3D76A

Crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, soaked at ph 7.0
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
116
structure length
116
Chain Sequence
WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
molecule tags Pheromone binding protein
total genus 37
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d76A00
2JPOA 3Q8IA 3CABA 1OOHA 4JD9A 3DXLA 1C3YA 3K1EA 3NHIA 3L4AA 1OOGA 3NGVA 2L2CA 3VB1A 3B6XA 3D74A 3BFAA 3B87A 2ERBA 1OOFA 1C3ZA 2WCJA 3R1PA 3PJIA 3RZSA 1OW4A 3CZ2A 3BFHA 2QEBA 1T14A 4PT1A 2PQLA 3D73A 3CYZA 2QEHA 2WC6A 3R1VA 4INXA 3BFBA 2P71A 3N7HA 3FE6A 3CZ0A 3S0DA 3S0AA 3D75A 1GM0A 1LS8A 3R72A 3B7AA 2FJYA 1TWOA 3D77A 3S0EA 2KPHA 2QEVA 3QMEA 4INWA 5EL2A 2WCHA 1P28A 1TUJA 1XFRA 2WC5A 3L47A 3L4LA 3NHTA 5DICA 3DYEA 1QWVA 2WCKA 3R1OA 3BJHA 3CDNA 3S0BA 3S0FA 2QDIA 4F7FA 4OZDA 3S0GA 3D78A 2H8VA 3DZTA 3DY9A 3B86A 1DQEA 3FE8A 1ORGA 4FQTA 3V2LA 2QEOA 3OGNA 3CZ1A 3D76A 3B88A 3FE9A 2WCMA 2WCLA 2P70A 2GTEA 1OOIX
chains in the Genus database with same CATH superfamily
2JPOA 1UHHA 3Q8IA 2E30A 3CABA 4P2YB 5CPVA 4GGFA 4CPVA 1AVSA 4JD9A 2KLEA 1JFKA 1DJWA 1L7ZA 4DIRA 2NLNA 3K1EA 1HQVA 3KF9A 3NHIA 3LCPC 1MWNA 1L2OB 1OQPA 1M31A 1AUIB 2L5YA 1A75B 1LA3A 4YRUA 2SASA 1B8RA 4IL1A 2H2KA 1XK4C 3LK1A 3EVRA 1ZOTB 1G8IA 1CLBA 2ZRTA 1B1GA 1DELA 5D3OA 1EG3A 4MLWA 1AHRA 1PULA 4NDBA 3D0YA 3AAKA 1K95A 2WCJA 2KI6C 1J7PA 5HYDA 1OW4A 1BJFA 2E6WA 3CZ2A 3EKJA 3OX5A 1KFXS 1DEKA 1BG1A 1KSMA 2HQ8A 2KI4B 5GQQC 1DF0B 2FCDA 1T14A 5PALA 3KPXA 3HCMA 2ZN8A 2LMUA 1IQ5A 3BUOB 2EC6C 5HLVA 4ORCB 1B8LA 3R1VA 4FTGA 4INXA 3CTNA 1S6CA 1SCVA 3I5FB 1SL9A 1UUSA 4MZKA 1ZUZA 2K7DA 2KFFA 3IF7A 4M2OA 2PRUA 1B8CA 2LVIA 3DF0A 4YGDB 4ZCVA 3FE6A 1QVIZ 1CFPA 2MHHA 1DTLA 1JWDA 2GGZA 1A2XA 1G33A 2KQ6A 3DVKA 4YGEB 3DD4A 1UHKA 1CNPA 1LVCD 1B7TZ 2CBLA 3MSEB 5D69A 1S5GZ 1CDNA 2CXJA 2K2AA 2PMYA 3OHMB 3PFVA 1QVIY 1WDCB 4ZCUA 2EGDA 3BQ3A 3SG4A 3D77A 1D1OA 2JT0A 2BE6A 2MRDA 3ZNIA 2QEVA 1SW8A 2P6BB 1M46A 3WHUB 3I5GC 1TUJA 2NZ0A 3WHTB 1B9AA 1DJYA 1MXLC 1TIZA 5DKRA 1SNLA 2Y1MA 2ZKMX 5DICA 3PALA 3EK7A 5CSIA 1K93D 1Y1UA 2KYFA 1YUUA 1QWVA 2QPTA 2WNDA 1B4CA 2WCKA 2BL0C 1QX5B 2PASA 1LA0A 4PE1A 3CZTX 3PLFB 1EL4A 5DKNA 1PVBA 2BECA 1FBVA 1RFJA 5KTYA 4MRXA 4L9MA 4XYNA 1JBAA 4NDCA 1SBJA 3S0FA 2CT9A 2LMVA 4OR9B 4PHKA 5G08A 1H8BA 1XK4A 4YI8A 5CSNA 1J7OA 1HT9A 2FJUB 1TCFA 5HL1A 3IQOA 2H8VA 4PE4A 2L5XB 2PVBA 2B1UA 2LAPA 3DVEA 1K90D 4MZJA 1RTP1 4FQTA 1SKTA 1R2UA 3V2LA 1YUTA 2QEOA 3FWCA 3IQQA 3CZ1A 3D76A 1K9UA 4AOMA 2Y4QA 2BCXA 2P70A 3A8RA 1ODBA 1KCYA 4MN0A 3OX6A 1TUZA 1N0YA 2MLEC 4PCWA 4CLNA 2MJWB 1DMOA 4N1FA 3PATA 2M1KB 1QXPA 2WC8A 4GNKB 2COLB 3TZ1A 4HSZA 2CNPA 2L50A 1FPWA 4MZLA 1CTRA 3DF0B 1J1DA 1KWOC 4DRWA 2FCEA 1V1FA 3AKAA 1M45A 3GOFA 3FWBA 3LLEA 1OE9B 1QV1A 2BE4A 2JQ6A 3I5IC 5HKZA 5AERA 1UWOA 2NCOA 4WRIA 2JNXA 2WOSA 3BXKA 3BOWA 5JJGA 1TNWA 1K8UA 2ERBA 4OCIA 2D8NA 4YGAA 3R1PA 2AMIA 2HF5A 2KLDA 2BCBA 2JOJA 2R2IA 2ZNDA 1NYAA 3RZSA 2Q91A 2TN4A 3I5HC 3OP0A 1XA5A 5AEQA 4BY5A 4OKHA 2LUCA 3HX4A 5CSFA 2KI6D 1F55A 1OOJA 1F4OA 3BFHA 3JVTC 2QEBA 1M63B 3DVMA 1IG5A 1WLZA 3O4XA 2PQLA 3PN7C 1IQ3A 2M7NA 4GFTA 1J7RA 5HKWA 4NDDA 4CFRA 1A4PA 3D73A 4JWQA 3BFBA 1N65A 4ICBA 1MXEA 4F0ZB 1KK8C 3AAJA 1CLMA 2M9GA 1OZSA 2WCFA 2PSRA 4I5NB 3PM2A 2ISDA 2LP3A 3S0DA 4ETOA 3F45A 1PALA 5B8IB 4GGNA 2I7AA 2NCPA 3O78A 3D75A 2I2RE 2JU0A 4AQIA 2KNEA 1LS8A 2G9BA 3GK1A 2JULA 3B7AA 1PRWA 1TNXA 1QIWA 2FJYA 2ZFDA 1XFYO 2JT3A 1FF1A 1IWQA 4FQOA 2KPHA 5FI6A 3S0EA 1BR1B 3TS5C 1K9PA 1OSAA 1NCXA 2L4HA 3ICBA 3BUXB 3TDZA 1JSAA 1S36A 1EXRA 5EL2A 2WCHA 3TS5B 1P28A 1JF2A 1XFRA 2MLFC 2Y5IA 4NQGA 1A03A 1JFJA 3CLNA 1KQMC 3L4LA 3L47A 2F2PA 1J7QA 1CDMA 1TNPA 3DYEA 5TNCA 1UHJA 2VRGA 1K94A 1LINA 1IRJA 2LUXA 2QACA 2K7OA 4JPZB 2H61C 4MRYA 1ALWA 2EC6B 3UNWA 2JWWA 2LANA 3R1OA 1XO5A 3BJHA 3CDNA 3NSKA 1KK7Y 2M97A 3S0BA 4HRGA 1NX0A 2A4JA 2CCMA 4OZDA 1DT7B 2G2BA 2LC5A 4DS7A 2LP2A 3BOWB 4DUQA 1TTXA 1J55A 3FE8A 3QRXA 1K2HA 1SSEB 5FI7A 2BAPA 1ORGA 1ZFSA 1CM1A 1ALVA 2GGMA 2ZNEA 3KEVA 3LK0A 1CB1A 4A4CA 3OGNA 2KQYA 1TRFA 1MUXA 2KBMA 1BR4B 1WLMA 1YX8A 1Q80A 5I2LA 1AP4A 3I5GB 2NXQA 2HQWA 2JRFA 4USLA 3UO9A 3FE9A 4CIDA 5J3XA 1SL8A 1FI6A 1W9ZA 1J1EA 1TCOB 2F8PA 2GTEA 2M49B 1VRKA 1SRAA 1MF8B 2KGBC 1YRTB 2JTTA 1KQVA 1OOHA 3AKBA 2BL0B 1Y1AA 2OS8C 2KDHA 1IKUA 4HREE 1C3YA 1S1EA 1AJ4A 4GUKA 1AK8A 5I94A 1QJTA 1WRKA 1SMGA 1YURA 2K7BA 4PE7A 2PYQA 3NGVA 1OMVA 1AJ5A 3IVTA 4DCKA 3D0YB 3B6XA 1N2DA 5IBWA 1K9KA 3E3RA 3FIAA 4HRHA 2LHLA 2IS9A 5HLOA 1CLLA 3SIAA 3WNXB 3KHEA 3VGOA 3EVVA 1Z4HA 1C07A 1DJZA 1XFZO 3PJIA 2ZN9A 1E8AA 1GGWA 1SCMC 3SS3A 1CKKA 2YGUA 1EJ3A 1LKJA 1QIVA 4GBAA 5CSJA 2WCEA 4XJKA 4YBHB 1EG4A 1OMRA 2DOQA 1CFDA 1JF0A 1S6JA 1NCZA 3JTDC 2H61A 2LV7A 5I2QA 1MQ1A 5FI2A 1CFCA 4N5XA 2LLSA 3N7HA 1TOPA 1BLQA 2K8MB 4MBEA 2O60A 3PSRA 5AXIA 3TUYC 1KWOB 1NX1A 3RM1A 1S6IA 2WCBA 1F4QA 2WORA 3BUNB 3CZ0A 1ZMZA 4PALA 3M0WA 1DC1A 1BF5A 2PALA 1RWYA 1SYMA 4P5OE 3I5IB 3GK4X 3BUMB 3TUYB 1NIWA 1XVJA 3R72A 4TNCA 1TWOA 2HPSA 1G4YR 1SR6C 3OB2B 1NPQA 2KOTA 2MBXA 2L51A 1KFUL 2BBNA 2I94A 2ZRSA 3SS5A 1CMFA 3I5HB 3QMEA 2L0PA 4INWA 1PVAA 1IJ6A 3JVTB 1XFXO 1OMDA 1X02A 1GQMA 3PN7B 1A29A 1MHOA 2OPOA 1F8HA 1DJXA 1FI5A 2GV5A 1W7JB 2K61A 4IJ7A 2M29A 1LXFC 4OVNF 5AFPA 3CS1A 5FYXA 5I2OA 5F6TA 3CWGA 1H4BA 1KK8B 1IGVA 1L2OC 2KSPA 2JTZA 4OV2A 1QX2A 2F33A 2M1UA 3TDUA 5ER5A 3PM8A 4R1EA 1K96A 1Y0VH 1SPYA 2I18A 1PSBA 1NX3A 1S26D 1DJGA 3VRPA 2EHBA 1QS7A 3D78A 2LM5A 1YVHA 4PHMA 1RK9A 3DY9A 1CMGA 2F3ZA 2KFGA 3B86A 1DQEA 4AQJA 4ORAB 3EK8A 1C7VA 2K2FA 2K60A 5ER4X 4QJ3B 2JZIA 2BCAA 5KU1A 3SG7A 3SIBA 3LL8B 2O5GA 1BODA 4I5KA 2M3WA 1YVLA 4I5JA 4UPGA 2KI4C 1KK7Z 2K0JA 4I5LB 2WCMA 1KQMB 1ZACA 2FOTA 2WCLA 3FS7A 3C1VA 4PDZA 1UP5A 5JOLA 4XJKB 3ZWHA 1XFVO 5DKQA 2MA2A 4C0KA 4PHJA 1S3PA 4YGCB 1QLKA 1XFUO 2KFHA 3DXLA 4WQ3A 3L4AA 5D7FA 3CR2A 3I5FC 1R6PA 1PK0D 1GJYA 1PSRA 4MSPA 1OOGA 5K89A 3VRQA 4WQ2A 1YUSA 1CDPA 2KBIA 2HETA 2L2CA 3VB1A 1YR5A 2LCPA 4MEWA 1QASA 3OB1B 3D74A 1UHIA 1U5IA 3BFAA 1DGUA 1WDCC 3BYAA 3B87A 1CFFA 1OOFA 1CM4A 1QLSA 4GPLB 2BNXA 1C3ZA 3O2PA 4E68A 1BMOA 1CDLA 2BKHB 3NSLA 4QJ4B 1KFXL 1MR8A 1SY9A 2LLUA 1EH2A 3EVUA 2JXLA 2LVJA 3VROA 2MAZA 3RLZA 2L4IA 3NSOA 3SG6A 1QATA 3O4YA 1B7TY 3CR4X 1S5GY 5I8NA 1B47A 2KAYA 4PT1A 4C0JA 1NUBA 5KSZA 5BPJA 1YTZC 2AUCA 2KGRA 1UHNA 1IIOA 4JQ0D 1KSOA 2LLTA 4BY4A 2LVKA 1BT6A 3CYZA 2QEHA 4GGFC 2WC6A 3KO0A 2OS8B 3SG2A 1JUOA 2P71A 1TNQA 1Y6WA 2LHIA 4M2PA 1WY9A 3SG3A 4C0LA 1DVIA 2AAOA 1WRLA 1A75A 1NWDA 1NSHA 2BBMA 1JC2A 1YRUB 1YX7A 2M0RA 2KAVA 3S0AA 1QX7A 1GM0A 2KYCA 2M8UA 2LMTA 3EG5B 4PE0A 3EKHA 2KAXA 2SCPA 3NSIA 3OBVA 4Q04A 1UURA 3EK4A 1M39A 2KHNA 1F70A 2CTNA 4PHNA 2L2EA 1IJ5A 1DGVA 1RROA 1XFWO 1DJHA 2Y1NA 1SCMB 1Y1XA 2V53A 2JPTA 2LVVA 3CR5X 2JXCA 1KFUS 2Q4UA 4ORBB 1RJVA 1DF0A 1IH0A 2WC5A 3NHTA 1NP8A 1WRZA 3H4SE 1SL7A 1Z2CB 3GK2A 3SS4A 3DVJA 1SK6D 3JTDB 1XYDA 1GGZA 4JKTA 2K7CA 4MVFA 1QTXA 3TDIA 1F71A 4YGBB 2JNFA 3BUWB 3WXAA 2BKIB 2JT8A 2OTGC 2QDIA 2RGIA 4F7FA 1RECA 1V1GA 2LE9B 4YI9A 3S0GA 3SJSA 1OZOA 3SG5A 3VRNA 2LNKA 2F2OA 1QV0A 4U8DA 3D10A 1TN4A 3K21A 1F54A 4M2QA 1U5IB 3DZTA 4KYNA 1SR6B 1C7WA 1DJIA 2OTGB 4QJ5B 3O6BA 5AANA 3VRRA 3CGAA 2L98A 4D1EA 1NCYA 4CFQA 1FW4A 5HKYA 1W7IB 1NX2A 3B88A 1BU3A 3NXAA 4N1GA 3A4UB 1BOCA 4A4BA 2JC2A 2F3YA 1OOIX 2M7LA 4GAOA
chains in the Genus database with same CATH topology
2JPOA 3Q8IA 3CABA 1OOHA 4JD9A 3DXLA 1C3YA 3K1EA 3NHIA 3L4AA 1OOGA 3NGVA 2L2CA 3VB1A 3B6XA 3D74A 3BFAA 3B87A 2ERBA 1OOFA 1C3ZA 2WCJA 3R1PA 3PJIA 3RZSA 1OW4A 3CZ2A 3BFHA 2QEBA 1T14A 4PT1A 2PQLA 3D73A 3CYZA 2QEHA 2WC6A 3R1VA 4INXA 3BFBA 2P71A 3N7HA 3FE6A 3CZ0A 3S0DA 3S0AA 3D75A 1GM0A 1LS8A 3R72A 3B7AA 2FJYA 1TWOA 3D77A 3S0EA 2KPHA 2QEVA 3QMEA 4INWA 5EL2A 2WCHA 1P28A 1TUJA 1XFRA 2WC5A 3L47A 3L4LA 3NHTA 5DICA 3DYEA 1QWVA 2WCKA 3R1OA 3BJHA 3CDNA 3S0BA 3S0FA 2QDIA 4F7FA 4OZDA 3S0GA 3D78A 2H8VA 3DZTA 3DY9A 3B86A 1DQEA 3FE8A 1ORGA 4FQTA 3V2LA 2QEOA 3OGNA 3CZ1A 3D76A 3B88A 3FE9A 2WCMA 2WCLA 2P70A 2GTEA 1OOIX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPO A;  3Q8I A;  3CAB A;  1OOH A;  4JD9 A;  3DXL A;  1C3Y A;  3K1E A;  3NHI A;  3L4A A;  1OOG A;  3NGV A;  2L2C A;  3VB1 A;  3B6X A;  3D74 A;  3BFA A;  3B87 A;  2ERB A;  1OOF A;  1C3Z A;  2WCJ A;  3R1P A;  3PJI A;  3RZS A;  1OW4 A;  3CZ2 A;  3BFH A;  2QEB A;  1T14 A;  4PT1 A;  2PQL A;  3D73 A;  3CYZ A;  2QEH A;  2WC6 A;  3R1V A;  4INX A;  3BFB A;  2P71 A;  3N7H A;  3FE6 A;  3CZ0 A;  3S0D A;  3S0A A;  3D75 A;  1GM0 A;  1LS8 A;  3R72 A;  3B7A A;  2FJY A;  1TWO A;  3D77 A;  3S0E A;  2KPH A;  2QEV A;  3QME A;  4INW A;  5EL2 A;  2WCH A;  1P28 A;  1TUJ A;  1XFR A;  2WC5 A;  3L47 A;  3L4L A;  3NHT A;  5DIC A;  3DYE A;  1QWV A;  2WCK A;  3R1O A;  3BJH A;  3CDN A;  3S0B A;  3S0F A;  2QDI A;  4F7F A;  4OZD A;  3S0G A;  3D78 A;  2H8V A;  3DZT A;  3DY9 A;  3B86 A;  1DQE A;  3FE8 A;  1ORG A;  4FQT A;  3V2L A;  2QEO A;  3OGN A;  3CZ1 A;  3D76 A;  3B88 A;  3FE9 A;  2WCM A;  2WCL A;  2P70 A;  2GTE A;  1OOI X; 
#chains in the Genus database with same CATH topology
 2JPO A;  1UHH A;  3Q8I A;  2E30 A;  3CAB A;  4P2Y B;  5CPV A;  4GGF A;  4CPV A;  1AVS A;  4JD9 A;  2KLE A;  1JFK A;  1DJW A;  1L7Z A;  4DIR A;  2NLN A;  3K1E A;  1HQV A;  3KF9 A;  3NHI A;  3LCP C;  1MWN A;  1L2O B;  1OQP A;  1M31 A;  1AUI B;  2L5Y A;  1A75 B;  1LA3 A;  4YRU A;  2SAS A;  1B8R A;  4IL1 A;  2H2K A;  1XK4 C;  3LK1 A;  3EVR A;  1ZOT B;  1G8I A;  1CLB A;  2ZRT A;  1B1G A;  1DEL A;  5D3O A;  1EG3 A;  4MLW A;  1AHR A;  1PUL A;  4NDB A;  3D0Y A;  3AAK A;  1K95 A;  2WCJ A;  2KI6 C;  1J7P A;  5HYD A;  1OW4 A;  1BJF A;  2E6W A;  3CZ2 A;  3EKJ A;  3OX5 A;  1KFX S;  1DEK A;  1BG1 A;  1KSM A;  2HQ8 A;  2KI4 B;  5GQQ C;  1DF0 B;  2FCD A;  1T14 A;  5PAL A;  3KPX A;  3HCM A;  2ZN8 A;  2LMU A;  1IQ5 A;  3BUO B;  2EC6 C;  5HLV A;  4ORC B;  1B8L A;  3R1V A;  4FTG A;  4INX A;  3CTN A;  1S6C A;  1SCV A;  3I5F B;  1SL9 A;  1UUS A;  4MZK A;  1ZUZ A;  2K7D A;  2KFF A;  3IF7 A;  4M2O A;  2PRU A;  1B8C A;  2LVI A;  3DF0 A;  4YGD B;  4ZCV A;  3FE6 A;  1QVI Z;  1CFP A;  2MHH A;  1DTL A;  1JWD A;  2GGZ A;  1A2X A;  1G33 A;  2KQ6 A;  3DVK A;  4YGE B;  3DD4 A;  1UHK A;  1CNP A;  1LVC D;  1B7T Z;  2CBL A;  3MSE B;  5D69 A;  1S5G Z;  1CDN A;  2CXJ A;  2K2A A;  2PMY A;  3OHM B;  3PFV A;  1QVI Y;  1WDC B;  4ZCU A;  2EGD A;  3BQ3 A;  3SG4 A;  3D77 A;  1D1O A;  2JT0 A;  2BE6 A;  2MRD A;  3ZNI A;  2QEV A;  1SW8 A;  2P6B B;  1M46 A;  3WHU B;  3I5G C;  1TUJ A;  2NZ0 A;  3WHT B;  1B9A A;  1DJY A;  1MXL C;  1TIZ A;  5DKR A;  1SNL A;  2Y1M A;  2ZKM X;  5DIC A;  3PAL A;  3EK7 A;  5CSI A;  1K93 D;  1Y1U A;  2KYF A;  1YUU A;  1QWV A;  2QPT A;  2WND A;  1B4C A;  2WCK A;  2BL0 C;  1QX5 B;  2PAS A;  1LA0 A;  4PE1 A;  3CZT X;  3PLF B;  1EL4 A;  5DKN A;  1PVB A;  2BEC A;  1FBV A;  1RFJ A;  5KTY A;  4MRX A;  4L9M A;  4XYN A;  1JBA A;  4NDC A;  1SBJ A;  3S0F A;  2CT9 A;  2LMV A;  4OR9 B;  4PHK A;  5G08 A;  1H8B A;  1XK4 A;  4YI8 A;  5CSN A;  1J7O A;  1HT9 A;  2FJU B;  1TCF A;  5HL1 A;  3IQO A;  2H8V A;  4PE4 A;  2L5X B;  2PVB A;  2B1U A;  2LAP A;  3DVE A;  1K90 D;  4MZJ A;  1RTP 1;  4FQT A;  1SKT A;  1R2U A;  3V2L A;  1YUT A;  2QEO A;  3FWC A;  3IQQ A;  3CZ1 A;  3D76 A;  1K9U A;  4AOM A;  2Y4Q A;  2BCX A;  2P70 A;  3A8R A;  1ODB A;  1KCY A;  4MN0 A;  3OX6 A;  1TUZ A;  1N0Y A;  2MLE C;  4PCW A;  4CLN A;  2MJW B;  1DMO A;  4N1F A;  3PAT A;  2M1K B;  1QXP A;  2WC8 A;  4GNK B;  2COL B;  3TZ1 A;  4HSZ A;  2CNP A;  2L50 A;  1FPW A;  4MZL A;  1CTR A;  3DF0 B;  1J1D A;  1KWO C;  4DRW A;  2FCE A;  1V1F A;  3AKA A;  1M45 A;  3GOF A;  3FWB A;  3LLE A;  1OE9 B;  1QV1 A;  2BE4 A;  2JQ6 A;  3I5I C;  5HKZ A;  5AER A;  1UWO A;  2NCO A;  4WRI A;  2JNX A;  2WOS A;  3BXK A;  3BOW A;  5JJG A;  1TNW A;  1K8U A;  2ERB A;  4OCI A;  2D8N A;  4YGA A;  3R1P A;  2AMI A;  2HF5 A;  2KLD A;  2BCB A;  2JOJ A;  2R2I A;  2ZND A;  1NYA A;  3RZS A;  2Q91 A;  2TN4 A;  3I5H C;  3OP0 A;  1XA5 A;  5AEQ A;  4BY5 A;  4OKH A;  2LUC A;  3HX4 A;  5CSF A;  2KI6 D;  1F55 A;  1OOJ A;  1F4O A;  3BFH A;  3JVT C;  2QEB A;  1M63 B;  3DVM A;  1IG5 A;  1WLZ A;  3O4X A;  2PQL A;  3PN7 C;  1IQ3 A;  2M7N A;  4GFT A;  1J7R A;  5HKW A;  4NDD A;  4CFR A;  1A4P A;  3D73 A;  4JWQ A;  3BFB A;  1N65 A;  4ICB A;  1MXE A;  4F0Z B;  1KK8 C;  3AAJ A;  1CLM A;  2M9G A;  1OZS A;  2WCF A;  2PSR A;  4I5N B;  3PM2 A;  2ISD A;  2LP3 A;  3S0D A;  4ETO A;  3F45 A;  1PAL A;  5B8I B;  4GGN A;  2I7A A;  2NCP A;  3O78 A;  3D75 A;  2I2R E;  2JU0 A;  4AQI A;  2KNE A;  1LS8 A;  2G9B A;  3GK1 A;  2JUL A;  3B7A A;  1PRW A;  1TNX A;  1QIW A;  2FJY A;  2ZFD A;  1XFY O;  2JT3 A;  1FF1 A;  1IWQ A;  4FQO A;  2KPH A;  5FI6 A;  3S0E A;  1BR1 B;  3TS5 C;  1K9P A;  1OSA A;  1NCX A;  2L4H A;  3ICB A;  3BUX B;  3TDZ A;  1JSA A;  1S36 A;  1EXR A;  5EL2 A;  2WCH A;  3TS5 B;  1P28 A;  1JF2 A;  1XFR A;  2MLF C;  2Y5I A;  4NQG A;  1A03 A;  1JFJ A;  3CLN A;  1KQM C;  3L4L A;  3L47 A;  2F2P A;  1J7Q A;  1CDM A;  1TNP A;  3DYE A;  5TNC A;  1UHJ A;  2VRG A;  1K94 A;  1LIN A;  1IRJ A;  2LUX A;  2QAC A;  2K7O A;  4JPZ B;  2H61 C;  4MRY A;  1ALW A;  2EC6 B;  3UNW A;  2JWW A;  2LAN A;  3R1O A;  1XO5 A;  3BJH A;  3CDN A;  3NSK A;  1KK7 Y;  2M97 A;  3S0B A;  4HRG A;  1NX0 A;  2A4J A;  2CCM A;  4OZD A;  1DT7 B;  2G2B A;  2LC5 A;  4DS7 A;  2LP2 A;  3BOW B;  4DUQ A;  1TTX A;  1J55 A;  3FE8 A;  3QRX A;  1K2H A;  1SSE B;  5FI7 A;  2BAP A;  1ORG A;  1ZFS A;  1CM1 A;  1ALV A;  2GGM A;  2ZNE A;  3KEV A;  3LK0 A;  1CB1 A;  4A4C A;  3OGN A;  2KQY A;  1TRF A;  1MUX A;  2KBM A;  1BR4 B;  1WLM A;  1YX8 A;  1Q80 A;  5I2L A;  1AP4 A;  3I5G B;  2NXQ A;  2HQW A;  2JRF A;  4USL A;  3UO9 A;  3FE9 A;  4CID A;  5J3X A;  1SL8 A;  1FI6 A;  1W9Z A;  1J1E A;  1TCO B;  2F8P A;  2GTE A;  2M49 B;  1VRK A;  1SRA A;  1MF8 B;  2KGB C;  1YRT B;  2JTT A;  1KQV A;  1OOH A;  3AKB A;  2BL0 B;  1Y1A A;  2OS8 C;  2KDH A;  1IKU A;  4HRE E;  1C3Y A;  1S1E A;  1AJ4 A;  4GUK A;  1AK8 A;  5I94 A;  1QJT A;  1WRK A;  1SMG A;  1YUR A;  2K7B A;  4PE7 A;  2PYQ A;  3NGV A;  1OMV A;  1AJ5 A;  3IVT A;  4DCK A;  3D0Y B;  3B6X A;  1N2D A;  5IBW A;  1K9K A;  3E3R A;  3FIA A;  4HRH A;  2LHL A;  2IS9 A;  5HLO A;  1CLL A;  3SIA A;  3WNX B;  3KHE A;  3VGO A;  3EVV A;  1Z4H A;  1C07 A;  1DJZ A;  1XFZ O;  3PJI A;  2ZN9 A;  1E8A A;  1GGW A;  1SCM C;  3SS3 A;  1CKK A;  2YGU A;  1EJ3 A;  1LKJ A;  1QIV A;  4GBA A;  5CSJ A;  2WCE A;  4XJK A;  4YBH B;  1EG4 A;  1OMR A;  2DOQ A;  1CFD A;  1JF0 A;  1S6J A;  1NCZ A;  3JTD C;  2H61 A;  2LV7 A;  5I2Q A;  1MQ1 A;  5FI2 A;  1CFC A;  4N5X A;  2LLS A;  3N7H A;  1TOP A;  1BLQ A;  2K8M B;  4MBE A;  2O60 A;  3PSR A;  5AXI A;  3TUY C;  1KWO B;  1NX1 A;  3RM1 A;  1S6I A;  2WCB A;  1F4Q A;  2WOR A;  3BUN B;  3CZ0 A;  1ZMZ A;  4PAL A;  3M0W A;  1DC1 A;  1BF5 A;  2PAL A;  1RWY A;  1SYM A;  4P5O E;  3I5I B;  3GK4 X;  3BUM B;  3TUY B;  1NIW A;  1XVJ A;  3R72 A;  4TNC A;  1TWO A;  2HPS A;  1G4Y R;  1SR6 C;  3OB2 B;  1NPQ A;  2KOT A;  2MBX A;  2L51 A;  1KFU L;  2BBN A;  2I94 A;  2ZRS A;  3SS5 A;  1CMF A;  3I5H B;  3QME A;  2L0P A;  4INW A;  1PVA A;  1IJ6 A;  3JVT B;  1XFX O;  1OMD A;  1X02 A;  1GQM A;  3PN7 B;  1A29 A;  1MHO A;  2OPO A;  1F8H A;  1DJX A;  1FI5 A;  2GV5 A;  1W7J B;  2K61 A;  4IJ7 A;  2M29 A;  1LXF C;  4OVN F;  5AFP A;  3CS1 A;  5FYX A;  5I2O A;  5F6T A;  3CWG A;  1H4B A;  1KK8 B;  1IGV A;  1L2O C;  2KSP A;  2JTZ A;  4OV2 A;  1QX2 A;  2F33 A;  2M1U A;  3TDU A;  5ER5 A;  3PM8 A;  4R1E A;  1K96 A;  1Y0V H;  1SPY A;  2I18 A;  1PSB A;  1NX3 A;  1S26 D;  1DJG A;  3VRP A;  2EHB A;  1QS7 A;  3D78 A;  2LM5 A;  1YVH A;  4PHM A;  1RK9 A;  3DY9 A;  1CMG A;  2F3Z A;  2KFG A;  3B86 A;  1DQE A;  4AQJ A;  4ORA B;  3EK8 A;  1C7V A;  2K2F A;  2K60 A;  5ER4 X;  4QJ3 B;  2JZI A;  2BCA A;  5KU1 A;  3SG7 A;  3SIB A;  3LL8 B;  2O5G A;  1BOD A;  4I5K A;  2M3W A;  1YVL A;  4I5J A;  4UPG A;  2KI4 C;  1KK7 Z;  2K0J A;  4I5L B;  2WCM A;  1KQM B;  1ZAC A;  2FOT A;  2WCL A;  3FS7 A;  3C1V A;  4PDZ A;  1UP5 A;  5JOL A;  4XJK B;  3ZWH A;  1XFV O;  5DKQ A;  2MA2 A;  4C0K A;  4PHJ A;  1S3P A;  4YGC B;  1QLK A;  1XFU O;  2KFH A;  3DXL A;  4WQ3 A;  3L4A A;  5D7F A;  3CR2 A;  3I5F C;  1R6P A;  1PK0 D;  1GJY A;  1PSR A;  4MSP A;  1OOG A;  5K89 A;  3VRQ A;  4WQ2 A;  1YUS A;  1CDP A;  2KBI A;  2HET A;  2L2C A;  3VB1 A;  1YR5 A;  2LCP A;  4MEW A;  1QAS A;  3OB1 B;  3D74 A;  1UHI A;  1U5I A;  3BFA A;  1DGU A;  1WDC C;  3BYA A;  3B87 A;  1CFF A;  1OOF A;  1CM4 A;  1QLS A;  4GPL B;  2BNX A;  1C3Z A;  3O2P A;  4E68 A;  1BMO A;  1CDL A;  2BKH B;  3NSL A;  4QJ4 B;  1KFX L;  1MR8 A;  1SY9 A;  2LLU A;  1EH2 A;  3EVU A;  2JXL A;  2LVJ A;  3VRO A;  2MAZ A;  3RLZ A;  2L4I A;  3NSO A;  3SG6 A;  1QAT A;  3O4Y A;  1B7T Y;  3CR4 X;  1S5G Y;  5I8N A;  1B47 A;  2KAY A;  4PT1 A;  4C0J A;  1NUB A;  5KSZ A;  5BPJ A;  1YTZ C;  2AUC A;  2KGR A;  1UHN A;  1IIO A;  4JQ0 D;  1KSO A;  2LLT A;  4BY4 A;  2LVK A;  1BT6 A;  3CYZ A;  2QEH A;  4GGF C;  2WC6 A;  3KO0 A;  2OS8 B;  3SG2 A;  1JUO A;  2P71 A;  1TNQ A;  1Y6W A;  2LHI A;  4M2P A;  1WY9 A;  3SG3 A;  4C0L A;  1DVI A;  2AAO A;  1WRL A;  1A75 A;  1NWD A;  1NSH A;  2BBM A;  1JC2 A;  1YRU B;  1YX7 A;  2M0R A;  2KAV A;  3S0A A;  1QX7 A;  1GM0 A;  2KYC A;  2M8U A;  2LMT A;  3EG5 B;  4PE0 A;  3EKH A;  2KAX A;  2SCP A;  3NSI A;  3OBV A;  4Q04 A;  1UUR A;  3EK4 A;  1M39 A;  2KHN A;  1F70 A;  2CTN A;  4PHN A;  2L2E A;  1IJ5 A;  1DGV A;  1RRO A;  1XFW O;  1DJH A;  2Y1N A;  1SCM B;  1Y1X A;  2V53 A;  2JPT A;  2LVV A;  3CR5 X;  2JXC A;  1KFU S;  2Q4U A;  4ORB B;  1RJV A;  1DF0 A;  1IH0 A;  2WC5 A;  3NHT A;  1NP8 A;  1WRZ A;  3H4S E;  1SL7 A;  1Z2C B;  3GK2 A;  3SS4 A;  3DVJ A;  1SK6 D;  3JTD B;  1XYD A;  1GGZ A;  4JKT A;  2K7C A;  4MVF A;  1QTX A;  3TDI A;  1F71 A;  4YGB B;  2JNF A;  3BUW B;  3WXA A;  2BKI B;  2JT8 A;  2OTG C;  2QDI A;  2RGI A;  4F7F A;  1REC A;  1V1G A;  2LE9 B;  4YI9 A;  3S0G A;  3SJS A;  1OZO A;  3SG5 A;  3VRN A;  2LNK A;  2F2O A;  1QV0 A;  4U8D A;  3D10 A;  1TN4 A;  3K21 A;  1F54 A;  4M2Q A;  1U5I B;  3DZT A;  4KYN A;  1SR6 B;  1C7W A;  1DJI A;  2OTG B;  4QJ5 B;  3O6B A;  5AAN A;  3VRR A;  3CGA A;  2L98 A;  4D1E A;  1NCY A;  4CFQ A;  1FW4 A;  5HKY A;  1W7I B;  1NX2 A;  3B88 A;  1BU3 A;  3NXA A;  4N1G A;  3A4U B;  1BOC A;  4A4B A;  2JC2 A;  2F3Y A;  1OOI X;  2M7L A;  4GAO A; 
#chains in the Genus database with same CATH homology
 2JPO A;  3Q8I A;  3CAB A;  1OOH A;  4JD9 A;  3DXL A;  1C3Y A;  3K1E A;  3NHI A;  3L4A A;  1OOG A;  3NGV A;  2L2C A;  3VB1 A;  3B6X A;  3D74 A;  3BFA A;  3B87 A;  2ERB A;  1OOF A;  1C3Z A;  2WCJ A;  3R1P A;  3PJI A;  3RZS A;  1OW4 A;  3CZ2 A;  3BFH A;  2QEB A;  1T14 A;  4PT1 A;  2PQL A;  3D73 A;  3CYZ A;  2QEH A;  2WC6 A;  3R1V A;  4INX A;  3BFB A;  2P71 A;  3N7H A;  3FE6 A;  3CZ0 A;  3S0D A;  3S0A A;  3D75 A;  1GM0 A;  1LS8 A;  3R72 A;  3B7A A;  2FJY A;  1TWO A;  3D77 A;  3S0E A;  2KPH A;  2QEV A;  3QME A;  4INW A;  5EL2 A;  2WCH A;  1P28 A;  1TUJ A;  1XFR A;  2WC5 A;  3L47 A;  3L4L A;  3NHT A;  5DIC A;  3DYE A;  1QWV A;  2WCK A;  3R1O A;  3BJH A;  3CDN A;  3S0B A;  3S0F A;  2QDI A;  4F7F A;  4OZD A;  3S0G A;  3D78 A;  2H8V A;  3DZT A;  3DY9 A;  3B86 A;  1DQE A;  3FE8 A;  1ORG A;  4FQT A;  3V2L A;  2QEO A;  3OGN A;  3CZ1 A;  3D76 A;  3B88 A;  3FE9 A;  2WCM A;  2WCL A;  2P70 A;  2GTE A;  1OOI X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...