2QEVA

Crystal structure of anopheles gambiae d7r4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
145
structure length
145
Chain Sequence
METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords D7R4 Protein
publication title The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae
pubmed doi rcsb
source organism Anopheles gambiae
total genus 56
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2qevA00
1GM0A 3R72A 4PT1A 3S0GA 2KPHA 2P71A 3FE9A 4OZDA 2QEBA 3B6XA 3CZ1A 1C3YA 3D76A 3OGNA 3CYZA 2ERBA 1OOGA 3NHIA 1OOIX 2H8VA 1QWVA 3D78A 3L4LA 2WCJA 2QDIA 3BJHA 2WCLA 3B7AA 4F7FA 3B86A 2L2CA 3BFHA 2QEHA 1P28A 2WCKA 3S0EA 5DICA 3L4AA 2WCMA 3CZ2A 3R1VA 1TWOA 3DY9A 3R1OA 1DQEA 3S0BA 3D77A 1OW4A 3CZ0A 2WC6A 2P70A 1C3ZA 1OOHA 4FQTA 3BFAA 2GTEA 4INWA 2JPOA 2WCHA 1TUJA 3L47A 4JD9A 3DYEA 3B88A 3S0FA 2FJYA 3CDNA 1OOFA 3R1PA 2WC5A 1XFRA 5EL2A 1ORGA 3PJIA 1T14A 3DXLA 3RZSA 3DZTA 3Q8IA 3D73A 4INXA 3NGVA 3NHTA 3D74A 1LS8A 3VB1A 3K1EA 3V2LA 3FE6A 3S0DA 3B87A 3CABA 2PQLA 3FE8A 2QEOA 3QMEA 3BFBA 2QEVA 3D75A 3N7HA 3S0AA
chains in the Genus database with same CATH superfamily
2M1UA 2JULA 1CDMA 1WDCC 1GM0A 4MZKA 1B1GA 4YI8A 2JT8A 1X02A 3S0GA 4DCKA 4F0ZB 1F70A 4MRYA 1TTXA 4MRXA 1SNLA 2QEBA 4YGAA 3B6XA 1UHJA 1QATA 1RJVA 1KK8B 1NCYA 1WY9A 2BCAA 4NQGA 2LM5A 2VRGA 1K95A 4BY5A 1A03A 4U8DA 4YGDB 1Z4HA 1QV0A 2GGMA 5J3XA 1J7QA 1MUXA 4YGBB 3SIAA 3A4UB 1J7RA 1V1FA 2OTGC 4DUQA 3DVKA 4XJKB 3D78A 1F4OA 2ZRTA 1TCOB 2QDIA 4WRIA 2M0RA 5KU1A 1GGWA 2LP3A 3CZTX 5I8NA 1KSOA 4GGFA 2MA2A 3D0YB 1Y1UA 2QEHA 3DVMA 1DJXA 2L4IA 1JFKA 2L5XB 2G2BA 1M63B 2EC6B 1KK8C 3BUXB 4GUKA 1MWNA 1WRZA 1NCXA 5I2OA 1WRLA 1QX5B 1EXRA 1S36A 2ZN8A 4OV2A 1G4YR 3GK4X 1QTXA 2HETA 1XFWO 1DQEA 1BR1B 2MLEC 2WC8A 2HQWA 3CGAA 2LV7A 1SRAA 2AMIA 1OW4A 1DC1A 4MN0A 2LAPA 1J1DA 3JTDB 4GGFC 3A8RA 1YUTA 2LHLA 2WC6A 2KLDA 3JVTB 3KHEA 2KAXA 4IJ7A 1S5GZ 4WQ3A 5I2QA 4PCWA 5D3OA 2L51A 3NSIA 1IG5A 3SG4A 2JQ6A 3L47A 4JD9A 1GQMA 2LUXA 1RWYA 4D1EA 4M2OA 1A75A 1NWDA 1NX0A 1ZUZA 1M39A 2H61A 1N0YA 2KYCA 1VRKA 3H4SE 3LK1A 3UO9A 4AOMA 1YX8A 2PMYA 1CB1A 1KQVA 1UURA 1A29A 1CLLA 1AJ4A 3TDIA 2K7OA 3PN7B 1EH2A 1CFCA 1RTP1 4WQ2A 5AEQA 2JRFA 1OOFA 2L2EA 3EK8A 4C0KA 1UP5A 3HX4A 2BCBA 3FWCA 4N1GA 5EL2A 1UHHA 3JTDC 3PJIA 3DVJA 3JVTC 2NXQA 2KBMA 4OCIA 1YTZC 5CSIA 2F2OA 3O4YA 2K7CA 3DZTA 3OHMB 1WRKA 2NCOA 1NX2A 2PYQA 2Q91A 4ORAB 4PE1A 2WORA 1AJ5A 5FI2A 1PSBA 1QV1A 3TDZA 2Y4QA 4OVNF 3SG3A 1S3PA 3SS3A 4IL1A 2P6BB 3FE8A 2LLSA 3LK0A 3PN7C 1K9KA 3OB1B 4YGCB 1ALVA 1CFFA 3EKHA 3I5HB 3I5GB 2KFGA 3D75A 3SS4A 3N7HA 4HRHA 2LMUA 1HT9A 4PE4A 2CXJA 2JU0A 2JPTA 1JF2A 3OB2B 4ICBA 3ZNIA 5DKRA 3LLEA 5AERA 3CS1A 1CLBA 1S6JA 2P71A 2LHIA 4OZDA 1XK4C 1DJWA 3CZ1A 3BUOB 1DF0B 3D76A 3OGNA 3TS5B 1FF1A 2FCEA 2L98A 3QRXA 1N65A 1FPWA 2TN4A 2KAYA 2E6WA 1QJTA 1FBVA 5GQQC 1NP8A 1OOGA 2LMVA 1B8RA 1OOIX 3I5GC 3I5HC 4USLA 2E30A 2QPTA 1QWVA 4NDDA 3WNXB 2M49B 2WCJA 3L4LA 2WCEA 1AHRA 4I5KA 1F4QA 3BJHA 5HYDA 2WCLA 3O2PA 3SJSA 4GFTA 4MZLA 4PHJA 1TNPA 1YRTB 3I5FB 4OKHA 3FIAA 2ISDA 1V1GA 2F3ZA 1P28A 3ICBA 1ALWA 2Y5IA 1XYDA 2KLEA 1CTRA 1UUSA 1Y1AA 3L4AA 4PHKA 1B8LA 3TS5C 5I94A 1QIVA 2H2KA 2WCMA 4GNKB 1SL7A 1IH0A 1K2HA 3R1OA 3VRNA 1BODA 3KO0A 3D77A 1K8UA 1OSAA 1RROA 2R2IA 1XFXO 5B8IB 1QASA 1BMOA 1IIOA 2K0JA 1L2OB 1PULA 4A4BA 2BCXA 2Y1MA 1YURA 2M7NA 3GK2A 3CZ0A 5CSNA 1QIWA 5I2LA 1PRWA 5FYXA 2L5YA 1DGUA 1S5GY 3I5FC 3OBVA 3AKBA 3EVVA 4XYNA 2MJWB 2GTEA 1JC2A 4AQJA 2JPOA 2WCHA 1S6CA 2I94A 3DYEA 2L0PA 1TIZA 1TCFA 5AXIA 1IQ5A 4QJ5B 1YR5A 1KK7Y 3PFVA 3I5IB 2LANA 2NZ0A 2FJYA 3PM8A 5K89A 1RK9A 1GJYA 2KI4C 1MXEA 1H8BA 4PE0A 1DT7B 4PHNA 2JTZA 4YRUA 1L2OC 1QLKA 1XFRA 1S26D 2NCPA 4C0LA 1HQVA 1SL9A 3DXLA 1CFDA 1SCVA 4CPVA 3OP0A 4M2QA 1CDLA 3RZSA 1ZOTB 3D73A 1B4CA 2SASA 3BOWA 1JBAA 1QVIY 1MR8A 3NHTA 1W9ZA 3BUWB 1BLQA 5D7FA 2M7LA 3K1EA 5HLOA 4HREE 5PALA 1A75B 3CWGA 2AAOA 2BKHB 3FE6A 2Q4UA 1H4BA 3CTNA 3I5IC 4QJ4B 3VRPA 3KF9A 3BUMB 1KK7Z 1CDPA 2LCPA 1KSMA 2M8UA 2KGRA 2PRUA 2ZRSA 5AANA 1ZACA 2FOTA 3MSEB 1JWDA 1DGVA 1OMDA 2CT9A 3SIBA 1AK8A 1XFZO 3AAKA 1UWOA 1UHKA 3R72A 1EG4A 1PK0D 1M31A 2G9BA 4GAOA 1IGVA 2CCMA 2GV5A 2KPHA 3AAJA 3O6BA 1Y1XA 5HLVA 4N5XA 1XFUO 1S1EA 1QX7A 1XVJA 1K93D 1EG3A 1TN4A 2LC5A 1B7TZ 1QX2A 3FE9A 1F71A 1JSAA 1QVIZ 1OZOA 4M2PA 2H61C 1SPYA 3VRRA 1Y0VH 5DKNA 1DJIA 2ZN9A 1FI6A 4I5JA 4L9MA 4MEWA 4A4CA 1A4PA 3DF0A 1C07A 2WOSA 1YVLA 1DJZA 1GGZA 1Q80A 2BE4A 2O60A 3PSRA 2M1KB 2LVJA 4NDCA 1IJ5A 1U5IB 4I5NB 1OOJA 1CDNA 3BQ3A 1J7OA 1J7PA 1DMOA 1U5IA 2F8PA 3FWBA 1BOCA 1FI5A 2K2AA 1DEKA 2L2CA 5HKZA 2EGDA 1JFJA 1IJ6A 1NCZA 4JKTA 1SYMA 3BFHA 3ZWHA 1OMRA 1NPQA 1R2UA 2YGUA 2F3YA 1PALA 1F55A 1YVHA 1EJ3A 1NSHA 1SMGA 3EVUA 5DICA 2JZIA 4ZCUA 3S0EA 5D69A 3K21A 1DELA 2OPOA 1KWOC 1TWOA 2GGZA 2LVVA 2LVIA 4JPZB 2JOJA 1SK6D 2LUCA 2JXCA 1CMGA 3GK1A 2BKIB 2Y1NA 4PDZA 3RM1A 4ETOA 2JXLA 3PLFB 4PALA 1W7IB 3CR5X 1ODBA 1WLMA 2CBLA 2I2RE 3GOFA 1SBJA 1TNWA 2HF5A 2K61A 2P70A 1AVSA 3DD4A 3CR4X 4I5LB 4P5OE 5F6TA 2EHBA 1LA0A 4FQTA 3M0WA 1CNPA 2F2PA 1B9AA 1TUJA 4CLNA 3CLNA 1PVBA 3VRQA 1IQ3A 2KOTA 4CFRA 1G33A 1MF8B 1UHNA 2B1UA 3IQOA 2KSPA 3RLZA 3HCMA 3CR2A 3VROA 2KGBC 2K7BA 1SW8A 2AUCA 2KI4B 3R1PA 2SCPA 3BYAA 1F54A 1Y6WA 2PALA 2LMTA 1SY9A 4FQOA 3AKAA 4C0JA 1LVCD 4UPGA 3OX6A 3OX5A 2MBXA 3TUYB 3Q8IA 2KDHA 3EG5B 3NGVA 3UNWA 4FTGA 3D74A 4ORBB 5FI7A 1LS8A 2WCFA 4HRGA 3VB1A 1DJYA 4ZCVA 1XO5A 1ZMZA 3C1VA 3S0DA 3B87A 3CABA 4YI9A 1XFVO 2BL0B 1KFXS 1MXLC 2KI6C 1XA5A 4R1EA 2BNXA 3NSOA 2ZFDA 2WCBA 3SS5A 1QS7A 3SG6A 2KFFA 1R6PA 1IRJA 3BFBA 3O4XA 2QEVA 5ER4X 2O5GA 2MHHA 1NX3A 3D10A 2JT3A 4XJKA 2JT0A 2COLB 1BF5A 1YRUB 1OQPA 2KBIA 2KFHA 5CSJA 1LXFC 1RECA 2CTNA 4JQ0D 2QACA 4JWQA 4PT1A 4Q04A 2ZKMX 2KI6D 5HKYA 3TUYC 3D0YA 3BOWB 2D8NA 2V53A 2KYFA 1K9UA 2LE9B 2MRDA 3O78A 1B7TY 4TNCA 1NX1A 3NSKA 5HKWA 2PASA 1MQ1A 1N2DA 1PSRA 1SKTA 1W7JB 1C3YA 1BU3A 1C7WA 2HQ8A 2FJUB 3PALA 3CYZA 2M29A 2MLFC 2CNPA 1K94A 2ERBA 1MHOA 2BL0C 2BBMA 1OMVA 1YUSA 4CFQA 1IWQA 2LVKA 1CMFA 1NYAA 3BXKA 2ZNDA 3NHIA 2DOQA 2H8VA 4CIDA 1KQMB 2JWWA 5G08A 3TZ1A 5HL1A 1SL8A 1TNQA 5BPJA 2JTTA 4KYNA 2KHNA 1BR4B 3VGOA 5KSZA 1CFPA 2A4JA 1Z2CB 1J55A 3KEVA 3TDUA 2ZNEA 3B7AA 3EK7A 3B86A 2OS8B 2BECA 4F7FA 1FW4A 3F45A 1RFJA 4DIRA 1IKUA 1AP4A 1CKKA 4OR9B 2K8MB 5CPVA 1A2XA 3SG5A 5ER5A 2EC6C 2K60A 1SCMB 1XFYO 1QXPA 2WCKA 1LKJA 1BJFA 2BAPA 1D1OA 3LCPC 5JJGA 5CSFA 4YBHB 4PE7A 3CZ2A 2K7DA 3R1VA 2M97A 2KNEA 5AFPA 3DY9A 5TNCA 3NSLA 1DVIA 2M3WA 1KWOB 4HSZA 4DRWA 2HPSA 3BUNB 1KCYA 3DF0B 3S0BA 1QLSA 1CM1A 1LINA 1KQMC 2I18A 4MVFA 1CM4A 3WHUB 3LL8B 3WXAA 1ZFSA 2OS8C 1KFUL 2PVBA 5IBWA 1C3ZA 1OOHA 2LNKA 1SR6B 1PVAA 3DVEA 3BFAA 1DJGA 1K96A 3KPXA 4INWA 1JUOA 4MSPA 4QJ3B 2JNFA 1SCMC 1TUZA 1LA3A 1YX7A 1XK4A 2IS9A 3B88A 3E3RA 4ORCB 4NDBA 1L7ZA 3IVTA 1S6IA 2MAZA 3S0FA 1AUIB 4P2YB 2L50A 4MZJA 1B8CA 1WLZA 3PM2A 1K90D 4GBAA 4MLWA 1SSEB 4GGNA 3CDNA 4MBEA 1CLMA 2KAVA 3EKJA 2KQYA 2PSRA 4AQIA 1F8HA 5KTYA 1BG1A 4E68A 1DTLA 2WC5A 2NLNA 2WNDA 4GPLB 1ORGA 2M9GA 1EL4A 1J1EA 1T14A 2FCDA 5DKQA 1DJHA 2K2FA 2LLTA 1WDCB 3NXAA 1TOPA 4PHMA 1SR6C 4DS7A 1E8AA 3EK4A 3IQQA 1KFUS 3PATA 1TNXA 4INXA 1TRFA 3EVRA 4YGEB 3WHTB 1M45A 1NIWA 1C7VA 3IF7A 1UHIA 5FI6A 3V2LA 2LLUA 2JNXA 1DF0A 5JOLA 1JF0A 2KQ6A 2I7AA 2JC2A 1KFXL 2BE6A 1G8IA 3FS7A 2PQLA 2RGIA 1BT6A 3SG7A 2QEOA 2L4HA 1K9PA 3QMEA 2F33A 4N1FA 2BBNA 3SG2A 4BY4A 1OZSA 1YUUA 2OTGB 2LP2A 1B47A 1NUBA 1OE9B 3S0AA 1M46A
chains in the Genus database with same CATH topology
1GM0A 3R72A 4PT1A 3S0GA 2KPHA 2P71A 3FE9A 4OZDA 2QEBA 3B6XA 3CZ1A 1C3YA 3D76A 3OGNA 3CYZA 2ERBA 1OOGA 3NHIA 1OOIX 2H8VA 1QWVA 3D78A 3L4LA 2WCJA 2QDIA 3BJHA 2WCLA 3B7AA 4F7FA 3B86A 2L2CA 3BFHA 2QEHA 1P28A 2WCKA 3S0EA 5DICA 3L4AA 2WCMA 3CZ2A 3R1VA 1TWOA 3DY9A 3R1OA 1DQEA 3S0BA 3D77A 1OW4A 3CZ0A 2WC6A 2P70A 1C3ZA 1OOHA 4FQTA 3BFAA 2GTEA 4INWA 2JPOA 2WCHA 1TUJA 3L47A 4JD9A 3DYEA 3B88A 3S0FA 2FJYA 3CDNA 1OOFA 3R1PA 2WC5A 1XFRA 5EL2A 1ORGA 3PJIA 1T14A 3DXLA 3RZSA 3DZTA 3Q8IA 3D73A 4INXA 3NGVA 3NHTA 3D74A 1LS8A 3VB1A 3K1EA 3V2LA 3FE6A 3S0DA 3B87A 3CABA 2PQLA 3FE8A 2QEOA 3QMEA 3BFBA 2QEVA 3D75A 3N7HA 3S0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GM0 A;  3R72 A;  4PT1 A;  3S0G A;  2KPH A;  2P71 A;  3FE9 A;  4OZD A;  2QEB A;  3B6X A;  3CZ1 A;  1C3Y A;  3D76 A;  3OGN A;  3CYZ A;  2ERB A;  1OOG A;  3NHI A;  1OOI X;  2H8V A;  1QWV A;  3D78 A;  3L4L A;  2WCJ A;  2QDI A;  3BJH A;  2WCL A;  3B7A A;  4F7F A;  3B86 A;  2L2C A;  3BFH A;  2QEH A;  1P28 A;  2WCK A;  3S0E A;  5DIC A;  3L4A A;  2WCM A;  3CZ2 A;  3R1V A;  1TWO A;  3DY9 A;  3R1O A;  1DQE A;  3S0B A;  3D77 A;  1OW4 A;  3CZ0 A;  2WC6 A;  2P70 A;  1C3Z A;  1OOH A;  4FQT A;  3BFA A;  2GTE A;  4INW A;  2JPO A;  2WCH A;  1TUJ A;  3L47 A;  4JD9 A;  3DYE A;  3B88 A;  3S0F A;  2FJY A;  3CDN A;  1OOF A;  3R1P A;  2WC5 A;  1XFR A;  5EL2 A;  1ORG A;  3PJI A;  1T14 A;  3DXL A;  3RZS A;  3DZT A;  3Q8I A;  3D73 A;  4INX A;  3NGV A;  3NHT A;  3D74 A;  1LS8 A;  3VB1 A;  3K1E A;  3V2L A;  3FE6 A;  3S0D A;  3B87 A;  3CAB A;  2PQL A;  3FE8 A;  2QEO A;  3QME A;  3BFB A;  2QEV A;  3D75 A;  3N7H A;  3S0A A; 
#chains in the Genus database with same CATH topology
 2M1U A;  2JUL A;  1CDM A;  1WDC C;  1GM0 A;  4MZK A;  1B1G A;  4YI8 A;  2JT8 A;  1X02 A;  3S0G A;  4DCK A;  4F0Z B;  1F70 A;  4MRY A;  1TTX A;  4MRX A;  1SNL A;  2QEB A;  4YGA A;  3B6X A;  1UHJ A;  1QAT A;  1RJV A;  1KK8 B;  1NCY A;  1WY9 A;  2BCA A;  4NQG A;  2LM5 A;  2VRG A;  1K95 A;  4BY5 A;  1A03 A;  4U8D A;  4YGD B;  1Z4H A;  1QV0 A;  2GGM A;  5J3X A;  1J7Q A;  1MUX A;  4YGB B;  3SIA A;  3A4U B;  1J7R A;  1V1F A;  2OTG C;  4DUQ A;  3DVK A;  4XJK B;  3D78 A;  1F4O A;  2ZRT A;  1TCO B;  2QDI A;  4WRI A;  2M0R A;  5KU1 A;  1GGW A;  2LP3 A;  3CZT X;  5I8N A;  1KSO A;  4GGF A;  2MA2 A;  3D0Y B;  1Y1U A;  2QEH A;  3DVM A;  1DJX A;  2L4I A;  1JFK A;  2L5X B;  2G2B A;  1M63 B;  2EC6 B;  1KK8 C;  3BUX B;  4GUK A;  1MWN A;  1WRZ A;  1NCX A;  5I2O A;  1WRL A;  1QX5 B;  1EXR A;  1S36 A;  2ZN8 A;  4OV2 A;  1G4Y R;  3GK4 X;  1QTX A;  2HET A;  1XFW O;  1DQE A;  1BR1 B;  2MLE C;  2WC8 A;  2HQW A;  3CGA A;  2LV7 A;  1SRA A;  2AMI A;  1OW4 A;  1DC1 A;  4MN0 A;  2LAP A;  1J1D A;  3JTD B;  4GGF C;  3A8R A;  1YUT A;  2LHL A;  2WC6 A;  2KLD A;  3JVT B;  3KHE A;  2KAX A;  4IJ7 A;  1S5G Z;  4WQ3 A;  5I2Q A;  4PCW A;  5D3O A;  2L51 A;  3NSI A;  1IG5 A;  3SG4 A;  2JQ6 A;  3L47 A;  4JD9 A;  1GQM A;  2LUX A;  1RWY A;  4D1E A;  4M2O A;  1A75 A;  1NWD A;  1NX0 A;  1ZUZ A;  1M39 A;  2H61 A;  1N0Y A;  2KYC A;  1VRK A;  3H4S E;  3LK1 A;  3UO9 A;  4AOM A;  1YX8 A;  2PMY A;  1CB1 A;  1KQV A;  1UUR A;  1A29 A;  1CLL A;  1AJ4 A;  3TDI A;  2K7O A;  3PN7 B;  1EH2 A;  1CFC A;  1RTP 1;  4WQ2 A;  5AEQ A;  2JRF A;  1OOF A;  2L2E A;  3EK8 A;  4C0K A;  1UP5 A;  3HX4 A;  2BCB A;  3FWC A;  4N1G A;  5EL2 A;  1UHH A;  3JTD C;  3PJI A;  3DVJ A;  3JVT C;  2NXQ A;  2KBM A;  4OCI A;  1YTZ C;  5CSI A;  2F2O A;  3O4Y A;  2K7C A;  3DZT A;  3OHM B;  1WRK A;  2NCO A;  1NX2 A;  2PYQ A;  2Q91 A;  4ORA B;  4PE1 A;  2WOR A;  1AJ5 A;  5FI2 A;  1PSB A;  1QV1 A;  3TDZ A;  2Y4Q A;  4OVN F;  3SG3 A;  1S3P A;  3SS3 A;  4IL1 A;  2P6B B;  3FE8 A;  2LLS A;  3LK0 A;  3PN7 C;  1K9K A;  3OB1 B;  4YGC B;  1ALV A;  1CFF A;  3EKH A;  3I5H B;  3I5G B;  2KFG A;  3D75 A;  3SS4 A;  3N7H A;  4HRH A;  2LMU A;  1HT9 A;  4PE4 A;  2CXJ A;  2JU0 A;  2JPT A;  1JF2 A;  3OB2 B;  4ICB A;  3ZNI A;  5DKR A;  3LLE A;  5AER A;  3CS1 A;  1CLB A;  1S6J A;  2P71 A;  2LHI A;  4OZD A;  1XK4 C;  1DJW A;  3CZ1 A;  3BUO B;  1DF0 B;  3D76 A;  3OGN A;  3TS5 B;  1FF1 A;  2FCE A;  2L98 A;  3QRX A;  1N65 A;  1FPW A;  2TN4 A;  2KAY A;  2E6W A;  1QJT A;  1FBV A;  5GQQ C;  1NP8 A;  1OOG A;  2LMV A;  1B8R A;  1OOI X;  3I5G C;  3I5H C;  4USL A;  2E30 A;  2QPT A;  1QWV A;  4NDD A;  3WNX B;  2M49 B;  2WCJ A;  3L4L A;  2WCE A;  1AHR A;  4I5K A;  1F4Q A;  3BJH A;  5HYD A;  2WCL A;  3O2P A;  3SJS A;  4GFT A;  4MZL A;  4PHJ A;  1TNP A;  1YRT B;  3I5F B;  4OKH A;  3FIA A;  2ISD A;  1V1G A;  2F3Z A;  1P28 A;  3ICB A;  1ALW A;  2Y5I A;  1XYD A;  2KLE A;  1CTR A;  1UUS A;  1Y1A A;  3L4A A;  4PHK A;  1B8L A;  3TS5 C;  5I94 A;  1QIV A;  2H2K A;  2WCM A;  4GNK B;  1SL7 A;  1IH0 A;  1K2H A;  3R1O A;  3VRN A;  1BOD A;  3KO0 A;  3D77 A;  1K8U A;  1OSA A;  1RRO A;  2R2I A;  1XFX O;  5B8I B;  1QAS A;  1BMO A;  1IIO A;  2K0J A;  1L2O B;  1PUL A;  4A4B A;  2BCX A;  2Y1M A;  1YUR A;  2M7N A;  3GK2 A;  3CZ0 A;  5CSN A;  1QIW A;  5I2L A;  1PRW A;  5FYX A;  2L5Y A;  1DGU A;  1S5G Y;  3I5F C;  3OBV A;  3AKB A;  3EVV A;  4XYN A;  2MJW B;  2GTE A;  1JC2 A;  4AQJ A;  2JPO A;  2WCH A;  1S6C A;  2I94 A;  3DYE A;  2L0P A;  1TIZ A;  1TCF A;  5AXI A;  1IQ5 A;  4QJ5 B;  1YR5 A;  1KK7 Y;  3PFV A;  3I5I B;  2LAN A;  2NZ0 A;  2FJY A;  3PM8 A;  5K89 A;  1RK9 A;  1GJY A;  2KI4 C;  1MXE A;  1H8B A;  4PE0 A;  1DT7 B;  4PHN A;  2JTZ A;  4YRU A;  1L2O C;  1QLK A;  1XFR A;  1S26 D;  2NCP A;  4C0L A;  1HQV A;  1SL9 A;  3DXL A;  1CFD A;  1SCV A;  4CPV A;  3OP0 A;  4M2Q A;  1CDL A;  3RZS A;  1ZOT B;  3D73 A;  1B4C A;  2SAS A;  3BOW A;  1JBA A;  1QVI Y;  1MR8 A;  3NHT A;  1W9Z A;  3BUW B;  1BLQ A;  5D7F A;  2M7L A;  3K1E A;  5HLO A;  4HRE E;  5PAL A;  1A75 B;  3CWG A;  2AAO A;  2BKH B;  3FE6 A;  2Q4U A;  1H4B A;  3CTN A;  3I5I C;  4QJ4 B;  3VRP A;  3KF9 A;  3BUM B;  1KK7 Z;  1CDP A;  2LCP A;  1KSM A;  2M8U A;  2KGR A;  2PRU A;  2ZRS A;  5AAN A;  1ZAC A;  2FOT A;  3MSE B;  1JWD A;  1DGV A;  1OMD A;  2CT9 A;  3SIB A;  1AK8 A;  1XFZ O;  3AAK A;  1UWO A;  1UHK A;  3R72 A;  1EG4 A;  1PK0 D;  1M31 A;  2G9B A;  4GAO A;  1IGV A;  2CCM A;  2GV5 A;  2KPH A;  3AAJ A;  3O6B A;  1Y1X A;  5HLV A;  4N5X A;  1XFU O;  1S1E A;  1QX7 A;  1XVJ A;  1K93 D;  1EG3 A;  1TN4 A;  2LC5 A;  1B7T Z;  1QX2 A;  3FE9 A;  1F71 A;  1JSA A;  1QVI Z;  1OZO A;  4M2P A;  2H61 C;  1SPY A;  3VRR A;  1Y0V H;  5DKN A;  1DJI A;  2ZN9 A;  1FI6 A;  4I5J A;  4L9M A;  4MEW A;  4A4C A;  1A4P A;  3DF0 A;  1C07 A;  2WOS A;  1YVL A;  1DJZ A;  1GGZ A;  1Q80 A;  2BE4 A;  2O60 A;  3PSR A;  2M1K B;  2LVJ A;  4NDC A;  1IJ5 A;  1U5I B;  4I5N B;  1OOJ A;  1CDN A;  3BQ3 A;  1J7O A;  1J7P A;  1DMO A;  1U5I A;  2F8P A;  3FWB A;  1BOC A;  1FI5 A;  2K2A A;  1DEK A;  2L2C A;  5HKZ A;  2EGD A;  1JFJ A;  1IJ6 A;  1NCZ A;  4JKT A;  1SYM A;  3BFH A;  3ZWH A;  1OMR A;  1NPQ A;  1R2U A;  2YGU A;  2F3Y A;  1PAL A;  1F55 A;  1YVH A;  1EJ3 A;  1NSH A;  1SMG A;  3EVU A;  5DIC A;  2JZI A;  4ZCU A;  3S0E A;  5D69 A;  3K21 A;  1DEL A;  2OPO A;  1KWO C;  1TWO A;  2GGZ A;  2LVV A;  2LVI A;  4JPZ B;  2JOJ A;  1SK6 D;  2LUC A;  2JXC A;  1CMG A;  3GK1 A;  2BKI B;  2Y1N A;  4PDZ A;  3RM1 A;  4ETO A;  2JXL A;  3PLF B;  4PAL A;  1W7I B;  3CR5 X;  1ODB A;  1WLM A;  2CBL A;  2I2R E;  3GOF A;  1SBJ A;  1TNW A;  2HF5 A;  2K61 A;  2P70 A;  1AVS A;  3DD4 A;  3CR4 X;  4I5L B;  4P5O E;  5F6T A;  2EHB A;  1LA0 A;  4FQT A;  3M0W A;  1CNP A;  2F2P A;  1B9A A;  1TUJ A;  4CLN A;  3CLN A;  1PVB A;  3VRQ A;  1IQ3 A;  2KOT A;  4CFR A;  1G33 A;  1MF8 B;  1UHN A;  2B1U A;  3IQO A;  2KSP A;  3RLZ A;  3HCM A;  3CR2 A;  3VRO A;  2KGB C;  2K7B A;  1SW8 A;  2AUC A;  2KI4 B;  3R1P A;  2SCP A;  3BYA A;  1F54 A;  1Y6W A;  2PAL A;  2LMT A;  1SY9 A;  4FQO A;  3AKA A;  4C0J A;  1LVC D;  4UPG A;  3OX6 A;  3OX5 A;  2MBX A;  3TUY B;  3Q8I A;  2KDH A;  3EG5 B;  3NGV A;  3UNW A;  4FTG A;  3D74 A;  4ORB B;  5FI7 A;  1LS8 A;  2WCF A;  4HRG A;  3VB1 A;  1DJY A;  4ZCV A;  1XO5 A;  1ZMZ A;  3C1V A;  3S0D A;  3B87 A;  3CAB A;  4YI9 A;  1XFV O;  2BL0 B;  1KFX S;  1MXL C;  2KI6 C;  1XA5 A;  4R1E A;  2BNX A;  3NSO A;  2ZFD A;  2WCB A;  3SS5 A;  1QS7 A;  3SG6 A;  2KFF A;  1R6P A;  1IRJ A;  3BFB A;  3O4X A;  2QEV A;  5ER4 X;  2O5G A;  2MHH A;  1NX3 A;  3D10 A;  2JT3 A;  4XJK A;  2JT0 A;  2COL B;  1BF5 A;  1YRU B;  1OQP A;  2KBI A;  2KFH A;  5CSJ A;  1LXF C;  1REC A;  2CTN A;  4JQ0 D;  2QAC A;  4JWQ A;  4PT1 A;  4Q04 A;  2ZKM X;  2KI6 D;  5HKY A;  3TUY C;  3D0Y A;  3BOW B;  2D8N A;  2V53 A;  2KYF A;  1K9U A;  2LE9 B;  2MRD A;  3O78 A;  1B7T Y;  4TNC A;  1NX1 A;  3NSK A;  5HKW A;  2PAS A;  1MQ1 A;  1N2D A;  1PSR A;  1SKT A;  1W7J B;  1C3Y A;  1BU3 A;  1C7W A;  2HQ8 A;  2FJU B;  3PAL A;  3CYZ A;  2M29 A;  2MLF C;  2CNP A;  1K94 A;  2ERB A;  1MHO A;  2BL0 C;  2BBM A;  1OMV A;  1YUS A;  4CFQ A;  1IWQ A;  2LVK A;  1CMF A;  1NYA A;  3BXK A;  2ZND A;  3NHI A;  2DOQ A;  2H8V A;  4CID A;  1KQM B;  2JWW A;  5G08 A;  3TZ1 A;  5HL1 A;  1SL8 A;  1TNQ A;  5BPJ A;  2JTT A;  4KYN A;  2KHN A;  1BR4 B;  3VGO A;  5KSZ A;  1CFP A;  2A4J A;  1Z2C B;  1J55 A;  3KEV A;  3TDU A;  2ZNE A;  3B7A A;  3EK7 A;  3B86 A;  2OS8 B;  2BEC A;  4F7F A;  1FW4 A;  3F45 A;  1RFJ A;  4DIR A;  1IKU A;  1AP4 A;  1CKK A;  4OR9 B;  2K8M B;  5CPV A;  1A2X A;  3SG5 A;  5ER5 A;  2EC6 C;  2K60 A;  1SCM B;  1XFY O;  1QXP A;  2WCK A;  1LKJ A;  1BJF A;  2BAP A;  1D1O A;  3LCP C;  5JJG A;  5CSF A;  4YBH B;  4PE7 A;  3CZ2 A;  2K7D A;  3R1V A;  2M97 A;  2KNE A;  5AFP A;  3DY9 A;  5TNC A;  3NSL A;  1DVI A;  2M3W A;  1KWO B;  4HSZ A;  4DRW A;  2HPS A;  3BUN B;  1KCY A;  3DF0 B;  3S0B A;  1QLS A;  1CM1 A;  1LIN A;  1KQM C;  2I18 A;  4MVF A;  1CM4 A;  3WHU B;  3LL8 B;  3WXA A;  1ZFS A;  2OS8 C;  1KFU L;  2PVB A;  5IBW A;  1C3Z A;  1OOH A;  2LNK A;  1SR6 B;  1PVA A;  3DVE A;  3BFA A;  1DJG A;  1K96 A;  3KPX A;  4INW A;  1JUO A;  4MSP A;  4QJ3 B;  2JNF A;  1SCM C;  1TUZ A;  1LA3 A;  1YX7 A;  1XK4 A;  2IS9 A;  3B88 A;  3E3R A;  4ORC B;  4NDB A;  1L7Z A;  3IVT A;  1S6I A;  2MAZ A;  3S0F A;  1AUI B;  4P2Y B;  2L50 A;  4MZJ A;  1B8C A;  1WLZ A;  3PM2 A;  1K90 D;  4GBA A;  4MLW A;  1SSE B;  4GGN A;  3CDN A;  4MBE A;  1CLM A;  2KAV A;  3EKJ A;  2KQY A;  2PSR A;  4AQI A;  1F8H A;  5KTY A;  1BG1 A;  4E68 A;  1DTL A;  2WC5 A;  2NLN A;  2WND A;  4GPL B;  1ORG A;  2M9G A;  1EL4 A;  1J1E A;  1T14 A;  2FCD A;  5DKQ A;  1DJH A;  2K2F A;  2LLT A;  1WDC B;  3NXA A;  1TOP A;  4PHM A;  1SR6 C;  4DS7 A;  1E8A A;  3EK4 A;  3IQQ A;  1KFU S;  3PAT A;  1TNX A;  4INX A;  1TRF A;  3EVR A;  4YGE B;  3WHT B;  1M45 A;  1NIW A;  1C7V A;  3IF7 A;  1UHI A;  5FI6 A;  3V2L A;  2LLU A;  2JNX A;  1DF0 A;  5JOL A;  1JF0 A;  2KQ6 A;  2I7A A;  2JC2 A;  1KFX L;  2BE6 A;  1G8I A;  3FS7 A;  2PQL A;  2RGI A;  1BT6 A;  3SG7 A;  2QEO A;  2L4H A;  1K9P A;  3QME A;  2F33 A;  4N1F A;  2BBN A;  3SG2 A;  4BY4 A;  1OZS A;  1YUU A;  2OTG B;  2LP2 A;  1B47 A;  1NUB A;  1OE9 B;  3S0A A;  1M46 A; 
#chains in the Genus database with same CATH homology
 1GM0 A;  3R72 A;  4PT1 A;  3S0G A;  2KPH A;  2P71 A;  3FE9 A;  4OZD A;  2QEB A;  3B6X A;  3CZ1 A;  1C3Y A;  3D76 A;  3OGN A;  3CYZ A;  2ERB A;  1OOG A;  3NHI A;  1OOI X;  2H8V A;  1QWV A;  3D78 A;  3L4L A;  2WCJ A;  2QDI A;  3BJH A;  2WCL A;  3B7A A;  4F7F A;  3B86 A;  2L2C A;  3BFH A;  2QEH A;  1P28 A;  2WCK A;  3S0E A;  5DIC A;  3L4A A;  2WCM A;  3CZ2 A;  3R1V A;  1TWO A;  3DY9 A;  3R1O A;  1DQE A;  3S0B A;  3D77 A;  1OW4 A;  3CZ0 A;  2WC6 A;  2P70 A;  1C3Z A;  1OOH A;  4FQT A;  3BFA A;  2GTE A;  4INW A;  2JPO A;  2WCH A;  1TUJ A;  3L47 A;  4JD9 A;  3DYE A;  3B88 A;  3S0F A;  2FJY A;  3CDN A;  1OOF A;  3R1P A;  2WC5 A;  1XFR A;  5EL2 A;  1ORG A;  3PJI A;  1T14 A;  3DXL A;  3RZS A;  3DZT A;  3Q8I A;  3D73 A;  4INX A;  3NGV A;  3NHT A;  3D74 A;  1LS8 A;  3VB1 A;  3K1E A;  3V2L A;  3FE6 A;  3S0D A;  3B87 A;  3CAB A;  2PQL A;  3FE8 A;  2QEO A;  3QME A;  3BFB A;  2QEV A;  3D75 A;  3N7H A;  3S0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...