3JVTC

Calcium-bound scallop myosin regulatory domain (lever arm) with reconstituted complete light chains
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated adductor muscle
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
total genus 48
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtC02
4ETOA 2LNKA 4ICBA 4MRXA 1IH0A 1CKKA 1BOCA 4PHKA 5F6TA 4F0ZB 3LK1A 1K8UA 2CBLA 4ORCB 1K9UA 2L50A 2M49B 4YGDB 3O78A 1BMOA 1CDPA 2I18A 2AMIA 2QACA 2WCBA 2B1UA 1QASA 4GPLB 2LC5A 1DJGA 2LVKA 4HSZA 1PALA 1V1GA 4NDBA 2K0JA 2AUCA 2O5GA 1SNLA 3C1VA 4PE4A 4ZCUA 2ISDA 4AQJA 1QX5B 1GQMA 3TUYB 2EGDA 2EC6C 1IJ5A 3BUXB 1J1EA 4CFRA 2KOTA 2K7CA 2Y1NA 2ZNEA 4WQ3A 1U5IA 2IS9A 2P6BB 3QRXA 5D69A 1RFJA 1KFXL 1YURA 4CIDA 4PDZA 3GOFA 2KAXA 4NQGA 2F2PA 2MLEC 2MBXA 2JWWA 3IQOA 2FOTA 5CSJA 1A75B 3SG5A 4MZLA 2WC8A 2LE9B 4NDCA 1QXPA 3SG3A 2HETA 1YUUA 1Y1AA 3F45A 1MHOA 5AANA 4USLA 1DT7B 1KFUS 1PULA 1BU3A 2MRDA 2Y1MA 2EC6B 1CDMA 1TOPA 1E8AA 1FBVA 1M31A 2KFHA 1JFKA 1G4YR 1NIWA 2Y4QA 1XO5A 4MSPA 2LCPA 4N1GA 3SG7A 4GBAA 1DJWA 1QLSA 2PRUA 2LANA 3TDZA 1NCXA 3M0WA 2F33A 1QLKA 3BUMB 3CR5X 3H4SE 2D8NA 1OMVA 4AOMA 5I2QA 2BKHB 1K96A 4DRWA 3OB2B 5ER4X 5HLVA 2WCFA 1WLZA 1KCYA 3I5GC 2KGRA 4GGNA 3GK4X 3KF9A 3PSRA 2E6WA 1TNQA 1NX3A 2COLB 2K7DA 4M2OA 2NXQA 1LA0A 3NSIA 2K61A 1CDLA 1SK6D 4L9MA 2GGZA 2JXLA 4MVFA 3NXAA 1KWOC 4PHJA 1B9AA 1NX2A 3CWGA 3EVUA 2LMUA 1C7VA 1Y1XA 1Q80A 1QIWA 1SBJA 2L0PA 4OR9B 3O4YA 3D10A 4ORBB 1K2HA 1DVIA 2NLNA 2GV5A 2I2RE 3BYAA 2PALA 1RWYA 1XFVO 2CCMA 3TDIA 2KI6D 4PHNA 1XFUO 3I5GB 4HREE 4DS7A 3NSKA 2EHBA 4YGEB 3VRNA 3DD4A 3AKAA 5AFPA 1MXLC 1CLBA 1N65A 3ZNIA 1GGWA 1SKTA 1B47A 2NCOA 4PE0A 2KAVA 4YRUA 1L7ZA 4OKHA 1S6IA 1EH2A 1KWOB 4ORAB 4I5KA 1CMGA 1UP5A 1UHNA 2ZRSA 4OVNF 5I2OA 1IWQA 1IKUA 4YGAA 2FJUB 1YX7A 2K2FA 1F71A 2HF5A 1K94A 3E3RA 4OV2A 5J3XA 5KSZA 2HPSA 1ZMZA 3I5FC 4YBHB 1CDNA 1PVBA 4ZCVA 4BY5A 1CFDA 1F8HA 1NP8A 4P5OE 4HRHA 1W7JB 1K9KA 1TN4A 1F55A 2WOSA 4QJ3B 1XFWO 1UWOA 3SJSA 1MR8A 2PVBA 2ZNDA 1CM4A 2M3WA 4GGFA 1YRTB 1K90D 2ZRTA 2BBNA 4MBEA 1WRLA 2BCXA 2JNXA 1TIZA 3JVTC 2FCEA 4M2PA 1J55A 1QV1A 3EKHA 4MZKA 3VRRA 1DTLA 1D1OA 1UURA 2CT9A 3PN7C 5IBWA 4I5JA 2BCBA 3FS7A 1NYAA 1W7IB 2JRFA 3I5FB 1ZFSA 3CZTX 2JPTA 5JJGA 2KI4C 3PATA 4GGFC 1KQMC 1S36A 5KU1A 1YR5A 1F70A 2M1KB 3DF0B 1DF0B 1KFUL 1EJ3A 1Y6WA 2PASA 2WCEA 3CTNA 4YI8A 1S26D 1JFJA 4OCIA 1JSAA 1NX1A 1WDCC 1XFXO 1VRKA 1AJ5A 1JWDA 1G8IA 2F3YA 2VRGA 1UUSA 1L2OB 2M8UA 4QJ5B 2TN4A 1SCMC 1TTXA 3OX5A 3JVTB 4N1FA 1LXFC 1Y1UA 2JT3A 2JOJA 2KBMA 1TNWA 1YVHA 3PN7B 2GGMA 2LM5A 3D0YB 5CPVA 2CXJA 1OZSA 1CFCA 2KAYA 3PALA 1SL9A 3I5HB 3WNXB 2KI4B 5K89A 1B4CA 1KQMB 2L5XB 3MSEB 1AVSA 1M39A 3JTDC 3OP0A 1ODBA 2A4JA 4IL1A 2DOQA 1HQVA 1WDCB 3KO0A 1UHIA 4FTGA 1A03A 1JF0A 1NCYA 1S6CA 1SCMB 2KSPA 1CLLA 1FPWA 1CNPA 5FYXA 3TS5C 1WRZA 1XVJA 3WHUB 1EL4A 2F8PA 2M1UA 1JBAA 3BXKA 1M45A 4TNCA 1JC2A 2JQ6A 1SL8A 1DJZA 2F3ZA 5GQQC 1MQ1A 2RGIA 5PALA 1RK9A 1F4QA 3OB1B 4WQ2A 2MHHA 4E68A 1B7TY 3NSLA 3JTDB 1IGVA 2L51A 1SRAA 2KBIA 4C0KA 3I5IC 2JULA 5HKZA 1H4BA 1FI5A 4JPZB 3OHMB 1PVAA 4XYNA 1J7PA 1LVCD 2OTGC 4CFQA 1S5GY 5DKNA 5KTYA 1OZOA 4A4CA 3LCPC 5AERA 1TCFA 2L98A 5ER5A 4CPVA 2JU0A 1BG1A 3TS5B 2M9GA 1OMRA 2QPTA 3RM1A 2KQYA 2Q91A 1RROA 5JOLA 4AQIA 3ZWHA 1XYDA 3RLZA 3TUYC 2NCPA 1B8CA 5AXIA 4R1EA 5CSNA 2CTNA 2BKIB 2BE6A 1WRKA 1QJTA 2K7OA 2L2EA 1SYMA 3I5IB 1PRWA 4YGBB 4D1EA 1A2XA 1SCVA 5HKWA 4PCWA 1UHJA 3FWCA 1BT6A 1N2DA 2OTGB 3VRQA 1AJ4A 1AHRA 2KFFA 2KQ6A 1IQ3A 1J7OA 2JTTA 1V1FA 4DIRA 3DF0A 3HX4A 1DF0A 3HCMA 3SIBA 5DKQA 3A8RA 2LLTA 2HQWA 2BE4A 1AK8A 4FQOA 3A4UB 3LL8B 3PFVA 1M63B 3SG6A 3GK2A 1CLMA 1N0YA 2MLFC 3AKBA 4QJ4B 1IG5A 1QIVA 2JNFA 4MZJA 3KPXA 1ALWA 4MRYA 1SW8A 2LV7A 2L4IA 1QVIY 1EG3A 2HQ8A 2BBMA 3LK0A 1XK4A 4CLNA 1KQVA 2M7NA 1B8LA 1IQ5A 3CR2A 2KDHA 5I8NA 1AUIB 1S1EA 3D0YA 1H8BA 4JWQA 3BQ3A 3K21A 1NWDA 1GJYA 2O60A 1L2OC 1A75A 4GUKA 1NSHA 2AAOA 1PSRA 1A29A 1X02A 1XFZO 4XJKB 2BL0B 3DVJA 1XK4C 4PE1A 3EKJA 2LUCA 3CS1A 1K9PA 4NDDA 1PK0D 2I7AA 2LAPA 1AP4A 3I5HC 3BUOB 1KSMA 2Q4UA 1BODA 1B1GA 2JC2A 1QX2A 2LP2A 1ZACA 1YVLA 2V53A 4GNKB 3WXAA 3BOWB 5HKYA 4P2YB 1DJXA 3O6BA 4U8DA 1WLMA 2LVIA 3CR4X 2LMTA 1NCZA 1KK7Y 5D7FA 2K7BA 5HLOA 3EK7A 1TCOB 2SASA 1DMOA 2LLUA 3SG2A 1XFYO 2KNEA 2LMVA 2OS8C 4MEWA 1RTP1 1KSOA 2R2IA 1RECA 2H61A 2CNPA 2L4HA 4DUQA 2M29A 3EVRA 2KYCA 1B7TZ 1TNXA 4PE7A 3PM8A 1G33A 1TRFA 2MAZA 2M7LA 1BJFA 2ZFDA 5CSIA 4UPGA 1CFPA 2JZIA 2LP3A 1YUTA 1F54A 1S5GZ 1LINA 2LVVA 1EG4A 2LVJA 3WHTB 1R6PA 2H61C 3SG4A 4I5NB 1RJVA 4PALA 5TNCA 1LKJA 3DVMA 2KYFA 2ZN9A 3O2PA 4I5LB 1S6JA 1CB1A 1IJ6A 2OS8B 5I2LA 5DKRA 1SR6C 3CGAA 2JT0A 1C07A 3EK4A 2NZ0A 2WNDA 1HT9A 2G2BA 3AAJA 4Q04A 1DJHA 3SIAA 1KK8C 2LLSA 5AEQA 1ZOTB 1PSBA 2BCAA 2PMYA 1A4PA 2SCPA 2H2KA 4A4BA 1JUOA 3AAKA 1DJYA 1YX8A 3LLEA 4DCKA 1OQPA 1FW4A 1QX7A 1S3PA 3EVVA 1BR4B 5CSFA 3DVKA 3IF7A 2LHIA 1SL7A 1CTRA 1KFXS 2F2OA 1K95A 1QATA 4WRIA 1DGUA 3BUWB 2KHNA 3KHEA 3PLFB 1SR6B 1OSAA 3VRPA 4MLWA 3VROA 1U5IB 1YRUB 4C0JA 4BY4A 2OPOA 3BUNB 1BR1B 1KK8B 2JTZA 1ALVA 1ZUZA 1QVIZ 2K8MB 1B8RA 3EK8A 1QTXA 1BLQA 2M97A 1BF5A 4XJKA 1UHKA 2KFGA 3FWBA 2G9BA 2FCDA 4JQ0D 1XA5A 1FI6A 3OX6A 1J1DA 2M0RA 4HRGA 5B8IB 4C0LA 1R2UA 4PHMA 2ZN8A 3VGOA 1DJIA 1GGZA 3KEVA 1CFFA 5HYDA 2MJWB 2Y5IA 2ZKMX 1C7WA 1JF2A 2LUXA 1K93D 2BL0C 3BOWA 4GAOA 4M2QA 2BECA 1OE9B 1MWNA 1J7RA 4MN0A 1NPQA 4YI9A 5G08A 1DGVA 1MXEA 2JT8A 2JXCA 2MA2A 1CMFA 2LHLA 3FIAA 1LA3A 1YUSA 4N5XA 1WY9A 2WORA 1TNPA 1MUXA 1NX0A 1SY9A 1KK7Z 1UHHA 3ICBA 3CLNA 1EXRA 1NUBA 1QV0A 2KGBC 3IQQA 3GK1A 3NSOA 1SPYA 2I94A 1J7QA 1IRJA 1OMDA 2K2AA 2PSRA 1F4OA 1MF8B 2E30A 4YGCB 3TDUA 1QS7A 1YTZC 1CM1A 5BPJA 1SMGA 2KI6C 1Y0VH 3DVEA 4GFTA 3TZ1A 1OOJA 1M46A 1FF1A
chains in the Genus database with same CATH superfamily
4JKTA 4ETOA 2LNKA 1OW4A 2WCHA 4ICBA 4MRXA 1IH0A 1CKKA 1BOCA 4PHKA 5F6TA 4F0ZB 2BAPA 3LK1A 1K8UA 2CBLA 3BJHA 1K9UA 4ORCB 2L50A 2M49B 4YGDB 3O78A 1BMOA 1CDPA 2I18A 5HL1A 2AMIA 2QACA 2WCBA 2B1UA 1QASA 3B7AA 4GPLB 2LC5A 1DJGA 2LVKA 3EG5B 4HSZA 1PALA 1V1GA 4NDBA 2K0JA 2AUCA 2O5GA 1SNLA 3C1VA 4PE4A 4ZCUA 2ISDA 3S0GA 4AQJA 1QX5B 1GQMA 3TUYB 2EGDA 1T14A 2EC6C 1IJ5A 3BUXB 1J1EA 4CFRA 2KOTA 2K7CA 2Y1NA 2ZNEA 4WQ3A 1U5IA 2IS9A 1OOHA 2P6BB 3QRXA 5D69A 1RFJA 1KFXL 1YURA 4CIDA 3D78A 3GOFA 4PDZA 3SS4A 5I94A 2KAXA 4NQGA 1C3YA 2F2PA 2MLEC 2MBXA 2JWWA 3IQOA 2FOTA 5CSJA 1A75B 3SG5A 4MZLA 2KLDA 2WC8A 2LE9B 4NDCA 1OOFA 1QXPA 1J7QA 3SG3A 2HETA 1YUUA 1Z2CB 1Y1AA 3F45A 1MHOA 5AANA 4USLA 1DT7B 1KFUS 1PULA 1BU3A 2MRDA 2Y1MA 2EC6B 1CDMA 1TOPA 1E8AA 1FBVA 1M31A 2KFHA 3D74A 3D77A 1JFKA 1G4YR 1NIWA 2Y4QA 1XO5A 4MSPA 2P70A 2LCPA 4N1GA 3SG7A 2L2CA 4GBAA 1DJWA 1QLSA 2PRUA 2LANA 3TDZA 1NCXA 3M0WA 2F33A 1QLKA 3BUMB 3CR5X 3H4SE 2QDIA 3DYEA 2D8NA 1OMVA 3UO9A 4AOMA 5I2QA 2BKHB 1K96A 1TUJA 4DRWA 3OB2B 5ER4X 5HLVA 2WCFA 1WLZA 2WCJA 3I5GC 2KGRA 3V2LA 1KCYA 4GGNA 3GK4X 3KF9A 3PSRA 2E6WA 1TNQA 2ERBA 1NX3A 2COLB 2K7DA 4M2OA 2NXQA 1LA0A 3NSIA 3PJIA 2K61A 1CDLA 1SK6D 4L9MA 2GGZA 2JXLA 4MVFA 3NXAA 1KWOC 4PHJA 1B9AA 1NX2A 3CWGA 1IIOA 3EVUA 2LMUA 1C7VA 2QEVA 1Y1XA 1Q80A 1QIWA 3RZSA 1SBJA 2L0PA 3R1VA 3O4YA 3D10A 4OR9B 4ORBB 1K2HA 1DVIA 2NLNA 2GV5A 2I2RE 3BYAA 2PALA 3BFHA 1RWYA 1XFVO 2CCMA 3TDIA 2KI6D 4PHNA 1XFUO 3I5GB 4HREE 4DS7A 3NSKA 2EHBA 4YGEB 3VRNA 3DD4A 3AKAA 5AFPA 1MXLC 4JD9A 1CLBA 1N65A 3ZNIA 1GGWA 1SKTA 1TUZA 1B47A 2NCOA 4PE0A 2KAVA 3FE8A 4YRUA 1L7ZA 4OKHA 1S6IA 1EH2A 1KWOB 4ORAB 4I5KA 3CZ2A 5EL2A 1UP5A 1CMGA 1UHNA 2ZRSA 4OVNF 5I2OA 1IWQA 1IKUA 1DC1A 4YGAA 3QMEA 1GM0A 1DQEA 2FJUB 1YX7A 2K2FA 1F71A 2HF5A 1K94A 3E3RA 4OV2A 5J3XA 4OZDA 5KSZA 2HPSA 1ZMZA 3I5FC 3R1OA 3S0EA 4YBHB 4PT1A 1CDNA 1PVBA 4ZCVA 4BY5A 1CFDA 1F8HA 1NP8A 2P71A 4P5OE 4HRHA 1W7JB 1K9KA 3OBVA 1TN4A 1F55A 2WOSA 4MZKA 4QJ3B 3O4XA 1XFWO 1UWOA 3SJSA 1MR8A 2PVBA 2ZNDA 1CM4A 2M3WA 4GGFA 1YRTB 1K90D 2ZRTA 2BBNA 4MBEA 1WRLA 2BCXA 2JNXA 1TIZA 2WC5A 2FCEA 3JVTC 1J55A 1QV1A 3EKHA 4M2PA 2KLEA 1DTLA 3VRRA 1D1OA 1UURA 2CT9A 3PN7C 5IBWA 4I5JA 2BCBA 3FS7A 1NYAA 1W7IB 2JRFA 3I5FB 1ZFSA 3CZTX 2JPTA 5JJGA 2KI4C 3PATA 4GGFC 1KQMC 1S36A 5KU1A 1YR5A 1F70A 2M1KB 2JPOA 3DF0B 1DF0B 1KFUL 1EJ3A 1Y6WA 2PASA 2WCEA 3CTNA 4YI8A 1S26D 1JFJA 4OCIA 1JSAA 1NX1A 1WDCC 1XFXO 1VRKA 1AJ5A 1JWDA 1G8IA 2F3YA 2VRGA 1UUSA 1L2OB 2M8UA 3BFBA 2L5YA 4QJ5B 2TN4A 3VB1A 1SCMC 1TTXA 3OX5A 3JVTB 4N1FA 1LXFC 1Y1UA 2JT3A 2JOJA 2KBMA 1TNWA 1YVHA 3PN7B 5FI2A 2GGMA 3UNWA 2LM5A 3L4AA 3B88A 3D0YB 5CPVA 2CXJA 1OZSA 1CFCA 2KAYA 3PALA 1SL9A 3I5HB 3WNXB 2KI4B 2BNXA 5K89A 1KQMB 2L5XB 1B4CA 3MSEB 1AVSA 1LS8A 1M39A 3D73A 3JTDC 3OP0A 1ODBA 2A4JA 4IL1A 2DOQA 1HQVA 1WDCB 3KO0A 1UHIA 4FTGA 1A03A 1QWVA 1JF0A 1NCYA 1S6CA 1SCMB 2KSPA 1CLLA 3SS3A 1FPWA 2K60A 1CNPA 5FYXA 3TS5C 1WRZA 1XVJA 2GTEA 3WHUB 1EL4A 2F8PA 2KPHA 2M1UA 1JBAA 3BXKA 1M45A 4TNCA 1JC2A 2JQ6A 1SL8A 1DJZA 2F3ZA 5GQQC 1MQ1A 2RGIA 5PALA 4INWA 1RK9A 1F4QA 3OB1B 4WQ2A 2MHHA 4E68A 1B7TY 3NSLA 3JTDB 1IGVA 2L51A 1SRAA 2KBIA 4C0KA 5FI7A 3I5IC 2JULA 5HKZA 1H4BA 1FI5A 4JPZB 3OHMB 1PVAA 4XYNA 1J7PA 1XFRA 1LVCD 1TWOA 2OTGC 1S5GY 4CFQA 5DKNA 5KTYA 1OZOA 4A4CA 3LCPC 5AERA 1TCFA 2L98A 3BFAA 5ER5A 2JU0A 4CPVA 1BG1A 3TS5B 2M9GA 1OMRA 2QPTA 3RM1A 2KQYA 2Q91A 2QEOA 1RROA 5JOLA 4AQIA 3ZWHA 1XYDA 3RLZA 3TUYC 2YGUA 3D76A 2NCPA 1B8CA 5AXIA 4R1EA 5CSNA 3R1PA 2CTNA 2BKIB 2BE6A 1WRKA 1QJTA 2K7OA 2L2EA 1SYMA 3I5IB 1PRWA 4YGBB 4D1EA 1A2XA 1SCVA 3N7HA 5HKWA 4PCWA 1UHJA 3FWCA 1BT6A 1N2DA 2OTGB 3K1EA 3VRQA 1AJ4A 1AHRA 2KFFA 2KQ6A 1IQ3A 1J7OA 2JTTA 3DZTA 1V1FA 4DIRA 3B87A 3DF0A 3HX4A 1DF0A 3HCMA 3SIBA 5DKQA 3A8RA 2LLTA 2HQWA 2BE4A 1AK8A 4FQOA 3A4UB 3LL8B 2WCKA 1M63B 3PFVA 3D75A 3GK2A 3SG6A 1CLMA 1N0YA 2MLFC 3AKBA 3R72A 4QJ4B 1IG5A 1QIVA 2JNFA 4MZJA 3KPXA 1ALWA 4MRYA 1SW8A 2LV7A 1DEKA 1QVIY 2L4IA 3B6XA 1EG3A 2HQ8A 2BBMA 3LK0A 1XK4A 4CLNA 1KQVA 3DY9A 2M7NA 1B8LA 1IQ5A 3CR2A 2KDHA 5I8NA 1AUIB 1S1EA 3D0YA 1H8BA 4JWQA 3BQ3A 3K21A 1NWDA 1GJYA 2O60A 3B86A 1L2OC 1A75A 4GUKA 1NSHA 2AAOA 1PSRA 1A29A 1X02A 1XFZO 4XJKB 2BL0B 3DVJA 1XK4C 4PE1A 3EKJA 2LUCA 3CS1A 1K9PA 4NDDA 1PK0D 2I7AA 2LAPA 1AP4A 3I5HC 3BUOB 3L4LA 1KSMA 3CYZA 2Q4UA 1BODA 1B1GA 2JC2A 1QX2A 2LP2A 1ZACA 3CZ1A 1YVLA 2V53A 4GNKB 3WXAA 3BOWB 5HKYA 1ORGA 4P2YB 1DJXA 2PQLA 3O6BA 4U8DA 1WLMA 2LVIA 3CR4X 3CDNA 2LMTA 1NCZA 3SS5A 1KK7Y 5D7FA 2K7BA 2WCLA 5HLOA 3EK7A 1TCOB 2SASA 2WC6A 3OGNA 1DMOA 2LLUA 3Q8IA 3SG2A 1XFYO 2KNEA 2LMVA 2QEBA 2OS8C 4MEWA 2WCMA 1RTP1 1KSOA 2R2IA 1RECA 2H61A 2CNPA 2L4HA 4DUQA 2M29A 3EVRA 3PM2A 2KYCA 1B7TZ 1TNXA 4PE7A 3PM8A 3S0BA 1G33A 1TRFA 2MAZA 4FQTA 2M7LA 1BJFA 2ZFDA 5CSIA 3CZ0A 4UPGA 1CFPA 2JZIA 2LP3A 1YUTA 3FE9A 1S5GZ 1LINA 2LVVA 4IJ7A 1EG4A 1F54A 2LVJA 2QEHA 3WHTB 1R6PA 2H61C 3SG4A 4I5NB 1RJVA 4PALA 5TNCA 1LKJA 3DVMA 2KYFA 2ZN9A 3O2PA 4I5LB 1S6JA 1CB1A 1IJ6A 2OS8B 5I2LA 5DKRA 1SR6C 3CGAA 2JT0A 1C07A 3EK4A 2NZ0A 2WNDA 1HT9A 2G2BA 3AAJA 3DXLA 1OOGA 4Q04A 1DJHA 3SIAA 1KK8C 2LLSA 5AEQA 1ZOTB 1DELA 1PSBA 2BCAA 2PMYA 1A4PA 2SCPA 2H2KA 4A4BA 1JUOA 1C3ZA 1DJYA 1YX8A 3AAKA 3LLEA 4DCKA 1OQPA 5D3OA 1FW4A 1QX7A 1S3PA 3EVVA 1BR4B 5CSFA 3DVKA 3IF7A 1W9ZA 1P28A 2FJYA 2LHIA 1SL7A 1CTRA 1KFXS 2F2OA 1K95A 1QATA 4WRIA 1DGUA 3BUWB 2KHNA 3KHEA 3PLFB 1SR6B 1Z4HA 1OSAA 3VRPA 4MLWA 3VROA 1U5IB 1YRUB 3S0DA 4C0JA 4BY4A 2OPOA 3BUNB 1BR1B 1KK8B 2JTZA 1ALVA 1ZUZA 3FE6A 1QVIZ 2K8MB 1B8RA 3EK8A 1QTXA 1BLQA 3NHIA 2M97A 1BF5A 3IVTA 5FI6A 4XJKA 1UHKA 2KFGA 3FWBA 1OOIX 2FCDA 2G9BA 2PYQA 4JQ0D 1XA5A 4KYNA 1FI6A 3OX6A 1J1DA 2M0RA 4HRGA 5B8IB 3CABA 1R2UA 4PHMA 4C0LA 2ZN8A 3VGOA 1DJIA 1GGZA 3KEVA 1CFFA 5HYDA 2MJWB 2Y5IA 2ZKMX 4INXA 1C7WA 1JF2A 2LUXA 1K93D 2BL0C 3BOWA 4GAOA 4M2QA 2BECA 1OE9B 2H8VA 1MWNA 1J7RA 4MN0A 1NPQA 4YI9A 1SSEB 5G08A 1DGVA 1MXEA 2JT8A 2JXCA 2MA2A 1CMFA 2LHLA 3FIAA 1LA3A 1YUSA 4N5XA 1WY9A 2WORA 1TNPA 1MUXA 1NX0A 1SY9A 1KK7Z 1UHHA 3ICBA 3CLNA 1EXRA 1NUBA 1QV0A 2KGBC 3IQQA 3GK1A 3NSOA 1SPYA 2I94A 5DICA 3S0AA 1IRJA 1OMDA 2K2AA 2PSRA 1F4OA 3NHTA 1MF8B 3L47A 2E30A 3NGVA 4YGCB 3TDUA 1QS7A 1YTZC 1CM1A 5BPJA 1SMGA 2KI6C 1Y0VH 3DVEA 3S0FA 4GFTA 3TZ1A 4F7FA 1OOJA 1M46A 1FF1A
chains in the Genus database with same CATH topology
4ETOA 2LNKA 4ICBA 4MRXA 1IH0A 1CKKA 1BOCA 4PHKA 5F6TA 4F0ZB 3LK1A 1K8UA 2CBLA 4ORCB 1K9UA 2L50A 2M49B 4YGDB 3O78A 1BMOA 1CDPA 2I18A 2AMIA 2QACA 2WCBA 2B1UA 1QASA 4GPLB 2LC5A 1DJGA 2LVKA 4HSZA 1PALA 1V1GA 4NDBA 2K0JA 2AUCA 2O5GA 1SNLA 3C1VA 4PE4A 4ZCUA 2ISDA 4AQJA 1QX5B 1GQMA 3TUYB 2EGDA 2EC6C 1IJ5A 3BUXB 1J1EA 4CFRA 2KOTA 2K7CA 2Y1NA 2ZNEA 4WQ3A 1U5IA 2IS9A 2P6BB 3QRXA 5D69A 1RFJA 1KFXL 1YURA 4CIDA 4PDZA 3GOFA 2KAXA 4NQGA 2F2PA 2MLEC 2MBXA 2JWWA 3IQOA 2FOTA 5CSJA 1A75B 3SG5A 4MZLA 2WC8A 2LE9B 4NDCA 1QXPA 3SG3A 2HETA 1YUUA 1Y1AA 3F45A 1MHOA 5AANA 4USLA 1DT7B 1KFUS 1PULA 1BU3A 2MRDA 2Y1MA 2EC6B 1CDMA 1TOPA 1E8AA 1FBVA 1M31A 2KFHA 1JFKA 1G4YR 1NIWA 2Y4QA 1XO5A 4MSPA 2LCPA 4N1GA 3SG7A 4GBAA 1DJWA 1QLSA 2PRUA 2LANA 3TDZA 1NCXA 3M0WA 2F33A 1QLKA 3BUMB 3CR5X 3H4SE 2D8NA 1OMVA 4AOMA 5I2QA 2BKHB 1K96A 4DRWA 3OB2B 5ER4X 5HLVA 2WCFA 1WLZA 1KCYA 3I5GC 2KGRA 4GGNA 3GK4X 3KF9A 3PSRA 2E6WA 1TNQA 1NX3A 2COLB 2K7DA 4M2OA 2NXQA 1LA0A 3NSIA 2K61A 1CDLA 1SK6D 4L9MA 2GGZA 2JXLA 4MVFA 3NXAA 1KWOC 4PHJA 1B9AA 1NX2A 3CWGA 3EVUA 2LMUA 1C7VA 1Y1XA 1Q80A 1QIWA 1SBJA 2L0PA 4OR9B 3O4YA 3D10A 4ORBB 1K2HA 1DVIA 2NLNA 2GV5A 2I2RE 3BYAA 2PALA 1RWYA 1XFVO 2CCMA 3TDIA 2KI6D 4PHNA 1XFUO 3I5GB 4HREE 4DS7A 3NSKA 2EHBA 4YGEB 3VRNA 3DD4A 3AKAA 5AFPA 1MXLC 1CLBA 1N65A 3ZNIA 1GGWA 1SKTA 1B47A 2NCOA 4PE0A 2KAVA 4YRUA 1L7ZA 4OKHA 1S6IA 1EH2A 1KWOB 4ORAB 4I5KA 1CMGA 1UP5A 1UHNA 2ZRSA 4OVNF 5I2OA 1IWQA 1IKUA 4YGAA 2FJUB 1YX7A 2K2FA 1F71A 2HF5A 1K94A 3E3RA 4OV2A 5J3XA 5KSZA 2HPSA 1ZMZA 3I5FC 4YBHB 1CDNA 1PVBA 4ZCVA 4BY5A 1CFDA 1F8HA 1NP8A 4P5OE 4HRHA 1W7JB 1K9KA 1TN4A 1F55A 2WOSA 4QJ3B 1XFWO 1UWOA 3SJSA 1MR8A 2PVBA 2ZNDA 1CM4A 2M3WA 4GGFA 1YRTB 1K90D 2ZRTA 2BBNA 4MBEA 1WRLA 2BCXA 2JNXA 1TIZA 3JVTC 2FCEA 4M2PA 1J55A 1QV1A 3EKHA 4MZKA 3VRRA 1DTLA 1D1OA 1UURA 2CT9A 3PN7C 5IBWA 4I5JA 2BCBA 3FS7A 1NYAA 1W7IB 2JRFA 3I5FB 1ZFSA 3CZTX 2JPTA 5JJGA 2KI4C 3PATA 4GGFC 1KQMC 1S36A 5KU1A 1YR5A 1F70A 2M1KB 3DF0B 1DF0B 1KFUL 1EJ3A 1Y6WA 2PASA 2WCEA 3CTNA 4YI8A 1S26D 1JFJA 4OCIA 1JSAA 1NX1A 1WDCC 1XFXO 1VRKA 1AJ5A 1JWDA 1G8IA 2F3YA 2VRGA 1UUSA 1L2OB 2M8UA 4QJ5B 2TN4A 1SCMC 1TTXA 3OX5A 3JVTB 4N1FA 1LXFC 1Y1UA 2JT3A 2JOJA 2KBMA 1TNWA 1YVHA 3PN7B 2GGMA 2LM5A 3D0YB 5CPVA 2CXJA 1OZSA 1CFCA 2KAYA 3PALA 1SL9A 3I5HB 3WNXB 2KI4B 5K89A 1B4CA 1KQMB 2L5XB 3MSEB 1AVSA 1M39A 3JTDC 3OP0A 1ODBA 2A4JA 4IL1A 2DOQA 1HQVA 1WDCB 3KO0A 1UHIA 4FTGA 1A03A 1JF0A 1NCYA 1S6CA 1SCMB 2KSPA 1CLLA 1FPWA 1CNPA 5FYXA 3TS5C 1WRZA 1XVJA 3WHUB 1EL4A 2F8PA 2M1UA 1JBAA 3BXKA 1M45A 4TNCA 1JC2A 2JQ6A 1SL8A 1DJZA 2F3ZA 5GQQC 1MQ1A 2RGIA 5PALA 1RK9A 1F4QA 3OB1B 4WQ2A 2MHHA 4E68A 1B7TY 3NSLA 3JTDB 1IGVA 2L51A 1SRAA 2KBIA 4C0KA 3I5IC 2JULA 5HKZA 1H4BA 1FI5A 4JPZB 3OHMB 1PVAA 4XYNA 1J7PA 1LVCD 2OTGC 4CFQA 1S5GY 5DKNA 5KTYA 1OZOA 4A4CA 3LCPC 5AERA 1TCFA 2L98A 5ER5A 4CPVA 2JU0A 1BG1A 3TS5B 2M9GA 1OMRA 2QPTA 3RM1A 2KQYA 2Q91A 1RROA 5JOLA 4AQIA 3ZWHA 1XYDA 3RLZA 3TUYC 2NCPA 1B8CA 5AXIA 4R1EA 5CSNA 2CTNA 2BKIB 2BE6A 1WRKA 1QJTA 2K7OA 2L2EA 1SYMA 3I5IB 1PRWA 4YGBB 4D1EA 1A2XA 1SCVA 5HKWA 4PCWA 1UHJA 3FWCA 1BT6A 1N2DA 2OTGB 3VRQA 1AJ4A 1AHRA 2KFFA 2KQ6A 1IQ3A 1J7OA 2JTTA 1V1FA 4DIRA 3DF0A 3HX4A 1DF0A 3HCMA 3SIBA 5DKQA 3A8RA 2LLTA 2HQWA 2BE4A 1AK8A 4FQOA 3A4UB 3LL8B 3PFVA 1M63B 3SG6A 3GK2A 1CLMA 1N0YA 2MLFC 3AKBA 4QJ4B 1IG5A 1QIVA 2JNFA 4MZJA 3KPXA 1ALWA 4MRYA 1SW8A 2LV7A 2L4IA 1QVIY 1EG3A 2HQ8A 2BBMA 3LK0A 1XK4A 4CLNA 1KQVA 2M7NA 1B8LA 1IQ5A 3CR2A 2KDHA 5I8NA 1AUIB 1S1EA 3D0YA 1H8BA 4JWQA 3BQ3A 3K21A 1NWDA 1GJYA 2O60A 1L2OC 1A75A 4GUKA 1NSHA 2AAOA 1PSRA 1A29A 1X02A 1XFZO 4XJKB 2BL0B 3DVJA 1XK4C 4PE1A 3EKJA 2LUCA 3CS1A 1K9PA 4NDDA 1PK0D 2I7AA 2LAPA 1AP4A 3I5HC 3BUOB 1KSMA 2Q4UA 1BODA 1B1GA 2JC2A 1QX2A 2LP2A 1ZACA 1YVLA 2V53A 4GNKB 3WXAA 3BOWB 5HKYA 4P2YB 1DJXA 3O6BA 4U8DA 1WLMA 2LVIA 3CR4X 2LMTA 1NCZA 1KK7Y 5D7FA 2K7BA 5HLOA 3EK7A 1TCOB 2SASA 1DMOA 2LLUA 3SG2A 1XFYO 2KNEA 2LMVA 2OS8C 4MEWA 1RTP1 1KSOA 2R2IA 1RECA 2H61A 2CNPA 2L4HA 4DUQA 2M29A 3EVRA 2KYCA 1B7TZ 1TNXA 4PE7A 3PM8A 1G33A 1TRFA 2MAZA 2M7LA 1BJFA 2ZFDA 5CSIA 4UPGA 1CFPA 2JZIA 2LP3A 1YUTA 1F54A 1S5GZ 1LINA 2LVVA 1EG4A 2LVJA 3WHTB 1R6PA 2H61C 3SG4A 4I5NB 1RJVA 4PALA 5TNCA 1LKJA 3DVMA 2KYFA 2ZN9A 3O2PA 4I5LB 1S6JA 1CB1A 1IJ6A 2OS8B 5I2LA 5DKRA 1SR6C 3CGAA 2JT0A 1C07A 3EK4A 2NZ0A 2WNDA 1HT9A 2G2BA 3AAJA 4Q04A 1DJHA 3SIAA 1KK8C 2LLSA 5AEQA 1ZOTB 1PSBA 2BCAA 2PMYA 1A4PA 2SCPA 2H2KA 4A4BA 1JUOA 3AAKA 1DJYA 1YX8A 3LLEA 4DCKA 1OQPA 1FW4A 1QX7A 1S3PA 3EVVA 1BR4B 5CSFA 3DVKA 3IF7A 2LHIA 1SL7A 1CTRA 1KFXS 2F2OA 1K95A 1QATA 4WRIA 1DGUA 3BUWB 2KHNA 3KHEA 3PLFB 1SR6B 1OSAA 3VRPA 4MLWA 3VROA 1U5IB 1YRUB 4C0JA 4BY4A 2OPOA 3BUNB 1BR1B 1KK8B 2JTZA 1ALVA 1ZUZA 1QVIZ 2K8MB 1B8RA 3EK8A 1QTXA 1BLQA 2M97A 1BF5A 4XJKA 1UHKA 2KFGA 3FWBA 2G9BA 2FCDA 4JQ0D 1XA5A 1FI6A 3OX6A 1J1DA 2M0RA 4HRGA 5B8IB 4C0LA 1R2UA 4PHMA 2ZN8A 3VGOA 1DJIA 1GGZA 3KEVA 1CFFA 5HYDA 2MJWB 2Y5IA 2ZKMX 1C7WA 1JF2A 2LUXA 1K93D 2BL0C 3BOWA 4GAOA 4M2QA 2BECA 1OE9B 1MWNA 1J7RA 4MN0A 1NPQA 4YI9A 5G08A 1DGVA 1MXEA 2JT8A 2JXCA 2MA2A 1CMFA 2LHLA 3FIAA 1LA3A 1YUSA 4N5XA 1WY9A 2WORA 1TNPA 1MUXA 1NX0A 1SY9A 1KK7Z 1UHHA 3ICBA 3CLNA 1EXRA 1NUBA 1QV0A 2KGBC 3IQQA 3GK1A 3NSOA 1SPYA 2I94A 1J7QA 1IRJA 1OMDA 2K2AA 2PSRA 1F4OA 1MF8B 2E30A 4YGCB 3TDUA 1QS7A 1YTZC 1CM1A 5BPJA 1SMGA 2KI6C 1Y0VH 3DVEA 4GFTA 3TZ1A 1OOJA 1M46A 1FF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ETO A;  2LNK A;  4ICB A;  4MRX A;  1IH0 A;  1CKK A;  1BOC A;  4PHK A;  5F6T A;  4F0Z B;  3LK1 A;  1K8U A;  2CBL A;  4ORC B;  1K9U A;  2L50 A;  2M49 B;  4YGD B;  3O78 A;  1BMO A;  1CDP A;  2I18 A;  2AMI A;  2QAC A;  2WCB A;  2B1U A;  1QAS A;  4GPL B;  2LC5 A;  1DJG A;  2LVK A;  4HSZ A;  1PAL A;  1V1G A;  4NDB A;  2K0J A;  2AUC A;  2O5G A;  1SNL A;  3C1V A;  4PE4 A;  4ZCU A;  2ISD A;  4AQJ A;  1QX5 B;  1GQM A;  3TUY B;  2EGD A;  2EC6 C;  1IJ5 A;  3BUX B;  1J1E A;  4CFR A;  2KOT A;  2K7C A;  2Y1N A;  2ZNE A;  4WQ3 A;  1U5I A;  2IS9 A;  2P6B B;  3QRX A;  5D69 A;  1RFJ A;  1KFX L;  1YUR A;  4CID A;  4PDZ A;  3GOF A;  2KAX A;  4NQG A;  2F2P A;  2MLE C;  2MBX A;  2JWW A;  3IQO A;  2FOT A;  5CSJ A;  1A75 B;  3SG5 A;  4MZL A;  2WC8 A;  2LE9 B;  4NDC A;  1QXP A;  3SG3 A;  2HET A;  1YUU A;  1Y1A A;  3F45 A;  1MHO A;  5AAN A;  4USL A;  1DT7 B;  1KFU S;  1PUL A;  1BU3 A;  2MRD A;  2Y1M A;  2EC6 B;  1CDM A;  1TOP A;  1E8A A;  1FBV A;  1M31 A;  2KFH A;  1JFK A;  1G4Y R;  1NIW A;  2Y4Q A;  1XO5 A;  4MSP A;  2LCP A;  4N1G A;  3SG7 A;  4GBA A;  1DJW A;  1QLS A;  2PRU A;  2LAN A;  3TDZ A;  1NCX A;  3M0W A;  2F33 A;  1QLK A;  3BUM B;  3CR5 X;  3H4S E;  2D8N A;  1OMV A;  4AOM A;  5I2Q A;  2BKH B;  1K96 A;  4DRW A;  3OB2 B;  5ER4 X;  5HLV A;  2WCF A;  1WLZ A;  1KCY A;  3I5G C;  2KGR A;  4GGN A;  3GK4 X;  3KF9 A;  3PSR A;  2E6W A;  1TNQ A;  1NX3 A;  2COL B;  2K7D A;  4M2O A;  2NXQ A;  1LA0 A;  3NSI A;  2K61 A;  1CDL A;  1SK6 D;  4L9M A;  2GGZ A;  2JXL A;  4MVF A;  3NXA A;  1KWO C;  4PHJ A;  1B9A A;  1NX2 A;  3CWG A;  3EVU A;  2LMU A;  1C7V A;  1Y1X A;  1Q80 A;  1QIW A;  1SBJ A;  2L0P A;  4OR9 B;  3O4Y A;  3D10 A;  4ORB B;  1K2H A;  1DVI A;  2NLN A;  2GV5 A;  2I2R E;  3BYA A;  2PAL A;  1RWY A;  1XFV O;  2CCM A;  3TDI A;  2KI6 D;  4PHN A;  1XFU O;  3I5G B;  4HRE E;  4DS7 A;  3NSK A;  2EHB A;  4YGE B;  3VRN A;  3DD4 A;  3AKA A;  5AFP A;  1MXL C;  1CLB A;  1N65 A;  3ZNI A;  1GGW A;  1SKT A;  1B47 A;  2NCO A;  4PE0 A;  2KAV A;  4YRU A;  1L7Z A;  4OKH A;  1S6I A;  1EH2 A;  1KWO B;  4ORA B;  4I5K A;  1CMG A;  1UP5 A;  1UHN A;  2ZRS A;  4OVN F;  5I2O A;  1IWQ A;  1IKU A;  4YGA A;  2FJU B;  1YX7 A;  2K2F A;  1F71 A;  2HF5 A;  1K94 A;  3E3R A;  4OV2 A;  5J3X A;  5KSZ A;  2HPS A;  1ZMZ A;  3I5F C;  4YBH B;  1CDN A;  1PVB A;  4ZCV A;  4BY5 A;  1CFD A;  1F8H A;  1NP8 A;  4P5O E;  4HRH A;  1W7J B;  1K9K A;  1TN4 A;  1F55 A;  2WOS A;  4QJ3 B;  1XFW O;  1UWO A;  3SJS A;  1MR8 A;  2PVB A;  2ZND A;  1CM4 A;  2M3W A;  4GGF A;  1YRT B;  1K90 D;  2ZRT A;  2BBN A;  4MBE A;  1WRL A;  2BCX A;  2JNX A;  1TIZ A;  3JVT C;  2FCE A;  4M2P A;  1J55 A;  1QV1 A;  3EKH A;  4MZK A;  3VRR A;  1DTL A;  1D1O A;  1UUR A;  2CT9 A;  3PN7 C;  5IBW A;  4I5J A;  2BCB A;  3FS7 A;  1NYA A;  1W7I B;  2JRF A;  3I5F B;  1ZFS A;  3CZT X;  2JPT A;  5JJG A;  2KI4 C;  3PAT A;  4GGF C;  1KQM C;  1S36 A;  5KU1 A;  1YR5 A;  1F70 A;  2M1K B;  3DF0 B;  1DF0 B;  1KFU L;  1EJ3 A;  1Y6W A;  2PAS A;  2WCE A;  3CTN A;  4YI8 A;  1S26 D;  1JFJ A;  4OCI A;  1JSA A;  1NX1 A;  1WDC C;  1XFX O;  1VRK A;  1AJ5 A;  1JWD A;  1G8I A;  2F3Y A;  2VRG A;  1UUS A;  1L2O B;  2M8U A;  4QJ5 B;  2TN4 A;  1SCM C;  1TTX A;  3OX5 A;  3JVT B;  4N1F A;  1LXF C;  1Y1U A;  2JT3 A;  2JOJ A;  2KBM A;  1TNW A;  1YVH A;  3PN7 B;  2GGM A;  2LM5 A;  3D0Y B;  5CPV A;  2CXJ A;  1OZS A;  1CFC A;  2KAY A;  3PAL A;  1SL9 A;  3I5H B;  3WNX B;  2KI4 B;  5K89 A;  1B4C A;  1KQM B;  2L5X B;  3MSE B;  1AVS A;  1M39 A;  3JTD C;  3OP0 A;  1ODB A;  2A4J A;  4IL1 A;  2DOQ A;  1HQV A;  1WDC B;  3KO0 A;  1UHI A;  4FTG A;  1A03 A;  1JF0 A;  1NCY A;  1S6C A;  1SCM B;  2KSP A;  1CLL A;  1FPW A;  1CNP A;  5FYX A;  3TS5 C;  1WRZ A;  1XVJ A;  3WHU B;  1EL4 A;  2F8P A;  2M1U A;  1JBA A;  3BXK A;  1M45 A;  4TNC A;  1JC2 A;  2JQ6 A;  1SL8 A;  1DJZ A;  2F3Z A;  5GQQ C;  1MQ1 A;  2RGI A;  5PAL A;  1RK9 A;  1F4Q A;  3OB1 B;  4WQ2 A;  2MHH A;  4E68 A;  1B7T Y;  3NSL A;  3JTD B;  1IGV A;  2L51 A;  1SRA A;  2KBI A;  4C0K A;  3I5I C;  2JUL A;  5HKZ A;  1H4B A;  1FI5 A;  4JPZ B;  3OHM B;  1PVA A;  4XYN A;  1J7P A;  1LVC D;  2OTG C;  4CFQ A;  1S5G Y;  5DKN A;  5KTY A;  1OZO A;  4A4C A;  3LCP C;  5AER A;  1TCF A;  2L98 A;  5ER5 A;  4CPV A;  2JU0 A;  1BG1 A;  3TS5 B;  2M9G A;  1OMR A;  2QPT A;  3RM1 A;  2KQY A;  2Q91 A;  1RRO A;  5JOL A;  4AQI A;  3ZWH A;  1XYD A;  3RLZ A;  3TUY C;  2NCP A;  1B8C A;  5AXI A;  4R1E A;  5CSN A;  2CTN A;  2BKI B;  2BE6 A;  1WRK A;  1QJT A;  2K7O A;  2L2E A;  1SYM A;  3I5I B;  1PRW A;  4YGB B;  4D1E A;  1A2X A;  1SCV A;  5HKW A;  4PCW A;  1UHJ A;  3FWC A;  1BT6 A;  1N2D A;  2OTG B;  3VRQ A;  1AJ4 A;  1AHR A;  2KFF A;  2KQ6 A;  1IQ3 A;  1J7O A;  2JTT A;  1V1F A;  4DIR A;  3DF0 A;  3HX4 A;  1DF0 A;  3HCM A;  3SIB A;  5DKQ A;  3A8R A;  2LLT A;  2HQW A;  2BE4 A;  1AK8 A;  4FQO A;  3A4U B;  3LL8 B;  3PFV A;  1M63 B;  3SG6 A;  3GK2 A;  1CLM A;  1N0Y A;  2MLF C;  3AKB A;  4QJ4 B;  1IG5 A;  1QIV A;  2JNF A;  4MZJ A;  3KPX A;  1ALW A;  4MRY A;  1SW8 A;  2LV7 A;  2L4I A;  1QVI Y;  1EG3 A;  2HQ8 A;  2BBM A;  3LK0 A;  1XK4 A;  4CLN A;  1KQV A;  2M7N A;  1B8L A;  1IQ5 A;  3CR2 A;  2KDH A;  5I8N A;  1AUI B;  1S1E A;  3D0Y A;  1H8B A;  4JWQ A;  3BQ3 A;  3K21 A;  1NWD A;  1GJY A;  2O60 A;  1L2O C;  1A75 A;  4GUK A;  1NSH A;  2AAO A;  1PSR A;  1A29 A;  1X02 A;  1XFZ O;  4XJK B;  2BL0 B;  3DVJ A;  1XK4 C;  4PE1 A;  3EKJ A;  2LUC A;  3CS1 A;  1K9P A;  4NDD A;  1PK0 D;  2I7A A;  2LAP A;  1AP4 A;  3I5H C;  3BUO B;  1KSM A;  2Q4U A;  1BOD A;  1B1G A;  2JC2 A;  1QX2 A;  2LP2 A;  1ZAC A;  1YVL A;  2V53 A;  4GNK B;  3WXA A;  3BOW B;  5HKY A;  4P2Y B;  1DJX A;  3O6B A;  4U8D A;  1WLM A;  2LVI A;  3CR4 X;  2LMT A;  1NCZ A;  1KK7 Y;  5D7F A;  2K7B A;  5HLO A;  3EK7 A;  1TCO B;  2SAS A;  1DMO A;  2LLU A;  3SG2 A;  1XFY O;  2KNE A;  2LMV A;  2OS8 C;  4MEW A;  1RTP 1;  1KSO A;  2R2I A;  1REC A;  2H61 A;  2CNP A;  2L4H A;  4DUQ A;  2M29 A;  3EVR A;  2KYC A;  1B7T Z;  1TNX A;  4PE7 A;  3PM8 A;  1G33 A;  1TRF A;  2MAZ A;  2M7L A;  1BJF A;  2ZFD A;  5CSI A;  4UPG A;  1CFP A;  2JZI A;  2LP3 A;  1YUT A;  1F54 A;  1S5G Z;  1LIN A;  2LVV A;  1EG4 A;  2LVJ A;  3WHT B;  1R6P A;  2H61 C;  3SG4 A;  4I5N B;  1RJV A;  4PAL A;  5TNC A;  1LKJ A;  3DVM A;  2KYF A;  2ZN9 A;  3O2P A;  4I5L B;  1S6J A;  1CB1 A;  1IJ6 A;  2OS8 B;  5I2L A;  5DKR A;  1SR6 C;  3CGA A;  2JT0 A;  1C07 A;  3EK4 A;  2NZ0 A;  2WND A;  1HT9 A;  2G2B A;  3AAJ A;  4Q04 A;  1DJH A;  3SIA A;  1KK8 C;  2LLS A;  5AEQ A;  1ZOT B;  1PSB A;  2BCA A;  2PMY A;  1A4P A;  2SCP A;  2H2K A;  4A4B A;  1JUO A;  3AAK A;  1DJY A;  1YX8 A;  3LLE A;  4DCK A;  1OQP A;  1FW4 A;  1QX7 A;  1S3P A;  3EVV A;  1BR4 B;  5CSF A;  3DVK A;  3IF7 A;  2LHI A;  1SL7 A;  1CTR A;  1KFX S;  2F2O A;  1K95 A;  1QAT A;  4WRI A;  1DGU A;  3BUW B;  2KHN A;  3KHE A;  3PLF B;  1SR6 B;  1OSA A;  3VRP A;  4MLW A;  3VRO A;  1U5I B;  1YRU B;  4C0J A;  4BY4 A;  2OPO A;  3BUN B;  1BR1 B;  1KK8 B;  2JTZ A;  1ALV A;  1ZUZ A;  1QVI Z;  2K8M B;  1B8R A;  3EK8 A;  1QTX A;  1BLQ A;  2M97 A;  1BF5 A;  4XJK A;  1UHK A;  2KFG A;  3FWB A;  2G9B A;  2FCD A;  4JQ0 D;  1XA5 A;  1FI6 A;  3OX6 A;  1J1D A;  2M0R A;  4HRG A;  5B8I B;  4C0L A;  1R2U A;  4PHM A;  2ZN8 A;  3VGO A;  1DJI A;  1GGZ A;  3KEV A;  1CFF A;  5HYD A;  2MJW B;  2Y5I A;  2ZKM X;  1C7W A;  1JF2 A;  2LUX A;  1K93 D;  2BL0 C;  3BOW A;  4GAO A;  4M2Q A;  2BEC A;  1OE9 B;  1MWN A;  1J7R A;  4MN0 A;  1NPQ A;  4YI9 A;  5G08 A;  1DGV A;  1MXE A;  2JT8 A;  2JXC A;  2MA2 A;  1CMF A;  2LHL A;  3FIA A;  1LA3 A;  1YUS A;  4N5X A;  1WY9 A;  2WOR A;  1TNP A;  1MUX A;  1NX0 A;  1SY9 A;  1KK7 Z;  1UHH A;  3ICB A;  3CLN A;  1EXR A;  1NUB A;  1QV0 A;  2KGB C;  3IQQ A;  3GK1 A;  3NSO A;  1SPY A;  2I94 A;  1J7Q A;  1IRJ A;  1OMD A;  2K2A A;  2PSR A;  1F4O A;  1MF8 B;  2E30 A;  4YGC B;  3TDU A;  1QS7 A;  1YTZ C;  1CM1 A;  5BPJ A;  1SMG A;  2KI6 C;  1Y0V H;  3DVE A;  4GFT A;  3TZ1 A;  1OOJ A;  1M46 A;  1FF1 A; 
#chains in the Genus database with same CATH topology
 4JKT A;  4ETO A;  2LNK A;  1OW4 A;  2WCH A;  4ICB A;  4MRX A;  1IH0 A;  1CKK A;  1BOC A;  4PHK A;  5F6T A;  4F0Z B;  2BAP A;  3LK1 A;  1K8U A;  2CBL A;  3BJH A;  1K9U A;  4ORC B;  2L50 A;  2M49 B;  4YGD B;  3O78 A;  1BMO A;  1CDP A;  2I18 A;  5HL1 A;  2AMI A;  2QAC A;  2WCB A;  2B1U A;  1QAS A;  3B7A A;  4GPL B;  2LC5 A;  1DJG A;  2LVK A;  3EG5 B;  4HSZ A;  1PAL A;  1V1G A;  4NDB A;  2K0J A;  2AUC A;  2O5G A;  1SNL A;  3C1V A;  4PE4 A;  4ZCU A;  2ISD A;  3S0G A;  4AQJ A;  1QX5 B;  1GQM A;  3TUY B;  2EGD A;  1T14 A;  2EC6 C;  1IJ5 A;  3BUX B;  1J1E A;  4CFR A;  2KOT A;  2K7C A;  2Y1N A;  2ZNE A;  4WQ3 A;  1U5I A;  2IS9 A;  1OOH A;  2P6B B;  3QRX A;  5D69 A;  1RFJ A;  1KFX L;  1YUR A;  4CID A;  3D78 A;  3GOF A;  4PDZ A;  3SS4 A;  5I94 A;  2KAX A;  4NQG A;  1C3Y A;  2F2P A;  2MLE C;  2MBX A;  2JWW A;  3IQO A;  2FOT A;  5CSJ A;  1A75 B;  3SG5 A;  4MZL A;  2KLD A;  2WC8 A;  2LE9 B;  4NDC A;  1OOF A;  1QXP A;  1J7Q A;  3SG3 A;  2HET A;  1YUU A;  1Z2C B;  1Y1A A;  3F45 A;  1MHO A;  5AAN A;  4USL A;  1DT7 B;  1KFU S;  1PUL A;  1BU3 A;  2MRD A;  2Y1M A;  2EC6 B;  1CDM A;  1TOP A;  1E8A A;  1FBV A;  1M31 A;  2KFH A;  3D74 A;  3D77 A;  1JFK A;  1G4Y R;  1NIW A;  2Y4Q A;  1XO5 A;  4MSP A;  2P70 A;  2LCP A;  4N1G A;  3SG7 A;  2L2C A;  4GBA A;  1DJW A;  1QLS A;  2PRU A;  2LAN A;  3TDZ A;  1NCX A;  3M0W A;  2F33 A;  1QLK A;  3BUM B;  3CR5 X;  3H4S E;  2QDI A;  3DYE A;  2D8N A;  1OMV A;  3UO9 A;  4AOM A;  5I2Q A;  2BKH B;  1K96 A;  1TUJ A;  4DRW A;  3OB2 B;  5ER4 X;  5HLV A;  2WCF A;  1WLZ A;  2WCJ A;  3I5G C;  2KGR A;  3V2L A;  1KCY A;  4GGN A;  3GK4 X;  3KF9 A;  3PSR A;  2E6W A;  1TNQ A;  2ERB A;  1NX3 A;  2COL B;  2K7D A;  4M2O A;  2NXQ A;  1LA0 A;  3NSI A;  3PJI A;  2K61 A;  1CDL A;  1SK6 D;  4L9M A;  2GGZ A;  2JXL A;  4MVF A;  3NXA A;  1KWO C;  4PHJ A;  1B9A A;  1NX2 A;  3CWG A;  1IIO A;  3EVU A;  2LMU A;  1C7V A;  2QEV A;  1Y1X A;  1Q80 A;  1QIW A;  3RZS A;  1SBJ A;  2L0P A;  3R1V A;  3O4Y A;  3D10 A;  4OR9 B;  4ORB B;  1K2H A;  1DVI A;  2NLN A;  2GV5 A;  2I2R E;  3BYA A;  2PAL A;  3BFH A;  1RWY A;  1XFV O;  2CCM A;  3TDI A;  2KI6 D;  4PHN A;  1XFU O;  3I5G B;  4HRE E;  4DS7 A;  3NSK A;  2EHB A;  4YGE B;  3VRN A;  3DD4 A;  3AKA A;  5AFP A;  1MXL C;  4JD9 A;  1CLB A;  1N65 A;  3ZNI A;  1GGW A;  1SKT A;  1TUZ A;  1B47 A;  2NCO A;  4PE0 A;  2KAV A;  3FE8 A;  4YRU A;  1L7Z A;  4OKH A;  1S6I A;  1EH2 A;  1KWO B;  4ORA B;  4I5K A;  3CZ2 A;  5EL2 A;  1UP5 A;  1CMG A;  1UHN A;  2ZRS A;  4OVN F;  5I2O A;  1IWQ A;  1IKU A;  1DC1 A;  4YGA A;  3QME A;  1GM0 A;  1DQE A;  2FJU B;  1YX7 A;  2K2F A;  1F71 A;  2HF5 A;  1K94 A;  3E3R A;  4OV2 A;  5J3X A;  4OZD A;  5KSZ A;  2HPS A;  1ZMZ A;  3I5F C;  3R1O A;  3S0E A;  4YBH B;  4PT1 A;  1CDN A;  1PVB A;  4ZCV A;  4BY5 A;  1CFD A;  1F8H A;  1NP8 A;  2P71 A;  4P5O E;  4HRH A;  1W7J B;  1K9K A;  3OBV A;  1TN4 A;  1F55 A;  2WOS A;  4MZK A;  4QJ3 B;  3O4X A;  1XFW O;  1UWO A;  3SJS A;  1MR8 A;  2PVB A;  2ZND A;  1CM4 A;  2M3W A;  4GGF A;  1YRT B;  1K90 D;  2ZRT A;  2BBN A;  4MBE A;  1WRL A;  2BCX A;  2JNX A;  1TIZ A;  2WC5 A;  2FCE A;  3JVT C;  1J55 A;  1QV1 A;  3EKH A;  4M2P A;  2KLE A;  1DTL A;  3VRR A;  1D1O A;  1UUR A;  2CT9 A;  3PN7 C;  5IBW A;  4I5J A;  2BCB A;  3FS7 A;  1NYA A;  1W7I B;  2JRF A;  3I5F B;  1ZFS A;  3CZT X;  2JPT A;  5JJG A;  2KI4 C;  3PAT A;  4GGF C;  1KQM C;  1S36 A;  5KU1 A;  1YR5 A;  1F70 A;  2M1K B;  2JPO A;  3DF0 B;  1DF0 B;  1KFU L;  1EJ3 A;  1Y6W A;  2PAS A;  2WCE A;  3CTN A;  4YI8 A;  1S26 D;  1JFJ A;  4OCI A;  1JSA A;  1NX1 A;  1WDC C;  1XFX O;  1VRK A;  1AJ5 A;  1JWD A;  1G8I A;  2F3Y A;  2VRG A;  1UUS A;  1L2O B;  2M8U A;  3BFB A;  2L5Y A;  4QJ5 B;  2TN4 A;  3VB1 A;  1SCM C;  1TTX A;  3OX5 A;  3JVT B;  4N1F A;  1LXF C;  1Y1U A;  2JT3 A;  2JOJ A;  2KBM A;  1TNW A;  1YVH A;  3PN7 B;  5FI2 A;  2GGM A;  3UNW A;  2LM5 A;  3L4A A;  3B88 A;  3D0Y B;  5CPV A;  2CXJ A;  1OZS A;  1CFC A;  2KAY A;  3PAL A;  1SL9 A;  3I5H B;  3WNX B;  2KI4 B;  2BNX A;  5K89 A;  1KQM B;  2L5X B;  1B4C A;  3MSE B;  1AVS A;  1LS8 A;  1M39 A;  3D73 A;  3JTD C;  3OP0 A;  1ODB A;  2A4J A;  4IL1 A;  2DOQ A;  1HQV A;  1WDC B;  3KO0 A;  1UHI A;  4FTG A;  1A03 A;  1QWV A;  1JF0 A;  1NCY A;  1S6C A;  1SCM B;  2KSP A;  1CLL A;  3SS3 A;  1FPW A;  2K60 A;  1CNP A;  5FYX A;  3TS5 C;  1WRZ A;  1XVJ A;  2GTE A;  3WHU B;  1EL4 A;  2F8P A;  2KPH A;  2M1U A;  1JBA A;  3BXK A;  1M45 A;  4TNC A;  1JC2 A;  2JQ6 A;  1SL8 A;  1DJZ A;  2F3Z A;  5GQQ C;  1MQ1 A;  2RGI A;  5PAL A;  4INW A;  1RK9 A;  1F4Q A;  3OB1 B;  4WQ2 A;  2MHH A;  4E68 A;  1B7T Y;  3NSL A;  3JTD B;  1IGV A;  2L51 A;  1SRA A;  2KBI A;  4C0K A;  5FI7 A;  3I5I C;  2JUL A;  5HKZ A;  1H4B A;  1FI5 A;  4JPZ B;  3OHM B;  1PVA A;  4XYN A;  1J7P A;  1XFR A;  1LVC D;  1TWO A;  2OTG C;  1S5G Y;  4CFQ A;  5DKN A;  5KTY A;  1OZO A;  4A4C A;  3LCP C;  5AER A;  1TCF A;  2L98 A;  3BFA A;  5ER5 A;  2JU0 A;  4CPV A;  1BG1 A;  3TS5 B;  2M9G A;  1OMR A;  2QPT A;  3RM1 A;  2KQY A;  2Q91 A;  2QEO A;  1RRO A;  5JOL A;  4AQI A;  3ZWH A;  1XYD A;  3RLZ A;  3TUY C;  2YGU A;  3D76 A;  2NCP A;  1B8C A;  5AXI A;  4R1E A;  5CSN A;  3R1P A;  2CTN A;  2BKI B;  2BE6 A;  1WRK A;  1QJT A;  2K7O A;  2L2E A;  1SYM A;  3I5I B;  1PRW A;  4YGB B;  4D1E A;  1A2X A;  1SCV A;  3N7H A;  5HKW A;  4PCW A;  1UHJ A;  3FWC A;  1BT6 A;  1N2D A;  2OTG B;  3K1E A;  3VRQ A;  1AJ4 A;  1AHR A;  2KFF A;  2KQ6 A;  1IQ3 A;  1J7O A;  2JTT A;  3DZT A;  1V1F A;  4DIR A;  3B87 A;  3DF0 A;  3HX4 A;  1DF0 A;  3HCM A;  3SIB A;  5DKQ A;  3A8R A;  2LLT A;  2HQW A;  2BE4 A;  1AK8 A;  4FQO A;  3A4U B;  3LL8 B;  2WCK A;  1M63 B;  3PFV A;  3D75 A;  3GK2 A;  3SG6 A;  1CLM A;  1N0Y A;  2MLF C;  3AKB A;  3R72 A;  4QJ4 B;  1IG5 A;  1QIV A;  2JNF A;  4MZJ A;  3KPX A;  1ALW A;  4MRY A;  1SW8 A;  2LV7 A;  1DEK A;  1QVI Y;  2L4I A;  3B6X A;  1EG3 A;  2HQ8 A;  2BBM A;  3LK0 A;  1XK4 A;  4CLN A;  1KQV A;  3DY9 A;  2M7N A;  1B8L A;  1IQ5 A;  3CR2 A;  2KDH A;  5I8N A;  1AUI B;  1S1E A;  3D0Y A;  1H8B A;  4JWQ A;  3BQ3 A;  3K21 A;  1NWD A;  1GJY A;  2O60 A;  3B86 A;  1L2O C;  1A75 A;  4GUK A;  1NSH A;  2AAO A;  1PSR A;  1A29 A;  1X02 A;  1XFZ O;  4XJK B;  2BL0 B;  3DVJ A;  1XK4 C;  4PE1 A;  3EKJ A;  2LUC A;  3CS1 A;  1K9P A;  4NDD A;  1PK0 D;  2I7A A;  2LAP A;  1AP4 A;  3I5H C;  3BUO B;  3L4L A;  1KSM A;  3CYZ A;  2Q4U A;  1BOD A;  1B1G A;  2JC2 A;  1QX2 A;  2LP2 A;  1ZAC A;  3CZ1 A;  1YVL A;  2V53 A;  4GNK B;  3WXA A;  3BOW B;  5HKY A;  1ORG A;  4P2Y B;  1DJX A;  2PQL A;  3O6B A;  4U8D A;  1WLM A;  2LVI A;  3CR4 X;  3CDN A;  2LMT A;  1NCZ A;  3SS5 A;  1KK7 Y;  5D7F A;  2K7B A;  2WCL A;  5HLO A;  3EK7 A;  1TCO B;  2SAS A;  2WC6 A;  3OGN A;  1DMO A;  2LLU A;  3Q8I A;  3SG2 A;  1XFY O;  2KNE A;  2LMV A;  2QEB A;  2OS8 C;  4MEW A;  2WCM A;  1RTP 1;  1KSO A;  2R2I A;  1REC A;  2H61 A;  2CNP A;  2L4H A;  4DUQ A;  2M29 A;  3EVR A;  3PM2 A;  2KYC A;  1B7T Z;  1TNX A;  4PE7 A;  3PM8 A;  3S0B A;  1G33 A;  1TRF A;  2MAZ A;  4FQT A;  2M7L A;  1BJF A;  2ZFD A;  5CSI A;  3CZ0 A;  4UPG A;  1CFP A;  2JZI A;  2LP3 A;  1YUT A;  3FE9 A;  1S5G Z;  1LIN A;  2LVV A;  4IJ7 A;  1EG4 A;  1F54 A;  2LVJ A;  2QEH A;  3WHT B;  1R6P A;  2H61 C;  3SG4 A;  4I5N B;  1RJV A;  4PAL A;  5TNC A;  1LKJ A;  3DVM A;  2KYF A;  2ZN9 A;  3O2P A;  4I5L B;  1S6J A;  1CB1 A;  1IJ6 A;  2OS8 B;  5I2L A;  5DKR A;  1SR6 C;  3CGA A;  2JT0 A;  1C07 A;  3EK4 A;  2NZ0 A;  2WND A;  1HT9 A;  2G2B A;  3AAJ A;  3DXL A;  1OOG A;  4Q04 A;  1DJH A;  3SIA A;  1KK8 C;  2LLS A;  5AEQ A;  1ZOT B;  1DEL A;  1PSB A;  2BCA A;  2PMY A;  1A4P A;  2SCP A;  2H2K A;  4A4B A;  1JUO A;  1C3Z A;  1DJY A;  1YX8 A;  3AAK A;  3LLE A;  4DCK A;  1OQP A;  5D3O A;  1FW4 A;  1QX7 A;  1S3P A;  3EVV A;  1BR4 B;  5CSF A;  3DVK A;  3IF7 A;  1W9Z A;  1P28 A;  2FJY A;  2LHI A;  1SL7 A;  1CTR A;  1KFX S;  2F2O A;  1K95 A;  1QAT A;  4WRI A;  1DGU A;  3BUW B;  2KHN A;  3KHE A;  3PLF B;  1SR6 B;  1Z4H A;  1OSA A;  3VRP A;  4MLW A;  3VRO A;  1U5I B;  1YRU B;  3S0D A;  4C0J A;  4BY4 A;  2OPO A;  3BUN B;  1BR1 B;  1KK8 B;  2JTZ A;  1ALV A;  1ZUZ A;  3FE6 A;  1QVI Z;  2K8M B;  1B8R A;  3EK8 A;  1QTX A;  1BLQ A;  3NHI A;  2M97 A;  1BF5 A;  3IVT A;  5FI6 A;  4XJK A;  1UHK A;  2KFG A;  3FWB A;  1OOI X;  2FCD A;  2G9B A;  2PYQ A;  4JQ0 D;  1XA5 A;  4KYN A;  1FI6 A;  3OX6 A;  1J1D A;  2M0R A;  4HRG A;  5B8I B;  3CAB A;  1R2U A;  4PHM A;  4C0L A;  2ZN8 A;  3VGO A;  1DJI A;  1GGZ A;  3KEV A;  1CFF A;  5HYD A;  2MJW B;  2Y5I A;  2ZKM X;  4INX A;  1C7W A;  1JF2 A;  2LUX A;  1K93 D;  2BL0 C;  3BOW A;  4GAO A;  4M2Q A;  2BEC A;  1OE9 B;  2H8V A;  1MWN A;  1J7R A;  4MN0 A;  1NPQ A;  4YI9 A;  1SSE B;  5G08 A;  1DGV A;  1MXE A;  2JT8 A;  2JXC A;  2MA2 A;  1CMF A;  2LHL A;  3FIA A;  1LA3 A;  1YUS A;  4N5X A;  1WY9 A;  2WOR A;  1TNP A;  1MUX A;  1NX0 A;  1SY9 A;  1KK7 Z;  1UHH A;  3ICB A;  3CLN A;  1EXR A;  1NUB A;  1QV0 A;  2KGB C;  3IQQ A;  3GK1 A;  3NSO A;  1SPY A;  2I94 A;  5DIC A;  3S0A A;  1IRJ A;  1OMD A;  2K2A A;  2PSR A;  1F4O A;  3NHT A;  1MF8 B;  3L47 A;  2E30 A;  3NGV A;  4YGC B;  3TDU A;  1QS7 A;  1YTZ C;  1CM1 A;  5BPJ A;  1SMG A;  2KI6 C;  1Y0V H;  3DVE A;  3S0F A;  4GFT A;  3TZ1 A;  4F7F A;  1OOJ A;  1M46 A;  1FF1 A; 
#chains in the Genus database with same CATH homology
 4ETO A;  2LNK A;  4ICB A;  4MRX A;  1IH0 A;  1CKK A;  1BOC A;  4PHK A;  5F6T A;  4F0Z B;  3LK1 A;  1K8U A;  2CBL A;  4ORC B;  1K9U A;  2L50 A;  2M49 B;  4YGD B;  3O78 A;  1BMO A;  1CDP A;  2I18 A;  2AMI A;  2QAC A;  2WCB A;  2B1U A;  1QAS A;  4GPL B;  2LC5 A;  1DJG A;  2LVK A;  4HSZ A;  1PAL A;  1V1G A;  4NDB A;  2K0J A;  2AUC A;  2O5G A;  1SNL A;  3C1V A;  4PE4 A;  4ZCU A;  2ISD A;  4AQJ A;  1QX5 B;  1GQM A;  3TUY B;  2EGD A;  2EC6 C;  1IJ5 A;  3BUX B;  1J1E A;  4CFR A;  2KOT A;  2K7C A;  2Y1N A;  2ZNE A;  4WQ3 A;  1U5I A;  2IS9 A;  2P6B B;  3QRX A;  5D69 A;  1RFJ A;  1KFX L;  1YUR A;  4CID A;  4PDZ A;  3GOF A;  2KAX A;  4NQG A;  2F2P A;  2MLE C;  2MBX A;  2JWW A;  3IQO A;  2FOT A;  5CSJ A;  1A75 B;  3SG5 A;  4MZL A;  2WC8 A;  2LE9 B;  4NDC A;  1QXP A;  3SG3 A;  2HET A;  1YUU A;  1Y1A A;  3F45 A;  1MHO A;  5AAN A;  4USL A;  1DT7 B;  1KFU S;  1PUL A;  1BU3 A;  2MRD A;  2Y1M A;  2EC6 B;  1CDM A;  1TOP A;  1E8A A;  1FBV A;  1M31 A;  2KFH A;  1JFK A;  1G4Y R;  1NIW A;  2Y4Q A;  1XO5 A;  4MSP A;  2LCP A;  4N1G A;  3SG7 A;  4GBA A;  1DJW A;  1QLS A;  2PRU A;  2LAN A;  3TDZ A;  1NCX A;  3M0W A;  2F33 A;  1QLK A;  3BUM B;  3CR5 X;  3H4S E;  2D8N A;  1OMV A;  4AOM A;  5I2Q A;  2BKH B;  1K96 A;  4DRW A;  3OB2 B;  5ER4 X;  5HLV A;  2WCF A;  1WLZ A;  1KCY A;  3I5G C;  2KGR A;  4GGN A;  3GK4 X;  3KF9 A;  3PSR A;  2E6W A;  1TNQ A;  1NX3 A;  2COL B;  2K7D A;  4M2O A;  2NXQ A;  1LA0 A;  3NSI A;  2K61 A;  1CDL A;  1SK6 D;  4L9M A;  2GGZ A;  2JXL A;  4MVF A;  3NXA A;  1KWO C;  4PHJ A;  1B9A A;  1NX2 A;  3CWG A;  3EVU A;  2LMU A;  1C7V A;  1Y1X A;  1Q80 A;  1QIW A;  1SBJ A;  2L0P A;  4OR9 B;  3O4Y A;  3D10 A;  4ORB B;  1K2H A;  1DVI A;  2NLN A;  2GV5 A;  2I2R E;  3BYA A;  2PAL A;  1RWY A;  1XFV O;  2CCM A;  3TDI A;  2KI6 D;  4PHN A;  1XFU O;  3I5G B;  4HRE E;  4DS7 A;  3NSK A;  2EHB A;  4YGE B;  3VRN A;  3DD4 A;  3AKA A;  5AFP A;  1MXL C;  1CLB A;  1N65 A;  3ZNI A;  1GGW A;  1SKT A;  1B47 A;  2NCO A;  4PE0 A;  2KAV A;  4YRU A;  1L7Z A;  4OKH A;  1S6I A;  1EH2 A;  1KWO B;  4ORA B;  4I5K A;  1CMG A;  1UP5 A;  1UHN A;  2ZRS A;  4OVN F;  5I2O A;  1IWQ A;  1IKU A;  4YGA A;  2FJU B;  1YX7 A;  2K2F A;  1F71 A;  2HF5 A;  1K94 A;  3E3R A;  4OV2 A;  5J3X A;  5KSZ A;  2HPS A;  1ZMZ A;  3I5F C;  4YBH B;  1CDN A;  1PVB A;  4ZCV A;  4BY5 A;  1CFD A;  1F8H A;  1NP8 A;  4P5O E;  4HRH A;  1W7J B;  1K9K A;  1TN4 A;  1F55 A;  2WOS A;  4QJ3 B;  1XFW O;  1UWO A;  3SJS A;  1MR8 A;  2PVB A;  2ZND A;  1CM4 A;  2M3W A;  4GGF A;  1YRT B;  1K90 D;  2ZRT A;  2BBN A;  4MBE A;  1WRL A;  2BCX A;  2JNX A;  1TIZ A;  3JVT C;  2FCE A;  4M2P A;  1J55 A;  1QV1 A;  3EKH A;  4MZK A;  3VRR A;  1DTL A;  1D1O A;  1UUR A;  2CT9 A;  3PN7 C;  5IBW A;  4I5J A;  2BCB A;  3FS7 A;  1NYA A;  1W7I B;  2JRF A;  3I5F B;  1ZFS A;  3CZT X;  2JPT A;  5JJG A;  2KI4 C;  3PAT A;  4GGF C;  1KQM C;  1S36 A;  5KU1 A;  1YR5 A;  1F70 A;  2M1K B;  3DF0 B;  1DF0 B;  1KFU L;  1EJ3 A;  1Y6W A;  2PAS A;  2WCE A;  3CTN A;  4YI8 A;  1S26 D;  1JFJ A;  4OCI A;  1JSA A;  1NX1 A;  1WDC C;  1XFX O;  1VRK A;  1AJ5 A;  1JWD A;  1G8I A;  2F3Y A;  2VRG A;  1UUS A;  1L2O B;  2M8U A;  4QJ5 B;  2TN4 A;  1SCM C;  1TTX A;  3OX5 A;  3JVT B;  4N1F A;  1LXF C;  1Y1U A;  2JT3 A;  2JOJ A;  2KBM A;  1TNW A;  1YVH A;  3PN7 B;  2GGM A;  2LM5 A;  3D0Y B;  5CPV A;  2CXJ A;  1OZS A;  1CFC A;  2KAY A;  3PAL A;  1SL9 A;  3I5H B;  3WNX B;  2KI4 B;  5K89 A;  1B4C A;  1KQM B;  2L5X B;  3MSE B;  1AVS A;  1M39 A;  3JTD C;  3OP0 A;  1ODB A;  2A4J A;  4IL1 A;  2DOQ A;  1HQV A;  1WDC B;  3KO0 A;  1UHI A;  4FTG A;  1A03 A;  1JF0 A;  1NCY A;  1S6C A;  1SCM B;  2KSP A;  1CLL A;  1FPW A;  1CNP A;  5FYX A;  3TS5 C;  1WRZ A;  1XVJ A;  3WHU B;  1EL4 A;  2F8P A;  2M1U A;  1JBA A;  3BXK A;  1M45 A;  4TNC A;  1JC2 A;  2JQ6 A;  1SL8 A;  1DJZ A;  2F3Z A;  5GQQ C;  1MQ1 A;  2RGI A;  5PAL A;  1RK9 A;  1F4Q A;  3OB1 B;  4WQ2 A;  2MHH A;  4E68 A;  1B7T Y;  3NSL A;  3JTD B;  1IGV A;  2L51 A;  1SRA A;  2KBI A;  4C0K A;  3I5I C;  2JUL A;  5HKZ A;  1H4B A;  1FI5 A;  4JPZ B;  3OHM B;  1PVA A;  4XYN A;  1J7P A;  1LVC D;  2OTG C;  4CFQ A;  1S5G Y;  5DKN A;  5KTY A;  1OZO A;  4A4C A;  3LCP C;  5AER A;  1TCF A;  2L98 A;  5ER5 A;  4CPV A;  2JU0 A;  1BG1 A;  3TS5 B;  2M9G A;  1OMR A;  2QPT A;  3RM1 A;  2KQY A;  2Q91 A;  1RRO A;  5JOL A;  4AQI A;  3ZWH A;  1XYD A;  3RLZ A;  3TUY C;  2NCP A;  1B8C A;  5AXI A;  4R1E A;  5CSN A;  2CTN A;  2BKI B;  2BE6 A;  1WRK A;  1QJT A;  2K7O A;  2L2E A;  1SYM A;  3I5I B;  1PRW A;  4YGB B;  4D1E A;  1A2X A;  1SCV A;  5HKW A;  4PCW A;  1UHJ A;  3FWC A;  1BT6 A;  1N2D A;  2OTG B;  3VRQ A;  1AJ4 A;  1AHR A;  2KFF A;  2KQ6 A;  1IQ3 A;  1J7O A;  2JTT A;  1V1F A;  4DIR A;  3DF0 A;  3HX4 A;  1DF0 A;  3HCM A;  3SIB A;  5DKQ A;  3A8R A;  2LLT A;  2HQW A;  2BE4 A;  1AK8 A;  4FQO A;  3A4U B;  3LL8 B;  3PFV A;  1M63 B;  3SG6 A;  3GK2 A;  1CLM A;  1N0Y A;  2MLF C;  3AKB A;  4QJ4 B;  1IG5 A;  1QIV A;  2JNF A;  4MZJ A;  3KPX A;  1ALW A;  4MRY A;  1SW8 A;  2LV7 A;  2L4I A;  1QVI Y;  1EG3 A;  2HQ8 A;  2BBM A;  3LK0 A;  1XK4 A;  4CLN A;  1KQV A;  2M7N A;  1B8L A;  1IQ5 A;  3CR2 A;  2KDH A;  5I8N A;  1AUI B;  1S1E A;  3D0Y A;  1H8B A;  4JWQ A;  3BQ3 A;  3K21 A;  1NWD A;  1GJY A;  2O60 A;  1L2O C;  1A75 A;  4GUK A;  1NSH A;  2AAO A;  1PSR A;  1A29 A;  1X02 A;  1XFZ O;  4XJK B;  2BL0 B;  3DVJ A;  1XK4 C;  4PE1 A;  3EKJ A;  2LUC A;  3CS1 A;  1K9P A;  4NDD A;  1PK0 D;  2I7A A;  2LAP A;  1AP4 A;  3I5H C;  3BUO B;  1KSM A;  2Q4U A;  1BOD A;  1B1G A;  2JC2 A;  1QX2 A;  2LP2 A;  1ZAC A;  1YVL A;  2V53 A;  4GNK B;  3WXA A;  3BOW B;  5HKY A;  4P2Y B;  1DJX A;  3O6B A;  4U8D A;  1WLM A;  2LVI A;  3CR4 X;  2LMT A;  1NCZ A;  1KK7 Y;  5D7F A;  2K7B A;  5HLO A;  3EK7 A;  1TCO B;  2SAS A;  1DMO A;  2LLU A;  3SG2 A;  1XFY O;  2KNE A;  2LMV A;  2OS8 C;  4MEW A;  1RTP 1;  1KSO A;  2R2I A;  1REC A;  2H61 A;  2CNP A;  2L4H A;  4DUQ A;  2M29 A;  3EVR A;  2KYC A;  1B7T Z;  1TNX A;  4PE7 A;  3PM8 A;  1G33 A;  1TRF A;  2MAZ A;  2M7L A;  1BJF A;  2ZFD A;  5CSI A;  4UPG A;  1CFP A;  2JZI A;  2LP3 A;  1YUT A;  1F54 A;  1S5G Z;  1LIN A;  2LVV A;  1EG4 A;  2LVJ A;  3WHT B;  1R6P A;  2H61 C;  3SG4 A;  4I5N B;  1RJV A;  4PAL A;  5TNC A;  1LKJ A;  3DVM A;  2KYF A;  2ZN9 A;  3O2P A;  4I5L B;  1S6J A;  1CB1 A;  1IJ6 A;  2OS8 B;  5I2L A;  5DKR A;  1SR6 C;  3CGA A;  2JT0 A;  1C07 A;  3EK4 A;  2NZ0 A;  2WND A;  1HT9 A;  2G2B A;  3AAJ A;  4Q04 A;  1DJH A;  3SIA A;  1KK8 C;  2LLS A;  5AEQ A;  1ZOT B;  1PSB A;  2BCA A;  2PMY A;  1A4P A;  2SCP A;  2H2K A;  4A4B A;  1JUO A;  3AAK A;  1DJY A;  1YX8 A;  3LLE A;  4DCK A;  1OQP A;  1FW4 A;  1QX7 A;  1S3P A;  3EVV A;  1BR4 B;  5CSF A;  3DVK A;  3IF7 A;  2LHI A;  1SL7 A;  1CTR A;  1KFX S;  2F2O A;  1K95 A;  1QAT A;  4WRI A;  1DGU A;  3BUW B;  2KHN A;  3KHE A;  3PLF B;  1SR6 B;  1OSA A;  3VRP A;  4MLW A;  3VRO A;  1U5I B;  1YRU B;  4C0J A;  4BY4 A;  2OPO A;  3BUN B;  1BR1 B;  1KK8 B;  2JTZ A;  1ALV A;  1ZUZ A;  1QVI Z;  2K8M B;  1B8R A;  3EK8 A;  1QTX A;  1BLQ A;  2M97 A;  1BF5 A;  4XJK A;  1UHK A;  2KFG A;  3FWB A;  2G9B A;  2FCD A;  4JQ0 D;  1XA5 A;  1FI6 A;  3OX6 A;  1J1D A;  2M0R A;  4HRG A;  5B8I B;  4C0L A;  1R2U A;  4PHM A;  2ZN8 A;  3VGO A;  1DJI A;  1GGZ A;  3KEV A;  1CFF A;  5HYD A;  2MJW B;  2Y5I A;  2ZKM X;  1C7W A;  1JF2 A;  2LUX A;  1K93 D;  2BL0 C;  3BOW A;  4GAO A;  4M2Q A;  2BEC A;  1OE9 B;  1MWN A;  1J7R A;  4MN0 A;  1NPQ A;  4YI9 A;  5G08 A;  1DGV A;  1MXE A;  2JT8 A;  2JXC A;  2MA2 A;  1CMF A;  2LHL A;  3FIA A;  1LA3 A;  1YUS A;  4N5X A;  1WY9 A;  2WOR A;  1TNP A;  1MUX A;  1NX0 A;  1SY9 A;  1KK7 Z;  1UHH A;  3ICB A;  3CLN A;  1EXR A;  1NUB A;  1QV0 A;  2KGB C;  3IQQ A;  3GK1 A;  3NSO A;  1SPY A;  2I94 A;  1J7Q A;  1IRJ A;  1OMD A;  2K2A A;  2PSR A;  1F4O A;  1MF8 B;  2E30 A;  4YGC B;  3TDU A;  1QS7 A;  1YTZ C;  1CM1 A;  5BPJ A;  1SMG A;  2KI6 C;  1Y0V H;  3DVE A;  4GFT A;  3TZ1 A;  1OOJ A;  1M46 A;  1FF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...