2QEVA

Crystal structure of anopheles gambiae d7r4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
145
structure length
145
Chain Sequence
b'METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Ligand binding protein
total genus 56
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qevA00
4F7FA 3R1PA 2QDIA 3B6XA 1QWVA 2PQLA 3V2LA 3CZ1A 1GM0A 1TWOA 2QEVA 2WCJA 3D77A 2P70A 3VB1A 3NHIA 3L47A 2P71A 4INXA 1LS8A 2WCHA 3S0EA 3CZ2A 3RZSA 4PT1A 4INWA 2GTEA 2KPHA 1OOHA 3NGVA 5EL2A 3PJIA 3B7AA 2WCLA 3D76A 5DICA 3BFHA 3D75A 2H8VA 1XFRA 4FQTA 3OGNA 1DQEA 3DZTA 3NHTA 2WC5A 2FJYA 2ERBA 2WCKA 4OZDA 1C3ZA 2JPOA 1OOFA 2L2CA 3D73A 3B86A 3FE6A 3L4AA 1C3YA 2QEHA 3R1OA 3K1EA 3BFBA 3S0AA 1ORGA 3CDNA 3CABA 3R1VA 3R72A 3Q8IA 3DXLA 1T14A 1OW4A 1P28A 3FE9A 3L4LA 3BFAA 3S0GA 1OOGA 3N7HA 1OOIX 3CYZA 3B88A 4JD9A 3DYEA 3QMEA 3S0BA 3CZ0A 2WC6A 3B87A 3BJHA 2QEBA 3S0FA 3S0DA 2QEOA 3D74A 2WCMA 3DY9A 3FE8A 1TUJA 3D78A
chains in the Genus database with same CATH superfamily
2F2PA 2JZIA 2JQ6A 1A75B 2F8PA 4I5NB 3R1PA 3VRQA 3V2LA 1QWVA 1MQ1A 1YTZC 2PQLA 3EK8A 4FQOA 2WCFA 5I94A 5HKYA 1ZUZA 1S1EA 3CZ1A 4PE1A 1EH2A 1K93D 2OS8C 1AJ4A 1DJHA 2JNXA 2KOTA 1SNLA 5D3OA 1RK9A 1J7OA 2BCBA 1R2UA 2BCXA 5HKWA 1CM4A 3O4XA 1CNPA 1IKUA 3NHIA 1OSAA 1DGVA 1SCMC 1XYDA 1CLMA 1K96A 1QV1A 1N65A 1YUUA 4AQJA 4WQ3A 2DOQA 1QV0A 1M39A 4DCKA 2F2OA 3RZSA 1S26D 3TUYB 1FBVA 1DJZA 1QLKA 1XFYO 2BBMA 1BU3A 1NCXA 2MRDA 5ER5A 3VRNA 1IRJA 1WRKA 4JQ0D 1NYAA 1XVJA 5EL2A 2E30A 2WCLA 1YVHA 3FE8A 1J7RA 2KAVA 1M45A 2MHHA 3D75A 1KFUS 1Y1AA 2KDHA 1NPQA 2QPTA 3AKBA 4GGFA 2BCAA 3EKHA 3JTDC 2JNFA 1NX1A 1DQEA 4I5JA 1CLBA 1TCFA 2G2BA 2WC5A 2ZNEA 1U5IB 1NSHA 2K2FA 1TOPA 2ERBA 2M7NA 4U8DA 1B9AA 2SASA 1GGZA 4PHKA 1JSAA 4OZDA 1C3ZA 2KI6D 2JPOA 1X02A 3SS4A 1HT9A 2MLEC 4NDDA 3OHMB 4ZCUA 1N2DA 1TNQA 3CWGA 1DEKA 5HLOA 4GFTA 1Z4HA 3O6BA 2NCOA 1CDPA 1WDCC 2ZFDA 5K89A 3BFBA 1ORGA 1IWQA 4M2QA 4AOMA 2BE6A 3CDNA 3CTNA 3O4YA 2ZKMX 3FWCA 3Q8IA 4DS7A 1BR4B 2D8NA 1JF0A 4YGDB 1B4CA 2EHBA 1UHJA 2PSRA 1H4BA 2JWWA 3EKJA 1Y1XA 3BFAA 1LKJA 3CLNA 1UHHA 1B8LA 3S0GA 3N7HA 1OOIX 1KFUL 2K8MB 3I5HC 3OBVA 4JPZB 5I8NA 1IJ5A 1SKTA 1EG3A 2K61A 3TDZA 1ZOTB 4MZJA 1SY9A 4N5XA 1TN4A 2ZRSA 1IQ3A 1S5GY 4MEWA 3BUNB 2G9BA 1G4YR 3FIAA 2MJWB 2LVJA 4MLWA 1DJGA 1K8UA 3B87A 3BJHA 3I5GB 3OB2B 3DF0A 1B7TZ 4C0JA 1QVIY 3JVTB 2I2RE 5FI7A 3DVKA 5CSIA 3D74A 1CLLA 4QJ3B 1PK0D 1MWNA 3DY9A 1SR6B 2JOJA 1TUJA 1XK4C 1QATA 1A29A 1OMVA 1NCYA 1RTP1 1YR5A 2M3WA 2WOSA 4R1EA 1SBJA 2AUCA 1SK6D 1NX0A 5CSJA 3WHUB 4F7FA 2L5YA 1KK7Z 1ZACA 3SG3A 1KWOC 3PN7C 3CR5X 2QDIA 2LHIA 2KLEA 3B6XA 2Y5IA 4MBEA 4GNKB 4BY4A 5AEQA 1BMOA 5ER4X 2QEVA 4PDZA 1CFPA 3D77A 2MAZA 1QX7A 1JBAA 1CDMA 2M1KB 1XFWO 2M49B 1LVCD 1SL7A 2HPSA 2PMYA 1DELA 2FOTA 2PYQA 2I7AA 3EK4A 2EC6B 3L47A 4I5LB 2BL0B 5DKNA 2LHLA 3BOWB 4OKHA 3VRPA 5I2OA 1BOCA 3ZWHA 2ZN8A 1KK8C 1YUTA 3BUMB 1B1GA 3CZ2A 4GPLB 2JC2A 2LVIA 3TZ1A 2GGZA 4INWA 1UHNA 2NCPA 1G8IA 2BKHB 1A2XA 5JOLA 3OX5A 3UNWA 1XFUO 1DJXA 2AMIA 1CFFA 2JPTA 2LUXA 4UPGA 1OOHA 1PVAA 2ISDA 2P6BB 3B7AA 4YGCB 3OP0A 5TNCA 3A8RA 2LANA 1MUXA 5DICA 4CLNA 1QTXA 2E6WA 2KQYA 1KCYA 2H8VA 2LNKA 1XFRA 4OVNF 2OS8B 1SYMA 1RJVA 1EXRA 2K7OA 1QXPA 2BE4A 3PSRA 1NIWA 2LE9B 4MRXA 4D1EA 3NHTA 5HKZA 1ZFSA 2FJYA 2BECA 2YGUA 1J7QA 4XJKA 3BQ3A 3I5IB 2WCKA 2WNDA 1B47A 1SCMB 2JTZA 2JXLA 4HRGA 2KGRA 3PLFB 2KFHA 4DIRA 1OOFA 1K94A 3GK1A 1M63B 1XFVO 3IF7A 1S6CA 3TDUA 1TTXA 4A4CA 4DUQA 1CM1A 2LV7A 2WC8A 3A4UB 1UURA 4HRHA 1WRZA 4YGBB 2WCEA 5PALA 5BPJA 2RGIA 1DMOA 3GK2A 5AANA 3I5FB 1J7PA 1G33A 2GV5A 3NSIA 1Y1UA 2L0PA 1KQMC 1NCZA 2LAPA 1AHRA 1BJFA 2LLTA 2LP2A 3OX6A 4WQ2A 5HYDA 2JTTA 5DKQA 4HSZA 3FE9A 2LLUA 3DF0B 1BLQA 2CTNA 2M1UA 2LVKA 3JTDB 1FW4A 1XA5A 2TN4A 5AERA 2BAPA 3B88A 4I5KA 4JD9A 2WCBA 3QMEA 4AQIA 1TNWA 3D0YB 2KLDA 3DVJA 1SL9A 1F8HA 1KSMA 5AFPA 2OTGB 1B7TY 2KI4B 1UP5A 1QASA 2FJUB 4YBHB 1C07A 4YRUA 5I2LA 4CFQA 1HQVA 2NLNA 1OZSA 1LA3A 2IS9A 2QEOA 2Q91A 1DGUA 2CNPA 3HCMA 4YI9A 2KQ6A 1CKKA 1KSOA 2NZ0A 1W9ZA 1KK7Y 1L2OC 1N0YA 3NXAA 3LCPC 2M29A 5AXIA 1NP8A 2MBXA 1EG4A 1GQMA 4IL1A 1MXEA 5JJGA 1IH0A 2A4JA 2PALA 4MRYA 3PM8A 3SJSA 2JT0A 1Y0VH 2HQ8A 3PFVA 5J3XA 1TNPA 1WY9A 3TS5C 2HF5A 1FF1A 1SL8A 1TRFA 1A4PA 1CDLA 1M31A 1BR1B 2LMUA 4PE4A 4DRWA 4N1FA 1DJWA 3SIBA 3SG5A 1QX5B 3WNXB 2P71A 4INXA 2KBIA 1B8RA 1ALVA 5FI2A 1Q80A 1RECA 3VGOA 4QJ4B 3S0EA 4OV2A 1Y6WA 1DF0A 4M2PA 2SCPA 1S6IA 4PT1A 3TDIA 1IJ6A 4N1GA 2I18A 3SIAA 1OOJA 1DVIA 1SPYA 2M0RA 4C0KA 1DC1A 3BYAA 3CS1A 1NX2A 2JXCA 3JVTC 4XJKB 4ZCVA 1F4OA 2JU0A 1PALA 3NGVA 1JC2A 1YX7A 3D76A 3PJIA 4OR9B 1IGVA 2K2AA 4C0LA 1FI5A 5D69A 3BFHA 2Y1NA 1SR6C 1L7ZA 2K60A 2OPOA 4FQTA 5HL1A 1F54A 3NSKA 2FCEA 3UO9A 1QJTA 2ZNDA 3PATA 1K90D 3ZNIA 3EG5B 1QS7A 1LA0A 3OGNA 2LP3A 1CFDA 1J1DA 3DZTA 4TNCA 3D10A 2CXJA 1XFZO 3GOFA 4NDCA 1AJ5A 1UUSA 3AAKA 3WXAA 4XYNA 3K21A 4PHNA 2VRGA 5B8IB 1LXFC 3QRXA 3L4AA 2O5GA 4ORAB 2PASA 1PRWA 3R1OA 4YI8A 1RROA 3WHTB 3K1EA 2EC6C 2F33A 3AKAA 4MZKA 2Y4QA 5KTYA 3S0AA 2BL0C 4ETOA 1WLMA 2L51A 2KAYA 4YGAA 1AUIB 4FTGA 1SCVA 3R1VA 2BKIB 2KFFA 1BT6A 3R72A 4GGFC 3DXLA 4MN0A 2KFGA 1T14A 3NSOA 4KYNA 2NXQA 1XK4A 1OW4A 4MVFA 3EVVA 1MXLC 1V1GA 5KU1A 1BF5A 3LLEA 1PSRA 2BBNA 1S3PA 2LCPA 4PCWA 1JUOA 2HETA 1JF2A 4M2OA 1XO5A 3DYEA 2L5XB 2B1UA 3CR4X 3VROA 1B8CA 3VRRA 3SG6A 2KNEA 1PULA 2LMVA 2M97A 2H61C 2LC5A 1NX3A 2PVBA 1JFJA 4NQGA 1KFXS 1QLSA 1PVBA 1XFXO 3IQQA 4GAOA 4PE7A 3CZTX 3RM1A 3I5IC 2KSPA 5G08A 1E8AA 1MHOA 1R6PA 1NWDA 1WLZA 3MSEB 3O78A 3TUYC 2K7CA 4OCIA 4ORCB 1SMGA 1YVLA 1QIVA 3SG4A 1OZOA 2K0JA 1JWDA 1IQ5A 3D78A 3LK1A 1SSEB 1KQMB 2F3ZA 4BY5A 4JKTA 3AAJA 1EJ3A 4ORBB 3C1VA 1CMGA 2M8UA 3BUWB 3I5FC 3BOWA 5IBWA 1DF0B 1TWOA 5GQQC 5KSZA 1GM0A 2WCJA 1V1FA 1OQPA 3DVMA 4YGEB 5HLVA 1DJYA 2I94A 2MLFC 3KF9A 1K9KA 1UHKA 1S36A 2FCDA 2P70A 1YX8A 2COLB 3PALA 3BUXB 1WDCB 3VB1A 1A75A 1JFKA 3E3RA 2CBLA 2K7BA 4A4BA 1D1OA 1LS8A 4PHJA 4WRIA 4IJ7A 2WCHA 4PHMA 1QX2A 2L50A 4Q04A 3O2PA 2EGDA 2O60A 1KFXL 3RLZA 2JULA 2ZN9A 3H4SE 1UHIA 2OTGC 2L98A 2KYFA 2KI4C 3BXKA 4MZLA 1KQVA 4CIDA 4L9MA 1K9PA 1L2OB 2JRFA 2GTEA 3DD4A 3FWBA 2H61A 5CSNA 1K95A 2KPHA 5FYXA 1EL4A 3SG7A 1DT7B 2CT9A 1QIWA 2LUCA 2JT3A 1UWOA 2H2KA 3EVRA 2KAXA 1WRLA 4JWQA 4NDBA 3I5HB 2LVVA 1OE9B 2L2EA 1IIOA 1OMDA 1RWYA 2V53A 1CMFA 1CDNA 3EVUA 2KI6C 3CGAA 5CPVA 3ICBA 2QACA 3KO0A 3LL8B 3GK4X 3EK7A 3PM2A 4P5OE 3IVTA 3TS5B 3KPXA 1W7IB 2PRUA 3CR2A 1AVSA 1J55A 1CB1A 1H8BA 1F4QA 1F55A 2ZRTA 1AP4A 1F71A 1FPWA 4E68A 1K9UA 4ICBA 1LINA 2L4IA 1RFJA 3BUOB 4QJ5B 3SG2A 1MF8B 1GGWA 1DTLA 2L2CA 3D73A 3B86A 3FE6A 4GGNA 5CSFA 3I5GC 2KGBC 2QEHA 1C3YA 1IG5A 2M9GA 1SRAA 4P2YB 3KEVA 1C7WA 1KWOB 3PN7B 2KBMA 1ZMZA 3KHEA 1TUZA 1U5IA 5F6TA 3DVEA 3CABA 3M0WA 1W7JB 3SS3A 2LLSA 4GBAA 1C7VA 1YRTB 4CFRA 1ALWA 3NSLA 4F0ZB 3FS7A 1Z2CB 2K7DA 5FI6A 2WORA 1SW8A 1M46A 1YURA 2Q4UA 4GUKA 4PE0A 3D0YA 1P28A 1TCOB 1GJYA 2L4HA 3L4LA 2KYCA 1CTRA 2Y1MA 1TNXA 1BODA 4CPVA 1OOGA 2LM5A 2M7LA 3CYZA 2R2IA 1VRKA 4PALA 4USLA 1BG1A 3S0BA 1KK8B 1NUBA 3CZ0A 2KHNA 2AAOA 3F45A 2CCMA 2WC6A 2GGMA 1AK8A 1TIZA 1S5GZ 5I2QA 3IQOA 1PSBA 1J1EA 1YUSA 4HREE 2QEBA 3LK0A 3S0FA 2BNXA 1A03A 1S6JA 3HX4A 5D7FA 3S0DA 1CFCA 5DKRA 1DJIA 1FI6A 1OMRA 3OB1B 1QVIZ 4MSPA 3SS5A 2WCMA 1F70A 2LMTA 2HQWA 2F3YA 1ODBA 1MR8A 2JT8A 1K2HA 2MA2A 1YRUB
chains in the Genus database with same CATH topology
4F7FA 3R1PA 2QDIA 3B6XA 1QWVA 2PQLA 3V2LA 3CZ1A 1GM0A 1TWOA 2QEVA 2WCJA 3D77A 2P70A 3VB1A 3NHIA 3L47A 2P71A 4INXA 1LS8A 2WCHA 3S0EA 3CZ2A 3RZSA 4PT1A 4INWA 2GTEA 2KPHA 1OOHA 3NGVA 5EL2A 3PJIA 3B7AA 2WCLA 3D76A 5DICA 3BFHA 3D75A 2H8VA 1XFRA 4FQTA 3OGNA 1DQEA 3DZTA 3NHTA 2WC5A 2FJYA 2ERBA 2WCKA 4OZDA 1C3ZA 2JPOA 1OOFA 2L2CA 3D73A 3B86A 3FE6A 3L4AA 1C3YA 2QEHA 3R1OA 3K1EA 3BFBA 3S0AA 1ORGA 3CDNA 3CABA 3R1VA 3R72A 3Q8IA 3DXLA 1T14A 1OW4A 1P28A 3FE9A 3L4LA 3BFAA 3S0GA 1OOGA 3N7HA 1OOIX 3CYZA 3B88A 4JD9A 3DYEA 3QMEA 3S0BA 3CZ0A 2WC6A 3B87A 3BJHA 2QEBA 3S0FA 3S0DA 2QEOA 3D74A 2WCMA 3DY9A 3FE8A 1TUJA 3D78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7F A;  3R1P A;  2QDI A;  3B6X A;  1QWV A;  2PQL A;  3V2L A;  3CZ1 A;  1GM0 A;  1TWO A;  2QEV A;  2WCJ A;  3D77 A;  2P70 A;  3VB1 A;  3NHI A;  3L47 A;  2P71 A;  4INX A;  1LS8 A;  2WCH A;  3S0E A;  3CZ2 A;  3RZS A;  4PT1 A;  4INW A;  2GTE A;  2KPH A;  1OOH A;  3NGV A;  5EL2 A;  3PJI A;  3B7A A;  2WCL A;  3D76 A;  5DIC A;  3BFH A;  3D75 A;  2H8V A;  1XFR A;  4FQT A;  3OGN A;  1DQE A;  3DZT A;  3NHT A;  2WC5 A;  2FJY A;  2ERB A;  2WCK A;  4OZD A;  1C3Z A;  2JPO A;  1OOF A;  2L2C A;  3D73 A;  3B86 A;  3FE6 A;  3L4A A;  1C3Y A;  2QEH A;  3R1O A;  3K1E A;  3BFB A;  3S0A A;  1ORG A;  3CDN A;  3CAB A;  3R1V A;  3R72 A;  3Q8I A;  3DXL A;  1T14 A;  1OW4 A;  1P28 A;  3FE9 A;  3L4L A;  3BFA A;  3S0G A;  1OOG A;  3N7H A;  1OOI X;  3CYZ A;  3B88 A;  4JD9 A;  3DYE A;  3QME A;  3S0B A;  3CZ0 A;  2WC6 A;  3B87 A;  3BJH A;  2QEB A;  3S0F A;  3S0D A;  2QEO A;  3D74 A;  2WCM A;  3DY9 A;  3FE8 A;  1TUJ A;  3D78 A; 
#chains in the Genus database with same CATH topology
 2F2P A;  2JZI A;  2JQ6 A;  1A75 B;  2F8P A;  4I5N B;  3R1P A;  3VRQ A;  3V2L A;  1QWV A;  1MQ1 A;  1YTZ C;  2PQL A;  3EK8 A;  4FQO A;  2WCF A;  5I94 A;  5HKY A;  1ZUZ A;  1S1E A;  3CZ1 A;  4PE1 A;  1EH2 A;  1K93 D;  2OS8 C;  1AJ4 A;  1DJH A;  2JNX A;  2KOT A;  1SNL A;  5D3O A;  1RK9 A;  1J7O A;  2BCB A;  1R2U A;  2BCX A;  5HKW A;  1CM4 A;  3O4X A;  1CNP A;  1IKU A;  3NHI A;  1OSA A;  1DGV A;  1SCM C;  1XYD A;  1CLM A;  1K96 A;  1QV1 A;  1N65 A;  1YUU A;  4AQJ A;  4WQ3 A;  2DOQ A;  1QV0 A;  1M39 A;  4DCK A;  2F2O A;  3RZS A;  1S26 D;  3TUY B;  1FBV A;  1DJZ A;  1QLK A;  1XFY O;  2BBM A;  1BU3 A;  1NCX A;  2MRD A;  5ER5 A;  3VRN A;  1IRJ A;  1WRK A;  4JQ0 D;  1NYA A;  1XVJ A;  5EL2 A;  2E30 A;  2WCL A;  1YVH A;  3FE8 A;  1J7R A;  2KAV A;  1M45 A;  2MHH A;  3D75 A;  1KFU S;  1Y1A A;  2KDH A;  1NPQ A;  2QPT A;  3AKB A;  4GGF A;  2BCA A;  3EKH A;  3JTD C;  2JNF A;  1NX1 A;  1DQE A;  4I5J A;  1CLB A;  1TCF A;  2G2B A;  2WC5 A;  2ZNE A;  1U5I B;  1NSH A;  2K2F A;  1TOP A;  2ERB A;  2M7N A;  4U8D A;  1B9A A;  2SAS A;  1GGZ A;  4PHK A;  1JSA A;  4OZD A;  1C3Z A;  2KI6 D;  2JPO A;  1X02 A;  3SS4 A;  1HT9 A;  2MLE C;  4NDD A;  3OHM B;  4ZCU A;  1N2D A;  1TNQ A;  3CWG A;  1DEK A;  5HLO A;  4GFT A;  1Z4H A;  3O6B A;  2NCO A;  1CDP A;  1WDC C;  2ZFD A;  5K89 A;  3BFB A;  1ORG A;  1IWQ A;  4M2Q A;  4AOM A;  2BE6 A;  3CDN A;  3CTN A;  3O4Y A;  2ZKM X;  3FWC A;  3Q8I A;  4DS7 A;  1BR4 B;  2D8N A;  1JF0 A;  4YGD B;  1B4C A;  2EHB A;  1UHJ A;  2PSR A;  1H4B A;  2JWW A;  3EKJ A;  1Y1X A;  3BFA A;  1LKJ A;  3CLN A;  1UHH A;  1B8L A;  3S0G A;  3N7H A;  1OOI X;  1KFU L;  2K8M B;  3I5H C;  3OBV A;  4JPZ B;  5I8N A;  1IJ5 A;  1SKT A;  1EG3 A;  2K61 A;  3TDZ A;  1ZOT B;  4MZJ A;  1SY9 A;  4N5X A;  1TN4 A;  2ZRS A;  1IQ3 A;  1S5G Y;  4MEW A;  3BUN B;  2G9B A;  1G4Y R;  3FIA A;  2MJW B;  2LVJ A;  4MLW A;  1DJG A;  1K8U A;  3B87 A;  3BJH A;  3I5G B;  3OB2 B;  3DF0 A;  1B7T Z;  4C0J A;  1QVI Y;  3JVT B;  2I2R E;  5FI7 A;  3DVK A;  5CSI A;  3D74 A;  1CLL A;  4QJ3 B;  1PK0 D;  1MWN A;  3DY9 A;  1SR6 B;  2JOJ A;  1TUJ A;  1XK4 C;  1QAT A;  1A29 A;  1OMV A;  1NCY A;  1RTP 1;  1YR5 A;  2M3W A;  2WOS A;  4R1E A;  1SBJ A;  2AUC A;  1SK6 D;  1NX0 A;  5CSJ A;  3WHU B;  4F7F A;  2L5Y A;  1KK7 Z;  1ZAC A;  3SG3 A;  1KWO C;  3PN7 C;  3CR5 X;  2QDI A;  2LHI A;  2KLE A;  3B6X A;  2Y5I A;  4MBE A;  4GNK B;  4BY4 A;  5AEQ A;  1BMO A;  5ER4 X;  2QEV A;  4PDZ A;  1CFP A;  3D77 A;  2MAZ A;  1QX7 A;  1JBA A;  1CDM A;  2M1K B;  1XFW O;  2M49 B;  1LVC D;  1SL7 A;  2HPS A;  2PMY A;  1DEL A;  2FOT A;  2PYQ A;  2I7A A;  3EK4 A;  2EC6 B;  3L47 A;  4I5L B;  2BL0 B;  5DKN A;  2LHL A;  3BOW B;  4OKH A;  3VRP A;  5I2O A;  1BOC A;  3ZWH A;  2ZN8 A;  1KK8 C;  1YUT A;  3BUM B;  1B1G A;  3CZ2 A;  4GPL B;  2JC2 A;  2LVI A;  3TZ1 A;  2GGZ A;  4INW A;  1UHN A;  2NCP A;  1G8I A;  2BKH B;  1A2X A;  5JOL A;  3OX5 A;  3UNW A;  1XFU O;  1DJX A;  2AMI A;  1CFF A;  2JPT A;  2LUX A;  4UPG A;  1OOH A;  1PVA A;  2ISD A;  2P6B B;  3B7A A;  4YGC B;  3OP0 A;  5TNC A;  3A8R A;  2LAN A;  1MUX A;  5DIC A;  4CLN A;  1QTX A;  2E6W A;  2KQY A;  1KCY A;  2H8V A;  2LNK A;  1XFR A;  4OVN F;  2OS8 B;  1SYM A;  1RJV A;  1EXR A;  2K7O A;  1QXP A;  2BE4 A;  3PSR A;  1NIW A;  2LE9 B;  4MRX A;  4D1E A;  3NHT A;  5HKZ A;  1ZFS A;  2FJY A;  2BEC A;  2YGU A;  1J7Q A;  4XJK A;  3BQ3 A;  3I5I B;  2WCK A;  2WND A;  1B47 A;  1SCM B;  2JTZ A;  2JXL A;  4HRG A;  2KGR A;  3PLF B;  2KFH A;  4DIR A;  1OOF A;  1K94 A;  3GK1 A;  1M63 B;  1XFV O;  3IF7 A;  1S6C A;  3TDU A;  1TTX A;  4A4C A;  4DUQ A;  1CM1 A;  2LV7 A;  2WC8 A;  3A4U B;  1UUR A;  4HRH A;  1WRZ A;  4YGB B;  2WCE A;  5PAL A;  5BPJ A;  2RGI A;  1DMO A;  3GK2 A;  5AAN A;  3I5F B;  1J7P A;  1G33 A;  2GV5 A;  3NSI A;  1Y1U A;  2L0P A;  1KQM C;  1NCZ A;  2LAP A;  1AHR A;  1BJF A;  2LLT A;  2LP2 A;  3OX6 A;  4WQ2 A;  5HYD A;  2JTT A;  5DKQ A;  4HSZ A;  3FE9 A;  2LLU A;  3DF0 B;  1BLQ A;  2CTN A;  2M1U A;  2LVK A;  3JTD B;  1FW4 A;  1XA5 A;  2TN4 A;  5AER A;  2BAP A;  3B88 A;  4I5K A;  4JD9 A;  2WCB A;  3QME A;  4AQI A;  1TNW A;  3D0Y B;  2KLD A;  3DVJ A;  1SL9 A;  1F8H A;  1KSM A;  5AFP A;  2OTG B;  1B7T Y;  2KI4 B;  1UP5 A;  1QAS A;  2FJU B;  4YBH B;  1C07 A;  4YRU A;  5I2L A;  4CFQ A;  1HQV A;  2NLN A;  1OZS A;  1LA3 A;  2IS9 A;  2QEO A;  2Q91 A;  1DGU A;  2CNP A;  3HCM A;  4YI9 A;  2KQ6 A;  1CKK A;  1KSO A;  2NZ0 A;  1W9Z A;  1KK7 Y;  1L2O C;  1N0Y A;  3NXA A;  3LCP C;  2M29 A;  5AXI A;  1NP8 A;  2MBX A;  1EG4 A;  1GQM A;  4IL1 A;  1MXE A;  5JJG A;  1IH0 A;  2A4J A;  2PAL A;  4MRY A;  3PM8 A;  3SJS A;  2JT0 A;  1Y0V H;  2HQ8 A;  3PFV A;  5J3X A;  1TNP A;  1WY9 A;  3TS5 C;  2HF5 A;  1FF1 A;  1SL8 A;  1TRF A;  1A4P A;  1CDL A;  1M31 A;  1BR1 B;  2LMU A;  4PE4 A;  4DRW A;  4N1F A;  1DJW A;  3SIB A;  3SG5 A;  1QX5 B;  3WNX B;  2P71 A;  4INX A;  2KBI A;  1B8R A;  1ALV A;  5FI2 A;  1Q80 A;  1REC A;  3VGO A;  4QJ4 B;  3S0E A;  4OV2 A;  1Y6W A;  1DF0 A;  4M2P A;  2SCP A;  1S6I A;  4PT1 A;  3TDI A;  1IJ6 A;  4N1G A;  2I18 A;  3SIA A;  1OOJ A;  1DVI A;  1SPY A;  2M0R A;  4C0K A;  1DC1 A;  3BYA A;  3CS1 A;  1NX2 A;  2JXC A;  3JVT C;  4XJK B;  4ZCV A;  1F4O A;  2JU0 A;  1PAL A;  3NGV A;  1JC2 A;  1YX7 A;  3D76 A;  3PJI A;  4OR9 B;  1IGV A;  2K2A A;  4C0L A;  1FI5 A;  5D69 A;  3BFH A;  2Y1N A;  1SR6 C;  1L7Z A;  2K60 A;  2OPO A;  4FQT A;  5HL1 A;  1F54 A;  3NSK A;  2FCE A;  3UO9 A;  1QJT A;  2ZND A;  3PAT A;  1K90 D;  3ZNI A;  3EG5 B;  1QS7 A;  1LA0 A;  3OGN A;  2LP3 A;  1CFD A;  1J1D A;  3DZT A;  4TNC A;  3D10 A;  2CXJ A;  1XFZ O;  3GOF A;  4NDC A;  1AJ5 A;  1UUS A;  3AAK A;  3WXA A;  4XYN A;  3K21 A;  4PHN A;  2VRG A;  5B8I B;  1LXF C;  3QRX A;  3L4A A;  2O5G A;  4ORA B;  2PAS A;  1PRW A;  3R1O A;  4YI8 A;  1RRO A;  3WHT B;  3K1E A;  2EC6 C;  2F33 A;  3AKA A;  4MZK A;  2Y4Q A;  5KTY A;  3S0A A;  2BL0 C;  4ETO A;  1WLM A;  2L51 A;  2KAY A;  4YGA A;  1AUI B;  4FTG A;  1SCV A;  3R1V A;  2BKI B;  2KFF A;  1BT6 A;  3R72 A;  4GGF C;  3DXL A;  4MN0 A;  2KFG A;  1T14 A;  3NSO A;  4KYN A;  2NXQ A;  1XK4 A;  1OW4 A;  4MVF A;  3EVV A;  1MXL C;  1V1G A;  5KU1 A;  1BF5 A;  3LLE A;  1PSR A;  2BBN A;  1S3P A;  2LCP A;  4PCW A;  1JUO A;  2HET A;  1JF2 A;  4M2O A;  1XO5 A;  3DYE A;  2L5X B;  2B1U A;  3CR4 X;  3VRO A;  1B8C A;  3VRR A;  3SG6 A;  2KNE A;  1PUL A;  2LMV A;  2M97 A;  2H61 C;  2LC5 A;  1NX3 A;  2PVB A;  1JFJ A;  4NQG A;  1KFX S;  1QLS A;  1PVB A;  1XFX O;  3IQQ A;  4GAO A;  4PE7 A;  3CZT X;  3RM1 A;  3I5I C;  2KSP A;  5G08 A;  1E8A A;  1MHO A;  1R6P A;  1NWD A;  1WLZ A;  3MSE B;  3O78 A;  3TUY C;  2K7C A;  4OCI A;  4ORC B;  1SMG A;  1YVL A;  1QIV A;  3SG4 A;  1OZO A;  2K0J A;  1JWD A;  1IQ5 A;  3D78 A;  3LK1 A;  1SSE B;  1KQM B;  2F3Z A;  4BY5 A;  4JKT A;  3AAJ A;  1EJ3 A;  4ORB B;  3C1V A;  1CMG A;  2M8U A;  3BUW B;  3I5F C;  3BOW A;  5IBW A;  1DF0 B;  1TWO A;  5GQQ C;  5KSZ A;  1GM0 A;  2WCJ A;  1V1F A;  1OQP A;  3DVM A;  4YGE B;  5HLV A;  1DJY A;  2I94 A;  2MLF C;  3KF9 A;  1K9K A;  1UHK A;  1S36 A;  2FCD A;  2P70 A;  1YX8 A;  2COL B;  3PAL A;  3BUX B;  1WDC B;  3VB1 A;  1A75 A;  1JFK A;  3E3R A;  2CBL A;  2K7B A;  4A4B A;  1D1O A;  1LS8 A;  4PHJ A;  4WRI A;  4IJ7 A;  2WCH A;  4PHM A;  1QX2 A;  2L50 A;  4Q04 A;  3O2P A;  2EGD A;  2O60 A;  1KFX L;  3RLZ A;  2JUL A;  2ZN9 A;  3H4S E;  1UHI A;  2OTG C;  2L98 A;  2KYF A;  2KI4 C;  3BXK A;  4MZL A;  1KQV A;  4CID A;  4L9M A;  1K9P A;  1L2O B;  2JRF A;  2GTE A;  3DD4 A;  3FWB A;  2H61 A;  5CSN A;  1K95 A;  2KPH A;  5FYX A;  1EL4 A;  3SG7 A;  1DT7 B;  2CT9 A;  1QIW A;  2LUC A;  2JT3 A;  1UWO A;  2H2K A;  3EVR A;  2KAX A;  1WRL A;  4JWQ A;  4NDB A;  3I5H B;  2LVV A;  1OE9 B;  2L2E A;  1IIO A;  1OMD A;  1RWY A;  2V53 A;  1CMF A;  1CDN A;  3EVU A;  2KI6 C;  3CGA A;  5CPV A;  3ICB A;  2QAC A;  3KO0 A;  3LL8 B;  3GK4 X;  3EK7 A;  3PM2 A;  4P5O E;  3IVT A;  3TS5 B;  3KPX A;  1W7I B;  2PRU A;  3CR2 A;  1AVS A;  1J55 A;  1CB1 A;  1H8B A;  1F4Q A;  1F55 A;  2ZRT A;  1AP4 A;  1F71 A;  1FPW A;  4E68 A;  1K9U A;  4ICB A;  1LIN A;  2L4I A;  1RFJ A;  3BUO B;  4QJ5 B;  3SG2 A;  1MF8 B;  1GGW A;  1DTL A;  2L2C A;  3D73 A;  3B86 A;  3FE6 A;  4GGN A;  5CSF A;  3I5G C;  2KGB C;  2QEH A;  1C3Y A;  1IG5 A;  2M9G A;  1SRA A;  4P2Y B;  3KEV A;  1C7W A;  1KWO B;  3PN7 B;  2KBM A;  1ZMZ A;  3KHE A;  1TUZ A;  1U5I A;  5F6T A;  3DVE A;  3CAB A;  3M0W A;  1W7J B;  3SS3 A;  2LLS A;  4GBA A;  1C7V A;  1YRT B;  4CFR A;  1ALW A;  3NSL A;  4F0Z B;  3FS7 A;  1Z2C B;  2K7D A;  5FI6 A;  2WOR A;  1SW8 A;  1M46 A;  1YUR A;  2Q4U A;  4GUK A;  4PE0 A;  3D0Y A;  1P28 A;  1TCO B;  1GJY A;  2L4H A;  3L4L A;  2KYC A;  1CTR A;  2Y1M A;  1TNX A;  1BOD A;  4CPV A;  1OOG A;  2LM5 A;  2M7L A;  3CYZ A;  2R2I A;  1VRK A;  4PAL A;  4USL A;  1BG1 A;  3S0B A;  1KK8 B;  1NUB A;  3CZ0 A;  2KHN A;  2AAO A;  3F45 A;  2CCM A;  2WC6 A;  2GGM A;  1AK8 A;  1TIZ A;  1S5G Z;  5I2Q A;  3IQO A;  1PSB A;  1J1E A;  1YUS A;  4HRE E;  2QEB A;  3LK0 A;  3S0F A;  2BNX A;  1A03 A;  1S6J A;  3HX4 A;  5D7F A;  3S0D A;  1CFC A;  5DKR A;  1DJI A;  1FI6 A;  1OMR A;  3OB1 B;  1QVI Z;  4MSP A;  3SS5 A;  2WCM A;  1F70 A;  2LMT A;  2HQW A;  2F3Y A;  1ODB A;  1MR8 A;  2JT8 A;  1K2H A;  2MA2 A;  1YRU B; 
#chains in the Genus database with same CATH homology
 4F7F A;  3R1P A;  2QDI A;  3B6X A;  1QWV A;  2PQL A;  3V2L A;  3CZ1 A;  1GM0 A;  1TWO A;  2QEV A;  2WCJ A;  3D77 A;  2P70 A;  3VB1 A;  3NHI A;  3L47 A;  2P71 A;  4INX A;  1LS8 A;  2WCH A;  3S0E A;  3CZ2 A;  3RZS A;  4PT1 A;  4INW A;  2GTE A;  2KPH A;  1OOH A;  3NGV A;  5EL2 A;  3PJI A;  3B7A A;  2WCL A;  3D76 A;  5DIC A;  3BFH A;  3D75 A;  2H8V A;  1XFR A;  4FQT A;  3OGN A;  1DQE A;  3DZT A;  3NHT A;  2WC5 A;  2FJY A;  2ERB A;  2WCK A;  4OZD A;  1C3Z A;  2JPO A;  1OOF A;  2L2C A;  3D73 A;  3B86 A;  3FE6 A;  3L4A A;  1C3Y A;  2QEH A;  3R1O A;  3K1E A;  3BFB A;  3S0A A;  1ORG A;  3CDN A;  3CAB A;  3R1V A;  3R72 A;  3Q8I A;  3DXL A;  1T14 A;  1OW4 A;  1P28 A;  3FE9 A;  3L4L A;  3BFA A;  3S0G A;  1OOG A;  3N7H A;  1OOI X;  3CYZ A;  3B88 A;  4JD9 A;  3DYE A;  3QME A;  3S0B A;  3CZ0 A;  2WC6 A;  3B87 A;  3BJH A;  2QEB A;  3S0F A;  3S0D A;  2QEO A;  3D74 A;  2WCM A;  3DY9 A;  3FE8 A;  1TUJ A;  3D78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...