2QEVA

Crystal structure of anopheles gambiae d7r4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
145
structure length
145
Chain Sequence
METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
molecule keywords D7R4 Protein
total genus 56
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qevA00
3CZ0A 3S0AA 3S0GA 2ERBA 3V2LA 2WCHA 3NHTA 1LS8A 3D75A 1OOFA 2WCKA 5EL2A 3L4LA 3D78A 3NGVA 3D73A 2QEVA 3CZ1A 3BJHA 4OZDA 2GTEA 1QWVA 3DYEA 2WCJA 3BFAA 1OOGA 2QDIA 2JPOA 3Q8IA 3BFHA 1TWOA 2WCLA 3D77A 4FQTA 2P70A 3D76A 4INWA 2WC5A 3DXLA 3D74A 4F7FA 3CABA 1GM0A 3S0EA 3R72A 2WC6A 4JD9A 3B6XA 2P71A 3L47A 1C3YA 3R1PA 1OOHA 3R1OA 2KPHA 3DY9A 3BFBA 3RZSA 1OOIX 1OW4A 3FE6A 3NHIA 2QEHA 3FE9A 1P28A 3B87A 3CYZA 3N7HA 3CZ2A 2FJYA 1TUJA 2QEOA 3FE8A 3QMEA 3DZTA 3B7AA 1XFRA 2QEBA 3PJIA 3K1EA 2PQLA 4PT1A 2WCMA 1C3ZA 3OGNA 1DQEA 4INXA 3B88A 5DICA 2L2CA 1T14A 3VB1A 3CDNA 3R1VA 2H8VA 3S0DA 3S0BA 3S0FA 3B86A 1ORGA 3L4AA
chains in the Genus database with same CATH superfamily
2MAZA 1ZACA 2OS8C 1DVIA 1S6IA 3S0AA 3TS5B 4F0ZB 3S0GA 4GUKA 2CCMA 4MEWA 2CTNA 1QIWA 1XA5A 3IF7A 1AK8A 1QX7A 2KGBC 3WXAA 1V1FA 3LCPC 1IIOA 1W7JB 1F71A 3NHTA 1N65A 1LS8A 5HKZA 3KO0A 4C0KA 1M45A 5EL2A 2Y1MA 4NDCA 1IJ5A 1IJ6A 1NUBA 2E6WA 3D78A 3QRXA 4PDZA 1BJFA 1BR4B 2LANA 2QEVA 2KNEA 3F45A 4MZLA 1OMRA 1LA0A 3EKHA 2NCOA 1IWQA 3PLFB 4JQ0D 4PE7A 4E68A 5AEQA 1R2UA 2KHNA 3BUMB 4ETOA 1F4QA 2AUCA 1HT9A 3SG4A 1J7PA 1NX2A 3BYAA 4NQGA 1TNXA 3IVTA 1Q80A 1DTLA 2IS9A 3EVRA 2LV7A 1S36A 1FPWA 5IBWA 1XVJA 3SG3A 2PRUA 1CLLA 1SL8A 1EG3A 1DF0B 2I18A 3BUWB 1LVCD 2KI6C 1G8IA 3D74A 4I5NB 3S0EA 3R72A 4I5JA 4PE1A 1WRLA 1G4YR 2CBLA 1OZSA 3SG7A 1UHIA 1JFJA 2H61C 1NSHA 2LP3A 2I7AA 2JXCA 1DJGA 2BAPA 1DJHA 1LKJA 3B6XA 1TN4A 3CTNA 1M63B 2NCPA 1UHNA 3TDUA 1JF2A 1F54A 1K9KA 1ZUZA 2M97A 1PSBA 1DEKA 1PULA 1B1GA 2AAOA 3FS7A 3L47A 2KI4B 5ER5A 3TUYC 2F3ZA 2ZNEA 1KCYA 2LM5A 1KK7Z 1S6CA 2KGRA 1MQ1A 2A4JA 2SASA 4GFTA 5JOLA 4A4CA 1RTP1 3SIAA 4MZKA 1JSAA 4PHJA 1OE9B 1J7RA 1PRWA 2MA2A 5KSZA 1M46A 4WQ2A 1PVAA 3RM1A 4DCKA 1NWDA 1SSEB 4N1FA 5I94A 2JNXA 3SIBA 1XFXO 1AP4A 1Y1AA 2BNXA 1AVSA 2KOTA 1OW4A 3FE6A 4DIRA 1B8LA 1ALVA 2ZN9A 1NX0A 1KK8C 4CIDA 1JWDA 2ZRSA 2EHBA 2VRGA 1SPYA 3SJSA 1VRKA 1XYDA 3IQOA 1J7OA 1CNPA 1JF0A 2PASA 1OMVA 2EC6C 3EKJA 1KWOB 3FE8A 1H8BA 1QVIZ 1KSOA 3WHUB 5DKQA 2QEBA 2KFFA 1YRTB 2KAXA 3DF0A 4NDBA 1BLQA 2DOQA 3PM8A 3I5IB 3VRRA 2HF5A 2L4IA 2CNPA 2WCMA 5D7FA 1A2XA 2G2BA 3SS3A 1F70A 3KF9A 1SCMB 3H4SE 4I5KA 2FCEA 3M0WA 2M0RA 4OKHA 3VB1A 1BOCA 3FWBA 5CSIA 3KPXA 2BE4A 1CDNA 1N0YA 2L5YA 3I5GB 4R1EA 3WHTB 1PVBA 4YI9A 3S0DA 3S0FA 1ORGA 1OOJA 1TUZA 5D3OA 2V53A 2KYFA 2K0JA 2K60A 4PCWA 3CZ0A 3NSIA 2Y5IA 1Z2CB 1CMFA 2LHIA 4PE4A 3SG5A 1IQ5A 3V2LA 1K96A 1K8UA 1AUIB 1UWOA 2GGMA 3AAJA 1A03A 2L98A 2WCBA 1FW4A 1OZOA 1TTXA 1SYMA 2WCKA 4KYNA 1UURA 1WDCB 1EL4A 2LLTA 2CXJA 2K7DA 3AKAA 3L4LA 2TN4A 1EG4A 5G08A 4QJ4B 5J3XA 1DC1A 4C0LA 4CFQA 1XFUO 3CZ1A 2ZRTA 2E30A 5CPVA 3KEVA 1TRFA 2MHHA 4UPGA 1B8RA 4OZDA 1Y0VH 1QWVA 2GTEA 4M2PA 4YI8A 1XK4A 1SBJA 3BFAA 1XK4C 2QDIA 3CR2A 2JPOA 1TNPA 5CSFA 2WCFA 4C0JA 1YX8A 4QJ5B 1CFPA 2JT8A 2LLSA 3LLEA 2H61A 1YVLA 1KSMA 1KWOC 4N5XA 3RLZA 4FQTA 1DJIA 2F8PA 1GGWA 5JJGA 2KAVA 4OVNF 4QJ3B 4JKTA 3BQ3A 1KFUL 1OSAA 2KI4C 1SY9A 2LMTA 3I5IC 1QV1A 2L5XB 3ZNIA 4F7FA 1GM0A 4GAOA 1QX2A 3CS1A 1LINA 1QIVA 2M1KB 2WC6A 2O5GA 1QTXA 1ZOTB 1IGVA 3O2PA 4ICBA 4PHNA 2ISDA 2L2EA 1TOPA 1KK7Y 1X02A 2QPTA 3DF0B 4ZCUA 5KTYA 1KFXL 2KFHA 1MUXA 1Y1XA 3AAKA 3EG5B 3SG6A 2KSPA 5TNCA 1TNWA 3D0YB 2PYQA 3BOWA 2RGIA 1H4BA 3GK1A 3EVVA 1CFCA 2BKIB 1KQMB 1IKUA 1MHOA 1K95A 4PALA 3LK0A 4YRUA 1CLMA 2L4HA 2L51A 5B8IB 3A8RA 2KPHA 3KHEA 1KQVA 1KFUS 3DY9A 3IQQA 3BFBA 3OX5A 4Q04A 2EC6B 3RZSA 1NCYA 5HL1A 5HYDA 2Y1NA 2FOTA 2OS8B 1F8HA 2K8MB 2WC8A 1SCVA 1NCXA 1RFJA 5CSNA 1ALWA 3SS5A 2QEHA 2NXQA 1P28A 1BR1B 2ZFDA 1DT7B 1UHHA 1XFWO 3VROA 1E8AA 1M31A 3SG2A 3UO9A 1LA3A 2KFGA 2M1UA 5CSJA 2FJYA 2M7NA 1B9AA 2BKHB 2QEOA 1JC2A 2ZKMX 4BY4A 3I5GC 3PN7C 4AOMA 3QMEA 2M8UA 3DZTA 2M29A 1EXRA 1XFRA 3OX6A 1YR5A 3PJIA 1DJXA 3D10A 2PQLA 2WORA 4ORBB 1C3ZA 3AKBA 1XO5A 1BU3A 2HPSA 3OGNA 4INXA 3VRNA 2COLB 1MXEA 1WLZA 1WLMA 1NIWA 2K61A 4MBEA 1K93D 1S26D 2BCAA 1K2HA 1T14A 1SL9A 3CDNA 3DD4A 1J55A 2H8VA 3JVTC 1IRJA 3DVEA 3B86A 1A75B 5K89A 3L4AA 2KBIA 3TUYB 1TNQA 2LE9B 2KLDA 2KDHA 1K90D 1UHJA 1QASA 4MZJA 1UP5A 3FWCA 2F2OA 2ZN8A 4DS7A 4ORAB 3CGAA 2G9BA 1NPQA 1Z4HA 2JU0A 1XFYO 4USLA 2LVJA 5D69A 3DVMA 4N1GA 2F3YA 2Y4QA 2LHLA 1OOFA 3C1VA 5I2LA 2Q91A 5PALA 2LNKA 1SR6C 2LP2A 3NGVA 4GNKB 1KK8B 3D73A 4HSZA 1YUTA 4XJKB 2BCBA 3I5HC 1CLBA 3BJHA 1QS7A 3WNXB 1J7QA 2M9GA 3CR4X 1QV0A 4YGDB 5I2OA 1CB1A 2HETA 4GGNA 2WCJA 1NX1A 3BUNB 3FIAA 1OOGA 1JBAA 2ZNDA 3OB1B 1TCFA 2JOJA 5HKWA 1YTZC 4YGCB 5AFPA 1WDCC 2KYCA 1RJVA 3NXAA 1FF1A 4FQOA 2BL0C 3BFHA 1TWOA 2WCLA 1C7VA 4HRHA 2EGDA 1MWNA 4INWA 4M2QA 2WC5A 5FI7A 2K2FA 4MRYA 1F55A 4AQIA 3CABA 4XJKA 1BT6A 4IJ7A 2LVKA 1N2DA 5FI6A 1CM4A 4PHMA 2LLUA 2PMYA 1K9UA 1S5GY 3BUXB 1XFZO 2K7OA 1KFXS 5F6TA 3VRQA 4BY5A 3E3RA 4U8DA 1UHKA 4DRWA 1SR6B 4OV2A 1DELA 3LK1A 2M49B 1B47A 3EK4A 2JT0A 5AANA 2LC5A 1SCMC 3EK8A 1U5IB 2WNDA 3NSLA 5AXIA 1R6PA 2BE6A 2LVVA 3R1PA 1GJYA 4D1EA 1RECA 1B7TZ 1OOHA 1NP8A 4P5OE 2P6BB 2LUCA 3R1OA 1A4PA 3PSRA 4MRXA 4YGAA 1CDPA 1UUSA 1GGZA 1YURA 1Y6WA 1YUSA 1CFDA 3D0YA 4DUQA 1CMGA 3PN7B 1IQ3A 1CDMA 1DF0A 1EH2A 4GGFA 1JFKA 3NHIA 4ORCB 1QLKA 3TDIA 2L50A 1CDLA 1TIZA 3B87A 3FE9A 1L2OC 1DGVA 3SS4A 2KBMA 1D1OA 1A29A 3VGOA 2D8NA 3GK4X 1BMOA 2F33A 2OPOA 3CYZA 1OQPA 3NSOA 3OP0A 1LXFC 2MLEC 3I5FB 1V1GA 3ICBA 1MF8B 2WOSA 1MXLC 3K1EA 3PM2A 2OTGC 2CT9A 1K9PA 3BXKA 1CTRA 1PK0D 2BBNA 1DQEA 1PALA 2M3WA 1RWYA 2FCDA 3BUOB 1A75A 2JC2A 3B88A 2PVBA 1DJYA 2QACA 4GPLB 5BPJA 5DICA 4M2OA 3JTDB 3K21A 1S6JA 1U5IA 2K7CA 1BF5A 5DKNA 5FI2A 1S3PA 1FI6A 3S0BA 1AHRA 4HRGA 2JRFA 2LVIA 2KI6D 1IH0A 1QJTA 2NZ0A 3O78A 4CLNA 3CR5X 1CKKA 2SCPA 1B8CA 1QATA 1CFFA 4PE0A 4YGEB 1XFVO 4L9MA 3TZ1A 4A4BA 3OBVA 2M7LA 1W7IB 2ERBA 1ZFSA 3JVTB 2KAYA 1MR8A 4MLWA 2WCHA 2HQWA 3D75A 1SKTA 2JTZA 4AQJA 3DVJA 2GGZA 2L0PA 2LAPA 1YVHA 2BECA 1YRUB 1NX3A 2I2RE 2K7BA 5I2QA 3PALA 3CWGA 3BOWB 3OB2B 4CPVA 2Q4UA 2HQ8A 3DYEA 3EVUA 3GOFA 1BG1A 1Y1UA 5I8NA 1WY9A 4WQ3A 3O4YA 2AMIA 3A4UB 2LMUA 2B1UA 3Q8IA 1SMGA 1DGUA 1L7ZA 3I5FC 1K94A 1QXPA 3D77A 1RK9A 2P70A 4YGBB 3LL8B 5HKYA 3D76A 2BL0B 2JTTA 1S5GZ 1C07A 1B4CA 4MVFA 1IG5A 1G33A 1BODA 3DXLA 5HLOA 4NDDA 2KLEA 1WRZA 2KQ6A 1JUOA 1WRKA 4XYNA 2JXLA 1YUUA 1SW8A 4JD9A 1SK6D 5HLVA 1YX7A 2JQ6A 1CM1A 1TCOB 1FI5A 1B7TY 2JZIA 2MLFC 3TS5C 3MSEB 1ZMZA 2P71A 4OCIA 1GQMA 3CLNA 1AJ4A 1DJZA 5FYXA 2WCEA 1SL7A 4HREE 2LCPA 3UNWA 4JWQA 1C3YA 2O60A 4JPZB 3PFVA 4YBHB 3EK7A 1EJ3A 4I5LB 5KU1A 2BBMA 4MSPA 2I94A 2JWWA 5DKRA 1SRAA 2H2KA 2K2AA 4ZCVA 1OOIX 2MJWB 2KQYA 3VRPA 1DJWA 2PSRA 4FTGA 1DMOA 1AJ5A 3GK2A 4MN0A 4CFRA 2JNFA 4PHKA 3N7HA 3CZ2A 4OR9B 3JTDC 1PSRA 1J1EA 1W9ZA 1TUJA 2JPTA 2PALA 4IL1A 4P2YB 4TNCA 1NYAA 2BCXA 1F4OA 3B7AA 2JT3A 1NCZA 3O4XA 1J1DA 4GGFC 2YGUA 2FJUB 3I5HB 3PATA 4PT1A 2LMVA 2GV5A 3HCMA 1FBVA 1SNLA 1HQVA 1L2OB 2F2PA 3NSKA 5ER4X 1KQMC 3HX4A 1C7WA 1QLSA 1QVIY 2OTGB 1S1EA 3CZTX 3O6BA 2L2CA 3DVKA 2LUXA 4GBAA 1QX5B 3TDZA 3R1VA 2MBXA 3ZWHA 1RROA 1OMDA 2JULA 1M39A 5GQQC 1ODBA 5AERA 3OHMB 2NLNA 4WRIA 2R2IA 2MRDA
chains in the Genus database with same CATH topology
3CZ0A 3S0AA 3S0GA 2ERBA 3V2LA 2WCHA 3NHTA 1LS8A 3D75A 1OOFA 2WCKA 5EL2A 3L4LA 3D78A 3NGVA 3D73A 2QEVA 3CZ1A 3BJHA 4OZDA 2GTEA 1QWVA 3DYEA 2WCJA 3BFAA 1OOGA 2QDIA 2JPOA 3Q8IA 3BFHA 1TWOA 2WCLA 3D77A 4FQTA 2P70A 3D76A 4INWA 2WC5A 3DXLA 3D74A 4F7FA 3CABA 1GM0A 3S0EA 3R72A 2WC6A 4JD9A 3B6XA 2P71A 3L47A 1C3YA 3R1PA 1OOHA 3R1OA 2KPHA 3DY9A 3BFBA 3RZSA 1OOIX 1OW4A 3FE6A 3NHIA 2QEHA 3FE9A 1P28A 3B87A 3CYZA 3N7HA 3CZ2A 2FJYA 1TUJA 2QEOA 3FE8A 3QMEA 3DZTA 3B7AA 1XFRA 2QEBA 3PJIA 3K1EA 2PQLA 4PT1A 2WCMA 1C3ZA 3OGNA 1DQEA 4INXA 3B88A 5DICA 2L2CA 1T14A 3VB1A 3CDNA 3R1VA 2H8VA 3S0DA 3S0BA 3S0FA 3B86A 1ORGA 3L4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ0 A;  3S0A A;  3S0G A;  2ERB A;  3V2L A;  2WCH A;  3NHT A;  1LS8 A;  3D75 A;  1OOF A;  2WCK A;  5EL2 A;  3L4L A;  3D78 A;  3NGV A;  3D73 A;  2QEV A;  3CZ1 A;  3BJH A;  4OZD A;  2GTE A;  1QWV A;  3DYE A;  2WCJ A;  3BFA A;  1OOG A;  2QDI A;  2JPO A;  3Q8I A;  3BFH A;  1TWO A;  2WCL A;  3D77 A;  4FQT A;  2P70 A;  3D76 A;  4INW A;  2WC5 A;  3DXL A;  3D74 A;  4F7F A;  3CAB A;  1GM0 A;  3S0E A;  3R72 A;  2WC6 A;  4JD9 A;  3B6X A;  2P71 A;  3L47 A;  1C3Y A;  3R1P A;  1OOH A;  3R1O A;  2KPH A;  3DY9 A;  3BFB A;  3RZS A;  1OOI X;  1OW4 A;  3FE6 A;  3NHI A;  2QEH A;  3FE9 A;  1P28 A;  3B87 A;  3CYZ A;  3N7H A;  3CZ2 A;  2FJY A;  1TUJ A;  2QEO A;  3FE8 A;  3QME A;  3DZT A;  3B7A A;  1XFR A;  2QEB A;  3PJI A;  3K1E A;  2PQL A;  4PT1 A;  2WCM A;  1C3Z A;  3OGN A;  1DQE A;  4INX A;  3B88 A;  5DIC A;  2L2C A;  1T14 A;  3VB1 A;  3CDN A;  3R1V A;  2H8V A;  3S0D A;  3S0B A;  3S0F A;  3B86 A;  1ORG A;  3L4A A; 
#chains in the Genus database with same CATH topology
 2MAZ A;  1ZAC A;  2OS8 C;  1DVI A;  1S6I A;  3S0A A;  3TS5 B;  4F0Z B;  3S0G A;  4GUK A;  2CCM A;  4MEW A;  2CTN A;  1QIW A;  1XA5 A;  3IF7 A;  1AK8 A;  1QX7 A;  2KGB C;  3WXA A;  1V1F A;  3LCP C;  1IIO A;  1W7J B;  1F71 A;  3NHT A;  1N65 A;  1LS8 A;  5HKZ A;  3KO0 A;  4C0K A;  1M45 A;  5EL2 A;  2Y1M A;  4NDC A;  1IJ5 A;  1IJ6 A;  1NUB A;  2E6W A;  3D78 A;  3QRX A;  4PDZ A;  1BJF A;  1BR4 B;  2LAN A;  2QEV A;  2KNE A;  3F45 A;  4MZL A;  1OMR A;  1LA0 A;  3EKH A;  2NCO A;  1IWQ A;  3PLF B;  4JQ0 D;  4PE7 A;  4E68 A;  5AEQ A;  1R2U A;  2KHN A;  3BUM B;  4ETO A;  1F4Q A;  2AUC A;  1HT9 A;  3SG4 A;  1J7P A;  1NX2 A;  3BYA A;  4NQG A;  1TNX A;  3IVT A;  1Q80 A;  1DTL A;  2IS9 A;  3EVR A;  2LV7 A;  1S36 A;  1FPW A;  5IBW A;  1XVJ A;  3SG3 A;  2PRU A;  1CLL A;  1SL8 A;  1EG3 A;  1DF0 B;  2I18 A;  3BUW B;  1LVC D;  2KI6 C;  1G8I A;  3D74 A;  4I5N B;  3S0E A;  3R72 A;  4I5J A;  4PE1 A;  1WRL A;  1G4Y R;  2CBL A;  1OZS A;  3SG7 A;  1UHI A;  1JFJ A;  2H61 C;  1NSH A;  2LP3 A;  2I7A A;  2JXC A;  1DJG A;  2BAP A;  1DJH A;  1LKJ A;  3B6X A;  1TN4 A;  3CTN A;  1M63 B;  2NCP A;  1UHN A;  3TDU A;  1JF2 A;  1F54 A;  1K9K A;  1ZUZ A;  2M97 A;  1PSB A;  1DEK A;  1PUL A;  1B1G A;  2AAO A;  3FS7 A;  3L47 A;  2KI4 B;  5ER5 A;  3TUY C;  2F3Z A;  2ZNE A;  1KCY A;  2LM5 A;  1KK7 Z;  1S6C A;  2KGR A;  1MQ1 A;  2A4J A;  2SAS A;  4GFT A;  5JOL A;  4A4C A;  1RTP 1;  3SIA A;  4MZK A;  1JSA A;  4PHJ A;  1OE9 B;  1J7R A;  1PRW A;  2MA2 A;  5KSZ A;  1M46 A;  4WQ2 A;  1PVA A;  3RM1 A;  4DCK A;  1NWD A;  1SSE B;  4N1F A;  5I94 A;  2JNX A;  3SIB A;  1XFX O;  1AP4 A;  1Y1A A;  2BNX A;  1AVS A;  2KOT A;  1OW4 A;  3FE6 A;  4DIR A;  1B8L A;  1ALV A;  2ZN9 A;  1NX0 A;  1KK8 C;  4CID A;  1JWD A;  2ZRS A;  2EHB A;  2VRG A;  1SPY A;  3SJS A;  1VRK A;  1XYD A;  3IQO A;  1J7O A;  1CNP A;  1JF0 A;  2PAS A;  1OMV A;  2EC6 C;  3EKJ A;  1KWO B;  3FE8 A;  1H8B A;  1QVI Z;  1KSO A;  3WHU B;  5DKQ A;  2QEB A;  2KFF A;  1YRT B;  2KAX A;  3DF0 A;  4NDB A;  1BLQ A;  2DOQ A;  3PM8 A;  3I5I B;  3VRR A;  2HF5 A;  2L4I A;  2CNP A;  2WCM A;  5D7F A;  1A2X A;  2G2B A;  3SS3 A;  1F70 A;  3KF9 A;  1SCM B;  3H4S E;  4I5K A;  2FCE A;  3M0W A;  2M0R A;  4OKH A;  3VB1 A;  1BOC A;  3FWB A;  5CSI A;  3KPX A;  2BE4 A;  1CDN A;  1N0Y A;  2L5Y A;  3I5G B;  4R1E A;  3WHT B;  1PVB A;  4YI9 A;  3S0D A;  3S0F A;  1ORG A;  1OOJ A;  1TUZ A;  5D3O A;  2V53 A;  2KYF A;  2K0J A;  2K60 A;  4PCW A;  3CZ0 A;  3NSI A;  2Y5I A;  1Z2C B;  1CMF A;  2LHI A;  4PE4 A;  3SG5 A;  1IQ5 A;  3V2L A;  1K96 A;  1K8U A;  1AUI B;  1UWO A;  2GGM A;  3AAJ A;  1A03 A;  2L98 A;  2WCB A;  1FW4 A;  1OZO A;  1TTX A;  1SYM A;  2WCK A;  4KYN A;  1UUR A;  1WDC B;  1EL4 A;  2LLT A;  2CXJ A;  2K7D A;  3AKA A;  3L4L A;  2TN4 A;  1EG4 A;  5G08 A;  4QJ4 B;  5J3X A;  1DC1 A;  4C0L A;  4CFQ A;  1XFU O;  3CZ1 A;  2ZRT A;  2E30 A;  5CPV A;  3KEV A;  1TRF A;  2MHH A;  4UPG A;  1B8R A;  4OZD A;  1Y0V H;  1QWV A;  2GTE A;  4M2P A;  4YI8 A;  1XK4 A;  1SBJ A;  3BFA A;  1XK4 C;  2QDI A;  3CR2 A;  2JPO A;  1TNP A;  5CSF A;  2WCF A;  4C0J A;  1YX8 A;  4QJ5 B;  1CFP A;  2JT8 A;  2LLS A;  3LLE A;  2H61 A;  1YVL A;  1KSM A;  1KWO C;  4N5X A;  3RLZ A;  4FQT A;  1DJI A;  2F8P A;  1GGW A;  5JJG A;  2KAV A;  4OVN F;  4QJ3 B;  4JKT A;  3BQ3 A;  1KFU L;  1OSA A;  2KI4 C;  1SY9 A;  2LMT A;  3I5I C;  1QV1 A;  2L5X B;  3ZNI A;  4F7F A;  1GM0 A;  4GAO A;  1QX2 A;  3CS1 A;  1LIN A;  1QIV A;  2M1K B;  2WC6 A;  2O5G A;  1QTX A;  1ZOT B;  1IGV A;  3O2P A;  4ICB A;  4PHN A;  2ISD A;  2L2E A;  1TOP A;  1KK7 Y;  1X02 A;  2QPT A;  3DF0 B;  4ZCU A;  5KTY A;  1KFX L;  2KFH A;  1MUX A;  1Y1X A;  3AAK A;  3EG5 B;  3SG6 A;  2KSP A;  5TNC A;  1TNW A;  3D0Y B;  2PYQ A;  3BOW A;  2RGI A;  1H4B A;  3GK1 A;  3EVV A;  1CFC A;  2BKI B;  1KQM B;  1IKU A;  1MHO A;  1K95 A;  4PAL A;  3LK0 A;  4YRU A;  1CLM A;  2L4H A;  2L51 A;  5B8I B;  3A8R A;  2KPH A;  3KHE A;  1KQV A;  1KFU S;  3DY9 A;  3IQQ A;  3BFB A;  3OX5 A;  4Q04 A;  2EC6 B;  3RZS A;  1NCY A;  5HL1 A;  5HYD A;  2Y1N A;  2FOT A;  2OS8 B;  1F8H A;  2K8M B;  2WC8 A;  1SCV A;  1NCX A;  1RFJ A;  5CSN A;  1ALW A;  3SS5 A;  2QEH A;  2NXQ A;  1P28 A;  1BR1 B;  2ZFD A;  1DT7 B;  1UHH A;  1XFW O;  3VRO A;  1E8A A;  1M31 A;  3SG2 A;  3UO9 A;  1LA3 A;  2KFG A;  2M1U A;  5CSJ A;  2FJY A;  2M7N A;  1B9A A;  2BKH B;  2QEO A;  1JC2 A;  2ZKM X;  4BY4 A;  3I5G C;  3PN7 C;  4AOM A;  3QME A;  2M8U A;  3DZT A;  2M29 A;  1EXR A;  1XFR A;  3OX6 A;  1YR5 A;  3PJI A;  1DJX A;  3D10 A;  2PQL A;  2WOR A;  4ORB B;  1C3Z A;  3AKB A;  1XO5 A;  1BU3 A;  2HPS A;  3OGN A;  4INX A;  3VRN A;  2COL B;  1MXE A;  1WLZ A;  1WLM A;  1NIW A;  2K61 A;  4MBE A;  1K93 D;  1S26 D;  2BCA A;  1K2H A;  1T14 A;  1SL9 A;  3CDN A;  3DD4 A;  1J55 A;  2H8V A;  3JVT C;  1IRJ A;  3DVE A;  3B86 A;  1A75 B;  5K89 A;  3L4A A;  2KBI A;  3TUY B;  1TNQ A;  2LE9 B;  2KLD A;  2KDH A;  1K90 D;  1UHJ A;  1QAS A;  4MZJ A;  1UP5 A;  3FWC A;  2F2O A;  2ZN8 A;  4DS7 A;  4ORA B;  3CGA A;  2G9B A;  1NPQ A;  1Z4H A;  2JU0 A;  1XFY O;  4USL A;  2LVJ A;  5D69 A;  3DVM A;  4N1G A;  2F3Y A;  2Y4Q A;  2LHL A;  1OOF A;  3C1V A;  5I2L A;  2Q91 A;  5PAL A;  2LNK A;  1SR6 C;  2LP2 A;  3NGV A;  4GNK B;  1KK8 B;  3D73 A;  4HSZ A;  1YUT A;  4XJK B;  2BCB A;  3I5H C;  1CLB A;  3BJH A;  1QS7 A;  3WNX B;  1J7Q A;  2M9G A;  3CR4 X;  1QV0 A;  4YGD B;  5I2O A;  1CB1 A;  2HET A;  4GGN A;  2WCJ A;  1NX1 A;  3BUN B;  3FIA A;  1OOG A;  1JBA A;  2ZND A;  3OB1 B;  1TCF A;  2JOJ A;  5HKW A;  1YTZ C;  4YGC B;  5AFP A;  1WDC C;  2KYC A;  1RJV A;  3NXA A;  1FF1 A;  4FQO A;  2BL0 C;  3BFH A;  1TWO A;  2WCL A;  1C7V A;  4HRH A;  2EGD A;  1MWN A;  4INW A;  4M2Q A;  2WC5 A;  5FI7 A;  2K2F A;  4MRY A;  1F55 A;  4AQI A;  3CAB A;  4XJK A;  1BT6 A;  4IJ7 A;  2LVK A;  1N2D A;  5FI6 A;  1CM4 A;  4PHM A;  2LLU A;  2PMY A;  1K9U A;  1S5G Y;  3BUX B;  1XFZ O;  2K7O A;  1KFX S;  5F6T A;  3VRQ A;  4BY5 A;  3E3R A;  4U8D A;  1UHK A;  4DRW A;  1SR6 B;  4OV2 A;  1DEL A;  3LK1 A;  2M49 B;  1B47 A;  3EK4 A;  2JT0 A;  5AAN A;  2LC5 A;  1SCM C;  3EK8 A;  1U5I B;  2WND A;  3NSL A;  5AXI A;  1R6P A;  2BE6 A;  2LVV A;  3R1P A;  1GJY A;  4D1E A;  1REC A;  1B7T Z;  1OOH A;  1NP8 A;  4P5O E;  2P6B B;  2LUC A;  3R1O A;  1A4P A;  3PSR A;  4MRX A;  4YGA A;  1CDP A;  1UUS A;  1GGZ A;  1YUR A;  1Y6W A;  1YUS A;  1CFD A;  3D0Y A;  4DUQ A;  1CMG A;  3PN7 B;  1IQ3 A;  1CDM A;  1DF0 A;  1EH2 A;  4GGF A;  1JFK A;  3NHI A;  4ORC B;  1QLK A;  3TDI A;  2L50 A;  1CDL A;  1TIZ A;  3B87 A;  3FE9 A;  1L2O C;  1DGV A;  3SS4 A;  2KBM A;  1D1O A;  1A29 A;  3VGO A;  2D8N A;  3GK4 X;  1BMO A;  2F33 A;  2OPO A;  3CYZ A;  1OQP A;  3NSO A;  3OP0 A;  1LXF C;  2MLE C;  3I5F B;  1V1G A;  3ICB A;  1MF8 B;  2WOS A;  1MXL C;  3K1E A;  3PM2 A;  2OTG C;  2CT9 A;  1K9P A;  3BXK A;  1CTR A;  1PK0 D;  2BBN A;  1DQE A;  1PAL A;  2M3W A;  1RWY A;  2FCD A;  3BUO B;  1A75 A;  2JC2 A;  3B88 A;  2PVB A;  1DJY A;  2QAC A;  4GPL B;  5BPJ A;  5DIC A;  4M2O A;  3JTD B;  3K21 A;  1S6J A;  1U5I A;  2K7C A;  1BF5 A;  5DKN A;  5FI2 A;  1S3P A;  1FI6 A;  3S0B A;  1AHR A;  4HRG A;  2JRF A;  2LVI A;  2KI6 D;  1IH0 A;  1QJT A;  2NZ0 A;  3O78 A;  4CLN A;  3CR5 X;  1CKK A;  2SCP A;  1B8C A;  1QAT A;  1CFF A;  4PE0 A;  4YGE B;  1XFV O;  4L9M A;  3TZ1 A;  4A4B A;  3OBV A;  2M7L A;  1W7I B;  2ERB A;  1ZFS A;  3JVT B;  2KAY A;  1MR8 A;  4MLW A;  2WCH A;  2HQW A;  3D75 A;  1SKT A;  2JTZ A;  4AQJ A;  3DVJ A;  2GGZ A;  2L0P A;  2LAP A;  1YVH A;  2BEC A;  1YRU B;  1NX3 A;  2I2R E;  2K7B A;  5I2Q A;  3PAL A;  3CWG A;  3BOW B;  3OB2 B;  4CPV A;  2Q4U A;  2HQ8 A;  3DYE A;  3EVU A;  3GOF A;  1BG1 A;  1Y1U A;  5I8N A;  1WY9 A;  4WQ3 A;  3O4Y A;  2AMI A;  3A4U B;  2LMU A;  2B1U A;  3Q8I A;  1SMG A;  1DGU A;  1L7Z A;  3I5F C;  1K94 A;  1QXP A;  3D77 A;  1RK9 A;  2P70 A;  4YGB B;  3LL8 B;  5HKY A;  3D76 A;  2BL0 B;  2JTT A;  1S5G Z;  1C07 A;  1B4C A;  4MVF A;  1IG5 A;  1G33 A;  1BOD A;  3DXL A;  5HLO A;  4NDD A;  2KLE A;  1WRZ A;  2KQ6 A;  1JUO A;  1WRK A;  4XYN A;  2JXL A;  1YUU A;  1SW8 A;  4JD9 A;  1SK6 D;  5HLV A;  1YX7 A;  2JQ6 A;  1CM1 A;  1TCO B;  1FI5 A;  1B7T Y;  2JZI A;  2MLF C;  3TS5 C;  3MSE B;  1ZMZ A;  2P71 A;  4OCI A;  1GQM A;  3CLN A;  1AJ4 A;  1DJZ A;  5FYX A;  2WCE A;  1SL7 A;  4HRE E;  2LCP A;  3UNW A;  4JWQ A;  1C3Y A;  2O60 A;  4JPZ B;  3PFV A;  4YBH B;  3EK7 A;  1EJ3 A;  4I5L B;  5KU1 A;  2BBM A;  4MSP A;  2I94 A;  2JWW A;  5DKR A;  1SRA A;  2H2K A;  2K2A A;  4ZCV A;  1OOI X;  2MJW B;  2KQY A;  3VRP A;  1DJW A;  2PSR A;  4FTG A;  1DMO A;  1AJ5 A;  3GK2 A;  4MN0 A;  4CFR A;  2JNF A;  4PHK A;  3N7H A;  3CZ2 A;  4OR9 B;  3JTD C;  1PSR A;  1J1E A;  1W9Z A;  1TUJ A;  2JPT A;  2PAL A;  4IL1 A;  4P2Y B;  4TNC A;  1NYA A;  2BCX A;  1F4O A;  3B7A A;  2JT3 A;  1NCZ A;  3O4X A;  1J1D A;  4GGF C;  2YGU A;  2FJU B;  3I5H B;  3PAT A;  4PT1 A;  2LMV A;  2GV5 A;  3HCM A;  1FBV A;  1SNL A;  1HQV A;  1L2O B;  2F2P A;  3NSK A;  5ER4 X;  1KQM C;  3HX4 A;  1C7W A;  1QLS A;  1QVI Y;  2OTG B;  1S1E A;  3CZT X;  3O6B A;  2L2C A;  3DVK A;  2LUX A;  4GBA A;  1QX5 B;  3TDZ A;  3R1V A;  2MBX A;  3ZWH A;  1RRO A;  1OMD A;  2JUL A;  1M39 A;  5GQQ C;  1ODB A;  5AER A;  3OHM B;  2NLN A;  4WRI A;  2R2I A;  2MRD A; 
#chains in the Genus database with same CATH homology
 3CZ0 A;  3S0A A;  3S0G A;  2ERB A;  3V2L A;  2WCH A;  3NHT A;  1LS8 A;  3D75 A;  1OOF A;  2WCK A;  5EL2 A;  3L4L A;  3D78 A;  3NGV A;  3D73 A;  2QEV A;  3CZ1 A;  3BJH A;  4OZD A;  2GTE A;  1QWV A;  3DYE A;  2WCJ A;  3BFA A;  1OOG A;  2QDI A;  2JPO A;  3Q8I A;  3BFH A;  1TWO A;  2WCL A;  3D77 A;  4FQT A;  2P70 A;  3D76 A;  4INW A;  2WC5 A;  3DXL A;  3D74 A;  4F7F A;  3CAB A;  1GM0 A;  3S0E A;  3R72 A;  2WC6 A;  4JD9 A;  3B6X A;  2P71 A;  3L47 A;  1C3Y A;  3R1P A;  1OOH A;  3R1O A;  2KPH A;  3DY9 A;  3BFB A;  3RZS A;  1OOI X;  1OW4 A;  3FE6 A;  3NHI A;  2QEH A;  3FE9 A;  1P28 A;  3B87 A;  3CYZ A;  3N7H A;  3CZ2 A;  2FJY A;  1TUJ A;  2QEO A;  3FE8 A;  3QME A;  3DZT A;  3B7A A;  1XFR A;  2QEB A;  3PJI A;  3K1E A;  2PQL A;  4PT1 A;  2WCM A;  1C3Z A;  3OGN A;  1DQE A;  4INX A;  3B88 A;  5DIC A;  2L2C A;  1T14 A;  3VB1 A;  3CDN A;  3R1V A;  2H8V A;  3S0D A;  3S0B A;  3S0F A;  3B86 A;  1ORG A;  3L4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...