2QEVA

Crystal structure of anopheles gambiae d7r4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
145
structure length
145
Chain Sequence
METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
total genus 56
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qevA00
3B6XA 3B88A 2WCMA 3FE9A 1P28A 3S0GA 4F7FA 3R1OA 1OOHA 3DYEA 2WC6A 2PQLA 1ORGA 4INXA 3CZ1A 1DQEA 3QMEA 3K1EA 3CYZA 3DY9A 3BJHA 2WCHA 3PJIA 3L47A 2P71A 1OOFA 3CZ0A 3CZ2A 2WCKA 4FQTA 2QEHA 1C3ZA 3CDNA 3DZTA 4OZDA 5DICA 3NHIA 3RZSA 1OOIX 3OGNA 2P70A 1OW4A 3VB1A 2L2CA 3Q8IA 3B86A 3D78A 1GM0A 1LS8A 3NHTA 3V2LA 3R1PA 2QEVA 2GTEA 2JPOA 1C3YA 3D73A 2WCJA 3R1VA 3N7HA 1OOGA 1T14A 2QEOA 3L4AA 3R72A 4JD9A 2QDIA 3D75A 3FE8A 3S0EA 3D74A 3D76A 2ERBA 2KPHA 3CABA 3B87A 3B7AA 3DXLA 3S0FA 1XFRA 3S0AA 3L4LA 4PT1A 3BFAA 3S0BA 2WCLA 3NGVA 3FE6A 2QEBA 3BFHA 3D77A 2FJYA 3BFBA 5EL2A 1TUJA 4INWA 1TWOA 1QWVA 2H8VA 3S0DA 2WC5A
chains in the Genus database with same CATH superfamily
3B6XA 2WCFA 1QIWA 3FE9A 1K96A 1MF8B 1N2DA 1PALA 2D8NA 1P28A 2ZN9A 3D10A 4GFTA 4GGFA 5CSIA 3S0GA 1AK8A 2Q4UA 2CCMA 2LLSA 1M46A 1ZACA 4PDZA 5I2LA 4OVNF 2KI6C 2CTNA 1QX2A 2EHBA 2BBNA 3CZ1A 1FW4A 1YVHA 3O78A 5AXIA 1B8CA 3AKAA 1OMRA 1A4PA 4DRWA 1F8HA 2LMTA 3KEVA 1DT7B 1SMGA 3DY9A 2JU0A 3PM8A 4OR9B 5JOLA 3CLNA 4HRHA 2LHLA 2KI6D 3CWGA 3O4YA 1QV1A 1DELA 1DJGA 1SL7A 1WLMA 3IF7A 3LK1A 3CZ2A 3DVMA 4FQTA 4PE1A 5PALA 5I2QA 4C0JA 2QEHA 2WOSA 2F3YA 1JUOA 1NX1A 3DVEA 3EKHA 3LLEA 5BPJA 3CDNA 3OBVA 1SBJA 2BE4A 4OZDA 1KFUS 5KTYA 2QPTA 3O6BA 1C7VA 2JT3A 4YGBB 1KWOC 4M2QA 2JT8A 1CKKA 2ZN8A 1OOIX 3SS3A 2JXCA 1NWDA 1QLSA 1MWNA 2MBXA 2QACA 4PHNA 3BYAA 3OGNA 2HQ8A 1PULA 1YX7A 1ALWA 2HQWA 2K7DA 2P70A 3BOWB 1J55A 2LUXA 1CB1A 1JF2A 5B8IB 1Z4HA 2NLNA 3H4SE 4MN0A 1B8LA 2FJUB 3I5IC 1XVJA 3NHTA 2L4IA 3NSKA 2K61A 2KQ6A 1M39A 2KI4B 3KO0A 3DVJA 3IQQA 1S3PA 5D69A 3V2LA 3A4UB 3JTDC 1SCVA 2JWWA 5FI7A 1QASA 2KLEA 1BJFA 1TRFA 3GK4X 4YBHB 1UHHA 5GQQC 1PRWA 3PFVA 4BY4A 2LCPA 2K7BA 4PALA 5CSFA 2BE6A 3L4AA 1AVSA 1Q80A 4NDDA 1K8UA 2F2OA 4ORAB 2P6BB 2ZKMX 5G08A 2HPSA 3KPXA 1DJXA 2KGBC 1J7RA 3F45A 1DEKA 3IQOA 1OZOA 1SCMB 3SG4A 1SSEB 2I2RE 2BL0C 4ORBB 1R2UA 2GGMA 4YI9A 4AOMA 2KPHA 3RLZA 3B87A 3B7AA 4DCKA 2OPOA 2PALA 1L2OB 1SR6C 1OOJA 2JOJA 1TUZA 4CIDA 2LLUA 1DJZA 4PHJA 1XK4A 1MHOA 1PVAA 1YRTB 5FI6A 4MZLA 2M97A 3A8RA 1NCXA 2BNXA 2H2KA 3SG6A 2LP3A 1Z2CB 4YRUA 1Y1AA 2WCLA 3SIBA 3VRQA 3SG3A 3WXAA 2GGZA 1F71A 1SKTA 4HRGA 1TCOB 2QEBA 3FE6A 1U5IB 3CR4X 1K94A 3JVTB 3KF9A 4GUKA 2AAOA 1J7PA 3HCMA 2BAPA 1TNPA 2PMYA 1TTXA 1NP8A 1KK8B 2CNPA 3M0WA 2WC8A 4CLNA 1G33A 2KFFA 1K2HA 3UO9A 1S5GZ 1XFZO 1MXLC 2FCDA 2MLEC 3TUYC 3RZSA 4I5KA 5F6TA 3OX5A 2H61A 4XJKB 2BKIB 3EVVA 4MZKA 3OP0A 1FI5A 1WRZA 3BOWA 4U8DA 1B47A 1G8IA 4OCIA 3K21A 1GQMA 2MJWB 5CSNA 1UHNA 2M29A 3QMEA 1HT9A 4Q04A 1CDLA 1X02A 1PVBA 2LE9B 2Y1MA 5HKWA 1IKUA 1XFWO 1KK7Y 1RJVA 2AMIA 1K9UA 2KQYA 4AQIA 4P2YB 3BXKA 4YGAA 2F3ZA 3AAJA 1LVCD 1F54A 1G4YR 3BUWB 3CZ0A 3IVTA 1RECA 4FTGA 2DOQA 1E8AA 4MBEA 2L0PA 2B1UA 2NCOA 1MUXA 1TOPA 3PM2A 4NDCA 1C3ZA 1SYMA 3WNXB 1KCYA 2LMVA 3DZTA 4ORCB 3SIAA 4DS7A 3D0YB 2M3WA 5D7FA 1YX8A 1KQVA 2OS8C 2LVVA 3PN7C 2I18A 1GJYA 2KGRA 1QJTA 4OKHA 2YGUA 2LUCA 1DMOA 1MXEA 2MA2A 4C0LA 3VROA 1NPQA 3Q8IA 3RM1A 4YGEB 4JKTA 4WQ2A 4GAOA 5J3XA 1NCZA 1WDCC 2L51A 4CFQA 1DVIA 5KU1A 1U5IA 2M1KB 1C3YA 1XFVO 2M1UA 5CSJA 1ZFSA 4QJ4B 3CR5X 2Y5IA 2M7LA 1KSOA 4MSPA 3VGOA 5FI2A 3CR2A 4R1EA 3N7HA 3I5GC 3LK0A 1T14A 5ER4X 1EL4A 1NUBA 1UHKA 3EKJA 3OX6A 1IG5A 1QXPA 3TS5B 3BUNB 3E3RA 4XJKA 4UPGA 2L2EA 3FE8A 3S0EA 3I5HC 2F2PA 2I7AA 1BOCA 1SR6B 3D76A 3VRNA 2LMUA 5I2OA 1K90D 1M31A 1QS7A 1JF0A 2KSPA 3QRXA 1CFCA 1PSBA 1QTXA 3WHTB 1TN4A 1ALVA 2ERBA 2LC5A 1LKJA 1SRAA 2V53A 1FPWA 2HETA 2OTGB 3SG7A 4PHKA 5TNCA 1QX5B 1DGUA 1B7TZ 1LA0A 1QX7A 3PATA 1QIVA 1OMDA 3S0BA 1J1DA 2EC6C 3CS1A 4CPVA 1UP5A 3NSIA 3AKBA 2K0JA 3NGVA 1M45A 2COLB 1S6CA 1BLQA 2KDHA 2A4JA 2KYCA 3CTNA 4PE4A 1EH2A 2KYFA 2KAVA 1AUIB 2FJYA 1MR8A 2PSRA 3BFBA 1F4OA 3D77A 3NSLA 4I5JA 4DUQA 1TUJA 1XA5A 3DF0B 1N0YA 1TWOA 3D0YA 1IQ3A 4N1GA 2SCPA 1QVIZ 1IGVA 1NX0A 1ZMZA 2RGIA 3BQ3A 2E30A 4ICBA 3O2PA 2L4HA 3HX4A 4GGNA 4WRIA 1XK4C 1UHIA 3DD4A 4F7FA 3R1OA 1R6PA 2L98A 1OOHA 4A4BA 1BF5A 2WC6A 4QJ5B 3EVUA 5AEQA 4A4CA 5HYDA 1V1FA 1JFJA 3LL8B 3VRRA 1A2XA 1ZOTB 1RTP1 3CZTX 1BG1A 1SW8A 4WQ3A 3EK7A 1KQMC 2JPTA 2LLTA 3FWBA 1TNXA 2AUCA 4FQOA 3CYZA 1WY9A 1DGVA 5CPVA 2NZ0A 3BJHA 1BU3A 4MZJA 2KBMA 2WCHA 1VRKA 3GOFA 2JTZA 1AHRA 1CFDA 3OHMB 1V1GA 1TNWA 3L47A 1KFXL 1FF1A 1CDNA 3FS7A 2JNXA 1BR1B 2H61C 1OOFA 2ZFDA 1J1EA 2MRDA 1JFKA 1F4QA 2NXQA 2PASA 1A03A 5JJGA 2BCAA 2LM5A 1XFUO 2K7OA 3EK4A 3I5FC 4YGDB 5HLOA 1N65A 2KFHA 1PK0D 3ZWHA 2ZNDA 1EXRA 2TN4A 3ICBA 4P5OE 2ISDA 2KI4C 4XYNA 4D1EA 1DC1A 3DVKA 3BUMB 1L7ZA 1H4BA 1CLMA 1UURA 1OW4A 1EG4A 2JXLA 3SG2A 1SNLA 2I94A 3VB1A 2LANA 2EGDA 4JPZB 3B86A 3D78A 4IJ7A 1LA3A 1LS8A 1XFXO 2WCBA 4ETOA 4GNKB 1J7QA 1KWOB 3SS4A 1NX3A 2QEVA 1SCMC 2GTEA 2PVBA 4MRXA 5HKYA 2K2AA 2KLDA 4GGFC 1RROA 4ZCVA 1A75B 2JULA 2K7CA 3FIAA 1AJ4A 1RFJA 1YUTA 3DF0A 1YUUA 1OOGA 3LCPC 2NCPA 1SL8A 2QEOA 1AP4A 1JWDA 1CMFA 1L2OC 3SJSA 3I5IB 1BT6A 2SASA 2LVJA 3D75A 4F0ZB 1CFPA 1QV0A 2JRFA 3NSOA 3JTDB 1D1OA 2F33A 4KYNA 4BY5A 5I94A 1MQ1A 1Y0VH 4OV2A 1DTLA 5ER5A 5AFPA 1GGWA 1RK9A 1HQVA 3CABA 3AAKA 1S6IA 3TDZA 1YUSA 3JVTC 1NYAA 3EG5B 3S0AA 1GGZA 3L4LA 1BODA 2CXJA 2BECA 5HLVA 1KK8C 1XO5A 3KHEA 2WCEA 1EJ3A 3EVRA 5HKZA 1BMOA 1B1GA 1SL9A 1CTRA 2BL0B 2M9GA 1K95A 3NXAA 1Y1XA 5FYXA 1H8BA 1QATA 4C0KA 2WNDA 1F55A 2O5GA 2BCXA 2KBIA 5DKRA 4TNCA 2F8PA 2FCEA 2KAYA 1IH0A 2Y1NA 5HL1A 1RWYA 1S5GY 4HSZA 1OQPA 2HF5A 3S0DA 2WC5A 1K9PA 1KQMB 2L50A 3B88A 3PLFB 1A29A 1TNQA 3SG5A 2WCMA 2L5XB 3WHUB 1B8RA 1B9AA 2LVKA 1NSHA 3CGAA 4HREE 2KAXA 4QJ3B 1CLBA 1DF0B 1DJIA 2M7NA 3DYEA 2PQLA 1BR4B 2GV5A 3OB2B 4MRYA 1ORGA 4INXA 4I5LB 4I5NB 1DQEA 5AERA 2PYQA 1S36A 2JZIA 3TUYB 3UNWA 3K1EA 1QLKA 1W9ZA 3OB1B 4JWQA 1A75A 2JT0A 3PJIA 1SPYA 1KK7Z 1OMVA 3I5FB 1S6JA 2KNEA 1F70A 5I8NA 1TIZA 1K9KA 1C7WA 1OZSA 2KFGA 2P71A 2K60A 5K89A 2WCKA 2WORA 1KFXS 2PRUA 2MAZA 5KSZA 1JSAA 2BBMA 1KFUL 1NIWA 1M63B 1CM4A 4GBAA 1UHJA 5DICA 1JC2A 3NHIA 1IQ5A 1YRUB 2JQ6A 3PALA 4CFRA 3GK1A 1ZUZA 4GPLB 3O4XA 1CFFA 5AANA 1IJ6A 1WLZA 4IL1A 4PE7A 3VRPA 5D3OA 1K93D 2ZRTA 3BUXB 1AJ5A 4PCWA 3BUOB 2LNKA 2JTTA 1CMGA 1YVLA 2L2CA 2MHHA 5IBWA 1SY9A 2FOTA 4NDBA 4PHMA 1IIOA 2KOTA 1GM0A 2Q91A 3TS5C 4N5XA 4USLA 1ODBA 2M49B 1LXFC 3R1PA 2JPOA 1UWOA 4L9MA 2BCBA 2VRGA 3D73A 1XFYO 2OS8B 4E68A 3PSRA 3PN7B 1FI6A 4N1FA 2L5YA 1S1EA 2WCJA 5DKNA 3R1VA 1KSMA 1OE9B 1TCFA 1W7JB 3EK8A 1CDMA 1Y6WA 3R72A 1CNPA 2ZRSA 1DJHA 4JD9A 1EG3A 2OTGC 4M2OA 1WDCB 2QDIA 1IRJA 2G9BA 1UUSA 1YTZC 3D74A 1DJYA 2KHNA 2O60A 2R2IA 1NX2A 2K8MB 1WRLA 2LV7A 1DF0A 4AQJA 2CT9A 2MLFC 4MEWA 2E6WA 2LHIA 2BKHB 3SS5A 3C1VA 3I5GB 2LP2A 1NCYA 1FBVA 2LVIA 3DXLA 2M8UA 3S0FA 1XFRA 1B4CA 1S26D 4MVFA 1CLLA 4ZCUA 4PT1A 1CM1A 2JNFA 1B7TY 3I5HB 1LINA 1YURA 3MSEB 2K2FA 5DKQA 3BFAA 1CDPA 2JC2A 4YI8A 4MLWA 2IS9A 1W7IB 1Y1UA 1XYDA 3GK2A 1C07A 2Y4QA 4PE0A 1DJWA 1WRKA 1J7OA 1JBAA 3FWCA 3TDIA 1PSRA 1OSAA 2M0RA 3BFHA 1YR5A 2LAPA 4JQ0D 5EL2A 1SK6D 2G2BA 4NQGA 2ZNEA 4DIRA 4INWA 1IWQA 3TDUA 1QWVA 2CBLA 2EC6B 4YGCB 3TZ1A 3ZNIA 2H8VA 1QVIY 1IJ5A 4M2PA
chains in the Genus database with same CATH topology
3B6XA 3B88A 2WCMA 3FE9A 1P28A 3S0GA 4F7FA 3R1OA 1OOHA 3DYEA 2WC6A 2PQLA 1ORGA 4INXA 3CZ1A 1DQEA 3QMEA 3K1EA 3CYZA 3DY9A 3BJHA 2WCHA 3PJIA 3L47A 2P71A 1OOFA 3CZ0A 3CZ2A 2WCKA 4FQTA 2QEHA 1C3ZA 3CDNA 3DZTA 4OZDA 5DICA 3NHIA 3RZSA 1OOIX 3OGNA 2P70A 1OW4A 3VB1A 2L2CA 3Q8IA 3B86A 3D78A 1GM0A 1LS8A 3NHTA 3V2LA 3R1PA 2QEVA 2GTEA 2JPOA 1C3YA 3D73A 2WCJA 3R1VA 3N7HA 1OOGA 1T14A 2QEOA 3L4AA 3R72A 4JD9A 2QDIA 3D75A 3FE8A 3S0EA 3D74A 3D76A 2ERBA 2KPHA 3CABA 3B87A 3B7AA 3DXLA 3S0FA 1XFRA 3S0AA 3L4LA 4PT1A 3BFAA 3S0BA 2WCLA 3NGVA 3FE6A 2QEBA 3BFHA 3D77A 2FJYA 3BFBA 5EL2A 1TUJA 4INWA 1TWOA 1QWVA 2H8VA 3S0DA 2WC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6X A;  3B88 A;  2WCM A;  3FE9 A;  1P28 A;  3S0G A;  4F7F A;  3R1O A;  1OOH A;  3DYE A;  2WC6 A;  2PQL A;  1ORG A;  4INX A;  3CZ1 A;  1DQE A;  3QME A;  3K1E A;  3CYZ A;  3DY9 A;  3BJH A;  2WCH A;  3PJI A;  3L47 A;  2P71 A;  1OOF A;  3CZ0 A;  3CZ2 A;  2WCK A;  4FQT A;  2QEH A;  1C3Z A;  3CDN A;  3DZT A;  4OZD A;  5DIC A;  3NHI A;  3RZS A;  1OOI X;  3OGN A;  2P70 A;  1OW4 A;  3VB1 A;  2L2C A;  3Q8I A;  3B86 A;  3D78 A;  1GM0 A;  1LS8 A;  3NHT A;  3V2L A;  3R1P A;  2QEV A;  2GTE A;  2JPO A;  1C3Y A;  3D73 A;  2WCJ A;  3R1V A;  3N7H A;  1OOG A;  1T14 A;  2QEO A;  3L4A A;  3R72 A;  4JD9 A;  2QDI A;  3D75 A;  3FE8 A;  3S0E A;  3D74 A;  3D76 A;  2ERB A;  2KPH A;  3CAB A;  3B87 A;  3B7A A;  3DXL A;  3S0F A;  1XFR A;  3S0A A;  3L4L A;  4PT1 A;  3BFA A;  3S0B A;  2WCL A;  3NGV A;  3FE6 A;  2QEB A;  3BFH A;  3D77 A;  2FJY A;  3BFB A;  5EL2 A;  1TUJ A;  4INW A;  1TWO A;  1QWV A;  2H8V A;  3S0D A;  2WC5 A; 
#chains in the Genus database with same CATH topology
 3B6X A;  2WCF A;  1QIW A;  3FE9 A;  1K96 A;  1MF8 B;  1N2D A;  1PAL A;  2D8N A;  1P28 A;  2ZN9 A;  3D10 A;  4GFT A;  4GGF A;  5CSI A;  3S0G A;  1AK8 A;  2Q4U A;  2CCM A;  2LLS A;  1M46 A;  1ZAC A;  4PDZ A;  5I2L A;  4OVN F;  2KI6 C;  2CTN A;  1QX2 A;  2EHB A;  2BBN A;  3CZ1 A;  1FW4 A;  1YVH A;  3O78 A;  5AXI A;  1B8C A;  3AKA A;  1OMR A;  1A4P A;  4DRW A;  1F8H A;  2LMT A;  3KEV A;  1DT7 B;  1SMG A;  3DY9 A;  2JU0 A;  3PM8 A;  4OR9 B;  5JOL A;  3CLN A;  4HRH A;  2LHL A;  2KI6 D;  3CWG A;  3O4Y A;  1QV1 A;  1DEL A;  1DJG A;  1SL7 A;  1WLM A;  3IF7 A;  3LK1 A;  3CZ2 A;  3DVM A;  4FQT A;  4PE1 A;  5PAL A;  5I2Q A;  4C0J A;  2QEH A;  2WOS A;  2F3Y A;  1JUO A;  1NX1 A;  3DVE A;  3EKH A;  3LLE A;  5BPJ A;  3CDN A;  3OBV A;  1SBJ A;  2BE4 A;  4OZD A;  1KFU S;  5KTY A;  2QPT A;  3O6B A;  1C7V A;  2JT3 A;  4YGB B;  1KWO C;  4M2Q A;  2JT8 A;  1CKK A;  2ZN8 A;  1OOI X;  3SS3 A;  2JXC A;  1NWD A;  1QLS A;  1MWN A;  2MBX A;  2QAC A;  4PHN A;  3BYA A;  3OGN A;  2HQ8 A;  1PUL A;  1YX7 A;  1ALW A;  2HQW A;  2K7D A;  2P70 A;  3BOW B;  1J55 A;  2LUX A;  1CB1 A;  1JF2 A;  5B8I B;  1Z4H A;  2NLN A;  3H4S E;  4MN0 A;  1B8L A;  2FJU B;  3I5I C;  1XVJ A;  3NHT A;  2L4I A;  3NSK A;  2K61 A;  2KQ6 A;  1M39 A;  2KI4 B;  3KO0 A;  3DVJ A;  3IQQ A;  1S3P A;  5D69 A;  3V2L A;  3A4U B;  3JTD C;  1SCV A;  2JWW A;  5FI7 A;  1QAS A;  2KLE A;  1BJF A;  1TRF A;  3GK4 X;  4YBH B;  1UHH A;  5GQQ C;  1PRW A;  3PFV A;  4BY4 A;  2LCP A;  2K7B A;  4PAL A;  5CSF A;  2BE6 A;  3L4A A;  1AVS A;  1Q80 A;  4NDD A;  1K8U A;  2F2O A;  4ORA B;  2P6B B;  2ZKM X;  5G08 A;  2HPS A;  3KPX A;  1DJX A;  2KGB C;  1J7R A;  3F45 A;  1DEK A;  3IQO A;  1OZO A;  1SCM B;  3SG4 A;  1SSE B;  2I2R E;  2BL0 C;  4ORB B;  1R2U A;  2GGM A;  4YI9 A;  4AOM A;  2KPH A;  3RLZ A;  3B87 A;  3B7A A;  4DCK A;  2OPO A;  2PAL A;  1L2O B;  1SR6 C;  1OOJ A;  2JOJ A;  1TUZ A;  4CID A;  2LLU A;  1DJZ A;  4PHJ A;  1XK4 A;  1MHO A;  1PVA A;  1YRT B;  5FI6 A;  4MZL A;  2M97 A;  3A8R A;  1NCX A;  2BNX A;  2H2K A;  3SG6 A;  2LP3 A;  1Z2C B;  4YRU A;  1Y1A A;  2WCL A;  3SIB A;  3VRQ A;  3SG3 A;  3WXA A;  2GGZ A;  1F71 A;  1SKT A;  4HRG A;  1TCO B;  2QEB A;  3FE6 A;  1U5I B;  3CR4 X;  1K94 A;  3JVT B;  3KF9 A;  4GUK A;  2AAO A;  1J7P A;  3HCM A;  2BAP A;  1TNP A;  2PMY A;  1TTX A;  1NP8 A;  1KK8 B;  2CNP A;  3M0W A;  2WC8 A;  4CLN A;  1G33 A;  2KFF A;  1K2H A;  3UO9 A;  1S5G Z;  1XFZ O;  1MXL C;  2FCD A;  2MLE C;  3TUY C;  3RZS A;  4I5K A;  5F6T A;  3OX5 A;  2H61 A;  4XJK B;  2BKI B;  3EVV A;  4MZK A;  3OP0 A;  1FI5 A;  1WRZ A;  3BOW A;  4U8D A;  1B47 A;  1G8I A;  4OCI A;  3K21 A;  1GQM A;  2MJW B;  5CSN A;  1UHN A;  2M29 A;  3QME A;  1HT9 A;  4Q04 A;  1CDL A;  1X02 A;  1PVB A;  2LE9 B;  2Y1M A;  5HKW A;  1IKU A;  1XFW O;  1KK7 Y;  1RJV A;  2AMI A;  1K9U A;  2KQY A;  4AQI A;  4P2Y B;  3BXK A;  4YGA A;  2F3Z A;  3AAJ A;  1LVC D;  1F54 A;  1G4Y R;  3BUW B;  3CZ0 A;  3IVT A;  1REC A;  4FTG A;  2DOQ A;  1E8A A;  4MBE A;  2L0P A;  2B1U A;  2NCO A;  1MUX A;  1TOP A;  3PM2 A;  4NDC A;  1C3Z A;  1SYM A;  3WNX B;  1KCY A;  2LMV A;  3DZT A;  4ORC B;  3SIA A;  4DS7 A;  3D0Y B;  2M3W A;  5D7F A;  1YX8 A;  1KQV A;  2OS8 C;  2LVV A;  3PN7 C;  2I18 A;  1GJY A;  2KGR A;  1QJT A;  4OKH A;  2YGU A;  2LUC A;  1DMO A;  1MXE A;  2MA2 A;  4C0L A;  3VRO A;  1NPQ A;  3Q8I A;  3RM1 A;  4YGE B;  4JKT A;  4WQ2 A;  4GAO A;  5J3X A;  1NCZ A;  1WDC C;  2L51 A;  4CFQ A;  1DVI A;  5KU1 A;  1U5I A;  2M1K B;  1C3Y A;  1XFV O;  2M1U A;  5CSJ A;  1ZFS A;  4QJ4 B;  3CR5 X;  2Y5I A;  2M7L A;  1KSO A;  4MSP A;  3VGO A;  5FI2 A;  3CR2 A;  4R1E A;  3N7H A;  3I5G C;  3LK0 A;  1T14 A;  5ER4 X;  1EL4 A;  1NUB A;  1UHK A;  3EKJ A;  3OX6 A;  1IG5 A;  1QXP A;  3TS5 B;  3BUN B;  3E3R A;  4XJK A;  4UPG A;  2L2E A;  3FE8 A;  3S0E A;  3I5H C;  2F2P A;  2I7A A;  1BOC A;  1SR6 B;  3D76 A;  3VRN A;  2LMU A;  5I2O A;  1K90 D;  1M31 A;  1QS7 A;  1JF0 A;  2KSP A;  3QRX A;  1CFC A;  1PSB A;  1QTX A;  3WHT B;  1TN4 A;  1ALV A;  2ERB A;  2LC5 A;  1LKJ A;  1SRA A;  2V53 A;  1FPW A;  2HET A;  2OTG B;  3SG7 A;  4PHK A;  5TNC A;  1QX5 B;  1DGU A;  1B7T Z;  1LA0 A;  1QX7 A;  3PAT A;  1QIV A;  1OMD A;  3S0B A;  1J1D A;  2EC6 C;  3CS1 A;  4CPV A;  1UP5 A;  3NSI A;  3AKB A;  2K0J A;  3NGV A;  1M45 A;  2COL B;  1S6C A;  1BLQ A;  2KDH A;  2A4J A;  2KYC A;  3CTN A;  4PE4 A;  1EH2 A;  2KYF A;  2KAV A;  1AUI B;  2FJY A;  1MR8 A;  2PSR A;  3BFB A;  1F4O A;  3D77 A;  3NSL A;  4I5J A;  4DUQ A;  1TUJ A;  1XA5 A;  3DF0 B;  1N0Y A;  1TWO A;  3D0Y A;  1IQ3 A;  4N1G A;  2SCP A;  1QVI Z;  1IGV A;  1NX0 A;  1ZMZ A;  2RGI A;  3BQ3 A;  2E30 A;  4ICB A;  3O2P A;  2L4H A;  3HX4 A;  4GGN A;  4WRI A;  1XK4 C;  1UHI A;  3DD4 A;  4F7F A;  3R1O A;  1R6P A;  2L98 A;  1OOH A;  4A4B A;  1BF5 A;  2WC6 A;  4QJ5 B;  3EVU A;  5AEQ A;  4A4C A;  5HYD A;  1V1F A;  1JFJ A;  3LL8 B;  3VRR A;  1A2X A;  1ZOT B;  1RTP 1;  3CZT X;  1BG1 A;  1SW8 A;  4WQ3 A;  3EK7 A;  1KQM C;  2JPT A;  2LLT A;  3FWB A;  1TNX A;  2AUC A;  4FQO A;  3CYZ A;  1WY9 A;  1DGV A;  5CPV A;  2NZ0 A;  3BJH A;  1BU3 A;  4MZJ A;  2KBM A;  2WCH A;  1VRK A;  3GOF A;  2JTZ A;  1AHR A;  1CFD A;  3OHM B;  1V1G A;  1TNW A;  3L47 A;  1KFX L;  1FF1 A;  1CDN A;  3FS7 A;  2JNX A;  1BR1 B;  2H61 C;  1OOF A;  2ZFD A;  1J1E A;  2MRD A;  1JFK A;  1F4Q A;  2NXQ A;  2PAS A;  1A03 A;  5JJG A;  2BCA A;  2LM5 A;  1XFU O;  2K7O A;  3EK4 A;  3I5F C;  4YGD B;  5HLO A;  1N65 A;  2KFH A;  1PK0 D;  3ZWH A;  2ZND A;  1EXR A;  2TN4 A;  3ICB A;  4P5O E;  2ISD A;  2KI4 C;  4XYN A;  4D1E A;  1DC1 A;  3DVK A;  3BUM B;  1L7Z A;  1H4B A;  1CLM A;  1UUR A;  1OW4 A;  1EG4 A;  2JXL A;  3SG2 A;  1SNL A;  2I94 A;  3VB1 A;  2LAN A;  2EGD A;  4JPZ B;  3B86 A;  3D78 A;  4IJ7 A;  1LA3 A;  1LS8 A;  1XFX O;  2WCB A;  4ETO A;  4GNK B;  1J7Q A;  1KWO B;  3SS4 A;  1NX3 A;  2QEV A;  1SCM C;  2GTE A;  2PVB A;  4MRX A;  5HKY A;  2K2A A;  2KLD A;  4GGF C;  1RRO A;  4ZCV A;  1A75 B;  2JUL A;  2K7C A;  3FIA A;  1AJ4 A;  1RFJ A;  1YUT A;  3DF0 A;  1YUU A;  1OOG A;  3LCP C;  2NCP A;  1SL8 A;  2QEO A;  1AP4 A;  1JWD A;  1CMF A;  1L2O C;  3SJS A;  3I5I B;  1BT6 A;  2SAS A;  2LVJ A;  3D75 A;  4F0Z B;  1CFP A;  1QV0 A;  2JRF A;  3NSO A;  3JTD B;  1D1O A;  2F33 A;  4KYN A;  4BY5 A;  5I94 A;  1MQ1 A;  1Y0V H;  4OV2 A;  1DTL A;  5ER5 A;  5AFP A;  1GGW A;  1RK9 A;  1HQV A;  3CAB A;  3AAK A;  1S6I A;  3TDZ A;  1YUS A;  3JVT C;  1NYA A;  3EG5 B;  3S0A A;  1GGZ A;  3L4L A;  1BOD A;  2CXJ A;  2BEC A;  5HLV A;  1KK8 C;  1XO5 A;  3KHE A;  2WCE A;  1EJ3 A;  3EVR A;  5HKZ A;  1BMO A;  1B1G A;  1SL9 A;  1CTR A;  2BL0 B;  2M9G A;  1K95 A;  3NXA A;  1Y1X A;  5FYX A;  1H8B A;  1QAT A;  4C0K A;  2WND A;  1F55 A;  2O5G A;  2BCX A;  2KBI A;  5DKR A;  4TNC A;  2F8P A;  2FCE A;  2KAY A;  1IH0 A;  2Y1N A;  5HL1 A;  1RWY A;  1S5G Y;  4HSZ A;  1OQP A;  2HF5 A;  3S0D A;  2WC5 A;  1K9P A;  1KQM B;  2L50 A;  3B88 A;  3PLF B;  1A29 A;  1TNQ A;  3SG5 A;  2WCM A;  2L5X B;  3WHU B;  1B8R A;  1B9A A;  2LVK A;  1NSH A;  3CGA A;  4HRE E;  2KAX A;  4QJ3 B;  1CLB A;  1DF0 B;  1DJI A;  2M7N A;  3DYE A;  2PQL A;  1BR4 B;  2GV5 A;  3OB2 B;  4MRY A;  1ORG A;  4INX A;  4I5L B;  4I5N B;  1DQE A;  5AER A;  2PYQ A;  1S36 A;  2JZI A;  3TUY B;  3UNW A;  3K1E A;  1QLK A;  1W9Z A;  3OB1 B;  4JWQ A;  1A75 A;  2JT0 A;  3PJI A;  1SPY A;  1KK7 Z;  1OMV A;  3I5F B;  1S6J A;  2KNE A;  1F70 A;  5I8N A;  1TIZ A;  1K9K A;  1C7W A;  1OZS A;  2KFG A;  2P71 A;  2K60 A;  5K89 A;  2WCK A;  2WOR A;  1KFX S;  2PRU A;  2MAZ A;  5KSZ A;  1JSA A;  2BBM A;  1KFU L;  1NIW A;  1M63 B;  1CM4 A;  4GBA A;  1UHJ A;  5DIC A;  1JC2 A;  3NHI A;  1IQ5 A;  1YRU B;  2JQ6 A;  3PAL A;  4CFR A;  3GK1 A;  1ZUZ A;  4GPL B;  3O4X A;  1CFF A;  5AAN A;  1IJ6 A;  1WLZ A;  4IL1 A;  4PE7 A;  3VRP A;  5D3O A;  1K93 D;  2ZRT A;  3BUX B;  1AJ5 A;  4PCW A;  3BUO B;  2LNK A;  2JTT A;  1CMG A;  1YVL A;  2L2C A;  2MHH A;  5IBW A;  1SY9 A;  2FOT A;  4NDB A;  4PHM A;  1IIO A;  2KOT A;  1GM0 A;  2Q91 A;  3TS5 C;  4N5X A;  4USL A;  1ODB A;  2M49 B;  1LXF C;  3R1P A;  2JPO A;  1UWO A;  4L9M A;  2BCB A;  2VRG A;  3D73 A;  1XFY O;  2OS8 B;  4E68 A;  3PSR A;  3PN7 B;  1FI6 A;  4N1F A;  2L5Y A;  1S1E A;  2WCJ A;  5DKN A;  3R1V A;  1KSM A;  1OE9 B;  1TCF A;  1W7J B;  3EK8 A;  1CDM A;  1Y6W A;  3R72 A;  1CNP A;  2ZRS A;  1DJH A;  4JD9 A;  1EG3 A;  2OTG C;  4M2O A;  1WDC B;  2QDI A;  1IRJ A;  2G9B A;  1UUS A;  1YTZ C;  3D74 A;  1DJY A;  2KHN A;  2O60 A;  2R2I A;  1NX2 A;  2K8M B;  1WRL A;  2LV7 A;  1DF0 A;  4AQJ A;  2CT9 A;  2MLF C;  4MEW A;  2E6W A;  2LHI A;  2BKH B;  3SS5 A;  3C1V A;  3I5G B;  2LP2 A;  1NCY A;  1FBV A;  2LVI A;  3DXL A;  2M8U A;  3S0F A;  1XFR A;  1B4C A;  1S26 D;  4MVF A;  1CLL A;  4ZCU A;  4PT1 A;  1CM1 A;  2JNF A;  1B7T Y;  3I5H B;  1LIN A;  1YUR A;  3MSE B;  2K2F A;  5DKQ A;  3BFA A;  1CDP A;  2JC2 A;  4YI8 A;  4MLW A;  2IS9 A;  1W7I B;  1Y1U A;  1XYD A;  3GK2 A;  1C07 A;  2Y4Q A;  4PE0 A;  1DJW A;  1WRK A;  1J7O A;  1JBA A;  3FWC A;  3TDI A;  1PSR A;  1OSA A;  2M0R A;  3BFH A;  1YR5 A;  2LAP A;  4JQ0 D;  5EL2 A;  1SK6 D;  2G2B A;  4NQG A;  2ZNE A;  4DIR A;  4INW A;  1IWQ A;  3TDU A;  1QWV A;  2CBL A;  2EC6 B;  4YGC B;  3TZ1 A;  3ZNI A;  2H8V A;  1QVI Y;  1IJ5 A;  4M2P A; 
#chains in the Genus database with same CATH homology
 3B6X A;  3B88 A;  2WCM A;  3FE9 A;  1P28 A;  3S0G A;  4F7F A;  3R1O A;  1OOH A;  3DYE A;  2WC6 A;  2PQL A;  1ORG A;  4INX A;  3CZ1 A;  1DQE A;  3QME A;  3K1E A;  3CYZ A;  3DY9 A;  3BJH A;  2WCH A;  3PJI A;  3L47 A;  2P71 A;  1OOF A;  3CZ0 A;  3CZ2 A;  2WCK A;  4FQT A;  2QEH A;  1C3Z A;  3CDN A;  3DZT A;  4OZD A;  5DIC A;  3NHI A;  3RZS A;  1OOI X;  3OGN A;  2P70 A;  1OW4 A;  3VB1 A;  2L2C A;  3Q8I A;  3B86 A;  3D78 A;  1GM0 A;  1LS8 A;  3NHT A;  3V2L A;  3R1P A;  2QEV A;  2GTE A;  2JPO A;  1C3Y A;  3D73 A;  2WCJ A;  3R1V A;  3N7H A;  1OOG A;  1T14 A;  2QEO A;  3L4A A;  3R72 A;  4JD9 A;  2QDI A;  3D75 A;  3FE8 A;  3S0E A;  3D74 A;  3D76 A;  2ERB A;  2KPH A;  3CAB A;  3B87 A;  3B7A A;  3DXL A;  3S0F A;  1XFR A;  3S0A A;  3L4L A;  4PT1 A;  3BFA A;  3S0B A;  2WCL A;  3NGV A;  3FE6 A;  2QEB A;  3BFH A;  3D77 A;  2FJY A;  3BFB A;  5EL2 A;  1TUJ A;  4INW A;  1TWO A;  1QWV A;  2H8V A;  3S0D A;  2WC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...