5DKNA

Crystal structure of calcium-loaded s100b bound to sbi4225
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
91
structure length
91
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein/inhibitor
total genus 32
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5dknA00
1K93D 5DKQA 2JULA 5HYDA 1OZSA 2KI4C 4F0ZB 2QACA 1QLKA 1UUSA 2MA2A 1EG3A 3KO0A 2WCFA 1JBAA 3NXAA 2KAVA 2MHHA 2BE4A 2AUCA 3CTNA 4PHNA 5D69A 4ICBA 3EKJA 3TDZA 2CTNA 4ZCVA 4GGFC 4JPZB 4DIRA 1V1FA 1YVHA 4D1EA 1IQ5A 2L0PA 2KAYA 3EKHA 1BT6A 2H2KA 5D7FA 4L9MA 2L98A 4YGBB 1JFJA 1AK8A 1AJ5A 1YTZC 2FCDA 3TDUA 5B8IB 2EHBA 5F6TA 1UHIA 2WCEA 2Y1MA 2LUXA 1DJWA 1UHJA 1WLZA 1K96A 2WC8A 3PALA 1FI6A 1BR4B 3PSRA 1MR8A 1W7JB 1L2OC 4NDCA 4M2PA 4ZCUA 2KI4B 4NDDA 1XFXO 3PFVA 4MBEA 2LP2A 2SCPA 2ZRTA 1G8IA 2M7NA 1KQVA 4AOMA 1YUSA 1SL7A 2BL0C 1NUBA 3LCPC 1A03A 1NX2A 4QJ3B 2DOQA 3WHUB 1IKUA 3WNXB 3EVUA 3LK1A 1TNWA 1B7TZ 4DS7A 1OE9B 1YUUA 4GGFA 3TUYB 1XK4C 3SIBA 2M9GA 1B47A 1CM1A 3OX6A 1A4PA 1S1EA 2NLNA 3ICBA 1JF2A 1RWYA 4MZLA 4OV2A 4MN0A 3CWGA 5AXIA 1CFFA 2KSPA 1ALVA 3BXKA 2KBMA 4CIDA 2ZNEA 5CSIA 5JOLA 1OQPA 2MBXA 1BLQA 4MLWA 3CS1A 2Y5IA 3KPXA 1FF1A 1L2OB 1CNPA 1KK7Z 2LUCA 1YX8A 2O5GA 2M7LA 1SW8A 2H61C 3RM1A 2WOSA 3GK2A 1MQ1A 1A2XA 2LE9B 1N65A 2LCPA 3LK0A 1WDCC 1SCMC 2BE6A 2PMYA 3BUWB 4GNKB 2BL0B 1TCOB 2D8NA 1DJXA 3EK7A 1IJ6A 2JNXA 3C1VA 1CLMA 1C7VA 2BCAA 1TRFA 1BR1B 2HQ8A 1DTLA 1IJ5A 2E30A 1PULA 2ZNDA 4FTGA 2K0JA 1E8AA 1EH2A 3NSIA 1UHHA 1N2DA 3TS5C 4CLNA 1B1GA 1KQMC 1B8CA 2M49B 1S3PA 3I5IC 1J1DA 1S6IA 1KCYA 1LINA 1QVIY 2BCBA 1K95A 4GGNA 1UURA 3OX5A 2CT9A 5CPVA 1M31A 1SKTA 2L2EA 2K7DA 1NCYA 2OPOA 2NZ0A 3E3RA 3EK8A 3JTDC 3OP0A 4YI8A 1X02A 2M1UA 2M0RA 2LHLA 1RTP1 1BJFA 1MXEA 1OMVA 1SMGA 3OB2B 1F70A 2HPSA 4BY5A 2JT3A 3M0WA 1KSMA 3DF0B 5KTYA 2F2OA 4DRWA 3BQ3A 3I5HC 2ZKMX 1RROA 1PVBA 1HT9A 1OZOA 3KF9A 2G9BA 1RK9A 2CNPA 1UHNA 1CLLA 4FQOA 4CPVA 2JTTA 3HX4A 1K9UA 1RJVA 1WLMA 4MSPA 5BPJA 4YRUA 1S6JA 3OB1B 1CMFA 3DVKA 3FS7A 4ORBB 1KK8C 2F33A 1AVSA 3BYAA 2CXJA 1DJHA 1ZMZA 1TIZA 1LVCD 2KQYA 3TS5B 1TNQA 2LMUA 1KQMB 3WHTB 1NSHA 3JVTC 1ZACA 2PVBA 3I5IB 1S26D 1OMDA 4P5OE 5HLOA 4E68A 2F3ZA 1J55A 4IL1A 5FYXA 1SCVA 1EJ3A 1GJYA 4USLA 3VRNA 2OTGC 3JTDB 2K7OA 3I5FC 2BBMA 3SIAA 1DJZA 1K94A 1B4CA 1XFZO 2V53A 2HETA 1BMOA 3NSKA 1CDPA 1SY9A 2EC6C 2I7AA 4NDBA 3I5HB 1R2UA 1YVLA 4JWQA 2JWWA 3HCMA 5DKNA 1B9AA 1TNPA 4UPGA 3BUMB 4GFTA 1GQMA 1QX2A 3MSEB 5KU1A 3SJSA 3O6BA 1Y0VH 4MRXA 1KK8B 3GK1A 4TNCA 2PASA 1MHOA 1QS7A 2MLFC 2MRDA 1DJGA 3DD4A 3QRXA 5I2OA 2LMVA 3JVTB 2EGDA 5AFPA 2M3WA 1Q80A 5KSZA 2R2IA 4JQ0D 1Y1AA 4YGDB 1LXFC 1CDNA 2OTGB 2MLEC 3I5FB 4DUQA 1F55A 1S6CA 4C0KA 4MRYA 2M1KB 1GGZA 1XFVO 4WQ3A 1BU3A 3VGOA 3IQOA 4GPLB 2KGRA 1IGVA 2EC6B 2LC5A 5HKWA 3ZWHA 2OS8C 1RECA 1S36A 2COLB 4OVNF 5DKRA 1DMOA 5I8NA 2KNEA 1SK6D 1TOPA 2GV5A 2JU0A 2PRUA 4C0LA 1A75A 4WRIA 3A8RA 2JXCA 3O4YA 1QV0A 1UHKA 2LAPA 2WCBA 1J1EA 1DJIA 4I5JA 2KI6D 2Q4UA 3RLZA 2IS9A 1BF5A 1YR5A 1ZUZA 2AMIA 2JXLA 3NSOA 1AJ4A 2LM5A 3DVEA 3FIAA 2GGMA 4PCWA 4PE0A 4AQJA 4YGEB 2I2RE 5IBWA 1QVIZ 1CMGA 2NXQA 2VRGA 4I5KA 1PK0D 4N5XA 1YX7A 1IRJA 4ORCB 3SG6A 1NYAA 4XJKA 1JUOA 3O2PA 1FPWA 2LVJA 4OCIA 2CCMA 1QV1A 2BECA 2LV7A 2JQ6A 2OS8B 3D0YA 3SG5A 2I94A 4MVFA 1U5IA 1QX7A 2CBLA 2F2PA 2L4IA 2WNDA 1LA0A 1WRKA 2FCEA 1B8RA 1NIWA 3DVJA 1J7PA 2JOJA 2LNKA 1B8LA 4ORAB 4M2QA 3BOWA 1VRKA 2LHIA 1BOCA 1DGUA 2JRFA 4QJ5B 3H4SE 1SR6C 2M29A 1H8BA 3OHMB 2KQ6A 3K21A 1MF8B 1NP8A 1K8UA 1F8HA 2KOTA 1SPYA 1FW4A 1WY9A 1M45A 4NQGA 1MWNA 1ODBA 1HQVA 1K90D 1WDCB 5K89A 1SCMB 1S5GY 1DF0A 1PSBA 1TTXA 2LLSA 1XYDA 1NX0A 2L51A 3CLNA 2KFHA 2QPTA 2KAXA 4PALA 1CM4A 2ZN8A 3VRPA 1RFJA 1CDLA 3CR4X 1NX1A 2K61A 3BUOB 3PN7C 4A4CA 1KFXS 5ER5A 1G4YR 2JTZA 1A29A 1Y6WA 3AKAA 1PVAA 1QATA 4GAOA 1BG1A 4HSZA 3SG2A 1QASA 4YGCB 1CKKA 1OMRA 1SBJA 1WRZA 5I2LA 2KFGA 5AERA 4ETOA 4MZJA 3VRQA 1SR6B 4PE1A 2FOTA 1NPQA 2M97A 2LLTA 2JT8A 1PSRA 1IH0A 3PM8A 3WXAA 3ZNIA 4YI9A 3LL8B 2G2BA 2HF5A 2KDHA 2M8UA 2MAZA 3O78A 4PE7A 4GBAA 1JWDA 4A4BA 1QXPA 2KHNA 1CB1A 2ZRSA 2JZIA 1K2HA 5PALA 4N1GA 4HRHA 1BODA 4HREE 5CSJA 1NWDA 2F3YA 3PN7B 2NCOA 5CSFA 1NCXA 2LVKA 1LKJA 5TNCA 3IQQA 1NX3A 4OKHA 1YRTB 4HRGA 1G33A 3TUYC 2JC2A 2K7BA 2PSRA 2LMTA 5I2QA 1J7OA 3SG7A 5ER4X 1CLBA 2HQWA 1CFPA 1EXRA 5HKYA 1NCZA 2I18A 1ZOTB 2O60A 3GK4X 1UWOA 1YRUB 1XFWO 1XVJA 4MEWA 1FBVA 1M39A 1F4QA 2A4JA 2L50A 2LVIA 3IF7A 1XO5A 1J7RA 2JT0A 1SL9A 3NSLA 1JF0A 1XA5A 4DCKA 1OOJA 1C07A 1F54A 1QTXA 1QIWA 1PRWA 1W7IB 2KI6C 2K2AA 5HKZA 1A75B 2B1UA 1JC2A 2Y4QA 4PDZA 1SL8A 1ALWA 2ZFDA 4AQIA 1ZFSA 1Y1UA 4PHJA 4CFRA 1YUTA 1CDMA 2Q91A 4PHMA 1QIVA 2K7CA 3CR5X 2Y1NA 3BUNB 2AAOA 2P6BB 4OR9B 1JFKA 4M2OA 2RGIA 1H4BA 1F71A 1UP5A 2ZN9A 4PHKA 2LLUA 5CSNA 1CFDA 3EK4A 1IG5A 1AP4A 4U8DA 3I5GC 2JPTA 2KFFA 1EG4A 4XJKB 1IQ3A 2BBNA 1KWOC 2K8MB 4WQ2A 2BCXA 2ISDA 3TZ1A 1C7WA 4BY4A 1IWQA 1XFYO 2SASA 5GQQC 3D0YB 2GGZA 2NCPA 1K9PA 4I5NB 3LLEA 2MJWB 1U5IB 1F4OA 2LVVA 5AANA 3D10A 1DVIA 1KSOA 1FI5A 1KFXL 3VROA 4QJ4B 1EL4A 5G08A 4C0JA 1B7TY 1CFCA 5J3XA 3BOWB 1M46A 1SRAA 1S5GZ 4I5LB 1DGVA 4XYNA 1D1OA 1M63B 3BUXB 3FWCA 1V1GA 2WORA 3F45A 3AAKA 3TDIA 4P2YB 3AAJA 1MUXA 1SNLA 3KHEA 1R6PA 3SG4A 4GUKA 1KFUL 2TN4A 2E6WA 1QLSA 2L4HA 3CR2A 1QJTA 1DF0B 2KGBC 3EVRA 1TN4A 3KEVA 4R1EA 3VRRA 3I5GB 2LANA 2LP3A 1AUIB 1DT7B 1KK7Y 1KWOB 1K9KA 3FWBA 1OSAA 1TCFA 4YBHB 2BKHB 1XFUO 3SG3A 3A4UB 2L5XB 1YURA 1JSAA 1QX5B 1XK4A 1J7QA 5AEQA 1TNXA 1L7ZA 1N0YA 1SYMA 3CZTX 5HLVA 4MZKA 2KBIA 1CTRA 3PATA 2K2FA 4CFQA 1GGWA 4N1FA 4YGAA 1AHRA 1Y1XA 3EVVA 2KYFA 4Q04A 1LA3A 2BKIB 3DVMA 3CGAA 2FJUB 3PLFB 1WRLA 4PE4A 1PALA 2H61A 3DF0A 1DJYA 3AKBA 3GOFA 1KFUS 2KYCA 2JNFA 5JJGA 2PALA 2F8PA 1MXLC
chains in the Genus database with same CATH superfamily
1K93D 5DKQA 2JULA 5HYDA 1OZSA 2KI4C 3B87A 4F0ZB 2QACA 1QLKA 3S0DA 1UUSA 2MA2A 1EG3A 3KO0A 2WCFA 1JBAA 3NXAA 2KAVA 2MHHA 2BE4A 2AUCA 2WCMA 3CTNA 4PHNA 5D69A 4ICBA 3EKJA 3TDZA 2CTNA 4ZCVA 4GGFC 4JPZB 5FI7A 4DIRA 1V1FA 1YVHA 4D1EA 1IQ5A 2L0PA 2KAYA 3EKHA 1BT6A 2H2KA 5D7FA 4L9MA 1Z2CB 3S0EA 2L98A 4YGBB 1JFJA 1AK8A 1AJ5A 1YTZC 3B86A 2FCDA 3R1OA 3TDUA 5B8IB 2EHBA 5F6TA 1UHIA 2WCEA 2Y1MA 2LUXA 1DJWA 1UHJA 1WLZA 1TUZA 1K96A 2WC8A 3PALA 1FI6A 3DZTA 1BR4B 3PSRA 1MR8A 1W7JB 1L2OC 4NDCA 4M2PA 4ZCUA 2KI4B 3B7AA 1XFXO 3L4AA 3PFVA 4MBEA 4NDDA 2LP2A 2SCPA 2ZRTA 1G8IA 2M7NA 3S0BA 1KQVA 4AOMA 3PJIA 1YUSA 1SL7A 2BL0C 1NUBA 3LCPC 1A03A 1NX2A 4QJ3B 2DOQA 3SS4A 3WHUB 5I94A 3WNXB 1IKUA 3B88A 3EVUA 3LK1A 1TNWA 1B7TZ 4DS7A 1OE9B 1YUUA 2L2CA 4GGFA 3TUYB 1XK4C 3SIBA 2M9GA 2BAPA 3K1EA 1B47A 1CM1A 3OX6A 1A4PA 1S1EA 2NLNA 3CZ0A 3ICBA 1JF2A 1RWYA 4MZLA 5D3OA 4OV2A 4MN0A 3CWGA 5AXIA 1CFFA 2KSPA 1ALVA 3BXKA 2KBMA 4CIDA 2ZNEA 4PT1A 5CSIA 1OQPA 5JOLA 2MBXA 1BLQA 4MLWA 3CS1A 2Y5IA 3KPXA 1FF1A 1L2OB 1CNPA 1KK7Z 2LUCA 1YX8A 2O5GA 2M7LA 1SW8A 3CZ1A 2H61C 3RM1A 2WOSA 3GK2A 1MQ1A 1A2XA 2LE9B 1N65A 1OOHA 2LCPA 3LK0A 2QEBA 2KLDA 1WDCC 1ORGA 1SCMC 2BE6A 2PMYA 3BFBA 3BUWB 4GNKB 2BL0B 1TCOB 2D8NA 1DJXA 3EK7A 1IJ6A 2JNXA 3C1VA 1CLMA 1C7VA 2BCAA 1TRFA 1BR1B 2HQ8A 1DTLA 1IJ5A 2E30A 4INXA 1PULA 2ZNDA 4FTGA 1OOFA 2K0JA 1E8AA 1EH2A 3NSIA 1UHHA 1N2DA 2WC6A 3TS5C 4CLNA 1KQMC 1B8CA 2M49B 1B1GA 1S3PA 3I5IC 1J1DA 1S6IA 1KCYA 1LINA 1QVIY 2BCBA 1K95A 4GGNA 1UURA 3OX5A 2CT9A 5CPVA 1M31A 1SKTA 2L2EA 2K7DA 1NCYA 2OPOA 2NZ0A 3E3RA 3EK8A 3JTDC 3OP0A 4YI8A 3BFHA 1X02A 1OW4A 2M1UA 2M0RA 2LHLA 3D78A 1RTP1 1BJFA 1MXEA 1OMVA 1SMGA 3OB2B 1F70A 2K60A 2HPSA 4BY5A 2JT3A 3M0WA 1KSMA 3DF0B 5KTYA 3CDNA 2F2OA 1Z4HA 4DRWA 3BQ3A 3I5HC 2ZKMX 1RROA 1PVBA 1HT9A 1OZOA 3KF9A 2G9BA 1RK9A 2CNPA 1UHNA 1CLLA 4FQOA 4CPVA 2JTTA 3HX4A 1K9UA 1RJVA 2ERBA 3V2LA 1WLMA 4MSPA 5BPJA 4YRUA 1S6JA 3OB1B 1CMFA 3DVKA 3FS7A 4ORBB 1KK8C 2F33A 1AVSA 3BYAA 2CXJA 1DJHA 1ZMZA 2P71A 1TIZA 1LVCD 2KQYA 3BFAA 1TNQA 2LMUA 3TS5B 1KQMB 3WHTB 1NSHA 3S0FA 3JVTC 1ZACA 2PVBA 3I5IB 1S26D 1OMDA 4P5OE 5HLOA 4E68A 2F3ZA 1J55A 4IL1A 5FYXA 1SCVA 1EJ3A 1GJYA 4USLA 3VRNA 2OTGC 1XFRA 3JTDB 2K7OA 3I5FC 2BBMA 3PM2A 3SIAA 1DJZA 1K94A 3VB1A 1B4CA 3RZSA 1XFZO 2V53A 2HETA 1BMOA 4JD9A 3NSKA 5HL1A 1CDPA 1SY9A 2EC6C 2I7AA 4NDBA 3I5HB 1R2UA 1YVLA 4JWQA 2JWWA 3HCMA 5DKNA 1B9AA 2QEVA 1TNPA 1IIOA 3S0GA 3BUMB 2WCKA 4GFTA 4UPGA 1GQMA 1QX2A 3UNWA 3MSEB 5KU1A 3SJSA 3O6BA 1Y0VH 4MRXA 1KK8B 3GK1A 4TNCA 2PASA 1C3YA 1MHOA 1QS7A 2MLFC 2MRDA 1DJGA 3DD4A 3QRXA 5I2OA 2LMVA 3JVTB 2EGDA 5AFPA 2M3WA 1Q80A 3UO9A 5KSZA 3FE8A 2R2IA 4JQ0D 1Y1AA 3D76A 4YGDB 1LXFC 1CDNA 2OTGB 2MLEC 3I5FB 4DUQA 1F55A 1S6CA 4C0KA 4MRYA 2M1KB 1GGZA 1XFVO 4WQ3A 1BU3A 3VGOA 3IQOA 4GPLB 2KGRA 1IGVA 2EC6B 2LC5A 1C3ZA 5HKWA 3ZWHA 2OS8C 1RECA 1S36A 2COLB 4OVNF 3NHIA 5DKRA 5DICA 1DMOA 5I8NA 2KNEA 1SK6D 3DYEA 1TOPA 3OGNA 2GV5A 2JU0A 2PRUA 4C0LA 1A75A 1T14A 4WRIA 3A8RA 2JXCA 3O4YA 1QV0A 1UHKA 2LAPA 2WCBA 2GTEA 1J1EA 1DJIA 3CABA 4I5JA 2KI6D 2Q4UA 3RLZA 2IS9A 3DY9A 1BF5A 2QDIA 1YR5A 1ZUZA 2AMIA 2JXLA 3NSOA 1AJ4A 2LM5A 3DVEA 3FIAA 3O4XA 2GGMA 1W9ZA 1DC1A 4PCWA 4PE0A 3SS3A 4YGEB 2I2RE 4AQJA 5IBWA 1QVIZ 3D73A 5FI2A 2P70A 1CMGA 2NXQA 2VRGA 4I5KA 1PK0D 4N5XA 1YX7A 3OBVA 1IRJA 4ORCB 3SG6A 1NYAA 3B6XA 4XJKA 1JUOA 3O2PA 1FPWA 1SSEB 2LVJA 4OCIA 2CCMA 1QV1A 2BECA 2LV7A 2JQ6A 2OS8B 3D0YA 3SG5A 2I94A 4MVFA 1U5IA 1QX7A 2CBLA 2F2PA 2L4IA 2WNDA 3CZ2A 1LA0A 1WRKA 2FCEA 1B8RA 1NIWA 3DVJA 1J7PA 2JOJA 2LNKA 1B8LA 4ORAB 4M2QA 3BOWA 1VRKA 2LHIA 2WC5A 1BOCA 1DGUA 2JRFA 4QJ5B 3H4SE 1SR6C 2M29A 1H8BA 3OHMB 2KQ6A 3K21A 1MF8B 1NP8A 1K8UA 2BNXA 1F8HA 2KOTA 1SPYA 1FW4A 1WY9A 1M45A 4NQGA 1MWNA 1ODBA 1HQVA 1K90D 2L5YA 1WDCB 5K89A 1SCMB 4IJ7A 1S5GY 1DF0A 1PSBA 1TTXA 2LLSA 1XYDA 1NX0A 2L51A 4INWA 3CLNA 2KFHA 2QPTA 2KAXA 4PALA 1CM4A 1DQEA 2ZN8A 1RFJA 1CDLA 3FE9A 3VRPA 2FJYA 3CR4X 1NX1A 4JKTA 2K61A 3BUOB 3PN7C 4A4CA 1KFXS 5ER5A 3D75A 1G4YR 2JTZA 1A29A 2PQLA 1Y6WA 3D77A 3AKAA 1PVAA 1QATA 3CYZA 4GAOA 1BG1A 4HSZA 3SG2A 2YGUA 1QASA 4YGCB 1CKKA 3Q8IA 1OMRA 4FQTA 1SBJA 1WRZA 5I2LA 2KFGA 5AERA 4ETOA 4MZJA 3VRQA 1SR6B 4PE1A 2FOTA 1NPQA 2M97A 2LLTA 2JT8A 1PSRA 1IH0A 1DEKA 3PM8A 3WXAA 3ZNIA 2JPOA 3R1PA 4YI9A 3SS5A 3LL8B 2G2BA 2HF5A 2KDHA 2M8UA 2MAZA 3O78A 4PE7A 4GBAA 1JWDA 4A4BA 1QXPA 2KHNA 3DXLA 1CB1A 2ZRSA 2JZIA 1K2HA 3QMEA 5PALA 4N1GA 4HRHA 1BODA 4HREE 5CSJA 1NWDA 2F3YA 3PN7B 2NCOA 2WCHA 5CSFA 1NCXA 2LVKA 1LKJA 5TNCA 3IQQA 1NX3A 2H8VA 4OKHA 1YRTB 2KLEA 4HRGA 2QEHA 1G33A 3TUYC 2JC2A 2K7BA 2PSRA 2LMTA 5I2QA 1J7OA 3SG7A 5ER4X 1CLBA 2HQWA 1CFPA 1EXRA 1QWVA 5HKYA 1NCZA 2QEOA 2I18A 1ZOTB 2O60A 3GK4X 1UWOA 1GM0A 1YRUB 1XFWO 1XVJA 1TUJA 3L4LA 4MEWA 1FBVA 1M39A 1F4QA 2A4JA 2L50A 2LVIA 3IF7A 1XO5A 1J7RA 2JT0A 1SL9A 3NSLA 1JF0A 1XA5A 4DCKA 1OOJA 1C07A 3NHTA 1F54A 1QTXA 1QIWA 1PRWA 1W7IB 2KI6C 2K2AA 5HKZA 1A75B 2B1UA 1JC2A 2Y4QA 4PDZA 1SL8A 1ALWA 2ZFDA 4AQIA 1ZFSA 1Y1UA 4PHJA 4CFRA 3R1VA 1YUTA 1CDMA 2KPHA 2Q91A 4PHMA 1QIVA 2K7CA 3CR5X 2Y1NA 1LS8A 3BUNB 2AAOA 2P6BB 4OR9B 1JFKA 4KYNA 4M2OA 1TWOA 1DELA 2RGIA 3FE6A 1H4BA 1F71A 1UP5A 2ZN9A 4PHKA 2LLUA 5CSNA 1CFDA 3EK4A 1IG5A 1AP4A 3IVTA 4U8DA 3I5GC 2JPTA 3R72A 2KFFA 3S0AA 1EG4A 3L47A 4XJKB 4F7FA 1IQ3A 2BBNA 1KWOC 2K8MB 4WQ2A 2BCXA 2ISDA 3TZ1A 1C7WA 4BY4A 1IWQA 1XFYO 2SASA 5GQQC 3D0YB 2GGZA 2NCPA 1K9PA 4I5NB 1OOGA 3LLEA 2MJWB 1U5IB 1F4OA 2LVVA 5AANA 3D10A 1DVIA 1OOIX 1KSOA 1FI5A 1KFXL 3VROA 4QJ4B 1EL4A 5G08A 4C0JA 1B7TY 1CFCA 5J3XA 3BOWB 1M46A 1SRAA 1S5GZ 4I5LB 1DGVA 4XYNA 1D1OA 1M63B 3BUXB 3FWCA 1V1GA 2WORA 3F45A 3D74A 3AAKA 3TDIA 3N7HA 2WCJA 4P2YB 3AAJA 1MUXA 2PYQA 1SNLA 3KHEA 1R6PA 3SG4A 4GUKA 1KFUL 2TN4A 2E6WA 1QLSA 2L4HA 3CR2A 1QJTA 1DF0B 2KGBC 3EVRA 1TN4A 3KEVA 4R1EA 3VRRA 3I5GB 3BJHA 2LANA 2LP3A 1AUIB 1DT7B 1KK7Y 1KWOB 1K9KA 3FWBA 1OSAA 4OZDA 5FI6A 1TCFA 4YBHB 2BKHB 1XFUO 3SG3A 3A4UB 2L5XB 1YURA 1JSAA 1QX5B 1XK4A 1J7QA 5AEQA 5EL2A 1TNXA 1L7ZA 1N0YA 1SYMA 3CZTX 5HLVA 4MZKA 2KBIA 1CTRA 3PATA 2K2FA 4CFQA 1GGWA 2WCLA 4N1FA 4YGAA 1AHRA 1Y1XA 3EVVA 2KYFA 4Q04A 1LA3A 2BKIB 3DVMA 3CGAA 2FJUB 3PLFB 1WRLA 4PE4A 1PALA 2H61A 3DF0A 1DJYA 3AKBA 3GOFA 3NGVA 1KFUS 1P28A 2KYCA 2JNFA 5JJGA 2PALA 3EG5B 2F8PA 1MXLC
chains in the Genus database with same CATH topology
1K93D 5DKQA 2JULA 5HYDA 1OZSA 2KI4C 4F0ZB 2QACA 1QLKA 1UUSA 2MA2A 1EG3A 3KO0A 2WCFA 1JBAA 3NXAA 2KAVA 2MHHA 2BE4A 2AUCA 3CTNA 4PHNA 5D69A 4ICBA 3EKJA 3TDZA 2CTNA 4ZCVA 4GGFC 4JPZB 4DIRA 1V1FA 1YVHA 4D1EA 1IQ5A 2L0PA 2KAYA 3EKHA 1BT6A 2H2KA 5D7FA 4L9MA 2L98A 4YGBB 1JFJA 1AK8A 1AJ5A 1YTZC 2FCDA 3TDUA 5B8IB 2EHBA 5F6TA 1UHIA 2WCEA 2Y1MA 2LUXA 1DJWA 1UHJA 1WLZA 1K96A 2WC8A 3PALA 1FI6A 1BR4B 3PSRA 1MR8A 1W7JB 1L2OC 4NDCA 4M2PA 4ZCUA 2KI4B 4NDDA 1XFXO 3PFVA 4MBEA 2LP2A 2SCPA 2ZRTA 1G8IA 2M7NA 1KQVA 4AOMA 1YUSA 1SL7A 2BL0C 1NUBA 3LCPC 1A03A 1NX2A 4QJ3B 2DOQA 3WHUB 1IKUA 3WNXB 3EVUA 3LK1A 1TNWA 1B7TZ 4DS7A 1OE9B 1YUUA 4GGFA 3TUYB 1XK4C 3SIBA 2M9GA 1B47A 1CM1A 3OX6A 1A4PA 1S1EA 2NLNA 3ICBA 1JF2A 1RWYA 4MZLA 4OV2A 4MN0A 3CWGA 5AXIA 1CFFA 2KSPA 1ALVA 3BXKA 2KBMA 4CIDA 2ZNEA 5CSIA 5JOLA 1OQPA 2MBXA 1BLQA 4MLWA 3CS1A 2Y5IA 3KPXA 1FF1A 1L2OB 1CNPA 1KK7Z 2LUCA 1YX8A 2O5GA 2M7LA 1SW8A 2H61C 3RM1A 2WOSA 3GK2A 1MQ1A 1A2XA 2LE9B 1N65A 2LCPA 3LK0A 1WDCC 1SCMC 2BE6A 2PMYA 3BUWB 4GNKB 2BL0B 1TCOB 2D8NA 1DJXA 3EK7A 1IJ6A 2JNXA 3C1VA 1CLMA 1C7VA 2BCAA 1TRFA 1BR1B 2HQ8A 1DTLA 1IJ5A 2E30A 1PULA 2ZNDA 4FTGA 2K0JA 1E8AA 1EH2A 3NSIA 1UHHA 1N2DA 3TS5C 4CLNA 1B1GA 1KQMC 1B8CA 2M49B 1S3PA 3I5IC 1J1DA 1S6IA 1KCYA 1LINA 1QVIY 2BCBA 1K95A 4GGNA 1UURA 3OX5A 2CT9A 5CPVA 1M31A 1SKTA 2L2EA 2K7DA 1NCYA 2OPOA 2NZ0A 3E3RA 3EK8A 3JTDC 3OP0A 4YI8A 1X02A 2M1UA 2M0RA 2LHLA 1RTP1 1BJFA 1MXEA 1OMVA 1SMGA 3OB2B 1F70A 2HPSA 4BY5A 2JT3A 3M0WA 1KSMA 3DF0B 5KTYA 2F2OA 4DRWA 3BQ3A 3I5HC 2ZKMX 1RROA 1PVBA 1HT9A 1OZOA 3KF9A 2G9BA 1RK9A 2CNPA 1UHNA 1CLLA 4FQOA 4CPVA 2JTTA 3HX4A 1K9UA 1RJVA 1WLMA 4MSPA 5BPJA 4YRUA 1S6JA 3OB1B 1CMFA 3DVKA 3FS7A 4ORBB 1KK8C 2F33A 1AVSA 3BYAA 2CXJA 1DJHA 1ZMZA 1TIZA 1LVCD 2KQYA 3TS5B 1TNQA 2LMUA 1KQMB 3WHTB 1NSHA 3JVTC 1ZACA 2PVBA 3I5IB 1S26D 1OMDA 4P5OE 5HLOA 4E68A 2F3ZA 1J55A 4IL1A 5FYXA 1SCVA 1EJ3A 1GJYA 4USLA 3VRNA 2OTGC 3JTDB 2K7OA 3I5FC 2BBMA 3SIAA 1DJZA 1K94A 1B4CA 1XFZO 2V53A 2HETA 1BMOA 3NSKA 1CDPA 1SY9A 2EC6C 2I7AA 4NDBA 3I5HB 1R2UA 1YVLA 4JWQA 2JWWA 3HCMA 5DKNA 1B9AA 1TNPA 4UPGA 3BUMB 4GFTA 1GQMA 1QX2A 3MSEB 5KU1A 3SJSA 3O6BA 1Y0VH 4MRXA 1KK8B 3GK1A 4TNCA 2PASA 1MHOA 1QS7A 2MLFC 2MRDA 1DJGA 3DD4A 3QRXA 5I2OA 2LMVA 3JVTB 2EGDA 5AFPA 2M3WA 1Q80A 5KSZA 2R2IA 4JQ0D 1Y1AA 4YGDB 1LXFC 1CDNA 2OTGB 2MLEC 3I5FB 4DUQA 1F55A 1S6CA 4C0KA 4MRYA 2M1KB 1GGZA 1XFVO 4WQ3A 1BU3A 3VGOA 3IQOA 4GPLB 2KGRA 1IGVA 2EC6B 2LC5A 5HKWA 3ZWHA 2OS8C 1RECA 1S36A 2COLB 4OVNF 5DKRA 1DMOA 5I8NA 2KNEA 1SK6D 1TOPA 2GV5A 2JU0A 2PRUA 4C0LA 1A75A 4WRIA 3A8RA 2JXCA 3O4YA 1QV0A 1UHKA 2LAPA 2WCBA 1J1EA 1DJIA 4I5JA 2KI6D 2Q4UA 3RLZA 2IS9A 1BF5A 1YR5A 1ZUZA 2AMIA 2JXLA 3NSOA 1AJ4A 2LM5A 3DVEA 3FIAA 2GGMA 4PCWA 4PE0A 4AQJA 4YGEB 2I2RE 5IBWA 1QVIZ 1CMGA 2NXQA 2VRGA 4I5KA 1PK0D 4N5XA 1YX7A 1IRJA 4ORCB 3SG6A 1NYAA 4XJKA 1JUOA 3O2PA 1FPWA 2LVJA 4OCIA 2CCMA 1QV1A 2BECA 2LV7A 2JQ6A 2OS8B 3D0YA 3SG5A 2I94A 4MVFA 1U5IA 1QX7A 2CBLA 2F2PA 2L4IA 2WNDA 1LA0A 1WRKA 2FCEA 1B8RA 1NIWA 3DVJA 1J7PA 2JOJA 2LNKA 1B8LA 4ORAB 4M2QA 3BOWA 1VRKA 2LHIA 1BOCA 1DGUA 2JRFA 4QJ5B 3H4SE 1SR6C 2M29A 1H8BA 3OHMB 2KQ6A 3K21A 1MF8B 1NP8A 1K8UA 1F8HA 2KOTA 1SPYA 1FW4A 1WY9A 1M45A 4NQGA 1MWNA 1ODBA 1HQVA 1K90D 1WDCB 5K89A 1SCMB 1S5GY 1DF0A 1PSBA 1TTXA 2LLSA 1XYDA 1NX0A 2L51A 3CLNA 2KFHA 2QPTA 2KAXA 4PALA 1CM4A 2ZN8A 3VRPA 1RFJA 1CDLA 3CR4X 1NX1A 2K61A 3BUOB 3PN7C 4A4CA 1KFXS 5ER5A 1G4YR 2JTZA 1A29A 1Y6WA 3AKAA 1PVAA 1QATA 4GAOA 1BG1A 4HSZA 3SG2A 1QASA 4YGCB 1CKKA 1OMRA 1SBJA 1WRZA 5I2LA 2KFGA 5AERA 4ETOA 4MZJA 3VRQA 1SR6B 4PE1A 2FOTA 1NPQA 2M97A 2LLTA 2JT8A 1PSRA 1IH0A 3PM8A 3WXAA 3ZNIA 4YI9A 3LL8B 2G2BA 2HF5A 2KDHA 2M8UA 2MAZA 3O78A 4PE7A 4GBAA 1JWDA 4A4BA 1QXPA 2KHNA 1CB1A 2ZRSA 2JZIA 1K2HA 5PALA 4N1GA 4HRHA 1BODA 4HREE 5CSJA 1NWDA 2F3YA 3PN7B 2NCOA 5CSFA 1NCXA 2LVKA 1LKJA 5TNCA 3IQQA 1NX3A 4OKHA 1YRTB 4HRGA 1G33A 3TUYC 2JC2A 2K7BA 2PSRA 2LMTA 5I2QA 1J7OA 3SG7A 5ER4X 1CLBA 2HQWA 1CFPA 1EXRA 5HKYA 1NCZA 2I18A 1ZOTB 2O60A 3GK4X 1UWOA 1YRUB 1XFWO 1XVJA 4MEWA 1FBVA 1M39A 1F4QA 2A4JA 2L50A 2LVIA 3IF7A 1XO5A 1J7RA 2JT0A 1SL9A 3NSLA 1JF0A 1XA5A 4DCKA 1OOJA 1C07A 1F54A 1QTXA 1QIWA 1PRWA 1W7IB 2KI6C 2K2AA 5HKZA 1A75B 2B1UA 1JC2A 2Y4QA 4PDZA 1SL8A 1ALWA 2ZFDA 4AQIA 1ZFSA 1Y1UA 4PHJA 4CFRA 1YUTA 1CDMA 2Q91A 4PHMA 1QIVA 2K7CA 3CR5X 2Y1NA 3BUNB 2AAOA 2P6BB 4OR9B 1JFKA 4M2OA 2RGIA 1H4BA 1F71A 1UP5A 2ZN9A 4PHKA 2LLUA 5CSNA 1CFDA 3EK4A 1IG5A 1AP4A 4U8DA 3I5GC 2JPTA 2KFFA 1EG4A 4XJKB 1IQ3A 2BBNA 1KWOC 2K8MB 4WQ2A 2BCXA 2ISDA 3TZ1A 1C7WA 4BY4A 1IWQA 1XFYO 2SASA 5GQQC 3D0YB 2GGZA 2NCPA 1K9PA 4I5NB 3LLEA 2MJWB 1U5IB 1F4OA 2LVVA 5AANA 3D10A 1DVIA 1KSOA 1FI5A 1KFXL 3VROA 4QJ4B 1EL4A 5G08A 4C0JA 1B7TY 1CFCA 5J3XA 3BOWB 1M46A 1SRAA 1S5GZ 4I5LB 1DGVA 4XYNA 1D1OA 1M63B 3BUXB 3FWCA 1V1GA 2WORA 3F45A 3AAKA 3TDIA 4P2YB 3AAJA 1MUXA 1SNLA 3KHEA 1R6PA 3SG4A 4GUKA 1KFUL 2TN4A 2E6WA 1QLSA 2L4HA 3CR2A 1QJTA 1DF0B 2KGBC 3EVRA 1TN4A 3KEVA 4R1EA 3VRRA 3I5GB 2LANA 2LP3A 1AUIB 1DT7B 1KK7Y 1KWOB 1K9KA 3FWBA 1OSAA 1TCFA 4YBHB 2BKHB 1XFUO 3SG3A 3A4UB 2L5XB 1YURA 1JSAA 1QX5B 1XK4A 1J7QA 5AEQA 1TNXA 1L7ZA 1N0YA 1SYMA 3CZTX 5HLVA 4MZKA 2KBIA 1CTRA 3PATA 2K2FA 4CFQA 1GGWA 4N1FA 4YGAA 1AHRA 1Y1XA 3EVVA 2KYFA 4Q04A 1LA3A 2BKIB 3DVMA 3CGAA 2FJUB 3PLFB 1WRLA 4PE4A 1PALA 2H61A 3DF0A 1DJYA 3AKBA 3GOFA 1KFUS 2KYCA 2JNFA 5JJGA 2PALA 2F8PA 1MXLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K93 D;  5DKQ A;  2JUL A;  5HYD A;  1OZS A;  2KI4 C;  4F0Z B;  2QAC A;  1QLK A;  1UUS A;  2MA2 A;  1EG3 A;  3KO0 A;  2WCF A;  1JBA A;  3NXA A;  2KAV A;  2MHH A;  2BE4 A;  2AUC A;  3CTN A;  4PHN A;  5D69 A;  4ICB A;  3EKJ A;  3TDZ A;  2CTN A;  4ZCV A;  4GGF C;  4JPZ B;  4DIR A;  1V1F A;  1YVH A;  4D1E A;  1IQ5 A;  2L0P A;  2KAY A;  3EKH A;  1BT6 A;  2H2K A;  5D7F A;  4L9M A;  2L98 A;  4YGB B;  1JFJ A;  1AK8 A;  1AJ5 A;  1YTZ C;  2FCD A;  3TDU A;  5B8I B;  2EHB A;  5F6T A;  1UHI A;  2WCE A;  2Y1M A;  2LUX A;  1DJW A;  1UHJ A;  1WLZ A;  1K96 A;  2WC8 A;  3PAL A;  1FI6 A;  1BR4 B;  3PSR A;  1MR8 A;  1W7J B;  1L2O C;  4NDC A;  4M2P A;  4ZCU A;  2KI4 B;  4NDD A;  1XFX O;  3PFV A;  4MBE A;  2LP2 A;  2SCP A;  2ZRT A;  1G8I A;  2M7N A;  1KQV A;  4AOM A;  1YUS A;  1SL7 A;  2BL0 C;  1NUB A;  3LCP C;  1A03 A;  1NX2 A;  4QJ3 B;  2DOQ A;  3WHU B;  1IKU A;  3WNX B;  3EVU A;  3LK1 A;  1TNW A;  1B7T Z;  4DS7 A;  1OE9 B;  1YUU A;  4GGF A;  3TUY B;  1XK4 C;  3SIB A;  2M9G A;  1B47 A;  1CM1 A;  3OX6 A;  1A4P A;  1S1E A;  2NLN A;  3ICB A;  1JF2 A;  1RWY A;  4MZL A;  4OV2 A;  4MN0 A;  3CWG A;  5AXI A;  1CFF A;  2KSP A;  1ALV A;  3BXK A;  2KBM A;  4CID A;  2ZNE A;  5CSI A;  5JOL A;  1OQP A;  2MBX A;  1BLQ A;  4MLW A;  3CS1 A;  2Y5I A;  3KPX A;  1FF1 A;  1L2O B;  1CNP A;  1KK7 Z;  2LUC A;  1YX8 A;  2O5G A;  2M7L A;  1SW8 A;  2H61 C;  3RM1 A;  2WOS A;  3GK2 A;  1MQ1 A;  1A2X A;  2LE9 B;  1N65 A;  2LCP A;  3LK0 A;  1WDC C;  1SCM C;  2BE6 A;  2PMY A;  3BUW B;  4GNK B;  2BL0 B;  1TCO B;  2D8N A;  1DJX A;  3EK7 A;  1IJ6 A;  2JNX A;  3C1V A;  1CLM A;  1C7V A;  2BCA A;  1TRF A;  1BR1 B;  2HQ8 A;  1DTL A;  1IJ5 A;  2E30 A;  1PUL A;  2ZND A;  4FTG A;  2K0J A;  1E8A A;  1EH2 A;  3NSI A;  1UHH A;  1N2D A;  3TS5 C;  4CLN A;  1B1G A;  1KQM C;  1B8C A;  2M49 B;  1S3P A;  3I5I C;  1J1D A;  1S6I A;  1KCY A;  1LIN A;  1QVI Y;  2BCB A;  1K95 A;  4GGN A;  1UUR A;  3OX5 A;  2CT9 A;  5CPV A;  1M31 A;  1SKT A;  2L2E A;  2K7D A;  1NCY A;  2OPO A;  2NZ0 A;  3E3R A;  3EK8 A;  3JTD C;  3OP0 A;  4YI8 A;  1X02 A;  2M1U A;  2M0R A;  2LHL A;  1RTP 1;  1BJF A;  1MXE A;  1OMV A;  1SMG A;  3OB2 B;  1F70 A;  2HPS A;  4BY5 A;  2JT3 A;  3M0W A;  1KSM A;  3DF0 B;  5KTY A;  2F2O A;  4DRW A;  3BQ3 A;  3I5H C;  2ZKM X;  1RRO A;  1PVB A;  1HT9 A;  1OZO A;  3KF9 A;  2G9B A;  1RK9 A;  2CNP A;  1UHN A;  1CLL A;  4FQO A;  4CPV A;  2JTT A;  3HX4 A;  1K9U A;  1RJV A;  1WLM A;  4MSP A;  5BPJ A;  4YRU A;  1S6J A;  3OB1 B;  1CMF A;  3DVK A;  3FS7 A;  4ORB B;  1KK8 C;  2F33 A;  1AVS A;  3BYA A;  2CXJ A;  1DJH A;  1ZMZ A;  1TIZ A;  1LVC D;  2KQY A;  3TS5 B;  1TNQ A;  2LMU A;  1KQM B;  3WHT B;  1NSH A;  3JVT C;  1ZAC A;  2PVB A;  3I5I B;  1S26 D;  1OMD A;  4P5O E;  5HLO A;  4E68 A;  2F3Z A;  1J55 A;  4IL1 A;  5FYX A;  1SCV A;  1EJ3 A;  1GJY A;  4USL A;  3VRN A;  2OTG C;  3JTD B;  2K7O A;  3I5F C;  2BBM A;  3SIA A;  1DJZ A;  1K94 A;  1B4C A;  1XFZ O;  2V53 A;  2HET A;  1BMO A;  3NSK A;  1CDP A;  1SY9 A;  2EC6 C;  2I7A A;  4NDB A;  3I5H B;  1R2U A;  1YVL A;  4JWQ A;  2JWW A;  3HCM A;  5DKN A;  1B9A A;  1TNP A;  4UPG A;  3BUM B;  4GFT A;  1GQM A;  1QX2 A;  3MSE B;  5KU1 A;  3SJS A;  3O6B A;  1Y0V H;  4MRX A;  1KK8 B;  3GK1 A;  4TNC A;  2PAS A;  1MHO A;  1QS7 A;  2MLF C;  2MRD A;  1DJG A;  3DD4 A;  3QRX A;  5I2O A;  2LMV A;  3JVT B;  2EGD A;  5AFP A;  2M3W A;  1Q80 A;  5KSZ A;  2R2I A;  4JQ0 D;  1Y1A A;  4YGD B;  1LXF C;  1CDN A;  2OTG B;  2MLE C;  3I5F B;  4DUQ A;  1F55 A;  1S6C A;  4C0K A;  4MRY A;  2M1K B;  1GGZ A;  1XFV O;  4WQ3 A;  1BU3 A;  3VGO A;  3IQO A;  4GPL B;  2KGR A;  1IGV A;  2EC6 B;  2LC5 A;  5HKW A;  3ZWH A;  2OS8 C;  1REC A;  1S36 A;  2COL B;  4OVN F;  5DKR A;  1DMO A;  5I8N A;  2KNE A;  1SK6 D;  1TOP A;  2GV5 A;  2JU0 A;  2PRU A;  4C0L A;  1A75 A;  4WRI A;  3A8R A;  2JXC A;  3O4Y A;  1QV0 A;  1UHK A;  2LAP A;  2WCB A;  1J1E A;  1DJI A;  4I5J A;  2KI6 D;  2Q4U A;  3RLZ A;  2IS9 A;  1BF5 A;  1YR5 A;  1ZUZ A;  2AMI A;  2JXL A;  3NSO A;  1AJ4 A;  2LM5 A;  3DVE A;  3FIA A;  2GGM A;  4PCW A;  4PE0 A;  4AQJ A;  4YGE B;  2I2R E;  5IBW A;  1QVI Z;  1CMG A;  2NXQ A;  2VRG A;  4I5K A;  1PK0 D;  4N5X A;  1YX7 A;  1IRJ A;  4ORC B;  3SG6 A;  1NYA A;  4XJK A;  1JUO A;  3O2P A;  1FPW A;  2LVJ A;  4OCI A;  2CCM A;  1QV1 A;  2BEC A;  2LV7 A;  2JQ6 A;  2OS8 B;  3D0Y A;  3SG5 A;  2I94 A;  4MVF A;  1U5I A;  1QX7 A;  2CBL A;  2F2P A;  2L4I A;  2WND A;  1LA0 A;  1WRK A;  2FCE A;  1B8R A;  1NIW A;  3DVJ A;  1J7P A;  2JOJ A;  2LNK A;  1B8L A;  4ORA B;  4M2Q A;  3BOW A;  1VRK A;  2LHI A;  1BOC A;  1DGU A;  2JRF A;  4QJ5 B;  3H4S E;  1SR6 C;  2M29 A;  1H8B A;  3OHM B;  2KQ6 A;  3K21 A;  1MF8 B;  1NP8 A;  1K8U A;  1F8H A;  2KOT A;  1SPY A;  1FW4 A;  1WY9 A;  1M45 A;  4NQG A;  1MWN A;  1ODB A;  1HQV A;  1K90 D;  1WDC B;  5K89 A;  1SCM B;  1S5G Y;  1DF0 A;  1PSB A;  1TTX A;  2LLS A;  1XYD A;  1NX0 A;  2L51 A;  3CLN A;  2KFH A;  2QPT A;  2KAX A;  4PAL A;  1CM4 A;  2ZN8 A;  3VRP A;  1RFJ A;  1CDL A;  3CR4 X;  1NX1 A;  2K61 A;  3BUO B;  3PN7 C;  4A4C A;  1KFX S;  5ER5 A;  1G4Y R;  2JTZ A;  1A29 A;  1Y6W A;  3AKA A;  1PVA A;  1QAT A;  4GAO A;  1BG1 A;  4HSZ A;  3SG2 A;  1QAS A;  4YGC B;  1CKK A;  1OMR A;  1SBJ A;  1WRZ A;  5I2L A;  2KFG A;  5AER A;  4ETO A;  4MZJ A;  3VRQ A;  1SR6 B;  4PE1 A;  2FOT A;  1NPQ A;  2M97 A;  2LLT A;  2JT8 A;  1PSR A;  1IH0 A;  3PM8 A;  3WXA A;  3ZNI A;  4YI9 A;  3LL8 B;  2G2B A;  2HF5 A;  2KDH A;  2M8U A;  2MAZ A;  3O78 A;  4PE7 A;  4GBA A;  1JWD A;  4A4B A;  1QXP A;  2KHN A;  1CB1 A;  2ZRS A;  2JZI A;  1K2H A;  5PAL A;  4N1G A;  4HRH A;  1BOD A;  4HRE E;  5CSJ A;  1NWD A;  2F3Y A;  3PN7 B;  2NCO A;  5CSF A;  1NCX A;  2LVK A;  1LKJ A;  5TNC A;  3IQQ A;  1NX3 A;  4OKH A;  1YRT B;  4HRG A;  1G33 A;  3TUY C;  2JC2 A;  2K7B A;  2PSR A;  2LMT A;  5I2Q A;  1J7O A;  3SG7 A;  5ER4 X;  1CLB A;  2HQW A;  1CFP A;  1EXR A;  5HKY A;  1NCZ A;  2I18 A;  1ZOT B;  2O60 A;  3GK4 X;  1UWO A;  1YRU B;  1XFW O;  1XVJ A;  4MEW A;  1FBV A;  1M39 A;  1F4Q A;  2A4J A;  2L50 A;  2LVI A;  3IF7 A;  1XO5 A;  1J7R A;  2JT0 A;  1SL9 A;  3NSL A;  1JF0 A;  1XA5 A;  4DCK A;  1OOJ A;  1C07 A;  1F54 A;  1QTX A;  1QIW A;  1PRW A;  1W7I B;  2KI6 C;  2K2A A;  5HKZ A;  1A75 B;  2B1U A;  1JC2 A;  2Y4Q A;  4PDZ A;  1SL8 A;  1ALW A;  2ZFD A;  4AQI A;  1ZFS A;  1Y1U A;  4PHJ A;  4CFR A;  1YUT A;  1CDM A;  2Q91 A;  4PHM A;  1QIV A;  2K7C A;  3CR5 X;  2Y1N A;  3BUN B;  2AAO A;  2P6B B;  4OR9 B;  1JFK A;  4M2O A;  2RGI A;  1H4B A;  1F71 A;  1UP5 A;  2ZN9 A;  4PHK A;  2LLU A;  5CSN A;  1CFD A;  3EK4 A;  1IG5 A;  1AP4 A;  4U8D A;  3I5G C;  2JPT A;  2KFF A;  1EG4 A;  4XJK B;  1IQ3 A;  2BBN A;  1KWO C;  2K8M B;  4WQ2 A;  2BCX A;  2ISD A;  3TZ1 A;  1C7W A;  4BY4 A;  1IWQ A;  1XFY O;  2SAS A;  5GQQ C;  3D0Y B;  2GGZ A;  2NCP A;  1K9P A;  4I5N B;  3LLE A;  2MJW B;  1U5I B;  1F4O A;  2LVV A;  5AAN A;  3D10 A;  1DVI A;  1KSO A;  1FI5 A;  1KFX L;  3VRO A;  4QJ4 B;  1EL4 A;  5G08 A;  4C0J A;  1B7T Y;  1CFC A;  5J3X A;  3BOW B;  1M46 A;  1SRA A;  1S5G Z;  4I5L B;  1DGV A;  4XYN A;  1D1O A;  1M63 B;  3BUX B;  3FWC A;  1V1G A;  2WOR A;  3F45 A;  3AAK A;  3TDI A;  4P2Y B;  3AAJ A;  1MUX A;  1SNL A;  3KHE A;  1R6P A;  3SG4 A;  4GUK A;  1KFU L;  2TN4 A;  2E6W A;  1QLS A;  2L4H A;  3CR2 A;  1QJT A;  1DF0 B;  2KGB C;  3EVR A;  1TN4 A;  3KEV A;  4R1E A;  3VRR A;  3I5G B;  2LAN A;  2LP3 A;  1AUI B;  1DT7 B;  1KK7 Y;  1KWO B;  1K9K A;  3FWB A;  1OSA A;  1TCF A;  4YBH B;  2BKH B;  1XFU O;  3SG3 A;  3A4U B;  2L5X B;  1YUR A;  1JSA A;  1QX5 B;  1XK4 A;  1J7Q A;  5AEQ A;  1TNX A;  1L7Z A;  1N0Y A;  1SYM A;  3CZT X;  5HLV A;  4MZK A;  2KBI A;  1CTR A;  3PAT A;  2K2F A;  4CFQ A;  1GGW A;  4N1F A;  4YGA A;  1AHR A;  1Y1X A;  3EVV A;  2KYF A;  4Q04 A;  1LA3 A;  2BKI B;  3DVM A;  3CGA A;  2FJU B;  3PLF B;  1WRL A;  4PE4 A;  1PAL A;  2H61 A;  3DF0 A;  1DJY A;  3AKB A;  3GOF A;  1KFU S;  2KYC A;  2JNF A;  5JJG A;  2PAL A;  2F8P A;  1MXL C; 
#chains in the Genus database with same CATH topology
 1K93 D;  5DKQ A;  2JUL A;  5HYD A;  1OZS A;  2KI4 C;  3B87 A;  4F0Z B;  2QAC A;  1QLK A;  3S0D A;  1UUS A;  2MA2 A;  1EG3 A;  3KO0 A;  2WCF A;  1JBA A;  3NXA A;  2KAV A;  2MHH A;  2BE4 A;  2AUC A;  2WCM A;  3CTN A;  4PHN A;  5D69 A;  4ICB A;  3EKJ A;  3TDZ A;  2CTN A;  4ZCV A;  4GGF C;  4JPZ B;  5FI7 A;  4DIR A;  1V1F A;  1YVH A;  4D1E A;  1IQ5 A;  2L0P A;  2KAY A;  3EKH A;  1BT6 A;  2H2K A;  5D7F A;  4L9M A;  1Z2C B;  3S0E A;  2L98 A;  4YGB B;  1JFJ A;  1AK8 A;  1AJ5 A;  1YTZ C;  3B86 A;  2FCD A;  3R1O A;  3TDU A;  5B8I B;  2EHB A;  5F6T A;  1UHI A;  2WCE A;  2Y1M A;  2LUX A;  1DJW A;  1UHJ A;  1WLZ A;  1TUZ A;  1K96 A;  2WC8 A;  3PAL A;  1FI6 A;  3DZT A;  1BR4 B;  3PSR A;  1MR8 A;  1W7J B;  1L2O C;  4NDC A;  4M2P A;  4ZCU A;  2KI4 B;  3B7A A;  1XFX O;  3L4A A;  3PFV A;  4MBE A;  4NDD A;  2LP2 A;  2SCP A;  2ZRT A;  1G8I A;  2M7N A;  3S0B A;  1KQV A;  4AOM A;  3PJI A;  1YUS A;  1SL7 A;  2BL0 C;  1NUB A;  3LCP C;  1A03 A;  1NX2 A;  4QJ3 B;  2DOQ A;  3SS4 A;  3WHU B;  5I94 A;  3WNX B;  1IKU A;  3B88 A;  3EVU A;  3LK1 A;  1TNW A;  1B7T Z;  4DS7 A;  1OE9 B;  1YUU A;  2L2C A;  4GGF A;  3TUY B;  1XK4 C;  3SIB A;  2M9G A;  2BAP A;  3K1E A;  1B47 A;  1CM1 A;  3OX6 A;  1A4P A;  1S1E A;  2NLN A;  3CZ0 A;  3ICB A;  1JF2 A;  1RWY A;  4MZL A;  5D3O A;  4OV2 A;  4MN0 A;  3CWG A;  5AXI A;  1CFF A;  2KSP A;  1ALV A;  3BXK A;  2KBM A;  4CID A;  2ZNE A;  4PT1 A;  5CSI A;  1OQP A;  5JOL A;  2MBX A;  1BLQ A;  4MLW A;  3CS1 A;  2Y5I A;  3KPX A;  1FF1 A;  1L2O B;  1CNP A;  1KK7 Z;  2LUC A;  1YX8 A;  2O5G A;  2M7L A;  1SW8 A;  3CZ1 A;  2H61 C;  3RM1 A;  2WOS A;  3GK2 A;  1MQ1 A;  1A2X A;  2LE9 B;  1N65 A;  1OOH A;  2LCP A;  3LK0 A;  2QEB A;  2KLD A;  1WDC C;  1ORG A;  1SCM C;  2BE6 A;  2PMY A;  3BFB A;  3BUW B;  4GNK B;  2BL0 B;  1TCO B;  2D8N A;  1DJX A;  3EK7 A;  1IJ6 A;  2JNX A;  3C1V A;  1CLM A;  1C7V A;  2BCA A;  1TRF A;  1BR1 B;  2HQ8 A;  1DTL A;  1IJ5 A;  2E30 A;  4INX A;  1PUL A;  2ZND A;  4FTG A;  1OOF A;  2K0J A;  1E8A A;  1EH2 A;  3NSI A;  1UHH A;  1N2D A;  2WC6 A;  3TS5 C;  4CLN A;  1KQM C;  1B8C A;  2M49 B;  1B1G A;  1S3P A;  3I5I C;  1J1D A;  1S6I A;  1KCY A;  1LIN A;  1QVI Y;  2BCB A;  1K95 A;  4GGN A;  1UUR A;  3OX5 A;  2CT9 A;  5CPV A;  1M31 A;  1SKT A;  2L2E A;  2K7D A;  1NCY A;  2OPO A;  2NZ0 A;  3E3R A;  3EK8 A;  3JTD C;  3OP0 A;  4YI8 A;  3BFH A;  1X02 A;  1OW4 A;  2M1U A;  2M0R A;  2LHL A;  3D78 A;  1RTP 1;  1BJF A;  1MXE A;  1OMV A;  1SMG A;  3OB2 B;  1F70 A;  2K60 A;  2HPS A;  4BY5 A;  2JT3 A;  3M0W A;  1KSM A;  3DF0 B;  5KTY A;  3CDN A;  2F2O A;  1Z4H A;  4DRW A;  3BQ3 A;  3I5H C;  2ZKM X;  1RRO A;  1PVB A;  1HT9 A;  1OZO A;  3KF9 A;  2G9B A;  1RK9 A;  2CNP A;  1UHN A;  1CLL A;  4FQO A;  4CPV A;  2JTT A;  3HX4 A;  1K9U A;  1RJV A;  2ERB A;  3V2L A;  1WLM A;  4MSP A;  5BPJ A;  4YRU A;  1S6J A;  3OB1 B;  1CMF A;  3DVK A;  3FS7 A;  4ORB B;  1KK8 C;  2F33 A;  1AVS A;  3BYA A;  2CXJ A;  1DJH A;  1ZMZ A;  2P71 A;  1TIZ A;  1LVC D;  2KQY A;  3BFA A;  1TNQ A;  2LMU A;  3TS5 B;  1KQM B;  3WHT B;  1NSH A;  3S0F A;  3JVT C;  1ZAC A;  2PVB A;  3I5I B;  1S26 D;  1OMD A;  4P5O E;  5HLO A;  4E68 A;  2F3Z A;  1J55 A;  4IL1 A;  5FYX A;  1SCV A;  1EJ3 A;  1GJY A;  4USL A;  3VRN A;  2OTG C;  1XFR A;  3JTD B;  2K7O A;  3I5F C;  2BBM A;  3PM2 A;  3SIA A;  1DJZ A;  1K94 A;  3VB1 A;  1B4C A;  3RZS A;  1XFZ O;  2V53 A;  2HET A;  1BMO A;  4JD9 A;  3NSK A;  5HL1 A;  1CDP A;  1SY9 A;  2EC6 C;  2I7A A;  4NDB A;  3I5H B;  1R2U A;  1YVL A;  4JWQ A;  2JWW A;  3HCM A;  5DKN A;  1B9A A;  2QEV A;  1TNP A;  1IIO A;  3S0G A;  3BUM B;  2WCK A;  4GFT A;  4UPG A;  1GQM A;  1QX2 A;  3UNW A;  3MSE B;  5KU1 A;  3SJS A;  3O6B A;  1Y0V H;  4MRX A;  1KK8 B;  3GK1 A;  4TNC A;  2PAS A;  1C3Y A;  1MHO A;  1QS7 A;  2MLF C;  2MRD A;  1DJG A;  3DD4 A;  3QRX A;  5I2O A;  2LMV A;  3JVT B;  2EGD A;  5AFP A;  2M3W A;  1Q80 A;  3UO9 A;  5KSZ A;  3FE8 A;  2R2I A;  4JQ0 D;  1Y1A A;  3D76 A;  4YGD B;  1LXF C;  1CDN A;  2OTG B;  2MLE C;  3I5F B;  4DUQ A;  1F55 A;  1S6C A;  4C0K A;  4MRY A;  2M1K B;  1GGZ A;  1XFV O;  4WQ3 A;  1BU3 A;  3VGO A;  3IQO A;  4GPL B;  2KGR A;  1IGV A;  2EC6 B;  2LC5 A;  1C3Z A;  5HKW A;  3ZWH A;  2OS8 C;  1REC A;  1S36 A;  2COL B;  4OVN F;  3NHI A;  5DKR A;  5DIC A;  1DMO A;  5I8N A;  2KNE A;  1SK6 D;  3DYE A;  1TOP A;  3OGN A;  2GV5 A;  2JU0 A;  2PRU A;  4C0L A;  1A75 A;  1T14 A;  4WRI A;  3A8R A;  2JXC A;  3O4Y A;  1QV0 A;  1UHK A;  2LAP A;  2WCB A;  2GTE A;  1J1E A;  1DJI A;  3CAB A;  4I5J A;  2KI6 D;  2Q4U A;  3RLZ A;  2IS9 A;  3DY9 A;  1BF5 A;  2QDI A;  1YR5 A;  1ZUZ A;  2AMI A;  2JXL A;  3NSO A;  1AJ4 A;  2LM5 A;  3DVE A;  3FIA A;  3O4X A;  2GGM A;  1W9Z A;  1DC1 A;  4PCW A;  4PE0 A;  3SS3 A;  4YGE B;  2I2R E;  4AQJ A;  5IBW A;  1QVI Z;  3D73 A;  5FI2 A;  2P70 A;  1CMG A;  2NXQ A;  2VRG A;  4I5K A;  1PK0 D;  4N5X A;  1YX7 A;  3OBV A;  1IRJ A;  4ORC B;  3SG6 A;  1NYA A;  3B6X A;  4XJK A;  1JUO A;  3O2P A;  1FPW A;  1SSE B;  2LVJ A;  4OCI A;  2CCM A;  1QV1 A;  2BEC A;  2LV7 A;  2JQ6 A;  2OS8 B;  3D0Y A;  3SG5 A;  2I94 A;  4MVF A;  1U5I A;  1QX7 A;  2CBL A;  2F2P A;  2L4I A;  2WND A;  3CZ2 A;  1LA0 A;  1WRK A;  2FCE A;  1B8R A;  1NIW A;  3DVJ A;  1J7P A;  2JOJ A;  2LNK A;  1B8L A;  4ORA B;  4M2Q A;  3BOW A;  1VRK A;  2LHI A;  2WC5 A;  1BOC A;  1DGU A;  2JRF A;  4QJ5 B;  3H4S E;  1SR6 C;  2M29 A;  1H8B A;  3OHM B;  2KQ6 A;  3K21 A;  1MF8 B;  1NP8 A;  1K8U A;  2BNX A;  1F8H A;  2KOT A;  1SPY A;  1FW4 A;  1WY9 A;  1M45 A;  4NQG A;  1MWN A;  1ODB A;  1HQV A;  1K90 D;  2L5Y A;  1WDC B;  5K89 A;  1SCM B;  4IJ7 A;  1S5G Y;  1DF0 A;  1PSB A;  1TTX A;  2LLS A;  1XYD A;  1NX0 A;  2L51 A;  4INW A;  3CLN A;  2KFH A;  2QPT A;  2KAX A;  4PAL A;  1CM4 A;  1DQE A;  2ZN8 A;  1RFJ A;  1CDL A;  3FE9 A;  3VRP A;  2FJY A;  3CR4 X;  1NX1 A;  4JKT A;  2K61 A;  3BUO B;  3PN7 C;  4A4C A;  1KFX S;  5ER5 A;  3D75 A;  1G4Y R;  2JTZ A;  1A29 A;  2PQL A;  1Y6W A;  3D77 A;  3AKA A;  1PVA A;  1QAT A;  3CYZ A;  4GAO A;  1BG1 A;  4HSZ A;  3SG2 A;  2YGU A;  1QAS A;  4YGC B;  1CKK A;  3Q8I A;  1OMR A;  4FQT A;  1SBJ A;  1WRZ A;  5I2L A;  2KFG A;  5AER A;  4ETO A;  4MZJ A;  3VRQ A;  1SR6 B;  4PE1 A;  2FOT A;  1NPQ A;  2M97 A;  2LLT A;  2JT8 A;  1PSR A;  1IH0 A;  1DEK A;  3PM8 A;  3WXA A;  3ZNI A;  2JPO A;  3R1P A;  4YI9 A;  3SS5 A;  3LL8 B;  2G2B A;  2HF5 A;  2KDH A;  2M8U A;  2MAZ A;  3O78 A;  4PE7 A;  4GBA A;  1JWD A;  4A4B A;  1QXP A;  2KHN A;  3DXL A;  1CB1 A;  2ZRS A;  2JZI A;  1K2H A;  3QME A;  5PAL A;  4N1G A;  4HRH A;  1BOD A;  4HRE E;  5CSJ A;  1NWD A;  2F3Y A;  3PN7 B;  2NCO A;  2WCH A;  5CSF A;  1NCX A;  2LVK A;  1LKJ A;  5TNC A;  3IQQ A;  1NX3 A;  2H8V A;  4OKH A;  1YRT B;  2KLE A;  4HRG A;  2QEH A;  1G33 A;  3TUY C;  2JC2 A;  2K7B A;  2PSR A;  2LMT A;  5I2Q A;  1J7O A;  3SG7 A;  5ER4 X;  1CLB A;  2HQW A;  1CFP A;  1EXR A;  1QWV A;  5HKY A;  1NCZ A;  2QEO A;  2I18 A;  1ZOT B;  2O60 A;  3GK4 X;  1UWO A;  1GM0 A;  1YRU B;  1XFW O;  1XVJ A;  1TUJ A;  3L4L A;  4MEW A;  1FBV A;  1M39 A;  1F4Q A;  2A4J A;  2L50 A;  2LVI A;  3IF7 A;  1XO5 A;  1J7R A;  2JT0 A;  1SL9 A;  3NSL A;  1JF0 A;  1XA5 A;  4DCK A;  1OOJ A;  1C07 A;  3NHT A;  1F54 A;  1QTX A;  1QIW A;  1PRW A;  1W7I B;  2KI6 C;  2K2A A;  5HKZ A;  1A75 B;  2B1U A;  1JC2 A;  2Y4Q A;  4PDZ A;  1SL8 A;  1ALW A;  2ZFD A;  4AQI A;  1ZFS A;  1Y1U A;  4PHJ A;  4CFR A;  3R1V A;  1YUT A;  1CDM A;  2KPH A;  2Q91 A;  4PHM A;  1QIV A;  2K7C A;  3CR5 X;  2Y1N A;  1LS8 A;  3BUN B;  2AAO A;  2P6B B;  4OR9 B;  1JFK A;  4KYN A;  4M2O A;  1TWO A;  1DEL A;  2RGI A;  3FE6 A;  1H4B A;  1F71 A;  1UP5 A;  2ZN9 A;  4PHK A;  2LLU A;  5CSN A;  1CFD A;  3EK4 A;  1IG5 A;  1AP4 A;  3IVT A;  4U8D A;  3I5G C;  2JPT A;  3R72 A;  2KFF A;  3S0A A;  1EG4 A;  3L47 A;  4XJK B;  4F7F A;  1IQ3 A;  2BBN A;  1KWO C;  2K8M B;  4WQ2 A;  2BCX A;  2ISD A;  3TZ1 A;  1C7W A;  4BY4 A;  1IWQ A;  1XFY O;  2SAS A;  5GQQ C;  3D0Y B;  2GGZ A;  2NCP A;  1K9P A;  4I5N B;  1OOG A;  3LLE A;  2MJW B;  1U5I B;  1F4O A;  2LVV A;  5AAN A;  3D10 A;  1DVI A;  1OOI X;  1KSO A;  1FI5 A;  1KFX L;  3VRO A;  4QJ4 B;  1EL4 A;  5G08 A;  4C0J A;  1B7T Y;  1CFC A;  5J3X A;  3BOW B;  1M46 A;  1SRA A;  1S5G Z;  4I5L B;  1DGV A;  4XYN A;  1D1O A;  1M63 B;  3BUX B;  3FWC A;  1V1G A;  2WOR A;  3F45 A;  3D74 A;  3AAK A;  3TDI A;  3N7H A;  2WCJ A;  4P2Y B;  3AAJ A;  1MUX A;  2PYQ A;  1SNL A;  3KHE A;  1R6P A;  3SG4 A;  4GUK A;  1KFU L;  2TN4 A;  2E6W A;  1QLS A;  2L4H A;  3CR2 A;  1QJT A;  1DF0 B;  2KGB C;  3EVR A;  1TN4 A;  3KEV A;  4R1E A;  3VRR A;  3I5G B;  3BJH A;  2LAN A;  2LP3 A;  1AUI B;  1DT7 B;  1KK7 Y;  1KWO B;  1K9K A;  3FWB A;  1OSA A;  4OZD A;  5FI6 A;  1TCF A;  4YBH B;  2BKH B;  1XFU O;  3SG3 A;  3A4U B;  2L5X B;  1YUR A;  1JSA A;  1QX5 B;  1XK4 A;  1J7Q A;  5AEQ A;  5EL2 A;  1TNX A;  1L7Z A;  1N0Y A;  1SYM A;  3CZT X;  5HLV A;  4MZK A;  2KBI A;  1CTR A;  3PAT A;  2K2F A;  4CFQ A;  1GGW A;  2WCL A;  4N1F A;  4YGA A;  1AHR A;  1Y1X A;  3EVV A;  2KYF A;  4Q04 A;  1LA3 A;  2BKI B;  3DVM A;  3CGA A;  2FJU B;  3PLF B;  1WRL A;  4PE4 A;  1PAL A;  2H61 A;  3DF0 A;  1DJY A;  3AKB A;  3GOF A;  3NGV A;  1KFU S;  1P28 A;  2KYC A;  2JNF A;  5JJG A;  2PAL A;  3EG5 B;  2F8P A;  1MXL C; 
#chains in the Genus database with same CATH homology
 1K93 D;  5DKQ A;  2JUL A;  5HYD A;  1OZS A;  2KI4 C;  4F0Z B;  2QAC A;  1QLK A;  1UUS A;  2MA2 A;  1EG3 A;  3KO0 A;  2WCF A;  1JBA A;  3NXA A;  2KAV A;  2MHH A;  2BE4 A;  2AUC A;  3CTN A;  4PHN A;  5D69 A;  4ICB A;  3EKJ A;  3TDZ A;  2CTN A;  4ZCV A;  4GGF C;  4JPZ B;  4DIR A;  1V1F A;  1YVH A;  4D1E A;  1IQ5 A;  2L0P A;  2KAY A;  3EKH A;  1BT6 A;  2H2K A;  5D7F A;  4L9M A;  2L98 A;  4YGB B;  1JFJ A;  1AK8 A;  1AJ5 A;  1YTZ C;  2FCD A;  3TDU A;  5B8I B;  2EHB A;  5F6T A;  1UHI A;  2WCE A;  2Y1M A;  2LUX A;  1DJW A;  1UHJ A;  1WLZ A;  1K96 A;  2WC8 A;  3PAL A;  1FI6 A;  1BR4 B;  3PSR A;  1MR8 A;  1W7J B;  1L2O C;  4NDC A;  4M2P A;  4ZCU A;  2KI4 B;  4NDD A;  1XFX O;  3PFV A;  4MBE A;  2LP2 A;  2SCP A;  2ZRT A;  1G8I A;  2M7N A;  1KQV A;  4AOM A;  1YUS A;  1SL7 A;  2BL0 C;  1NUB A;  3LCP C;  1A03 A;  1NX2 A;  4QJ3 B;  2DOQ A;  3WHU B;  1IKU A;  3WNX B;  3EVU A;  3LK1 A;  1TNW A;  1B7T Z;  4DS7 A;  1OE9 B;  1YUU A;  4GGF A;  3TUY B;  1XK4 C;  3SIB A;  2M9G A;  1B47 A;  1CM1 A;  3OX6 A;  1A4P A;  1S1E A;  2NLN A;  3ICB A;  1JF2 A;  1RWY A;  4MZL A;  4OV2 A;  4MN0 A;  3CWG A;  5AXI A;  1CFF A;  2KSP A;  1ALV A;  3BXK A;  2KBM A;  4CID A;  2ZNE A;  5CSI A;  5JOL A;  1OQP A;  2MBX A;  1BLQ A;  4MLW A;  3CS1 A;  2Y5I A;  3KPX A;  1FF1 A;  1L2O B;  1CNP A;  1KK7 Z;  2LUC A;  1YX8 A;  2O5G A;  2M7L A;  1SW8 A;  2H61 C;  3RM1 A;  2WOS A;  3GK2 A;  1MQ1 A;  1A2X A;  2LE9 B;  1N65 A;  2LCP A;  3LK0 A;  1WDC C;  1SCM C;  2BE6 A;  2PMY A;  3BUW B;  4GNK B;  2BL0 B;  1TCO B;  2D8N A;  1DJX A;  3EK7 A;  1IJ6 A;  2JNX A;  3C1V A;  1CLM A;  1C7V A;  2BCA A;  1TRF A;  1BR1 B;  2HQ8 A;  1DTL A;  1IJ5 A;  2E30 A;  1PUL A;  2ZND A;  4FTG A;  2K0J A;  1E8A A;  1EH2 A;  3NSI A;  1UHH A;  1N2D A;  3TS5 C;  4CLN A;  1B1G A;  1KQM C;  1B8C A;  2M49 B;  1S3P A;  3I5I C;  1J1D A;  1S6I A;  1KCY A;  1LIN A;  1QVI Y;  2BCB A;  1K95 A;  4GGN A;  1UUR A;  3OX5 A;  2CT9 A;  5CPV A;  1M31 A;  1SKT A;  2L2E A;  2K7D A;  1NCY A;  2OPO A;  2NZ0 A;  3E3R A;  3EK8 A;  3JTD C;  3OP0 A;  4YI8 A;  1X02 A;  2M1U A;  2M0R A;  2LHL A;  1RTP 1;  1BJF A;  1MXE A;  1OMV A;  1SMG A;  3OB2 B;  1F70 A;  2HPS A;  4BY5 A;  2JT3 A;  3M0W A;  1KSM A;  3DF0 B;  5KTY A;  2F2O A;  4DRW A;  3BQ3 A;  3I5H C;  2ZKM X;  1RRO A;  1PVB A;  1HT9 A;  1OZO A;  3KF9 A;  2G9B A;  1RK9 A;  2CNP A;  1UHN A;  1CLL A;  4FQO A;  4CPV A;  2JTT A;  3HX4 A;  1K9U A;  1RJV A;  1WLM A;  4MSP A;  5BPJ A;  4YRU A;  1S6J A;  3OB1 B;  1CMF A;  3DVK A;  3FS7 A;  4ORB B;  1KK8 C;  2F33 A;  1AVS A;  3BYA A;  2CXJ A;  1DJH A;  1ZMZ A;  1TIZ A;  1LVC D;  2KQY A;  3TS5 B;  1TNQ A;  2LMU A;  1KQM B;  3WHT B;  1NSH A;  3JVT C;  1ZAC A;  2PVB A;  3I5I B;  1S26 D;  1OMD A;  4P5O E;  5HLO A;  4E68 A;  2F3Z A;  1J55 A;  4IL1 A;  5FYX A;  1SCV A;  1EJ3 A;  1GJY A;  4USL A;  3VRN A;  2OTG C;  3JTD B;  2K7O A;  3I5F C;  2BBM A;  3SIA A;  1DJZ A;  1K94 A;  1B4C A;  1XFZ O;  2V53 A;  2HET A;  1BMO A;  3NSK A;  1CDP A;  1SY9 A;  2EC6 C;  2I7A A;  4NDB A;  3I5H B;  1R2U A;  1YVL A;  4JWQ A;  2JWW A;  3HCM A;  5DKN A;  1B9A A;  1TNP A;  4UPG A;  3BUM B;  4GFT A;  1GQM A;  1QX2 A;  3MSE B;  5KU1 A;  3SJS A;  3O6B A;  1Y0V H;  4MRX A;  1KK8 B;  3GK1 A;  4TNC A;  2PAS A;  1MHO A;  1QS7 A;  2MLF C;  2MRD A;  1DJG A;  3DD4 A;  3QRX A;  5I2O A;  2LMV A;  3JVT B;  2EGD A;  5AFP A;  2M3W A;  1Q80 A;  5KSZ A;  2R2I A;  4JQ0 D;  1Y1A A;  4YGD B;  1LXF C;  1CDN A;  2OTG B;  2MLE C;  3I5F B;  4DUQ A;  1F55 A;  1S6C A;  4C0K A;  4MRY A;  2M1K B;  1GGZ A;  1XFV O;  4WQ3 A;  1BU3 A;  3VGO A;  3IQO A;  4GPL B;  2KGR A;  1IGV A;  2EC6 B;  2LC5 A;  5HKW A;  3ZWH A;  2OS8 C;  1REC A;  1S36 A;  2COL B;  4OVN F;  5DKR A;  1DMO A;  5I8N A;  2KNE A;  1SK6 D;  1TOP A;  2GV5 A;  2JU0 A;  2PRU A;  4C0L A;  1A75 A;  4WRI A;  3A8R A;  2JXC A;  3O4Y A;  1QV0 A;  1UHK A;  2LAP A;  2WCB A;  1J1E A;  1DJI A;  4I5J A;  2KI6 D;  2Q4U A;  3RLZ A;  2IS9 A;  1BF5 A;  1YR5 A;  1ZUZ A;  2AMI A;  2JXL A;  3NSO A;  1AJ4 A;  2LM5 A;  3DVE A;  3FIA A;  2GGM A;  4PCW A;  4PE0 A;  4AQJ A;  4YGE B;  2I2R E;  5IBW A;  1QVI Z;  1CMG A;  2NXQ A;  2VRG A;  4I5K A;  1PK0 D;  4N5X A;  1YX7 A;  1IRJ A;  4ORC B;  3SG6 A;  1NYA A;  4XJK A;  1JUO A;  3O2P A;  1FPW A;  2LVJ A;  4OCI A;  2CCM A;  1QV1 A;  2BEC A;  2LV7 A;  2JQ6 A;  2OS8 B;  3D0Y A;  3SG5 A;  2I94 A;  4MVF A;  1U5I A;  1QX7 A;  2CBL A;  2F2P A;  2L4I A;  2WND A;  1LA0 A;  1WRK A;  2FCE A;  1B8R A;  1NIW A;  3DVJ A;  1J7P A;  2JOJ A;  2LNK A;  1B8L A;  4ORA B;  4M2Q A;  3BOW A;  1VRK A;  2LHI A;  1BOC A;  1DGU A;  2JRF A;  4QJ5 B;  3H4S E;  1SR6 C;  2M29 A;  1H8B A;  3OHM B;  2KQ6 A;  3K21 A;  1MF8 B;  1NP8 A;  1K8U A;  1F8H A;  2KOT A;  1SPY A;  1FW4 A;  1WY9 A;  1M45 A;  4NQG A;  1MWN A;  1ODB A;  1HQV A;  1K90 D;  1WDC B;  5K89 A;  1SCM B;  1S5G Y;  1DF0 A;  1PSB A;  1TTX A;  2LLS A;  1XYD A;  1NX0 A;  2L51 A;  3CLN A;  2KFH A;  2QPT A;  2KAX A;  4PAL A;  1CM4 A;  2ZN8 A;  3VRP A;  1RFJ A;  1CDL A;  3CR4 X;  1NX1 A;  2K61 A;  3BUO B;  3PN7 C;  4A4C A;  1KFX S;  5ER5 A;  1G4Y R;  2JTZ A;  1A29 A;  1Y6W A;  3AKA A;  1PVA A;  1QAT A;  4GAO A;  1BG1 A;  4HSZ A;  3SG2 A;  1QAS A;  4YGC B;  1CKK A;  1OMR A;  1SBJ A;  1WRZ A;  5I2L A;  2KFG A;  5AER A;  4ETO A;  4MZJ A;  3VRQ A;  1SR6 B;  4PE1 A;  2FOT A;  1NPQ A;  2M97 A;  2LLT A;  2JT8 A;  1PSR A;  1IH0 A;  3PM8 A;  3WXA A;  3ZNI A;  4YI9 A;  3LL8 B;  2G2B A;  2HF5 A;  2KDH A;  2M8U A;  2MAZ A;  3O78 A;  4PE7 A;  4GBA A;  1JWD A;  4A4B A;  1QXP A;  2KHN A;  1CB1 A;  2ZRS A;  2JZI A;  1K2H A;  5PAL A;  4N1G A;  4HRH A;  1BOD A;  4HRE E;  5CSJ A;  1NWD A;  2F3Y A;  3PN7 B;  2NCO A;  5CSF A;  1NCX A;  2LVK A;  1LKJ A;  5TNC A;  3IQQ A;  1NX3 A;  4OKH A;  1YRT B;  4HRG A;  1G33 A;  3TUY C;  2JC2 A;  2K7B A;  2PSR A;  2LMT A;  5I2Q A;  1J7O A;  3SG7 A;  5ER4 X;  1CLB A;  2HQW A;  1CFP A;  1EXR A;  5HKY A;  1NCZ A;  2I18 A;  1ZOT B;  2O60 A;  3GK4 X;  1UWO A;  1YRU B;  1XFW O;  1XVJ A;  4MEW A;  1FBV A;  1M39 A;  1F4Q A;  2A4J A;  2L50 A;  2LVI A;  3IF7 A;  1XO5 A;  1J7R A;  2JT0 A;  1SL9 A;  3NSL A;  1JF0 A;  1XA5 A;  4DCK A;  1OOJ A;  1C07 A;  1F54 A;  1QTX A;  1QIW A;  1PRW A;  1W7I B;  2KI6 C;  2K2A A;  5HKZ A;  1A75 B;  2B1U A;  1JC2 A;  2Y4Q A;  4PDZ A;  1SL8 A;  1ALW A;  2ZFD A;  4AQI A;  1ZFS A;  1Y1U A;  4PHJ A;  4CFR A;  1YUT A;  1CDM A;  2Q91 A;  4PHM A;  1QIV A;  2K7C A;  3CR5 X;  2Y1N A;  3BUN B;  2AAO A;  2P6B B;  4OR9 B;  1JFK A;  4M2O A;  2RGI A;  1H4B A;  1F71 A;  1UP5 A;  2ZN9 A;  4PHK A;  2LLU A;  5CSN A;  1CFD A;  3EK4 A;  1IG5 A;  1AP4 A;  4U8D A;  3I5G C;  2JPT A;  2KFF A;  1EG4 A;  4XJK B;  1IQ3 A;  2BBN A;  1KWO C;  2K8M B;  4WQ2 A;  2BCX A;  2ISD A;  3TZ1 A;  1C7W A;  4BY4 A;  1IWQ A;  1XFY O;  2SAS A;  5GQQ C;  3D0Y B;  2GGZ A;  2NCP A;  1K9P A;  4I5N B;  3LLE A;  2MJW B;  1U5I B;  1F4O A;  2LVV A;  5AAN A;  3D10 A;  1DVI A;  1KSO A;  1FI5 A;  1KFX L;  3VRO A;  4QJ4 B;  1EL4 A;  5G08 A;  4C0J A;  1B7T Y;  1CFC A;  5J3X A;  3BOW B;  1M46 A;  1SRA A;  1S5G Z;  4I5L B;  1DGV A;  4XYN A;  1D1O A;  1M63 B;  3BUX B;  3FWC A;  1V1G A;  2WOR A;  3F45 A;  3AAK A;  3TDI A;  4P2Y B;  3AAJ A;  1MUX A;  1SNL A;  3KHE A;  1R6P A;  3SG4 A;  4GUK A;  1KFU L;  2TN4 A;  2E6W A;  1QLS A;  2L4H A;  3CR2 A;  1QJT A;  1DF0 B;  2KGB C;  3EVR A;  1TN4 A;  3KEV A;  4R1E A;  3VRR A;  3I5G B;  2LAN A;  2LP3 A;  1AUI B;  1DT7 B;  1KK7 Y;  1KWO B;  1K9K A;  3FWB A;  1OSA A;  1TCF A;  4YBH B;  2BKH B;  1XFU O;  3SG3 A;  3A4U B;  2L5X B;  1YUR A;  1JSA A;  1QX5 B;  1XK4 A;  1J7Q A;  5AEQ A;  1TNX A;  1L7Z A;  1N0Y A;  1SYM A;  3CZT X;  5HLV A;  4MZK A;  2KBI A;  1CTR A;  3PAT A;  2K2F A;  4CFQ A;  1GGW A;  4N1F A;  4YGA A;  1AHR A;  1Y1X A;  3EVV A;  2KYF A;  4Q04 A;  1LA3 A;  2BKI B;  3DVM A;  3CGA A;  2FJU B;  3PLF B;  1WRL A;  4PE4 A;  1PAL A;  2H61 A;  3DF0 A;  1DJY A;  3AKB A;  3GOF A;  1KFU S;  2KYC A;  2JNF A;  5JJG A;  2PAL A;  2F8P A;  1MXL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...