3D76A

Crystal structure of a pheromone binding protein mutant d35n, from apis mellifera, soaked at ph 7.0
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
116
structure length
116
Chain Sequence
WVPPEVFDLVAEDKARCMSEHGTTQAQIDDVNKGNLVNEPSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone binding protein
molecule keywords Pheromone-binding protein ASP1
publication title Queen bee pheromone binding protein pH-induced domain swapping favors pheromone release
pubmed doi rcsb
source organism Apis mellifera
total genus 37
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3d76A00
3D78A 1OW4A 3CDNA 1OOFA 2P70A 3DZTA 3S0DA 2QEHA 3OGNA 4OZDA 3L4LA 3B6XA 3S0GA 3BFAA 3S0FA 4F7FA 3RZSA 1ORGA 1C3YA 3FE8A 1T14A 3D77A 1OOHA 2JPOA 1OOGA 3D74A 3CZ0A 3D73A 2QDIA 1XFRA 3DXLA 3V2LA 2PQLA 3K1EA 5DICA 2WCHA 3B86A 3NHTA 2FJYA 3BJHA 3D76A 2QEBA 3DY9A 1TWOA 2P71A 1DQEA 2WCKA 3D75A 2ERBA 3L47A 2WCMA 2WC5A 3B87A 4JD9A 2QEVA 3CZ2A 2H8VA 3FE9A 3R1OA 3FE6A 2WCJA 3NGVA 2WCLA 4INWA 3R72A 1C3ZA 3R1VA 3PJIA 2WC6A 3N7HA 3R1PA 1GM0A 3NHIA 3CYZA 2GTEA 2QEOA 4PT1A 3BFHA 1LS8A 3L4AA 3CZ1A 2KPHA 4INXA 3S0AA 1QWVA 2L2CA 3Q8IA 4FQTA 1OOIX 3BFBA 3B7AA 5EL2A 3S0BA 3DYEA 3QMEA 1TUJA 3B88A 1P28A 3S0EA 3CABA 3VB1A
chains in the Genus database with same CATH superfamily
1OQPA 3CDNA 2F3YA 5K89A 1OOFA 3SJSA 4PHKA 1B7TZ 1DELA 4MLWA 3EVUA 4HRHA 2KI4B 2SCPA 1BT6A 4N5XA 4YI8A 1SL8A 1J7PA 5G08A 4OZDA 4CPVA 2LHIA 3L4LA 2NLNA 3O4XA 2BAPA 3WNXB 5JOLA 3SG4A 2M7NA 4F0ZB 1JBAA 1N2DA 1DJZA 3PM2A 1KQMC 4M2QA 2F3ZA 1DJHA 1M63B 1CFPA 1WDCC 2AUCA 1DEKA 5IBWA 1B8RA 2JT0A 3RZSA 1T14A 3OHMB 5FI7A 1V1FA 1KK7Z 2JXLA 2LM5A 1J7OA 4YGCB 1TN4A 2KFFA 3H4SE 1S26D 1NCZA 1YRUB 3JVTC 1L2OC 2EC6C 3AKAA 3BUOB 4GAOA 3DXLA 4BY5A 1F70A 1NP8A 2PVBA 2ZFDA 2LVIA 2KAVA 1SR6B 3O2PA 1R6PA 4ORAB 5HYDA 2OTGC 3B86A 2Y1MA 1RROA 2QPTA 3E3RA 4YGEB 1TIZA 1C07A 1L7ZA 1MWNA 3HCMA 2M9GA 1Z2CB 1NUBA 3TZ1A 1EG4A 1BJFA 1CKKA 1M39A 2M97A 2Y4QA 1NSHA 3SG3A 2QEBA 1CDLA 5CSJA 1XFXO 1F4OA 1TWOA 4I5JA 1K9PA 3DF0B 5I2QA 2ZKMX 3A4UB 3LL8B 1OZOA 3TDZA 1UHJA 1NX1A 2ERBA 1QJTA 2LCPA 3VRNA 3D10A 1F8HA 1B4CA 1WLMA 1ZMZA 2WC5A 2VRGA 4QJ3B 3PSRA 5I2OA 1FBVA 2FJUB 2H8VA 3FE9A 3OB2B 1F55A 1MF8B 4C0JA 1SNLA 4WRIA 3VRQA 1G33A 4R1EA 4OCIA 1W7IB 2PASA 2KHNA 5KTYA 1SY9A 1K2HA 2JPTA 2ZNDA 1EXRA 4ORCB 3R72A 4DUQA 1C3ZA 2P6BB 4YBHB 3PJIA 1AUIB 3AKBA 1K95A 1SSEB 3I5IC 3N7HA 1OE9B 1NIWA 4ETOA 2FCDA 4XYNA 1BMOA 2L0PA 4GGNA 3KF9A 4PHJA 3EK4A 3L4AA 2LUCA 3BUXB 1KQMB 2CBLA 3I5HC 3S0AA 1IJ6A 4OR9B 2BL0B 1UURA 3CLNA 1WDCB 2ZN9A 1TRFA 2JQ6A 2LMVA 2GGZA 4MBEA 3OP0A 1A03A 2K60A 2WORA 1EH2A 2BBMA 2V53A 1DJXA 4JKTA 4PALA 3BXKA 1QLSA 3SS3A 2TN4A 2YGUA 3DYEA 2FOTA 2ZN8A 2EC6B 2R2IA 3JVTB 4CLNA 5HLOA 1KSMA 2F2OA 1J1EA 3BOWA 2GGMA 2BCAA 3CABA 2JWWA 4HRGA 3VB1A 1K96A 1K94A 1K90D 1XK4A 2KQYA 2LVKA 4CFRA 2OTGB 3CGAA 2LLUA 2Q91A 3DZTA 4C0KA 1ALVA 5ER4X 2L5YA 1UHHA 2BBNA 4JPZB 1J7QA 4GBAA 1BG1A 1YURA 1AVSA 1W9ZA 2DOQA 1M45A 5I8NA 1KFUL 1MHOA 1IJ5A 3BFAA 3S0FA 1B8CA 2LANA 3EK8A 5CSIA 4QJ4B 3PATA 1YVHA 4F7FA 1BR1B 1LKJA 2WC8A 2WNDA 1F54A 2I18A 4WQ2A 1A4PA 4MVFA 3FE8A 3D77A 3PALA 1XK4C 1CLMA 3MSEB 4MRYA 2KAYA 1OOGA 3SG5A 4WQ3A 1DJYA 1RJVA 3CZ0A 1C7WA 2QDIA 1XFRA 1SKTA 1M46A 1OMDA 1S36A 2D8NA 3RM1A 2HQWA 1Y1AA 3C1VA 3EKJA 2KBIA 1QIVA 5DICA 2I94A 1OSAA 1AP4A 1CM1A 2JOJA 5D69A 1J1DA 2L4IA 1PRWA 3TS5B 4HSZA 2CXJA 3WHTB 2JXCA 2K7CA 4PE1A 3D76A 4PE0A 1WRZA 4JWQA 2CT9A 2KYCA 1S6JA 1NX0A 3I5IB 4DRWA 1JFJA 2PRUA 2BL0C 4BY4A 2H61A 1CFFA 2KI6D 1CMGA 1MXEA 1CDNA 1CFDA 2OPOA 5JJGA 1KWOB 2M29A 1IWQA 3BUMB 3WXAA 5KU1A 1DQEA 2P71A 5AXIA 3ZWHA 1XFWO 1DVIA 3BUWB 2WCKA 3VRPA 3I5HB 5I94A 2M1KB 3AAKA 2MHHA 3ZNIA 1AHRA 4U8DA 1Y1XA 2OS8B 2LUXA 1S6CA 4JD9A 1VRKA 2M8UA 2QEVA 3CZ2A 5FYXA 3TUYC 3PM8A 2HETA 3R1OA 4Q04A 4ZCUA 3FE6A 1JC2A 1JF0A 2MLFC 2AMIA 1S6IA 4NDCA 1DTLA 1JWDA 1TNQA 4INWA 3CS1A 1B47A 2M49B 4YGBB 3NSIA 4I5NB 1RWYA 1UWOA 1H8BA 2Y5IA 1SYMA 3NHIA 1QXPA 4OV2A 1LINA 2E30A 3CYZA 3DVJA 2M7LA 1Y0VH 1KFUS 4MEWA 5TNCA 2JULA 2GTEA 1SW8A 2L5XB 3VROA 1YUSA 2LP2A 1LS8A 2K7BA 4INXA 2NZ0A 1SRAA 1CNPA 3M0WA 2L2CA 3BOWB 1TCFA 4PDZA 1FPWA 4IJ7A 1RFJA 3I5GB 2K2AA 1ZUZA 3EVVA 3B7AA 1K93D 4AOMA 5KSZA 3TS5C 1JUOA 3LCPC 3NXAA 1V1GA 4M2OA 3QMEA 1DT7B 3O78A 1QS7A 1TUJA 3B88A 2MJWB 2RGIA 3HX4A 1XYDA 2LLSA 3FWBA 1FI5A 3D78A 2WCFA 2L2EA 4FTGA 3TDIA 3UO9A 2JNFA 3OBVA 2BNXA 3NSKA 3S0DA 2E6WA 1KWOC 4GFTA 3JTDC 2LC5A 4UPGA 1XFYO 4YI9A 1YTZC 1SPYA 4HREE 4NDDA 3CR4X 1UHKA 1U5IA 3KO0A 2OS8C 2KFGA 3S0GA 1NWDA 3NSLA 1NYAA 1DJIA 3FIAA 2L98A 3ICBA 1TUZA 3LK0A 1FF1A 3IQQA 1C3YA 4QJ5B 1OOHA 1YR5A 5F6TA 3BQ3A 4XJKA 1JF2A 1LA3A 3PLFB 4PHMA 5I2LA 1CTRA 2L50A 1MXLC 3PN7B 2LVVA 3FWCA 2BKIB 1CLBA 1G4YR 1TNPA 4GPLB 1RECA 2L4HA 3TUYB 3V2LA 1LVCD 3IF7A 3K1EA 1M31A 1WRLA 3OX6A 1D1OA 2WCHA 1IRJA 3I5FB 2KFHA 2F2PA 2IS9A 3WHUB 4YGAA 1DF0A 3DVKA 3D0YA 2KI6C 1QV1A 5DKRA 2BCXA 3F45A 2KOTA 3VGOA 2O60A 1PSRA 1OZSA 1KQVA 5B8IB 1Y1UA 5DKNA 2CNPA 3VRRA 1K8UA 1CMFA 1KSOA 1MQ1A 1NPQA 2KBMA 3DY9A 3LK1A 1YRTB 1KK8B 3I5GC 4CIDA 1CFCA 2PALA 1QVIY 1TTXA 2WCBA 2EGDA 1RK9A 1S3PA 1A75A 2JU0A 2FCEA 2PYQA 3EVRA 1LA0A 1AK8A 1EL4A 1BU3A 1A2XA 2PMYA 2LMUA 1Q80A 3D75A 3L47A 1BODA 4AQJA 3O6BA 3SS4A 1WLZA 2BE4A 3CZTX 3UNWA 3B87A 4MZJA 1RTP1 1QASA 2K61A 1YVLA 2G2BA 1CDMA 1IKUA 2LV7A 5AANA 1GJYA 5AEQA 1NX2A 3EKHA 1SL7A 1SCMC 3KEVA 3SIAA 4N1GA 3NGVA 2MAZA 2Y1NA 3DVEA 1CDPA 4L9MA 1CM4A 3A8RA 3CTNA 1LXFC 2A4JA 1HQVA 1JSAA 1QATA 1UHNA 2JTZA 2ZRTA 3R1PA 1GM0A 1DGUA 4P2YB 4D1EA 2L51A 5AFPA 1QTXA 1UP5A 3JTDB 2KNEA 2LMTA 1AJ5A 4I5LB 2LNKA 3BFHA 4DIRA 3GK2A 5AERA 2KGBC 3PN7C 2KPHA 4OKHA 5BPJA 1CB1A 2LP3A 1YUUA 5HLVA 3SG6A 1IH0A 1XA5A 3SG7A 1BF5A 1XFUO 1IIOA 4KYNA 1OMVA 1OOIX 1KFXL 1MR8A 1SBJA 1E8AA 2H61C 3BFBA 1FI6A 2I2RE 1DJWA 5EL2A 3I5FC 1B8LA 5D7FA 3QRXA 1IQ5A 1DGVA 1QV0A 4PE7A 4E68A 3CWGA 1QVIZ 2ISDA 3SIBA 2K2FA 2M1UA 1XO5A 1P28A 2M0RA 3FS7A 1XFVO 2BCBA 1SCVA 2JC2A 1ZOTB 1OW4A 1UUSA 2CCMA 4NQGA 2ZNEA 1TCOB 2B1UA 4JQ0D 1U5IB 4MN0A 4YGDB 2KAXA 3GK1A 2P70A 1F4QA 2QEHA 1KK8C 1UHIA 4A4CA 1XFZO 3OGNA 4ICBA 5ER5A 5PALA 3RLZA 5FI6A 3DVMA 2KQ6A 4YRUA 3B6XA 4XJKB 1PSBA 3PFVA 5GQQC 2LVJA 4DS7A 1S1EA 1TNWA 5FI2A 1YX8A 4OVNF 5DKQA 4PCWA 3K21A 1A29A 2K7OA 1ORGA 1TOPA 5CSFA 1PALA 3BYAA 1J55A 1NCYA 2F8PA 1S5GY 1G8IA 2O5GA 2JPOA 3NSOA 2LLTA 1DF0B 1IQ3A 1QX2A 2JTTA 3AAJA 3D0YB 5CPVA 2JNXA 3D74A 3GK4X 3SG2A 1BOCA 1W7JB 2NXQA 4TNCA 3D73A 1TNXA 3KPXA 2NCPA 2PQLA 1BR4B 2MRDA 4MZKA 1QX5B 2HQ8A 1SCMB 2KYFA 5D3OA 1EJ3A 3EK7A 4GNKB 4IL1A 4PE4A 5CSNA 5HKWA 1GGWA 4A4BA 1AJ4A 1B9AA 2NCOA 3NHTA 2KLEA 2FJYA 1N65A 3BJHA 2HF5A 2KI4C 3IQOA 3OX5A 1A75B 5HL1A 2QACA 4ORBB 1DMOA 2F33A 1ODBA 5HKZA 4ZCVA 1J7RA 2G9BA 2KGRA 4AQIA 5J3XA 1EG3A 1GQMA 1QIWA 1ZACA 1ALWA 4USLA 2MBXA 5HKYA 1OOJA 2KSPA 1WY9A 3O4YA 1KFXS 1QLKA 2BKHB 4NDBA 4PHNA 1SK6D 2JT8A 2K8MB 2WCMA 4I5KA 1B7TY 1N0YA 4DCKA 1PULA 3DF0A 1Z4HA 2H2KA 1WRKA 1SR6C 2WCEA 3IVTA 2WCJA 4C0LA 1SMGA 2K0JA 2LAPA 2LHLA 2M3WA 2WCLA 1XVJA 1IG5A 2PSRA 3BUNB 4GGFA 1KCYA 1S5GZ 1L2OB 3R1VA 1CLLA 3CR2A 2Q4UA 1R2UA 2WC6A 2ZRSA 1SL9A 1BLQA 2JZIA 2JRFA 1F71A 3GOFA 1DJGA 4MRXA 3TDUA 4CFQA 1B1GA 3CR5X 1KK7Y 2GV5A 2HPSA 2AAOA 3EG5B 2QEOA 4PT1A 2BE6A 1PVBA 2BECA 1FW4A 3KHEA 1QX7A 1H4BA 1K9KA 1ZFSA 3CZ1A 3LLEA 1YUTA 1OMRA 3SS5A 1NCXA 1QWVA 1Y6WA 2I7AA 1K9UA 2KLDA 3DD4A 4P5OE 1NX3A 4N1FA 1DC1A 3Q8IA 4GGFC 2KDHA 3OB1B 2CTNA 2SASA 4FQTA 1JFKA 2EHBA 4GUKA 1PK0D 1MUXA 1X02A 3S0BA 1HT9A 2JT3A 1YX7A 2LE9B 2MA2A 2WOSA 4FQOA 2K7DA 1IGVA 4M2PA 2MLEC 4MSPA 1C7VA 1GGZA 3S0EA 4MZLA 1PVAA 2COLB
chains in the Genus database with same CATH topology
3D78A 1OW4A 3CDNA 1OOFA 2P70A 3DZTA 3S0DA 2QEHA 3OGNA 4OZDA 3L4LA 3B6XA 3S0GA 3BFAA 3S0FA 4F7FA 3RZSA 1ORGA 1C3YA 3FE8A 1T14A 3D77A 1OOHA 2JPOA 1OOGA 3D74A 3CZ0A 3D73A 2QDIA 1XFRA 3DXLA 3V2LA 2PQLA 3K1EA 5DICA 2WCHA 3B86A 3NHTA 2FJYA 3BJHA 3D76A 2QEBA 3DY9A 1TWOA 2P71A 1DQEA 2WCKA 3D75A 2ERBA 3L47A 2WCMA 2WC5A 3B87A 4JD9A 2QEVA 3CZ2A 2H8VA 3FE9A 3R1OA 3FE6A 2WCJA 3NGVA 2WCLA 4INWA 3R72A 1C3ZA 3R1VA 3PJIA 2WC6A 3N7HA 3R1PA 1GM0A 3NHIA 3CYZA 2GTEA 2QEOA 4PT1A 3BFHA 1LS8A 3L4AA 3CZ1A 2KPHA 4INXA 3S0AA 1QWVA 2L2CA 3Q8IA 4FQTA 1OOIX 3BFBA 3B7AA 5EL2A 3S0BA 3DYEA 3QMEA 1TUJA 3B88A 1P28A 3S0EA 3CABA 3VB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D78 A;  1OW4 A;  3CDN A;  1OOF A;  2P70 A;  3DZT A;  3S0D A;  2QEH A;  3OGN A;  4OZD A;  3L4L A;  3B6X A;  3S0G A;  3BFA A;  3S0F A;  4F7F A;  3RZS A;  1ORG A;  1C3Y A;  3FE8 A;  1T14 A;  3D77 A;  1OOH A;  2JPO A;  1OOG A;  3D74 A;  3CZ0 A;  3D73 A;  2QDI A;  1XFR A;  3DXL A;  3V2L A;  2PQL A;  3K1E A;  5DIC A;  2WCH A;  3B86 A;  3NHT A;  2FJY A;  3BJH A;  3D76 A;  2QEB A;  3DY9 A;  1TWO A;  2P71 A;  1DQE A;  2WCK A;  3D75 A;  2ERB A;  3L47 A;  2WCM A;  2WC5 A;  3B87 A;  4JD9 A;  2QEV A;  3CZ2 A;  2H8V A;  3FE9 A;  3R1O A;  3FE6 A;  2WCJ A;  3NGV A;  2WCL A;  4INW A;  3R72 A;  1C3Z A;  3R1V A;  3PJI A;  2WC6 A;  3N7H A;  3R1P A;  1GM0 A;  3NHI A;  3CYZ A;  2GTE A;  2QEO A;  4PT1 A;  3BFH A;  1LS8 A;  3L4A A;  3CZ1 A;  2KPH A;  4INX A;  3S0A A;  1QWV A;  2L2C A;  3Q8I A;  4FQT A;  1OOI X;  3BFB A;  3B7A A;  5EL2 A;  3S0B A;  3DYE A;  3QME A;  1TUJ A;  3B88 A;  1P28 A;  3S0E A;  3CAB A;  3VB1 A; 
#chains in the Genus database with same CATH topology
 1OQP A;  3CDN A;  2F3Y A;  5K89 A;  1OOF A;  3SJS A;  4PHK A;  1B7T Z;  1DEL A;  4MLW A;  3EVU A;  4HRH A;  2KI4 B;  2SCP A;  1BT6 A;  4N5X A;  4YI8 A;  1SL8 A;  1J7P A;  5G08 A;  4OZD A;  4CPV A;  2LHI A;  3L4L A;  2NLN A;  3O4X A;  2BAP A;  3WNX B;  5JOL A;  3SG4 A;  2M7N A;  4F0Z B;  1JBA A;  1N2D A;  1DJZ A;  3PM2 A;  1KQM C;  4M2Q A;  2F3Z A;  1DJH A;  1M63 B;  1CFP A;  1WDC C;  2AUC A;  1DEK A;  5IBW A;  1B8R A;  2JT0 A;  3RZS A;  1T14 A;  3OHM B;  5FI7 A;  1V1F A;  1KK7 Z;  2JXL A;  2LM5 A;  1J7O A;  4YGC B;  1TN4 A;  2KFF A;  3H4S E;  1S26 D;  1NCZ A;  1YRU B;  3JVT C;  1L2O C;  2EC6 C;  3AKA A;  3BUO B;  4GAO A;  3DXL A;  4BY5 A;  1F70 A;  1NP8 A;  2PVB A;  2ZFD A;  2LVI A;  2KAV A;  1SR6 B;  3O2P A;  1R6P A;  4ORA B;  5HYD A;  2OTG C;  3B86 A;  2Y1M A;  1RRO A;  2QPT A;  3E3R A;  4YGE B;  1TIZ A;  1C07 A;  1L7Z A;  1MWN A;  3HCM A;  2M9G A;  1Z2C B;  1NUB A;  3TZ1 A;  1EG4 A;  1BJF A;  1CKK A;  1M39 A;  2M97 A;  2Y4Q A;  1NSH A;  3SG3 A;  2QEB A;  1CDL A;  5CSJ A;  1XFX O;  1F4O A;  1TWO A;  4I5J A;  1K9P A;  3DF0 B;  5I2Q A;  2ZKM X;  3A4U B;  3LL8 B;  1OZO A;  3TDZ A;  1UHJ A;  1NX1 A;  2ERB A;  1QJT A;  2LCP A;  3VRN A;  3D10 A;  1F8H A;  1B4C A;  1WLM A;  1ZMZ A;  2WC5 A;  2VRG A;  4QJ3 B;  3PSR A;  5I2O A;  1FBV A;  2FJU B;  2H8V A;  3FE9 A;  3OB2 B;  1F55 A;  1MF8 B;  4C0J A;  1SNL A;  4WRI A;  3VRQ A;  1G33 A;  4R1E A;  4OCI A;  1W7I B;  2PAS A;  2KHN A;  5KTY A;  1SY9 A;  1K2H A;  2JPT A;  2ZND A;  1EXR A;  4ORC B;  3R72 A;  4DUQ A;  1C3Z A;  2P6B B;  4YBH B;  3PJI A;  1AUI B;  3AKB A;  1K95 A;  1SSE B;  3I5I C;  3N7H A;  1OE9 B;  1NIW A;  4ETO A;  2FCD A;  4XYN A;  1BMO A;  2L0P A;  4GGN A;  3KF9 A;  4PHJ A;  3EK4 A;  3L4A A;  2LUC A;  3BUX B;  1KQM B;  2CBL A;  3I5H C;  3S0A A;  1IJ6 A;  4OR9 B;  2BL0 B;  1UUR A;  3CLN A;  1WDC B;  2ZN9 A;  1TRF A;  2JQ6 A;  2LMV A;  2GGZ A;  4MBE A;  3OP0 A;  1A03 A;  2K60 A;  2WOR A;  1EH2 A;  2BBM A;  2V53 A;  1DJX A;  4JKT A;  4PAL A;  3BXK A;  1QLS A;  3SS3 A;  2TN4 A;  2YGU A;  3DYE A;  2FOT A;  2ZN8 A;  2EC6 B;  2R2I A;  3JVT B;  4CLN A;  5HLO A;  1KSM A;  2F2O A;  1J1E A;  3BOW A;  2GGM A;  2BCA A;  3CAB A;  2JWW A;  4HRG A;  3VB1 A;  1K96 A;  1K94 A;  1K90 D;  1XK4 A;  2KQY A;  2LVK A;  4CFR A;  2OTG B;  3CGA A;  2LLU A;  2Q91 A;  3DZT A;  4C0K A;  1ALV A;  5ER4 X;  2L5Y A;  1UHH A;  2BBN A;  4JPZ B;  1J7Q A;  4GBA A;  1BG1 A;  1YUR A;  1AVS A;  1W9Z A;  2DOQ A;  1M45 A;  5I8N A;  1KFU L;  1MHO A;  1IJ5 A;  3BFA A;  3S0F A;  1B8C A;  2LAN A;  3EK8 A;  5CSI A;  4QJ4 B;  3PAT A;  1YVH A;  4F7F A;  1BR1 B;  1LKJ A;  2WC8 A;  2WND A;  1F54 A;  2I18 A;  4WQ2 A;  1A4P A;  4MVF A;  3FE8 A;  3D77 A;  3PAL A;  1XK4 C;  1CLM A;  3MSE B;  4MRY A;  2KAY A;  1OOG A;  3SG5 A;  4WQ3 A;  1DJY A;  1RJV A;  3CZ0 A;  1C7W A;  2QDI A;  1XFR A;  1SKT A;  1M46 A;  1OMD A;  1S36 A;  2D8N A;  3RM1 A;  2HQW A;  1Y1A A;  3C1V A;  3EKJ A;  2KBI A;  1QIV A;  5DIC A;  2I94 A;  1OSA A;  1AP4 A;  1CM1 A;  2JOJ A;  5D69 A;  1J1D A;  2L4I A;  1PRW A;  3TS5 B;  4HSZ A;  2CXJ A;  3WHT B;  2JXC A;  2K7C A;  4PE1 A;  3D76 A;  4PE0 A;  1WRZ A;  4JWQ A;  2CT9 A;  2KYC A;  1S6J A;  1NX0 A;  3I5I B;  4DRW A;  1JFJ A;  2PRU A;  2BL0 C;  4BY4 A;  2H61 A;  1CFF A;  2KI6 D;  1CMG A;  1MXE A;  1CDN A;  1CFD A;  2OPO A;  5JJG A;  1KWO B;  2M29 A;  1IWQ A;  3BUM B;  3WXA A;  5KU1 A;  1DQE A;  2P71 A;  5AXI A;  3ZWH A;  1XFW O;  1DVI A;  3BUW B;  2WCK A;  3VRP A;  3I5H B;  5I94 A;  2M1K B;  3AAK A;  2MHH A;  3ZNI A;  1AHR A;  4U8D A;  1Y1X A;  2OS8 B;  2LUX A;  1S6C A;  4JD9 A;  1VRK A;  2M8U A;  2QEV A;  3CZ2 A;  5FYX A;  3TUY C;  3PM8 A;  2HET A;  3R1O A;  4Q04 A;  4ZCU A;  3FE6 A;  1JC2 A;  1JF0 A;  2MLF C;  2AMI A;  1S6I A;  4NDC A;  1DTL A;  1JWD A;  1TNQ A;  4INW A;  3CS1 A;  1B47 A;  2M49 B;  4YGB B;  3NSI A;  4I5N B;  1RWY A;  1UWO A;  1H8B A;  2Y5I A;  1SYM A;  3NHI A;  1QXP A;  4OV2 A;  1LIN A;  2E30 A;  3CYZ A;  3DVJ A;  2M7L A;  1Y0V H;  1KFU S;  4MEW A;  5TNC A;  2JUL A;  2GTE A;  1SW8 A;  2L5X B;  3VRO A;  1YUS A;  2LP2 A;  1LS8 A;  2K7B A;  4INX A;  2NZ0 A;  1SRA A;  1CNP A;  3M0W A;  2L2C A;  3BOW B;  1TCF A;  4PDZ A;  1FPW A;  4IJ7 A;  1RFJ A;  3I5G B;  2K2A A;  1ZUZ A;  3EVV A;  3B7A A;  1K93 D;  4AOM A;  5KSZ A;  3TS5 C;  1JUO A;  3LCP C;  3NXA A;  1V1G A;  4M2O A;  3QME A;  1DT7 B;  3O78 A;  1QS7 A;  1TUJ A;  3B88 A;  2MJW B;  2RGI A;  3HX4 A;  1XYD A;  2LLS A;  3FWB A;  1FI5 A;  3D78 A;  2WCF A;  2L2E A;  4FTG A;  3TDI A;  3UO9 A;  2JNF A;  3OBV A;  2BNX A;  3NSK A;  3S0D A;  2E6W A;  1KWO C;  4GFT A;  3JTD C;  2LC5 A;  4UPG A;  1XFY O;  4YI9 A;  1YTZ C;  1SPY A;  4HRE E;  4NDD A;  3CR4 X;  1UHK A;  1U5I A;  3KO0 A;  2OS8 C;  2KFG A;  3S0G A;  1NWD A;  3NSL A;  1NYA A;  1DJI A;  3FIA A;  2L98 A;  3ICB A;  1TUZ A;  3LK0 A;  1FF1 A;  3IQQ A;  1C3Y A;  4QJ5 B;  1OOH A;  1YR5 A;  5F6T A;  3BQ3 A;  4XJK A;  1JF2 A;  1LA3 A;  3PLF B;  4PHM A;  5I2L A;  1CTR A;  2L50 A;  1MXL C;  3PN7 B;  2LVV A;  3FWC A;  2BKI B;  1CLB A;  1G4Y R;  1TNP A;  4GPL B;  1REC A;  2L4H A;  3TUY B;  3V2L A;  1LVC D;  3IF7 A;  3K1E A;  1M31 A;  1WRL A;  3OX6 A;  1D1O A;  2WCH A;  1IRJ A;  3I5F B;  2KFH A;  2F2P A;  2IS9 A;  3WHU B;  4YGA A;  1DF0 A;  3DVK A;  3D0Y A;  2KI6 C;  1QV1 A;  5DKR A;  2BCX A;  3F45 A;  2KOT A;  3VGO A;  2O60 A;  1PSR A;  1OZS A;  1KQV A;  5B8I B;  1Y1U A;  5DKN A;  2CNP A;  3VRR A;  1K8U A;  1CMF A;  1KSO A;  1MQ1 A;  1NPQ A;  2KBM A;  3DY9 A;  3LK1 A;  1YRT B;  1KK8 B;  3I5G C;  4CID A;  1CFC A;  2PAL A;  1QVI Y;  1TTX A;  2WCB A;  2EGD A;  1RK9 A;  1S3P A;  1A75 A;  2JU0 A;  2FCE A;  2PYQ A;  3EVR A;  1LA0 A;  1AK8 A;  1EL4 A;  1BU3 A;  1A2X A;  2PMY A;  2LMU A;  1Q80 A;  3D75 A;  3L47 A;  1BOD A;  4AQJ A;  3O6B A;  3SS4 A;  1WLZ A;  2BE4 A;  3CZT X;  3UNW A;  3B87 A;  4MZJ A;  1RTP 1;  1QAS A;  2K61 A;  1YVL A;  2G2B A;  1CDM A;  1IKU A;  2LV7 A;  5AAN A;  1GJY A;  5AEQ A;  1NX2 A;  3EKH A;  1SL7 A;  1SCM C;  3KEV A;  3SIA A;  4N1G A;  3NGV A;  2MAZ A;  2Y1N A;  3DVE A;  1CDP A;  4L9M A;  1CM4 A;  3A8R A;  3CTN A;  1LXF C;  2A4J A;  1HQV A;  1JSA A;  1QAT A;  1UHN A;  2JTZ A;  2ZRT A;  3R1P A;  1GM0 A;  1DGU A;  4P2Y B;  4D1E A;  2L51 A;  5AFP A;  1QTX A;  1UP5 A;  3JTD B;  2KNE A;  2LMT A;  1AJ5 A;  4I5L B;  2LNK A;  3BFH A;  4DIR A;  3GK2 A;  5AER A;  2KGB C;  3PN7 C;  2KPH A;  4OKH A;  5BPJ A;  1CB1 A;  2LP3 A;  1YUU A;  5HLV A;  3SG6 A;  1IH0 A;  1XA5 A;  3SG7 A;  1BF5 A;  1XFU O;  1IIO A;  4KYN A;  1OMV A;  1OOI X;  1KFX L;  1MR8 A;  1SBJ A;  1E8A A;  2H61 C;  3BFB A;  1FI6 A;  2I2R E;  1DJW A;  5EL2 A;  3I5F C;  1B8L A;  5D7F A;  3QRX A;  1IQ5 A;  1DGV A;  1QV0 A;  4PE7 A;  4E68 A;  3CWG A;  1QVI Z;  2ISD A;  3SIB A;  2K2F A;  2M1U A;  1XO5 A;  1P28 A;  2M0R A;  3FS7 A;  1XFV O;  2BCB A;  1SCV A;  2JC2 A;  1ZOT B;  1OW4 A;  1UUS A;  2CCM A;  4NQG A;  2ZNE A;  1TCO B;  2B1U A;  4JQ0 D;  1U5I B;  4MN0 A;  4YGD B;  2KAX A;  3GK1 A;  2P70 A;  1F4Q A;  2QEH A;  1KK8 C;  1UHI A;  4A4C A;  1XFZ O;  3OGN A;  4ICB A;  5ER5 A;  5PAL A;  3RLZ A;  5FI6 A;  3DVM A;  2KQ6 A;  4YRU A;  3B6X A;  4XJK B;  1PSB A;  3PFV A;  5GQQ C;  2LVJ A;  4DS7 A;  1S1E A;  1TNW A;  5FI2 A;  1YX8 A;  4OVN F;  5DKQ A;  4PCW A;  3K21 A;  1A29 A;  2K7O A;  1ORG A;  1TOP A;  5CSF A;  1PAL A;  3BYA A;  1J55 A;  1NCY A;  2F8P A;  1S5G Y;  1G8I A;  2O5G A;  2JPO A;  3NSO A;  2LLT A;  1DF0 B;  1IQ3 A;  1QX2 A;  2JTT A;  3AAJ A;  3D0Y B;  5CPV A;  2JNX A;  3D74 A;  3GK4 X;  3SG2 A;  1BOC A;  1W7J B;  2NXQ A;  4TNC A;  3D73 A;  1TNX A;  3KPX A;  2NCP A;  2PQL A;  1BR4 B;  2MRD A;  4MZK A;  1QX5 B;  2HQ8 A;  1SCM B;  2KYF A;  5D3O A;  1EJ3 A;  3EK7 A;  4GNK B;  4IL1 A;  4PE4 A;  5CSN A;  5HKW A;  1GGW A;  4A4B A;  1AJ4 A;  1B9A A;  2NCO A;  3NHT A;  2KLE A;  2FJY A;  1N65 A;  3BJH A;  2HF5 A;  2KI4 C;  3IQO A;  3OX5 A;  1A75 B;  5HL1 A;  2QAC A;  4ORB B;  1DMO A;  2F33 A;  1ODB A;  5HKZ A;  4ZCV A;  1J7R A;  2G9B A;  2KGR A;  4AQI A;  5J3X A;  1EG3 A;  1GQM A;  1QIW A;  1ZAC A;  1ALW A;  4USL A;  2MBX A;  5HKY A;  1OOJ A;  2KSP A;  1WY9 A;  3O4Y A;  1KFX S;  1QLK A;  2BKH B;  4NDB A;  4PHN A;  1SK6 D;  2JT8 A;  2K8M B;  2WCM A;  4I5K A;  1B7T Y;  1N0Y A;  4DCK A;  1PUL A;  3DF0 A;  1Z4H A;  2H2K A;  1WRK A;  1SR6 C;  2WCE A;  3IVT A;  2WCJ A;  4C0L A;  1SMG A;  2K0J A;  2LAP A;  2LHL A;  2M3W A;  2WCL A;  1XVJ A;  1IG5 A;  2PSR A;  3BUN B;  4GGF A;  1KCY A;  1S5G Z;  1L2O B;  3R1V A;  1CLL A;  3CR2 A;  2Q4U A;  1R2U A;  2WC6 A;  2ZRS A;  1SL9 A;  1BLQ A;  2JZI A;  2JRF A;  1F71 A;  3GOF A;  1DJG A;  4MRX A;  3TDU A;  4CFQ A;  1B1G A;  3CR5 X;  1KK7 Y;  2GV5 A;  2HPS A;  2AAO A;  3EG5 B;  2QEO A;  4PT1 A;  2BE6 A;  1PVB A;  2BEC A;  1FW4 A;  3KHE A;  1QX7 A;  1H4B A;  1K9K A;  1ZFS A;  3CZ1 A;  3LLE A;  1YUT A;  1OMR A;  3SS5 A;  1NCX A;  1QWV A;  1Y6W A;  2I7A A;  1K9U A;  2KLD A;  3DD4 A;  4P5O E;  1NX3 A;  4N1F A;  1DC1 A;  3Q8I A;  4GGF C;  2KDH A;  3OB1 B;  2CTN A;  2SAS A;  4FQT A;  1JFK A;  2EHB A;  4GUK A;  1PK0 D;  1MUX A;  1X02 A;  3S0B A;  1HT9 A;  2JT3 A;  1YX7 A;  2LE9 B;  2MA2 A;  2WOS A;  4FQO A;  2K7D A;  1IGV A;  4M2P A;  2MLE C;  4MSP A;  1C7V A;  1GGZ A;  3S0E A;  4MZL A;  1PVA A;  2COL B; 
#chains in the Genus database with same CATH homology
 3D78 A;  1OW4 A;  3CDN A;  1OOF A;  2P70 A;  3DZT A;  3S0D A;  2QEH A;  3OGN A;  4OZD A;  3L4L A;  3B6X A;  3S0G A;  3BFA A;  3S0F A;  4F7F A;  3RZS A;  1ORG A;  1C3Y A;  3FE8 A;  1T14 A;  3D77 A;  1OOH A;  2JPO A;  1OOG A;  3D74 A;  3CZ0 A;  3D73 A;  2QDI A;  1XFR A;  3DXL A;  3V2L A;  2PQL A;  3K1E A;  5DIC A;  2WCH A;  3B86 A;  3NHT A;  2FJY A;  3BJH A;  3D76 A;  2QEB A;  3DY9 A;  1TWO A;  2P71 A;  1DQE A;  2WCK A;  3D75 A;  2ERB A;  3L47 A;  2WCM A;  2WC5 A;  3B87 A;  4JD9 A;  2QEV A;  3CZ2 A;  2H8V A;  3FE9 A;  3R1O A;  3FE6 A;  2WCJ A;  3NGV A;  2WCL A;  4INW A;  3R72 A;  1C3Z A;  3R1V A;  3PJI A;  2WC6 A;  3N7H A;  3R1P A;  1GM0 A;  3NHI A;  3CYZ A;  2GTE A;  2QEO A;  4PT1 A;  3BFH A;  1LS8 A;  3L4A A;  3CZ1 A;  2KPH A;  4INX A;  3S0A A;  1QWV A;  2L2C A;  3Q8I A;  4FQT A;  1OOI X;  3BFB A;  3B7A A;  5EL2 A;  3S0B A;  3DYE A;  3QME A;  1TUJ A;  3B88 A;  1P28 A;  3S0E A;  3CAB A;  3VB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...