRZA 1L2OB 1DQEA 2Q4UA 1BR4B 5ER4X 1C7VA 1JBAA 1S5GY 1YR5A 2KYCA 1A29A 1TCFA 3D73A 3NHTA 5CSJA 2ZN8A 1J1EA 3DXLA 2H61A 4PHJA 3DZTA 4GBAA 1BOCA 1DJXA 2I7AA 4YGBB 4OR9B 3D10A 4I5LB 1GGZA 1F54A 3I5GC 3NHIA 1YX8A 1KWOC 1Y1XA 5AERA 1JFJA 1KSOA 2LMVA 1DT7B 1H4BA 1B8LA 4MEWA 4PHKA 2LLTA 1W7JB 3KPXA 2MHHA 5CSNA 5HKWA 1LXFC 1L7ZA 2M3WA 3IVTA 1CFDA 4BY5A 4PHNA 3CYZA 2LUXA 1UHJA 3TS5C 2KBIA 3QRXA 1FI5A 1DJIA 2LNKA 2L51A 1YURA 1NCXA 1OMVA 4OCIA 4A4CA 3C1VA 1D1OA 2AMIA 2KFFA 2PYQA 3FE9A 1XK4A 4TNCA 4ICBA 3LCPC 1Y1AA 2QEHA 4XYNA 4WRIA 5I8NA 2BL0C 4OZDA 3V2LA 2LLUA 5FI7A 1AJ4A 3DVEA 2K7BA 1A75A 3BJHA 1MR8A 2BL0B 1EG4A 2KDHA 3SG6A 1NX3A 5F6TA 3OP0A 3D76A 4N1FA 4N5XA 2MLEC 2BBMA 2M7NA 3SS5A 5DKNA 2KBMA 1S3PA 1A03A 4F7FA 2WCKA 4INWA 2PASA 1OZOA 2QACA 2BBNA 1CTRA 3OX5A 1DJWA 3TS5B 3BFHA 5EL2A 4GPLB 4WQ3A 1F55A 1RTP1 1UHKA 5JOLA 4GGFC 1EG3A 1WLMA 1KQVA 2ZN9A 3BUOB 5DICA 2PVBA 1QV1A 3SS3A 1SK6D 2L4HA 1VRKA 4IL1A 1F4QA 1SKTA 1T14A 2L4IA 3CR5X 1F8HA 1LA3A 1CM1A 1H8BA 2K8MB 3CS1A 2LHLA 1BMOA 1RFJA 2L0PA 1HT9A 3CZ0A 3PM2A 3EVVA 2L2CA 2EC6B 2LANA 1MUXA 3NSLA 1AP4A 1SR6B 3DVMA 1DMOA 1OMDA 1K9UA 3F45A 2BECA 1SW8A 1FBVA 1AUIB 2HPSA 4Q04A 2F3YA 1SCVA 2WOSA 3CR2A 3D74A 3E3RA 4OVNF 3RM1A 1CM4A 2G2BA 4F0ZB 3I5FC 3B7AA 3FWBA 2CTNA 5ER5A 3VRPA 1BU3A 2JULA 1W7IB 2GTEA 4JPZB 4MRYA 4DIRA 5HYDA 2PMYA 1DTLA 3FE8A 4GGNA 4CFRA 3BUWB 2JNFA 1BODA 3TZ1A 1Z2CB 2JT3A 1RJVA 3CDNA 1XFZO 4JD9A 1YVLA 2LVVA 2BCXA 1TCOB 2CBLA 1K90D 2V53A 2K2AA 3R72A 4HRGA 1QIWA 4MSPA 2NXQA 2RGIA 4JQ0D 4PE4A 2OS8B 5I94A 1JSAA 4AQJA 1QASA 1Y1UA 1UP5A 1TNXA 2DOQA 4BY4A 2HQ8A 5KSZA 1BG1A 2OTGC 3D0YB 1PK0D 1XK4C 3A4UB 4L9MA 1M46A 1SPYA 4PHMA 4PT1A 2OPOA 3TUYB 5KU1A 1B1GA 5BPJA 1EXRA 1CFCA 3LL8B 2WC8A 2P71A 2E6WA 1DVIA 2CT9A 1L2OC 1Z4HA 1S6JA 1YUUA 2L2EA 1KQMB 1YVHA 1OE9B 1XO5A 1QVIY 2F2PA 3M0WA 3ZWHA 1KK8C 5TNCA 2Q91A 1J7QA 2F8PA 1MXLC 3SJSA 3FE6A 1V1GA 4MZKA 2KAVA 4NDDA 4YI8A 1AHRA 4PCWA 2M49B 4ORAB 3CZTX 4INXA 3BOWB 1V1FA 3CR4X 1CNPA 2QEOA 4D1EA 4M2PA 2KAYA 3SG2A 2H61C 4PE1A 2KFGA 2D8NA 2JT8A 3DF0A 4MRXA 1PALA 2O60A 5FI2A 4CIDA 3FIAA 4ETOA 4WQ2A 4OV2A 5PALA
chains in the Genus database with same CATH topology
3TUYC 1K2HA 1QTXA 2ZFDA 1CDPA 1XFYO 2G9BA 1IGVA 1SL9A 3TDIA 2GV5A 1ZMZA 1J1DA 3JTDB 2BE6A 2BCBA 3AKAA 5D7FA 4I5JA 3SIBA 3SG4A 3GK4X 2LC5A 2KI4B 1NYAA 3PM8A 1KFUL 1LVCD 4YI9A 1JF2A 1NX0A 1GGWA 2BKIB 3KF9A 2A4JA 1QV0A 1DF0B 1UHHA 1WY9A 3DVKA 1ZOTB 2MJWB 4FQOA 1QJTA 1KFUS 2LM5A 1ALVA 1TNWA 4USLA 1PVBA 2M9GA 1NX1A 1IKUA 1B4CA 1M63B 1YRTB 3WHUB 1TIZA 2FJUB 2LHIA 1HQVA 1N65A 2AUCA 2GGMA 1AVSA 2ZRTA 3BOWA 4ORCB 3IQQA 2JXCA 4A4BA 1R6PA 3EVRA 2KI6D 1CFFA 3VRRA 4QJ4B 3D0YA 3LK1A 1WRKA 3TDZA 3KO0A 3PALA 1N0YA 3CGAA 3GOFA 1SYMA 4DCKA 1J55A 4XJKA 2ZRSA 2K61A 1CLMA 4I5NB 1ODBA 2SASA 1SR6C 1NWDA 1MF8B 1CMGA 3EKHA 1NP8A 1GQMA 1MXEA 1AJ5A 1NPQA 2CCMA 1NUBA 1K93D 2HF5A 2KQ6A 3CLNA 3SG7A 1SMGA 1DF0A 1N2DA 1SL7A 2LVIA 1EL4A 1NX2A 3BQ3A 4CFQA 2LAPA 2QPTA 1J7OA 1SNLA 1LINA 2L5XB 1TNPA 3SIAA 3O2PA 3EKJA 1KK7Y 3DF0B 2JZIA 4YGDB 3MSEB 1CDLA 1SBJA 1JC2A 1QXPA 1UHIA 2IS9A 1TOPA 1CB1A 2KI6C 5AFPA 1WDCB 1IJ6A 1XFXO 1DJZA 1LA0A 1CKKA 1BR1B 1B9AA 1IJ5A 2PSRA 1FI6A 3FS7A 1SCMC 1XA5A 5IBWA 2ISDA 1CDMA 2LCPA 1OQPA 4XJKB 2M29A 1J7RA 3SG5A 2BKHB 2CXJA 4MZLA 4DS7A 2JRFA 1DJGA 1WLZA 2GGZA 4M2OA 1JWDA 3EK4A 1S5GZ 2I2RE 4ZCVA 3A8RA 4NDCA 5D69A 2LMTA 1S6CA 1TNQA 2JOJA 4HRHA 2EGDA 1DGUA 3CWGA 2WCBA 2MRDA 1XYDA 1RECA 1ZFSA 1CLBA 4GAOA 1TRFA 4C0LA 5I2OA 5FYXA 5CSIA 3GK2A 5GQQC 3VROA 4PE7A 3RLZA 1XFUO 2F33A 4YRUA 5HKYA 1Q80A 3PFVA 4QJ5B 1OOJA 3SG3A 3HCMA 1NSHA 2BCAA 2KGBC 1C07A 3H4SE 1A4PA 2MAZA 3VRNA 1YUSA 4GNKB 1KQMC 1K9KA 2KFHA 3OHMB 2KGRA 2Y1MA 1KFXL 3BXKA 4I5KA 5KTYA 2WCFA 1K95A 1MHOA 4QJ3B 3PN7B 4ZCUA 3CTNA 1K8UA 5J3XA 2LP3A 1U5IB 1PSRA 2KQYA 3PN7C 4DUQA 2CNPA 4MN0A 1BJFA 1KFXS 2LVJA 4GGFA 1RWYA 3LK0A 1EJ3A 1BLQA 4YGAA 2LLSA 1IQ3A 4HREE 2K2FA 5B8IB 3LLEA 1WRLA 1KWOB 1B7TY 1QX7A 2AAOA 2ZNDA 3AAJA 1F4OA 1BT6A 3K21A 1S26D 2JNXA 3I5IB 2HQWA 2EHBA 3WHTB 4M2QA 1B8RA 2M97A 2KNEA 3O6BA 4DRWA 1S36A 3I5HC 1QLSA 3GK1A 1AK8A 1G33A 1OSAA 5HKZA 1XFVO 2JQ6A 2B1UA 4OKHA 1JFKA 1MWNA 2F3ZA 1UHNA 5AEQA 1CFPA 1C7WA 1ZACA 2K0JA 2JXLA 1JUOA 1S6IA 1U5IA 1IRJA 4GUKA 2H2KA 4R1EA 4U8DA 5I2QA 3KEVA 3NSIA 1E8AA 2P6BB 2Y4QA 3AKBA 3JTDC 5G08A 1OZSA 2LMUA 2ZNEA 1IH0A 1B7TZ 3JVTB 2F2OA 4CPVA 3NSKA 2KYFA 2NZ0A 2PALA 3BUXB 3BYAA 3OB2B 2M7LA 2Y5IA 5HLOA 4MZJA 2L98A 1DJHA 2TN4A 1S1EA 5CPVA 1FPWA 1YUTA 1UUSA 1SL8A 1PSBA 2FCEA 2O5GA 3O4YA 4NQGA 3DD4A 1M45A 2R2IA 4N1GA 3IQOA 2WORA 1KK7Z 1QS7A 1F71A 1SRAA 3DVJA 2E30A 1NCYA 2JWWA 3BUNB 1K9PA 1A75B 4FTGA 4E68A 2EC6C 1B8CA 1G4YR 1UURA 1IWQA 5HLVA 3EK7A 5JJGA 2BE4A 4PE0A 1NIWA 2FCDA 3EVUA 2LP2A 2I18A 4C0JA 1Y0VH 2MLFC 1ZUZA 1BF5A 1RK9A 2KI4C 4UPGA 2KHNA 2WCEA 2JC2A 5I2LA 1J7PA 4MLWA 1TN4A 1KCYA 4P5OE 1YX7A 2KAXA 1IG5A 1F70A 3NSOA 2KSPA 5K89A 5CSFA 2KOTA 1CLLA 3EK8A 1IQ5A 1B47A 3VRQA 2LE9B 4ORBB 3O78A 1A2XA 4MBEA 1QLKA 1QX2A 3FWCA 3PATA 1FF1A 1ALWA 1KSMA 1LKJA 2K7DA 3PSRA 2FOTA 3TDUA 2JU0A 1K96A 3JVTC 1OMRA 1TTXA 4CLNA 1RROA 2Y1NA 1M31A 4PALA 1JF0A 3I5HB 1PRWA 1PVAA 1XFWO 2JTTA 3ICBA 1XVJA 3IF7A 2LV7A 1QIVA 1DGVA 3WXAA 1R2UA 1SCMB 2MBXA 4YGEB 1EH2A 2NCOA 2LUCA 5DKQA 2M8UA 2LVKA 2I94A 1X02A 1QX5B 1YRUB 1M39A 2COLB 2OTGB 1NCZA 4GFTA 5AXIA 2JTZA 1GJYA 2SCPA 4C0KA 1K94A 2WNDA 3KHEA 3OB1B 4YBHB 4AOMA 3I5GB 2NCPA 3BUMB 1PULA 1DJYA 2L50A 3PLFB 3ZNIA 4PDZA 3HX4A 1QATA 2VRGA 2ZKMX 2JPTA 1FW4A 2M1KB 3OX6A 3I5IC 2MA2A 4HSZA 5DKRA 2JT0A 4NDBA 4AQIA 1CMFA 2PRUA 3AAKA 2M1UA 1Y6WA 1QVIZ 2K7CA 1G8IA 2NLNA 4MVFA 5AANA 1UWOA 2HETA 2M0RA 1KK8B 3VGOA 2K7OA 4P2YB 3WNXB 1CDNA 1WDCC 3NXAA 1SY9A 1YTZC 1MQ1A 3I5FB 2OS8C 4JWQA 4YGCB 1WRZA 1L2OB 2Q4UA 1BR4B 5ER4X 1C7VA 1JBAA 1S5GY 1YR5A 2KYCA 1A29A 1TCFA 1H4BA 5CSJA 2ZN8A 1J1EA 2H61A 4PHJA 1BOCA 4GBAA 1DJXA 2I7AA 4YGBB 4OR9B 3D10A 4I5LB 1GGZA 1F54A 3I5GC 1YX8A 1KWOC 1Y1XA 5AERA 1JFJA 1KSOA 2LMVA 1DT7B 1B8LA 4MEWA 4PHKA 2LLTA 1W7JB 3KPXA 2MHHA 5CSNA 5HKWA 1LXFC 1L7ZA 2M3WA 1CFDA 4BY5A 4PHNA 2LUXA 1UHJA 3TS5C 2KBIA 3QRXA 1FI5A 1DJIA 2LNKA 2L51A 1YURA 1NCXA 1OMVA 4OCIA 4A4CA 3C1VA 1D1OA 2AMIA 2KFFA 1XK4A 4TNCA 4ICBA 3LCPC 1Y1AA 4XYNA 4WRIA 5I8NA 2BL0C 2LLUA 1AJ4A 3DVEA 2K7BA 1A75A 1MR8A 2BL0B 1EG4A 2KDHA 3SG6A 1NX3A 5F6TA 3OP0A 4N1FA 4N5XA 2MLEC 2BBMA 2M7NA 5DKNA 2KBMA 1S3PA 1A03A 2PASA 1OZOA 2QACA 2BBNA 1CTRA 3OX5A 1DJWA 3TS5B 1F55A 4GPLB 4WQ3A 1RTP1 1UHKA 5JOLA 4GGFC 1EG3A 1WLMA 1KQVA 2ZN9A 3BUOB 2PVBA 1QV1A 1SK6D 2L4HA 1VRKA 4IL1A 1F4QA 1SKTA 2L4IA 3CR5X 1F8HA 1LA3A 1CM1A 1H8BA 2K8MB 3CS1A 2LHLA 1BMOA 1RFJA 2L0PA 1HT9A 3EVVA 2LANA 2EC6B 1MUXA 3NSLA 1AP4A 1SR6B 3DVMA 1DMOA 1OMDA 1K9UA 3F45A 2BECA 1SW8A 1FBVA 1AUIB 2HPSA 4Q04A 2F3YA 1SCVA 2WOSA 3CR2A 3E3RA 4OVNF 3RM1A 2G2BA 1CM4A 4F0ZB 3I5FC 3FWBA 2CTNA 5ER5A 3VRPA 1BU3A 2JULA 1W7IB 4JPZB 4MRYA 4DIRA 5HYDA 2PMYA 1DTLA 4GGNA 4CFRA 3BUWB 2JNFA 1BODA 3TZ1A 2JT3A 1RJVA 1XFZO 1YVLA 2LVVA 2BCXA 1TCOB 2CBLA 1K90D 2V53A 2K2AA 4HRGA 4MSPA 1QIWA 2NXQA 2RGIA 4JQ0D 4PE4A 2OS8B 1JSAA 4AQJA 1QASA 1Y1UA 1UP5A 1TNXA 2DOQA 4BY4A 2HQ8A 5KSZA 1BG1A 2OTGC 3D0YB 1PK0D 1XK4C 3A4UB 4L9MA 1M46A 1SPYA 4PHMA 3TUYB 2OPOA 5KU1A 1B1GA 5BPJA 1EXRA 1CFCA 3LL8B 2WC8A 2E6WA 1DVIA 2CT9A 1L2OC 1S6JA 1YUUA 2L2EA 1KQMB 1YVHA 1OE9B 1XO5A 1QVIY 2F2PA 3M0WA 3ZWHA 1KK8C 5TNCA 2Q91A 1J7QA 2F8PA 1MXLC 3SJSA 1V1GA 4MZKA 2KAVA 4NDDA 4YI8A 1AHRA 4PCWA 2M49B 4ORAB 3CZTX 3BOWB 1V1FA 3CR4X 1CNPA 4D1EA 4M2PA 2KAYA 3SG2A 2H61C 4PE1A 2KFGA 2D8NA 2JT8A 3DF0A 4MRXA 1PALA 2O60A 4CIDA 4ETOA 3FIAA 4WQ2A 4OV2A 5PALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUY C;  1K2H A;  1QTX A;  2ZFD A;  1CDP A;  1XFY O;  2G9B A;  1IGV A;  1SL9 A;  3TDI A;  2GV5 A;  1ZMZ A;  1J1D A;  3JTD B;  2BE6 A;  2BCB A;  3AKA A;  5D7F A;  4I5J A;  3SIB A;  3SG4 A;  3GK4 X;  2LC5 A;  2KI4 B;  1NYA A;  3PM8 A;  1KFU L;  1LVC D;  4YI9 A;  1JF2 A;  1NX0 A;  1GGW A;  2BKI B;  3KF9 A;  2A4J A;  1QV0 A;  1DF0 B;  1UHH A;  1WY9 A;  3DVK A;  1ZOT B;  2MJW B;  4FQO A;  1QJT A;  1KFU S;  2LM5 A;  1ALV A;  1TNW A;  4USL A;  1PVB A;  2M9G A;  1NX1 A;  1IKU A;  1B4C A;  1M63 B;  1YRT B;  3WHU B;  1TIZ A;  2FJU B;  2LHI A;  1HQV A;  1N65 A;  2AUC A;  2GGM A;  1AVS A;  2ZRT A;  3BOW A;  4ORC B;  3IQQ A;  2JXC A;  4A4B A;  1R6P A;  3EVR A;  2KI6 D;  1CFF A;  3VRR A;  4QJ4 B;  3D0Y A;  3LK1 A;  1WRK A;  3TDZ A;  3KO0 A;  3PAL A;  1N0Y A;  3CGA A;  3GOF A;  1SYM A;  4DCK A;  1J55 A;  4XJK A;  2ZRS A;  2K61 A;  1CLM A;  4I5N B;  1ODB A;  2SAS A;  1SR6 C;  1NWD A;  1MF8 B;  1CMG A;  3EKH A;  1NP8 A;  1GQM A;  1MXE A;  1AJ5 A;  1NPQ A;  2CCM A;  1NUB A;  1K93 D;  2HF5 A;  2KQ6 A;  3CLN A;  3SG7 A;  1SMG A;  1DF0 A;  1N2D A;  1SL7 A;  2LVI A;  1EL4 A;  1NX2 A;  3BQ3 A;  4CFQ A;  2LAP A;  2QPT A;  1J7O A;  1SNL A;  1LIN A;  2L5X B;  1TNP A;  3SIA A;  3O2P A;  3EKJ A;  1KK7 Y;  3DF0 B;  2JZI A;  4YGD B;  3MSE B;  1CDL A;  1SBJ A;  1JC2 A;  1QXP A;  1UHI A;  2IS9 A;  1TOP A;  1CB1 A;  2KI6 C;  5AFP A;  1WDC B;  1IJ6 A;  1XFX O;  1DJZ A;  1LA0 A;  1CKK A;  1BR1 B;  1B9A A;  1IJ5 A;  2PSR A;  1FI6 A;  3FS7 A;  1SCM C;  1XA5 A;  5IBW A;  2ISD A;  1CDM A;  2LCP A;  1OQP A;  4XJK B;  2M29 A;  1J7R A;  3SG5 A;  2BKH B;  2CXJ A;  4MZL A;  4DS7 A;  2JRF A;  1DJG A;  1WLZ A;  2GGZ A;  4M2O A;  1JWD A;  3EK4 A;  1S5G Z;  2I2R E;  4ZCV A;  3A8R A;  4NDC A;  5D69 A;  2LMT A;  1S6C A;  1TNQ A;  2JOJ A;  4HRH A;  2EGD A;  1DGU A;  3CWG A;  2WCB A;  2MRD A;  1XYD A;  1REC A;  1ZFS A;  1CLB A;  4GAO A;  1TRF A;  4C0L A;  5I2O A;  5FYX A;  5CSI A;  3GK2 A;  5GQQ C;  3VRO A;  4PE7 A;  3RLZ A;  1XFU O;  2F33 A;  4YRU A;  5HKY A;  1Q80 A;  3PFV A;  4QJ5 B;  1OOJ A;  3SG3 A;  3HCM A;  1NSH A;  2BCA A;  2KGB C;  1C07 A;  3H4S E;  1A4P A;  2MAZ A;  3VRN A;  1YUS A;  4GNK B;  1KQM C;  1K9K A;  2KFH A;  3OHM B;  2KGR A;  2Y1M A;  1KFX L;  3BXK A;  4I5K A;  5KTY A;  2WCF A;  1K95 A;  1MHO A;  4QJ3 B;  3PN7 B;  4ZCU A;  3CTN A;  1K8U A;  5J3X A;  2LP3 A;  1U5I B;  1PSR A;  2KQY A;  3PN7 C;  4DUQ A;  2CNP A;  4MN0 A;  1BJF A;  1KFX S;  2LVJ A;  4GGF A;  1RWY A;  3LK0 A;  1EJ3 A;  1BLQ A;  4YGA A;  2LLS A;  1IQ3 A;  4HRE E;  2K2F A;  5B8I B;  3LLE A;  1WRL A;  1KWO B;  1B7T Y;  1QX7 A;  2AAO A;  2ZND A;  3AAJ A;  1F4O A;  1BT6 A;  3K21 A;  1S26 D;  2JNX A;  3I5I B;  2HQW A;  2EHB A;  3WHT B;  4M2Q A;  1B8R A;  2M97 A;  2KNE A;  3O6B A;  4DRW A;  1S36 A;  3I5H C;  1QLS A;  3GK1 A;  1AK8 A;  1G33 A;  1OSA A;  5HKZ A;  1XFV O;  2JQ6 A;  2B1U A;  4OKH A;  1JFK A;  1MWN A;  2F3Z A;  1UHN A;  5AEQ A;  1CFP A;  1C7W A;  1ZAC A;  2K0J A;  2JXL A;  1JUO A;  1S6I A;  1U5I A;  1IRJ A;  4GUK A;  2H2K A;  4R1E A;  4U8D A;  5I2Q A;  3KEV A;  3NSI A;  1E8A A;  2P6B B;  2Y4Q A;  3AKB A;  3JTD C;  5G08 A;  1OZS A;  2LMU A;  2ZNE A;  1IH0 A;  1B7T Z;  3JVT B;  2F2O A;  4CPV A;  3NSK A;  2KYF A;  2NZ0 A;  2PAL A;  3BUX B;  3BYA A;  3OB2 B;  2M7L A;  2Y5I A;  5HLO A;  4MZJ A;  2L98 A;  1DJH A;  2TN4 A;  1S1E A;  5CPV A;  1FPW A;  1YUT A;  1UUS A;  1SL8 A;  1PSB A;  2FCE A;  2O5G A;  3O4Y A;  4NQG A;  3DD4 A;  1M45 A;  2R2I A;  4N1G A;  3IQO A;  2WOR A;  1KK7 Z;  1QS7 A;  1F71 A;  1SRA A;  3DVJ A;  2E30 A;  1NCY A;  2JWW A;  3BUN B;  1K9P A;  1A75 B;  4FTG A;  4E68 A;  2EC6 C;  1B8C A;  1G4Y R;  1UUR A;  1IWQ A;  5HLV A;  3EK7 A;  5JJG A;  2BE4 A;  4PE0 A;  1NIW A;  2FCD A;  3EVU A;  2LP2 A;  2I18 A;  4C0J A;  1Y0V H;  2MLF C;  1ZUZ A;  1BF5 A;  1RK9 A;  2KI4 C;  4UPG A;  2KHN A;  2WCE A;  2JC2 A;  5I2L A;  1J7P A;  4MLW A;  1TN4 A;  1KCY A;  4P5O E;  1YX7 A;  2KAX A;  1IG5 A;  1F70 A;  3NSO A;  2KSP A;  5K89 A;  5CSF A;  2KOT A;  1CLL A;  3EK8 A;  1IQ5 A;  1B47 A;  3VRQ A;  2LE9 B;  4ORB B;  3O78 A;  1A2X A;  4MBE A;  1QLK A;  1QX2 A;  3FWC A;  3PAT A;  1FF1 A;  1ALW A;  1KSM A;  1LKJ A;  2K7D A;  3PSR A;  2FOT A;  3TDU A;  2JU0 A;  1K96 A;  3JVT C;  1OMR A;  1TTX A;  4CLN A;  1RRO A;  2Y1N A;  1M31 A;  4PAL A;  1JF0 A;  3I5H B;  1PRW A;  1PVA A;  1XFW O;  2JTT A;  3ICB A;  1XVJ A;  3IF7 A;  2LV7 A;  1QIV A;  1DGV A;  3WXA A;  1R2U A;  1SCM B;  2MBX A;  4YGE B;  1EH2 A;  2NCO A;  2LUC A;  5DKQ A;  2M8U A;  2LVK A;  2I94 A;  1X02 A;  1QX5 B;  1YRU B;  1M39 A;  2COL B;  2OTG B;  1NCZ A;  4GFT A;  5AXI A;  2JTZ A;  1GJY A;  2SCP A;  4C0K A;  1K94 A;  2WND A;  3KHE A;  3OB1 B;  4YBH B;  4AOM A;  3I5G B;  2NCP A;  3BUM B;  1PUL A;  1DJY A;  2L50 A;  3PLF B;  3ZNI A;  4PDZ A;  3HX4 A;  1QAT A;  2VRG A;  2ZKM X;  2JPT A;  1FW4 A;  2M1K B;  3OX6 A;  3I5I C;  2MA2 A;  4HSZ A;  5DKR A;  2JT0 A;  4NDB A;  4AQI A;  1CMF A;  2PRU A;  3AAK A;  2M1U A;  1Y6W A;  1QVI Z;  2K7C A;  1G8I A;  2NLN A;  4MVF A;  5AAN A;  1UWO A;  2HET A;  2M0R A;  1KK8 B;  3VGO A;  2K7O A;  4P2Y B;  3WNX B;  1CDN A;  1WDC C;  3NXA A;  1SY9 A;  1YTZ C;  1MQ1 A;  3I5F B;  2OS8 C;  4JWQ A;  4YGC B;  1WRZ A;  1L2O B;  2Q4U A;  1BR4 B;  5ER4 X;  1C7V A;  1JBA A;  1S5G Y;  1YR5 A;  2KYC A;  1A29 A;  1TCF A;  1H4B A;  5CSJ A;  2ZN8 A;  1J1E A;  2H61 A;  4PHJ A;  1BOC A;  4GBA A;  1DJX A;  2I7A A;  4YGB B;  4OR9 B;  3D10 A;  4I5L B;  1GGZ A;  1F54 A;  3I5G C;  1YX8 A;  1KWO C;  1Y1X A;  5AER A;  1JFJ A;  1KSO A;  2LMV A;  1DT7 B;  1B8L A;  4MEW A;  4PHK A;  2LLT A;  1W7J B;  3KPX A;  2MHH A;  5CSN A;  5HKW A;  1LXF C;  1L7Z A;  2M3W A;  1CFD A;  4BY5 A;  4PHN A;  2LUX A;  1UHJ A;  3TS5 C;  2KBI A;  3QRX A;  1FI5 A;  1DJI A;  2LNK A;  2L51 A;  1YUR A;  1NCX A;  1OMV A;  4OCI A;  4A4C A;  3C1V A;  1D1O A;  2AMI A;  2KFF A;  1XK4 A;  4TNC A;  4ICB A;  3LCP C;  1Y1A A;  4XYN A;  4WRI A;  5I8N A;  2BL0 C;  2LLU A;  1AJ4 A;  3DVE A;  2K7B A;  1A75 A;  1MR8 A;  2BL0 B;  1EG4 A;  2KDH A;  3SG6 A;  1NX3 A;  5F6T A;  3OP0 A;  4N1F A;  4N5X A;  2MLE C;  2BBM A;  2M7N A;  5DKN A;  2KBM A;  1S3P A;  1A03 A;  2PAS A;  1OZO A;  2QAC A;  2BBN A;  1CTR A;  3OX5 A;  1DJW A;  3TS5 B;  1F55 A;  4GPL B;  4WQ3 A;  1RTP 1;  1UHK A;  5JOL A;  4GGF C;  1EG3 A;  1WLM A;  1KQV A;  2ZN9 A;  3BUO B;  2PVB A;  1QV1 A;  1SK6 D;  2L4H A;  1VRK A;  4IL1 A;  1F4Q A;  1SKT A;  2L4I A;  3CR5 X;  1F8H A;  1LA3 A;  1CM1 A;  1H8B A;  2K8M B;  3CS1 A;  2LHL A;  1BMO A;  1RFJ A;  2L0P A;  1HT9 A;  3EVV A;  2LAN A;  2EC6 B;  1MUX A;  3NSL A;  1AP4 A;  1SR6 B;  3DVM A;  1DMO A;  1OMD A;  1K9U A;  3F45 A;  2BEC A;  1SW8 A;  1FBV A;  1AUI B;  2HPS A;  4Q04 A;  2F3Y A;  1SCV A;  2WOS A;  3CR2 A;  3E3R A;  4OVN F;  3RM1 A;  2G2B A;  1CM4 A;  4F0Z B;  3I5F C;  3FWB A;  2CTN A;  5ER5 A;  3VRP A;  1BU3 A;  2JUL A;  1W7I B;  4JPZ B;  4MRY A;  4DIR A;  5HYD A;  2PMY A;  1DTL A;  4GGN A;  4CFR A;  3BUW B;  2JNF A;  1BOD A;  3TZ1 A;  2JT3 A;  1RJV A;  1XFZ O;  1YVL A;  2LVV A;  2BCX A;  1TCO B;  2CBL A;  1K90 D;  2V53 A;  2K2A A;  4HRG A;  4MSP A;  1QIW A;  2NXQ A;  2RGI A;  4JQ0 D;  4PE4 A;  2OS8 B;  1JSA A;  4AQJ A;  1QAS A;  1Y1U A;  1UP5 A;  1TNX A;  2DOQ A;  4BY4 A;  2HQ8 A;  5KSZ A;  1BG1 A;  2OTG C;  3D0Y B;  1PK0 D;  1XK4 C;  3A4U B;  4L9M A;  1M46 A;  1SPY A;  4PHM A;  3TUY B;  2OPO A;  5KU1 A;  1B1G A;  5BPJ A;  1EXR A;  1CFC A;  3LL8 B;  2WC8 A;  2E6W A;  1DVI A;  2CT9 A;  1L2O C;  1S6J A;  1YUU A;  2L2E A;  1KQM B;  1YVH A;  1OE9 B;  1XO5 A;  1QVI Y;  2F2P A;  3M0W A;  3ZWH A;  1KK8 C;  5TNC A;  2Q91 A;  1J7Q A;  2F8P A;  1MXL C;  3SJS A;  1V1G A;  4MZK A;  2KAV A;  4NDD A;  4YI8 A;  1AHR A;  4PCW A;  2M49 B;  4ORA B;  3CZT X;  3BOW B;  1V1F A;  3CR4 X;  1CNP A;  4D1E A;  4M2P A;  2KAY A;  3SG2 A;  2H61 C;  4PE1 A;  2KFG A;  2D8N A;  2JT8 A;  3DF0 A;  4MRX A;  1PAL A;  2O60 A;  4CID A;  4ETO A;  3FIA A;  4WQ2 A;  4OV2 A;  5PAL A; 
#chains in the Genus database with same CATH topology
 3TUY C;  1K2H A;  1QTX A;  2KLD A;  2ZFD A;  1CDP A;  1XFY O;  2G9B A;  1IGV A;  1SL9 A;  3TDI A;  2GV5 A;  1ZMZ A;  1J1D A;  3JTD B;  2BE6 A;  2BCB A;  3AKA A;  5D7F A;  4I5J A;  3VB1 A;  3SIB A;  3SG4 A;  3GK4 X;  4FQT A;  2LC5 A;  2KI4 B;  1NYA A;  3PM8 A;  1KFU L;  1GM0 A;  1LVC D;  4YI9 A;  3S0F A;  3S0G A;  1JF2 A;  1NX0 A;  1GGW A;  2BKI B;  3D78 A;  3KF9 A;  2A4J A;  3CZ1 A;  2WCL A;  1QV0 A;  1DF0 B;  1UHH A;  2ERB A;  1WY9 A;  3DVK A;  1ZOT B;  2MJW B;  4FQO A;  1QJT A;  1KFU S;  2LM5 A;  3S0B A;  1ALV A;  1SSE B;  3DYE A;  1TNW A;  4USL A;  1PVB A;  2M9G A;  1NX1 A;  3CAB A;  1IKU A;  1B4C A;  1M63 B;  1YRT B;  3WHU B;  1TIZ A;  2FJU B;  2LHI A;  1HQV A;  4KYN A;  1N65 A;  2AUC A;  2GGM A;  1AVS A;  2ZRT A;  5HL1 A;  3BOW A;  4ORC B;  3IQQ A;  1DEK A;  2JXC A;  1R6P A;  4A4B A;  3EVR A;  2KI6 D;  1CFF A;  3VRR A;  3S0D A;  4QJ4 B;  3D0Y A;  3LK1 A;  1WRK A;  3TDZ A;  3KO0 A;  3PAL A;  1TUJ A;  1W9Z A;  3PJI A;  1N0Y A;  3CGA A;  3GOF A;  1SYM A;  4DCK A;  1J55 A;  4XJK A;  2ZRS A;  2K61 A;  1CLM A;  4I5N B;  1ODB A;  2SAS A;  1SR6 C;  1NWD A;  1MF8 B;  1CMG A;  1DEL A;  3EKH A;  1NP8 A;  1GQM A;  1MXE A;  1AJ5 A;  1NPQ A;  2CCM A;  1NUB A;  1K93 D;  2HF5 A;  2KQ6 A;  3CLN A;  3SG7 A;  1SMG A;  1DF0 A;  1N2D A;  1SL7 A;  2LVI A;  1EL4 A;  1NX2 A;  3BQ3 A;  1DC1 A;  4CFQ A;  2LAP A;  1TWO A;  2QPT A;  1J7O A;  1SNL A;  1LIN A;  2L5X B;  1TNP A;  3SIA A;  3O2P A;  3EKJ A;  2WCM A;  4IJ7 A;  1KK7 Y;  3DF0 B;  2JZI A;  4YGD B;  3MSE B;  1CDL A;  1SBJ A;  2H8V A;  1QXP A;  1UHI A;  2IS9 A;  1TOP A;  1CB1 A;  1JC2 A;  2KI6 C;  5AFP A;  1WDC B;  1IJ6 A;  1XFX O;  1DJZ A;  1LA0 A;  1CKK A;  1BR1 B;  1B9A A;  1IJ5 A;  2PSR A;  2WCH A;  1FI6 A;  3FS7 A;  1SCM C;  3R1P A;  1XA5 A;  5IBW A;  2ISD A;  1CDM A;  2LCP A;  1OQP A;  3OBV A;  4XJK B;  2M29 A;  1J7R A;  3SG5 A;  2BKH B;  1TUZ A;  2CXJ A;  3R1V A;  4MZL A;  2JRF A;  4DS7 A;  1DJG A;  1WLZ A;  2GGZ A;  4M2O A;  3B87 A;  1JWD A;  3EK4 A;  3SS4 A;  1S5G Z;  2I2R E;  4ZCV A;  3A8R A;  2QEB A;  4NDC A;  5D69 A;  2LMT A;  1S6C A;  1TNQ A;  2JOJ A;  4HRH A;  2EGD A;  3S0A A;  1DGU A;  3CWG A;  2WCB A;  2MRD A;  1XYD A;  1REC A;  1ZFS A;  1CLB A;  4GAO A;  1TRF A;  4C0L A;  5I2O A;  5FYX A;  5CSI A;  3GK2 A;  5GQQ C;  3VRO A;  4PE7 A;  3RLZ A;  1XFU O;  2F33 A;  4YRU A;  5HKY A;  1Q80 A;  3PFV A;  4QJ5 B;  1OOJ A;  3SG3 A;  3HCM A;  1NSH A;  2BCA A;  2KGB C;  1C07 A;  2KLE A;  3H4S E;  1A4P A;  2MAZ A;  3VRN A;  1YUS A;  4GNK B;  1KQM C;  1K9K A;  2KFH A;  3OHM B;  2KGR A;  2Y1M A;  1KFX L;  2PQL A;  2WC5 A;  3BXK A;  4I5K A;  1C3Y A;  2WCF A;  1K95 A;  1MHO A;  4QJ3 B;  3PN7 B;  4ZCU A;  3CTN A;  1K8U A;  5J3X A;  1XFR A;  2LP3 A;  1U5I B;  3R1O A;  1PSR A;  2KQY A;  3PN7 C;  4DUQ A;  2CNP A;  4MN0 A;  1BJF A;  1KFX S;  2LVJ A;  4GGF A;  1ORG A;  3QME A;  1RWY A;  2WCJ A;  3LK0 A;  1EJ3 A;  1BLQ A;  4YGA A;  2LLS A;  1IQ3 A;  4HRE E;  2K2F A;  5B8I B;  3LLE A;  1WRL A;  1KWO B;  1B7T Y;  1QX7 A;  2AAO A;  2ZND A;  3AAJ A;  1F4O A;  1BT6 A;  3K21 A;  1S26 D;  2JNX A;  2QDI A;  3I5I B;  3NGV A;  2HQW A;  3UNW A;  2EHB A;  3WHT B;  3L4A A;  4M2Q A;  1B8R A;  2M97 A;  2FJY A;  2KNE A;  3O6B A;  1S36 A;  3I5H C;  1QLS A;  4DRW A;  3GK1 A;  1AK8 A;  1G33 A;  1OSA A;  5HKZ A;  1XFV O;  2JQ6 A;  2B1U A;  4OKH A;  1OOF A;  1JFK A;  1MWN A;  2F3Z A;  1UHN A;  5AEQ A;  1CFP A;  1C7W A;  1ZAC A;  2K0J A;  2JXL A;  1JUO A;  1S6I A;  1U5I A;  1IRJ A;  3K1E A;  4GUK A;  2H2K A;  1OOI X;  4R1E A;  4U8D A;  5I2Q A;  3KEV A;  3NSI A;  1E8A A;  2P6B B;  3N7H A;  2Y4Q A;  3D75 A;  3AKB A;  3JTD C;  5G08 A;  1OZS A;  2LMU A;  2ZNE A;  3UO9 A;  1IH0 A;  1B7T Z;  3JVT B;  2F2O A;  4CPV A;  3NSK A;  5D3O A;  2KYF A;  2NZ0 A;  2PAL A;  3BFA A;  3BUX B;  3BYA A;  3OB2 B;  2M7L A;  2Y5I A;  5HLO A;  4MZJ A;  2L98 A;  1DJH A;  2TN4 A;  1OW4 A;  1S1E A;  5CPV A;  1FPW A;  1YUT A;  1UUS A;  1SL8 A;  1PSB A;  2FCE A;  2O5G A;  3O4Y A;  4NQG A;  3DD4 A;  1M45 A;  2R2I A;  3RZS A;  4N1G A;  3IQO A;  2WOR A;  1KK7 Z;  1QS7 A;  1F71 A;  1SRA A;  3DVJ A;  1IIO A;  2E30 A;  1QWV A;  1NCY A;  3B6X A;  2JWW A;  3BUN B;  1K9P A;  1A75 B;  4FTG A;  4E68 A;  2EC6 C;  1B8C A;  1G4Y R;  1UUR A;  1IWQ A;  1OOH A;  3EK7 A;  1OOG A;  5HLV A;  2BE4 A;  5JJG A;  4PE0 A;  1NIW A;  2FCD A;  3EVU A;  2LP2 A;  2I18 A;  4C0J A;  1Y0V H;  2MLF C;  1ZUZ A;  1BF5 A;  1RK9 A;  2KI4 C;  4UPG A;  2KHN A;  2BNX A;  2WCE A;  2JC2 A;  5I2L A;  1J7P A;  4MLW A;  1TN4 A;  1KCY A;  4P5O E;  1YX7 A;  2KAX A;  1IG5 A;  2BAP A;  1F70 A;  3NSO A;  2KSP A;  3L4L A;  3EG5 B;  4JKT A;  5K89 A;  5CSF A;  2KOT A;  1CLL A;  3D77 A;  3EK8 A;  1IQ5 A;  1B47 A;  3L47 A;  3Q8I A;  3VRQ A;  5KTY A;  2LE9 B;  4ORB B;  3O78 A;  1A2X A;  4MBE A;  1QLK A;  1QX2 A;  3FWC A;  3PAT A;  1FF1 A;  1ALW A;  1KSM A;  1LKJ A;  2P70 A;  3BFB A;  2K7D A;  3PSR A;  2FOT A;  3TDU A;  2JU0 A;  1K96 A;  3JVT C;  1OMR A;  1TTX A;  4CLN A;  1RRO A;  2Y1N A;  1M31 A;  4PAL A;  3OGN A;  1JF0 A;  2QEV A;  3I5H B;  2K60 A;  2JPO A;  1PRW A;  1PVA A;  1XFW O;  2JTT A;  3ICB A;  1XVJ A;  3IF7 A;  2LV7 A;  5FI6 A;  1QIV A;  1DGV A;  3WXA A;  1R2U A;  1SCM B;  2KPH A;  4YGE B;  2MBX A;  1EH2 A;  2NCO A;  2LUC A;  5DKQ A;  2M8U A;  2LVK A;  2I94 A;  1X02 A;  1QX5 B;  1YRU B;  1M39 A;  2COL B;  2OTG B;  1NCZ A;  3DY9 A;  4GFT A;  5AXI A;  3B86 A;  2JTZ A;  1GJY A;  2SCP A;  4C0K A;  1P28 A;  1K94 A;  2WND A;  3B88 A;  3KHE A;  3OB1 B;  4YBH B;  4AOM A;  3I5G B;  2NCP A;  3BUM B;  1PUL A;  1DJY A;  2L50 A;  2WC6 A;  3O4X A;  3PLF B;  3ZNI A;  4PDZ A;  3HX4 A;  1QAT A;  2L5Y A;  2VRG A;  2ZKM X;  2JPT A;  1FW4 A;  3S0E A;  2M1K B;  3OX6 A;  3I5I C;  2MA2 A;  4HSZ A;  5DKR A;  2JT0 A;  4NDB A;  4AQI A;  1CMF A;  2PRU A;  3AAK A;  3CZ2 A;  2M1U A;  1Y6W A;  1QVI Z;  2K7C A;  1G8I A;  2NLN A;  4MVF A;  5AAN A;  1UWO A;  2HET A;  2M0R A;  1KK8 B;  3VGO A;  2K7O A;  4P2Y B;  1C3Z A;  3WNX B;  1CDN A;  1WDC C;  3NXA A;  1LS8 A;  1SY9 A;  1YTZ C;  1MQ1 A;  3I5F B;  2OS8 C;  2YGU A;  4JWQ A;  4YGC B;  1WRZ A;  1L2O B;  1DQE A;  2Q4U A;  1BR4 B;  5ER4 X;  1C7V A;  1JBA A;  1S5G Y;  1YR5 A;  2KYC A;  1A29 A;  1TCF A;  3D73 A;  3NHT A;  5CSJ A;  2ZN8 A;  1J1E A;  3DXL A;  2H61 A;  4PHJ A;  3DZT A;  4GBA A;  1BOC A;  1DJX A;  2I7A A;  4YGB B;  4OR9 B;  3D10 A;  4I5L B;  1GGZ A;  1F54 A;  3I5G C;  3NHI A;  1YX8 A;  1KWO C;  1Y1X A;  5AER A;  1JFJ A;  1KSO A;  2LMV A;  1DT7 B;  1H4B A;  1B8L A;  4MEW A;  4PHK A;  2LLT A;  1W7J B;  3KPX A;  2MHH A;  5CSN A;  5HKW A;  1LXF C;  1L7Z A;  2M3W A;  3IVT A;  1CFD A;  4BY5 A;  4PHN A;  3CYZ A;  2LUX A;  1UHJ A;  3TS5 C;  2KBI A;  3QRX A;  1FI5 A;  1DJI A;  2LNK A;  2L51 A;  1YUR A;  1NCX A;  1OMV A;  4OCI A;  4A4C A;  3C1V A;  1D1O A;  2AMI A;  2KFF A;  2PYQ A;  3FE9 A;  1XK4 A;  4TNC A;  4ICB A;  3LCP C;  1Y1A A;  2QEH A;  4XYN A;  4WRI A;  5I8N A;  2BL0 C;  4OZD A;  3V2L A;  2LLU A;  5FI7 A;  1AJ4 A;  3DVE A;  2K7B A;  1A75 A;  3BJH A;  1MR8 A;  2BL0 B;  1EG4 A;  2KDH A;  3SG6 A;  1NX3 A;  5F6T A;  3OP0 A;  3D76 A;  4N1F A;  4N5X A;  2MLE C;  2BBM A;  2M7N A;  3SS5 A;  5DKN A;  2KBM A;  1S3P A;  1A03 A;  4F7F A;  2WCK A;  4INW A;  2PAS A;  1OZO A;  2QAC A;  2BBN A;  1CTR A;  3OX5 A;  1DJW A;  3TS5 B;  3BFH A;  5EL2 A;  4GPL B;  4WQ3 A;  1F55 A;  1RTP 1;  1UHK A;  5JOL A;  4GGF C;  1EG3 A;  1WLM A;  1KQV A;  2ZN9 A;  3BUO B;  5DIC A;  2PVB A;  1QV1 A;  3SS3 A;  1SK6 D;  2L4H A;  1VRK A;  4IL1 A;  1F4Q A;  1SKT A;  1T14 A;  2L4I A;  3CR5 X;  1F8H A;  1LA3 A;  1CM1 A;  1H8B A;  2K8M B;  3CS1 A;  2LHL A;  1BMO A;  1RFJ A;  2L0P A;  1HT9 A;  3CZ0 A;  3PM2 A;  3EVV A;  2L2C A;  2EC6 B;  2LAN A;  1MUX A;  3NSL A;  1AP4 A;  1SR6 B;  3DVM A;  1DMO A;  1OMD A;  1K9U A;  3F45 A;  2BEC A;  1SW8 A;  1FBV A;  1AUI B;  2HPS A;  4Q04 A;  2F3Y A;  1SCV A;  2WOS A;  3CR2 A;  3D74 A;  3E3R A;  4OVN F;  3RM1 A;  1CM4 A;  2G2B A;  4F0Z B;  3I5F C;  3B7A A;  3FWB A;  2CTN A;  5ER5 A;  3VRP A;  1BU3 A;  2JUL A;  1W7I B;  2GTE A;  4JPZ B;  4MRY A;  4DIR A;  5HYD A;  2PMY A;  1DTL A;  3FE8 A;  4GGN A;  4CFR A;  3BUW B;  2JNF A;  1BOD A;  3TZ1 A;  1Z2C B;  2JT3 A;  1RJV A;  3CDN A;  1XFZ O;  4JD9 A;  1YVL A;  2LVV A;  2BCX A;  1TCO B;  2CBL A;  1K90 D;  2V53 A;  2K2A A;  3R72 A;  4HRG A;  1QIW A;  4MSP A;  2NXQ A;  2RGI A;  4JQ0 D;  4PE4 A;  2OS8 B;  5I94 A;  1JSA A;  4AQJ A;  1QAS A;  1Y1U A;  1UP5 A;  1TNX A;  2DOQ A;  4BY4 A;  2HQ8 A;  5KSZ A;  1BG1 A;  2OTG C;  3D0Y B;  1PK0 D;  1XK4 C;  3A4U B;  4L9M A;  1M46 A;  1SPY A;  4PHM A;  4PT1 A;  2OPO A;  3TUY B;  5KU1 A;  1B1G A;  5BPJ A;  1EXR A;  1CFC A;  3LL8 B;  2WC8 A;  2P71 A;  2E6W A;  1DVI A;  2CT9 A;  1L2O C;  1Z4H A;  1S6J A;  1YUU A;  2L2E A;  1KQM B;  1YVH A;  1OE9 B;  1XO5 A;  1QVI Y;  2F2P A;  3M0W A;  3ZWH A;  1KK8 C;  5TNC A;  2Q91 A;  1J7Q A;  2F8P A;  1MXL C;  3SJS A;  3FE6 A;  1V1G A;  4MZK A;  2KAV A;  4NDD A;  4YI8 A;  1AHR A;  4PCW A;  2M49 B;  4ORA B;  3CZT X;  4INX A;  3BOW B;  1V1F A;  3CR4 X;  1CNP A;  2QEO A;  4D1E A;  4M2P A;  2KAY A;  3SG2 A;  2H61 C;  4PE1 A;  2KFG A;  2D8N A;  2JT8 A;  3DF0 A;  4MRX A;  1PAL A;  2O60 A;  5FI2 A;  4CID A;  3FIA A;  4ETO A;  4WQ2 A;  4OV2 A;  5PAL A; 
#chains in the Genus database with same CATH homology
 3TUY C;  1K2H A;  1QTX A;  2ZFD A;  1CDP A;  1XFY O;  2G9B A;  1IGV A;  1SL9 A;  3TDI A;  2GV5 A;  1ZMZ A;  1J1D A;  3JTD B;  2BE6 A;  2BCB A;  3AKA A;  5D7F A;  4I5J A;  3SIB A;  3SG4 A;  3GK4 X;  2LC5 A;  2KI4 B;  1NYA A;  3PM8 A;  1KFU L;  1LVC D;  4YI9 A;  1JF2 A;  1NX0 A;  1GGW A;  2BKI B;  3KF9 A;  2A4J A;  1QV0 A;  1DF0 B;  1UHH A;  1WY9 A;  3DVK A;  1ZOT B;  2MJW B;  4FQO A;  1QJT A;  1KFU S;  2LM5 A;  1ALV A;  1TNW A;  4USL A;  1PVB A;  2M9G A;  1NX1 A;  1IKU A;  1B4C A;  1M63 B;  1YRT B;  3WHU B;  1TIZ A;  2FJU B;  2LHI A;  1HQV A;  1N65 A;  2AUC A;  2GGM A;  1AVS A;  2ZRT A;  3BOW A;  4ORC B;  3IQQ A;  2JXC A;  4A4B A;  1R6P A;  3EVR A;  2KI6 D;  1CFF A;  3VRR A;  4QJ4 B;  3D0Y A;  3LK1 A;  1WRK A;  3TDZ A;  3KO0 A;  3PAL A;  1N0Y A;  3CGA A;  3GOF A;  1SYM A;  4DCK A;  1J55 A;  4XJK A;  2ZRS A;  2K61 A;  1CLM A;  4I5N B;  1ODB A;  2SAS A;  1SR6 C;  1NWD A;  1MF8 B;  1CMG A;  3EKH A;  1NP8 A;  1GQM A;  1MXE A;  1AJ5 A;  1NPQ A;  2CCM A;  1NUB A;  1K93 D;  2HF5 A;  2KQ6 A;  3CLN A;  3SG7 A;  1SMG A;  1DF0 A;  1N2D A;  1SL7 A;  2LVI A;  1EL4 A;  1NX2 A;  3BQ3 A;  4CFQ A;  2LAP A;  2QPT A;  1J7O A;  1SNL A;  1LIN A;  2L5X B;  1TNP A;  3SIA A;  3O2P A;  3EKJ A;  1KK7 Y;  3DF0 B;  2JZI A;  4YGD B;  3MSE B;  1CDL A;  1SBJ A;  1JC2 A;  1QXP A;  1UHI A;  2IS9 A;  1TOP A;  1CB1 A;  2KI6 C;  5AFP A;  1WDC B;  1IJ6 A;  1XFX O;  1DJZ A;  1LA0 A;  1CKK A;  1BR1 B;  1B9A A;  1IJ5 A;  2PSR A;  1FI6 A;  3FS7 A;  1SCM C;  1XA5 A;  5IBW A;  2ISD A;  1CDM A;  2LCP A;  1OQP A;  4XJK B;  2M29 A;  1J7R A;  3SG5 A;  2BKH B;  2CXJ A;  4MZL A;  4DS7 A;  2JRF A;  1DJG A;  1WLZ A;  2GGZ A;  4M2O A;  1JWD A;  3EK4 A;  1S5G Z;  2I2R E;  4ZCV A;  3A8R A;  4NDC A;  5D69 A;  2LMT A;  1S6C A;  1TNQ A;  2JOJ A;  4HRH A;  2EGD A;  1DGU A;  3CWG A;  2WCB A;  2MRD A;  1XYD A;  1REC A;  1ZFS A;  1CLB A;  4GAO A;  1TRF A;  4C0L A;  5I2O A;  5FYX A;  5CSI A;  3GK2 A;  5GQQ C;  3VRO A;  4PE7 A;  3RLZ A;  1XFU O;  2F33 A;  4YRU A;  5HKY A;  1Q80 A;  3PFV A;  4QJ5 B;  1OOJ A;  3SG3 A;  3HCM A;  1NSH A;  2BCA A;  2KGB C;  1C07 A;  3H4S E;  1A4P A;  2MAZ A;  3VRN A;  1YUS A;  4GNK B;  1KQM C;  1K9K A;  2KFH A;  3OHM B;  2KGR A;  2Y1M A;  1KFX L;  3BXK A;  4I5K A;  5KTY A;  2WCF A;  1K95 A;  1MHO A;  4QJ3 B;  3PN7 B;  4ZCU A;  3CTN A;  1K8U A;  5J3X A;  2LP3 A;  1U5I B;  1PSR A;  2KQY A;  3PN7 C;  4DUQ A;  2CNP A;  4MN0 A;  1BJF A;  1KFX S;  2LVJ A;  4GGF A;  1RWY A;  3LK0 A;  1EJ3 A;  1BLQ A;  4YGA A;  2LLS A;  1IQ3 A;  4HRE E;  2K2F A;  5B8I B;  3LLE A;  1WRL A;  1KWO B;  1B7T Y;  1QX7 A;  2AAO A;  2ZND A;  3AAJ A;  1F4O A;  1BT6 A;  3K21 A;  1S26 D;  2JNX A;  3I5I B;  2HQW A;  2EHB A;  3WHT B;  4M2Q A;  1B8R A;  2M97 A;  2KNE A;  3O6B A;  4DRW A;  1S36 A;  3I5H C;  1QLS A;  3GK1 A;  1AK8 A;  1G33 A;  1OSA A;  5HKZ A;  1XFV O;  2JQ6 A;  2B1U A;  4OKH A;  1JFK A;  1MWN A;  2F3Z A;  1UHN A;  5AEQ A;  1CFP A;  1C7W A;  1ZAC A;  2K0J A;  2JXL A;  1JUO A;  1S6I A;  1U5I A;  1IRJ A;  4GUK A;  2H2K A;  4R1E A;  4U8D A;  5I2Q A;  3KEV A;  3NSI A;  1E8A A;  2P6B B;  2Y4Q A;  3AKB A;  3JTD C;  5G08 A;  1OZS A;  2LMU A;  2ZNE A;  1IH0 A;  1B7T Z;  3JVT B;  2F2O A;  4CPV A;  3NSK A;  2KYF A;  2NZ0 A;  2PAL A;  3BUX B;  3BYA A;  3OB2 B;  2M7L A;  2Y5I A;  5HLO A;  4MZJ A;  2L98 A;  1DJH A;  2TN4 A;  1S1E A;  5CPV A;  1FPW A;  1YUT A;  1UUS A;  1SL8 A;  1PSB A;  2FCE A;  2O5G A;  3O4Y A;  4NQG A;  3DD4 A;  1M45 A;  2R2I A;  4N1G A;  3IQO A;  2WOR A;  1KK7 Z;  1QS7 A;  1F71 A;  1SRA A;  3DVJ A;  2E30 A;  1NCY A;  2JWW A;  3BUN B;  1K9P A;  1A75 B;  4FTG A;  4E68 A;  2EC6 C;  1B8C A;  1G4Y R;  1UUR A;  1IWQ A;  5HLV A;  3EK7 A;  5JJG A;  2BE4 A;  4PE0 A;  1NIW A;  2FCD A;  3EVU A;  2LP2 A;  2I18 A;  4C0J A;  1Y0V H;  2MLF C;  1ZUZ A;  1BF5 A;  1RK9 A;  2KI4 C;  4UPG A;  2KHN A;  2WCE A;  2JC2 A;  5I2L A;  1J7P A;  4MLW A;  1TN4 A;  1KCY A;  4P5O E;  1YX7 A;  2KAX A;  1IG5 A;  1F70 A;  3NSO A;  2KSP A;  5K89 A;  5CSF A;  2KOT A;  1CLL A;  3EK8 A;  1IQ5 A;  1B47 A;  3VRQ A;  2LE9 B;  4ORB B;  3O78 A;  1A2X A;  4MBE A;  1QLK A;  1QX2 A;  3FWC A;  3PAT A;  1FF1 A;  1ALW A;  1KSM A;  1LKJ A;  2K7D A;  3PSR A;  2FOT A;  3TDU A;  2JU0 A;  1K96 A;  3JVT C;  1OMR A;  1TTX A;  4CLN A;  1RRO A;  2Y1N A;  1M31 A;  4PAL A;  1JF0 A;  3I5H B;  1PRW A;  1PVA A;  1XFW O;  2JTT A;  3ICB A;  1XVJ A;  3IF7 A;  2LV7 A;  1QIV A;  1DGV A;  3WXA A;  1R2U A;  1SCM B;  2MBX A;  4YGE B;  1EH2 A;  2NCO A;  2LUC A;  5DKQ A;  2M8U A;  2LVK A;  2I94 A;  1X02 A;  1QX5 B;  1YRU B;  1M39 A;  2COL B;  2OTG B;  1NCZ A;  4GFT A;  5AXI A;  2JTZ A;  1GJY A;  2SCP A;  4C0K A;  1K94 A;  2WND A;  3KHE A;  3OB1 B;  4YBH B;  4AOM A;  3I5G B;  2NCP A;  3BUM B;  1PUL A;  1DJY A;  2L50 A;  3PLF B;  3ZNI A;  4PDZ A;  3HX4 A;  1QAT A;  2VRG A;  2ZKM X;  2JPT A;  1FW4 A;  2M1K B;  3OX6 A;  3I5I C;  2MA2 A;  4HSZ A;  5DKR A;  2JT0 A;  4NDB A;  4AQI A;  1CMF A;  2PRU A;  3AAK A;  2M1U A;  1Y6W A;  1QVI Z;  2K7C A;  1G8I A;  2NLN A;  4MVF A;  5AAN A;  1UWO A;  2HET A;  2M0R A;  1KK8 B;  3VGO A;  2K7O A;  4P2Y B;  3WNX B;  1CDN A;  1WDC C;  3NXA A;  1SY9 A;  1YTZ C;  1MQ1 A;  3I5F B;  2OS8 C;  4JWQ A;  4YGC B;  1WRZ A;  1L2O B;  2Q4U A;  1BR4 B;  5ER4 X;  1C7V A;  1JBA A;  1S5G Y;  1YR5 A;  2KYC A;  1A29 A;  1TCF A;  1H4B A;  5CSJ A;  2ZN8 A;  1J1E A;  2H61 A;  4PHJ A;  1BOC A;  4GBA A;  1DJX A;  2I7A A;  4YGB B;  4OR9 B;  3D10 A;  4I5L B;  1GGZ A;  1F54 A;  3I5G C;  1YX8 A;  1KWO C;  1Y1X A;  5AER A;  1JFJ A;  1KSO A;  2LMV A;  1DT7 B;  1B8L A;  4MEW A;  4PHK A;  2LLT A;  1W7J B;  3KPX A;  2MHH A;  5CSN A;  5HKW A;  1LXF C;  1L7Z A;  2M3W A;  1CFD A;  4BY5 A;  4PHN A;  2LUX A;  1UHJ A;  3TS5 C;  2KBI A;  3QRX A;  1FI5 A;  1DJI A;  2LNK A;  2L51 A;  1YUR A;  1NCX A;  1OMV A;  4OCI A;  4A4C A;  3C1V A;  1D1O A;  2AMI A;  2KFF A;  1XK4 A;  4TNC A;  4ICB A;  3LCP C;  1Y1A A;  4XYN A;  4WRI A;  5I8N A;  2BL0 C;  2LLU A;  1AJ4 A;  3DVE A;  2K7B A;  1A75 A;  1MR8 A;  2BL0 B;  1EG4 A;  2KDH A;  3SG6 A;  1NX3 A;  5F6T A;  3OP0 A;  4N1F A;  4N5X A;  2MLE C;  2BBM A;  2M7N A;  5DKN A;  2KBM A;  1S3P A;  1A03 A;  2PAS A;  1OZO A;  2QAC A;  2BBN A;  1CTR A;  3OX5 A;  1DJW A;  3TS5 B;  1F55 A;  4GPL B;  4WQ3 A;  1RTP 1;  1UHK A;  5JOL A;  4GGF C;  1EG3 A;  1WLM A;  1KQV A;  2ZN9 A;  3BUO B;  2PVB A;  1QV1 A;  1SK6 D;  2L4H A;  1VRK A;  4IL1 A;  1F4Q A;  1SKT A;  2L4I A;  3CR5 X;  1F8H A;  1LA3 A;  1CM1 A;  1H8B A;  2K8M B;  3CS1 A;  2LHL A;  1BMO A;  1RFJ A;  2L0P A;  1HT9 A;  3EVV A;  2LAN A;  2EC6 B;  1MUX A;  3NSL A;  1AP4 A;  1SR6 B;  3DVM A;  1DMO A;  1OMD A;  1K9U A;  3F45 A;  2BEC A;  1SW8 A;  1FBV A;  1AUI B;  2HPS A;  4Q04 A;  2F3Y A;  1SCV A;  2WOS A;  3CR2 A;  3E3R A;  4OVN F;  3RM1 A;  2G2B A;  1CM4 A;  4F0Z B;  3I5F C;  3FWB A;  2CTN A;  5ER5 A;  3VRP A;  1BU3 A;  2JUL A;  1W7I B;  4JPZ B;  4MRY A;  4DIR A;  5HYD A;  2PMY A;  1DTL A;  4GGN A;  4CFR A;  3BUW B;  2JNF A;  1BOD A;  3TZ1 A;  2JT3 A;  1RJV A;  1XFZ O;  1YVL A;  2LVV A;  2BCX A;  1TCO B;  2CBL A;  1K90 D;  2V53 A;  2K2A A;  4HRG A;  4MSP A;  1QIW A;  2NXQ A;  2RGI A;  4JQ0 D;  4PE4 A;  2OS8 B;  1JSA A;  4AQJ A;  1QAS A;  1Y1U A;  1UP5 A;  1TNX A;  2DOQ A;  4BY4 A;  2HQ8 A;  5KSZ A;  1BG1 A;  2OTG C;  3D0Y B;  1PK0 D;  1XK4 C;  3A4U B;  4L9M A;  1M46 A;  1SPY A;  4PHM A;  3TUY B;  2OPO A;  5KU1 A;  1B1G A;  5BPJ A;  1EXR A;  1CFC A;  3LL8 B;  2WC8 A;  2E6W A;  1DVI A;  2CT9 A;  1L2O C;  1S6J A;  1YUU A;  2L2E A;  1KQM B;  1YVH A;  1OE9 B;  1XO5 A;  1QVI Y;  2F2P A;  3M0W A;  3ZWH A;  1KK8 C;  5TNC A;  2Q91 A;  1J7Q A;  2F8P A;  1MXL C;  3SJS A;  1V1G A;  4MZK A;  2KAV A;  4NDD A;  4YI8 A;  1AHR A;  4PCW A;  2M49 B;  4ORA B;  3CZT X;  3BOW B;  1V1F A;  3CR4 X;  1CNP A;  4D1E A;  4M2P A;  2KAY A;  3SG2 A;  2H61 C;  4PE1 A;  2KFG A;  2D8N A;  2JT8 A;  3DF0 A;  4MRX A;  1PAL A;  2O60 A;  4CID A;  4ETO A;  3FIA A;  4WQ2 A;  4OV2 A;  5PAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...