2HQ8A

Crystal structure of coelenterazine-binding protein from renilla muelleri in the ca loaded apo form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
181
Chain Sequence
ITESERAYHLRKMKTRMQRVDVTGDGFISREDYELIAVRIAKIAKLSAEKAEETRQEFLRVADQLGLAPGVRISVEEAAVNATDSLLKMKGEEKAMAVIQSLIMYDCIDTDKDGYVSLPEFKAFLQAVGPDLTDDKAITCFNTLDFNKNGQISRDEFLVTVNDFLFGLEETALANAFYGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coelenterazine-binding protein ca-bound apo form
publication title Crystal structure of coelenterazine-binding protein from Renilla muelleri at 1.7 A: why it is not a calcium-regulated photoprotein.
pubmed doi rcsb
source organism Renilla muelleri
molecule tags Structural genomics, unknown function
total genus 70
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hq8A00
1OMRA 2KHNA 1UWOA 5DKRA 1ZMZA 2RGIA 4JQ0D 4MLWA 2BL0C 2LE9B 3AAKA 2GGZA 3O6BA 3LLEA 1CFFA 1SPYA 1J7PA 1SRAA 3D10A 4ORAB 1MQ1A 1OE9B 1WLMA 1S6JA 2JXCA 4ETOA 1DJIA 3NSIA 3I5FB 4MBEA 4I5LB 1CDMA 3KPXA 5CSFA 3A4UB 4PE1A 5KTYA 3E3RA 1QS7A 3VRNA 1TTXA 4Q04A 2FCEA 1PALA 2KQYA 2GGMA 2JZIA 1NCYA 1DJZA 3GOFA 2LANA 4MRXA 2KYFA 4QJ3B 3NXAA 1S3PA 1U5IB 3EKHA 1NWDA 3MSEB 3FIAA 4DCKA 2LAPA 2I18A 5FYXA 4CFQA 1K95A 3HX4A 4QJ5B 2M1KB 2BKIB 1PSBA 2EC6C 2VRGA 3F45A 1B8CA 4I5JA 1TN4A 4YGCB 3SG2A 2L0PA 2BL0B 1JFJA 1C07A 1MUXA 5DKNA 3CLNA 3SG3A 1A75A 1GJYA 4R1EA 3PALA 1LA3A 1F55A 2LLTA 4YI8A 4GGFC 4CLNA 1ALWA 1XO5A 2K2FA 1DTLA 3OP0A 1RWYA 4MEWA 4PHJA 2JT3A 1XFVO 4ORCB 4I5NB 1J7RA 5JJGA 3IQQA 2WCFA 2BBNA 3EVUA 1HT9A 1NPQA 1SNLA 1NIWA 1NX1A 1S5GY 2M9GA 2ZNDA 4PDZA 2OTGC 1M31A 1U5IA 1W7IB 1S26D 2PMYA 1CLLA 4MRYA 3BQ3A 1NSHA 2WNDA 2BECA 2L2EA 3BUOB 1B9AA 1R6PA 1WLZA 1BLQA 2EC6B 1N65A 3EVRA 1MXEA 3WHUB 1DGVA 1A2XA 4GUKA 1TNQA 2LHIA 2LUXA 2K61A 4FQOA 1DVIA 3NSOA 3TDIA 1QVIY 1UHNA 1YX7A 3DVEA 3LCPC 2L51A 1YUSA 2KSPA 2HETA 1IWQA 1F54A 2SASA 2KGBC 5HLVA 1WRLA 1QIWA 2CTNA 2QACA 1DT7B 1Y1UA 2JT0A 2M97A 2Q4UA 5HLOA 2BBMA 1QX5B 1YVLA 3CZTX 3QRXA 4YGAA 2BCAA 1XFZO 1OQPA 2FCDA 3O4YA 4C0LA 3TUYC 2OTGB 4MZKA 3ZNIA 2KOTA 1RFJA 2K7BA 1X02A 3KF9A 1LA0A 1PK0D 1YR5A 2F3ZA 1RROA 2Q91A 2Y5IA 1XK4A 3D0YB 2ZNEA 3CS1A 3OB2B 3DF0B 4QJ4B 1B7TZ 1JF0A 1OSAA 4ZCUA 1QV1A 1M39A 2AAOA 1CKKA 4OV2A 1K9KA 2KI6D 5TNCA 1CDLA 1CLMA 2B1UA 2NXQA 4L9MA 2KAVA 5AFPA 1KFUS 5B8IB 1DJYA 3CR4X 2L4IA 2CNPA 2LHLA 4M2QA 4PHNA 1AUIB 5AERA 1DJGA 1M45A 2MHHA 2M29A 1AK8A 1DMOA 2JC2A 3I5IB 1BMOA 1EJ3A 5JOLA 2MJWB 4WQ2A 1V1GA 2K8MB 1K8UA 4MVFA 3PN7C 3TUYB 1G8IA 1SCVA 1SYMA 1FI5A 1G4YR 1TOPA 2CBLA 2HPSA 1DJHA 2WCEA 2F8PA 1S36A 1CFPA 1BT6A 5D7FA 3PFVA 3EK8A 3IF7A 1KK8C 1N2DA 4GNKB 1CFCA 5CPVA 1K93D 1LINA 1OMDA 1SY9A 1K2HA 1TCFA 1JF2A 4HRGA 4AQIA 1UP5A 1RTP1 1NX0A 1K96A 2BE4A 2HF5A 1SR6B 1SCMC 1TIZA 1XFXO 3WHTB 1SW8A 5ER5A 1GQMA 4NQGA 2V53A 2PALA 2KYCA 3NSLA 1MXLC 5K89A 3RLZA 1Y1XA 1VRKA 2AMIA 3PN7B 4DRWA 1KK7Y 2I94A 5CSNA 2KFGA 2L50A 4WRIA 2Y1NA 1SK6D 2ZRSA 1MR8A 1ZUZA 4IL1A 3PLFB 3TDUA 3TDZA 4BY5A 3VRQA 3C1VA 1AP4A 3EK4A 4DUQA 1WDCC 1KK8B 2H61C 4NDBA 1SKTA 3PSRA 4PHKA 2JQ6A 1IKUA 1KCYA 1L2OC 1J7OA 2JT8A 1NX2A 3OHMB 3EKJA 2KI6C 3HCMA 4P2YB 1DJXA 1A29A 3M0WA 4GFTA 1JBAA 4USLA 1OOJA 1SBJA 1NX3A 1GGZA 5HYDA 1DF0B 3I5HC 1EH2A 2WC8A 1FW4A 4OKHA 3TZ1A 1PVBA 2KI4C 1BODA 1SCMB 2BCBA 2NCOA 3BUNB 3DVJA 4M2PA 4N1FA 1L7ZA 2KDHA 1IRJA 1UHHA 3SG4A 2NCPA 1YUUA 2SCPA 1JUOA 5CSJA 1CM1A 3SIBA 1QVIZ 4N1GA 4M2OA 1EG3A 1E8AA 4MZLA 1CTRA 1M63B 2K7CA 2O60A 1N0YA 2JWWA 3BUXB 3BOWB 3FS7A 2BE6A 1WRZA 1XVJA 2FOTA 1LVCD 3A8RA 4F0ZB 3OX5A 1FPWA 2M1UA 2H2KA 1SL8A 1WDCB 2FJUB 4A4BA 4PALA 4AOMA 1L2OB 4PE4A 4YRUA 1KQMC 1OZOA 2WCBA 5J3XA 1DF0A 2Y4QA 1UHKA 1HQVA 4CPVA 3OB1B 1J7QA 3I5HB 1W7JB 1RJVA 2BKHB 2L5XB 3EVVA 2K0JA 4N5XA 3IQOA 1QXPA 3AKBA 2K2AA 2MLFC 3SIAA 2KQ6A 4GAOA 2NZ0A 1F4OA 1PSRA 1B1GA 1CMGA 1ZFSA 1KSMA 1CLBA 1IQ3A 2LP3A 4P5OE 2M7NA 1OMVA 2R2IA 3O2PA 1JFKA 2JULA 4YBHB 4DIRA 1QTXA 2LC5A 2QPTA 4GPLB 1AVSA 2D8NA 1KSOA 2KFHA 1H4BA 2JNXA 1DGUA 2PASA 2H61A 2JTZA 1UURA 2LMUA 2LNKA 1F71A 3AKAA 2K7OA 2MLEC 2WOSA 1QASA 5F6TA 2ZRTA 5HKYA 3RM1A 1XYDA 2TN4A 1C7WA 2JXLA 1YTZC 4GGFA 1KQMB 2WORA 3I5GC 3LL8B 3K21A 1J1EA 2F2PA 1ZACA 1YVHA 2PSRA 5G08A 1TNWA 4PCWA 5KSZA 1MF8B 1CNPA 2L98A 1KFXL 1TCOB 4MSPA 1NYAA 1J55A 1EXRA 1QX7A 1EL4A 4HRHA 2EHBA 1YURA 3D0YA 2ZN9A 1JSAA 3DF0A 2JPTA 1RK9A 4XJKB 1UHJA 3VROA 3ZWHA 2JNFA 2CT9A 1B4CA 1BU3A 3VRRA 2LUCA 2MRDA 2KAXA 5I2QA 1JWDA 2LVJA 2BCXA 4A4CA 2LVVA 4ORBB 2ZFDA 2JRFA 1QIVA 4I5KA 1Y1AA 1YUTA 3TS5C 3KO0A 3I5GB 2ZN8A 3NSKA 1CDNA 1NUBA 1ODBA 1A4PA 1Y0VH 2L4HA 2LM5A 5AXIA 3KEVA 1LKJA 2JU0A 2DOQA 2F3YA 1CDPA 2G9BA 3JTDC 4DS7A 1AHRA 3GK2A 2COLB 5I2OA 1FI6A 2KAYA 1K9UA 4XJKA 1A75B 2MA2A 3SG7A 4TNCA 1SL7A 1XFYO 1UUSA 2LVKA 1PULA 2CXJA 4OR9B 1K9PA 1YRUB 2O5GA 1KQVA 4HSZA 1RECA 1TNPA 5I2LA 2KGRA 1GGWA 1QATA 3LK1A 3SG6A 1QJTA 1S5GZ 1S6IA 1IJ6A 1CFDA 2OS8C 4OVNF 2G2BA 1S1EA 1BG1A 5CSIA 1K94A 4D1EA 2M8UA 2E30A 2LLUA 3FWCA 3TS5B 1KWOC 1XK4C 4AQJA 1G33A 2KBMA 4U8DA 5KU1A 1A03A 1CM4A 2LMTA 2HQWA 1CMFA 4C0JA 1M46A 4JPZB 3AAJA 3SJSA 3JVTC 3CWGA 1QV0A 1XFUO 2EGDA 2LP2A 3KHEA 3JTDB 2LLSA 3CR2A 2M7LA 3GK1A 2F33A 2MBXA 4XYNA 2Y1MA 4ICBA 1AJ5A 2GV5A 1MHOA 1XA5A 5DKQA 2E6WA 3SG5A 5ER4X 3BUWB 3LK0A 1WRKA 3ICBA 1B8RA 2A4JA 1KK7Z 1PVAA 2OS8B 2IS9A 4YI9A 4PHMA 4CFRA 1TRFA 5D69A 5AEQA 3GK4X 2LCPA 1IJ5A 4MZJA 1OZSA 2KNEA 3OX6A 1MWNA 1BJFA 1KWOB 1ZOTB 1IQ5A 2KI4B 1F4QA 4PE0A 1BR1B 2P6BB 4FTGA 4C0KA 5HKWA 1BR4B 1IH0A 1WY9A 1Q80A 1CB1A 2M0RA 4YGBB 3JVTB 3CTNA 5AANA 1YRTB 2KBIA 2JTTA 2NLNA 3BOWA 1IG5A 5IBWA 1B8LA 4NDCA 3BUMB 3EK7A 2PRUA 4ZCVA 2OPOA 1YX8A 1K90D 3I5IC 1UHIA 3PATA 4UPGA 1V1FA 2M3WA 4MN0A 1F70A 1TNXA 1PRWA 1NP8A 4PE7A 3BXKA 1F8HA 5GQQC 2KFFA 2LV7A 3PM8A 3WNXB 1KFUL 5HKZA 1QLSA 4GGNA 4OCIA 1Y6WA 2I2RE 1S6CA 4BY4A 1B47A 1FBVA 1JC2A 2JOJA 2CCMA 2ISDA 4GBAA 1C7VA 4YGEB 5I8NA 3DD4A 2I7AA 2HQ8A 2LVIA 4E68A 2PVBA 3VGOA 4HREE 4CIDA 1D1OA 1BOCA 3FWBA 1LXFC 1DJWA 1J1DA 5BPJA 2ZKMX 1QX2A 3I5FC 2MAZA 4JWQA 1AJ4A 1XFWO 3DVKA 1BF5A 1B7TY 2F2OA 1QLKA 3CR5X 1EG4A 3H4SE 1R2UA 1SR6C 3DVMA 1H8BA 1SL9A 3CGAA 3BYAA 2K7DA 1SMGA 2M49B 4WQ3A 4NDDA 4YGDB 1IGVA 1KFXS 5PALA 2AUCA 2LMVA 3VRPA 1ALVA 1NCXA 3O78A 3WXAA 1FF1A 1NCZA
chains in the Genus database with same CATH superfamily
1OMRA 2KHNA 1UWOA 5DKRA 1ZMZA 2RGIA 3D78A 4JQ0D 4MLWA 2BL0C 2LE9B 3AAKA 2GGZA 3O6BA 3LLEA 1CFFA 1SPYA 1J7PA 1SRAA 3D10A 4ORAB 1IIOA 1MQ1A 1OE9B 1WLMA 1S6JA 2PQLA 2JXCA 4ETOA 1DJIA 2L2CA 2KLEA 3R1VA 3NSIA 1T14A 2KLDA 3I5FB 4MBEA 4I5LB 1CDMA 3KPXA 5CSFA 3A4UB 4PE1A 5KTYA 3OBVA 2WC6A 3E3RA 1QS7A 3VRNA 1TTXA 4Q04A 2FCEA 1PALA 2KQYA 2GGMA 2P70A 1TWOA 2JZIA 1NCYA 1DJZA 3GOFA 3L47A 2LANA 4MRXA 2KYFA 4QJ3B 3NXAA 3S0FA 1S3PA 1U5IB 3EKHA 1NWDA 3MSEB 3FIAA 4DCKA 3PM2A 2LAPA 2I18A 5FYXA 4CFQA 1K95A 3HX4A 4QJ5B 2M1KB 2BKIB 1PSBA 2EC6C 2VRGA 3F45A 1B8CA 4I5JA 1TN4A 4YGCB 3SG2A 2L0PA 2BL0B 2WCLA 2BAPA 1JFJA 1C07A 1MUXA 5DKNA 3CLNA 3SG3A 1A75A 1GJYA 4R1EA 2ERBA 1LA3A 3PALA 3DZTA 5I94A 1F55A 2LLTA 4YI8A 4GGFC 4CLNA 3NHIA 1ALWA 1XO5A 2K2FA 1DTLA 3OP0A 1RWYA 4MEWA 4PHJA 2JT3A 1XFVO 4ORCB 4I5NB 1J7RA 3NGVA 5JJGA 3IQQA 2WCFA 2BBNA 3EG5B 3EVUA 1HT9A 1NPQA 1SNLA 1NIWA 1NX1A 1S5GY 2M9GA 2ZNDA 4PDZA 2OTGC 1M31A 1U5IA 1W7IB 1S26D 2PMYA 1CLLA 4MRYA 3BQ3A 1NSHA 2WNDA 3CZ0A 2BECA 2L2EA 3BUOB 1B9AA 2QEOA 1R6PA 1WLZA 1BLQA 2EC6B 1N65A 4JKTA 3EVRA 1MXEA 3WHUB 1DGVA 1OOGA 1A2XA 4GUKA 1GM0A 1TNQA 2LHIA 2LUXA 2K61A 4FQOA 1DVIA 3NSOA 3TDIA 3UO9A 1QVIY 1UHNA 1YX7A 3DVEA 3LCPC 2L51A 1YUSA 2KSPA 2HETA 1OOFA 1IWQA 1F54A 2SASA 4JD9A 2KGBC 5HLVA 1WRLA 1DEKA 1QIWA 2CTNA 3R1OA 3CYZA 2QACA 1DT7B 1Y1UA 2JT0A 2M97A 2Q4UA 5HLOA 1W9ZA 2BBMA 1QX5B 5FI6A 1YVLA 3CZTX 3QRXA 4YGAA 2BCAA 1XFZO 1OQPA 2FCDA 3O4YA 4C0LA 3TUYC 2OTGB 4MZKA 3ZNIA 2KOTA 1RFJA 2K7BA 1X02A 3KF9A 1LA0A 1PK0D 1YR5A 2F3ZA 3PJIA 1RROA 2Q91A 2Y5IA 1XK4A 3D0YB 2ZNEA 3CS1A 3OB2B 3DF0B 4QJ4B 1B7TZ 1JF0A 1OSAA 4ZCUA 1QV1A 1M39A 2AAOA 1CKKA 4OV2A 1K9KA 2KI6D 5TNCA 2WCKA 5EL2A 1CDLA 1CLMA 2B1UA 2NXQA 4L9MA 2FJYA 2KAVA 5AFPA 1KFUS 5B8IB 1DJYA 2WCHA 3CR4X 2L4IA 3BFBA 2CNPA 2LHLA 4M2QA 2QEBA 4PHNA 1AUIB 5AERA 1DJGA 1M45A 2MHHA 2M29A 1AK8A 1DMOA 2JC2A 3I5IB 1BMOA 1EJ3A 5JOLA 2MJWB 2QEVA 4WQ2A 3B87A 1V1GA 2K8MB 1K8UA 4MVFA 3PN7C 3TUYB 1G8IA 3D73A 1SCVA 1SYMA 1FI5A 1G4YR 1TOPA 2CBLA 2HPSA 1DJHA 2WCEA 2F8PA 2QEHA 3N7HA 1S36A 1CFPA 1BT6A 5D7FA 3PFVA 3EK8A 3IF7A 3VB1A 3O4XA 1KK8C 3D75A 1N2DA 4GNKB 1CFCA 1TUZA 5CPVA 1K93D 1LINA 1OMDA 1SY9A 1K2HA 1TCFA 1JF2A 4HRGA 4AQIA 1UP5A 1RTP1 1NX0A 1K96A 2BE4A 2HF5A 1SR6B 1SCMC 1TIZA 1XFXO 2PYQA 3WHTB 1SW8A 5ER5A 3FE8A 4F7FA 1GQMA 4NQGA 2V53A 2PALA 2KYCA 3NSLA 1MXLC 5K89A 3RLZA 1Y1XA 1VRKA 2AMIA 3PN7B 4DRWA 3S0AA 1KK7Y 2I94A 5CSNA 3QMEA 2KFGA 2L50A 4WRIA 2Y1NA 1SK6D 2ZRSA 1MR8A 1XFRA 1ZUZA 4IL1A 3PLFB 3Q8IA 3TDUA 3TDZA 4BY5A 1QWVA 3VRQA 3C1VA 1AP4A 3SS5A 3EK4A 4DUQA 1WDCC 1KK8B 2H61C 4NDBA 1SKTA 3PSRA 4PHKA 2JQ6A 1IKUA 1KCYA 3FE6A 1L2OC 1J7OA 1Z4HA 2JT8A 1NX2A 3CDNA 3OHMB 3EKJA 2KI6C 3HCMA 4P2YB 1DJXA 1A29A 3M0WA 4GFTA 1JBAA 4USLA 1OOJA 1SBJA 3BJHA 1NX3A 1GGZA 5HYDA 1DF0B 3I5HC 1EH2A 2WC8A 1FW4A 4OKHA 3TZ1A 1PVBA 2KI4C 1BODA 1SCMB 2BCBA 2NCOA 3BUNB 3DVJA 4M2PA 4N1FA 3S0GA 1L7ZA 2KDHA 1IRJA 1UHHA 3SG4A 2NCPA 1YUUA 2SCPA 1JUOA 5CSJA 1CM1A 3SIBA 1QVIZ 4N1GA 4M2OA 1EG3A 1E8AA 4MZLA 1CTRA 1M63B 2K7CA 2O60A 3S0BA 1N0YA 2JWWA 3BUXB 3BOWB 3FS7A 2BE6A 1WRZA 1XVJA 2FOTA 3K1EA 1LVCD 3A8RA 4F0ZB 3OX5A 1FPWA 2M1UA 1TUJA 2H2KA 1SL8A 1WDCB 2FJUB 4A4BA 4PALA 4AOMA 1L2OB 3B6XA 4PE4A 4YRUA 1KQMC 1OZOA 4OZDA 2WCBA 5J3XA 1DF0A 2Y4QA 1UHKA 1HQVA 1Z2CB 4CPVA 3OB1B 4INXA 1J7QA 3I5HB 1W7JB 1RJVA 2BKHB 2L5XB 3EVVA 1OW4A 2K0JA 4N5XA 3IQOA 3BFHA 1QXPA 3AKBA 2K2AA 2MLFC 3CZ2A 3SIAA 2KQ6A 4GAOA 2NZ0A 1F4OA 1PSRA 1B1GA 1C3ZA 1CMGA 1ZFSA 1KSMA 1CLBA 1IQ3A 2LP3A 4P5OE 2M7NA 1OMVA 2R2IA 3O2PA 1JFKA 2JULA 4YBHB 4DIRA 1QTXA 2LC5A 2QPTA 1OOHA 4GPLB 1AVSA 2D8NA 1KSOA 2KFHA 3B88A 1H4BA 2JNXA 1DGUA 2PASA 2H61A 2JTZA 1UURA 2K60A 2LMUA 3SS4A 2LNKA 1F71A 3AKAA 2K7OA 2MLEC 2WOSA 1QASA 5F6TA 2ZRTA 5HKYA 3RM1A 1XYDA 2TN4A 1C7WA 2JXLA 1YTZC 4GGFA 1KQMB 2WORA 3I5GC 3D76A 1DQEA 3R72A 3LL8B 4IJ7A 3K21A 1J1EA 2F2PA 3BFAA 1ZACA 1YVHA 2PSRA 5G08A 1TNWA 4PCWA 5KSZA 1MF8B 1CNPA 2L98A 1KFXL 1TCOB 2WCJA 4MSPA 1NYAA 1J55A 1EXRA 2P71A 1QX7A 1EL4A 4HRHA 2EHBA 1YURA 3D0YA 2ZN9A 1JSAA 3DF0A 2JPTA 1RK9A 3DYEA 1UHJA 4XJKB 3D74A 3VROA 3ZWHA 2JNFA 3SS3A 2WCMA 5FI7A 2CT9A 2QDIA 1B4CA 1BU3A 4PT1A 3VRRA 2LUCA 2MRDA 2KAXA 5I2QA 1JWDA 2LVJA 2BCXA 4A4CA 2LVVA 4ORBB 2ZFDA 2JRFA 3S0EA 1QIVA 4I5KA 1Y1AA 1YUTA 3TS5C 3KO0A 5FI2A 3I5GB 2ZN8A 3NSKA 1CDNA 1NUBA 1ODBA 1A4PA 1Y0VH 2L4HA 1DC1A 2LM5A 5AXIA 3KEVA 1LKJA 3V2LA 2JU0A 2DOQA 2F3YA 1CDPA 2G9BA 3CABA 3JTDC 4DS7A 3B7AA 2KPHA 1AHRA 3GK2A 3R1PA 2COLB 5I2OA 1FI6A 2KAYA 1LS8A 1K9UA 4XJKA 1A75B 2MA2A 3SG7A 4TNCA 1SL7A 1XFYO 1UUSA 2LVKA 1PULA 2CXJA 4INWA 1DELA 4OR9B 1K9PA 1YRUB 2O5GA 1KQVA 4HSZA 1RECA 1TNPA 5I2LA 2KGRA 1GGWA 1QATA 3LK1A 3SG6A 1QJTA 1S5GZ 1S6IA 1IJ6A 1CFDA 2OS8C 4OVNF 2G2BA 3DY9A 1S1EA 1BG1A 4FQTA 5CSIA 1K94A 4D1EA 2M8UA 2E30A 2LLUA 3FWCA 3TS5B 1KWOC 1XK4C 4AQJA 1G33A 2GTEA 2KBMA 4U8DA 5KU1A 1A03A 1CM4A 2LMTA 2HQWA 1CMFA 3RZSA 2BNXA 4C0JA 1M46A 4JPZB 3AAJA 1OOIX 3SJSA 3JVTC 3CWGA 1QV0A 1XFUO 2EGDA 2LP2A 3KHEA 3JTDB 2LLSA 3CR2A 2M7LA 2H8VA 3GK1A 2F33A 2JPOA 2MBXA 4XYNA 2Y1MA 4ICBA 3DXLA 3B86A 3IVTA 1AJ5A 2GV5A 1MHOA 1XA5A 5DKQA 2E6WA 3SG5A 5ER4X 3BUWB 3S0DA 3LK0A 1WRKA 3ICBA 1ORGA 1B8RA 2A4JA 1KK7Z 1PVAA 2OS8B 2IS9A 5D3OA 4YI9A 4PHMA 4CFRA 1TRFA 5D69A 5AEQA 3GK4X 2LCPA 1IJ5A 4MZJA 1OZSA 2KNEA 3OX6A 1MWNA 1BJFA 1KWOB 1ZOTB 1IQ5A 2KI4B 1F4QA 4PE0A 3OGNA 1BR1B 2P6BB 4FTGA 4C0KA 5HKWA 1BR4B 1IH0A 1WY9A 1Q80A 1CB1A 2M0RA 3NHTA 4YGBB 3JVTB 3CTNA 5AANA 3UNWA 1YRTB 2KBIA 2JTTA 2NLNA 3BOWA 1IG5A 5IBWA 1B8LA 4NDCA 3BUMB 3EK7A 2PRUA 4ZCVA 2OPOA 3D77A 1YX8A 1K90D 1SSEB 3I5IC 1UHIA 3PATA 4UPGA 1V1FA 2M3WA 4MN0A 1F70A 1TNXA 1PRWA 1NP8A 4PE7A 3BXKA 1F8HA 5GQQC 1P28A 2KFFA 2LV7A 3PM8A 3WNXB 1KFUL 2YGUA 5HKZA 1QLSA 4GGNA 5HL1A 4OCIA 1Y6WA 2I2RE 1S6CA 4BY4A 1B47A 1FBVA 1JC2A 2JOJA 2CCMA 3FE9A 4GBAA 2ISDA 1C7VA 4YGEB 5I8NA 3DD4A 2I7AA 2HQ8A 2LVIA 4E68A 2PVBA 3VGOA 4HREE 4CIDA 4KYNA 1D1OA 3FWBA 1BOCA 1LXFC 1DJWA 1J1DA 5BPJA 2ZKMX 1QX2A 3I5FC 2MAZA 4JWQA 1AJ4A 2WC5A 1C3YA 1XFWO 2L5YA 3DVKA 1BF5A 1B7TY 5DICA 2F2OA 1QLKA 3CR5X 3L4LA 1EG4A 3H4SE 3L4AA 1R2UA 1SR6C 3DVMA 1H8BA 1SL9A 3CGAA 3BYAA 2K7DA 1SMGA 2M49B 4WQ3A 4NDDA 4YGDB 1IGVA 1KFXS 5PALA 2AUCA 2LMVA 3VRPA 1ALVA 1NCXA 3O78A 3WXAA 1FF1A 3CZ1A 1NCZA
chains in the Genus database with same CATH topology
1OMRA 2KHNA 1UWOA 5DKRA 1ZMZA 2RGIA 4JQ0D 4MLWA 2BL0C 2LE9B 3AAKA 2GGZA 3O6BA 3LLEA 1CFFA 1SPYA 1J7PA 1SRAA 3D10A 4ORAB 1MQ1A 1OE9B 1WLMA 1S6JA 2JXCA 4ETOA 1DJIA 3NSIA 3I5FB 4MBEA 4I5LB 1CDMA 3KPXA 5CSFA 3A4UB 4PE1A 5KTYA 3E3RA 1QS7A 3VRNA 1TTXA 4Q04A 2FCEA 1PALA 2KQYA 2GGMA 2JZIA 1NCYA 1DJZA 3GOFA 2LANA 4MRXA 2KYFA 4QJ3B 3NXAA 1S3PA 1U5IB 3EKHA 1NWDA 3MSEB 3FIAA 4DCKA 2LAPA 2I18A 5FYXA 4CFQA 1K95A 3HX4A 4QJ5B 2M1KB 2BKIB 1PSBA 2EC6C 2VRGA 3F45A 1B8CA 4I5JA 1TN4A 4YGCB 3SG2A 2L0PA 2BL0B 1JFJA 1C07A 1MUXA 5DKNA 3CLNA 3SG3A 1A75A 1GJYA 4R1EA 3PALA 1LA3A 1F55A 2LLTA 4YI8A 4GGFC 4CLNA 1ALWA 1XO5A 2K2FA 1DTLA 3OP0A 1RWYA 4MEWA 4PHJA 2JT3A 1XFVO 4ORCB 4I5NB 1J7RA 5JJGA 3IQQA 2WCFA 2BBNA 3EVUA 1HT9A 1NPQA 1SNLA 1NIWA 1NX1A 1S5GY 2M9GA 2ZNDA 4PDZA 2OTGC 1M31A 1U5IA 1W7IB 1S26D 2PMYA 1CLLA 4MRYA 3BQ3A 1NSHA 2WNDA 2BECA 2L2EA 3BUOB 1B9AA 1R6PA 1WLZA 1BLQA 2EC6B 1N65A 3EVRA 1MXEA 3WHUB 1DGVA 1A2XA 4GUKA 1TNQA 2LHIA 2LUXA 2K61A 4FQOA 1DVIA 3NSOA 3TDIA 1QVIY 1UHNA 1YX7A 3DVEA 3LCPC 2L51A 1YUSA 2KSPA 2HETA 1IWQA 1F54A 2SASA 2KGBC 5HLVA 1WRLA 1QIWA 2CTNA 2QACA 1DT7B 1Y1UA 2JT0A 2M97A 2Q4UA 5HLOA 2BBMA 1QX5B 1YVLA 3CZTX 3QRXA 4YGAA 2BCAA 1XFZO 1OQPA 2FCDA 3O4YA 4C0LA 3TUYC 2OTGB 4MZKA 3ZNIA 2KOTA 1RFJA 2K7BA 1X02A 3KF9A 1LA0A 1PK0D 1YR5A 2F3ZA 1RROA 2Q91A 2Y5IA 1XK4A 3D0YB 2ZNEA 3CS1A 3OB2B 3DF0B 4QJ4B 1B7TZ 1JF0A 1OSAA 4ZCUA 1QV1A 1M39A 2AAOA 1CKKA 4OV2A 1K9KA 2KI6D 5TNCA 1CDLA 1CLMA 2B1UA 2NXQA 4L9MA 2KAVA 5AFPA 1KFUS 5B8IB 1DJYA 3CR4X 2L4IA 2CNPA 2LHLA 4M2QA 4PHNA 1AUIB 5AERA 1DJGA 1M45A 2MHHA 2M29A 1AK8A 1DMOA 2JC2A 3I5IB 1BMOA 1EJ3A 5JOLA 2MJWB 4WQ2A 1V1GA 2K8MB 1K8UA 4MVFA 3PN7C 3TUYB 1G8IA 1SCVA 1SYMA 1FI5A 1G4YR 1TOPA 2CBLA 2HPSA 1DJHA 2WCEA 2F8PA 1S36A 1CFPA 1BT6A 5D7FA 3PFVA 3EK8A 3IF7A 1KK8C 1N2DA 4GNKB 1CFCA 5CPVA 1K93D 1LINA 1OMDA 1SY9A 1K2HA 1TCFA 1JF2A 4HRGA 4AQIA 1UP5A 1RTP1 1NX0A 1K96A 2BE4A 2HF5A 1SR6B 1SCMC 1TIZA 1XFXO 3WHTB 1SW8A 5ER5A 1GQMA 4NQGA 2V53A 2PALA 2KYCA 3NSLA 1MXLC 5K89A 3RLZA 1Y1XA 1VRKA 2AMIA 3PN7B 4DRWA 1KK7Y 2I94A 5CSNA 2KFGA 2L50A 4WRIA 2Y1NA 1SK6D 2ZRSA 1MR8A 1ZUZA 4IL1A 3PLFB 3TDUA 3TDZA 4BY5A 3VRQA 3C1VA 1AP4A 3EK4A 4DUQA 1WDCC 1KK8B 2H61C 4NDBA 1SKTA 3PSRA 4PHKA 2JQ6A 1IKUA 1KCYA 1L2OC 1J7OA 2JT8A 1NX2A 3OHMB 3EKJA 2KI6C 3HCMA 4P2YB 1DJXA 1A29A 3M0WA 4GFTA 1JBAA 4USLA 1OOJA 1SBJA 1NX3A 1GGZA 5HYDA 1DF0B 3I5HC 1EH2A 2WC8A 1FW4A 4OKHA 3TZ1A 1PVBA 2KI4C 1BODA 1SCMB 2BCBA 2NCOA 3BUNB 3DVJA 4M2PA 4N1FA 1L7ZA 2KDHA 1IRJA 1UHHA 3SG4A 2NCPA 1YUUA 2SCPA 1JUOA 5CSJA 1CM1A 3SIBA 1QVIZ 4N1GA 4M2OA 1EG3A 1E8AA 4MZLA 1CTRA 1M63B 2K7CA 2O60A 1N0YA 2JWWA 3BUXB 3BOWB 3FS7A 2BE6A 1WRZA 1XVJA 2FOTA 1LVCD 3A8RA 4F0ZB 3OX5A 1FPWA 2M1UA 2H2KA 1SL8A 1WDCB 2FJUB 4A4BA 4PALA 4AOMA 1L2OB 4PE4A 4YRUA 1KQMC 1OZOA 2WCBA 5J3XA 1DF0A 2Y4QA 1UHKA 1HQVA 4CPVA 3OB1B 1J7QA 3I5HB 1W7JB 1RJVA 2BKHB 2L5XB 3EVVA 2K0JA 4N5XA 3IQOA 1QXPA 3AKBA 2K2AA 2MLFC 3SIAA 2KQ6A 4GAOA 2NZ0A 1F4OA 1PSRA 1B1GA 1CMGA 1ZFSA 1KSMA 1CLBA 1IQ3A 2LP3A 4P5OE 2M7NA 1OMVA 2R2IA 3O2PA 1JFKA 2JULA 4YBHB 4DIRA 1QTXA 2LC5A 2QPTA 4GPLB 1AVSA 2D8NA 1KSOA 2KFHA 1H4BA 2JNXA 1DGUA 2PASA 2H61A 2JTZA 1UURA 2LMUA 2LNKA 1F71A 3AKAA 2K7OA 2MLEC 2WOSA 1QASA 5F6TA 2ZRTA 5HKYA 3RM1A 1XYDA 2TN4A 1C7WA 2JXLA 1YTZC 4GGFA 1KQMB 2WORA 3I5GC 3LL8B 3K21A 1J1EA 2F2PA 1ZACA 1YVHA 2PSRA 5G08A 1TNWA 4PCWA 5KSZA 1MF8B 1CNPA 2L98A 1KFXL 1TCOB 4MSPA 1NYAA 1J55A 1EXRA 1QX7A 1EL4A 4HRHA 2EHBA 1YURA 3D0YA 2ZN9A 1JSAA 3DF0A 2JPTA 1RK9A 4XJKB 1UHJA 3VROA 3ZWHA 2JNFA 2CT9A 1B4CA 1BU3A 3VRRA 2LUCA 2MRDA 2KAXA 5I2QA 1JWDA 2LVJA 2BCXA 4A4CA 2LVVA 4ORBB 2ZFDA 2JRFA 1QIVA 4I5KA 1Y1AA 1YUTA 3TS5C 3KO0A 3I5GB 2ZN8A 3NSKA 1CDNA 1NUBA 1ODBA 1A4PA 1Y0VH 2L4HA 2LM5A 5AXIA 3KEVA 1LKJA 2JU0A 2DOQA 2F3YA 1CDPA 2G9BA 3JTDC 4DS7A 1AHRA 3GK2A 2COLB 5I2OA 1FI6A 2KAYA 1K9UA 4XJKA 1A75B 2MA2A 3SG7A 4TNCA 1SL7A 1XFYO 1UUSA 2LVKA 1PULA 2CXJA 4OR9B 1K9PA 1YRUB 2O5GA 1KQVA 4HSZA 1RECA 1TNPA 5I2LA 2KGRA 1GGWA 1QATA 3LK1A 3SG6A 1QJTA 1S5GZ 1S6IA 1IJ6A 1CFDA 2OS8C 4OVNF 2G2BA 1S1EA 1BG1A 5CSIA 1K94A 4D1EA 2M8UA 2E30A 2LLUA 3FWCA 3TS5B 1KWOC 1XK4C 4AQJA 1G33A 2KBMA 4U8DA 5KU1A 1A03A 1CM4A 2LMTA 2HQWA 1CMFA 4C0JA 1M46A 4JPZB 3AAJA 3SJSA 3JVTC 3CWGA 1QV0A 1XFUO 2EGDA 2LP2A 3KHEA 3JTDB 2LLSA 3CR2A 2M7LA 3GK1A 2F33A 2MBXA 4XYNA 2Y1MA 4ICBA 1AJ5A 2GV5A 1MHOA 1XA5A 5DKQA 2E6WA 3SG5A 5ER4X 3BUWB 3LK0A 1WRKA 3ICBA 1B8RA 2A4JA 1KK7Z 1PVAA 2OS8B 2IS9A 4YI9A 4PHMA 4CFRA 1TRFA 5D69A 5AEQA 3GK4X 2LCPA 1IJ5A 4MZJA 1OZSA 2KNEA 3OX6A 1MWNA 1BJFA 1KWOB 1ZOTB 1IQ5A 2KI4B 1F4QA 4PE0A 1BR1B 2P6BB 4FTGA 4C0KA 5HKWA 1BR4B 1IH0A 1WY9A 1Q80A 1CB1A 2M0RA 4YGBB 3JVTB 3CTNA 5AANA 1YRTB 2KBIA 2JTTA 2NLNA 3BOWA 1IG5A 5IBWA 1B8LA 4NDCA 3BUMB 3EK7A 2PRUA 4ZCVA 2OPOA 1YX8A 1K90D 3I5IC 1UHIA 3PATA 4UPGA 1V1FA 2M3WA 4MN0A 1F70A 1TNXA 1PRWA 1NP8A 4PE7A 3BXKA 1F8HA 5GQQC 2KFFA 2LV7A 3PM8A 3WNXB 1KFUL 5HKZA 1QLSA 4GGNA 4OCIA 1Y6WA 2I2RE 1S6CA 4BY4A 1B47A 1FBVA 1JC2A 2JOJA 2CCMA 2ISDA 4GBAA 1C7VA 4YGEB 5I8NA 3DD4A 2I7AA 2HQ8A 2LVIA 4E68A 2PVBA 3VGOA 4HREE 4CIDA 1D1OA 1BOCA 3FWBA 1LXFC 1DJWA 1J1DA 5BPJA 2ZKMX 1QX2A 3I5FC 2MAZA 4JWQA 1AJ4A 1XFWO 3DVKA 1BF5A 1B7TY 2F2OA 1QLKA 3CR5X 1EG4A 3H4SE 1R2UA 1SR6C 3DVMA 1H8BA 1SL9A 3CGAA 3BYAA 2K7DA 1SMGA 2M49B 4WQ3A 4NDDA 4YGDB 1IGVA 1KFXS 5PALA 2AUCA 2LMVA 3VRPA 1ALVA 1NCXA 3O78A 3WXAA 1FF1A 1NCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMR A;  2KHN A;  1UWO A;  5DKR A;  1ZMZ A;  2RGI A;  4JQ0 D;  4MLW A;  2BL0 C;  2LE9 B;  3AAK A;  2GGZ A;  3O6B A;  3LLE A;  1CFF A;  1SPY A;  1J7P A;  1SRA A;  3D10 A;  4ORA B;  1MQ1 A;  1OE9 B;  1WLM A;  1S6J A;  2JXC A;  4ETO A;  1DJI A;  3NSI A;  3I5F B;  4MBE A;  4I5L B;  1CDM A;  3KPX A;  5CSF A;  3A4U B;  4PE1 A;  5KTY A;  3E3R A;  1QS7 A;  3VRN A;  1TTX A;  4Q04 A;  2FCE A;  1PAL A;  2KQY A;  2GGM A;  2JZI A;  1NCY A;  1DJZ A;  3GOF A;  2LAN A;  4MRX A;  2KYF A;  4QJ3 B;  3NXA A;  1S3P A;  1U5I B;  3EKH A;  1NWD A;  3MSE B;  3FIA A;  4DCK A;  2LAP A;  2I18 A;  5FYX A;  4CFQ A;  1K95 A;  3HX4 A;  4QJ5 B;  2M1K B;  2BKI B;  1PSB A;  2EC6 C;  2VRG A;  3F45 A;  1B8C A;  4I5J A;  1TN4 A;  4YGC B;  3SG2 A;  2L0P A;  2BL0 B;  1JFJ A;  1C07 A;  1MUX A;  5DKN A;  3CLN A;  3SG3 A;  1A75 A;  1GJY A;  4R1E A;  3PAL A;  1LA3 A;  1F55 A;  2LLT A;  4YI8 A;  4GGF C;  4CLN A;  1ALW A;  1XO5 A;  2K2F A;  1DTL A;  3OP0 A;  1RWY A;  4MEW A;  4PHJ A;  2JT3 A;  1XFV O;  4ORC B;  4I5N B;  1J7R A;  5JJG A;  3IQQ A;  2WCF A;  2BBN A;  3EVU A;  1HT9 A;  1NPQ A;  1SNL A;  1NIW A;  1NX1 A;  1S5G Y;  2M9G A;  2ZND A;  4PDZ A;  2OTG C;  1M31 A;  1U5I A;  1W7I B;  1S26 D;  2PMY A;  1CLL A;  4MRY A;  3BQ3 A;  1NSH A;  2WND A;  2BEC A;  2L2E A;  3BUO B;  1B9A A;  1R6P A;  1WLZ A;  1BLQ A;  2EC6 B;  1N65 A;  3EVR A;  1MXE A;  3WHU B;  1DGV A;  1A2X A;  4GUK A;  1TNQ A;  2LHI A;  2LUX A;  2K61 A;  4FQO A;  1DVI A;  3NSO A;  3TDI A;  1QVI Y;  1UHN A;  1YX7 A;  3DVE A;  3LCP C;  2L51 A;  1YUS A;  2KSP A;  2HET A;  1IWQ A;  1F54 A;  2SAS A;  2KGB C;  5HLV A;  1WRL A;  1QIW A;  2CTN A;  2QAC A;  1DT7 B;  1Y1U A;  2JT0 A;  2M97 A;  2Q4U A;  5HLO A;  2BBM A;  1QX5 B;  1YVL A;  3CZT X;  3QRX A;  4YGA A;  2BCA A;  1XFZ O;  1OQP A;  2FCD A;  3O4Y A;  4C0L A;  3TUY C;  2OTG B;  4MZK A;  3ZNI A;  2KOT A;  1RFJ A;  2K7B A;  1X02 A;  3KF9 A;  1LA0 A;  1PK0 D;  1YR5 A;  2F3Z A;  1RRO A;  2Q91 A;  2Y5I A;  1XK4 A;  3D0Y B;  2ZNE A;  3CS1 A;  3OB2 B;  3DF0 B;  4QJ4 B;  1B7T Z;  1JF0 A;  1OSA A;  4ZCU A;  1QV1 A;  1M39 A;  2AAO A;  1CKK A;  4OV2 A;  1K9K A;  2KI6 D;  5TNC A;  1CDL A;  1CLM A;  2B1U A;  2NXQ A;  4L9M A;  2KAV A;  5AFP A;  1KFU S;  5B8I B;  1DJY A;  3CR4 X;  2L4I A;  2CNP A;  2LHL A;  4M2Q A;  4PHN A;  1AUI B;  5AER A;  1DJG A;  1M45 A;  2MHH A;  2M29 A;  1AK8 A;  1DMO A;  2JC2 A;  3I5I B;  1BMO A;  1EJ3 A;  5JOL A;  2MJW B;  4WQ2 A;  1V1G A;  2K8M B;  1K8U A;  4MVF A;  3PN7 C;  3TUY B;  1G8I A;  1SCV A;  1SYM A;  1FI5 A;  1G4Y R;  1TOP A;  2CBL A;  2HPS A;  1DJH A;  2WCE A;  2F8P A;  1S36 A;  1CFP A;  1BT6 A;  5D7F A;  3PFV A;  3EK8 A;  3IF7 A;  1KK8 C;  1N2D A;  4GNK B;  1CFC A;  5CPV A;  1K93 D;  1LIN A;  1OMD A;  1SY9 A;  1K2H A;  1TCF A;  1JF2 A;  4HRG A;  4AQI A;  1UP5 A;  1RTP 1;  1NX0 A;  1K96 A;  2BE4 A;  2HF5 A;  1SR6 B;  1SCM C;  1TIZ A;  1XFX O;  3WHT B;  1SW8 A;  5ER5 A;  1GQM A;  4NQG A;  2V53 A;  2PAL A;  2KYC A;  3NSL A;  1MXL C;  5K89 A;  3RLZ A;  1Y1X A;  1VRK A;  2AMI A;  3PN7 B;  4DRW A;  1KK7 Y;  2I94 A;  5CSN A;  2KFG A;  2L50 A;  4WRI A;  2Y1N A;  1SK6 D;  2ZRS A;  1MR8 A;  1ZUZ A;  4IL1 A;  3PLF B;  3TDU A;  3TDZ A;  4BY5 A;  3VRQ A;  3C1V A;  1AP4 A;  3EK4 A;  4DUQ A;  1WDC C;  1KK8 B;  2H61 C;  4NDB A;  1SKT A;  3PSR A;  4PHK A;  2JQ6 A;  1IKU A;  1KCY A;  1L2O C;  1J7O A;  2JT8 A;  1NX2 A;  3OHM B;  3EKJ A;  2KI6 C;  3HCM A;  4P2Y B;  1DJX A;  1A29 A;  3M0W A;  4GFT A;  1JBA A;  4USL A;  1OOJ A;  1SBJ A;  1NX3 A;  1GGZ A;  5HYD A;  1DF0 B;  3I5H C;  1EH2 A;  2WC8 A;  1FW4 A;  4OKH A;  3TZ1 A;  1PVB A;  2KI4 C;  1BOD A;  1SCM B;  2BCB A;  2NCO A;  3BUN B;  3DVJ A;  4M2P A;  4N1F A;  1L7Z A;  2KDH A;  1IRJ A;  1UHH A;  3SG4 A;  2NCP A;  1YUU A;  2SCP A;  1JUO A;  5CSJ A;  1CM1 A;  3SIB A;  1QVI Z;  4N1G A;  4M2O A;  1EG3 A;  1E8A A;  4MZL A;  1CTR A;  1M63 B;  2K7C A;  2O60 A;  1N0Y A;  2JWW A;  3BUX B;  3BOW B;  3FS7 A;  2BE6 A;  1WRZ A;  1XVJ A;  2FOT A;  1LVC D;  3A8R A;  4F0Z B;  3OX5 A;  1FPW A;  2M1U A;  2H2K A;  1SL8 A;  1WDC B;  2FJU B;  4A4B A;  4PAL A;  4AOM A;  1L2O B;  4PE4 A;  4YRU A;  1KQM C;  1OZO A;  2WCB A;  5J3X A;  1DF0 A;  2Y4Q A;  1UHK A;  1HQV A;  4CPV A;  3OB1 B;  1J7Q A;  3I5H B;  1W7J B;  1RJV A;  2BKH B;  2L5X B;  3EVV A;  2K0J A;  4N5X A;  3IQO A;  1QXP A;  3AKB A;  2K2A A;  2MLF C;  3SIA A;  2KQ6 A;  4GAO A;  2NZ0 A;  1F4O A;  1PSR A;  1B1G A;  1CMG A;  1ZFS A;  1KSM A;  1CLB A;  1IQ3 A;  2LP3 A;  4P5O E;  2M7N A;  1OMV A;  2R2I A;  3O2P A;  1JFK A;  2JUL A;  4YBH B;  4DIR A;  1QTX A;  2LC5 A;  2QPT A;  4GPL B;  1AVS A;  2D8N A;  1KSO A;  2KFH A;  1H4B A;  2JNX A;  1DGU A;  2PAS A;  2H61 A;  2JTZ A;  1UUR A;  2LMU A;  2LNK A;  1F71 A;  3AKA A;  2K7O A;  2MLE C;  2WOS A;  1QAS A;  5F6T A;  2ZRT A;  5HKY A;  3RM1 A;  1XYD A;  2TN4 A;  1C7W A;  2JXL A;  1YTZ C;  4GGF A;  1KQM B;  2WOR A;  3I5G C;  3LL8 B;  3K21 A;  1J1E A;  2F2P A;  1ZAC A;  1YVH A;  2PSR A;  5G08 A;  1TNW A;  4PCW A;  5KSZ A;  1MF8 B;  1CNP A;  2L98 A;  1KFX L;  1TCO B;  4MSP A;  1NYA A;  1J55 A;  1EXR A;  1QX7 A;  1EL4 A;  4HRH A;  2EHB A;  1YUR A;  3D0Y A;  2ZN9 A;  1JSA A;  3DF0 A;  2JPT A;  1RK9 A;  4XJK B;  1UHJ A;  3VRO A;  3ZWH A;  2JNF A;  2CT9 A;  1B4C A;  1BU3 A;  3VRR A;  2LUC A;  2MRD A;  2KAX A;  5I2Q A;  1JWD A;  2LVJ A;  2BCX A;  4A4C A;  2LVV A;  4ORB B;  2ZFD A;  2JRF A;  1QIV A;  4I5K A;  1Y1A A;  1YUT A;  3TS5 C;  3KO0 A;  3I5G B;  2ZN8 A;  3NSK A;  1CDN A;  1NUB A;  1ODB A;  1A4P A;  1Y0V H;  2L4H A;  2LM5 A;  5AXI A;  3KEV A;  1LKJ A;  2JU0 A;  2DOQ A;  2F3Y A;  1CDP A;  2G9B A;  3JTD C;  4DS7 A;  1AHR A;  3GK2 A;  2COL B;  5I2O A;  1FI6 A;  2KAY A;  1K9U A;  4XJK A;  1A75 B;  2MA2 A;  3SG7 A;  4TNC A;  1SL7 A;  1XFY O;  1UUS A;  2LVK A;  1PUL A;  2CXJ A;  4OR9 B;  1K9P A;  1YRU B;  2O5G A;  1KQV A;  4HSZ A;  1REC A;  1TNP A;  5I2L A;  2KGR A;  1GGW A;  1QAT A;  3LK1 A;  3SG6 A;  1QJT A;  1S5G Z;  1S6I A;  1IJ6 A;  1CFD A;  2OS8 C;  4OVN F;  2G2B A;  1S1E A;  1BG1 A;  5CSI A;  1K94 A;  4D1E A;  2M8U A;  2E30 A;  2LLU A;  3FWC A;  3TS5 B;  1KWO C;  1XK4 C;  4AQJ A;  1G33 A;  2KBM A;  4U8D A;  5KU1 A;  1A03 A;  1CM4 A;  2LMT A;  2HQW A;  1CMF A;  4C0J A;  1M46 A;  4JPZ B;  3AAJ A;  3SJS A;  3JVT C;  3CWG A;  1QV0 A;  1XFU O;  2EGD A;  2LP2 A;  3KHE A;  3JTD B;  2LLS A;  3CR2 A;  2M7L A;  3GK1 A;  2F33 A;  2MBX A;  4XYN A;  2Y1M A;  4ICB A;  1AJ5 A;  2GV5 A;  1MHO A;  1XA5 A;  5DKQ A;  2E6W A;  3SG5 A;  5ER4 X;  3BUW B;  3LK0 A;  1WRK A;  3ICB A;  1B8R A;  2A4J A;  1KK7 Z;  1PVA A;  2OS8 B;  2IS9 A;  4YI9 A;  4PHM A;  4CFR A;  1TRF A;  5D69 A;  5AEQ A;  3GK4 X;  2LCP A;  1IJ5 A;  4MZJ A;  1OZS A;  2KNE A;  3OX6 A;  1MWN A;  1BJF A;  1KWO B;  1ZOT B;  1IQ5 A;  2KI4 B;  1F4Q A;  4PE0 A;  1BR1 B;  2P6B B;  4FTG A;  4C0K A;  5HKW A;  1BR4 B;  1IH0 A;  1WY9 A;  1Q80 A;  1CB1 A;  2M0R A;  4YGB B;  3JVT B;  3CTN A;  5AAN A;  1YRT B;  2KBI A;  2JTT A;  2NLN A;  3BOW A;  1IG5 A;  5IBW A;  1B8L A;  4NDC A;  3BUM B;  3EK7 A;  2PRU A;  4ZCV A;  2OPO A;  1YX8 A;  1K90 D;  3I5I C;  1UHI A;  3PAT A;  4UPG A;  1V1F A;  2M3W A;  4MN0 A;  1F70 A;  1TNX A;  1PRW A;  1NP8 A;  4PE7 A;  3BXK A;  1F8H A;  5GQQ C;  2KFF A;  2LV7 A;  3PM8 A;  3WNX B;  1KFU L;  5HKZ A;  1QLS A;  4GGN A;  4OCI A;  1Y6W A;  2I2R E;  1S6C A;  4BY4 A;  1B47 A;  1FBV A;  1JC2 A;  2JOJ A;  2CCM A;  2ISD A;  4GBA A;  1C7V A;  4YGE B;  5I8N A;  3DD4 A;  2I7A A;  2HQ8 A;  2LVI A;  4E68 A;  2PVB A;  3VGO A;  4HRE E;  4CID A;  1D1O A;  1BOC A;  3FWB A;  1LXF C;  1DJW A;  1J1D A;  5BPJ A;  2ZKM X;  1QX2 A;  3I5F C;  2MAZ A;  4JWQ A;  1AJ4 A;  1XFW O;  3DVK A;  1BF5 A;  1B7T Y;  2F2O A;  1QLK A;  3CR5 X;  1EG4 A;  3H4S E;  1R2U A;  1SR6 C;  3DVM A;  1H8B A;  1SL9 A;  3CGA A;  3BYA A;  2K7D A;  1SMG A;  2M49 B;  4WQ3 A;  4NDD A;  4YGD B;  1IGV A;  1KFX S;  5PAL A;  2AUC A;  2LMV A;  3VRP A;  1ALV A;  1NCX A;  3O78 A;  3WXA A;  1FF1 A;  1NCZ A; 
#chains in the Genus database with same CATH topology
 1OMR A;  2KHN A;  1UWO A;  5DKR A;  1ZMZ A;  2RGI A;  3D78 A;  4JQ0 D;  4MLW A;  2BL0 C;  2LE9 B;  3AAK A;  2GGZ A;  3O6B A;  3LLE A;  1CFF A;  1SPY A;  1J7P A;  1SRA A;  3D10 A;  4ORA B;  1IIO A;  1MQ1 A;  1OE9 B;  1WLM A;  1S6J A;  2PQL A;  2JXC A;  4ETO A;  1DJI A;  2L2C A;  2KLE A;  3R1V A;  3NSI A;  1T14 A;  2KLD A;  3I5F B;  4MBE A;  4I5L B;  1CDM A;  3KPX A;  5CSF A;  3A4U B;  4PE1 A;  5KTY A;  3OBV A;  2WC6 A;  3E3R A;  1QS7 A;  3VRN A;  1TTX A;  4Q04 A;  2FCE A;  1PAL A;  2KQY A;  2GGM A;  2P70 A;  1TWO A;  2JZI A;  1NCY A;  1DJZ A;  3GOF A;  3L47 A;  2LAN A;  4MRX A;  2KYF A;  4QJ3 B;  3NXA A;  3S0F A;  1S3P A;  1U5I B;  3EKH A;  1NWD A;  3MSE B;  3FIA A;  4DCK A;  3PM2 A;  2LAP A;  2I18 A;  5FYX A;  4CFQ A;  1K95 A;  3HX4 A;  4QJ5 B;  2M1K B;  2BKI B;  1PSB A;  2EC6 C;  2VRG A;  3F45 A;  1B8C A;  4I5J A;  1TN4 A;  4YGC B;  3SG2 A;  2L0P A;  2BL0 B;  2WCL A;  2BAP A;  1JFJ A;  1C07 A;  1MUX A;  5DKN A;  3CLN A;  3SG3 A;  1A75 A;  1GJY A;  4R1E A;  2ERB A;  1LA3 A;  3PAL A;  3DZT A;  5I94 A;  1F55 A;  2LLT A;  4YI8 A;  4GGF C;  4CLN A;  3NHI A;  1ALW A;  1XO5 A;  2K2F A;  1DTL A;  3OP0 A;  1RWY A;  4MEW A;  4PHJ A;  2JT3 A;  1XFV O;  4ORC B;  4I5N B;  1J7R A;  3NGV A;  5JJG A;  3IQQ A;  2WCF A;  2BBN A;  3EG5 B;  3EVU A;  1HT9 A;  1NPQ A;  1SNL A;  1NIW A;  1NX1 A;  1S5G Y;  2M9G A;  2ZND A;  4PDZ A;  2OTG C;  1M31 A;  1U5I A;  1W7I B;  1S26 D;  2PMY A;  1CLL A;  4MRY A;  3BQ3 A;  1NSH A;  2WND A;  3CZ0 A;  2BEC A;  2L2E A;  3BUO B;  1B9A A;  2QEO A;  1R6P A;  1WLZ A;  1BLQ A;  2EC6 B;  1N65 A;  4JKT A;  3EVR A;  1MXE A;  3WHU B;  1DGV A;  1OOG A;  1A2X A;  4GUK A;  1GM0 A;  1TNQ A;  2LHI A;  2LUX A;  2K61 A;  4FQO A;  1DVI A;  3NSO A;  3TDI A;  3UO9 A;  1QVI Y;  1UHN A;  1YX7 A;  3DVE A;  3LCP C;  2L51 A;  1YUS A;  2KSP A;  2HET A;  1OOF A;  1IWQ A;  1F54 A;  2SAS A;  4JD9 A;  2KGB C;  5HLV A;  1WRL A;  1DEK A;  1QIW A;  2CTN A;  3R1O A;  3CYZ A;  2QAC A;  1DT7 B;  1Y1U A;  2JT0 A;  2M97 A;  2Q4U A;  5HLO A;  1W9Z A;  2BBM A;  1QX5 B;  5FI6 A;  1YVL A;  3CZT X;  3QRX A;  4YGA A;  2BCA A;  1XFZ O;  1OQP A;  2FCD A;  3O4Y A;  4C0L A;  3TUY C;  2OTG B;  4MZK A;  3ZNI A;  2KOT A;  1RFJ A;  2K7B A;  1X02 A;  3KF9 A;  1LA0 A;  1PK0 D;  1YR5 A;  2F3Z A;  3PJI A;  1RRO A;  2Q91 A;  2Y5I A;  1XK4 A;  3D0Y B;  2ZNE A;  3CS1 A;  3OB2 B;  3DF0 B;  4QJ4 B;  1B7T Z;  1JF0 A;  1OSA A;  4ZCU A;  1QV1 A;  1M39 A;  2AAO A;  1CKK A;  4OV2 A;  1K9K A;  2KI6 D;  5TNC A;  2WCK A;  5EL2 A;  1CDL A;  1CLM A;  2B1U A;  2NXQ A;  4L9M A;  2FJY A;  2KAV A;  5AFP A;  1KFU S;  5B8I B;  1DJY A;  2WCH A;  3CR4 X;  2L4I A;  3BFB A;  2CNP A;  2LHL A;  4M2Q A;  2QEB A;  4PHN A;  1AUI B;  5AER A;  1DJG A;  1M45 A;  2MHH A;  2M29 A;  1AK8 A;  1DMO A;  2JC2 A;  3I5I B;  1BMO A;  1EJ3 A;  5JOL A;  2MJW B;  2QEV A;  4WQ2 A;  3B87 A;  1V1G A;  2K8M B;  1K8U A;  4MVF A;  3PN7 C;  3TUY B;  1G8I A;  3D73 A;  1SCV A;  1SYM A;  1FI5 A;  1G4Y R;  1TOP A;  2CBL A;  2HPS A;  1DJH A;  2WCE A;  2F8P A;  2QEH A;  3N7H A;  1S36 A;  1CFP A;  1BT6 A;  5D7F A;  3PFV A;  3EK8 A;  3IF7 A;  3VB1 A;  3O4X A;  1KK8 C;  3D75 A;  1N2D A;  4GNK B;  1CFC A;  1TUZ A;  5CPV A;  1K93 D;  1LIN A;  1OMD A;  1SY9 A;  1K2H A;  1TCF A;  1JF2 A;  4HRG A;  4AQI A;  1UP5 A;  1RTP 1;  1NX0 A;  1K96 A;  2BE4 A;  2HF5 A;  1SR6 B;  1SCM C;  1TIZ A;  1XFX O;  2PYQ A;  3WHT B;  1SW8 A;  5ER5 A;  3FE8 A;  4F7F A;  1GQM A;  4NQG A;  2V53 A;  2PAL A;  2KYC A;  3NSL A;  1MXL C;  5K89 A;  3RLZ A;  1Y1X A;  1VRK A;  2AMI A;  3PN7 B;  4DRW A;  3S0A A;  1KK7 Y;  2I94 A;  5CSN A;  3QME A;  2KFG A;  2L50 A;  4WRI A;  2Y1N A;  1SK6 D;  2ZRS A;  1MR8 A;  1XFR A;  1ZUZ A;  4IL1 A;  3PLF B;  3Q8I A;  3TDU A;  3TDZ A;  4BY5 A;  1QWV A;  3VRQ A;  3C1V A;  1AP4 A;  3SS5 A;  3EK4 A;  4DUQ A;  1WDC C;  1KK8 B;  2H61 C;  4NDB A;  1SKT A;  3PSR A;  4PHK A;  2JQ6 A;  1IKU A;  1KCY A;  3FE6 A;  1L2O C;  1J7O A;  1Z4H A;  2JT8 A;  1NX2 A;  3CDN A;  3OHM B;  3EKJ A;  2KI6 C;  3HCM A;  4P2Y B;  1DJX A;  1A29 A;  3M0W A;  4GFT A;  1JBA A;  4USL A;  1OOJ A;  1SBJ A;  3BJH A;  1NX3 A;  1GGZ A;  5HYD A;  1DF0 B;  3I5H C;  1EH2 A;  2WC8 A;  1FW4 A;  4OKH A;  3TZ1 A;  1PVB A;  2KI4 C;  1BOD A;  1SCM B;  2BCB A;  2NCO A;  3BUN B;  3DVJ A;  4M2P A;  4N1F A;  3S0G A;  1L7Z A;  2KDH A;  1IRJ A;  1UHH A;  3SG4 A;  2NCP A;  1YUU A;  2SCP A;  1JUO A;  5CSJ A;  1CM1 A;  3SIB A;  1QVI Z;  4N1G A;  4M2O A;  1EG3 A;  1E8A A;  4MZL A;  1CTR A;  1M63 B;  2K7C A;  2O60 A;  3S0B A;  1N0Y A;  2JWW A;  3BUX B;  3BOW B;  3FS7 A;  2BE6 A;  1WRZ A;  1XVJ A;  2FOT A;  3K1E A;  1LVC D;  3A8R A;  4F0Z B;  3OX5 A;  1FPW A;  2M1U A;  1TUJ A;  2H2K A;  1SL8 A;  1WDC B;  2FJU B;  4A4B A;  4PAL A;  4AOM A;  1L2O B;  3B6X A;  4PE4 A;  4YRU A;  1KQM C;  1OZO A;  4OZD A;  2WCB A;  5J3X A;  1DF0 A;  2Y4Q A;  1UHK A;  1HQV A;  1Z2C B;  4CPV A;  3OB1 B;  4INX A;  1J7Q A;  3I5H B;  1W7J B;  1RJV A;  2BKH B;  2L5X B;  3EVV A;  1OW4 A;  2K0J A;  4N5X A;  3IQO A;  3BFH A;  1QXP A;  3AKB A;  2K2A A;  2MLF C;  3CZ2 A;  3SIA A;  2KQ6 A;  4GAO A;  2NZ0 A;  1F4O A;  1PSR A;  1B1G A;  1C3Z A;  1CMG A;  1ZFS A;  1KSM A;  1CLB A;  1IQ3 A;  2LP3 A;  4P5O E;  2M7N A;  1OMV A;  2R2I A;  3O2P A;  1JFK A;  2JUL A;  4YBH B;  4DIR A;  1QTX A;  2LC5 A;  2QPT A;  1OOH A;  4GPL B;  1AVS A;  2D8N A;  1KSO A;  2KFH A;  3B88 A;  1H4B A;  2JNX A;  1DGU A;  2PAS A;  2H61 A;  2JTZ A;  1UUR A;  2K60 A;  2LMU A;  3SS4 A;  2LNK A;  1F71 A;  3AKA A;  2K7O A;  2MLE C;  2WOS A;  1QAS A;  5F6T A;  2ZRT A;  5HKY A;  3RM1 A;  1XYD A;  2TN4 A;  1C7W A;  2JXL A;  1YTZ C;  4GGF A;  1KQM B;  2WOR A;  3I5G C;  3D76 A;  1DQE A;  3R72 A;  3LL8 B;  4IJ7 A;  3K21 A;  1J1E A;  2F2P A;  3BFA A;  1ZAC A;  1YVH A;  2PSR A;  5G08 A;  1TNW A;  4PCW A;  5KSZ A;  1MF8 B;  1CNP A;  2L98 A;  1KFX L;  1TCO B;  2WCJ A;  4MSP A;  1NYA A;  1J55 A;  1EXR A;  2P71 A;  1QX7 A;  1EL4 A;  4HRH A;  2EHB A;  1YUR A;  3D0Y A;  2ZN9 A;  1JSA A;  3DF0 A;  2JPT A;  1RK9 A;  3DYE A;  1UHJ A;  4XJK B;  3D74 A;  3VRO A;  3ZWH A;  2JNF A;  3SS3 A;  2WCM A;  5FI7 A;  2CT9 A;  2QDI A;  1B4C A;  1BU3 A;  4PT1 A;  3VRR A;  2LUC A;  2MRD A;  2KAX A;  5I2Q A;  1JWD A;  2LVJ A;  2BCX A;  4A4C A;  2LVV A;  4ORB B;  2ZFD A;  2JRF A;  3S0E A;  1QIV A;  4I5K A;  1Y1A A;  1YUT A;  3TS5 C;  3KO0 A;  5FI2 A;  3I5G B;  2ZN8 A;  3NSK A;  1CDN A;  1NUB A;  1ODB A;  1A4P A;  1Y0V H;  2L4H A;  1DC1 A;  2LM5 A;  5AXI A;  3KEV A;  1LKJ A;  3V2L A;  2JU0 A;  2DOQ A;  2F3Y A;  1CDP A;  2G9B A;  3CAB A;  3JTD C;  4DS7 A;  3B7A A;  2KPH A;  1AHR A;  3GK2 A;  3R1P A;  2COL B;  5I2O A;  1FI6 A;  2KAY A;  1LS8 A;  1K9U A;  4XJK A;  1A75 B;  2MA2 A;  3SG7 A;  4TNC A;  1SL7 A;  1XFY O;  1UUS A;  2LVK A;  1PUL A;  2CXJ A;  4INW A;  1DEL A;  4OR9 B;  1K9P A;  1YRU B;  2O5G A;  1KQV A;  4HSZ A;  1REC A;  1TNP A;  5I2L A;  2KGR A;  1GGW A;  1QAT A;  3LK1 A;  3SG6 A;  1QJT A;  1S5G Z;  1S6I A;  1IJ6 A;  1CFD A;  2OS8 C;  4OVN F;  2G2B A;  3DY9 A;  1S1E A;  1BG1 A;  4FQT A;  5CSI A;  1K94 A;  4D1E A;  2M8U A;  2E30 A;  2LLU A;  3FWC A;  3TS5 B;  1KWO C;  1XK4 C;  4AQJ A;  1G33 A;  2GTE A;  2KBM A;  4U8D A;  5KU1 A;  1A03 A;  1CM4 A;  2LMT A;  2HQW A;  1CMF A;  3RZS A;  2BNX A;  4C0J A;  1M46 A;  4JPZ B;  3AAJ A;  1OOI X;  3SJS A;  3JVT C;  3CWG A;  1QV0 A;  1XFU O;  2EGD A;  2LP2 A;  3KHE A;  3JTD B;  2LLS A;  3CR2 A;  2M7L A;  2H8V A;  3GK1 A;  2F33 A;  2JPO A;  2MBX A;  4XYN A;  2Y1M A;  4ICB A;  3DXL A;  3B86 A;  3IVT A;  1AJ5 A;  2GV5 A;  1MHO A;  1XA5 A;  5DKQ A;  2E6W A;  3SG5 A;  5ER4 X;  3BUW B;  3S0D A;  3LK0 A;  1WRK A;  3ICB A;  1ORG A;  1B8R A;  2A4J A;  1KK7 Z;  1PVA A;  2OS8 B;  2IS9 A;  5D3O A;  4YI9 A;  4PHM A;  4CFR A;  1TRF A;  5D69 A;  5AEQ A;  3GK4 X;  2LCP A;  1IJ5 A;  4MZJ A;  1OZS A;  2KNE A;  3OX6 A;  1MWN A;  1BJF A;  1KWO B;  1ZOT B;  1IQ5 A;  2KI4 B;  1F4Q A;  4PE0 A;  3OGN A;  1BR1 B;  2P6B B;  4FTG A;  4C0K A;  5HKW A;  1BR4 B;  1IH0 A;  1WY9 A;  1Q80 A;  1CB1 A;  2M0R A;  3NHT A;  4YGB B;  3JVT B;  3CTN A;  5AAN A;  3UNW A;  1YRT B;  2KBI A;  2JTT A;  2NLN A;  3BOW A;  1IG5 A;  5IBW A;  1B8L A;  4NDC A;  3BUM B;  3EK7 A;  2PRU A;  4ZCV A;  2OPO A;  3D77 A;  1YX8 A;  1K90 D;  1SSE B;  3I5I C;  1UHI A;  3PAT A;  4UPG A;  1V1F A;  2M3W A;  4MN0 A;  1F70 A;  1TNX A;  1PRW A;  1NP8 A;  4PE7 A;  3BXK A;  1F8H A;  5GQQ C;  1P28 A;  2KFF A;  2LV7 A;  3PM8 A;  3WNX B;  1KFU L;  2YGU A;  5HKZ A;  1QLS A;  4GGN A;  5HL1 A;  4OCI A;  1Y6W A;  2I2R E;  1S6C A;  4BY4 A;  1B47 A;  1FBV A;  1JC2 A;  2JOJ A;  2CCM A;  3FE9 A;  4GBA A;  2ISD A;  1C7V A;  4YGE B;  5I8N A;  3DD4 A;  2I7A A;  2HQ8 A;  2LVI A;  4E68 A;  2PVB A;  3VGO A;  4HRE E;  4CID A;  4KYN A;  1D1O A;  3FWB A;  1BOC A;  1LXF C;  1DJW A;  1J1D A;  5BPJ A;  2ZKM X;  1QX2 A;  3I5F C;  2MAZ A;  4JWQ A;  1AJ4 A;  2WC5 A;  1C3Y A;  1XFW O;  2L5Y A;  3DVK A;  1BF5 A;  1B7T Y;  5DIC A;  2F2O A;  1QLK A;  3CR5 X;  3L4L A;  1EG4 A;  3H4S E;  3L4A A;  1R2U A;  1SR6 C;  3DVM A;  1H8B A;  1SL9 A;  3CGA A;  3BYA A;  2K7D A;  1SMG A;  2M49 B;  4WQ3 A;  4NDD A;  4YGD B;  1IGV A;  1KFX S;  5PAL A;  2AUC A;  2LMV A;  3VRP A;  1ALV A;  1NCX A;  3O78 A;  3WXA A;  1FF1 A;  3CZ1 A;  1NCZ A; 
#chains in the Genus database with same CATH homology
 1OMR A;  2KHN A;  1UWO A;  5DKR A;  1ZMZ A;  2RGI A;  4JQ0 D;  4MLW A;  2BL0 C;  2LE9 B;  3AAK A;  2GGZ A;  3O6B A;  3LLE A;  1CFF A;  1SPY A;  1J7P A;  1SRA A;  3D10 A;  4ORA B;  1MQ1 A;  1OE9 B;  1WLM A;  1S6J A;  2JXC A;  4ETO A;  1DJI A;  3NSI A;  3I5F B;  4MBE A;  4I5L B;  1CDM A;  3KPX A;  5CSF A;  3A4U B;  4PE1 A;  5KTY A;  3E3R A;  1QS7 A;  3VRN A;  1TTX A;  4Q04 A;  2FCE A;  1PAL A;  2KQY A;  2GGM A;  2JZI A;  1NCY A;  1DJZ A;  3GOF A;  2LAN A;  4MRX A;  2KYF A;  4QJ3 B;  3NXA A;  1S3P A;  1U5I B;  3EKH A;  1NWD A;  3MSE B;  3FIA A;  4DCK A;  2LAP A;  2I18 A;  5FYX A;  4CFQ A;  1K95 A;  3HX4 A;  4QJ5 B;  2M1K B;  2BKI B;  1PSB A;  2EC6 C;  2VRG A;  3F45 A;  1B8C A;  4I5J A;  1TN4 A;  4YGC B;  3SG2 A;  2L0P A;  2BL0 B;  1JFJ A;  1C07 A;  1MUX A;  5DKN A;  3CLN A;  3SG3 A;  1A75 A;  1GJY A;  4R1E A;  3PAL A;  1LA3 A;  1F55 A;  2LLT A;  4YI8 A;  4GGF C;  4CLN A;  1ALW A;  1XO5 A;  2K2F A;  1DTL A;  3OP0 A;  1RWY A;  4MEW A;  4PHJ A;  2JT3 A;  1XFV O;  4ORC B;  4I5N B;  1J7R A;  5JJG A;  3IQQ A;  2WCF A;  2BBN A;  3EVU A;  1HT9 A;  1NPQ A;  1SNL A;  1NIW A;  1NX1 A;  1S5G Y;  2M9G A;  2ZND A;  4PDZ A;  2OTG C;  1M31 A;  1U5I A;  1W7I B;  1S26 D;  2PMY A;  1CLL A;  4MRY A;  3BQ3 A;  1NSH A;  2WND A;  2BEC A;  2L2E A;  3BUO B;  1B9A A;  1R6P A;  1WLZ A;  1BLQ A;  2EC6 B;  1N65 A;  3EVR A;  1MXE A;  3WHU B;  1DGV A;  1A2X A;  4GUK A;  1TNQ A;  2LHI A;  2LUX A;  2K61 A;  4FQO A;  1DVI A;  3NSO A;  3TDI A;  1QVI Y;  1UHN A;  1YX7 A;  3DVE A;  3LCP C;  2L51 A;  1YUS A;  2KSP A;  2HET A;  1IWQ A;  1F54 A;  2SAS A;  2KGB C;  5HLV A;  1WRL A;  1QIW A;  2CTN A;  2QAC A;  1DT7 B;  1Y1U A;  2JT0 A;  2M97 A;  2Q4U A;  5HLO A;  2BBM A;  1QX5 B;  1YVL A;  3CZT X;  3QRX A;  4YGA A;  2BCA A;  1XFZ O;  1OQP A;  2FCD A;  3O4Y A;  4C0L A;  3TUY C;  2OTG B;  4MZK A;  3ZNI A;  2KOT A;  1RFJ A;  2K7B A;  1X02 A;  3KF9 A;  1LA0 A;  1PK0 D;  1YR5 A;  2F3Z A;  1RRO A;  2Q91 A;  2Y5I A;  1XK4 A;  3D0Y B;  2ZNE A;  3CS1 A;  3OB2 B;  3DF0 B;  4QJ4 B;  1B7T Z;  1JF0 A;  1OSA A;  4ZCU A;  1QV1 A;  1M39 A;  2AAO A;  1CKK A;  4OV2 A;  1K9K A;  2KI6 D;  5TNC A;  1CDL A;  1CLM A;  2B1U A;  2NXQ A;  4L9M A;  2KAV A;  5AFP A;  1KFU S;  5B8I B;  1DJY A;  3CR4 X;  2L4I A;  2CNP A;  2LHL A;  4M2Q A;  4PHN A;  1AUI B;  5AER A;  1DJG A;  1M45 A;  2MHH A;  2M29 A;  1AK8 A;  1DMO A;  2JC2 A;  3I5I B;  1BMO A;  1EJ3 A;  5JOL A;  2MJW B;  4WQ2 A;  1V1G A;  2K8M B;  1K8U A;  4MVF A;  3PN7 C;  3TUY B;  1G8I A;  1SCV A;  1SYM A;  1FI5 A;  1G4Y R;  1TOP A;  2CBL A;  2HPS A;  1DJH A;  2WCE A;  2F8P A;  1S36 A;  1CFP A;  1BT6 A;  5D7F A;  3PFV A;  3EK8 A;  3IF7 A;  1KK8 C;  1N2D A;  4GNK B;  1CFC A;  5CPV A;  1K93 D;  1LIN A;  1OMD A;  1SY9 A;  1K2H A;  1TCF A;  1JF2 A;  4HRG A;  4AQI A;  1UP5 A;  1RTP 1;  1NX0 A;  1K96 A;  2BE4 A;  2HF5 A;  1SR6 B;  1SCM C;  1TIZ A;  1XFX O;  3WHT B;  1SW8 A;  5ER5 A;  1GQM A;  4NQG A;  2V53 A;  2PAL A;  2KYC A;  3NSL A;  1MXL C;  5K89 A;  3RLZ A;  1Y1X A;  1VRK A;  2AMI A;  3PN7 B;  4DRW A;  1KK7 Y;  2I94 A;  5CSN A;  2KFG A;  2L50 A;  4WRI A;  2Y1N A;  1SK6 D;  2ZRS A;  1MR8 A;  1ZUZ A;  4IL1 A;  3PLF B;  3TDU A;  3TDZ A;  4BY5 A;  3VRQ A;  3C1V A;  1AP4 A;  3EK4 A;  4DUQ A;  1WDC C;  1KK8 B;  2H61 C;  4NDB A;  1SKT A;  3PSR A;  4PHK A;  2JQ6 A;  1IKU A;  1KCY A;  1L2O C;  1J7O A;  2JT8 A;  1NX2 A;  3OHM B;  3EKJ A;  2KI6 C;  3HCM A;  4P2Y B;  1DJX A;  1A29 A;  3M0W A;  4GFT A;  1JBA A;  4USL A;  1OOJ A;  1SBJ A;  1NX3 A;  1GGZ A;  5HYD A;  1DF0 B;  3I5H C;  1EH2 A;  2WC8 A;  1FW4 A;  4OKH A;  3TZ1 A;  1PVB A;  2KI4 C;  1BOD A;  1SCM B;  2BCB A;  2NCO A;  3BUN B;  3DVJ A;  4M2P A;  4N1F A;  1L7Z A;  2KDH A;  1IRJ A;  1UHH A;  3SG4 A;  2NCP A;  1YUU A;  2SCP A;  1JUO A;  5CSJ A;  1CM1 A;  3SIB A;  1QVI Z;  4N1G A;  4M2O A;  1EG3 A;  1E8A A;  4MZL A;  1CTR A;  1M63 B;  2K7C A;  2O60 A;  1N0Y A;  2JWW A;  3BUX B;  3BOW B;  3FS7 A;  2BE6 A;  1WRZ A;  1XVJ A;  2FOT A;  1LVC D;  3A8R A;  4F0Z B;  3OX5 A;  1FPW A;  2M1U A;  2H2K A;  1SL8 A;  1WDC B;  2FJU B;  4A4B A;  4PAL A;  4AOM A;  1L2O B;  4PE4 A;  4YRU A;  1KQM C;  1OZO A;  2WCB A;  5J3X A;  1DF0 A;  2Y4Q A;  1UHK A;  1HQV A;  4CPV A;  3OB1 B;  1J7Q A;  3I5H B;  1W7J B;  1RJV A;  2BKH B;  2L5X B;  3EVV A;  2K0J A;  4N5X A;  3IQO A;  1QXP A;  3AKB A;  2K2A A;  2MLF C;  3SIA A;  2KQ6 A;  4GAO A;  2NZ0 A;  1F4O A;  1PSR A;  1B1G A;  1CMG A;  1ZFS A;  1KSM A;  1CLB A;  1IQ3 A;  2LP3 A;  4P5O E;  2M7N A;  1OMV A;  2R2I A;  3O2P A;  1JFK A;  2JUL A;  4YBH B;  4DIR A;  1QTX A;  2LC5 A;  2QPT A;  4GPL B;  1AVS A;  2D8N A;  1KSO A;  2KFH A;  1H4B A;  2JNX A;  1DGU A;  2PAS A;  2H61 A;  2JTZ A;  1UUR A;  2LMU A;  2LNK A;  1F71 A;  3AKA A;  2K7O A;  2MLE C;  2WOS A;  1QAS A;  5F6T A;  2ZRT A;  5HKY A;  3RM1 A;  1XYD A;  2TN4 A;  1C7W A;  2JXL A;  1YTZ C;  4GGF A;  1KQM B;  2WOR A;  3I5G C;  3LL8 B;  3K21 A;  1J1E A;  2F2P A;  1ZAC A;  1YVH A;  2PSR A;  5G08 A;  1TNW A;  4PCW A;  5KSZ A;  1MF8 B;  1CNP A;  2L98 A;  1KFX L;  1TCO B;  4MSP A;  1NYA A;  1J55 A;  1EXR A;  1QX7 A;  1EL4 A;  4HRH A;  2EHB A;  1YUR A;  3D0Y A;  2ZN9 A;  1JSA A;  3DF0 A;  2JPT A;  1RK9 A;  4XJK B;  1UHJ A;  3VRO A;  3ZWH A;  2JNF A;  2CT9 A;  1B4C A;  1BU3 A;  3VRR A;  2LUC A;  2MRD A;  2KAX A;  5I2Q A;  1JWD A;  2LVJ A;  2BCX A;  4A4C A;  2LVV A;  4ORB B;  2ZFD A;  2JRF A;  1QIV A;  4I5K A;  1Y1A A;  1YUT A;  3TS5 C;  3KO0 A;  3I5G B;  2ZN8 A;  3NSK A;  1CDN A;  1NUB A;  1ODB A;  1A4P A;  1Y0V H;  2L4H A;  2LM5 A;  5AXI A;  3KEV A;  1LKJ A;  2JU0 A;  2DOQ A;  2F3Y A;  1CDP A;  2G9B A;  3JTD C;  4DS7 A;  1AHR A;  3GK2 A;  2COL B;  5I2O A;  1FI6 A;  2KAY A;  1K9U A;  4XJK A;  1A75 B;  2MA2 A;  3SG7 A;  4TNC A;  1SL7 A;  1XFY O;  1UUS A;  2LVK A;  1PUL A;  2CXJ A;  4OR9 B;  1K9P A;  1YRU B;  2O5G A;  1KQV A;  4HSZ A;  1REC A;  1TNP A;  5I2L A;  2KGR A;  1GGW A;  1QAT A;  3LK1 A;  3SG6 A;  1QJT A;  1S5G Z;  1S6I A;  1IJ6 A;  1CFD A;  2OS8 C;  4OVN F;  2G2B A;  1S1E A;  1BG1 A;  5CSI A;  1K94 A;  4D1E A;  2M8U A;  2E30 A;  2LLU A;  3FWC A;  3TS5 B;  1KWO C;  1XK4 C;  4AQJ A;  1G33 A;  2KBM A;  4U8D A;  5KU1 A;  1A03 A;  1CM4 A;  2LMT A;  2HQW A;  1CMF A;  4C0J A;  1M46 A;  4JPZ B;  3AAJ A;  3SJS A;  3JVT C;  3CWG A;  1QV0 A;  1XFU O;  2EGD A;  2LP2 A;  3KHE A;  3JTD B;  2LLS A;  3CR2 A;  2M7L A;  3GK1 A;  2F33 A;  2MBX A;  4XYN A;  2Y1M A;  4ICB A;  1AJ5 A;  2GV5 A;  1MHO A;  1XA5 A;  5DKQ A;  2E6W A;  3SG5 A;  5ER4 X;  3BUW B;  3LK0 A;  1WRK A;  3ICB A;  1B8R A;  2A4J A;  1KK7 Z;  1PVA A;  2OS8 B;  2IS9 A;  4YI9 A;  4PHM A;  4CFR A;  1TRF A;  5D69 A;  5AEQ A;  3GK4 X;  2LCP A;  1IJ5 A;  4MZJ A;  1OZS A;  2KNE A;  3OX6 A;  1MWN A;  1BJF A;  1KWO B;  1ZOT B;  1IQ5 A;  2KI4 B;  1F4Q A;  4PE0 A;  1BR1 B;  2P6B B;  4FTG A;  4C0K A;  5HKW A;  1BR4 B;  1IH0 A;  1WY9 A;  1Q80 A;  1CB1 A;  2M0R A;  4YGB B;  3JVT B;  3CTN A;  5AAN A;  1YRT B;  2KBI A;  2JTT A;  2NLN A;  3BOW A;  1IG5 A;  5IBW A;  1B8L A;  4NDC A;  3BUM B;  3EK7 A;  2PRU A;  4ZCV A;  2OPO A;  1YX8 A;  1K90 D;  3I5I C;  1UHI A;  3PAT A;  4UPG A;  1V1F A;  2M3W A;  4MN0 A;  1F70 A;  1TNX A;  1PRW A;  1NP8 A;  4PE7 A;  3BXK A;  1F8H A;  5GQQ C;  2KFF A;  2LV7 A;  3PM8 A;  3WNX B;  1KFU L;  5HKZ A;  1QLS A;  4GGN A;  4OCI A;  1Y6W A;  2I2R E;  1S6C A;  4BY4 A;  1B47 A;  1FBV A;  1JC2 A;  2JOJ A;  2CCM A;  2ISD A;  4GBA A;  1C7V A;  4YGE B;  5I8N A;  3DD4 A;  2I7A A;  2HQ8 A;  2LVI A;  4E68 A;  2PVB A;  3VGO A;  4HRE E;  4CID A;  1D1O A;  1BOC A;  3FWB A;  1LXF C;  1DJW A;  1J1D A;  5BPJ A;  2ZKM X;  1QX2 A;  3I5F C;  2MAZ A;  4JWQ A;  1AJ4 A;  1XFW O;  3DVK A;  1BF5 A;  1B7T Y;  2F2O A;  1QLK A;  3CR5 X;  1EG4 A;  3H4S E;  1R2U A;  1SR6 C;  3DVM A;  1H8B A;  1SL9 A;  3CGA A;  3BYA A;  2K7D A;  1SMG A;  2M49 B;  4WQ3 A;  4NDD A;  4YGD B;  1IGV A;  1KFX S;  5PAL A;  2AUC A;  2LMV A;  3VRP A;  1ALV A;  1NCX A;  3O78 A;  3WXA A;  1FF1 A;  1NCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...