3D76A

Crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, soaked at ph 7.0
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
116
structure length
116
Chain Sequence
WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 37
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d76A00
3B86A 1GM0A 2WCMA 3L4LA 4INWA 3DYEA 1OOGA 1OOIX 3CZ2A 1OW4A 3S0GA 3B7AA 2P71A 3BFHA 2WCHA 3FE6A 4OZDA 2WCLA 3B87A 1C3ZA 3CDNA 3CZ0A 1C3YA 3S0BA 4JD9A 3N7HA 2WCKA 4FQTA 2QEVA 3B6XA 3D73A 2ERBA 2FJYA 2H8VA 1DQEA 3D74A 3BJHA 5DICA 3R1OA 3L47A 3FE9A 1T14A 1ORGA 3PJIA 3RZSA 3FE8A 2P70A 3CABA 3S0FA 1OOHA 1P28A 3CZ1A 3S0AA 2WC5A 3L4AA 2PQLA 2WC6A 2GTEA 3BFBA 4INXA 2KPHA 3B88A 3D76A 3QMEA 3R72A 3NHTA 3DY9A 2JPOA 3OGNA 1TWOA 3DXLA 1XFRA 3BFAA 2QEOA 1QWVA 3DZTA 3R1VA 1OOFA 3D78A 1TUJA 3CYZA 2QEHA 5EL2A 2QEBA 2WCJA 3S0EA 2QDIA 4F7FA 2L2CA 3VB1A 3NGVA 1LS8A 3V2LA 3NHIA 3D75A 4PT1A 3K1EA 3Q8IA 3R1PA 3S0DA 3D77A
chains in the Genus database with same CATH superfamily
4YBHB 2YGUA 4GAOA 1TOPA 4PHMA 1J7PA 3DYEA 2Q4UA 5CSJA 2FCEA 2FOTA 3PALA 3I5GC 3OX6A 1YTZC 2WNDA 1K9UA 2P71A 5TNCA 1BMOA 1KWOC 1Y6WA 3AKBA 4OZDA 4C0KA 1J55A 1JBAA 1K9PA 1OMDA 1J1DA 3B87A 3FS7A 2FJUB 4MEWA 2DOQA 3RLZA 4CIDA 4MN0A 1UHKA 3I5HC 5CPVA 3CDNA 3IVTA 2KBMA 5HL1A 2KFHA 1BT6A 3I5FB 1CMFA 1DF0B 1SCVA 2JZIA 2M0RA 2NCOA 1TCOB 2IS9A 4C0JA 4FQTA 4ETOA 2QEVA 5PALA 2MBXA 2L51A 1KFXL 1QATA 2GGMA 1PVAA 1CLMA 3PN7C 3NSKA 2KFGA 3VRRA 1BODA 1S1EA 3LK0A 4TNCA 3D73A 4I5JA 4AQJA 1TNQA 4MZKA 1F71A 2LE9B 2M97A 2ZFDA 3D74A 3M0WA 2KNEA 2KGBC 2E30A 1K93D 1W7JB 3AAKA 2E6WA 1OMRA 1YURA 3D10A 4DIRA 4M2QA 2M3WA 1XA5A 4CPVA 3I5HB 4ICBA 1E8AA 3EVUA 2COLB 2OS8C 3FIAA 5HKZA 2P70A 1OOHA 2G2BA 3CZ1A 3CGAA 4GBAA 1C7VA 3L4AA 3EG5B 3OBVA 4MRYA 4HSZA 2KI6C 4MBEA 2KYFA 1YRUB 1CDNA 1M39A 4PHKA 2GTEA 2PYQA 4A4CA 2M1UA 3SG7A 3SS5A 2JWWA 2SASA 3D76A 1F70A 1CFCA 1JFKA 3K21A 3JVTC 3TS5C 2A4JA 1A75A 2G9BA 2GV5A 3EKHA 1A29A 3GK4X 2JQ6A 3NXAA 1GJYA 1UURA 1CM1A 1OOJA 5DKRA 2Y4QA 2QACA 1TWOA 2BE4A 1SK6D 4FTGA 4YGCB 5D3OA 2NZ0A 2OS8B 3H4SE 1BF5A 4PE4A 1AJ5A 1YX7A 1VRKA 3OHMB 3DVEA 5HKWA 5AEQA 5HLOA 2TN4A 3R1VA 2EC6C 4N5XA 3NSOA 1OOFA 2M9GA 1TTXA 2KBIA 1PK0D 2WCEA 3O6BA 3CYZA 3KO0A 2M1KB 1JF0A 2KLEA 1KK7Z 1CFPA 1LKJA 1SRAA 4PE1A 1IQ3A 1NUBA 2L98A 3PSRA 1DTLA 1B7TY 2JC2A 2WCJA 3JTDB 1NX1A 4ORBB 1A75B 1Y1XA 2OTGC 1G33A 3SG6A 1S6JA 5AXIA 1S3PA 2HQWA 2AUCA 3NHIA 2QPTA 2CBLA 4PT1A 2L0PA 1NIWA 3SG5A 2BBNA 3VROA 4C0LA 1R2UA 1N65A 1CLLA 1UHIA 4AQIA 1DJYA 1CFDA 3KF9A 2MA2A 2JT8A 1AK8A 2EC6B 1NP8A 4I5LB 3HCMA 1MF8B 1KFUS 1DJXA 1RJVA 1B8CA 1FW4A 1OOGA 1B47A 3BUOB 1WLMA 3CZ2A 2ZRTA 4IJ7A 1H8BA 1OMVA 1PVBA 2H61A 1LXFC 4YI8A 1CM4A 1YRTB 1IH0A 5BPJA 3TUYC 1OSAA 4ZCVA 1KQMC 1RECA 1XK4C 3CZ0A 3KEVA 1K8UA 1YUUA 3IQQA 2MLFC 3CZTX 1EG3A 1JUOA 2KQ6A 1UHHA 3N7HA 2PMYA 2MHHA 4GGNA 1YVHA 2BE6A 1CKKA 1ZOTB 1JFJA 2WCFA 5I2LA 3QRXA 1L7ZA 1DJGA 4YGEB 1B4CA 2ERBA 1HT9A 5JOLA 5DKNA 1S36A 2JNXA 2KHNA 3LCPC 2K7OA 1NWDA 3FWBA 2JRFA 3OB2B 1DGUA 3BXKA 1JF2A 2BECA 3ZWHA 2ZN8A 1AUIB 1F54A 2P6BB 2LCPA 1DJHA 3DD4A 1BU3A 5I2QA 4A4BA 5FYXA 5I2OA 1T14A 1SCMC 1TIZA 1KQMB 1G4YR 1ORGA 1AVSA 2LLSA 1K95A 2M7NA 3FE8A 1EG4A 3KPXA 3CABA 1B1GA 4DS7A 3S0AA 2WC5A 1X02A 2BCBA 4YRUA 5AANA 2KYCA 2M49B 1CMGA 3CTNA 2CXJA 2CNPA 3O78A 3ICBA 1NX2A 3BFBA 2KPHA 3B88A 1QASA 1EXRA 1RK9A 2H2KA 2LC5A 3VRNA 4I5KA 4MVFA 3I5GB 2BNXA 1YVLA 1C07A 2JXCA 2EGDA 1NCXA 2FCDA 2Y5IA 5FI7A 1ALWA 1KWOB 1IJ6A 1UUSA 2JPOA 2LMTA 2WCBA 3OGNA 2AAOA 4PE7A 3VRPA 4E68A 1LVCD 1XFYO 2LAPA 1G8IA 2LM5A 4OCIA 3RM1A 1SCMB 3BFAA 2HF5A 3TDUA 4IL1A 1HQVA 4ORCB 4GPLB 3A8RA 3DVKA 1A4PA 4R1EA 5D7FA 1IRJA 2LHIA 1K2HA 3VGOA 1KK8C 1UHJA 1B7TZ 3AKAA 2CT9A 1N2DA 3I5IC 2K8MB 1L2OC 2LVVA 4F0ZB 1J1EA 1SY9A 3DF0A 3PN7B 5EL2A 1Y1AA 4CFRA 1TN4A 4M2OA 1Y0VH 3BUWB 3S0EA 2QDIA 4I5NB 4F7FA 5I8NA 1FBVA 3OB1B 3BOWB 1DEKA 4BY5A 2R2IA 1TCFA 2LMVA 3D75A 2M7LA 1CDPA 1K9KA 1RWYA 3D0YB 1BG1A 3VRQA 1S26D 3LK1A 2BKIB 1SL8A 1YX8A 3S0DA 2KAYA 1ALVA 1QJTA 1F4OA 1XYDA 2LANA 2ZNEA 1NCYA 4PDZA 1OE9B 3E3RA 3I5IB 3B86A 5CSNA 1XFXO 4OKHA 1JC2A 1NPQA 2WCMA 2HQ8A 3DF0B 1Y1UA 3L4LA 4INWA 5GQQC 2ZKMX 1R6PA 1OOIX 1M63B 4YGAA 4OVNF 1JSAA 1OW4A 1QX5B 1AP4A 3S0GA 1EH2A 1Q80A 3JVTB 1V1GA 1S5GY 4MLWA 2JOJA 1SR6C 1KFXS 1GGZA 1OZSA 1PSRA 2F33A 1CDLA 2L5XB 3WHUB 1QX2A 3TZ1A 2MLEC 2LVKA 3UNWA 4U8DA 4KYNA 1K90D 3C1VA 2ZNDA 1K94A 3SG3A 1V1FA 1YUSA 1U5IB 3S0BA 4MZJA 1CB1A 3EVRA 1F55A 4GFTA 1LA0A 1DGVA 1DELA 2AMIA 1IGVA 5AFPA 2ZRSA 3KHEA 4JWQA 2BCAA 3UO9A 1IWQA 2KQYA 1QX7A 2L4IA 2LHLA 2FJYA 2H8VA 1GGWA 1QS7A 1SL9A 1NCZA 1DQEA 5KSZA 5HLVA 2LVJA 1WY9A 2NXQA 3OX5A 4GNKB 2K60A 2OTGB 3EK7A 1OZOA 1TRFA 2BL0C 1XVJA 1SMGA 3NSIA 4NDDA 2MRDA 1UWOA 2NLNA 1QVIY 2L2EA 4GGFC 5I94A 1CNPA 3RZSA 2F2OA 1XK4A 2BKHB 1P28A 2MJWB 4PCWA 5KTYA 4QJ5B 3CR5X 3O4XA 5F6TA 4OR9B 2SCPA 1MXEA 1WDCC 2MAZA 1AJ4A 1WLZA 4PHNA 1CDMA 1W9ZA 1SBJA 2KI6D 4XJKA 3SIAA 1UP5A 5DKQA 3PM2A 1BLQA 2LV7A 2WORA 3BUNB 3PM8A 5FI6A 2L5YA 2JT3A 4AOMA 3EK4A 3O2PA 1MHOA 1QLKA 4BY4A 1S6IA 2GGZA 3DY9A 5IBWA 3CS1A 4JQ0D 3DXLA 3SS3A 2QEOA 1WRLA 3CR2A 3TUYB 4PALA 3O4YA 2O5GA 4YGDB 3I5FC 1CTRA 4ZCUA 1RTP1 4FQOA 3TDZA 1GQMA 1KSMA 1IJ5A 1WDCB 2WOSA 3D78A 1TUZA 1C7WA 4M2PA 1TUJA 4HREE 4MRXA 2JNFA 3WNXB 3WHTB 1SSEB 4XJKB 4DRWA 2O60A 2QEBA 5HKYA 1Z2CB 2LUCA 2BAPA 1EL4A 2F3ZA 1OQPA 2Y1NA 1M31A 4MSPA 4MZLA 1IQ5A 3BUMB 4HRGA 2HPSA 1FI6A 2I2RE 2LLTA 1B8RA 2BBMA 2K0JA 2NCPA 5D69A 2CCMA 3NGVA 1JWDA 2I94A 2K7BA 3BOWA 1F8HA 3LL8B 4QJ4B 2KLDA 1QV0A 3Q8IA 3R1PA 3D0YA 2L4HA 2K2FA 4WRIA 1FI5A 1BJFA 2K2AA 1MQ1A 3D77A 2I18A 2KAVA 4N1FA 3HX4A 3FWCA 2PSRA 3TS5B 2L50A 3EK8A 3BUXB 1DVIA 1S5GZ 1GM0A 1DC1A 3IQOA 1AHRA 1M45A 1KSOA 2CTNA 4DCKA 1CFFA 2JULA 5K89A 1K96A 1CLBA 2V53A 3A4UB 4L9MA 1KCYA 1XFVO 2JXLA 1ZMZA 2EHBA 5HYDA 3B7AA 4USLA 2F8PA 3BFHA 1J7QA 1LA3A 2RGIA 1A2XA 2WCHA 3FE6A 1MR8A 2WCLA 1PSBA 1C3ZA 1XO5A 1DT7B 1KQVA 2BCXA 2KOTA 5J3XA 2JPTA 2VRGA 5JJGA 1M46A 1MXLC 1RFJA 1KFUL 4P5OE 5ER5A 1TNPA 1J7OA 1DMOA 5ER4X 1C3YA 4XYNA 1XFUO 1FF1A 1SNLA 1IKUA 1U5IA 2Q91A 1NX3A 1W7IB 4NQGA 2M29A 2PRUA 3PATA 4JD9A 4YI9A 1F4QA 1KK8B 2WCKA 3EVVA 1ZACA 2I7AA 1XFWO 3SIBA 1L2OB 5KU1A 1DJWA 4NDCA 1QTXA 3B6XA 3GOFA 4HRHA 1IIOA 1WRZA 2LP3A 3GK1A 4PHJA 3JTDC 3SG4A 1H4BA 2M8UA 1DJZA 1QVIZ 1QXPA 3BJHA 3TDIA 4NDBA 1NSHA 1QIWA 5DICA 4CLNA 1UHNA 4D1EA 3R1OA 3EKJA 1QV1A 3L47A 3LLEA 2KI4C 1MUXA 5CSIA 2B1UA 1IG5A 3FE9A 3OP0A 1RROA 3DVMA 4WQ2A 4QJ3B 3SG2A 3PJIA 3S0FA 3WXAA 2PQLA 4P2YB 4ORAB 2WC6A 3SJSA 3ZNIA 4JPZB 5FI2A 3NSLA 3SS4A 1LINA 1SYMA 3PLFB 2KGRA 4PE0A 4OV2A 4INXA 1QLSA 1D1OA 3CLNA 4JKTA 3QMEA 4GUKA 1XFZO 3IF7A 3R72A 1Z4HA 1ZUZA 3NHTA 2JT0A 1QIVA 1SR6B 1YR5A 1NYAA 2KFFA 2PVBA 4DUQA 4WQ3A 1FPWA 3GK2A 1B8LA 2KI4B 2PALA 3CR4X 2K7CA 1XFRA 1SPYA 4CFQA 2LP2A 2JTZA 4GGFA 1QWVA 1MWNA 3DZTA 2KDHA 1B9AA 1SL7A 1DJIA 2KSPA 2LLUA 4N1GA 5B8IB 1A03A 4UPGA 1S6CA 3CWGA 2PASA 1J7RA 1PULA 1SW8A 2OPOA 2QEHA 1PRWA 2K7DA 2JU0A 2LUXA 2K61A 2Y1MA 1PALA 2F2PA 1ODBA 2LNKA 3BQ3A 3AAJA 2ISDA 1KK7Y 2L2CA 2LVIA 3VB1A 2H61C 2ZN9A 1LS8A 3V2LA 1BR4B 2BL0B 3BYAA 2LMUA 3K1EA 3MSEB 3DVJA 1NX0A 2HETA 2JTTA 1BR1B 1SKTA 1WRKA 1N0YA 2KAXA 3PFVA 4Q04A 4YGBB 5AERA 1BOCA 1YUTA 3F45A 1EJ3A 1ZFSA 5G08A 1DF0A 1TNWA 1TNXA 2D8NA 5CSFA 2WC8A 2F3YA
chains in the Genus database with same CATH topology
3B86A 1GM0A 2WCMA 3L4LA 4INWA 3DYEA 1OOGA 1OOIX 3CZ2A 1OW4A 3S0GA 3B7AA 2P71A 3BFHA 2WCHA 3FE6A 4OZDA 2WCLA 3B87A 1C3ZA 3CDNA 3CZ0A 1C3YA 3S0BA 4JD9A 3N7HA 2WCKA 4FQTA 2QEVA 3B6XA 3D73A 2ERBA 2FJYA 2H8VA 1DQEA 3D74A 3BJHA 5DICA 3R1OA 3L47A 3FE9A 1T14A 1ORGA 3PJIA 3RZSA 3FE8A 2P70A 3CABA 3S0FA 1OOHA 1P28A 3CZ1A 3S0AA 2WC5A 3L4AA 2PQLA 2WC6A 2GTEA 3BFBA 4INXA 2KPHA 3B88A 3D76A 3QMEA 3R72A 3NHTA 3DY9A 2JPOA 3OGNA 1TWOA 3DXLA 1XFRA 3BFAA 2QEOA 1QWVA 3DZTA 3R1VA 1OOFA 3D78A 1TUJA 3CYZA 2QEHA 5EL2A 2QEBA 2WCJA 3S0EA 2QDIA 4F7FA 2L2CA 3VB1A 3NGVA 1LS8A 3V2LA 3NHIA 3D75A 4PT1A 3K1EA 3Q8IA 3R1PA 3S0DA 3D77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B86 A;  1GM0 A;  2WCM A;  3L4L A;  4INW A;  3DYE A;  1OOG A;  1OOI X;  3CZ2 A;  1OW4 A;  3S0G A;  3B7A A;  2P71 A;  3BFH A;  2WCH A;  3FE6 A;  4OZD A;  2WCL A;  3B87 A;  1C3Z A;  3CDN A;  3CZ0 A;  1C3Y A;  3S0B A;  4JD9 A;  3N7H A;  2WCK A;  4FQT A;  2QEV A;  3B6X A;  3D73 A;  2ERB A;  2FJY A;  2H8V A;  1DQE A;  3D74 A;  3BJH A;  5DIC A;  3R1O A;  3L47 A;  3FE9 A;  1T14 A;  1ORG A;  3PJI A;  3RZS A;  3FE8 A;  2P70 A;  3CAB A;  3S0F A;  1OOH A;  1P28 A;  3CZ1 A;  3S0A A;  2WC5 A;  3L4A A;  2PQL A;  2WC6 A;  2GTE A;  3BFB A;  4INX A;  2KPH A;  3B88 A;  3D76 A;  3QME A;  3R72 A;  3NHT A;  3DY9 A;  2JPO A;  3OGN A;  1TWO A;  3DXL A;  1XFR A;  3BFA A;  2QEO A;  1QWV A;  3DZT A;  3R1V A;  1OOF A;  3D78 A;  1TUJ A;  3CYZ A;  2QEH A;  5EL2 A;  2QEB A;  2WCJ A;  3S0E A;  2QDI A;  4F7F A;  2L2C A;  3VB1 A;  3NGV A;  1LS8 A;  3V2L A;  3NHI A;  3D75 A;  4PT1 A;  3K1E A;  3Q8I A;  3R1P A;  3S0D A;  3D77 A; 
#chains in the Genus database with same CATH topology
 4YBH B;  2YGU A;  4GAO A;  1TOP A;  4PHM A;  1J7P A;  3DYE A;  2Q4U A;  5CSJ A;  2FCE A;  2FOT A;  3PAL A;  3I5G C;  3OX6 A;  1YTZ C;  2WND A;  1K9U A;  2P71 A;  5TNC A;  1BMO A;  1KWO C;  1Y6W A;  3AKB A;  4OZD A;  4C0K A;  1J55 A;  1JBA A;  1K9P A;  1OMD A;  1J1D A;  3B87 A;  3FS7 A;  2FJU B;  4MEW A;  2DOQ A;  3RLZ A;  4CID A;  4MN0 A;  1UHK A;  3I5H C;  5CPV A;  3CDN A;  3IVT A;  2KBM A;  5HL1 A;  2KFH A;  1BT6 A;  3I5F B;  1CMF A;  1DF0 B;  1SCV A;  2JZI A;  2M0R A;  2NCO A;  1TCO B;  2IS9 A;  4C0J A;  4FQT A;  4ETO A;  2QEV A;  5PAL A;  2MBX A;  2L51 A;  1KFX L;  1QAT A;  2GGM A;  1PVA A;  1CLM A;  3PN7 C;  3NSK A;  2KFG A;  3VRR A;  1BOD A;  1S1E A;  3LK0 A;  4TNC A;  3D73 A;  4I5J A;  4AQJ A;  1TNQ A;  4MZK A;  1F71 A;  2LE9 B;  2M97 A;  2ZFD A;  3D74 A;  3M0W A;  2KNE A;  2KGB C;  2E30 A;  1K93 D;  1W7J B;  3AAK A;  2E6W A;  1OMR A;  1YUR A;  3D10 A;  4DIR A;  4M2Q A;  2M3W A;  1XA5 A;  4CPV A;  3I5H B;  4ICB A;  1E8A A;  3EVU A;  2COL B;  2OS8 C;  3FIA A;  5HKZ A;  2P70 A;  1OOH A;  2G2B A;  3CZ1 A;  3CGA A;  4GBA A;  1C7V A;  3L4A A;  3EG5 B;  3OBV A;  4MRY A;  4HSZ A;  2KI6 C;  4MBE A;  2KYF A;  1YRU B;  1CDN A;  1M39 A;  4PHK A;  2GTE A;  2PYQ A;  4A4C A;  2M1U A;  3SG7 A;  3SS5 A;  2JWW A;  2SAS A;  3D76 A;  1F70 A;  1CFC A;  1JFK A;  3K21 A;  3JVT C;  3TS5 C;  2A4J A;  1A75 A;  2G9B A;  2GV5 A;  3EKH A;  1A29 A;  3GK4 X;  2JQ6 A;  3NXA A;  1GJY A;  1UUR A;  1CM1 A;  1OOJ A;  5DKR A;  2Y4Q A;  2QAC A;  1TWO A;  2BE4 A;  1SK6 D;  4FTG A;  4YGC B;  5D3O A;  2NZ0 A;  2OS8 B;  3H4S E;  1BF5 A;  4PE4 A;  1AJ5 A;  1YX7 A;  1VRK A;  3OHM B;  3DVE A;  5HKW A;  5AEQ A;  5HLO A;  2TN4 A;  3R1V A;  2EC6 C;  4N5X A;  3NSO A;  1OOF A;  2M9G A;  1TTX A;  2KBI A;  1PK0 D;  2WCE A;  3O6B A;  3CYZ A;  3KO0 A;  2M1K B;  1JF0 A;  2KLE A;  1KK7 Z;  1CFP A;  1LKJ A;  1SRA A;  4PE1 A;  1IQ3 A;  1NUB A;  2L98 A;  3PSR A;  1DTL A;  1B7T Y;  2JC2 A;  2WCJ A;  3JTD B;  1NX1 A;  4ORB B;  1A75 B;  1Y1X A;  2OTG C;  1G33 A;  3SG6 A;  1S6J A;  5AXI A;  1S3P A;  2HQW A;  2AUC A;  3NHI A;  2QPT A;  2CBL A;  4PT1 A;  2L0P A;  1NIW A;  3SG5 A;  2BBN A;  3VRO A;  4C0L A;  1R2U A;  1N65 A;  1CLL A;  1UHI A;  4AQI A;  1DJY A;  1CFD A;  3KF9 A;  2MA2 A;  2JT8 A;  1AK8 A;  2EC6 B;  1NP8 A;  4I5L B;  3HCM A;  1MF8 B;  1KFU S;  1DJX A;  1RJV A;  1B8C A;  1FW4 A;  1OOG A;  1B47 A;  3BUO B;  1WLM A;  3CZ2 A;  2ZRT A;  4IJ7 A;  1H8B A;  1OMV A;  1PVB A;  2H61 A;  1LXF C;  4YI8 A;  1CM4 A;  1YRT B;  1IH0 A;  5BPJ A;  3TUY C;  1OSA A;  4ZCV A;  1KQM C;  1REC A;  1XK4 C;  3CZ0 A;  3KEV A;  1K8U A;  1YUU A;  3IQQ A;  2MLF C;  3CZT X;  1EG3 A;  1JUO A;  2KQ6 A;  1UHH A;  3N7H A;  2PMY A;  2MHH A;  4GGN A;  1YVH A;  2BE6 A;  1CKK A;  1ZOT B;  1JFJ A;  2WCF A;  5I2L A;  3QRX A;  1L7Z A;  1DJG A;  4YGE B;  1B4C A;  2ERB A;  1HT9 A;  5JOL A;  5DKN A;  1S36 A;  2JNX A;  2KHN A;  3LCP C;  2K7O A;  1NWD A;  3FWB A;  2JRF A;  3OB2 B;  1DGU A;  3BXK A;  1JF2 A;  2BEC A;  3ZWH A;  2ZN8 A;  1AUI B;  1F54 A;  2P6B B;  2LCP A;  1DJH A;  3DD4 A;  1BU3 A;  5I2Q A;  4A4B A;  5FYX A;  5I2O A;  1T14 A;  1SCM C;  1TIZ A;  1KQM B;  1G4Y R;  1ORG A;  1AVS A;  2LLS A;  1K95 A;  2M7N A;  3FE8 A;  1EG4 A;  3KPX A;  3CAB A;  1B1G A;  4DS7 A;  3S0A A;  2WC5 A;  1X02 A;  2BCB A;  4YRU A;  5AAN A;  2KYC A;  2M49 B;  1CMG A;  3CTN A;  2CXJ A;  2CNP A;  3O78 A;  3ICB A;  1NX2 A;  3BFB A;  2KPH A;  3B88 A;  1QAS A;  1EXR A;  1RK9 A;  2H2K A;  2LC5 A;  3VRN A;  4I5K A;  4MVF A;  3I5G B;  2BNX A;  1YVL A;  1C07 A;  2JXC A;  2EGD A;  1NCX A;  2FCD A;  2Y5I A;  5FI7 A;  1ALW A;  1KWO B;  1IJ6 A;  1UUS A;  2JPO A;  2LMT A;  2WCB A;  3OGN A;  2AAO A;  4PE7 A;  3VRP A;  4E68 A;  1LVC D;  1XFY O;  2LAP A;  1G8I A;  2LM5 A;  4OCI A;  3RM1 A;  1SCM B;  3BFA A;  2HF5 A;  3TDU A;  4IL1 A;  1HQV A;  4ORC B;  4GPL B;  3A8R A;  3DVK A;  1A4P A;  4R1E A;  5D7F A;  1IRJ A;  2LHI A;  1K2H A;  3VGO A;  1KK8 C;  1UHJ A;  1B7T Z;  3AKA A;  2CT9 A;  1N2D A;  3I5I C;  2K8M B;  1L2O C;  2LVV A;  4F0Z B;  1J1E A;  1SY9 A;  3DF0 A;  3PN7 B;  5EL2 A;  1Y1A A;  4CFR A;  1TN4 A;  4M2O A;  1Y0V H;  3BUW B;  3S0E A;  2QDI A;  4I5N B;  4F7F A;  5I8N A;  1FBV A;  3OB1 B;  3BOW B;  1DEK A;  4BY5 A;  2R2I A;  1TCF A;  2LMV A;  3D75 A;  2M7L A;  1CDP A;  1K9K A;  1RWY A;  3D0Y B;  1BG1 A;  3VRQ A;  1S26 D;  3LK1 A;  2BKI B;  1SL8 A;  1YX8 A;  3S0D A;  2KAY A;  1ALV A;  1QJT A;  1F4O A;  1XYD A;  2LAN A;  2ZNE A;  1NCY A;  4PDZ A;  1OE9 B;  3E3R A;  3I5I B;  3B86 A;  5CSN A;  1XFX O;  4OKH A;  1JC2 A;  1NPQ A;  2WCM A;  2HQ8 A;  3DF0 B;  1Y1U A;  3L4L A;  4INW A;  5GQQ C;  2ZKM X;  1R6P A;  1OOI X;  1M63 B;  4YGA A;  4OVN F;  1JSA A;  1OW4 A;  1QX5 B;  1AP4 A;  3S0G A;  1EH2 A;  1Q80 A;  3JVT B;  1V1G A;  1S5G Y;  4MLW A;  2JOJ A;  1SR6 C;  1KFX S;  1GGZ A;  1OZS A;  1PSR A;  2F33 A;  1CDL A;  2L5X B;  3WHU B;  1QX2 A;  3TZ1 A;  2MLE C;  2LVK A;  3UNW A;  4U8D A;  4KYN A;  1K90 D;  3C1V A;  2ZND A;  1K94 A;  3SG3 A;  1V1F A;  1YUS A;  1U5I B;  3S0B A;  4MZJ A;  1CB1 A;  3EVR A;  1F55 A;  4GFT A;  1LA0 A;  1DGV A;  1DEL A;  2AMI A;  1IGV A;  5AFP A;  2ZRS A;  3KHE A;  4JWQ A;  2BCA A;  3UO9 A;  1IWQ A;  2KQY A;  1QX7 A;  2L4I A;  2LHL A;  2FJY A;  2H8V A;  1GGW A;  1QS7 A;  1SL9 A;  1NCZ A;  1DQE A;  5KSZ A;  5HLV A;  2LVJ A;  1WY9 A;  2NXQ A;  3OX5 A;  4GNK B;  2K60 A;  2OTG B;  3EK7 A;  1OZO A;  1TRF A;  2BL0 C;  1XVJ A;  1SMG A;  3NSI A;  4NDD A;  2MRD A;  1UWO A;  2NLN A;  1QVI Y;  2L2E A;  4GGF C;  5I94 A;  1CNP A;  3RZS A;  2F2O A;  1XK4 A;  2BKH B;  1P28 A;  2MJW B;  4PCW A;  5KTY A;  4QJ5 B;  3CR5 X;  3O4X A;  5F6T A;  4OR9 B;  2SCP A;  1MXE A;  1WDC C;  2MAZ A;  1AJ4 A;  1WLZ A;  4PHN A;  1CDM A;  1W9Z A;  1SBJ A;  2KI6 D;  4XJK A;  3SIA A;  1UP5 A;  5DKQ A;  3PM2 A;  1BLQ A;  2LV7 A;  2WOR A;  3BUN B;  3PM8 A;  5FI6 A;  2L5Y A;  2JT3 A;  4AOM A;  3EK4 A;  3O2P A;  1MHO A;  1QLK A;  4BY4 A;  1S6I A;  2GGZ A;  3DY9 A;  5IBW A;  3CS1 A;  4JQ0 D;  3DXL A;  3SS3 A;  2QEO A;  1WRL A;  3CR2 A;  3TUY B;  4PAL A;  3O4Y A;  2O5G A;  4YGD B;  3I5F C;  1CTR A;  4ZCU A;  1RTP 1;  4FQO A;  3TDZ A;  1GQM A;  1KSM A;  1IJ5 A;  1WDC B;  2WOS A;  3D78 A;  1TUZ A;  1C7W A;  4M2P A;  1TUJ A;  4HRE E;  4MRX A;  2JNF A;  3WNX B;  3WHT B;  1SSE B;  4XJK B;  4DRW A;  2O60 A;  2QEB A;  5HKY A;  1Z2C B;  2LUC A;  2BAP A;  1EL4 A;  2F3Z A;  1OQP A;  2Y1N A;  1M31 A;  4MSP A;  4MZL A;  1IQ5 A;  3BUM B;  4HRG A;  2HPS A;  1FI6 A;  2I2R E;  2LLT A;  1B8R A;  2BBM A;  2K0J A;  2NCP A;  5D69 A;  2CCM A;  3NGV A;  1JWD A;  2I94 A;  2K7B A;  3BOW A;  1F8H A;  3LL8 B;  4QJ4 B;  2KLD A;  1QV0 A;  3Q8I A;  3R1P A;  3D0Y A;  2L4H A;  2K2F A;  4WRI A;  1FI5 A;  1BJF A;  2K2A A;  1MQ1 A;  3D77 A;  2I18 A;  2KAV A;  4N1F A;  3HX4 A;  3FWC A;  2PSR A;  3TS5 B;  2L50 A;  3EK8 A;  3BUX B;  1DVI A;  1S5G Z;  1GM0 A;  1DC1 A;  3IQO A;  1AHR A;  1M45 A;  1KSO A;  2CTN A;  4DCK A;  1CFF A;  2JUL A;  5K89 A;  1K96 A;  1CLB A;  2V53 A;  3A4U B;  4L9M A;  1KCY A;  1XFV O;  2JXL A;  1ZMZ A;  2EHB A;  5HYD A;  3B7A A;  4USL A;  2F8P A;  3BFH A;  1J7Q A;  1LA3 A;  2RGI A;  1A2X A;  2WCH A;  3FE6 A;  1MR8 A;  2WCL A;  1PSB A;  1C3Z A;  1XO5 A;  1DT7 B;  1KQV A;  2BCX A;  2KOT A;  5J3X A;  2JPT A;  2VRG A;  5JJG A;  1M46 A;  1MXL C;  1RFJ A;  1KFU L;  4P5O E;  5ER5 A;  1TNP A;  1J7O A;  1DMO A;  5ER4 X;  1C3Y A;  4XYN A;  1XFU O;  1FF1 A;  1SNL A;  1IKU A;  1U5I A;  2Q91 A;  1NX3 A;  1W7I B;  4NQG A;  2M29 A;  2PRU A;  3PAT A;  4JD9 A;  4YI9 A;  1F4Q A;  1KK8 B;  2WCK A;  3EVV A;  1ZAC A;  2I7A A;  1XFW O;  3SIB A;  1L2O B;  5KU1 A;  1DJW A;  4NDC A;  1QTX A;  3B6X A;  3GOF A;  4HRH A;  1IIO A;  1WRZ A;  2LP3 A;  3GK1 A;  4PHJ A;  3JTD C;  3SG4 A;  1H4B A;  2M8U A;  1DJZ A;  1QVI Z;  1QXP A;  3BJH A;  3TDI A;  4NDB A;  1NSH A;  1QIW A;  5DIC A;  4CLN A;  1UHN A;  4D1E A;  3R1O A;  3EKJ A;  1QV1 A;  3L47 A;  3LLE A;  2KI4 C;  1MUX A;  5CSI A;  2B1U A;  1IG5 A;  3FE9 A;  3OP0 A;  1RRO A;  3DVM A;  4WQ2 A;  4QJ3 B;  3SG2 A;  3PJI A;  3S0F A;  3WXA A;  2PQL A;  4P2Y B;  4ORA B;  2WC6 A;  3SJS A;  3ZNI A;  4JPZ B;  5FI2 A;  3NSL A;  3SS4 A;  1LIN A;  1SYM A;  3PLF B;  2KGR A;  4PE0 A;  4OV2 A;  4INX A;  1QLS A;  1D1O A;  3CLN A;  4JKT A;  3QME A;  4GUK A;  1XFZ O;  3IF7 A;  3R72 A;  1Z4H A;  1ZUZ A;  3NHT A;  2JT0 A;  1QIV A;  1SR6 B;  1YR5 A;  1NYA A;  2KFF A;  2PVB A;  4DUQ A;  4WQ3 A;  1FPW A;  3GK2 A;  1B8L A;  2KI4 B;  2PAL A;  3CR4 X;  2K7C A;  1XFR A;  1SPY A;  4CFQ A;  2LP2 A;  2JTZ A;  4GGF A;  1QWV A;  1MWN A;  3DZT A;  2KDH A;  1B9A A;  1SL7 A;  1DJI A;  2KSP A;  2LLU A;  4N1G A;  5B8I B;  1A03 A;  4UPG A;  1S6C A;  3CWG A;  2PAS A;  1J7R A;  1PUL A;  1SW8 A;  2OPO A;  2QEH A;  1PRW A;  2K7D A;  2JU0 A;  2LUX A;  2K61 A;  2Y1M A;  1PAL A;  2F2P A;  1ODB A;  2LNK A;  3BQ3 A;  3AAJ A;  2ISD A;  1KK7 Y;  2L2C A;  2LVI A;  3VB1 A;  2H61 C;  2ZN9 A;  1LS8 A;  3V2L A;  1BR4 B;  2BL0 B;  3BYA A;  2LMU A;  3K1E A;  3MSE B;  3DVJ A;  1NX0 A;  2HET A;  2JTT A;  1BR1 B;  1SKT A;  1WRK A;  1N0Y A;  2KAX A;  3PFV A;  4Q04 A;  4YGB B;  5AER A;  1BOC A;  1YUT A;  3F45 A;  1EJ3 A;  1ZFS A;  5G08 A;  1DF0 A;  1TNW A;  1TNX A;  2D8N A;  5CSF A;  2WC8 A;  2F3Y A; 
#chains in the Genus database with same CATH homology
 3B86 A;  1GM0 A;  2WCM A;  3L4L A;  4INW A;  3DYE A;  1OOG A;  1OOI X;  3CZ2 A;  1OW4 A;  3S0G A;  3B7A A;  2P71 A;  3BFH A;  2WCH A;  3FE6 A;  4OZD A;  2WCL A;  3B87 A;  1C3Z A;  3CDN A;  3CZ0 A;  1C3Y A;  3S0B A;  4JD9 A;  3N7H A;  2WCK A;  4FQT A;  2QEV A;  3B6X A;  3D73 A;  2ERB A;  2FJY A;  2H8V A;  1DQE A;  3D74 A;  3BJH A;  5DIC A;  3R1O A;  3L47 A;  3FE9 A;  1T14 A;  1ORG A;  3PJI A;  3RZS A;  3FE8 A;  2P70 A;  3CAB A;  3S0F A;  1OOH A;  1P28 A;  3CZ1 A;  3S0A A;  2WC5 A;  3L4A A;  2PQL A;  2WC6 A;  2GTE A;  3BFB A;  4INX A;  2KPH A;  3B88 A;  3D76 A;  3QME A;  3R72 A;  3NHT A;  3DY9 A;  2JPO A;  3OGN A;  1TWO A;  3DXL A;  1XFR A;  3BFA A;  2QEO A;  1QWV A;  3DZT A;  3R1V A;  1OOF A;  3D78 A;  1TUJ A;  3CYZ A;  2QEH A;  5EL2 A;  2QEB A;  2WCJ A;  3S0E A;  2QDI A;  4F7F A;  2L2C A;  3VB1 A;  3NGV A;  1LS8 A;  3V2L A;  3NHI A;  3D75 A;  4PT1 A;  3K1E A;  3Q8I A;  3R1P A;  3S0D A;  3D77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...