5DKNA

Crystal structure of calcium-loaded s100b bound to sbi4225
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/inhibitor
molecule keywords Protein S100-B
publication title Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.
pubmed doi rcsb
source organism Bos taurus
total genus 32
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5dknA00
1N65A 3EKJA 4JWQA 1G33A 1RFJA 2I94A 2LUXA 2MHHA 3VRPA 1CMGA 2KGBC 2KNEA 4FQOA 1K95A 3CWGA 4YGCB 4XJKB 1CM1A 1IQ5A 3VRRA 5ER4X 3CLNA 1KFXL 1IQ3A 2LCPA 2BL0B 1J7OA 2JZIA 2EC6B 1YX7A 2LP2A 1BG1A 2KI4B 3TS5B 3I5GC 2JTTA 1UWOA 1DGVA 4PDZA 1WDCB 1WLZA 1EH2A 2OPOA 3BXKA 2JTZA 3CS1A 1HT9A 1LINA 4YGDB 2LM5A 3AKAA 4ZCUA 1ZMZA 3WNXB 1KSMA 1KSOA 5DKNA 2BCXA 3IF7A 3VRQA 3WHUB 1QX7A 2K2AA 2G2BA 1K94A 1LKJA 1XFUO 2PMYA 4Q04A 2BE6A 1CLBA 1IH0A 1B7TY 1IGVA 1NUBA 2B1UA 4PHJA 5DKQA 4PHNA 1R6PA 1JWDA 2LVJA 2NXQA 5PALA 2V53A 2FCEA 5JJGA 1ZACA 1TNQA 3NSIA 2K7CA 4CFRA 1CFDA 5CSFA 2HETA 1A75A 2JRFA 2MAZA 3I5IB 1J1EA 1YUUA 1J7PA 1M63B 1PK0D 5CSNA 2L0PA 5TNCA 2LAPA 1L2OC 1MXEA 1N0YA 3VGOA 1RROA 2BE4A 3EVVA 3GOFA 2KGRA 1Y6WA 2PALA 2I2RE 2KAVA 3BUWB 3D0YB 1K9UA 4MEWA 1SBJA 2M1UA 5HKYA 3OB2B 2NLNA 1TIZA 1UHJA 1MUXA 2JT3A 4MSPA 2KYFA 2L2EA 2MBXA 2CNPA 4NQGA 1YUTA 1KWOC 1F8HA 1YVHA 1CDPA 4PE7A 1TNWA 2O60A 4ORBB 2NCOA 2Y1MA 4TNCA 1NYAA 1UP5A 1SL7A 1SCVA 1XYDA 2KI6C 1CDMA 1IG5A 2KAXA 1SY9A 3OP0A 3SIBA 3VRNA 2CT9A 2QACA 1AHRA 2MJWB 5HKZA 2JU0A 3LCPC 3PSRA 3GK2A 5HLOA 2M1KB 1RJVA 2KI6D 5I2OA 2WC8A 3BYAA 1SW8A 4OKHA 1M39A 1OQPA 1Y1UA 1SYMA 2MLEC 4C0LA 2JC2A 4HSZA 1FBVA 3BQ3A 1Q80A 1XO5A 2L98A 3O6BA 3PFVA 1UHIA 4AQIA 1KFUL 2VRGA 1KFXS 3BUNB 5I8NA 2ZKMX 2COLB 2Y5IA 4M2PA 2NCPA 1CLLA 5KSZA 1AP4A 1DTLA 1RWYA 1QV1A 3WHTB 1XFWO 2JULA 2SASA 2ZNDA 1FI5A 2FCDA 2LMUA 4A4BA 2TN4A 1CDLA 1TCOB 1BU3A 1OOJA 1U5IA 2BCBA 1CTRA 1KQMC 4M2OA 4N1GA 3KF9A 2KBMA 1B47A 2O5GA 2K7OA 5CSJA 1K9KA 1NCYA 1QIWA 1NX3A 1PSRA 2IS9A 2E30A 3I5FB 4YI9A 3RLZA 1S26D 2CCMA 4F0ZB 2EGDA 1QTXA 1WY9A 4QJ4B 4MZJA 5CSIA 3EK4A 4P2YB 2BBNA 2BECA 4BY4A 4E68A 1D1OA 4C0KA 1DJIA 2LVKA 1E8AA 3D0YA 3JTDB 4GPLB 2F8PA 3I5HB 1B8RA 2FOTA 2JNXA 3PALA 5IBWA 1TN4A 1CKKA 1PSBA 1C7VA 1IRJA 2ZRTA 4YRUA 1AJ5A 1SR6C 5BPJA 4CFQA 2F33A 4GFTA 2L51A 4GAOA 3CGAA 3EKHA 4YI8A 1CMFA 1SCMB 1CNPA 1BLQA 1XFZO 3NSOA 2A4JA 1CDNA 1PULA 2WOSA 3GK4X 4P5OE 3M0WA 1DT7B 4PE0A 1J7QA 2WORA 2HF5A 2L5XB 1YRTB 1F4QA 2OTGB 2Q91A 3GK1A 1DF0B 2M49B 4NDDA 1B4CA 1OMDA 1TNPA 4AQJA 3BOWA 4DCKA 2GGZA 3JVTC 4WQ2A 3FIAA 4C0JA 3OX5A 2H2KA 3AAKA 1W7JB 4YGBB 2K7DA 3K21A 2WNDA 3CR4X 1DJYA 1RTP1 3OB1B 1JF2A 1N2DA 2M8UA 1XFXO 2KFFA 5CPVA 5J3XA 2WCEA 1XVJA 3CZTX 4MVFA 1IJ5A 1M45A 3I5GB 1JFJA 1KFUS 5JOLA 4MRYA 3CTNA 1ALVA 1TTXA 1S36A 3BUMB 1YX8A 1EG3A 1GQMA 5HYDA 1GJYA 2CXJA 2OS8C 3KEVA 2PSRA 4I5KA 1MXLC 5D7FA 3SG4A 1QVIY 2BKHB 2HQ8A 5DKRA 4PE1A 4IL1A 1J7RA 4PALA 1BMOA 1MR8A 4NDCA 1K93D 5G08A 3RM1A 4DIRA 4MBEA 3TUYB 4DUQA 1S6IA 4DRWA 2Y4QA 4ORAB 1S5GY 4YGAA 1KK8C 5F6TA 1B1GA 4GBAA 5B8IB 3AAJA 4ETOA 3TDIA 1FI6A 2CTNA 2G9BA 1K2HA 2DOQA 2KOTA 2FJUB 2JT0A 4XJKA 3F45A 2ZN9A 1MQ1A 4YBHB 1XFVO 2JXLA 1KCYA 1YR5A 1QIVA 1ZOTB 2LVVA 2LLUA 4BY5A 5KU1A 1M31A 1C07A 1XFYO 3SG2A 1K8UA 1XK4A 1YURA 2BKIB 4WQ3A 3ICBA 1B8CA 2GV5A 1Y0VH 1DVIA 1L7ZA 2SCPA 2JPTA 1BJFA 2R2IA 2LANA 3PN7C 1TNXA 3ZNIA 5AERA 3DVEA 1CFPA 2JWWA 3AKBA 2ZRSA 1DF0A 1PRWA 1SRAA 1G4YR 2F2OA 3DF0B 3EVUA 2ISDA 2LLTA 1BR4B 3TZ1A 1KWOB 2LMVA 3WXAA 1BR1B 2KQYA 4GGNA 5GQQC 4GUKA 3A4UB 4M2QA 2RGIA 4R1EA 3DD4A 1QX2A 4PCWA 1UHNA 1V1FA 3SG5A 1S3PA 3FWCA 3CR2A 1BODA 1NPQA 1PALA 2JQ6A 3I5HC 3PATA 2BL0C 4ORCB 1SL8A 2EC6C 1YRUB 2KI4C 2NZ0A 3KO0A 3TS5C 1BT6A 1GGZA 1QVIZ 2H61A 2LHLA 1J1DA 1NX2A 4N5XA 4PHKA 4OCIA 2LHIA 4QJ3B 3FWBA 1RECA 1BOCA 1UHKA 1XK4C 2M29A 2K7BA 1SCMC 1WDCC 1S5GZ 1PVBA 1NX0A 1LVCD 1IWQA 4ZCVA 1H8BA 4XYNA 1AVSA 1C7WA 4I5JA 2M0RA 2M3WA 1YVLA 3O2PA 1RK9A 2MLFC 2BBMA 3NXAA 3DVMA 1CM4A 1WRLA 2QPTA 1AK8A 4I5LB 4D1EA 1CFCA 1B9AA 3KHEA 1IJ6A 4PHMA 3MSEB 1DGUA 4UPGA 2KQ6A 1F55A 4YGEB 1VRKA 2L4IA 4U8DA 1SNLA 2PASA 1KQMB 2KBIA 1DMOA 1MHOA 1FW4A 1DJWA 2P6BB 3NSLA 1KQVA 2AUCA 4HREE 4JQ0D 1WLMA 1UUSA 3I5IC 2H61C 3O78A 1NCZA 1NX1A 4HRGA 1F71A 5AANA 3SG6A 3PM8A 5I2LA 5D69A 1ZUZA 1OE9B 1QATA 2Y1NA 3EK8A 1UHHA 2K0JA 2LV7A 1W7IB 3FS7A 3IQOA 3DF0A 2CBLA 3TUYC 5KTYA 3LLEA 1DJZA 3CR5X 1BF5A 2KSPA 3LL8B 5AXIA 1LA0A 1QLSA 3C1VA 1SR6B 1PVAA 1MWNA 3ZWHA 3OHMB 1F4OA 4GGFA 3SJSA 3TDZA 1S6JA 2Q4UA 2KFGA 2K2FA 2LLSA 2L4HA 2M7NA 2KYCA 1CB1A 1CFFA 1WRKA 2WCFA 2LUCA 2F3ZA 1U5IB 3SG3A 1V1GA 3OX6A 1H4BA 1DJXA 1QLKA 2JNFA 1SKTA 3DVKA 2LE9B 2JXCA 1JF0A 2L50A 4N1FA 2LP3A 4WRIA 1TOPA 3JVTB 5HLVA 1UURA 4L9MA 5ER5A 1SK6D 2MA2A 4MLWA 1K9PA 5AFPA 2PRUA 3QRXA 2ZN8A 1KK7Z 4JPZB 5FYXA 1QXPA 1GGWA 3LK0A 2E6WA 1ALWA 1J55A 1G8IA 1NCXA 3BUOB 1A2XA 3IQQA 2WCBA 4MN0A 4A4CA 1LA3A 4CPVA 2LC5A 3LK1A 1NIWA 1WRZA 2HPSA 3HCMA 4GNKB 4MZLA 1NP8A 2GGMA 4OR9B 1QJTA 1S1EA 1JFKA 2AMIA 1M46A 1L2OB 4HRHA 1EXRA 4GGFC 2K61A 4DS7A 3SIAA 4FTGA 2D8NA 1DJGA 2OS8B 3EK7A 2K8MB 4QJ5B 2JOJA 1QASA 2BCAA 2F3YA 2M97A 2HQWA 4NDBA 3BUXB 2KDHA 2ZFDA 1DJHA 3I5FC 3PLFB 2LNKA 4PE4A 1JC2A 1OZSA 1Y1XA 2LVIA 3A8RA 1KK8B 4OV2A 1OZOA 1AJ4A 1SMGA 3BOWB 4OVNF 2EHBA 3D10A 3EVRA 3H4SE 1MF8B 3JTDC 3E3RA 1A29A 1A4PA 1OMRA 4I5NB 1R2UA 1B7TZ 1B8LA 1ODBA 2I7AA 1EG4A 3DVJA 1K96A 2KFHA 2MRDA 1F70A 1SPYA 1FF1A 5I2QA 4CLNA 1SL9A 4USLA 1IKUA 1QS7A 1JBAA 1A75B 1OMVA 1TCFA 5K89A 2M9GA 2LMTA 1QX5B 3NSKA 3VROA 4AOMA 4MRXA 3SG7A 1YUSA 4MZKA 1EL4A 2JT8A 2M7LA 1ZFSA 3PN7B 2KHNA 1TRFA 3HX4A 1EJ3A 4ICBA 5AEQA 1OSAA 1QV0A 1Y1AA 1YTZC 1JSAA 2F2PA 3TDUA 1FPWA 2OTGC 1AUIB 1K90D 1LXFC 1NSHA 1F54A 2KAYA 2I18A 1KK7Y 4CIDA 2ZNEA 1NWDA 1A03A 1JUOA 3O4YA 1CLMA 5HKWA 1S6CA 3KPXA 1HQVA 1X02A 1XA5A 2PVBA 2AAOA
chains in the Genus database with same CATH superfamily
1N65A 3EKJA 4JWQA 1G33A 1RFJA 2I94A 2LUXA 2MHHA 5FI7A 3VRPA 1CMGA 2KGBC 2KNEA 4FQOA 1K95A 3CWGA 3NHTA 4XJKB 1CM1A 1IQ5A 4YGCB 5ER4X 3VRRA 3CLNA 1KFXL 1IQ3A 2LCPA 2BL0B 1J7OA 2JZIA 4JKTA 2EC6B 1YX7A 2LP2A 1BG1A 2KI4B 3TS5B 3I5GC 2WCMA 2JTTA 3NHIA 1Z4HA 1UWOA 1DGVA 4PDZA 2GTEA 1WDCB 1WLZA 3OBVA 1EH2A 2OPOA 3BXKA 2JTZA 3CS1A 5D3OA 1HT9A 1LINA 4YGDB 2LM5A 3AKAA 1XFRA 1ZMZA 4ZCUA 3VB1A 3WNXB 1KSMA 1KSOA 2L2CA 2BCXA 3IF7A 5DKNA 3VRQA 3WHUB 1QX7A 2K2AA 2G2BA 3FE8A 1K94A 1LKJA 1XFUO 2PMYA 3CYZA 2BE6A 4Q04A 1CLBA 1IH0A 1B7TY 1IGVA 1NUBA 2B1UA 4PHJA 5DKQA 4PHNA 1R6PA 1JWDA 2LVJA 2NXQA 5PALA 3EG5B 2V53A 2FCEA 5JJGA 1DC1A 1ZACA 1TNQA 3NSIA 2K7CA 4INWA 3CZ2A 4CFRA 1CFDA 5CSFA 1OOFA 2HETA 1A75A 2JRFA 2MAZA 3I5IB 1J1EA 1YUUA 1J7PA 1M63B 1PK0D 4INXA 5CSNA 2L0PA 5TNCA 2LAPA 1L2OC 1MXEA 1N0YA 3VGOA 1RROA 2BE4A 3EVVA 3GOFA 2KGRA 1Y6WA 4FQTA 2PALA 4IJ7A 2I2RE 2KAVA 3BUWB 3D0YB 1K9UA 4MEWA 1SBJA 2M1UA 5HKYA 3OB2B 2NLNA 1TIZA 1UHJA 1MUXA 2JT3A 4MSPA 2KYFA 2L2EA 2MBXA 2CNPA 4NQGA 1YUTA 1KWOC 3B87A 1F8HA 3S0EA 1YVHA 1CDPA 4PE7A 1TNWA 2O60A 4ORBB 2FJYA 2NCOA 2Y1MA 4TNCA 1NYAA 1UP5A 1SL7A 1SCVA 1XYDA 2KI6C 1CDMA 1IG5A 2KAXA 1SY9A 3OP0A 3SIBA 3VRNA 2CT9A 2QACA 1AHRA 2MJWB 5HKZA 2JU0A 3LCPC 3PSRA 3GK2A 5HLOA 2M1KB 1RJVA 2KI6D 5I2OA 2WC8A 3BYAA 1SW8A 4OKHA 1M39A 1OQPA 1Y1UA 1SYMA 2MLEC 4C0LA 2JC2A 2WC6A 4HSZA 1FBVA 3V2LA 3BQ3A 1TUJA 2KPHA 1Q80A 1XO5A 2L98A 3O6BA 3PFVA 1UHIA 4AQIA 1KFUL 2VRGA 1KFXS 3BUNB 5I8NA 2ZKMX 2COLB 2Y5IA 3D78A 4M2PA 2NCPA 1CLLA 5KSZA 2JPOA 1AP4A 1DTLA 1RWYA 1QV1A 3WHTB 3N7HA 1XFWO 2JULA 2SASA 2ZNDA 1FI5A 2FCDA 2LMUA 2WCJA 4A4BA 3L4LA 2TN4A 3CDNA 1CDLA 1TCOB 1BU3A 1OOJA 1U5IA 2BCBA 1CTRA 1KQMC 4M2OA 4N1GA 4JD9A 3KF9A 2KBMA 1B47A 2O5GA 2K7OA 3CZ0A 5CSJA 1K9KA 1NCYA 1QIWA 3DY9A 1NX3A 1PSRA 2IS9A 2E30A 3I5FB 4YI9A 3RLZA 1S26D 2CCMA 3CABA 4F0ZB 2EGDA 1QTXA 1WY9A 4QJ4B 4MZJA 5CSIA 3EK4A 3S0FA 4P2YB 2BBNA 2BECA 4BY4A 4E68A 2H8VA 1D1OA 4C0KA 2QEVA 1DJIA 2LVKA 2QEBA 3BJHA 1E8AA 3D0YA 3JTDB 4GPLB 3D75A 2F8PA 3I5HB 1B8RA 2FOTA 2JNXA 3PALA 5IBWA 1TN4A 1CKKA 1PSBA 1C7VA 1IRJA 2ZRTA 4YRUA 3S0BA 1AJ5A 1SR6C 5BPJA 4CFQA 2F33A 4GFTA 2L51A 4GAOA 3CGAA 3EKHA 4YI8A 1CMFA 1SCMB 1CNPA 1DELA 1BLQA 1XFZO 3NSOA 2K60A 2A4JA 1CDNA 1PULA 2WOSA 3GK4X 4P5OE 3M0WA 2WCKA 3FE6A 1DT7B 4PE0A 1J7QA 2WORA 2HF5A 2L5XB 1YRTB 1F4QA 2OTGB 2Q91A 3GK1A 1DF0B 2M49B 4NDDA 1B4CA 1OMDA 1TNPA 4AQJA 3BOWA 4DCKA 2GGZA 3JVTC 4WQ2A 3FIAA 4C0JA 3OX5A 2H2KA 3AAKA 1W7JB 4YGBB 2K7DA 3K21A 2WNDA 3CR4X 1DJYA 1RTP1 3OB1B 1JF2A 1N2DA 2M8UA 1XFXO 2KFFA 5CPVA 5J3XA 2WCEA 3QMEA 3L47A 1XVJA 3CZTX 4MVFA 1IJ5A 1M45A 3I5GB 3S0DA 1JFJA 3D77A 1KFUS 5JOLA 4MRYA 3CTNA 1ALVA 1TTXA 1S36A 3BUMB 1YX8A 1EG3A 1GQMA 2KLDA 5HYDA 1GJYA 2CXJA 2OS8C 3KEVA 2PSRA 4I5KA 1MXLC 5D7FA 3SG4A 1QVIY 2BKHB 2HQ8A 5DKRA 4PE1A 4IL1A 1J7RA 4PALA 1BMOA 1MR8A 4NDCA 1K93D 5G08A 3RM1A 4DIRA 1LS8A 4MBEA 3TUYB 4DUQA 1S6IA 4DRWA 2Y4QA 4ORAB 1S5GY 4YGAA 1KK8C 5F6TA 1B1GA 3BFHA 4GBAA 5B8IB 1OOGA 3AAJA 4ETOA 3TDIA 1FI6A 2CTNA 2G9BA 3D76A 1K2HA 5HL1A 2DOQA 2KOTA 2FJUB 2WCHA 2JT0A 2PQLA 2QEOA 4XJKA 2PYQA 3F45A 2ZN9A 1MQ1A 4YBHB 1XFVO 2JXLA 1KCYA 1YR5A 1QIVA 1T14A 1ZOTB 1ORGA 2LVVA 3DXLA 2LLUA 4BY5A 5KU1A 1M31A 2WC5A 1XFYO 1C07A 3SG2A 1K8UA 1XK4A 1YURA 2BKIB 4WQ3A 3ICBA 1B8CA 2GV5A 1Y0VH 1DVIA 1L7ZA 2L5YA 2SCPA 2JPTA 1BJFA 2R2IA 2LANA 3PN7C 4PT1A 1TNXA 3RZSA 1TUZA 3ZNIA 5AERA 3DVEA 1CFPA 2JWWA 3AKBA 2ZRSA 1DF0A 1PRWA 3IVTA 1SRAA 1G4YR 2F2OA 3DF0B 3EVUA 2ISDA 1W9ZA 2LLTA 1BR4B 5FI2A 3TZ1A 1IIOA 1DEKA 1KWOB 2LMVA 3WXAA 1BR1B 2KQYA 4GGNA 3FE9A 5GQQC 3R1OA 3R72A 4F7FA 4GUKA 3A4UB 4M2QA 2RGIA 4R1EA 3DD4A 1QX2A 4PCWA 1UHNA 1V1FA 3BFBA 3SG5A 1S3PA 3FWCA 3CR2A 1BODA 1NPQA 1PALA 2JQ6A 3I5HC 3S0GA 3PATA 2BL0C 4ORCB 1SL8A 2EC6C 1YRUB 2KI4C 2NZ0A 3KO0A 3TS5C 1BT6A 1GGZA 1QVIZ 2H61A 1C3YA 3B86A 2LHLA 1J1DA 1NX2A 2YGUA 4N5XA 4OCIA 2LHIA 4PHKA 3FWBA 1RECA 4QJ3B 1BOCA 1UHKA 1XK4C 2M29A 2K7BA 1SCMC 1WDCC 1S5GZ 1PVBA 1NX0A 1LVCD 1IWQA 4ZCVA 1H8BA 4XYNA 1AVSA 1C7WA 1GM0A 4I5JA 3B6XA 2M0RA 2M3WA 3UNWA 1YVLA 3O2PA 1RK9A 2MLFC 2BBMA 3NXAA 3DVMA 1CM4A 1WRLA 2QPTA 2QEHA 1AK8A 4I5LB 4D1EA 1CFCA 1B9AA 3KHEA 1IJ6A 4PHMA 3MSEB 1DGUA 4UPGA 2BNXA 2KQ6A 1F55A 4YGEB 1VRKA 2L4IA 4U8DA 1SNLA 2PASA 1KQMB 2KBIA 1DMOA 1MHOA 1FW4A 1DJWA 2P6BB 3NSLA 1KQVA 1P28A 3D74A 2AUCA 4HREE 4OZDA 4JQ0D 1WLMA 1UUSA 3I5IC 3PM2A 2H61C 3S0AA 3O78A 1NCZA 1NX1A 4HRGA 1F71A 5AANA 3SG6A 3PM8A 3DZTA 5I2LA 5D69A 1ZUZA 1OE9B 1QATA 3O4XA 2Y1NA 3EK8A 1UHHA 2K0JA 2LV7A 1W7IB 3SS5A 3FS7A 3IQOA 2KLEA 3DF0A 2CBLA 3TUYC 5KTYA 3LLEA 1DJZA 2QDIA 3CR5X 1BF5A 2KSPA 3LL8B 5AXIA 1LA0A 1QLSA 3C1VA 1SR6B 3SS3A 3PJIA 1PVAA 1MWNA 3ZWHA 3OHMB 1F4OA 4GGFA 2ERBA 3BFAA 3SJSA 3TDZA 1S6JA 2Q4UA 2KFGA 2K2FA 2LLSA 2L4HA 2M7NA 2KYCA 1CB1A 1CFFA 1WRKA 2WCFA 2LUCA 2F3ZA 1U5IB 3SG3A 1V1GA 3OX6A 1H4BA 1DJXA 1QLKA 2JNFA 5EL2A 1SKTA 3DVKA 2LE9B 2WCLA 3B7AA 2JXCA 1JF0A 2L50A 4N1FA 2LP3A 4WRIA 1TOPA 3JVTB 5HLVA 1UURA 4L9MA 5ER5A 3DYEA 1SK6D 2MA2A 4MLWA 1K9PA 5AFPA 2PRUA 1SSEB 2ZN8A 1KK7Z 1OOHA 3QRXA 4JPZB 5FYXA 1QXPA 1GGWA 2BAPA 3LK0A 2E6WA 1ALWA 1J55A 1G8IA 1C3ZA 1NCXA 3BUOB 1A2XA 1OOIX 3IQQA 2WCBA 4MN0A 4A4CA 1LA3A 4CPVA 2LC5A 3LK1A 1NIWA 1WRZA 4KYNA 3UO9A 3CZ1A 3OGNA 2HPSA 3HCMA 4GNKB 4MZLA 1NP8A 2GGMA 4OR9B 1QJTA 1Z2CB 1S1EA 1JFKA 2AMIA 1M46A 1L2OB 4HRHA 1EXRA 4GGFC 2K61A 4DS7A 3SIAA 4FTGA 2D8NA 1DJGA 2OS8B 1OW4A 3EK7A 2K8MB 4QJ5B 2JOJA 1QASA 3L4AA 2BCAA 2F3YA 2M97A 2HQWA 4NDBA 1DQEA 2KDHA 2ZFDA 3BUXB 5I94A 1DJHA 3I5FC 3PLFB 2LNKA 1QWVA 4PE4A 1JC2A 1OZSA 3R1PA 1Y1XA 2LVIA 3A8RA 3R1VA 1KK8B 4OV2A 1OZOA 1AJ4A 1SMGA 3BOWB 3K1EA 4OVNF 3SS4A 2EHBA 3D10A 3D73A 3EVRA 3H4SE 1MF8B 3JTDC 3E3RA 1A29A 1A4PA 1OMRA 3B88A 4I5NB 1R2UA 2P71A 1B7TZ 1B8LA 1ODBA 2I7AA 1EG4A 3DVJA 1K96A 2KFHA 2MRDA 1F70A 1SPYA 5DICA 5I2QA 1FF1A 4CLNA 1SL9A 4USLA 1IKUA 1QS7A 1JBAA 1A75B 1OMVA 1TCFA 5K89A 2M9GA 2LMTA 1QX5B 3NSKA 3VROA 4AOMA 4MRXA 3SG7A 1YUSA 4MZKA 5FI6A 1EL4A 2JT8A 2M7LA 1ZFSA 3PN7B 2KHNA 1TRFA 3HX4A 1EJ3A 4ICBA 5AEQA 1OSAA 1QV0A 1Y1AA 1YTZC 1JSAA 2F2PA 3TDUA 3NGVA 3Q8IA 1FPWA 2OTGC 1AUIB 1K90D 1LXFC 1NSHA 1F54A 2KAYA 2I18A 1KK7Y 4CIDA 2ZNEA 1NWDA 1A03A 1JUOA 3O4YA 1TWOA 1CLMA 5HKWA 1S6CA 3KPXA 1HQVA 1X02A 1XA5A 2P70A 2PVBA 2AAOA
chains in the Genus database with same CATH topology
1N65A 3EKJA 4JWQA 1G33A 1RFJA 2I94A 2LUXA 2MHHA 3VRPA 1CMGA 2KGBC 2KNEA 4FQOA 1K95A 3CWGA 4YGCB 4XJKB 1CM1A 1IQ5A 3VRRA 5ER4X 3CLNA 1KFXL 1IQ3A 2LCPA 2BL0B 1J7OA 2JZIA 2EC6B 1YX7A 2LP2A 1BG1A 2KI4B 3TS5B 3I5GC 2JTTA 1UWOA 1DGVA 4PDZA 1WDCB 1WLZA 1EH2A 2OPOA 3BXKA 2JTZA 3CS1A 1HT9A 1LINA 4YGDB 2LM5A 3AKAA 4ZCUA 1ZMZA 3WNXB 1KSMA 1KSOA 5DKNA 2BCXA 3IF7A 3VRQA 3WHUB 1QX7A 2K2AA 2G2BA 1K94A 1LKJA 1XFUO 2PMYA 4Q04A 2BE6A 1CLBA 1IH0A 1B7TY 1IGVA 1NUBA 2B1UA 4PHJA 5DKQA 4PHNA 1R6PA 1JWDA 2LVJA 2NXQA 5PALA 2V53A 2FCEA 5JJGA 1ZACA 1TNQA 3NSIA 2K7CA 4CFRA 1CFDA 5CSFA 2HETA 1A75A 2JRFA 2MAZA 3I5IB 1J1EA 1YUUA 1J7PA 1M63B 1PK0D 5CSNA 2L0PA 5TNCA 2LAPA 1L2OC 1MXEA 1N0YA 3VGOA 1RROA 2BE4A 3EVVA 3GOFA 2KGRA 1Y6WA 2PALA 2I2RE 2KAVA 3BUWB 3D0YB 1K9UA 4MEWA 1SBJA 2M1UA 5HKYA 3OB2B 2NLNA 1TIZA 1UHJA 1MUXA 2JT3A 4MSPA 2KYFA 2L2EA 2MBXA 2CNPA 4NQGA 1YUTA 1KWOC 1F8HA 1YVHA 1CDPA 4PE7A 1TNWA 2O60A 4ORBB 2NCOA 2Y1MA 4TNCA 1NYAA 1UP5A 1SL7A 1SCVA 1XYDA 2KI6C 1CDMA 1IG5A 2KAXA 1SY9A 3OP0A 3SIBA 3VRNA 2CT9A 2QACA 1AHRA 2MJWB 5HKZA 2JU0A 3LCPC 3PSRA 3GK2A 5HLOA 2M1KB 1RJVA 2KI6D 5I2OA 2WC8A 3BYAA 1SW8A 4OKHA 1M39A 1OQPA 1Y1UA 1SYMA 2MLEC 4C0LA 2JC2A 4HSZA 1FBVA 3BQ3A 1Q80A 1XO5A 2L98A 3O6BA 3PFVA 1UHIA 4AQIA 1KFUL 2VRGA 1KFXS 3BUNB 5I8NA 2ZKMX 2COLB 2Y5IA 4M2PA 2NCPA 1CLLA 5KSZA 1AP4A 1DTLA 1RWYA 1QV1A 3WHTB 1XFWO 2JULA 2SASA 2ZNDA 1FI5A 2FCDA 2LMUA 4A4BA 2TN4A 1CDLA 1TCOB 1BU3A 1OOJA 1U5IA 2BCBA 1CTRA 1KQMC 4M2OA 4N1GA 3KF9A 2KBMA 1B47A 2O5GA 2K7OA 5CSJA 1K9KA 1NCYA 1QIWA 1NX3A 1PSRA 2IS9A 2E30A 3I5FB 4YI9A 3RLZA 1S26D 2CCMA 4F0ZB 2EGDA 1QTXA 1WY9A 4QJ4B 4MZJA 5CSIA 3EK4A 4P2YB 2BBNA 2BECA 4BY4A 4E68A 1D1OA 4C0KA 1DJIA 2LVKA 1E8AA 3D0YA 3JTDB 4GPLB 2F8PA 3I5HB 1B8RA 2FOTA 2JNXA 3PALA 5IBWA 1TN4A 1CKKA 1PSBA 1C7VA 1IRJA 2ZRTA 4YRUA 1AJ5A 1SR6C 5BPJA 4CFQA 2F33A 4GFTA 2L51A 4GAOA 3CGAA 3EKHA 4YI8A 1CMFA 1SCMB 1CNPA 1BLQA 1XFZO 3NSOA 2A4JA 1CDNA 1PULA 2WOSA 3GK4X 4P5OE 3M0WA 1DT7B 4PE0A 1J7QA 2WORA 2HF5A 2L5XB 1YRTB 1F4QA 2OTGB 2Q91A 3GK1A 1DF0B 2M49B 4NDDA 1B4CA 1OMDA 1TNPA 4AQJA 3BOWA 4DCKA 2GGZA 3JVTC 4WQ2A 3FIAA 4C0JA 3OX5A 2H2KA 3AAKA 1W7JB 4YGBB 2K7DA 3K21A 2WNDA 3CR4X 1DJYA 1RTP1 3OB1B 1JF2A 1N2DA 2M8UA 1XFXO 2KFFA 5CPVA 5J3XA 2WCEA 1XVJA 3CZTX 4MVFA 1IJ5A 1M45A 3I5GB 1JFJA 1KFUS 5JOLA 4MRYA 3CTNA 1ALVA 1TTXA 1S36A 3BUMB 1YX8A 1EG3A 1GQMA 5HYDA 1GJYA 2CXJA 2OS8C 3KEVA 2PSRA 4I5KA 1MXLC 5D7FA 3SG4A 1QVIY 2BKHB 2HQ8A 5DKRA 4PE1A 4IL1A 1J7RA 4PALA 1BMOA 1MR8A 4NDCA 1K93D 5G08A 3RM1A 4DIRA 4MBEA 3TUYB 4DUQA 1S6IA 4DRWA 2Y4QA 4ORAB 1S5GY 4YGAA 1KK8C 5F6TA 1B1GA 4GBAA 5B8IB 3AAJA 4ETOA 3TDIA 1FI6A 2CTNA 2G9BA 1K2HA 2DOQA 2KOTA 2FJUB 2JT0A 4XJKA 3F45A 2ZN9A 1MQ1A 4YBHB 1XFVO 2JXLA 1KCYA 1YR5A 1QIVA 1ZOTB 2LVVA 2LLUA 4BY5A 5KU1A 1M31A 1C07A 1XFYO 3SG2A 1K8UA 1XK4A 1YURA 2BKIB 4WQ3A 3ICBA 1B8CA 2GV5A 1Y0VH 1DVIA 1L7ZA 2SCPA 2JPTA 1BJFA 2R2IA 2LANA 3PN7C 1TNXA 3ZNIA 5AERA 3DVEA 1CFPA 2JWWA 3AKBA 2ZRSA 1DF0A 1PRWA 1SRAA 1G4YR 2F2OA 3DF0B 3EVUA 2ISDA 2LLTA 1BR4B 3TZ1A 1KWOB 2LMVA 3WXAA 1BR1B 2KQYA 4GGNA 5GQQC 4GUKA 3A4UB 4M2QA 2RGIA 4R1EA 3DD4A 1QX2A 4PCWA 1UHNA 1V1FA 3SG5A 1S3PA 3FWCA 3CR2A 1BODA 1NPQA 1PALA 2JQ6A 3I5HC 3PATA 2BL0C 4ORCB 1SL8A 2EC6C 1YRUB 2KI4C 2NZ0A 3KO0A 3TS5C 1BT6A 1GGZA 1QVIZ 2H61A 2LHLA 1J1DA 1NX2A 4N5XA 4PHKA 4OCIA 2LHIA 4QJ3B 3FWBA 1RECA 1BOCA 1UHKA 1XK4C 2M29A 2K7BA 1SCMC 1WDCC 1S5GZ 1PVBA 1NX0A 1LVCD 1IWQA 4ZCVA 1H8BA 4XYNA 1AVSA 1C7WA 4I5JA 2M0RA 2M3WA 1YVLA 3O2PA 1RK9A 2MLFC 2BBMA 3NXAA 3DVMA 1CM4A 1WRLA 2QPTA 1AK8A 4I5LB 4D1EA 1CFCA 1B9AA 3KHEA 1IJ6A 4PHMA 3MSEB 1DGUA 4UPGA 2KQ6A 1F55A 4YGEB 1VRKA 2L4IA 4U8DA 1SNLA 2PASA 1KQMB 2KBIA 1DMOA 1MHOA 1FW4A 1DJWA 2P6BB 3NSLA 1KQVA 2AUCA 4HREE 4JQ0D 1WLMA 1UUSA 3I5IC 2H61C 3O78A 1NCZA 1NX1A 4HRGA 1F71A 5AANA 3SG6A 3PM8A 5I2LA 5D69A 1ZUZA 1OE9B 1QATA 2Y1NA 3EK8A 1UHHA 2K0JA 2LV7A 1W7IB 3FS7A 3IQOA 3DF0A 2CBLA 3TUYC 5KTYA 3LLEA 1DJZA 3CR5X 1BF5A 2KSPA 3LL8B 5AXIA 1LA0A 1QLSA 3C1VA 1SR6B 1PVAA 1MWNA 3ZWHA 3OHMB 1F4OA 4GGFA 3SJSA 3TDZA 1S6JA 2Q4UA 2KFGA 2K2FA 2LLSA 2L4HA 2M7NA 2KYCA 1CB1A 1CFFA 1WRKA 2WCFA 2LUCA 2F3ZA 1U5IB 3SG3A 1V1GA 3OX6A 1H4BA 1DJXA 1QLKA 2JNFA 1SKTA 3DVKA 2LE9B 2JXCA 1JF0A 2L50A 4N1FA 2LP3A 4WRIA 1TOPA 3JVTB 5HLVA 1UURA 4L9MA 5ER5A 1SK6D 2MA2A 4MLWA 1K9PA 5AFPA 2PRUA 3QRXA 2ZN8A 1KK7Z 4JPZB 5FYXA 1QXPA 1GGWA 3LK0A 2E6WA 1ALWA 1J55A 1G8IA 1NCXA 3BUOB 1A2XA 3IQQA 2WCBA 4MN0A 4A4CA 1LA3A 4CPVA 2LC5A 3LK1A 1NIWA 1WRZA 2HPSA 3HCMA 4GNKB 4MZLA 1NP8A 2GGMA 4OR9B 1QJTA 1S1EA 1JFKA 2AMIA 1M46A 1L2OB 4HRHA 1EXRA 4GGFC 2K61A 4DS7A 3SIAA 4FTGA 2D8NA 1DJGA 2OS8B 3EK7A 2K8MB 4QJ5B 2JOJA 1QASA 2BCAA 2F3YA 2M97A 2HQWA 4NDBA 3BUXB 2KDHA 2ZFDA 1DJHA 3I5FC 3PLFB 2LNKA 4PE4A 1JC2A 1OZSA 1Y1XA 2LVIA 3A8RA 1KK8B 4OV2A 1OZOA 1AJ4A 1SMGA 3BOWB 4OVNF 2EHBA 3D10A 3EVRA 3H4SE 1MF8B 3JTDC 3E3RA 1A29A 1A4PA 1OMRA 4I5NB 1R2UA 1B7TZ 1B8LA 1ODBA 2I7AA 1EG4A 3DVJA 1K96A 2KFHA 2MRDA 1F70A 1SPYA 1FF1A 5I2QA 4CLNA 1SL9A 4USLA 1IKUA 1QS7A 1JBAA 1A75B 1OMVA 1TCFA 5K89A 2M9GA 2LMTA 1QX5B 3NSKA 3VROA 4AOMA 4MRXA 3SG7A 1YUSA 4MZKA 1EL4A 2JT8A 2M7LA 1ZFSA 3PN7B 2KHNA 1TRFA 3HX4A 1EJ3A 4ICBA 5AEQA 1OSAA 1QV0A 1Y1AA 1YTZC 1JSAA 2F2PA 3TDUA 1FPWA 2OTGC 1AUIB 1K90D 1LXFC 1NSHA 1F54A 2KAYA 2I18A 1KK7Y 4CIDA 2ZNEA 1NWDA 1A03A 1JUOA 3O4YA 1CLMA 5HKWA 1S6CA 3KPXA 1HQVA 1X02A 1XA5A 2PVBA 2AAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N65 A;  3EKJ A;  4JWQ A;  1G33 A;  1RFJ A;  2I94 A;  2LUX A;  2MHH A;  3VRP A;  1CMG A;  2KGB C;  2KNE A;  4FQO A;  1K95 A;  3CWG A;  4YGC B;  4XJK B;  1CM1 A;  1IQ5 A;  3VRR A;  5ER4 X;  3CLN A;  1KFX L;  1IQ3 A;  2LCP A;  2BL0 B;  1J7O A;  2JZI A;  2EC6 B;  1YX7 A;  2LP2 A;  1BG1 A;  2KI4 B;  3TS5 B;  3I5G C;  2JTT A;  1UWO A;  1DGV A;  4PDZ A;  1WDC B;  1WLZ A;  1EH2 A;  2OPO A;  3BXK A;  2JTZ A;  3CS1 A;  1HT9 A;  1LIN A;  4YGD B;  2LM5 A;  3AKA A;  4ZCU A;  1ZMZ A;  3WNX B;  1KSM A;  1KSO A;  5DKN A;  2BCX A;  3IF7 A;  3VRQ A;  3WHU B;  1QX7 A;  2K2A A;  2G2B A;  1K94 A;  1LKJ A;  1XFU O;  2PMY A;  4Q04 A;  2BE6 A;  1CLB A;  1IH0 A;  1B7T Y;  1IGV A;  1NUB A;  2B1U A;  4PHJ A;  5DKQ A;  4PHN A;  1R6P A;  1JWD A;  2LVJ A;  2NXQ A;  5PAL A;  2V53 A;  2FCE A;  5JJG A;  1ZAC A;  1TNQ A;  3NSI A;  2K7C A;  4CFR A;  1CFD A;  5CSF A;  2HET A;  1A75 A;  2JRF A;  2MAZ A;  3I5I B;  1J1E A;  1YUU A;  1J7P A;  1M63 B;  1PK0 D;  5CSN A;  2L0P A;  5TNC A;  2LAP A;  1L2O C;  1MXE A;  1N0Y A;  3VGO A;  1RRO A;  2BE4 A;  3EVV A;  3GOF A;  2KGR A;  1Y6W A;  2PAL A;  2I2R E;  2KAV A;  3BUW B;  3D0Y B;  1K9U A;  4MEW A;  1SBJ A;  2M1U A;  5HKY A;  3OB2 B;  2NLN A;  1TIZ A;  1UHJ A;  1MUX A;  2JT3 A;  4MSP A;  2KYF A;  2L2E A;  2MBX A;  2CNP A;  4NQG A;  1YUT A;  1KWO C;  1F8H A;  1YVH A;  1CDP A;  4PE7 A;  1TNW A;  2O60 A;  4ORB B;  2NCO A;  2Y1M A;  4TNC A;  1NYA A;  1UP5 A;  1SL7 A;  1SCV A;  1XYD A;  2KI6 C;  1CDM A;  1IG5 A;  2KAX A;  1SY9 A;  3OP0 A;  3SIB A;  3VRN A;  2CT9 A;  2QAC A;  1AHR A;  2MJW B;  5HKZ A;  2JU0 A;  3LCP C;  3PSR A;  3GK2 A;  5HLO A;  2M1K B;  1RJV A;  2KI6 D;  5I2O A;  2WC8 A;  3BYA A;  1SW8 A;  4OKH A;  1M39 A;  1OQP A;  1Y1U A;  1SYM A;  2MLE C;  4C0L A;  2JC2 A;  4HSZ A;  1FBV A;  3BQ3 A;  1Q80 A;  1XO5 A;  2L98 A;  3O6B A;  3PFV A;  1UHI A;  4AQI A;  1KFU L;  2VRG A;  1KFX S;  3BUN B;  5I8N A;  2ZKM X;  2COL B;  2Y5I A;  4M2P A;  2NCP A;  1CLL A;  5KSZ A;  1AP4 A;  1DTL A;  1RWY A;  1QV1 A;  3WHT B;  1XFW O;  2JUL A;  2SAS A;  2ZND A;  1FI5 A;  2FCD A;  2LMU A;  4A4B A;  2TN4 A;  1CDL A;  1TCO B;  1BU3 A;  1OOJ A;  1U5I A;  2BCB A;  1CTR A;  1KQM C;  4M2O A;  4N1G A;  3KF9 A;  2KBM A;  1B47 A;  2O5G A;  2K7O A;  5CSJ A;  1K9K A;  1NCY A;  1QIW A;  1NX3 A;  1PSR A;  2IS9 A;  2E30 A;  3I5F B;  4YI9 A;  3RLZ A;  1S26 D;  2CCM A;  4F0Z B;  2EGD A;  1QTX A;  1WY9 A;  4QJ4 B;  4MZJ A;  5CSI A;  3EK4 A;  4P2Y B;  2BBN A;  2BEC A;  4BY4 A;  4E68 A;  1D1O A;  4C0K A;  1DJI A;  2LVK A;  1E8A A;  3D0Y A;  3JTD B;  4GPL B;  2F8P A;  3I5H B;  1B8R A;  2FOT A;  2JNX A;  3PAL A;  5IBW A;  1TN4 A;  1CKK A;  1PSB A;  1C7V A;  1IRJ A;  2ZRT A;  4YRU A;  1AJ5 A;  1SR6 C;  5BPJ A;  4CFQ A;  2F33 A;  4GFT A;  2L51 A;  4GAO A;  3CGA A;  3EKH A;  4YI8 A;  1CMF A;  1SCM B;  1CNP A;  1BLQ A;  1XFZ O;  3NSO A;  2A4J A;  1CDN A;  1PUL A;  2WOS A;  3GK4 X;  4P5O E;  3M0W A;  1DT7 B;  4PE0 A;  1J7Q A;  2WOR A;  2HF5 A;  2L5X B;  1YRT B;  1F4Q A;  2OTG B;  2Q91 A;  3GK1 A;  1DF0 B;  2M49 B;  4NDD A;  1B4C A;  1OMD A;  1TNP A;  4AQJ A;  3BOW A;  4DCK A;  2GGZ A;  3JVT C;  4WQ2 A;  3FIA A;  4C0J A;  3OX5 A;  2H2K A;  3AAK A;  1W7J B;  4YGB B;  2K7D A;  3K21 A;  2WND A;  3CR4 X;  1DJY A;  1RTP 1;  3OB1 B;  1JF2 A;  1N2D A;  2M8U A;  1XFX O;  2KFF A;  5CPV A;  5J3X A;  2WCE A;  1XVJ A;  3CZT X;  4MVF A;  1IJ5 A;  1M45 A;  3I5G B;  1JFJ A;  1KFU S;  5JOL A;  4MRY A;  3CTN A;  1ALV A;  1TTX A;  1S36 A;  3BUM B;  1YX8 A;  1EG3 A;  1GQM A;  5HYD A;  1GJY A;  2CXJ A;  2OS8 C;  3KEV A;  2PSR A;  4I5K A;  1MXL C;  5D7F A;  3SG4 A;  1QVI Y;  2BKH B;  2HQ8 A;  5DKR A;  4PE1 A;  4IL1 A;  1J7R A;  4PAL A;  1BMO A;  1MR8 A;  4NDC A;  1K93 D;  5G08 A;  3RM1 A;  4DIR A;  4MBE A;  3TUY B;  4DUQ A;  1S6I A;  4DRW A;  2Y4Q A;  4ORA B;  1S5G Y;  4YGA A;  1KK8 C;  5F6T A;  1B1G A;  4GBA A;  5B8I B;  3AAJ A;  4ETO A;  3TDI A;  1FI6 A;  2CTN A;  2G9B A;  1K2H A;  2DOQ A;  2KOT A;  2FJU B;  2JT0 A;  4XJK A;  3F45 A;  2ZN9 A;  1MQ1 A;  4YBH B;  1XFV O;  2JXL A;  1KCY A;  1YR5 A;  1QIV A;  1ZOT B;  2LVV A;  2LLU A;  4BY5 A;  5KU1 A;  1M31 A;  1C07 A;  1XFY O;  3SG2 A;  1K8U A;  1XK4 A;  1YUR A;  2BKI B;  4WQ3 A;  3ICB A;  1B8C A;  2GV5 A;  1Y0V H;  1DVI A;  1L7Z A;  2SCP A;  2JPT A;  1BJF A;  2R2I A;  2LAN A;  3PN7 C;  1TNX A;  3ZNI A;  5AER A;  3DVE A;  1CFP A;  2JWW A;  3AKB A;  2ZRS A;  1DF0 A;  1PRW A;  1SRA A;  1G4Y R;  2F2O A;  3DF0 B;  3EVU A;  2ISD A;  2LLT A;  1BR4 B;  3TZ1 A;  1KWO B;  2LMV A;  3WXA A;  1BR1 B;  2KQY A;  4GGN A;  5GQQ C;  4GUK A;  3A4U B;  4M2Q A;  2RGI A;  4R1E A;  3DD4 A;  1QX2 A;  4PCW A;  1UHN A;  1V1F A;  3SG5 A;  1S3P A;  3FWC A;  3CR2 A;  1BOD A;  1NPQ A;  1PAL A;  2JQ6 A;  3I5H C;  3PAT A;  2BL0 C;  4ORC B;  1SL8 A;  2EC6 C;  1YRU B;  2KI4 C;  2NZ0 A;  3KO0 A;  3TS5 C;  1BT6 A;  1GGZ A;  1QVI Z;  2H61 A;  2LHL A;  1J1D A;  1NX2 A;  4N5X A;  4PHK A;  4OCI A;  2LHI A;  4QJ3 B;  3FWB A;  1REC A;  1BOC A;  1UHK A;  1XK4 C;  2M29 A;  2K7B A;  1SCM C;  1WDC C;  1S5G Z;  1PVB A;  1NX0 A;  1LVC D;  1IWQ A;  4ZCV A;  1H8B A;  4XYN A;  1AVS A;  1C7W A;  4I5J A;  2M0R A;  2M3W A;  1YVL A;  3O2P A;  1RK9 A;  2MLF C;  2BBM A;  3NXA A;  3DVM A;  1CM4 A;  1WRL A;  2QPT A;  1AK8 A;  4I5L B;  4D1E A;  1CFC A;  1B9A A;  3KHE A;  1IJ6 A;  4PHM A;  3MSE B;  1DGU A;  4UPG A;  2KQ6 A;  1F55 A;  4YGE B;  1VRK A;  2L4I A;  4U8D A;  1SNL A;  2PAS A;  1KQM B;  2KBI A;  1DMO A;  1MHO A;  1FW4 A;  1DJW A;  2P6B B;  3NSL A;  1KQV A;  2AUC A;  4HRE E;  4JQ0 D;  1WLM A;  1UUS A;  3I5I C;  2H61 C;  3O78 A;  1NCZ A;  1NX1 A;  4HRG A;  1F71 A;  5AAN A;  3SG6 A;  3PM8 A;  5I2L A;  5D69 A;  1ZUZ A;  1OE9 B;  1QAT A;  2Y1N A;  3EK8 A;  1UHH A;  2K0J A;  2LV7 A;  1W7I B;  3FS7 A;  3IQO A;  3DF0 A;  2CBL A;  3TUY C;  5KTY A;  3LLE A;  1DJZ A;  3CR5 X;  1BF5 A;  2KSP A;  3LL8 B;  5AXI A;  1LA0 A;  1QLS A;  3C1V A;  1SR6 B;  1PVA A;  1MWN A;  3ZWH A;  3OHM B;  1F4O A;  4GGF A;  3SJS A;  3TDZ A;  1S6J A;  2Q4U A;  2KFG A;  2K2F A;  2LLS A;  2L4H A;  2M7N A;  2KYC A;  1CB1 A;  1CFF A;  1WRK A;  2WCF A;  2LUC A;  2F3Z A;  1U5I B;  3SG3 A;  1V1G A;  3OX6 A;  1H4B A;  1DJX A;  1QLK A;  2JNF A;  1SKT A;  3DVK A;  2LE9 B;  2JXC A;  1JF0 A;  2L50 A;  4N1F A;  2LP3 A;  4WRI A;  1TOP A;  3JVT B;  5HLV A;  1UUR A;  4L9M A;  5ER5 A;  1SK6 D;  2MA2 A;  4MLW A;  1K9P A;  5AFP A;  2PRU A;  3QRX A;  2ZN8 A;  1KK7 Z;  4JPZ B;  5FYX A;  1QXP A;  1GGW A;  3LK0 A;  2E6W A;  1ALW A;  1J55 A;  1G8I A;  1NCX A;  3BUO B;  1A2X A;  3IQQ A;  2WCB A;  4MN0 A;  4A4C A;  1LA3 A;  4CPV A;  2LC5 A;  3LK1 A;  1NIW A;  1WRZ A;  2HPS A;  3HCM A;  4GNK B;  4MZL A;  1NP8 A;  2GGM A;  4OR9 B;  1QJT A;  1S1E A;  1JFK A;  2AMI A;  1M46 A;  1L2O B;  4HRH A;  1EXR A;  4GGF C;  2K61 A;  4DS7 A;  3SIA A;  4FTG A;  2D8N A;  1DJG A;  2OS8 B;  3EK7 A;  2K8M B;  4QJ5 B;  2JOJ A;  1QAS A;  2BCA A;  2F3Y A;  2M97 A;  2HQW A;  4NDB A;  3BUX B;  2KDH A;  2ZFD A;  1DJH A;  3I5F C;  3PLF B;  2LNK A;  4PE4 A;  1JC2 A;  1OZS A;  1Y1X A;  2LVI A;  3A8R A;  1KK8 B;  4OV2 A;  1OZO A;  1AJ4 A;  1SMG A;  3BOW B;  4OVN F;  2EHB A;  3D10 A;  3EVR A;  3H4S E;  1MF8 B;  3JTD C;  3E3R A;  1A29 A;  1A4P A;  1OMR A;  4I5N B;  1R2U A;  1B7T Z;  1B8L A;  1ODB A;  2I7A A;  1EG4 A;  3DVJ A;  1K96 A;  2KFH A;  2MRD A;  1F70 A;  1SPY A;  1FF1 A;  5I2Q A;  4CLN A;  1SL9 A;  4USL A;  1IKU A;  1QS7 A;  1JBA A;  1A75 B;  1OMV A;  1TCF A;  5K89 A;  2M9G A;  2LMT A;  1QX5 B;  3NSK A;  3VRO A;  4AOM A;  4MRX A;  3SG7 A;  1YUS A;  4MZK A;  1EL4 A;  2JT8 A;  2M7L A;  1ZFS A;  3PN7 B;  2KHN A;  1TRF A;  3HX4 A;  1EJ3 A;  4ICB A;  5AEQ A;  1OSA A;  1QV0 A;  1Y1A A;  1YTZ C;  1JSA A;  2F2P A;  3TDU A;  1FPW A;  2OTG C;  1AUI B;  1K90 D;  1LXF C;  1NSH A;  1F54 A;  2KAY A;  2I18 A;  1KK7 Y;  4CID A;  2ZNE A;  1NWD A;  1A03 A;  1JUO A;  3O4Y A;  1CLM A;  5HKW A;  1S6C A;  3KPX A;  1HQV A;  1X02 A;  1XA5 A;  2PVB A;  2AAO A; 
#chains in the Genus database with same CATH topology
 1N65 A;  3EKJ A;  4JWQ A;  1G33 A;  1RFJ A;  2I94 A;  2LUX A;  2MHH A;  5FI7 A;  3VRP A;  1CMG A;  2KGB C;  2KNE A;  4FQO A;  1K95 A;  3CWG A;  3NHT A;  4XJK B;  1CM1 A;  1IQ5 A;  4YGC B;  5ER4 X;  3VRR A;  3CLN A;  1KFX L;  1IQ3 A;  2LCP A;  2BL0 B;  1J7O A;  2JZI A;  4JKT A;  2EC6 B;  1YX7 A;  2LP2 A;  1BG1 A;  2KI4 B;  3TS5 B;  3I5G C;  2WCM A;  2JTT A;  3NHI A;  1Z4H A;  1UWO A;  1DGV A;  4PDZ A;  2GTE A;  1WDC B;  1WLZ A;  3OBV A;  1EH2 A;  2OPO A;  3BXK A;  2JTZ A;  3CS1 A;  5D3O A;  1HT9 A;  1LIN A;  4YGD B;  2LM5 A;  3AKA A;  1XFR A;  1ZMZ A;  4ZCU A;  3VB1 A;  3WNX B;  1KSM A;  1KSO A;  2L2C A;  2BCX A;  3IF7 A;  5DKN A;  3VRQ A;  3WHU B;  1QX7 A;  2K2A A;  2G2B A;  3FE8 A;  1K94 A;  1LKJ A;  1XFU O;  2PMY A;  3CYZ A;  2BE6 A;  4Q04 A;  1CLB A;  1IH0 A;  1B7T Y;  1IGV A;  1NUB A;  2B1U A;  4PHJ A;  5DKQ A;  4PHN A;  1R6P A;  1JWD A;  2LVJ A;  2NXQ A;  5PAL A;  3EG5 B;  2V53 A;  2FCE A;  5JJG A;  1DC1 A;  1ZAC A;  1TNQ A;  3NSI A;  2K7C A;  4INW A;  3CZ2 A;  4CFR A;  1CFD A;  5CSF A;  1OOF A;  2HET A;  1A75 A;  2JRF A;  2MAZ A;  3I5I B;  1J1E A;  1YUU A;  1J7P A;  1M63 B;  1PK0 D;  4INX A;  5CSN A;  2L0P A;  5TNC A;  2LAP A;  1L2O C;  1MXE A;  1N0Y A;  3VGO A;  1RRO A;  2BE4 A;  3EVV A;  3GOF A;  2KGR A;  1Y6W A;  4FQT A;  2PAL A;  4IJ7 A;  2I2R E;  2KAV A;  3BUW B;  3D0Y B;  1K9U A;  4MEW A;  1SBJ A;  2M1U A;  5HKY A;  3OB2 B;  2NLN A;  1TIZ A;  1UHJ A;  1MUX A;  2JT3 A;  4MSP A;  2KYF A;  2L2E A;  2MBX A;  2CNP A;  4NQG A;  1YUT A;  1KWO C;  3B87 A;  1F8H A;  3S0E A;  1YVH A;  1CDP A;  4PE7 A;  1TNW A;  2O60 A;  4ORB B;  2FJY A;  2NCO A;  2Y1M A;  4TNC A;  1NYA A;  1UP5 A;  1SL7 A;  1SCV A;  1XYD A;  2KI6 C;  1CDM A;  1IG5 A;  2KAX A;  1SY9 A;  3OP0 A;  3SIB A;  3VRN A;  2CT9 A;  2QAC A;  1AHR A;  2MJW B;  5HKZ A;  2JU0 A;  3LCP C;  3PSR A;  3GK2 A;  5HLO A;  2M1K B;  1RJV A;  2KI6 D;  5I2O A;  2WC8 A;  3BYA A;  1SW8 A;  4OKH A;  1M39 A;  1OQP A;  1Y1U A;  1SYM A;  2MLE C;  4C0L A;  2JC2 A;  2WC6 A;  4HSZ A;  1FBV A;  3V2L A;  3BQ3 A;  1TUJ A;  2KPH A;  1Q80 A;  1XO5 A;  2L98 A;  3O6B A;  3PFV A;  1UHI A;  4AQI A;  1KFU L;  2VRG A;  1KFX S;  3BUN B;  5I8N A;  2ZKM X;  2COL B;  2Y5I A;  3D78 A;  4M2P A;  2NCP A;  1CLL A;  5KSZ A;  2JPO A;  1AP4 A;  1DTL A;  1RWY A;  1QV1 A;  3WHT B;  3N7H A;  1XFW O;  2JUL A;  2SAS A;  2ZND A;  1FI5 A;  2FCD A;  2LMU A;  2WCJ A;  4A4B A;  3L4L A;  2TN4 A;  3CDN A;  1CDL A;  1TCO B;  1BU3 A;  1OOJ A;  1U5I A;  2BCB A;  1CTR A;  1KQM C;  4M2O A;  4N1G A;  4JD9 A;  3KF9 A;  2KBM A;  1B47 A;  2O5G A;  2K7O A;  3CZ0 A;  5CSJ A;  1K9K A;  1NCY A;  1QIW A;  3DY9 A;  1NX3 A;  1PSR A;  2IS9 A;  2E30 A;  3I5F B;  4YI9 A;  3RLZ A;  1S26 D;  2CCM A;  3CAB A;  4F0Z B;  2EGD A;  1QTX A;  1WY9 A;  4QJ4 B;  4MZJ A;  5CSI A;  3EK4 A;  3S0F A;  4P2Y B;  2BBN A;  2BEC A;  4BY4 A;  4E68 A;  2H8V A;  1D1O A;  4C0K A;  2QEV A;  1DJI A;  2LVK A;  2QEB A;  3BJH A;  1E8A A;  3D0Y A;  3JTD B;  4GPL B;  3D75 A;  2F8P A;  3I5H B;  1B8R A;  2FOT A;  2JNX A;  3PAL A;  5IBW A;  1TN4 A;  1CKK A;  1PSB A;  1C7V A;  1IRJ A;  2ZRT A;  4YRU A;  3S0B A;  1AJ5 A;  1SR6 C;  5BPJ A;  4CFQ A;  2F33 A;  4GFT A;  2L51 A;  4GAO A;  3CGA A;  3EKH A;  4YI8 A;  1CMF A;  1SCM B;  1CNP A;  1DEL A;  1BLQ A;  1XFZ O;  3NSO A;  2K60 A;  2A4J A;  1CDN A;  1PUL A;  2WOS A;  3GK4 X;  4P5O E;  3M0W A;  2WCK A;  3FE6 A;  1DT7 B;  4PE0 A;  1J7Q A;  2WOR A;  2HF5 A;  2L5X B;  1YRT B;  1F4Q A;  2OTG B;  2Q91 A;  3GK1 A;  1DF0 B;  2M49 B;  4NDD A;  1B4C A;  1OMD A;  1TNP A;  4AQJ A;  3BOW A;  4DCK A;  2GGZ A;  3JVT C;  4WQ2 A;  3FIA A;  4C0J A;  3OX5 A;  2H2K A;  3AAK A;  1W7J B;  4YGB B;  2K7D A;  3K21 A;  2WND A;  3CR4 X;  1DJY A;  1RTP 1;  3OB1 B;  1JF2 A;  1N2D A;  2M8U A;  1XFX O;  2KFF A;  5CPV A;  5J3X A;  2WCE A;  3QME A;  3L47 A;  1XVJ A;  3CZT X;  4MVF A;  1IJ5 A;  1M45 A;  3I5G B;  3S0D A;  1JFJ A;  3D77 A;  1KFU S;  5JOL A;  4MRY A;  3CTN A;  1ALV A;  1TTX A;  1S36 A;  3BUM B;  1YX8 A;  1EG3 A;  1GQM A;  2KLD A;  5HYD A;  1GJY A;  2CXJ A;  2OS8 C;  3KEV A;  2PSR A;  4I5K A;  1MXL C;  5D7F A;  3SG4 A;  1QVI Y;  2BKH B;  2HQ8 A;  5DKR A;  4PE1 A;  4IL1 A;  1J7R A;  4PAL A;  1BMO A;  1MR8 A;  4NDC A;  1K93 D;  5G08 A;  3RM1 A;  4DIR A;  1LS8 A;  4MBE A;  3TUY B;  4DUQ A;  1S6I A;  4DRW A;  2Y4Q A;  4ORA B;  1S5G Y;  4YGA A;  1KK8 C;  5F6T A;  1B1G A;  3BFH A;  4GBA A;  5B8I B;  1OOG A;  3AAJ A;  4ETO A;  3TDI A;  1FI6 A;  2CTN A;  2G9B A;  3D76 A;  1K2H A;  5HL1 A;  2DOQ A;  2KOT A;  2FJU B;  2WCH A;  2JT0 A;  2PQL A;  2QEO A;  4XJK A;  2PYQ A;  3F45 A;  2ZN9 A;  1MQ1 A;  4YBH B;  1XFV O;  2JXL A;  1KCY A;  1YR5 A;  1QIV A;  1T14 A;  1ZOT B;  1ORG A;  2LVV A;  3DXL A;  2LLU A;  4BY5 A;  5KU1 A;  1M31 A;  2WC5 A;  1XFY O;  1C07 A;  3SG2 A;  1K8U A;  1XK4 A;  1YUR A;  2BKI B;  4WQ3 A;  3ICB A;  1B8C A;  2GV5 A;  1Y0V H;  1DVI A;  1L7Z A;  2L5Y A;  2SCP A;  2JPT A;  1BJF A;  2R2I A;  2LAN A;  3PN7 C;  4PT1 A;  1TNX A;  3RZS A;  1TUZ A;  3ZNI A;  5AER A;  3DVE A;  1CFP A;  2JWW A;  3AKB A;  2ZRS A;  1DF0 A;  1PRW A;  3IVT A;  1SRA A;  1G4Y R;  2F2O A;  3DF0 B;  3EVU A;  2ISD A;  1W9Z A;  2LLT A;  1BR4 B;  5FI2 A;  3TZ1 A;  1IIO A;  1DEK A;  1KWO B;  2LMV A;  3WXA A;  1BR1 B;  2KQY A;  4GGN A;  3FE9 A;  5GQQ C;  3R1O A;  3R72 A;  4F7F A;  4GUK A;  3A4U B;  4M2Q A;  2RGI A;  4R1E A;  3DD4 A;  1QX2 A;  4PCW A;  1UHN A;  1V1F A;  3BFB A;  3SG5 A;  1S3P A;  3FWC A;  3CR2 A;  1BOD A;  1NPQ A;  1PAL A;  2JQ6 A;  3I5H C;  3S0G A;  3PAT A;  2BL0 C;  4ORC B;  1SL8 A;  2EC6 C;  1YRU B;  2KI4 C;  2NZ0 A;  3KO0 A;  3TS5 C;  1BT6 A;  1GGZ A;  1QVI Z;  2H61 A;  1C3Y A;  3B86 A;  2LHL A;  1J1D A;  1NX2 A;  2YGU A;  4N5X A;  4OCI A;  2LHI A;  4PHK A;  3FWB A;  1REC A;  4QJ3 B;  1BOC A;  1UHK A;  1XK4 C;  2M29 A;  2K7B A;  1SCM C;  1WDC C;  1S5G Z;  1PVB A;  1NX0 A;  1LVC D;  1IWQ A;  4ZCV A;  1H8B A;  4XYN A;  1AVS A;  1C7W A;  1GM0 A;  4I5J A;  3B6X A;  2M0R A;  2M3W A;  3UNW A;  1YVL A;  3O2P A;  1RK9 A;  2MLF C;  2BBM A;  3NXA A;  3DVM A;  1CM4 A;  1WRL A;  2QPT A;  2QEH A;  1AK8 A;  4I5L B;  4D1E A;  1CFC A;  1B9A A;  3KHE A;  1IJ6 A;  4PHM A;  3MSE B;  1DGU A;  4UPG A;  2BNX A;  2KQ6 A;  1F55 A;  4YGE B;  1VRK A;  2L4I A;  4U8D A;  1SNL A;  2PAS A;  1KQM B;  2KBI A;  1DMO A;  1MHO A;  1FW4 A;  1DJW A;  2P6B B;  3NSL A;  1KQV A;  1P28 A;  3D74 A;  2AUC A;  4HRE E;  4OZD A;  4JQ0 D;  1WLM A;  1UUS A;  3I5I C;  3PM2 A;  2H61 C;  3S0A A;  3O78 A;  1NCZ A;  1NX1 A;  4HRG A;  1F71 A;  5AAN A;  3SG6 A;  3PM8 A;  3DZT A;  5I2L A;  5D69 A;  1ZUZ A;  1OE9 B;  1QAT A;  3O4X A;  2Y1N A;  3EK8 A;  1UHH A;  2K0J A;  2LV7 A;  1W7I B;  3SS5 A;  3FS7 A;  3IQO A;  2KLE A;  3DF0 A;  2CBL A;  3TUY C;  5KTY A;  3LLE A;  1DJZ A;  2QDI A;  3CR5 X;  1BF5 A;  2KSP A;  3LL8 B;  5AXI A;  1LA0 A;  1QLS A;  3C1V A;  1SR6 B;  3SS3 A;  3PJI A;  1PVA A;  1MWN A;  3ZWH A;  3OHM B;  1F4O A;  4GGF A;  2ERB A;  3BFA A;  3SJS A;  3TDZ A;  1S6J A;  2Q4U A;  2KFG A;  2K2F A;  2LLS A;  2L4H A;  2M7N A;  2KYC A;  1CB1 A;  1CFF A;  1WRK A;  2WCF A;  2LUC A;  2F3Z A;  1U5I B;  3SG3 A;  1V1G A;  3OX6 A;  1H4B A;  1DJX A;  1QLK A;  2JNF A;  5EL2 A;  1SKT A;  3DVK A;  2LE9 B;  2WCL A;  3B7A A;  2JXC A;  1JF0 A;  2L50 A;  4N1F A;  2LP3 A;  4WRI A;  1TOP A;  3JVT B;  5HLV A;  1UUR A;  4L9M A;  5ER5 A;  3DYE A;  1SK6 D;  2MA2 A;  4MLW A;  1K9P A;  5AFP A;  2PRU A;  1SSE B;  2ZN8 A;  1KK7 Z;  1OOH A;  3QRX A;  4JPZ B;  5FYX A;  1QXP A;  1GGW A;  2BAP A;  3LK0 A;  2E6W A;  1ALW A;  1J55 A;  1G8I A;  1C3Z A;  1NCX A;  3BUO B;  1A2X A;  1OOI X;  3IQQ A;  2WCB A;  4MN0 A;  4A4C A;  1LA3 A;  4CPV A;  2LC5 A;  3LK1 A;  1NIW A;  1WRZ A;  4KYN A;  3UO9 A;  3CZ1 A;  3OGN A;  2HPS A;  3HCM A;  4GNK B;  4MZL A;  1NP8 A;  2GGM A;  4OR9 B;  1QJT A;  1Z2C B;  1S1E A;  1JFK A;  2AMI A;  1M46 A;  1L2O B;  4HRH A;  1EXR A;  4GGF C;  2K61 A;  4DS7 A;  3SIA A;  4FTG A;  2D8N A;  1DJG A;  2OS8 B;  1OW4 A;  3EK7 A;  2K8M B;  4QJ5 B;  2JOJ A;  1QAS A;  3L4A A;  2BCA A;  2F3Y A;  2M97 A;  2HQW A;  4NDB A;  1DQE A;  2KDH A;  2ZFD A;  3BUX B;  5I94 A;  1DJH A;  3I5F C;  3PLF B;  2LNK A;  1QWV A;  4PE4 A;  1JC2 A;  1OZS A;  3R1P A;  1Y1X A;  2LVI A;  3A8R A;  3R1V A;  1KK8 B;  4OV2 A;  1OZO A;  1AJ4 A;  1SMG A;  3BOW B;  3K1E A;  4OVN F;  3SS4 A;  2EHB A;  3D10 A;  3D73 A;  3EVR A;  3H4S E;  1MF8 B;  3JTD C;  3E3R A;  1A29 A;  1A4P A;  1OMR A;  3B88 A;  4I5N B;  1R2U A;  2P71 A;  1B7T Z;  1B8L A;  1ODB A;  2I7A A;  1EG4 A;  3DVJ A;  1K96 A;  2KFH A;  2MRD A;  1F70 A;  1SPY A;  5DIC A;  5I2Q A;  1FF1 A;  4CLN A;  1SL9 A;  4USL A;  1IKU A;  1QS7 A;  1JBA A;  1A75 B;  1OMV A;  1TCF A;  5K89 A;  2M9G A;  2LMT A;  1QX5 B;  3NSK A;  3VRO A;  4AOM A;  4MRX A;  3SG7 A;  1YUS A;  4MZK A;  5FI6 A;  1EL4 A;  2JT8 A;  2M7L A;  1ZFS A;  3PN7 B;  2KHN A;  1TRF A;  3HX4 A;  1EJ3 A;  4ICB A;  5AEQ A;  1OSA A;  1QV0 A;  1Y1A A;  1YTZ C;  1JSA A;  2F2P A;  3TDU A;  3NGV A;  3Q8I A;  1FPW A;  2OTG C;  1AUI B;  1K90 D;  1LXF C;  1NSH A;  1F54 A;  2KAY A;  2I18 A;  1KK7 Y;  4CID A;  2ZNE A;  1NWD A;  1A03 A;  1JUO A;  3O4Y A;  1TWO A;  1CLM A;  5HKW A;  1S6C A;  3KPX A;  1HQV A;  1X02 A;  1XA5 A;  2P70 A;  2PVB A;  2AAO A; 
#chains in the Genus database with same CATH homology
 1N65 A;  3EKJ A;  4JWQ A;  1G33 A;  1RFJ A;  2I94 A;  2LUX A;  2MHH A;  3VRP A;  1CMG A;  2KGB C;  2KNE A;  4FQO A;  1K95 A;  3CWG A;  4YGC B;  4XJK B;  1CM1 A;  1IQ5 A;  3VRR A;  5ER4 X;  3CLN A;  1KFX L;  1IQ3 A;  2LCP A;  2BL0 B;  1J7O A;  2JZI A;  2EC6 B;  1YX7 A;  2LP2 A;  1BG1 A;  2KI4 B;  3TS5 B;  3I5G C;  2JTT A;  1UWO A;  1DGV A;  4PDZ A;  1WDC B;  1WLZ A;  1EH2 A;  2OPO A;  3BXK A;  2JTZ A;  3CS1 A;  1HT9 A;  1LIN A;  4YGD B;  2LM5 A;  3AKA A;  4ZCU A;  1ZMZ A;  3WNX B;  1KSM A;  1KSO A;  5DKN A;  2BCX A;  3IF7 A;  3VRQ A;  3WHU B;  1QX7 A;  2K2A A;  2G2B A;  1K94 A;  1LKJ A;  1XFU O;  2PMY A;  4Q04 A;  2BE6 A;  1CLB A;  1IH0 A;  1B7T Y;  1IGV A;  1NUB A;  2B1U A;  4PHJ A;  5DKQ A;  4PHN A;  1R6P A;  1JWD A;  2LVJ A;  2NXQ A;  5PAL A;  2V53 A;  2FCE A;  5JJG A;  1ZAC A;  1TNQ A;  3NSI A;  2K7C A;  4CFR A;  1CFD A;  5CSF A;  2HET A;  1A75 A;  2JRF A;  2MAZ A;  3I5I B;  1J1E A;  1YUU A;  1J7P A;  1M63 B;  1PK0 D;  5CSN A;  2L0P A;  5TNC A;  2LAP A;  1L2O C;  1MXE A;  1N0Y A;  3VGO A;  1RRO A;  2BE4 A;  3EVV A;  3GOF A;  2KGR A;  1Y6W A;  2PAL A;  2I2R E;  2KAV A;  3BUW B;  3D0Y B;  1K9U A;  4MEW A;  1SBJ A;  2M1U A;  5HKY A;  3OB2 B;  2NLN A;  1TIZ A;  1UHJ A;  1MUX A;  2JT3 A;  4MSP A;  2KYF A;  2L2E A;  2MBX A;  2CNP A;  4NQG A;  1YUT A;  1KWO C;  1F8H A;  1YVH A;  1CDP A;  4PE7 A;  1TNW A;  2O60 A;  4ORB B;  2NCO A;  2Y1M A;  4TNC A;  1NYA A;  1UP5 A;  1SL7 A;  1SCV A;  1XYD A;  2KI6 C;  1CDM A;  1IG5 A;  2KAX A;  1SY9 A;  3OP0 A;  3SIB A;  3VRN A;  2CT9 A;  2QAC A;  1AHR A;  2MJW B;  5HKZ A;  2JU0 A;  3LCP C;  3PSR A;  3GK2 A;  5HLO A;  2M1K B;  1RJV A;  2KI6 D;  5I2O A;  2WC8 A;  3BYA A;  1SW8 A;  4OKH A;  1M39 A;  1OQP A;  1Y1U A;  1SYM A;  2MLE C;  4C0L A;  2JC2 A;  4HSZ A;  1FBV A;  3BQ3 A;  1Q80 A;  1XO5 A;  2L98 A;  3O6B A;  3PFV A;  1UHI A;  4AQI A;  1KFU L;  2VRG A;  1KFX S;  3BUN B;  5I8N A;  2ZKM X;  2COL B;  2Y5I A;  4M2P A;  2NCP A;  1CLL A;  5KSZ A;  1AP4 A;  1DTL A;  1RWY A;  1QV1 A;  3WHT B;  1XFW O;  2JUL A;  2SAS A;  2ZND A;  1FI5 A;  2FCD A;  2LMU A;  4A4B A;  2TN4 A;  1CDL A;  1TCO B;  1BU3 A;  1OOJ A;  1U5I A;  2BCB A;  1CTR A;  1KQM C;  4M2O A;  4N1G A;  3KF9 A;  2KBM A;  1B47 A;  2O5G A;  2K7O A;  5CSJ A;  1K9K A;  1NCY A;  1QIW A;  1NX3 A;  1PSR A;  2IS9 A;  2E30 A;  3I5F B;  4YI9 A;  3RLZ A;  1S26 D;  2CCM A;  4F0Z B;  2EGD A;  1QTX A;  1WY9 A;  4QJ4 B;  4MZJ A;  5CSI A;  3EK4 A;  4P2Y B;  2BBN A;  2BEC A;  4BY4 A;  4E68 A;  1D1O A;  4C0K A;  1DJI A;  2LVK A;  1E8A A;  3D0Y A;  3JTD B;  4GPL B;  2F8P A;  3I5H B;  1B8R A;  2FOT A;  2JNX A;  3PAL A;  5IBW A;  1TN4 A;  1CKK A;  1PSB A;  1C7V A;  1IRJ A;  2ZRT A;  4YRU A;  1AJ5 A;  1SR6 C;  5BPJ A;  4CFQ A;  2F33 A;  4GFT A;  2L51 A;  4GAO A;  3CGA A;  3EKH A;  4YI8 A;  1CMF A;  1SCM B;  1CNP A;  1BLQ A;  1XFZ O;  3NSO A;  2A4J A;  1CDN A;  1PUL A;  2WOS A;  3GK4 X;  4P5O E;  3M0W A;  1DT7 B;  4PE0 A;  1J7Q A;  2WOR A;  2HF5 A;  2L5X B;  1YRT B;  1F4Q A;  2OTG B;  2Q91 A;  3GK1 A;  1DF0 B;  2M49 B;  4NDD A;  1B4C A;  1OMD A;  1TNP A;  4AQJ A;  3BOW A;  4DCK A;  2GGZ A;  3JVT C;  4WQ2 A;  3FIA A;  4C0J A;  3OX5 A;  2H2K A;  3AAK A;  1W7J B;  4YGB B;  2K7D A;  3K21 A;  2WND A;  3CR4 X;  1DJY A;  1RTP 1;  3OB1 B;  1JF2 A;  1N2D A;  2M8U A;  1XFX O;  2KFF A;  5CPV A;  5J3X A;  2WCE A;  1XVJ A;  3CZT X;  4MVF A;  1IJ5 A;  1M45 A;  3I5G B;  1JFJ A;  1KFU S;  5JOL A;  4MRY A;  3CTN A;  1ALV A;  1TTX A;  1S36 A;  3BUM B;  1YX8 A;  1EG3 A;  1GQM A;  5HYD A;  1GJY A;  2CXJ A;  2OS8 C;  3KEV A;  2PSR A;  4I5K A;  1MXL C;  5D7F A;  3SG4 A;  1QVI Y;  2BKH B;  2HQ8 A;  5DKR A;  4PE1 A;  4IL1 A;  1J7R A;  4PAL A;  1BMO A;  1MR8 A;  4NDC A;  1K93 D;  5G08 A;  3RM1 A;  4DIR A;  4MBE A;  3TUY B;  4DUQ A;  1S6I A;  4DRW A;  2Y4Q A;  4ORA B;  1S5G Y;  4YGA A;  1KK8 C;  5F6T A;  1B1G A;  4GBA A;  5B8I B;  3AAJ A;  4ETO A;  3TDI A;  1FI6 A;  2CTN A;  2G9B A;  1K2H A;  2DOQ A;  2KOT A;  2FJU B;  2JT0 A;  4XJK A;  3F45 A;  2ZN9 A;  1MQ1 A;  4YBH B;  1XFV O;  2JXL A;  1KCY A;  1YR5 A;  1QIV A;  1ZOT B;  2LVV A;  2LLU A;  4BY5 A;  5KU1 A;  1M31 A;  1C07 A;  1XFY O;  3SG2 A;  1K8U A;  1XK4 A;  1YUR A;  2BKI B;  4WQ3 A;  3ICB A;  1B8C A;  2GV5 A;  1Y0V H;  1DVI A;  1L7Z A;  2SCP A;  2JPT A;  1BJF A;  2R2I A;  2LAN A;  3PN7 C;  1TNX A;  3ZNI A;  5AER A;  3DVE A;  1CFP A;  2JWW A;  3AKB A;  2ZRS A;  1DF0 A;  1PRW A;  1SRA A;  1G4Y R;  2F2O A;  3DF0 B;  3EVU A;  2ISD A;  2LLT A;  1BR4 B;  3TZ1 A;  1KWO B;  2LMV A;  3WXA A;  1BR1 B;  2KQY A;  4GGN A;  5GQQ C;  4GUK A;  3A4U B;  4M2Q A;  2RGI A;  4R1E A;  3DD4 A;  1QX2 A;  4PCW A;  1UHN A;  1V1F A;  3SG5 A;  1S3P A;  3FWC A;  3CR2 A;  1BOD A;  1NPQ A;  1PAL A;  2JQ6 A;  3I5H C;  3PAT A;  2BL0 C;  4ORC B;  1SL8 A;  2EC6 C;  1YRU B;  2KI4 C;  2NZ0 A;  3KO0 A;  3TS5 C;  1BT6 A;  1GGZ A;  1QVI Z;  2H61 A;  2LHL A;  1J1D A;  1NX2 A;  4N5X A;  4PHK A;  4OCI A;  2LHI A;  4QJ3 B;  3FWB A;  1REC A;  1BOC A;  1UHK A;  1XK4 C;  2M29 A;  2K7B A;  1SCM C;  1WDC C;  1S5G Z;  1PVB A;  1NX0 A;  1LVC D;  1IWQ A;  4ZCV A;  1H8B A;  4XYN A;  1AVS A;  1C7W A;  4I5J A;  2M0R A;  2M3W A;  1YVL A;  3O2P A;  1RK9 A;  2MLF C;  2BBM A;  3NXA A;  3DVM A;  1CM4 A;  1WRL A;  2QPT A;  1AK8 A;  4I5L B;  4D1E A;  1CFC A;  1B9A A;  3KHE A;  1IJ6 A;  4PHM A;  3MSE B;  1DGU A;  4UPG A;  2KQ6 A;  1F55 A;  4YGE B;  1VRK A;  2L4I A;  4U8D A;  1SNL A;  2PAS A;  1KQM B;  2KBI A;  1DMO A;  1MHO A;  1FW4 A;  1DJW A;  2P6B B;  3NSL A;  1KQV A;  2AUC A;  4HRE E;  4JQ0 D;  1WLM A;  1UUS A;  3I5I C;  2H61 C;  3O78 A;  1NCZ A;  1NX1 A;  4HRG A;  1F71 A;  5AAN A;  3SG6 A;  3PM8 A;  5I2L A;  5D69 A;  1ZUZ A;  1OE9 B;  1QAT A;  2Y1N A;  3EK8 A;  1UHH A;  2K0J A;  2LV7 A;  1W7I B;  3FS7 A;  3IQO A;  3DF0 A;  2CBL A;  3TUY C;  5KTY A;  3LLE A;  1DJZ A;  3CR5 X;  1BF5 A;  2KSP A;  3LL8 B;  5AXI A;  1LA0 A;  1QLS A;  3C1V A;  1SR6 B;  1PVA A;  1MWN A;  3ZWH A;  3OHM B;  1F4O A;  4GGF A;  3SJS A;  3TDZ A;  1S6J A;  2Q4U A;  2KFG A;  2K2F A;  2LLS A;  2L4H A;  2M7N A;  2KYC A;  1CB1 A;  1CFF A;  1WRK A;  2WCF A;  2LUC A;  2F3Z A;  1U5I B;  3SG3 A;  1V1G A;  3OX6 A;  1H4B A;  1DJX A;  1QLK A;  2JNF A;  1SKT A;  3DVK A;  2LE9 B;  2JXC A;  1JF0 A;  2L50 A;  4N1F A;  2LP3 A;  4WRI A;  1TOP A;  3JVT B;  5HLV A;  1UUR A;  4L9M A;  5ER5 A;  1SK6 D;  2MA2 A;  4MLW A;  1K9P A;  5AFP A;  2PRU A;  3QRX A;  2ZN8 A;  1KK7 Z;  4JPZ B;  5FYX A;  1QXP A;  1GGW A;  3LK0 A;  2E6W A;  1ALW A;  1J55 A;  1G8I A;  1NCX A;  3BUO B;  1A2X A;  3IQQ A;  2WCB A;  4MN0 A;  4A4C A;  1LA3 A;  4CPV A;  2LC5 A;  3LK1 A;  1NIW A;  1WRZ A;  2HPS A;  3HCM A;  4GNK B;  4MZL A;  1NP8 A;  2GGM A;  4OR9 B;  1QJT A;  1S1E A;  1JFK A;  2AMI A;  1M46 A;  1L2O B;  4HRH A;  1EXR A;  4GGF C;  2K61 A;  4DS7 A;  3SIA A;  4FTG A;  2D8N A;  1DJG A;  2OS8 B;  3EK7 A;  2K8M B;  4QJ5 B;  2JOJ A;  1QAS A;  2BCA A;  2F3Y A;  2M97 A;  2HQW A;  4NDB A;  3BUX B;  2KDH A;  2ZFD A;  1DJH A;  3I5F C;  3PLF B;  2LNK A;  4PE4 A;  1JC2 A;  1OZS A;  1Y1X A;  2LVI A;  3A8R A;  1KK8 B;  4OV2 A;  1OZO A;  1AJ4 A;  1SMG A;  3BOW B;  4OVN F;  2EHB A;  3D10 A;  3EVR A;  3H4S E;  1MF8 B;  3JTD C;  3E3R A;  1A29 A;  1A4P A;  1OMR A;  4I5N B;  1R2U A;  1B7T Z;  1B8L A;  1ODB A;  2I7A A;  1EG4 A;  3DVJ A;  1K96 A;  2KFH A;  2MRD A;  1F70 A;  1SPY A;  1FF1 A;  5I2Q A;  4CLN A;  1SL9 A;  4USL A;  1IKU A;  1QS7 A;  1JBA A;  1A75 B;  1OMV A;  1TCF A;  5K89 A;  2M9G A;  2LMT A;  1QX5 B;  3NSK A;  3VRO A;  4AOM A;  4MRX A;  3SG7 A;  1YUS A;  4MZK A;  1EL4 A;  2JT8 A;  2M7L A;  1ZFS A;  3PN7 B;  2KHN A;  1TRF A;  3HX4 A;  1EJ3 A;  4ICB A;  5AEQ A;  1OSA A;  1QV0 A;  1Y1A A;  1YTZ C;  1JSA A;  2F2P A;  3TDU A;  1FPW A;  2OTG C;  1AUI B;  1K90 D;  1LXF C;  1NSH A;  1F54 A;  2KAY A;  2I18 A;  1KK7 Y;  4CID A;  2ZNE A;  1NWD A;  1A03 A;  1JUO A;  3O4Y A;  1CLM A;  5HKW A;  1S6C A;  3KPX A;  1HQV A;  1X02 A;  1XA5 A;  2PVB A;  2AAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...