2QEVA

Crystal structure of anopheles gambiae d7r4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
145
structure length
145
Chain Sequence
METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
molecule keywords D7R4 Protein
total genus 56
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qevA00
1TWOA 3QMEA 1GM0A 1OOIX 3NGVA 2P70A 2QEHA 3Q8IA 3CDNA 4OZDA 2PQLA 3S0GA 3R72A 1P28A 2P71A 3RZSA 2L2CA 2QEBA 3FE9A 3B6XA 2QDIA 2QEOA 2H8VA 2ERBA 4F7FA 3PJIA 3BJHA 3VB1A 3OGNA 3L4LA 1OOGA 1OOFA 3S0AA 4INXA 3FE6A 1C3YA 2WCJA 5EL2A 3DXLA 2FJYA 3BFAA 3R1VA 2KPHA 3R1PA 3FE8A 3R1OA 2WCLA 1C3ZA 3NHTA 3S0BA 4INWA 2WC6A 1ORGA 2WCMA 3L4AA 1QWVA 4FQTA 1LS8A 3D75A 2GTEA 3CZ2A 3DY9A 1OW4A 3K1EA 2WCHA 3D78A 5DICA 3D73A 4JD9A 3L47A 3S0FA 3B87A 3NHIA 2JPOA 3BFHA 3S0DA 2WC5A 1TUJA 3CZ1A 3CABA 3B86A 2QEVA 1T14A 2WCKA 3CZ0A 3V2LA 4PT1A 3CYZA 3B7AA 1DQEA 3DYEA 3N7HA 1OOHA 3BFBA 3S0EA 1XFRA 3D77A 3DZTA 3D74A 3B88A 3D76A
chains in the Genus database with same CATH superfamily
2L5XB 1J7RA 2HQ8A 2CCMA 3QMEA 3I5HB 3EKHA 5CSFA 1GQMA 3NSIA 1DJZA 4MZKA 1SK6D 1NSHA 2ZKMX 1MR8A 4R1EA 1ALVA 1DJGA 3AAJA 1PALA 1ZFSA 4M2PA 5G08A 1TTXA 2OTGB 1CDLA 4OZDA 3AKAA 1C07A 2L4HA 1EG3A 1XFWO 4FQOA 5I8NA 3CR4X 2A4JA 1OQPA 1CTRA 3IVTA 1DJWA 4JPZB 1U5IB 1KFXL 1S1EA 1KQMB 2K61A 3FE9A 4PCWA 2LLSA 2KFHA 2QDIA 3O78A 2F3ZA 4F0ZB 1U5IA 2LV7A 1IIOA 2JZIA 2PASA 1FW4A 1K90D 4OV2A 1AP4A 4JQ0D 1MUXA 1BU3A 5DKQA 4ZCUA 1S26D 2SASA 3VB1A 2WCEA 2M49B 3I5HC 1DF0B 2L2EA 5KSZA 3SG5A 3VRPA 1NYAA 4PE7A 2F8PA 2L98A 2M0RA 3SS3A 1DVIA 1DMOA 3PN7C 1PRWA 1FI5A 5F6TA 1CLLA 2LM5A 2KYCA 3DF0A 1LXFC 4TNCA 4CLNA 2L51A 2M97A 3PN7B 4XJKB 5FI2A 2KPHA 1JUOA 2K60A 3IQOA 5FI7A 4ORAB 1ZMZA 1UWOA 2Y1NA 4NDCA 4MEWA 2M1UA 2OS8C 4M2QA 5PALA 1SRAA 1CFFA 2G2BA 3H4SE 2KFGA 4GPLB 5AANA 4INWA 2WC6A 2M7LA 1K9PA 1NX3A 2JNXA 2LLUA 4NQGA 1QLSA 3DVMA 3DVEA 1XK4A 1NX1A 5I2LA 2LC5A 1ZUZA 1C7WA 4A4CA 1LKJA 3RLZA 2KNEA 1MXEA 3CGAA 4C0JA 3DY9A 1XFZO 2OS8B 2WORA 1QV0A 2KQYA 2KDHA 5ER5A 2JOJA 2WC8A 1NCYA 4I5JA 3SG4A 1IQ5A 1CFPA 1DJXA 3I5FC 1KK8C 2ZRTA 3D78A 4OCIA 3GK1A 1QXPA 3O4YA 5AEQA 1PVAA 3ZWHA 1CLBA 4YI8A 2L5YA 3KO0A 2JNFA 1FPWA 2I94A 1YUUA 4MRXA 3HX4A 4U8DA 1A4PA 1AVSA 1IGVA 1UURA 2Y5IA 1UHNA 3O2PA 1QVIZ 1UHJA 1BT6A 4YGEB 4C0KA 1JFJA 1SKTA 2CNPA 3CZ0A 1T14A 1L7ZA 2YGUA 3I5IC 2KAXA 2R2IA 4C0LA 1J7PA 2JPTA 4MZJA 5CSJA 5GQQC 3D10A 1JWDA 2VRGA 1WRZA 4YGAA 2KAYA 1H8BA 4PHKA 2JQ6A 1Y0VH 2HQWA 4M2OA 1IJ6A 1B4CA 4GFTA 2LANA 4I5KA 1KFUS 1L2OC 3EK7A 1XFVO 3K21A 2SCPA 2KI6C 2MAZA 2OPOA 3OX5A 3EK4A 2PYQA 1IKUA 3BFBA 1XYDA 1QIVA 1Y1AA 1XFRA 4ORBB 5HKZA 1PVBA 2JT8A 2PVBA 1YRUB 1QX7A 2FCDA 5I2OA 4AQIA 3BUWB 1SCMC 1GM0A 1YX8A 1MXLC 3BQ3A 1TCFA 1A29A 4YBHB 1S3PA 1S5GZ 1KFXS 1KWOC 4MSPA 1Y1XA 2LNKA 1IRJA 1AUIB 1BR1B 1BOCA 4IL1A 3GK2A 3C1VA 5AXIA 2H61A 1XFUO 3AKBA 1BR4B 2FCEA 1TN4A 1GJYA 2CBLA 5D3OA 1AHRA 2ISDA 2L2CA 4MN0A 2Y1MA 1Y6WA 2QEBA 5JOLA 2JULA 3B6XA 3SJSA 4MLWA 1XA5A 2F2OA 3AAKA 3VRNA 1WRKA 2LAPA 2QEOA 1NCZA 2DOQA 2CT9A 2ERBA 2M9GA 1J7OA 2QPTA 2OTGC 1N0YA 1J1DA 2LLTA 1G8IA 2LMVA 1CMGA 1YX7A 1S6JA 4DCKA 1SR6B 4INXA 1W7JB 1AK8A 2KLDA 1NP8A 2WCJA 3SG3A 2KGBC 3CWGA 3DVJA 3PLFB 4DS7A 1RROA 2BBMA 2KI4C 1D1OA 1Z4HA 2FJYA 3BFAA 3KPXA 3R1VA 1BJFA 2JRFA 3KEVA 4DUQA 3FE8A 4XJKA 1C3ZA 3NHTA 5TNCA 1X02A 1L2OB 1UHKA 1K2HA 3EK8A 1ORGA 1CDNA 1OMRA 2LUCA 1XFXO 3LLEA 1NPQA 2BE4A 2Q4UA 3I5GC 4HRGA 4MRYA 2ZNEA 1SL8A 1YURA 1BODA 2E6WA 5ER4X 3NSKA 2RGIA 3CS1A 1KSMA 3K1EA 2WCHA 1CM4A 4JWQA 3NXAA 1WRLA 1WLZA 1K9KA 1TNQA 2LVJA 2F3YA 2JTZA 1MF8B 1QVIY 4N1GA 1OOJA 3L47A 1YVHA 1FBVA 3KHEA 1LINA 3HCMA 3NHIA 1A75B 1M39A 2NLNA 3BFHA 2KAVA 1LA3A 3PM8A 1EH2A 1DTLA 1WY9A 3GK4X 5CSIA 4UPGA 2K8MB 3CLNA 3CABA 4CPVA 1TCOB 2LMUA 3D0YA 1JFKA 2K7OA 3V2LA 2ZFDA 4QJ3B 3JTDB 3JVTC 3PATA 1OMVA 1KWOB 3VRRA 3CYZA 2K7BA 1SSEB 1YR5A 4N5XA 2MRDA 3IF7A 1GGWA 4GUKA 1RWYA 2EC6C 2GGZA 3B7AA 2ZNDA 2PMYA 5I2QA 2AUCA 1BF5A 1A03A 1XVJA 4PE0A 3PSRA 1NIWA 1ZOTB 2MLFC 2D8NA 3WNXB 3DZTA 4I5LB 2KBMA 3D76A 1DEKA 2K2FA 1B7TY 1QS7A 5D7FA 4PHMA 2BECA 2Y4QA 3UO9A 4USLA 2BL0C 2EC6B 1M63B 1OOIX 2ZRSA 2P70A 2M1KB 2QEHA 3PFVA 1XFYO 5DKNA 1IJ5A 1TNXA 1K94A 1CLMA 4BY4A 3BUOB 1CB1A 2BNXA 1WDCC 2BCXA 1J55A 1K93D 3LK1A 1DJYA 3TDIA 2KQ6A 1S6CA 5J3XA 1P28A 1OZSA 2JTTA 1LA0A 4P5OE 1EXRA 1NCXA 2O60A 2LP2A 3OP0A 2KI6D 2K7DA 2NXQA 1FI6A 1LVCD 1M31A 1M46A 2PSRA 3CZTX 3WXAA 1M45A 1SPYA 1TNWA 3PM2A 3PALA 1GGZA 3FIAA 4CFQA 3BJHA 2IS9A 5JJGA 1F4QA 2TN4A 2LE9B 2KSPA 3SIBA 3BUNB 5KTYA 1F70A 3FE6A 1C3YA 1DF0A 1NWDA 1DELA 1JSAA 5CSNA 1N2DA 1SCMB 5HLVA 1G4YR 1J1EA 1DJHA 1TRFA 2KHNA 5B8IB 3SIAA 3DXLA 2E30A 4GBAA 2HPSA 2CXJA 2K7CA 1S6IA 1CNPA 1CDPA 3TZ1A 4FTGA 1UUSA 2BCBA 3BOWA 5I94A 1YRTB 3R1OA 1DT7B 1FF1A 1MQ1A 4IJ7A 4WQ3A 3SG6A 4DIRA 3S0BA 1CM1A 1JBAA 4PE1A 3JTDC 3JVTB 1JC2A 1W9ZA 1KK7Y 1MWNA 1XO5A 4L9MA 3OB2B 2K0JA 1B8LA 2WCMA 5KU1A 4GGNA 3VRQA 2MHHA 1OE9B 3NSLA 1LS8A 1NX0A 5HKYA 3TS5B 3EKJA 1NX2A 1PK0D 2COLB 2GTEA 3UNWA 1RFJA 1KQMC 2AMIA 3EG5B 4ZCVA 1H4BA 3NSOA 5CPVA 1DGVA 4QJ5B 3KF9A 2NZ0A 2BKIB 2BE6A 1C7VA 2GGMA 1CFDA 1SYMA 2P6BB 1SMGA 1B1GA 1IQ3A 5DICA 3D73A 3QRXA 4JD9A 1S5GY 3ZNIA 4GAOA 3O6BA 1A75A 3WHUB 2WCFA 3A4UB 2K2AA 3FS7A 1W7IB 1DC1A 1IG5A 2LP3A 3B87A 5BPJA 1K95A 2BL0B 3S0DA 1E8AA 2JWWA 1Q80A 1UP5A 1A2XA 1MHOA 1TUJA 2BAPA 2O5GA 3ICBA 1K96A 4AOMA 3EVVA 2NCPA 4HREE 1KSOA 2EHBA 2NCOA 2JXLA 3B86A 2L0PA 1QTXA 1K8UA 2QEVA 4JKTA 4PHNA 3E3RA 1KFUL 1YUSA 4PT1A 1F55A 3D0YB 1KCYA 1SCVA 1VRKA 1RTP1 1KQVA 3GOFA 3I5GB 4WQ2A 2MLEC 2LVKA 1IWQA 1TOPA 4MVFA 4PDZA 3LK0A 3LCPC 4I5NB 1R6PA 3DYEA 1XK4C 2ZN8A 1QATA 3OHMB 1K9UA 1QLKA 1SL9A 3EVUA 1DGUA 1OOHA 4ORCB 4Q04A 3S0EA 4KYNA 3D74A 1ODBA 3B88A 1TWOA 4PALA 1PULA 4ICBA 1CMFA 4CFRA 5K89A 3CR5X 4YRUA 3NGVA 1J7QA 1B9AA 2FOTA 2L50A 4NDDA 1YTZC 2KGRA 1RJVA 3Q8IA 3CDNA 2KBIA 3CTNA 3TUYB 5HYDA 1CFCA 2JT3A 4PE4A 5FI6A 2QACA 4YGBB 2MBXA 1OMDA 2KLEA 2PQLA 3S0GA 2AAOA 3R72A 5HKWA 2P71A 3RZSA 1RECA 1Y1UA 2JT0A 2JXCA 1B8RA 2M3WA 3A8RA 1YUTA 3CR2A 3TUYC 1OSAA 1SR6C 2H8VA 2BKHB 4F7FA 3PJIA 2BCAA 4GNKB 2L4IA 1AJ5A 1B8CA 1WDCB 1F8HA 1TUZA 1BMOA 1V1FA 3OGNA 1N65A 2H61C 3L4LA 1OOGA 1OOFA 4OVNF 3S0AA 1QJTA 2PALA 3EVRA 3I5FB 1QX2A 3RM1A 1ALWA 3LL8B 2WNDA 2LVIA 1KK7Z 2G9BA 1YVLA 4P2YB 1F54A 1JF2A 2I18A 3FWCA 4OR9B 1CKKA 5EL2A 3SS4A 4NDBA 3WHTB 4E68A 1NUBA 1UHIA 3O4XA 2JU0A 1ZACA 3R1PA 4D1EA 3DF0B 1CDMA 2LCPA 2WCLA 3BYAA 1S36A 1EL4A 3VROA 2I7AA 1G33A 5IBWA 3F45A 3BOWB 2M7NA 1SY9A 3I5IB 4DRWA 3L4AA 1QWVA 5FYXA 4FQTA 3MSEB 4BY5A 1EJ3A 2I2RE 2M29A 4XYNA 1RK9A 1WLMA 3D75A 1AJ4A 1HT9A 1PSRA 2LMTA 4GGFC 3CZ2A 3OBVA 1SNLA 4N1FA 5DKRA 4CIDA 2BBNA 3VGOA 3SS5A 2MJWB 1EG4A 1OW4A 1F4OA 1PSBA 2M8UA 1BLQA 3BUXB 5HLOA 2KI4B 4OKHA 1B7TZ 1TNPA 1B47A 1JF0A 2CTNA 3BUMB 3FWBA 5HL1A 2LHLA 4MBEA 2V53A 2WOSA 2LHIA 1KK8B 2FJUB 2H2KA 2WCBA 3M0WA 4MZLA 4ETOA 2JC2A 3S0FA 2EGDA 2F33A 2HF5A 4WRIA 1UHHA 1QV1A 2Q91A 4A4BA 1HQVA 2JPOA 2ZN9A 4AQJA 1QX5B 3SG7A 2GV5A 1BG1A 3TDZA 2WC5A 5AFPA 1QASA 3CZ1A 1TIZA 4QJ4B 2PRUA 2LVVA 1Z2CB 2HETA 3DVKA 2F2PA 2WCKA 5AERA 4YGCB 4YI9A 1IH0A 3TS5C 5D69A 1SBJA 3BXKA 1DJIA 4HRHA 2MA2A 1R2UA 4GGFA 1SW8A 2B1UA 1QIWA 4HSZA 1V1GA 3IQQA 1DQEA 3OB1B 3OX6A 3N7HA 1SL7A 4PHJA 3DD4A 4YGDB 1OZOA 2KOTA 2KFFA 2KYFA 3TDUA 3D77A 3SG2A 2LUXA 1F71A
chains in the Genus database with same CATH topology
1TWOA 3QMEA 1GM0A 1OOIX 3NGVA 2P70A 2QEHA 3Q8IA 3CDNA 4OZDA 2PQLA 3S0GA 3R72A 1P28A 2P71A 3RZSA 2L2CA 2QEBA 3FE9A 3B6XA 2QDIA 2QEOA 2H8VA 2ERBA 4F7FA 3PJIA 3BJHA 3VB1A 3OGNA 3L4LA 1OOGA 1OOFA 3S0AA 4INXA 3FE6A 1C3YA 2WCJA 5EL2A 3DXLA 2FJYA 3BFAA 3R1VA 2KPHA 3R1PA 3FE8A 3R1OA 2WCLA 1C3ZA 3NHTA 3S0BA 4INWA 2WC6A 1ORGA 2WCMA 3L4AA 1QWVA 4FQTA 1LS8A 3D75A 2GTEA 3CZ2A 3DY9A 1OW4A 3K1EA 2WCHA 3D78A 5DICA 3D73A 4JD9A 3L47A 3S0FA 3B87A 3NHIA 2JPOA 3BFHA 3S0DA 2WC5A 1TUJA 3CZ1A 3CABA 3B86A 2QEVA 1T14A 2WCKA 3CZ0A 3V2LA 4PT1A 3CYZA 3B7AA 1DQEA 3DYEA 3N7HA 1OOHA 3BFBA 3S0EA 1XFRA 3D77A 3DZTA 3D74A 3B88A 3D76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWO A;  3QME A;  1GM0 A;  1OOI X;  3NGV A;  2P70 A;  2QEH A;  3Q8I A;  3CDN A;  4OZD A;  2PQL A;  3S0G A;  3R72 A;  1P28 A;  2P71 A;  3RZS A;  2L2C A;  2QEB A;  3FE9 A;  3B6X A;  2QDI A;  2QEO A;  2H8V A;  2ERB A;  4F7F A;  3PJI A;  3BJH A;  3VB1 A;  3OGN A;  3L4L A;  1OOG A;  1OOF A;  3S0A A;  4INX A;  3FE6 A;  1C3Y A;  2WCJ A;  5EL2 A;  3DXL A;  2FJY A;  3BFA A;  3R1V A;  2KPH A;  3R1P A;  3FE8 A;  3R1O A;  2WCL A;  1C3Z A;  3NHT A;  3S0B A;  4INW A;  2WC6 A;  1ORG A;  2WCM A;  3L4A A;  1QWV A;  4FQT A;  1LS8 A;  3D75 A;  2GTE A;  3CZ2 A;  3DY9 A;  1OW4 A;  3K1E A;  2WCH A;  3D78 A;  5DIC A;  3D73 A;  4JD9 A;  3L47 A;  3S0F A;  3B87 A;  3NHI A;  2JPO A;  3BFH A;  3S0D A;  2WC5 A;  1TUJ A;  3CZ1 A;  3CAB A;  3B86 A;  2QEV A;  1T14 A;  2WCK A;  3CZ0 A;  3V2L A;  4PT1 A;  3CYZ A;  3B7A A;  1DQE A;  3DYE A;  3N7H A;  1OOH A;  3BFB A;  3S0E A;  1XFR A;  3D77 A;  3DZT A;  3D74 A;  3B88 A;  3D76 A; 
#chains in the Genus database with same CATH topology
 2L5X B;  1J7R A;  2HQ8 A;  2CCM A;  3QME A;  3I5H B;  3EKH A;  5CSF A;  1GQM A;  3NSI A;  1DJZ A;  4MZK A;  1SK6 D;  1NSH A;  2ZKM X;  1MR8 A;  4R1E A;  1ALV A;  1DJG A;  3AAJ A;  1PAL A;  1ZFS A;  4M2P A;  5G08 A;  1TTX A;  2OTG B;  1CDL A;  4OZD A;  3AKA A;  1C07 A;  2L4H A;  1EG3 A;  1XFW O;  4FQO A;  5I8N A;  3CR4 X;  2A4J A;  1OQP A;  1CTR A;  3IVT A;  1DJW A;  4JPZ B;  1U5I B;  1KFX L;  1S1E A;  1KQM B;  2K61 A;  3FE9 A;  4PCW A;  2LLS A;  2KFH A;  2QDI A;  3O78 A;  2F3Z A;  4F0Z B;  1U5I A;  2LV7 A;  1IIO A;  2JZI A;  2PAS A;  1FW4 A;  1K90 D;  4OV2 A;  1AP4 A;  4JQ0 D;  1MUX A;  1BU3 A;  5DKQ A;  4ZCU A;  1S26 D;  2SAS A;  3VB1 A;  2WCE A;  2M49 B;  3I5H C;  1DF0 B;  2L2E A;  5KSZ A;  3SG5 A;  3VRP A;  1NYA A;  4PE7 A;  2F8P A;  2L98 A;  2M0R A;  3SS3 A;  1DVI A;  1DMO A;  3PN7 C;  1PRW A;  1FI5 A;  5F6T A;  1CLL A;  2LM5 A;  2KYC A;  3DF0 A;  1LXF C;  4TNC A;  4CLN A;  2L51 A;  2M97 A;  3PN7 B;  4XJK B;  5FI2 A;  2KPH A;  1JUO A;  2K60 A;  3IQO A;  5FI7 A;  4ORA B;  1ZMZ A;  1UWO A;  2Y1N A;  4NDC A;  4MEW A;  2M1U A;  2OS8 C;  4M2Q A;  5PAL A;  1SRA A;  1CFF A;  2G2B A;  3H4S E;  2KFG A;  4GPL B;  5AAN A;  4INW A;  2WC6 A;  2M7L A;  1K9P A;  1NX3 A;  2JNX A;  2LLU A;  4NQG A;  1QLS A;  3DVM A;  3DVE A;  1XK4 A;  1NX1 A;  5I2L A;  2LC5 A;  1ZUZ A;  1C7W A;  4A4C A;  1LKJ A;  3RLZ A;  2KNE A;  1MXE A;  3CGA A;  4C0J A;  3DY9 A;  1XFZ O;  2OS8 B;  2WOR A;  1QV0 A;  2KQY A;  2KDH A;  5ER5 A;  2JOJ A;  2WC8 A;  1NCY A;  4I5J A;  3SG4 A;  1IQ5 A;  1CFP A;  1DJX A;  3I5F C;  1KK8 C;  2ZRT A;  3D78 A;  4OCI A;  3GK1 A;  1QXP A;  3O4Y A;  5AEQ A;  1PVA A;  3ZWH A;  1CLB A;  4YI8 A;  2L5Y A;  3KO0 A;  2JNF A;  1FPW A;  2I94 A;  1YUU A;  4MRX A;  3HX4 A;  4U8D A;  1A4P A;  1AVS A;  1IGV A;  1UUR A;  2Y5I A;  1UHN A;  3O2P A;  1QVI Z;  1UHJ A;  1BT6 A;  4YGE B;  4C0K A;  1JFJ A;  1SKT A;  2CNP A;  3CZ0 A;  1T14 A;  1L7Z A;  2YGU A;  3I5I C;  2KAX A;  2R2I A;  4C0L A;  1J7P A;  2JPT A;  4MZJ A;  5CSJ A;  5GQQ C;  3D10 A;  1JWD A;  2VRG A;  1WRZ A;  4YGA A;  2KAY A;  1H8B A;  4PHK A;  2JQ6 A;  1Y0V H;  2HQW A;  4M2O A;  1IJ6 A;  1B4C A;  4GFT A;  2LAN A;  4I5K A;  1KFU S;  1L2O C;  3EK7 A;  1XFV O;  3K21 A;  2SCP A;  2KI6 C;  2MAZ A;  2OPO A;  3OX5 A;  3EK4 A;  2PYQ A;  1IKU A;  3BFB A;  1XYD A;  1QIV A;  1Y1A A;  1XFR A;  4ORB B;  5HKZ A;  1PVB A;  2JT8 A;  2PVB A;  1YRU B;  1QX7 A;  2FCD A;  5I2O A;  4AQI A;  3BUW B;  1SCM C;  1GM0 A;  1YX8 A;  1MXL C;  3BQ3 A;  1TCF A;  1A29 A;  4YBH B;  1S3P A;  1S5G Z;  1KFX S;  1KWO C;  4MSP A;  1Y1X A;  2LNK A;  1IRJ A;  1AUI B;  1BR1 B;  1BOC A;  4IL1 A;  3GK2 A;  3C1V A;  5AXI A;  2H61 A;  1XFU O;  3AKB A;  1BR4 B;  2FCE A;  1TN4 A;  1GJY A;  2CBL A;  5D3O A;  1AHR A;  2ISD A;  2L2C A;  4MN0 A;  2Y1M A;  1Y6W A;  2QEB A;  5JOL A;  2JUL A;  3B6X A;  3SJS A;  4MLW A;  1XA5 A;  2F2O A;  3AAK A;  3VRN A;  1WRK A;  2LAP A;  2QEO A;  1NCZ A;  2DOQ A;  2CT9 A;  2ERB A;  2M9G A;  1J7O A;  2QPT A;  2OTG C;  1N0Y A;  1J1D A;  2LLT A;  1G8I A;  2LMV A;  1CMG A;  1YX7 A;  1S6J A;  4DCK A;  1SR6 B;  4INX A;  1W7J B;  1AK8 A;  2KLD A;  1NP8 A;  2WCJ A;  3SG3 A;  2KGB C;  3CWG A;  3DVJ A;  3PLF B;  4DS7 A;  1RRO A;  2BBM A;  2KI4 C;  1D1O A;  1Z4H A;  2FJY A;  3BFA A;  3KPX A;  3R1V A;  1BJF A;  2JRF A;  3KEV A;  4DUQ A;  3FE8 A;  4XJK A;  1C3Z A;  3NHT A;  5TNC A;  1X02 A;  1L2O B;  1UHK A;  1K2H A;  3EK8 A;  1ORG A;  1CDN A;  1OMR A;  2LUC A;  1XFX O;  3LLE A;  1NPQ A;  2BE4 A;  2Q4U A;  3I5G C;  4HRG A;  4MRY A;  2ZNE A;  1SL8 A;  1YUR A;  1BOD A;  2E6W A;  5ER4 X;  3NSK A;  2RGI A;  3CS1 A;  1KSM A;  3K1E A;  2WCH A;  1CM4 A;  4JWQ A;  3NXA A;  1WRL A;  1WLZ A;  1K9K A;  1TNQ A;  2LVJ A;  2F3Y A;  2JTZ A;  1MF8 B;  1QVI Y;  4N1G A;  1OOJ A;  3L47 A;  1YVH A;  1FBV A;  3KHE A;  1LIN A;  3HCM A;  3NHI A;  1A75 B;  1M39 A;  2NLN A;  3BFH A;  2KAV A;  1LA3 A;  3PM8 A;  1EH2 A;  1DTL A;  1WY9 A;  3GK4 X;  5CSI A;  4UPG A;  2K8M B;  3CLN A;  3CAB A;  4CPV A;  1TCO B;  2LMU A;  3D0Y A;  1JFK A;  2K7O A;  3V2L A;  2ZFD A;  4QJ3 B;  3JTD B;  3JVT C;  3PAT A;  1OMV A;  1KWO B;  3VRR A;  3CYZ A;  2K7B A;  1SSE B;  1YR5 A;  4N5X A;  2MRD A;  3IF7 A;  1GGW A;  4GUK A;  1RWY A;  2EC6 C;  2GGZ A;  3B7A A;  2ZND A;  2PMY A;  5I2Q A;  2AUC A;  1BF5 A;  1A03 A;  1XVJ A;  4PE0 A;  3PSR A;  1NIW A;  1ZOT B;  2MLF C;  2D8N A;  3WNX B;  3DZT A;  4I5L B;  2KBM A;  3D76 A;  1DEK A;  2K2F A;  1B7T Y;  1QS7 A;  5D7F A;  4PHM A;  2BEC A;  2Y4Q A;  3UO9 A;  4USL A;  2BL0 C;  2EC6 B;  1M63 B;  1OOI X;  2ZRS A;  2P70 A;  2M1K B;  2QEH A;  3PFV A;  1XFY O;  5DKN A;  1IJ5 A;  1TNX A;  1K94 A;  1CLM A;  4BY4 A;  3BUO B;  1CB1 A;  2BNX A;  1WDC C;  2BCX A;  1J55 A;  1K93 D;  3LK1 A;  1DJY A;  3TDI A;  2KQ6 A;  1S6C A;  5J3X A;  1P28 A;  1OZS A;  2JTT A;  1LA0 A;  4P5O E;  1EXR A;  1NCX A;  2O60 A;  2LP2 A;  3OP0 A;  2KI6 D;  2K7D A;  2NXQ A;  1FI6 A;  1LVC D;  1M31 A;  1M46 A;  2PSR A;  3CZT X;  3WXA A;  1M45 A;  1SPY A;  1TNW A;  3PM2 A;  3PAL A;  1GGZ A;  3FIA A;  4CFQ A;  3BJH A;  2IS9 A;  5JJG A;  1F4Q A;  2TN4 A;  2LE9 B;  2KSP A;  3SIB A;  3BUN B;  5KTY A;  1F70 A;  3FE6 A;  1C3Y A;  1DF0 A;  1NWD A;  1DEL A;  1JSA A;  5CSN A;  1N2D A;  1SCM B;  5HLV A;  1G4Y R;  1J1E A;  1DJH A;  1TRF A;  2KHN A;  5B8I B;  3SIA A;  3DXL A;  2E30 A;  4GBA A;  2HPS A;  2CXJ A;  2K7C A;  1S6I A;  1CNP A;  1CDP A;  3TZ1 A;  4FTG A;  1UUS A;  2BCB A;  3BOW A;  5I94 A;  1YRT B;  3R1O A;  1DT7 B;  1FF1 A;  1MQ1 A;  4IJ7 A;  4WQ3 A;  3SG6 A;  4DIR A;  3S0B A;  1CM1 A;  1JBA A;  4PE1 A;  3JTD C;  3JVT B;  1JC2 A;  1W9Z A;  1KK7 Y;  1MWN A;  1XO5 A;  4L9M A;  3OB2 B;  2K0J A;  1B8L A;  2WCM A;  5KU1 A;  4GGN A;  3VRQ A;  2MHH A;  1OE9 B;  3NSL A;  1LS8 A;  1NX0 A;  5HKY A;  3TS5 B;  3EKJ A;  1NX2 A;  1PK0 D;  2COL B;  2GTE A;  3UNW A;  1RFJ A;  1KQM C;  2AMI A;  3EG5 B;  4ZCV A;  1H4B A;  3NSO A;  5CPV A;  1DGV A;  4QJ5 B;  3KF9 A;  2NZ0 A;  2BKI B;  2BE6 A;  1C7V A;  2GGM A;  1CFD A;  1SYM A;  2P6B B;  1SMG A;  1B1G A;  1IQ3 A;  5DIC A;  3D73 A;  3QRX A;  4JD9 A;  1S5G Y;  3ZNI A;  4GAO A;  3O6B A;  1A75 A;  3WHU B;  2WCF A;  3A4U B;  2K2A A;  3FS7 A;  1W7I B;  1DC1 A;  1IG5 A;  2LP3 A;  3B87 A;  5BPJ A;  1K95 A;  2BL0 B;  3S0D A;  1E8A A;  2JWW A;  1Q80 A;  1UP5 A;  1A2X A;  1MHO A;  1TUJ A;  2BAP A;  2O5G A;  3ICB A;  1K96 A;  4AOM A;  3EVV A;  2NCP A;  4HRE E;  1KSO A;  2EHB A;  2NCO A;  2JXL A;  3B86 A;  2L0P A;  1QTX A;  1K8U A;  2QEV A;  4JKT A;  4PHN A;  3E3R A;  1KFU L;  1YUS A;  4PT1 A;  1F55 A;  3D0Y B;  1KCY A;  1SCV A;  1VRK A;  1RTP 1;  1KQV A;  3GOF A;  3I5G B;  4WQ2 A;  2MLE C;  2LVK A;  1IWQ A;  1TOP A;  4MVF A;  4PDZ A;  3LK0 A;  3LCP C;  4I5N B;  1R6P A;  3DYE A;  1XK4 C;  2ZN8 A;  1QAT A;  3OHM B;  1K9U A;  1QLK A;  1SL9 A;  3EVU A;  1DGU A;  1OOH A;  4ORC B;  4Q04 A;  3S0E A;  4KYN A;  3D74 A;  1ODB A;  3B88 A;  1TWO A;  4PAL A;  1PUL A;  4ICB A;  1CMF A;  4CFR A;  5K89 A;  3CR5 X;  4YRU A;  3NGV A;  1J7Q A;  1B9A A;  2FOT A;  2L50 A;  4NDD A;  1YTZ C;  2KGR A;  1RJV A;  3Q8I A;  3CDN A;  2KBI A;  3CTN A;  3TUY B;  5HYD A;  1CFC A;  2JT3 A;  4PE4 A;  5FI6 A;  2QAC A;  4YGB B;  2MBX A;  1OMD A;  2KLE A;  2PQL A;  3S0G A;  2AAO A;  3R72 A;  5HKW A;  2P71 A;  3RZS A;  1REC A;  1Y1U A;  2JT0 A;  2JXC A;  1B8R A;  2M3W A;  3A8R A;  1YUT A;  3CR2 A;  3TUY C;  1OSA A;  1SR6 C;  2H8V A;  2BKH B;  4F7F A;  3PJI A;  2BCA A;  4GNK B;  2L4I A;  1AJ5 A;  1B8C A;  1WDC B;  1F8H A;  1TUZ A;  1BMO A;  1V1F A;  3OGN A;  1N65 A;  2H61 C;  3L4L A;  1OOG A;  1OOF A;  4OVN F;  3S0A A;  1QJT A;  2PAL A;  3EVR A;  3I5F B;  1QX2 A;  3RM1 A;  1ALW A;  3LL8 B;  2WND A;  2LVI A;  1KK7 Z;  2G9B A;  1YVL A;  4P2Y B;  1F54 A;  1JF2 A;  2I18 A;  3FWC A;  4OR9 B;  1CKK A;  5EL2 A;  3SS4 A;  4NDB A;  3WHT B;  4E68 A;  1NUB A;  1UHI A;  3O4X A;  2JU0 A;  1ZAC A;  3R1P A;  4D1E A;  3DF0 B;  1CDM A;  2LCP A;  2WCL A;  3BYA A;  1S36 A;  1EL4 A;  3VRO A;  2I7A A;  1G33 A;  5IBW A;  3F45 A;  3BOW B;  2M7N A;  1SY9 A;  3I5I B;  4DRW A;  3L4A A;  1QWV A;  5FYX A;  4FQT A;  3MSE B;  4BY5 A;  1EJ3 A;  2I2R E;  2M29 A;  4XYN A;  1RK9 A;  1WLM A;  3D75 A;  1AJ4 A;  1HT9 A;  1PSR A;  2LMT A;  4GGF C;  3CZ2 A;  3OBV A;  1SNL A;  4N1F A;  5DKR A;  4CID A;  2BBN A;  3VGO A;  3SS5 A;  2MJW B;  1EG4 A;  1OW4 A;  1F4O A;  1PSB A;  2M8U A;  1BLQ A;  3BUX B;  5HLO A;  2KI4 B;  4OKH A;  1B7T Z;  1TNP A;  1B47 A;  1JF0 A;  2CTN A;  3BUM B;  3FWB A;  5HL1 A;  2LHL A;  4MBE A;  2V53 A;  2WOS A;  2LHI A;  1KK8 B;  2FJU B;  2H2K A;  2WCB A;  3M0W A;  4MZL A;  4ETO A;  2JC2 A;  3S0F A;  2EGD A;  2F33 A;  2HF5 A;  4WRI A;  1UHH A;  1QV1 A;  2Q91 A;  4A4B A;  1HQV A;  2JPO A;  2ZN9 A;  4AQJ A;  1QX5 B;  3SG7 A;  2GV5 A;  1BG1 A;  3TDZ A;  2WC5 A;  5AFP A;  1QAS A;  3CZ1 A;  1TIZ A;  4QJ4 B;  2PRU A;  2LVV A;  1Z2C B;  2HET A;  3DVK A;  2F2P A;  2WCK A;  5AER A;  4YGC B;  4YI9 A;  1IH0 A;  3TS5 C;  5D69 A;  1SBJ A;  3BXK A;  1DJI A;  4HRH A;  2MA2 A;  1R2U A;  4GGF A;  1SW8 A;  2B1U A;  1QIW A;  4HSZ A;  1V1G A;  3IQQ A;  1DQE A;  3OB1 B;  3OX6 A;  3N7H A;  1SL7 A;  4PHJ A;  3DD4 A;  4YGD B;  1OZO A;  2KOT A;  2KFF A;  2KYF A;  3TDU A;  3D77 A;  3SG2 A;  2LUX A;  1F71 A; 
#chains in the Genus database with same CATH homology
 1TWO A;  3QME A;  1GM0 A;  1OOI X;  3NGV A;  2P70 A;  2QEH A;  3Q8I A;  3CDN A;  4OZD A;  2PQL A;  3S0G A;  3R72 A;  1P28 A;  2P71 A;  3RZS A;  2L2C A;  2QEB A;  3FE9 A;  3B6X A;  2QDI A;  2QEO A;  2H8V A;  2ERB A;  4F7F A;  3PJI A;  3BJH A;  3VB1 A;  3OGN A;  3L4L A;  1OOG A;  1OOF A;  3S0A A;  4INX A;  3FE6 A;  1C3Y A;  2WCJ A;  5EL2 A;  3DXL A;  2FJY A;  3BFA A;  3R1V A;  2KPH A;  3R1P A;  3FE8 A;  3R1O A;  2WCL A;  1C3Z A;  3NHT A;  3S0B A;  4INW A;  2WC6 A;  1ORG A;  2WCM A;  3L4A A;  1QWV A;  4FQT A;  1LS8 A;  3D75 A;  2GTE A;  3CZ2 A;  3DY9 A;  1OW4 A;  3K1E A;  2WCH A;  3D78 A;  5DIC A;  3D73 A;  4JD9 A;  3L47 A;  3S0F A;  3B87 A;  3NHI A;  2JPO A;  3BFH A;  3S0D A;  2WC5 A;  1TUJ A;  3CZ1 A;  3CAB A;  3B86 A;  2QEV A;  1T14 A;  2WCK A;  3CZ0 A;  3V2L A;  4PT1 A;  3CYZ A;  3B7A A;  1DQE A;  3DYE A;  3N7H A;  1OOH A;  3BFB A;  3S0E A;  1XFR A;  3D77 A;  3DZT A;  3D74 A;  3B88 A;  3D76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...