2HQ8A

Crystal structure of coelenterazine-binding protein from renilla muelleri in the ca loaded apo form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
181
structure length
181
Chain Sequence
ITESERAYHLRKMKTRMQRVDVTGDGFISREDYELIAVRIAKIAKLSAEKAEETRQEFLRVADQLGLAPGVRISVEEAAVNATDSLLKMKGEEKAMAVIQSLIMYDCIDTDKDGYVSLPEFKAFLQAVGPDLTDDKAITCFNTLDFNKNGQISRDEFLVTVNDFLFGLEETALANAFYGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coelenterazine-binding protein ca-bound apo form
publication title Crystal structure of coelenterazine-binding protein from Renilla muelleri at 1.7 A: why it is not a calcium-regulated photoprotein.
pubmed doi rcsb
source organism Renilla muelleri
molecule tags Structural genomics, unknown function
total genus 70
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hq8A00
4AQIA 1A2XA 4PHNA 1CMFA 1SCMC 3CR2A 1OOJA 2BECA 3EK8A 2CXJA 4NDBA 1FI6A 4NDCA 1PALA 4BY5A 2ZKMX 1LA3A 1U5IB 1RFJA 1IQ5A 2WCFA 2M3WA 4C0JA 1BF5A 1EG4A 4ORAB 1UWOA 2WC8A 3EK4A 1K2HA 1JC2A 3LCPC 1SL7A 3DF0A 1NSHA 5AEQA 1CLBA 3KF9A 4DS7A 4C0LA 1SKTA 2JNXA 4PE4A 2G9BA 1PVAA 4UPGA 1H4BA 2CT9A 2O5GA 1M31A 4FTGA 1DJWA 1IJ5A 2KYFA 1KWOC 2LE9B 4DRWA 1IRJA 3PM8A 4P2YB 5TNCA 3OX6A 1N2DA 1IKUA 2MLFC 2MRDA 1NYAA 1AK8A 1PSBA 2E6WA 1J55A 2BKHB 2OTGB 5HKWA 1BU3A 2H61C 1ZMZA 2JC2A 3D10A 4ICBA 2KI6C 1XFUO 4MZLA 2JOJA 5AERA 5AANA 1FI5A 4OV2A 3TDUA 5CSIA 3PN7B 1M63B 1QX7A 1CMGA 3D0YA 1K9PA 3TS5B 3SG5A 1K96A 2ZFDA 4HRHA 3VRQA 1WLMA 2JU0A 3KHEA 3IF7A 4M2PA 2HQWA 2SCPA 3E3RA 3SG3A 1B4CA 2GGMA 3O6BA 1PRWA 2HQ8A 1KFUL 3OB1B 3DVMA 3OB2B 4I5NB 3MSEB 4M2QA 2P6BB 2NCPA 1GGWA 1KQMC 4CFQA 1WRLA 2Q91A 4L9MA 4YGAA 3I5FC 3EKJA 2AUCA 1UUSA 4GGFC 1F55A 4C0KA 1A75B 1TTXA 3OX5A 1K94A 3IQOA 3GK1A 5CSFA 2I18A 3WXAA 3M0WA 2WCEA 4CIDA 1M46A 1BLQA 2L51A 2LV7A 1KK7Y 1SR6C 1SCMB 1ALWA 1GGZA 4D1EA 1KFXL 2V53A 4CPVA 4GGFA 2KQYA 3PLFB 4R1EA 5HKYA 3BOWA 3ICBA 1TNPA 1R6PA 3SG7A 3VGOA 2FOTA 5IBWA 1DT7B 1K9KA 1KK7Z 1ODBA 2LLUA 1DGUA 2I2RE 1JUOA 1B47A 1QX2A 2JWWA 5HKZA 2M1UA 1CDNA 2A4JA 2LVVA 1B1GA 1K95A 1M45A 2KSPA 1KWOB 2KYCA 2NXQA 1V1GA 1KCYA 1MHOA 1C7WA 4ORBB 4WRIA 3SJSA 1S1EA 1MXLC 3D0YB 3NSOA 5B8IB 4GNKB 1QLSA 3LL8B 4BY4A 3GK4X 4OVNF 3JTDB 3SIBA 4WQ3A 1JF2A 1KFUS 2L2EA 1S36A 4JWQA 1NPQA 4DCKA 1SYMA 4OKHA 2Y4QA 1XVJA 1YX7A 3TUYB 1XFXO 2BBNA 1A03A 1NP8A 1WDCB 1BR4B 3RM1A 2KAXA 2JT3A 2M1KB 2F33A 1A4PA 1YTZC 2K61A 3H4SE 5D69A 2LUCA 4QJ3B 1C07A 1SW8A 1YVHA 1UHKA 4MBEA 2D8NA 2ZNDA 1XFZO 1HQVA 2EC6C 4PDZA 2NLNA 1RTP1 4AQJA 3DD4A 1CFPA 1J7QA 1MF8B 1CLLA 1QJTA 1KFXS 1CLMA 1YRUB 3IQQA 2FCDA 1CFDA 1FPWA 2QPTA 4OR9B 1KQMB 1KQVA 1SCVA 1QV1A 4MZKA 3PALA 2PASA 2LP2A 2Y5IA 2JQ6A 1NWDA 1BMOA 2JTTA 3SG2A 4MEWA 3BOWB 5AXIA 4NDDA 2KBMA 1Y1UA 1YX8A 1M39A 2JULA 2WORA 5DKQA 1MQ1A 2ZN9A 3NSKA 5G08A 1SR6B 4PE0A 3EVUA 1HT9A 2LVJA 2WNDA 3BUNB 2CNPA 2KFHA 2JXCA 1CM1A 1QATA 1CDLA 2BCAA 2HF5A 1QV0A 2TN4A 5CSJA 3KO0A 2KFFA 1LKJA 3KEVA 5PALA 2BCBA 1RWYA 4MN0A 2JXLA 2KGBC 1IQ3A 2BKIB 4JPZB 1CFCA 1QXPA 1XFVO 1XK4C 3EVVA 1OZOA 1IG5A 1SPYA 2KAYA 1AJ5A 1WRZA 1H8BA 1IGVA 2L4HA 1G8IA 1UHHA 1ALVA 4NQGA 1NCXA 2L0PA 1SL9A 2GGZA 1RECA 1F71A 2LCPA 4GUKA 5GQQC 1XK4A 2LMTA 2M49B 2Y1MA 1ZFSA 1EJ3A 1UURA 2LHLA 1BJFA 3VRPA 1QX5B 1BR1B 4XJKA 1N65A 2NZ0A 4TNCA 3VRRA 1JBAA 2SASA 1YURA 4DIRA 3I5GC 3ZWHA 5K89A 1YVLA 1OE9B 1PULA 1DVIA 1DJGA 1EG3A 1SK6D 4MLWA 2OS8B 2DOQA 4N1GA 4ORCB 5CPVA 3WHUB 2JNFA 1IH0A 4F0ZB 1QVIY 1UHIA 1JFKA 2LMVA 3DF0B 3SIAA 1LINA 5HLOA 1ZOTB 1TNXA 1BT6A 1QIVA 1SRAA 1QASA 2EC6B 2WOSA 3HCMA 3A8RA 3HX4A 3WNXB 3BUWB 2JT8A 3TDIA 1TNQA 1TOPA 2KBIA 1MUXA 2PRUA 2MBXA 4AOMA 2ISDA 3CS1A 1K90D 5I8NA 1QVIZ 2M7LA 2I7AA 2LLSA 1K9UA 3EK7A 1NX0A 1YR5A 3OHMB 1SMGA 2FCEA 3PATA 2KGRA 1N0YA 1F4QA 2KNEA 1DGVA 2M29A 4USLA 1PSRA 3CR4X 4XYNA 1CTRA 1U5IA 2L98A 1TNWA 2F8PA 1D1OA 2M0RA 4GBAA 1PK0D 1LXFC 1WY9A 2M7NA 4E68A 3KPXA 1K93D 5ER5A 2F2PA 2LANA 1TCFA 1SL8A 2CBLA 2GV5A 1FW4A 2KFGA 3EVRA 2K7DA 3BUOB 1C7VA 1NCZA 2AMIA 2ZNEA 3BUMB 1NUBA 1R2UA 1SNLA 1KK8C 1B7TZ 2K8MB 2KI4C 1YUUA 5I2LA 2LUXA 5D7FA 1AUIB 2MAZA 3FS7A 4GFTA 4IL1A 1DJXA 1BODA 3I5IC 3A4UB 4XJKB 4A4CA 3I5HC 1B8LA 1Y1XA 1F4OA 4QJ4B 1QTXA 2F3ZA 1OMDA 3CWGA 3JVTC 2M97A 1KSMA 2KDHA 5ER4X 2PVBA 1DJIA 2L50A 1DJHA 3QRXA 1DJYA 3O2PA 2JPTA 1AP4A 2K0JA 2MA2A 4MSPA 4U8DA 2JT0A 4ETOA 2Y1NA 3NXAA 4PE1A 1DF0A 3I5GB 2HPSA 1S6JA 1RROA 3PFVA 3I5FB 2BCXA 3CGAA 2G2BA 4I5JA 4PALA 4PCWA 1J1DA 4I5LB 2LP3A 3PSRA 4PHKA 2F2OA 1WRKA 1TRFA 2LC5A 5JOLA 3SG4A 1YRTB 3NSLA 1NIWA 1EXRA 1S6IA 2LNKA 2LVIA 4YBHB 1S26D 4HREE 1F70A 2MJWB 1OMVA 3DVKA 1DMOA 5KSZA 1ZUZA 1ZACA 3VRNA 3O4YA 2HETA 2PMYA 1UP5A 1JSAA 2BL0C 1CKKA 2LLTA 1A75A 1XO5A 1FBVA 4M2OA 3O78A 2QACA 1V1FA 2BBMA 4GAOA 4PHJA 1G4YR 1YUTA 4WQ2A 2WCBA 2KAVA 4ZCVA 1XA5A 1XYDA 1TCOB 3BYAA 3EKHA 1OMRA 3DVEA 1EL4A 1X02A 1L2OC 2L5XB 4YGBB 1QLKA 1K8UA 3FIAA 2E30A 3BXKA 1MWNA 2VRGA 1B8CA 5CSNA 1GJYA 1BG1A 2Q4UA 4MZJA 2ZRSA 4HSZA 1LA0A 4OCIA 2AAOA 1YUSA 3OP0A 1AJ4A 2LHIA 3JTDC 1S5GY 2ZRTA 4YGCB 1FF1A 3FWBA 2BE6A 1KK8B 2CCMA 2KI4B 1RK9A 1AHRA 1B8RA 1J1EA 1MR8A 2BE4A 2K7CA 2PALA 3GK2A 3LK0A 2JZIA 1F8HA 1XFWO 3LK1A 3I5IB 3TUYC 1NX3A 1JWDA 5DKRA 3I5HB 3GOFA 1WDCC 2FJUB 1CNPA 1OSAA 2ZN8A 1CDMA 3JVTB 2H61A 1DF0B 1Y6WA 1VRKA 1OQPA 1Y0VH 3LLEA 3F45A 4MRXA 1NX1A 1S5GZ 1TN4A 5FYXA 1J7OA 2I94A 2JRFA 2KQ6A 3C1VA 2K7OA 2JTZA 3WHTB 1RJVA 4ZCUA 2MLEC 2NCOA 4MRYA 3CR5X 3AAJA 1NX2A 2IS9A 3CZTX 5JJGA 5I2QA 1BOCA 1QS7A 1AVSA 1TIZA 2K2AA 4Q04A 5AFPA 1E8AA 3AAKA 3VROA 5HYDA 1WLZA 5I2OA 2F3YA 2PSRA 3FWCA 1S6CA 5J3XA 4HRGA 1NCYA 3TDZA 4P5OE 4A4BA 1JFJA 3K21A 2KOTA 1CB1A 2OPOA 1B7TY 3RLZA 4YI8A 1S3PA 3NSIA 4PE7A 1UHNA 2EHBA 1W7JB 2BL0B 4CFRA 3SG6A 2R2IA 1A29A 1B9AA 1KSOA 4N5XA 1DJZA 2B1UA 2OTGC 1PVBA 1DTLA 1J7RA 2KI6D 3BQ3A 1XFYO 1L7ZA 1UHJA 1CM4A 1IJ6A 2RGIA 3DVJA 5DKNA 5F6TA 4JQ0D 4FQOA 2MHHA 5BPJA 4YGEB 2LMUA 4GGNA 4DUQA 3PN7C 1F54A 1L2OB 3AKAA 2EGDA 1G33A 2O60A 3TS5C 1LVCD 1JF0A 3CTNA 1Y1AA 1EH2A 2CTNA 1QIWA 5HLVA 4QJ5B 2LM5A 4CLNA 3CLNA 2H2KA 3BUXB 1SBJA 4GPLB 4MVFA 4YGDB 2M9GA 1CFFA 1W7IB 5KTYA 2L4IA 1OZSA 1GQMA 1Q80A 4I5KA 1IWQA 4PHMA 2M8UA 5KU1A 2K2FA 3ZNIA 4YI9A 2LAPA 2COLB 1MXEA 1J7PA 2K7BA 2OS8C 3TZ1A 4YRUA 1SY9A 2KHNA 3AKBA 1CDPA 2LVKA 4N1FA
chains in the Genus database with same CATH superfamily
4AQIA 1A2XA 4PHNA 1CMFA 1SCMC 3CR2A 1OOJA 2BNXA 3JVTB 2BECA 3EK8A 2CXJA 4NDBA 3B86A 2PYQA 4NDCA 1FI6A 1PALA 4BY5A 2ZKMX 1LA3A 3R72A 1U5IB 1RFJA 1IQ5A 2WCFA 2M3WA 3DXLA 4C0JA 1EG4A 1BF5A 4ORAB 2QEVA 1UWOA 2WC8A 3EK4A 1K2HA 1JC2A 3LCPC 1SL7A 3DF0A 1NSHA 5AEQA 3RZSA 1CLBA 3BFHA 3KF9A 4DS7A 1DEKA 4C0LA 1SKTA 2JNXA 4PE4A 2G9BA 1PVAA 4UPGA 1H4BA 2K60A 2CT9A 2O5GA 1M31A 4FTGA 1DJWA 1IJ5A 2KYFA 1KWOC 2LE9B 4DRWA 1IRJA 1LS8A 3PM8A 4P2YB 5TNCA 3OX6A 1N2DA 1IKUA 2MLFC 2MRDA 1NYAA 1AK8A 1PSBA 2E6WA 1J55A 2BKHB 2OTGB 5HKWA 1BU3A 2H61C 1ZMZA 3D76A 3D78A 2JC2A 3D10A 4ICBA 2KI6C 1XFUO 4MZLA 1OOHA 2JOJA 5AERA 5AANA 1FI5A 4OV2A 3TDUA 5HL1A 5CSIA 3PN7B 1M63B 1QX7A 1CMGA 3D0YA 1K9PA 3TS5B 3SG5A 1K96A 2ZFDA 4HRHA 3VRQA 1WLMA 3BJHA 2JU0A 3KHEA 3IF7A 4M2PA 2HQWA 2SCPA 3E3RA 3SG3A 1B4CA 2GGMA 3O6BA 4IJ7A 1PRWA 2HQ8A 1KFUL 3OB1B 3DVMA 3OB2B 4I5NB 3MSEB 2GTEA 4M2QA 2P6BB 3SS4A 2NCPA 1GGWA 1KQMC 4CFQA 1WRLA 2Q91A 3SS5A 4L9MA 4YGAA 3I5FC 3EKJA 2AUCA 1UUSA 4GGFC 1F55A 4C0KA 1A75B 1TTXA 3OX5A 1DC1A 1K94A 3IQOA 3GK1A 5CSFA 2I18A 3WXAA 3M0WA 2WCEA 4CIDA 1M46A 4F7FA 3CZ0A 1BLQA 1OOFA 2L51A 2LV7A 1OOGA 1KK7Y 1SR6C 1SCMB 1ALWA 1GGZA 3FE9A 4D1EA 1KFXL 2V53A 4CPVA 4GGFA 2KQYA 3PLFB 2WCKA 4R1EA 5HKYA 3BOWA 1QWVA 3ICBA 2P71A 1TNPA 1R6PA 4OZDA 2JPOA 3SG7A 3VGOA 2FOTA 5IBWA 1DT7B 3D73A 4JKTA 1K9KA 1KK7Z 1ODBA 2LLUA 1DGUA 2I2RE 1JUOA 1B47A 1QX2A 2JWWA 5HKZA 2M1UA 1CDNA 1Z2CB 3BFBA 2A4JA 2LVVA 1B1GA 1K95A 1M45A 2KSPA 1KWOB 2KYCA 2NXQA 2QDIA 1V1GA 1KCYA 1DQEA 1MHOA 3Q8IA 1C7WA 4ORBB 2WCLA 4WRIA 3SJSA 1S1EA 1MXLC 3D0YB 3NSOA 5B8IB 4GNKB 1QLSA 3LL8B 4BY4A 2WC5A 3GK4X 3JTDB 4OVNF 4WQ3A 3SIBA 1JF2A 1KFUS 2L2EA 1S36A 4JWQA 1NPQA 4DCKA 1SYMA 4OKHA 2Y4QA 3L4AA 1XVJA 1YX7A 3TUYB 1XFXO 2BBNA 1A03A 1NP8A 1WDCB 1BR4B 3RM1A 2KAXA 2JT3A 2M1KB 2F33A 1A4PA 1YTZC 2K61A 3H4SE 5D69A 2LUCA 3N7HA 4QJ3B 1C07A 1SW8A 1YVHA 1UHKA 3NHTA 4MBEA 2D8NA 2ZNDA 1XFZO 1HQVA 2EC6C 4PDZA 2NLNA 1RTP1 4AQJA 3DD4A 1CFPA 1J7QA 1MF8B 1CLLA 1QJTA 1KFXS 1CLMA 1YRUB 3CZ2A 2FCDA 3IQQA 3DY9A 1CFDA 1FPWA 2QPTA 1T14A 4OR9B 1KQMB 1KQVA 1SCVA 1QV1A 4MZKA 3PALA 2PASA 2LP2A 2Y5IA 2JQ6A 1NWDA 1BMOA 2JTTA 3SG2A 4MEWA 3BOWB 5AXIA 4NDDA 2KBMA 1Y1UA 1YX8A 1M39A 2JULA 2WORA 5DKQA 1MQ1A 2P70A 2WCHA 2ZN9A 3NSKA 5G08A 1SR6B 4PE0A 3EVUA 1HT9A 2LVJA 2WNDA 3BUNB 2CNPA 2KFHA 2JXCA 1CM1A 1QATA 1CDLA 2BCAA 2HF5A 1QV0A 2TN4A 5CSJA 5FI2A 3K1EA 3KO0A 2KFFA 1LKJA 3KEVA 4KYNA 5PALA 2BCBA 1RWYA 4MN0A 2JXLA 2KGBC 4JD9A 1IQ3A 2BKIB 4JPZB 1CFCA 1QXPA 1XFVO 1XK4C 3EVVA 1OZOA 1C3YA 1IG5A 1SPYA 2KAYA 1AJ5A 1WRZA 1H8BA 1IGVA 2L4HA 1G8IA 1UHHA 4INXA 1ALVA 4NQGA 5EL2A 2KLDA 1NCXA 2L0PA 1SL9A 2GGZA 1RECA 1F71A 2LCPA 4GUKA 5GQQC 3OGNA 1XK4A 2LMTA 2M49B 2Y1MA 1ZFSA 1EJ3A 1UURA 2LHLA 1BJFA 3VRPA 3R1OA 1QX5B 1BR1B 3NGVA 4XJKA 3S0DA 1N65A 1Z4HA 2NZ0A 4TNCA 3VRRA 1JBAA 2SASA 1YURA 4DIRA 3I5GC 3ZWHA 5K89A 1YVLA 1OE9B 1PULA 1DVIA 5I94A 1DJGA 1EG3A 1SK6D 4MLWA 2OS8B 2DOQA 4N1GA 4ORCB 5CPVA 2KLEA 2JNFA 3L4LA 3WHUB 1IH0A 4F0ZB 1QVIY 1UHIA 1JFKA 2LMVA 3DF0B 3SIAA 4FQTA 1LINA 5HLOA 1ZOTB 1TNXA 1BT6A 1QIVA 1SRAA 1QASA 2EC6B 2WOSA 3HCMA 3A8RA 3HX4A 3SS3A 3WNXB 1XFRA 3BUWB 2JT8A 2WCJA 3TDIA 1TNQA 1TOPA 2KBIA 1MUXA 2PRUA 2MBXA 4AOMA 2ISDA 3CS1A 5D3OA 3S0EA 1K90D 5I8NA 1QVIZ 2M7LA 2I7AA 4INWA 2LLSA 1K9UA 3EK7A 5DICA 1NX0A 1YR5A 3OHMB 1SMGA 2FCEA 3NHIA 2KGRA 3PATA 1N0YA 1F4QA 2KNEA 1DGVA 2M29A 4USLA 1PSRA 3CR4X 4XYNA 1CTRA 1U5IA 2L98A 1TNWA 2F8PA 2BAPA 1D1OA 2M0RA 4GBAA 1PK0D 1LXFC 1WY9A 2M7NA 4E68A 3D75A 3KPXA 1K93D 1IIOA 3EG5B 5ER5A 2F2PA 2LANA 1TCFA 1SL8A 2CBLA 2GV5A 2QEBA 1FW4A 2KFGA 3EVRA 2K7DA 3BUOB 3FE8A 1C7VA 1NCZA 3B7AA 2AMIA 2ZNEA 3BUMB 1NUBA 1R2UA 1SNLA 1KK8C 1B7TZ 2K8MB 2KI4C 1YUUA 5I2LA 2LUXA 5D7FA 1AUIB 2MAZA 3FS7A 3CZ1A 4GFTA 4IL1A 1DJXA 1BODA 3I5IC 3A4UB 4XJKB 4A4CA 3I5HC 1B8LA 1Y1XA 1F4OA 4QJ4B 1QTXA 2F3ZA 1OMDA 3CWGA 3JVTC 2M97A 1KSMA 2KDHA 5ER4X 3B87A 2PVBA 1DJIA 2L50A 1DJHA 3QRXA 1DJYA 3O2PA 2JPTA 1AP4A 2K0JA 2MA2A 3B6XA 1TUJA 1TWOA 4MSPA 4U8DA 1SSEB 2JT0A 2Y1NA 4ETOA 3NXAA 4PE1A 1DF0A 3I5GB 2HPSA 1S6JA 3FE6A 1RROA 3PFVA 3I5FB 2BCXA 3CGAA 3L47A 2G2BA 4I5JA 4PALA 4PCWA 1J1DA 4I5LB 2LP3A 3PSRA 4PHKA 2F2OA 1WRKA 1TRFA 2LC5A 5JOLA 3SG4A 1YRTB 3NSLA 1NIWA 1EXRA 1S6IA 2LNKA 2LVIA 4YBHB 1S26D 4HREE 1F70A 2MJWB 3D74A 1OMVA 3DVKA 1DMOA 1C3ZA 5KSZA 1ZUZA 1ZACA 3S0BA 3VRNA 3O4YA 2HETA 2PMYA 2PQLA 1OOIX 3DYEA 1UP5A 1JSAA 2BL0C 1CKKA 2LLTA 1A75A 1XO5A 1FBVA 4M2OA 3O78A 2QACA 1V1FA 2BBMA 2WCMA 4GAOA 3D77A 4PHJA 3V2LA 1G4YR 1YUTA 4WQ2A 2WCBA 2KAVA 4ZCVA 1OW4A 1XA5A 1XYDA 1TCOB 3BYAA 3EKHA 1OMRA 3DVEA 1EL4A 1X02A 1L2OC 2L5XB 4YGBB 1QLKA 1K8UA 2WC6A 2E30A 3CDNA 3BXKA 1MWNA 3FIAA 2VRGA 1B8CA 5CSNA 1GJYA 1BG1A 2Q4UA 4MZJA 2ZRSA 4HSZA 1LA0A 4OCIA 2AAOA 1YUSA 3OP0A 1AJ4A 2LHIA 3JTDC 1S5GY 2ZRTA 4PT1A 4YGCB 3VB1A 1FF1A 3FWBA 2BE6A 1KK8B 2CCMA 2KI4B 1RK9A 1AHRA 1B8RA 1J1EA 1MR8A 2BE4A 2K7CA 2PALA 3GK2A 3LK0A 2JZIA 1F8HA 1XFWO 3LK1A 3I5IB 3TUYC 1NX3A 1JWDA 5DKRA 3I5HB 3GOFA 1WDCC 1P28A 1GM0A 3DZTA 3B88A 2FJUB 1CNPA 1OSAA 2ZN8A 1CDMA 2QEHA 1ORGA 1DF0B 1Y6WA 1VRKA 1Y0VH 1OQPA 2H61A 3LLEA 3F45A 4MRXA 2ERBA 1NX1A 1S5GZ 1TN4A 2KPHA 5FYXA 2I94A 1J7OA 2JRFA 2KQ6A 5FI7A 3C1VA 2K7OA 3CABA 2JTZA 3R1PA 3WHTB 1RJVA 4ZCUA 3BFAA 2MLEC 2NCOA 4MRYA 3CR5X 3AAJA 1NX2A 2IS9A 3CZTX 5JJGA 5I2QA 1BOCA 1QS7A 1AVSA 1TIZA 2K2AA 3CYZA 4Q04A 5AFPA 1E8AA 3AAKA 3VROA 5HYDA 1WLZA 5I2OA 2F3YA 2PSRA 3FWCA 1S6CA 5J3XA 4HRGA 1NCYA 3TDZA 2QEOA 4P5OE 4A4BA 1JFJA 3K21A 2KOTA 1CB1A 2OPOA 1B7TY 3RLZA 4YI8A 1S3PA 3NSIA 4PE7A 1UHNA 2EHBA 1W7JB 2BL0B 4CFRA 3SG6A 2L2CA 3S0AA 2R2IA 1A29A 1B9AA 1KSOA 4N5XA 1DJZA 3UO9A 2B1UA 2OTGC 1PVBA 1DTLA 3O4XA 1J7RA 2KI6D 3UNWA 3BQ3A 1XFYO 3R1VA 1L7ZA 1UHJA 1CM4A 1IJ6A 2FJYA 2RGIA 3DVJA 5DKNA 4JQ0D 5F6TA 4FQOA 5FI6A 2MHHA 5BPJA 2YGUA 4YGEB 2LMUA 4GGNA 4DUQA 3PN7C 3OBVA 1L2OB 1F54A 3AKAA 2EGDA 1G33A 2O60A 3IVTA 1LVCD 1JF0A 3CTNA 1Y1AA 2H8VA 3TS5C 2CTNA 2L5YA 1QIWA 5HLVA 1EH2A 4QJ5B 2LM5A 4CLNA 3CLNA 1W9ZA 2H2KA 3BUXB 1SBJA 4GPLB 4MVFA 1TUZA 4YGDB 2M9GA 1CFFA 1W7IB 5KTYA 2L4IA 1OZSA 1GQMA 1Q80A 4I5KA 3QMEA 1IWQA 4PHMA 2M8UA 5KU1A 1DELA 2K2FA 3ZNIA 4YI9A 3S0FA 2LAPA 3PM2A 2COLB 3PJIA 1MXEA 1J7PA 2K7BA 2OS8C 3TZ1A 4YRUA 3S0GA 1SY9A 2KHNA 3AKBA 1CDPA 2LVKA 4N1FA
chains in the Genus database with same CATH topology
4AQIA 1A2XA 4PHNA 1CMFA 1SCMC 3CR2A 1OOJA 2BECA 3EK8A 2CXJA 4NDBA 1FI6A 4NDCA 1PALA 4BY5A 2ZKMX 1LA3A 1U5IB 1RFJA 1IQ5A 2WCFA 2M3WA 4C0JA 1BF5A 1EG4A 4ORAB 1UWOA 2WC8A 3EK4A 1K2HA 1JC2A 3LCPC 1SL7A 3DF0A 1NSHA 5AEQA 1CLBA 3KF9A 4DS7A 4C0LA 1SKTA 2JNXA 4PE4A 2G9BA 1PVAA 4UPGA 1H4BA 2CT9A 2O5GA 1M31A 4FTGA 1DJWA 1IJ5A 2KYFA 1KWOC 2LE9B 4DRWA 1IRJA 3PM8A 4P2YB 5TNCA 3OX6A 1N2DA 1IKUA 2MLFC 2MRDA 1NYAA 1AK8A 1PSBA 2E6WA 1J55A 2BKHB 2OTGB 5HKWA 1BU3A 2H61C 1ZMZA 2JC2A 3D10A 4ICBA 2KI6C 1XFUO 4MZLA 2JOJA 5AERA 5AANA 1FI5A 4OV2A 3TDUA 5CSIA 3PN7B 1M63B 1QX7A 1CMGA 3D0YA 1K9PA 3TS5B 3SG5A 1K96A 2ZFDA 4HRHA 3VRQA 1WLMA 2JU0A 3KHEA 3IF7A 4M2PA 2HQWA 2SCPA 3E3RA 3SG3A 1B4CA 2GGMA 3O6BA 1PRWA 2HQ8A 1KFUL 3OB1B 3DVMA 3OB2B 4I5NB 3MSEB 4M2QA 2P6BB 2NCPA 1GGWA 1KQMC 4CFQA 1WRLA 2Q91A 4L9MA 4YGAA 3I5FC 3EKJA 2AUCA 1UUSA 4GGFC 1F55A 4C0KA 1A75B 1TTXA 3OX5A 1K94A 3IQOA 3GK1A 5CSFA 2I18A 3WXAA 3M0WA 2WCEA 4CIDA 1M46A 1BLQA 2L51A 2LV7A 1KK7Y 1SR6C 1SCMB 1ALWA 1GGZA 4D1EA 1KFXL 2V53A 4CPVA 4GGFA 2KQYA 3PLFB 4R1EA 5HKYA 3BOWA 3ICBA 1TNPA 1R6PA 3SG7A 3VGOA 2FOTA 5IBWA 1DT7B 1K9KA 1KK7Z 1ODBA 2LLUA 1DGUA 2I2RE 1JUOA 1B47A 1QX2A 2JWWA 5HKZA 2M1UA 1CDNA 2A4JA 2LVVA 1B1GA 1K95A 1M45A 2KSPA 1KWOB 2KYCA 2NXQA 1V1GA 1KCYA 1MHOA 1C7WA 4ORBB 4WRIA 3SJSA 1S1EA 1MXLC 3D0YB 3NSOA 5B8IB 4GNKB 1QLSA 3LL8B 4BY4A 3GK4X 4OVNF 3JTDB 3SIBA 4WQ3A 1JF2A 1KFUS 2L2EA 1S36A 4JWQA 1NPQA 4DCKA 1SYMA 4OKHA 2Y4QA 1XVJA 1YX7A 3TUYB 1XFXO 2BBNA 1A03A 1NP8A 1WDCB 1BR4B 3RM1A 2KAXA 2JT3A 2M1KB 2F33A 1A4PA 1YTZC 2K61A 3H4SE 5D69A 2LUCA 4QJ3B 1C07A 1SW8A 1YVHA 1UHKA 4MBEA 2D8NA 2ZNDA 1XFZO 1HQVA 2EC6C 4PDZA 2NLNA 1RTP1 4AQJA 3DD4A 1CFPA 1J7QA 1MF8B 1CLLA 1QJTA 1KFXS 1CLMA 1YRUB 3IQQA 2FCDA 1CFDA 1FPWA 2QPTA 4OR9B 1KQMB 1KQVA 1SCVA 1QV1A 4MZKA 3PALA 2PASA 2LP2A 2Y5IA 2JQ6A 1NWDA 1BMOA 2JTTA 3SG2A 4MEWA 3BOWB 5AXIA 4NDDA 2KBMA 1Y1UA 1YX8A 1M39A 2JULA 2WORA 5DKQA 1MQ1A 2ZN9A 3NSKA 5G08A 1SR6B 4PE0A 3EVUA 1HT9A 2LVJA 2WNDA 3BUNB 2CNPA 2KFHA 2JXCA 1CM1A 1QATA 1CDLA 2BCAA 2HF5A 1QV0A 2TN4A 5CSJA 3KO0A 2KFFA 1LKJA 3KEVA 5PALA 2BCBA 1RWYA 4MN0A 2JXLA 2KGBC 1IQ3A 2BKIB 4JPZB 1CFCA 1QXPA 1XFVO 1XK4C 3EVVA 1OZOA 1IG5A 1SPYA 2KAYA 1AJ5A 1WRZA 1H8BA 1IGVA 2L4HA 1G8IA 1UHHA 1ALVA 4NQGA 1NCXA 2L0PA 1SL9A 2GGZA 1RECA 1F71A 2LCPA 4GUKA 5GQQC 1XK4A 2LMTA 2M49B 2Y1MA 1ZFSA 1EJ3A 1UURA 2LHLA 1BJFA 3VRPA 1QX5B 1BR1B 4XJKA 1N65A 2NZ0A 4TNCA 3VRRA 1JBAA 2SASA 1YURA 4DIRA 3I5GC 3ZWHA 5K89A 1YVLA 1OE9B 1PULA 1DVIA 1DJGA 1EG3A 1SK6D 4MLWA 2OS8B 2DOQA 4N1GA 4ORCB 5CPVA 3WHUB 2JNFA 1IH0A 4F0ZB 1QVIY 1UHIA 1JFKA 2LMVA 3DF0B 3SIAA 1LINA 5HLOA 1ZOTB 1TNXA 1BT6A 1QIVA 1SRAA 1QASA 2EC6B 2WOSA 3HCMA 3A8RA 3HX4A 3WNXB 3BUWB 2JT8A 3TDIA 1TNQA 1TOPA 2KBIA 1MUXA 2PRUA 2MBXA 4AOMA 2ISDA 3CS1A 1K90D 5I8NA 1QVIZ 2M7LA 2I7AA 2LLSA 1K9UA 3EK7A 1NX0A 1YR5A 3OHMB 1SMGA 2FCEA 3PATA 2KGRA 1N0YA 1F4QA 2KNEA 1DGVA 2M29A 4USLA 1PSRA 3CR4X 4XYNA 1CTRA 1U5IA 2L98A 1TNWA 2F8PA 1D1OA 2M0RA 4GBAA 1PK0D 1LXFC 1WY9A 2M7NA 4E68A 3KPXA 1K93D 5ER5A 2F2PA 2LANA 1TCFA 1SL8A 2CBLA 2GV5A 1FW4A 2KFGA 3EVRA 2K7DA 3BUOB 1C7VA 1NCZA 2AMIA 2ZNEA 3BUMB 1NUBA 1R2UA 1SNLA 1KK8C 1B7TZ 2K8MB 2KI4C 1YUUA 5I2LA 2LUXA 5D7FA 1AUIB 2MAZA 3FS7A 4GFTA 4IL1A 1DJXA 1BODA 3I5IC 3A4UB 4XJKB 4A4CA 3I5HC 1B8LA 1Y1XA 1F4OA 4QJ4B 1QTXA 2F3ZA 1OMDA 3CWGA 3JVTC 2M97A 1KSMA 2KDHA 5ER4X 2PVBA 1DJIA 2L50A 1DJHA 3QRXA 1DJYA 3O2PA 2JPTA 1AP4A 2K0JA 2MA2A 4MSPA 4U8DA 2JT0A 4ETOA 2Y1NA 3NXAA 4PE1A 1DF0A 3I5GB 2HPSA 1S6JA 1RROA 3PFVA 3I5FB 2BCXA 3CGAA 2G2BA 4I5JA 4PALA 4PCWA 1J1DA 4I5LB 2LP3A 3PSRA 4PHKA 2F2OA 1WRKA 1TRFA 2LC5A 5JOLA 3SG4A 1YRTB 3NSLA 1NIWA 1EXRA 1S6IA 2LNKA 2LVIA 4YBHB 1S26D 4HREE 1F70A 2MJWB 1OMVA 3DVKA 1DMOA 5KSZA 1ZUZA 1ZACA 3VRNA 3O4YA 2HETA 2PMYA 1UP5A 1JSAA 2BL0C 1CKKA 2LLTA 1A75A 1XO5A 1FBVA 4M2OA 3O78A 2QACA 1V1FA 2BBMA 4GAOA 4PHJA 1G4YR 1YUTA 4WQ2A 2WCBA 2KAVA 4ZCVA 1XA5A 1XYDA 1TCOB 3BYAA 3EKHA 1OMRA 3DVEA 1EL4A 1X02A 1L2OC 2L5XB 4YGBB 1QLKA 1K8UA 3FIAA 2E30A 3BXKA 1MWNA 2VRGA 1B8CA 5CSNA 1GJYA 1BG1A 2Q4UA 4MZJA 2ZRSA 4HSZA 1LA0A 4OCIA 2AAOA 1YUSA 3OP0A 1AJ4A 2LHIA 3JTDC 1S5GY 2ZRTA 4YGCB 1FF1A 3FWBA 2BE6A 1KK8B 2CCMA 2KI4B 1RK9A 1AHRA 1B8RA 1J1EA 1MR8A 2BE4A 2K7CA 2PALA 3GK2A 3LK0A 2JZIA 1F8HA 1XFWO 3LK1A 3I5IB 3TUYC 1NX3A 1JWDA 5DKRA 3I5HB 3GOFA 1WDCC 2FJUB 1CNPA 1OSAA 2ZN8A 1CDMA 3JVTB 2H61A 1DF0B 1Y6WA 1VRKA 1OQPA 1Y0VH 3LLEA 3F45A 4MRXA 1NX1A 1S5GZ 1TN4A 5FYXA 1J7OA 2I94A 2JRFA 2KQ6A 3C1VA 2K7OA 2JTZA 3WHTB 1RJVA 4ZCUA 2MLEC 2NCOA 4MRYA 3CR5X 3AAJA 1NX2A 2IS9A 3CZTX 5JJGA 5I2QA 1BOCA 1QS7A 1AVSA 1TIZA 2K2AA 4Q04A 5AFPA 1E8AA 3AAKA 3VROA 5HYDA 1WLZA 5I2OA 2F3YA 2PSRA 3FWCA 1S6CA 5J3XA 4HRGA 1NCYA 3TDZA 4P5OE 4A4BA 1JFJA 3K21A 2KOTA 1CB1A 2OPOA 1B7TY 3RLZA 4YI8A 1S3PA 3NSIA 4PE7A 1UHNA 2EHBA 1W7JB 2BL0B 4CFRA 3SG6A 2R2IA 1A29A 1B9AA 1KSOA 4N5XA 1DJZA 2B1UA 2OTGC 1PVBA 1DTLA 1J7RA 2KI6D 3BQ3A 1XFYO 1L7ZA 1UHJA 1CM4A 1IJ6A 2RGIA 3DVJA 5DKNA 5F6TA 4JQ0D 4FQOA 2MHHA 5BPJA 4YGEB 2LMUA 4GGNA 4DUQA 3PN7C 1F54A 1L2OB 3AKAA 2EGDA 1G33A 2O60A 3TS5C 1LVCD 1JF0A 3CTNA 1Y1AA 1EH2A 2CTNA 1QIWA 5HLVA 4QJ5B 2LM5A 4CLNA 3CLNA 2H2KA 3BUXB 1SBJA 4GPLB 4MVFA 4YGDB 2M9GA 1CFFA 1W7IB 5KTYA 2L4IA 1OZSA 1GQMA 1Q80A 4I5KA 1IWQA 4PHMA 2M8UA 5KU1A 2K2FA 3ZNIA 4YI9A 2LAPA 2COLB 1MXEA 1J7PA 2K7BA 2OS8C 3TZ1A 4YRUA 1SY9A 2KHNA 3AKBA 1CDPA 2LVKA 4N1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQI A;  1A2X A;  4PHN A;  1CMF A;  1SCM C;  3CR2 A;  1OOJ A;  2BEC A;  3EK8 A;  2CXJ A;  4NDB A;  1FI6 A;  4NDC A;  1PAL A;  4BY5 A;  2ZKM X;  1LA3 A;  1U5I B;  1RFJ A;  1IQ5 A;  2WCF A;  2M3W A;  4C0J A;  1BF5 A;  1EG4 A;  4ORA B;  1UWO A;  2WC8 A;  3EK4 A;  1K2H A;  1JC2 A;  3LCP C;  1SL7 A;  3DF0 A;  1NSH A;  5AEQ A;  1CLB A;  3KF9 A;  4DS7 A;  4C0L A;  1SKT A;  2JNX A;  4PE4 A;  2G9B A;  1PVA A;  4UPG A;  1H4B A;  2CT9 A;  2O5G A;  1M31 A;  4FTG A;  1DJW A;  1IJ5 A;  2KYF A;  1KWO C;  2LE9 B;  4DRW A;  1IRJ A;  3PM8 A;  4P2Y B;  5TNC A;  3OX6 A;  1N2D A;  1IKU A;  2MLF C;  2MRD A;  1NYA A;  1AK8 A;  1PSB A;  2E6W A;  1J55 A;  2BKH B;  2OTG B;  5HKW A;  1BU3 A;  2H61 C;  1ZMZ A;  2JC2 A;  3D10 A;  4ICB A;  2KI6 C;  1XFU O;  4MZL A;  2JOJ A;  5AER A;  5AAN A;  1FI5 A;  4OV2 A;  3TDU A;  5CSI A;  3PN7 B;  1M63 B;  1QX7 A;  1CMG A;  3D0Y A;  1K9P A;  3TS5 B;  3SG5 A;  1K96 A;  2ZFD A;  4HRH A;  3VRQ A;  1WLM A;  2JU0 A;  3KHE A;  3IF7 A;  4M2P A;  2HQW A;  2SCP A;  3E3R A;  3SG3 A;  1B4C A;  2GGM A;  3O6B A;  1PRW A;  2HQ8 A;  1KFU L;  3OB1 B;  3DVM A;  3OB2 B;  4I5N B;  3MSE B;  4M2Q A;  2P6B B;  2NCP A;  1GGW A;  1KQM C;  4CFQ A;  1WRL A;  2Q91 A;  4L9M A;  4YGA A;  3I5F C;  3EKJ A;  2AUC A;  1UUS A;  4GGF C;  1F55 A;  4C0K A;  1A75 B;  1TTX A;  3OX5 A;  1K94 A;  3IQO A;  3GK1 A;  5CSF A;  2I18 A;  3WXA A;  3M0W A;  2WCE A;  4CID A;  1M46 A;  1BLQ A;  2L51 A;  2LV7 A;  1KK7 Y;  1SR6 C;  1SCM B;  1ALW A;  1GGZ A;  4D1E A;  1KFX L;  2V53 A;  4CPV A;  4GGF A;  2KQY A;  3PLF B;  4R1E A;  5HKY A;  3BOW A;  3ICB A;  1TNP A;  1R6P A;  3SG7 A;  3VGO A;  2FOT A;  5IBW A;  1DT7 B;  1K9K A;  1KK7 Z;  1ODB A;  2LLU A;  1DGU A;  2I2R E;  1JUO A;  1B47 A;  1QX2 A;  2JWW A;  5HKZ A;  2M1U A;  1CDN A;  2A4J A;  2LVV A;  1B1G A;  1K95 A;  1M45 A;  2KSP A;  1KWO B;  2KYC A;  2NXQ A;  1V1G A;  1KCY A;  1MHO A;  1C7W A;  4ORB B;  4WRI A;  3SJS A;  1S1E A;  1MXL C;  3D0Y B;  3NSO A;  5B8I B;  4GNK B;  1QLS A;  3LL8 B;  4BY4 A;  3GK4 X;  4OVN F;  3JTD B;  3SIB A;  4WQ3 A;  1JF2 A;  1KFU S;  2L2E A;  1S36 A;  4JWQ A;  1NPQ A;  4DCK A;  1SYM A;  4OKH A;  2Y4Q A;  1XVJ A;  1YX7 A;  3TUY B;  1XFX O;  2BBN A;  1A03 A;  1NP8 A;  1WDC B;  1BR4 B;  3RM1 A;  2KAX A;  2JT3 A;  2M1K B;  2F33 A;  1A4P A;  1YTZ C;  2K61 A;  3H4S E;  5D69 A;  2LUC A;  4QJ3 B;  1C07 A;  1SW8 A;  1YVH A;  1UHK A;  4MBE A;  2D8N A;  2ZND A;  1XFZ O;  1HQV A;  2EC6 C;  4PDZ A;  2NLN A;  1RTP 1;  4AQJ A;  3DD4 A;  1CFP A;  1J7Q A;  1MF8 B;  1CLL A;  1QJT A;  1KFX S;  1CLM A;  1YRU B;  3IQQ A;  2FCD A;  1CFD A;  1FPW A;  2QPT A;  4OR9 B;  1KQM B;  1KQV A;  1SCV A;  1QV1 A;  4MZK A;  3PAL A;  2PAS A;  2LP2 A;  2Y5I A;  2JQ6 A;  1NWD A;  1BMO A;  2JTT A;  3SG2 A;  4MEW A;  3BOW B;  5AXI A;  4NDD A;  2KBM A;  1Y1U A;  1YX8 A;  1M39 A;  2JUL A;  2WOR A;  5DKQ A;  1MQ1 A;  2ZN9 A;  3NSK A;  5G08 A;  1SR6 B;  4PE0 A;  3EVU A;  1HT9 A;  2LVJ A;  2WND A;  3BUN B;  2CNP A;  2KFH A;  2JXC A;  1CM1 A;  1QAT A;  1CDL A;  2BCA A;  2HF5 A;  1QV0 A;  2TN4 A;  5CSJ A;  3KO0 A;  2KFF A;  1LKJ A;  3KEV A;  5PAL A;  2BCB A;  1RWY A;  4MN0 A;  2JXL A;  2KGB C;  1IQ3 A;  2BKI B;  4JPZ B;  1CFC A;  1QXP A;  1XFV O;  1XK4 C;  3EVV A;  1OZO A;  1IG5 A;  1SPY A;  2KAY A;  1AJ5 A;  1WRZ A;  1H8B A;  1IGV A;  2L4H A;  1G8I A;  1UHH A;  1ALV A;  4NQG A;  1NCX A;  2L0P A;  1SL9 A;  2GGZ A;  1REC A;  1F71 A;  2LCP A;  4GUK A;  5GQQ C;  1XK4 A;  2LMT A;  2M49 B;  2Y1M A;  1ZFS A;  1EJ3 A;  1UUR A;  2LHL A;  1BJF A;  3VRP A;  1QX5 B;  1BR1 B;  4XJK A;  1N65 A;  2NZ0 A;  4TNC A;  3VRR A;  1JBA A;  2SAS A;  1YUR A;  4DIR A;  3I5G C;  3ZWH A;  5K89 A;  1YVL A;  1OE9 B;  1PUL A;  1DVI A;  1DJG A;  1EG3 A;  1SK6 D;  4MLW A;  2OS8 B;  2DOQ A;  4N1G A;  4ORC B;  5CPV A;  3WHU B;  2JNF A;  1IH0 A;  4F0Z B;  1QVI Y;  1UHI A;  1JFK A;  2LMV A;  3DF0 B;  3SIA A;  1LIN A;  5HLO A;  1ZOT B;  1TNX A;  1BT6 A;  1QIV A;  1SRA A;  1QAS A;  2EC6 B;  2WOS A;  3HCM A;  3A8R A;  3HX4 A;  3WNX B;  3BUW B;  2JT8 A;  3TDI A;  1TNQ A;  1TOP A;  2KBI A;  1MUX A;  2PRU A;  2MBX A;  4AOM A;  2ISD A;  3CS1 A;  1K90 D;  5I8N A;  1QVI Z;  2M7L A;  2I7A A;  2LLS A;  1K9U A;  3EK7 A;  1NX0 A;  1YR5 A;  3OHM B;  1SMG A;  2FCE A;  3PAT A;  2KGR A;  1N0Y A;  1F4Q A;  2KNE A;  1DGV A;  2M29 A;  4USL A;  1PSR A;  3CR4 X;  4XYN A;  1CTR A;  1U5I A;  2L98 A;  1TNW A;  2F8P A;  1D1O A;  2M0R A;  4GBA A;  1PK0 D;  1LXF C;  1WY9 A;  2M7N A;  4E68 A;  3KPX A;  1K93 D;  5ER5 A;  2F2P A;  2LAN A;  1TCF A;  1SL8 A;  2CBL A;  2GV5 A;  1FW4 A;  2KFG A;  3EVR A;  2K7D A;  3BUO B;  1C7V A;  1NCZ A;  2AMI A;  2ZNE A;  3BUM B;  1NUB A;  1R2U A;  1SNL A;  1KK8 C;  1B7T Z;  2K8M B;  2KI4 C;  1YUU A;  5I2L A;  2LUX A;  5D7F A;  1AUI B;  2MAZ A;  3FS7 A;  4GFT A;  4IL1 A;  1DJX A;  1BOD A;  3I5I C;  3A4U B;  4XJK B;  4A4C A;  3I5H C;  1B8L A;  1Y1X A;  1F4O A;  4QJ4 B;  1QTX A;  2F3Z A;  1OMD A;  3CWG A;  3JVT C;  2M97 A;  1KSM A;  2KDH A;  5ER4 X;  2PVB A;  1DJI A;  2L50 A;  1DJH A;  3QRX A;  1DJY A;  3O2P A;  2JPT A;  1AP4 A;  2K0J A;  2MA2 A;  4MSP A;  4U8D A;  2JT0 A;  4ETO A;  2Y1N A;  3NXA A;  4PE1 A;  1DF0 A;  3I5G B;  2HPS A;  1S6J A;  1RRO A;  3PFV A;  3I5F B;  2BCX A;  3CGA A;  2G2B A;  4I5J A;  4PAL A;  4PCW A;  1J1D A;  4I5L B;  2LP3 A;  3PSR A;  4PHK A;  2F2O A;  1WRK A;  1TRF A;  2LC5 A;  5JOL A;  3SG4 A;  1YRT B;  3NSL A;  1NIW A;  1EXR A;  1S6I A;  2LNK A;  2LVI A;  4YBH B;  1S26 D;  4HRE E;  1F70 A;  2MJW B;  1OMV A;  3DVK A;  1DMO A;  5KSZ A;  1ZUZ A;  1ZAC A;  3VRN A;  3O4Y A;  2HET A;  2PMY A;  1UP5 A;  1JSA A;  2BL0 C;  1CKK A;  2LLT A;  1A75 A;  1XO5 A;  1FBV A;  4M2O A;  3O78 A;  2QAC A;  1V1F A;  2BBM A;  4GAO A;  4PHJ A;  1G4Y R;  1YUT A;  4WQ2 A;  2WCB A;  2KAV A;  4ZCV A;  1XA5 A;  1XYD A;  1TCO B;  3BYA A;  3EKH A;  1OMR A;  3DVE A;  1EL4 A;  1X02 A;  1L2O C;  2L5X B;  4YGB B;  1QLK A;  1K8U A;  3FIA A;  2E30 A;  3BXK A;  1MWN A;  2VRG A;  1B8C A;  5CSN A;  1GJY A;  1BG1 A;  2Q4U A;  4MZJ A;  2ZRS A;  4HSZ A;  1LA0 A;  4OCI A;  2AAO A;  1YUS A;  3OP0 A;  1AJ4 A;  2LHI A;  3JTD C;  1S5G Y;  2ZRT A;  4YGC B;  1FF1 A;  3FWB A;  2BE6 A;  1KK8 B;  2CCM A;  2KI4 B;  1RK9 A;  1AHR A;  1B8R A;  1J1E A;  1MR8 A;  2BE4 A;  2K7C A;  2PAL A;  3GK2 A;  3LK0 A;  2JZI A;  1F8H A;  1XFW O;  3LK1 A;  3I5I B;  3TUY C;  1NX3 A;  1JWD A;  5DKR A;  3I5H B;  3GOF A;  1WDC C;  2FJU B;  1CNP A;  1OSA A;  2ZN8 A;  1CDM A;  3JVT B;  2H61 A;  1DF0 B;  1Y6W A;  1VRK A;  1OQP A;  1Y0V H;  3LLE A;  3F45 A;  4MRX A;  1NX1 A;  1S5G Z;  1TN4 A;  5FYX A;  1J7O A;  2I94 A;  2JRF A;  2KQ6 A;  3C1V A;  2K7O A;  2JTZ A;  3WHT B;  1RJV A;  4ZCU A;  2MLE C;  2NCO A;  4MRY A;  3CR5 X;  3AAJ A;  1NX2 A;  2IS9 A;  3CZT X;  5JJG A;  5I2Q A;  1BOC A;  1QS7 A;  1AVS A;  1TIZ A;  2K2A A;  4Q04 A;  5AFP A;  1E8A A;  3AAK A;  3VRO A;  5HYD A;  1WLZ A;  5I2O A;  2F3Y A;  2PSR A;  3FWC A;  1S6C A;  5J3X A;  4HRG A;  1NCY A;  3TDZ A;  4P5O E;  4A4B A;  1JFJ A;  3K21 A;  2KOT A;  1CB1 A;  2OPO A;  1B7T Y;  3RLZ A;  4YI8 A;  1S3P A;  3NSI A;  4PE7 A;  1UHN A;  2EHB A;  1W7J B;  2BL0 B;  4CFR A;  3SG6 A;  2R2I A;  1A29 A;  1B9A A;  1KSO A;  4N5X A;  1DJZ A;  2B1U A;  2OTG C;  1PVB A;  1DTL A;  1J7R A;  2KI6 D;  3BQ3 A;  1XFY O;  1L7Z A;  1UHJ A;  1CM4 A;  1IJ6 A;  2RGI A;  3DVJ A;  5DKN A;  5F6T A;  4JQ0 D;  4FQO A;  2MHH A;  5BPJ A;  4YGE B;  2LMU A;  4GGN A;  4DUQ A;  3PN7 C;  1F54 A;  1L2O B;  3AKA A;  2EGD A;  1G33 A;  2O60 A;  3TS5 C;  1LVC D;  1JF0 A;  3CTN A;  1Y1A A;  1EH2 A;  2CTN A;  1QIW A;  5HLV A;  4QJ5 B;  2LM5 A;  4CLN A;  3CLN A;  2H2K A;  3BUX B;  1SBJ A;  4GPL B;  4MVF A;  4YGD B;  2M9G A;  1CFF A;  1W7I B;  5KTY A;  2L4I A;  1OZS A;  1GQM A;  1Q80 A;  4I5K A;  1IWQ A;  4PHM A;  2M8U A;  5KU1 A;  2K2F A;  3ZNI A;  4YI9 A;  2LAP A;  2COL B;  1MXE A;  1J7P A;  2K7B A;  2OS8 C;  3TZ1 A;  4YRU A;  1SY9 A;  2KHN A;  3AKB A;  1CDP A;  2LVK A;  4N1F A; 
#chains in the Genus database with same CATH topology
 4AQI A;  1A2X A;  4PHN A;  1CMF A;  1SCM C;  3CR2 A;  1OOJ A;  2BNX A;  3JVT B;  2BEC A;  3EK8 A;  2CXJ A;  4NDB A;  3B86 A;  2PYQ A;  4NDC A;  1FI6 A;  1PAL A;  4BY5 A;  2ZKM X;  1LA3 A;  3R72 A;  1U5I B;  1RFJ A;  1IQ5 A;  2WCF A;  2M3W A;  3DXL A;  4C0J A;  1EG4 A;  1BF5 A;  4ORA B;  2QEV A;  1UWO A;  2WC8 A;  3EK4 A;  1K2H A;  1JC2 A;  3LCP C;  1SL7 A;  3DF0 A;  1NSH A;  5AEQ A;  3RZS A;  1CLB A;  3BFH A;  3KF9 A;  4DS7 A;  1DEK A;  4C0L A;  1SKT A;  2JNX A;  4PE4 A;  2G9B A;  1PVA A;  4UPG A;  1H4B A;  2K60 A;  2CT9 A;  2O5G A;  1M31 A;  4FTG A;  1DJW A;  1IJ5 A;  2KYF A;  1KWO C;  2LE9 B;  4DRW A;  1IRJ A;  1LS8 A;  3PM8 A;  4P2Y B;  5TNC A;  3OX6 A;  1N2D A;  1IKU A;  2MLF C;  2MRD A;  1NYA A;  1AK8 A;  1PSB A;  2E6W A;  1J55 A;  2BKH B;  2OTG B;  5HKW A;  1BU3 A;  2H61 C;  1ZMZ A;  3D76 A;  3D78 A;  2JC2 A;  3D10 A;  4ICB A;  2KI6 C;  1XFU O;  4MZL A;  1OOH A;  2JOJ A;  5AER A;  5AAN A;  1FI5 A;  4OV2 A;  3TDU A;  5HL1 A;  5CSI A;  3PN7 B;  1M63 B;  1QX7 A;  1CMG A;  3D0Y A;  1K9P A;  3TS5 B;  3SG5 A;  1K96 A;  2ZFD A;  4HRH A;  3VRQ A;  1WLM A;  3BJH A;  2JU0 A;  3KHE A;  3IF7 A;  4M2P A;  2HQW A;  2SCP A;  3E3R A;  3SG3 A;  1B4C A;  2GGM A;  3O6B A;  4IJ7 A;  1PRW A;  2HQ8 A;  1KFU L;  3OB1 B;  3DVM A;  3OB2 B;  4I5N B;  3MSE B;  2GTE A;  4M2Q A;  2P6B B;  3SS4 A;  2NCP A;  1GGW A;  1KQM C;  4CFQ A;  1WRL A;  2Q91 A;  3SS5 A;  4L9M A;  4YGA A;  3I5F C;  3EKJ A;  2AUC A;  1UUS A;  4GGF C;  1F55 A;  4C0K A;  1A75 B;  1TTX A;  3OX5 A;  1DC1 A;  1K94 A;  3IQO A;  3GK1 A;  5CSF A;  2I18 A;  3WXA A;  3M0W A;  2WCE A;  4CID A;  1M46 A;  4F7F A;  3CZ0 A;  1BLQ A;  1OOF A;  2L51 A;  2LV7 A;  1OOG A;  1KK7 Y;  1SR6 C;  1SCM B;  1ALW A;  1GGZ A;  3FE9 A;  4D1E A;  1KFX L;  2V53 A;  4CPV A;  4GGF A;  2KQY A;  3PLF B;  2WCK A;  4R1E A;  5HKY A;  3BOW A;  1QWV A;  3ICB A;  2P71 A;  1TNP A;  1R6P A;  4OZD A;  2JPO A;  3SG7 A;  3VGO A;  2FOT A;  5IBW A;  1DT7 B;  3D73 A;  4JKT A;  1K9K A;  1KK7 Z;  1ODB A;  2LLU A;  1DGU A;  2I2R E;  1JUO A;  1B47 A;  1QX2 A;  2JWW A;  5HKZ A;  2M1U A;  1CDN A;  1Z2C B;  3BFB A;  2A4J A;  2LVV A;  1B1G A;  1K95 A;  1M45 A;  2KSP A;  1KWO B;  2KYC A;  2NXQ A;  2QDI A;  1V1G A;  1KCY A;  1DQE A;  1MHO A;  3Q8I A;  1C7W A;  4ORB B;  2WCL A;  4WRI A;  3SJS A;  1S1E A;  1MXL C;  3D0Y B;  3NSO A;  5B8I B;  4GNK B;  1QLS A;  3LL8 B;  4BY4 A;  2WC5 A;  3GK4 X;  3JTD B;  4OVN F;  4WQ3 A;  3SIB A;  1JF2 A;  1KFU S;  2L2E A;  1S36 A;  4JWQ A;  1NPQ A;  4DCK A;  1SYM A;  4OKH A;  2Y4Q A;  3L4A A;  1XVJ A;  1YX7 A;  3TUY B;  1XFX O;  2BBN A;  1A03 A;  1NP8 A;  1WDC B;  1BR4 B;  3RM1 A;  2KAX A;  2JT3 A;  2M1K B;  2F33 A;  1A4P A;  1YTZ C;  2K61 A;  3H4S E;  5D69 A;  2LUC A;  3N7H A;  4QJ3 B;  1C07 A;  1SW8 A;  1YVH A;  1UHK A;  3NHT A;  4MBE A;  2D8N A;  2ZND A;  1XFZ O;  1HQV A;  2EC6 C;  4PDZ A;  2NLN A;  1RTP 1;  4AQJ A;  3DD4 A;  1CFP A;  1J7Q A;  1MF8 B;  1CLL A;  1QJT A;  1KFX S;  1CLM A;  1YRU B;  3CZ2 A;  2FCD A;  3IQQ A;  3DY9 A;  1CFD A;  1FPW A;  2QPT A;  1T14 A;  4OR9 B;  1KQM B;  1KQV A;  1SCV A;  1QV1 A;  4MZK A;  3PAL A;  2PAS A;  2LP2 A;  2Y5I A;  2JQ6 A;  1NWD A;  1BMO A;  2JTT A;  3SG2 A;  4MEW A;  3BOW B;  5AXI A;  4NDD A;  2KBM A;  1Y1U A;  1YX8 A;  1M39 A;  2JUL A;  2WOR A;  5DKQ A;  1MQ1 A;  2P70 A;  2WCH A;  2ZN9 A;  3NSK A;  5G08 A;  1SR6 B;  4PE0 A;  3EVU A;  1HT9 A;  2LVJ A;  2WND A;  3BUN B;  2CNP A;  2KFH A;  2JXC A;  1CM1 A;  1QAT A;  1CDL A;  2BCA A;  2HF5 A;  1QV0 A;  2TN4 A;  5CSJ A;  5FI2 A;  3K1E A;  3KO0 A;  2KFF A;  1LKJ A;  3KEV A;  4KYN A;  5PAL A;  2BCB A;  1RWY A;  4MN0 A;  2JXL A;  2KGB C;  4JD9 A;  1IQ3 A;  2BKI B;  4JPZ B;  1CFC A;  1QXP A;  1XFV O;  1XK4 C;  3EVV A;  1OZO A;  1C3Y A;  1IG5 A;  1SPY A;  2KAY A;  1AJ5 A;  1WRZ A;  1H8B A;  1IGV A;  2L4H A;  1G8I A;  1UHH A;  4INX A;  1ALV A;  4NQG A;  5EL2 A;  2KLD A;  1NCX A;  2L0P A;  1SL9 A;  2GGZ A;  1REC A;  1F71 A;  2LCP A;  4GUK A;  5GQQ C;  3OGN A;  1XK4 A;  2LMT A;  2M49 B;  2Y1M A;  1ZFS A;  1EJ3 A;  1UUR A;  2LHL A;  1BJF A;  3VRP A;  3R1O A;  1QX5 B;  1BR1 B;  3NGV A;  4XJK A;  3S0D A;  1N65 A;  1Z4H A;  2NZ0 A;  4TNC A;  3VRR A;  1JBA A;  2SAS A;  1YUR A;  4DIR A;  3I5G C;  3ZWH A;  5K89 A;  1YVL A;  1OE9 B;  1PUL A;  1DVI A;  5I94 A;  1DJG A;  1EG3 A;  1SK6 D;  4MLW A;  2OS8 B;  2DOQ A;  4N1G A;  4ORC B;  5CPV A;  2KLE A;  2JNF A;  3L4L A;  3WHU B;  1IH0 A;  4F0Z B;  1QVI Y;  1UHI A;  1JFK A;  2LMV A;  3DF0 B;  3SIA A;  4FQT A;  1LIN A;  5HLO A;  1ZOT B;  1TNX A;  1BT6 A;  1QIV A;  1SRA A;  1QAS A;  2EC6 B;  2WOS A;  3HCM A;  3A8R A;  3HX4 A;  3SS3 A;  3WNX B;  1XFR A;  3BUW B;  2JT8 A;  2WCJ A;  3TDI A;  1TNQ A;  1TOP A;  2KBI A;  1MUX A;  2PRU A;  2MBX A;  4AOM A;  2ISD A;  3CS1 A;  5D3O A;  3S0E A;  1K90 D;  5I8N A;  1QVI Z;  2M7L A;  2I7A A;  4INW A;  2LLS A;  1K9U A;  3EK7 A;  5DIC A;  1NX0 A;  1YR5 A;  3OHM B;  1SMG A;  2FCE A;  3NHI A;  2KGR A;  3PAT A;  1N0Y A;  1F4Q A;  2KNE A;  1DGV A;  2M29 A;  4USL A;  1PSR A;  3CR4 X;  4XYN A;  1CTR A;  1U5I A;  2L98 A;  1TNW A;  2F8P A;  2BAP A;  1D1O A;  2M0R A;  4GBA A;  1PK0 D;  1LXF C;  1WY9 A;  2M7N A;  4E68 A;  3D75 A;  3KPX A;  1K93 D;  1IIO A;  3EG5 B;  5ER5 A;  2F2P A;  2LAN A;  1TCF A;  1SL8 A;  2CBL A;  2GV5 A;  2QEB A;  1FW4 A;  2KFG A;  3EVR A;  2K7D A;  3BUO B;  3FE8 A;  1C7V A;  1NCZ A;  3B7A A;  2AMI A;  2ZNE A;  3BUM B;  1NUB A;  1R2U A;  1SNL A;  1KK8 C;  1B7T Z;  2K8M B;  2KI4 C;  1YUU A;  5I2L A;  2LUX A;  5D7F A;  1AUI B;  2MAZ A;  3FS7 A;  3CZ1 A;  4GFT A;  4IL1 A;  1DJX A;  1BOD A;  3I5I C;  3A4U B;  4XJK B;  4A4C A;  3I5H C;  1B8L A;  1Y1X A;  1F4O A;  4QJ4 B;  1QTX A;  2F3Z A;  1OMD A;  3CWG A;  3JVT C;  2M97 A;  1KSM A;  2KDH A;  5ER4 X;  3B87 A;  2PVB A;  1DJI A;  2L50 A;  1DJH A;  3QRX A;  1DJY A;  3O2P A;  2JPT A;  1AP4 A;  2K0J A;  2MA2 A;  3B6X A;  1TUJ A;  1TWO A;  4MSP A;  4U8D A;  1SSE B;  2JT0 A;  2Y1N A;  4ETO A;  3NXA A;  4PE1 A;  1DF0 A;  3I5G B;  2HPS A;  1S6J A;  3FE6 A;  1RRO A;  3PFV A;  3I5F B;  2BCX A;  3CGA A;  3L47 A;  2G2B A;  4I5J A;  4PAL A;  4PCW A;  1J1D A;  4I5L B;  2LP3 A;  3PSR A;  4PHK A;  2F2O A;  1WRK A;  1TRF A;  2LC5 A;  5JOL A;  3SG4 A;  1YRT B;  3NSL A;  1NIW A;  1EXR A;  1S6I A;  2LNK A;  2LVI A;  4YBH B;  1S26 D;  4HRE E;  1F70 A;  2MJW B;  3D74 A;  1OMV A;  3DVK A;  1DMO A;  1C3Z A;  5KSZ A;  1ZUZ A;  1ZAC A;  3S0B A;  3VRN A;  3O4Y A;  2HET A;  2PMY A;  2PQL A;  1OOI X;  3DYE A;  1UP5 A;  1JSA A;  2BL0 C;  1CKK A;  2LLT A;  1A75 A;  1XO5 A;  1FBV A;  4M2O A;  3O78 A;  2QAC A;  1V1F A;  2BBM A;  2WCM A;  4GAO A;  3D77 A;  4PHJ A;  3V2L A;  1G4Y R;  1YUT A;  4WQ2 A;  2WCB A;  2KAV A;  4ZCV A;  1OW4 A;  1XA5 A;  1XYD A;  1TCO B;  3BYA A;  3EKH A;  1OMR A;  3DVE A;  1EL4 A;  1X02 A;  1L2O C;  2L5X B;  4YGB B;  1QLK A;  1K8U A;  2WC6 A;  2E30 A;  3CDN A;  3BXK A;  1MWN A;  3FIA A;  2VRG A;  1B8C A;  5CSN A;  1GJY A;  1BG1 A;  2Q4U A;  4MZJ A;  2ZRS A;  4HSZ A;  1LA0 A;  4OCI A;  2AAO A;  1YUS A;  3OP0 A;  1AJ4 A;  2LHI A;  3JTD C;  1S5G Y;  2ZRT A;  4PT1 A;  4YGC B;  3VB1 A;  1FF1 A;  3FWB A;  2BE6 A;  1KK8 B;  2CCM A;  2KI4 B;  1RK9 A;  1AHR A;  1B8R A;  1J1E A;  1MR8 A;  2BE4 A;  2K7C A;  2PAL A;  3GK2 A;  3LK0 A;  2JZI A;  1F8H A;  1XFW O;  3LK1 A;  3I5I B;  3TUY C;  1NX3 A;  1JWD A;  5DKR A;  3I5H B;  3GOF A;  1WDC C;  1P28 A;  1GM0 A;  3DZT A;  3B88 A;  2FJU B;  1CNP A;  1OSA A;  2ZN8 A;  1CDM A;  2QEH A;  1ORG A;  1DF0 B;  1Y6W A;  1VRK A;  1Y0V H;  1OQP A;  2H61 A;  3LLE A;  3F45 A;  4MRX A;  2ERB A;  1NX1 A;  1S5G Z;  1TN4 A;  2KPH A;  5FYX A;  2I94 A;  1J7O A;  2JRF A;  2KQ6 A;  5FI7 A;  3C1V A;  2K7O A;  3CAB A;  2JTZ A;  3R1P A;  3WHT B;  1RJV A;  4ZCU A;  3BFA A;  2MLE C;  2NCO A;  4MRY A;  3CR5 X;  3AAJ A;  1NX2 A;  2IS9 A;  3CZT X;  5JJG A;  5I2Q A;  1BOC A;  1QS7 A;  1AVS A;  1TIZ A;  2K2A A;  3CYZ A;  4Q04 A;  5AFP A;  1E8A A;  3AAK A;  3VRO A;  5HYD A;  1WLZ A;  5I2O A;  2F3Y A;  2PSR A;  3FWC A;  1S6C A;  5J3X A;  4HRG A;  1NCY A;  3TDZ A;  2QEO A;  4P5O E;  4A4B A;  1JFJ A;  3K21 A;  2KOT A;  1CB1 A;  2OPO A;  1B7T Y;  3RLZ A;  4YI8 A;  1S3P A;  3NSI A;  4PE7 A;  1UHN A;  2EHB A;  1W7J B;  2BL0 B;  4CFR A;  3SG6 A;  2L2C A;  3S0A A;  2R2I A;  1A29 A;  1B9A A;  1KSO A;  4N5X A;  1DJZ A;  3UO9 A;  2B1U A;  2OTG C;  1PVB A;  1DTL A;  3O4X A;  1J7R A;  2KI6 D;  3UNW A;  3BQ3 A;  1XFY O;  3R1V A;  1L7Z A;  1UHJ A;  1CM4 A;  1IJ6 A;  2FJY A;  2RGI A;  3DVJ A;  5DKN A;  4JQ0 D;  5F6T A;  4FQO A;  5FI6 A;  2MHH A;  5BPJ A;  2YGU A;  4YGE B;  2LMU A;  4GGN A;  4DUQ A;  3PN7 C;  3OBV A;  1L2O B;  1F54 A;  3AKA A;  2EGD A;  1G33 A;  2O60 A;  3IVT A;  1LVC D;  1JF0 A;  3CTN A;  1Y1A A;  2H8V A;  3TS5 C;  2CTN A;  2L5Y A;  1QIW A;  5HLV A;  1EH2 A;  4QJ5 B;  2LM5 A;  4CLN A;  3CLN A;  1W9Z A;  2H2K A;  3BUX B;  1SBJ A;  4GPL B;  4MVF A;  1TUZ A;  4YGD B;  2M9G A;  1CFF A;  1W7I B;  5KTY A;  2L4I A;  1OZS A;  1GQM A;  1Q80 A;  4I5K A;  3QME A;  1IWQ A;  4PHM A;  2M8U A;  5KU1 A;  1DEL A;  2K2F A;  3ZNI A;  4YI9 A;  3S0F A;  2LAP A;  3PM2 A;  2COL B;  3PJI A;  1MXE A;  1J7P A;  2K7B A;  2OS8 C;  3TZ1 A;  4YRU A;  3S0G A;  1SY9 A;  2KHN A;  3AKB A;  1CDP A;  2LVK A;  4N1F A; 
#chains in the Genus database with same CATH homology
 4AQI A;  1A2X A;  4PHN A;  1CMF A;  1SCM C;  3CR2 A;  1OOJ A;  2BEC A;  3EK8 A;  2CXJ A;  4NDB A;  1FI6 A;  4NDC A;  1PAL A;  4BY5 A;  2ZKM X;  1LA3 A;  1U5I B;  1RFJ A;  1IQ5 A;  2WCF A;  2M3W A;  4C0J A;  1BF5 A;  1EG4 A;  4ORA B;  1UWO A;  2WC8 A;  3EK4 A;  1K2H A;  1JC2 A;  3LCP C;  1SL7 A;  3DF0 A;  1NSH A;  5AEQ A;  1CLB A;  3KF9 A;  4DS7 A;  4C0L A;  1SKT A;  2JNX A;  4PE4 A;  2G9B A;  1PVA A;  4UPG A;  1H4B A;  2CT9 A;  2O5G A;  1M31 A;  4FTG A;  1DJW A;  1IJ5 A;  2KYF A;  1KWO C;  2LE9 B;  4DRW A;  1IRJ A;  3PM8 A;  4P2Y B;  5TNC A;  3OX6 A;  1N2D A;  1IKU A;  2MLF C;  2MRD A;  1NYA A;  1AK8 A;  1PSB A;  2E6W A;  1J55 A;  2BKH B;  2OTG B;  5HKW A;  1BU3 A;  2H61 C;  1ZMZ A;  2JC2 A;  3D10 A;  4ICB A;  2KI6 C;  1XFU O;  4MZL A;  2JOJ A;  5AER A;  5AAN A;  1FI5 A;  4OV2 A;  3TDU A;  5CSI A;  3PN7 B;  1M63 B;  1QX7 A;  1CMG A;  3D0Y A;  1K9P A;  3TS5 B;  3SG5 A;  1K96 A;  2ZFD A;  4HRH A;  3VRQ A;  1WLM A;  2JU0 A;  3KHE A;  3IF7 A;  4M2P A;  2HQW A;  2SCP A;  3E3R A;  3SG3 A;  1B4C A;  2GGM A;  3O6B A;  1PRW A;  2HQ8 A;  1KFU L;  3OB1 B;  3DVM A;  3OB2 B;  4I5N B;  3MSE B;  4M2Q A;  2P6B B;  2NCP A;  1GGW A;  1KQM C;  4CFQ A;  1WRL A;  2Q91 A;  4L9M A;  4YGA A;  3I5F C;  3EKJ A;  2AUC A;  1UUS A;  4GGF C;  1F55 A;  4C0K A;  1A75 B;  1TTX A;  3OX5 A;  1K94 A;  3IQO A;  3GK1 A;  5CSF A;  2I18 A;  3WXA A;  3M0W A;  2WCE A;  4CID A;  1M46 A;  1BLQ A;  2L51 A;  2LV7 A;  1KK7 Y;  1SR6 C;  1SCM B;  1ALW A;  1GGZ A;  4D1E A;  1KFX L;  2V53 A;  4CPV A;  4GGF A;  2KQY A;  3PLF B;  4R1E A;  5HKY A;  3BOW A;  3ICB A;  1TNP A;  1R6P A;  3SG7 A;  3VGO A;  2FOT A;  5IBW A;  1DT7 B;  1K9K A;  1KK7 Z;  1ODB A;  2LLU A;  1DGU A;  2I2R E;  1JUO A;  1B47 A;  1QX2 A;  2JWW A;  5HKZ A;  2M1U A;  1CDN A;  2A4J A;  2LVV A;  1B1G A;  1K95 A;  1M45 A;  2KSP A;  1KWO B;  2KYC A;  2NXQ A;  1V1G A;  1KCY A;  1MHO A;  1C7W A;  4ORB B;  4WRI A;  3SJS A;  1S1E A;  1MXL C;  3D0Y B;  3NSO A;  5B8I B;  4GNK B;  1QLS A;  3LL8 B;  4BY4 A;  3GK4 X;  4OVN F;  3JTD B;  3SIB A;  4WQ3 A;  1JF2 A;  1KFU S;  2L2E A;  1S36 A;  4JWQ A;  1NPQ A;  4DCK A;  1SYM A;  4OKH A;  2Y4Q A;  1XVJ A;  1YX7 A;  3TUY B;  1XFX O;  2BBN A;  1A03 A;  1NP8 A;  1WDC B;  1BR4 B;  3RM1 A;  2KAX A;  2JT3 A;  2M1K B;  2F33 A;  1A4P A;  1YTZ C;  2K61 A;  3H4S E;  5D69 A;  2LUC A;  4QJ3 B;  1C07 A;  1SW8 A;  1YVH A;  1UHK A;  4MBE A;  2D8N A;  2ZND A;  1XFZ O;  1HQV A;  2EC6 C;  4PDZ A;  2NLN A;  1RTP 1;  4AQJ A;  3DD4 A;  1CFP A;  1J7Q A;  1MF8 B;  1CLL A;  1QJT A;  1KFX S;  1CLM A;  1YRU B;  3IQQ A;  2FCD A;  1CFD A;  1FPW A;  2QPT A;  4OR9 B;  1KQM B;  1KQV A;  1SCV A;  1QV1 A;  4MZK A;  3PAL A;  2PAS A;  2LP2 A;  2Y5I A;  2JQ6 A;  1NWD A;  1BMO A;  2JTT A;  3SG2 A;  4MEW A;  3BOW B;  5AXI A;  4NDD A;  2KBM A;  1Y1U A;  1YX8 A;  1M39 A;  2JUL A;  2WOR A;  5DKQ A;  1MQ1 A;  2ZN9 A;  3NSK A;  5G08 A;  1SR6 B;  4PE0 A;  3EVU A;  1HT9 A;  2LVJ A;  2WND A;  3BUN B;  2CNP A;  2KFH A;  2JXC A;  1CM1 A;  1QAT A;  1CDL A;  2BCA A;  2HF5 A;  1QV0 A;  2TN4 A;  5CSJ A;  3KO0 A;  2KFF A;  1LKJ A;  3KEV A;  5PAL A;  2BCB A;  1RWY A;  4MN0 A;  2JXL A;  2KGB C;  1IQ3 A;  2BKI B;  4JPZ B;  1CFC A;  1QXP A;  1XFV O;  1XK4 C;  3EVV A;  1OZO A;  1IG5 A;  1SPY A;  2KAY A;  1AJ5 A;  1WRZ A;  1H8B A;  1IGV A;  2L4H A;  1G8I A;  1UHH A;  1ALV A;  4NQG A;  1NCX A;  2L0P A;  1SL9 A;  2GGZ A;  1REC A;  1F71 A;  2LCP A;  4GUK A;  5GQQ C;  1XK4 A;  2LMT A;  2M49 B;  2Y1M A;  1ZFS A;  1EJ3 A;  1UUR A;  2LHL A;  1BJF A;  3VRP A;  1QX5 B;  1BR1 B;  4XJK A;  1N65 A;  2NZ0 A;  4TNC A;  3VRR A;  1JBA A;  2SAS A;  1YUR A;  4DIR A;  3I5G C;  3ZWH A;  5K89 A;  1YVL A;  1OE9 B;  1PUL A;  1DVI A;  1DJG A;  1EG3 A;  1SK6 D;  4MLW A;  2OS8 B;  2DOQ A;  4N1G A;  4ORC B;  5CPV A;  3WHU B;  2JNF A;  1IH0 A;  4F0Z B;  1QVI Y;  1UHI A;  1JFK A;  2LMV A;  3DF0 B;  3SIA A;  1LIN A;  5HLO A;  1ZOT B;  1TNX A;  1BT6 A;  1QIV A;  1SRA A;  1QAS A;  2EC6 B;  2WOS A;  3HCM A;  3A8R A;  3HX4 A;  3WNX B;  3BUW B;  2JT8 A;  3TDI A;  1TNQ A;  1TOP A;  2KBI A;  1MUX A;  2PRU A;  2MBX A;  4AOM A;  2ISD A;  3CS1 A;  1K90 D;  5I8N A;  1QVI Z;  2M7L A;  2I7A A;  2LLS A;  1K9U A;  3EK7 A;  1NX0 A;  1YR5 A;  3OHM B;  1SMG A;  2FCE A;  3PAT A;  2KGR A;  1N0Y A;  1F4Q A;  2KNE A;  1DGV A;  2M29 A;  4USL A;  1PSR A;  3CR4 X;  4XYN A;  1CTR A;  1U5I A;  2L98 A;  1TNW A;  2F8P A;  1D1O A;  2M0R A;  4GBA A;  1PK0 D;  1LXF C;  1WY9 A;  2M7N A;  4E68 A;  3KPX A;  1K93 D;  5ER5 A;  2F2P A;  2LAN A;  1TCF A;  1SL8 A;  2CBL A;  2GV5 A;  1FW4 A;  2KFG A;  3EVR A;  2K7D A;  3BUO B;  1C7V A;  1NCZ A;  2AMI A;  2ZNE A;  3BUM B;  1NUB A;  1R2U A;  1SNL A;  1KK8 C;  1B7T Z;  2K8M B;  2KI4 C;  1YUU A;  5I2L A;  2LUX A;  5D7F A;  1AUI B;  2MAZ A;  3FS7 A;  4GFT A;  4IL1 A;  1DJX A;  1BOD A;  3I5I C;  3A4U B;  4XJK B;  4A4C A;  3I5H C;  1B8L A;  1Y1X A;  1F4O A;  4QJ4 B;  1QTX A;  2F3Z A;  1OMD A;  3CWG A;  3JVT C;  2M97 A;  1KSM A;  2KDH A;  5ER4 X;  2PVB A;  1DJI A;  2L50 A;  1DJH A;  3QRX A;  1DJY A;  3O2P A;  2JPT A;  1AP4 A;  2K0J A;  2MA2 A;  4MSP A;  4U8D A;  2JT0 A;  4ETO A;  2Y1N A;  3NXA A;  4PE1 A;  1DF0 A;  3I5G B;  2HPS A;  1S6J A;  1RRO A;  3PFV A;  3I5F B;  2BCX A;  3CGA A;  2G2B A;  4I5J A;  4PAL A;  4PCW A;  1J1D A;  4I5L B;  2LP3 A;  3PSR A;  4PHK A;  2F2O A;  1WRK A;  1TRF A;  2LC5 A;  5JOL A;  3SG4 A;  1YRT B;  3NSL A;  1NIW A;  1EXR A;  1S6I A;  2LNK A;  2LVI A;  4YBH B;  1S26 D;  4HRE E;  1F70 A;  2MJW B;  1OMV A;  3DVK A;  1DMO A;  5KSZ A;  1ZUZ A;  1ZAC A;  3VRN A;  3O4Y A;  2HET A;  2PMY A;  1UP5 A;  1JSA A;  2BL0 C;  1CKK A;  2LLT A;  1A75 A;  1XO5 A;  1FBV A;  4M2O A;  3O78 A;  2QAC A;  1V1F A;  2BBM A;  4GAO A;  4PHJ A;  1G4Y R;  1YUT A;  4WQ2 A;  2WCB A;  2KAV A;  4ZCV A;  1XA5 A;  1XYD A;  1TCO B;  3BYA A;  3EKH A;  1OMR A;  3DVE A;  1EL4 A;  1X02 A;  1L2O C;  2L5X B;  4YGB B;  1QLK A;  1K8U A;  3FIA A;  2E30 A;  3BXK A;  1MWN A;  2VRG A;  1B8C A;  5CSN A;  1GJY A;  1BG1 A;  2Q4U A;  4MZJ A;  2ZRS A;  4HSZ A;  1LA0 A;  4OCI A;  2AAO A;  1YUS A;  3OP0 A;  1AJ4 A;  2LHI A;  3JTD C;  1S5G Y;  2ZRT A;  4YGC B;  1FF1 A;  3FWB A;  2BE6 A;  1KK8 B;  2CCM A;  2KI4 B;  1RK9 A;  1AHR A;  1B8R A;  1J1E A;  1MR8 A;  2BE4 A;  2K7C A;  2PAL A;  3GK2 A;  3LK0 A;  2JZI A;  1F8H A;  1XFW O;  3LK1 A;  3I5I B;  3TUY C;  1NX3 A;  1JWD A;  5DKR A;  3I5H B;  3GOF A;  1WDC C;  2FJU B;  1CNP A;  1OSA A;  2ZN8 A;  1CDM A;  3JVT B;  2H61 A;  1DF0 B;  1Y6W A;  1VRK A;  1OQP A;  1Y0V H;  3LLE A;  3F45 A;  4MRX A;  1NX1 A;  1S5G Z;  1TN4 A;  5FYX A;  1J7O A;  2I94 A;  2JRF A;  2KQ6 A;  3C1V A;  2K7O A;  2JTZ A;  3WHT B;  1RJV A;  4ZCU A;  2MLE C;  2NCO A;  4MRY A;  3CR5 X;  3AAJ A;  1NX2 A;  2IS9 A;  3CZT X;  5JJG A;  5I2Q A;  1BOC A;  1QS7 A;  1AVS A;  1TIZ A;  2K2A A;  4Q04 A;  5AFP A;  1E8A A;  3AAK A;  3VRO A;  5HYD A;  1WLZ A;  5I2O A;  2F3Y A;  2PSR A;  3FWC A;  1S6C A;  5J3X A;  4HRG A;  1NCY A;  3TDZ A;  4P5O E;  4A4B A;  1JFJ A;  3K21 A;  2KOT A;  1CB1 A;  2OPO A;  1B7T Y;  3RLZ A;  4YI8 A;  1S3P A;  3NSI A;  4PE7 A;  1UHN A;  2EHB A;  1W7J B;  2BL0 B;  4CFR A;  3SG6 A;  2R2I A;  1A29 A;  1B9A A;  1KSO A;  4N5X A;  1DJZ A;  2B1U A;  2OTG C;  1PVB A;  1DTL A;  1J7R A;  2KI6 D;  3BQ3 A;  1XFY O;  1L7Z A;  1UHJ A;  1CM4 A;  1IJ6 A;  2RGI A;  3DVJ A;  5DKN A;  5F6T A;  4JQ0 D;  4FQO A;  2MHH A;  5BPJ A;  4YGE B;  2LMU A;  4GGN A;  4DUQ A;  3PN7 C;  1F54 A;  1L2O B;  3AKA A;  2EGD A;  1G33 A;  2O60 A;  3TS5 C;  1LVC D;  1JF0 A;  3CTN A;  1Y1A A;  1EH2 A;  2CTN A;  1QIW A;  5HLV A;  4QJ5 B;  2LM5 A;  4CLN A;  3CLN A;  2H2K A;  3BUX B;  1SBJ A;  4GPL B;  4MVF A;  4YGD B;  2M9G A;  1CFF A;  1W7I B;  5KTY A;  2L4I A;  1OZS A;  1GQM A;  1Q80 A;  4I5K A;  1IWQ A;  4PHM A;  2M8U A;  5KU1 A;  2K2F A;  3ZNI A;  4YI9 A;  2LAP A;  2COL B;  1MXE A;  1J7P A;  2K7B A;  2OS8 C;  3TZ1 A;  4YRU A;  1SY9 A;  2KHN A;  3AKB A;  1CDP A;  2LVK A;  4N1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...