3JVTC

Calcium-bound scallop myosin regulatory domain (lever arm) with reconstituted complete light chains
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated adductor muscle
total genus 48
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtC02
2K7DA 2VRGA 3EKJA 2H61A 1XFZO 2AMIA 1KWOB 3I5FB 3VGOA 1TNPA 3CGAA 3JVTB 2SASA 1MUXA 1A03A 2L5XB 1J7PA 1UHJA 3TUYC 2HQ8A 3DVEA 1PVAA 2ZNEA 5GQQC 2EHBA 1SL7A 4YRUA 2KBIA 3BQ3A 1TIZA 1MXEA 2JTTA 3FWBA 3EK7A 4NDBA 4YGEB 3EK8A 2KHNA 2JWWA 4YI9A 1IH0A 1PRWA 2CBLA 2PALA 4GAOA 1ZMZA 5DKRA 3VRPA 1SRAA 3D0YA 1OOJA 1PULA 1XO5A 4WQ3A 2BBNA 1Y1XA 1NUBA 4N1GA 4CIDA 4MN0A 1NX0A 5I8NA 2WORA 1MR8A 5FYXA 1MQ1A 2ZN9A 2M1UA 1L2OC 1SK6D 5DKNA 2LUXA 3KEVA 1B9AA 1B8LA 2JXCA 1S36A 1KQVA 3KPXA 4PDZA 1QX7A 1WLZA 3E3RA 3LK0A 1Y1AA 1SYMA 5J3XA 1CM1A 4AOMA 5K89A 2F3YA 3BUWB 1GJYA 1ODBA 1AUIB 2M1KB 1N2DA 2D8NA 4A4CA 2BCBA 2NZ0A 3OX5A 1YX7A 1C07A 1KFUL 1XFWO 4MLWA 3D10A 1TNXA 1B8RA 3OB1B 3TDZA 2FJUB 1CDLA 1B7TZ 1IQ5A 2KGRA 1QVIZ 1TNWA 1WRLA 3BXKA 1CB1A 4YI8A 2MLFC 4CFRA 1UHKA 2KFFA 2O5GA 4GGFA 1NYAA 1R2UA 4F0ZB 1UURA 1SMGA 1DVIA 1DJWA 5AANA 4FQOA 2Y4QA 1UHNA 2EC6C 4UPGA 2COLB 3JTDC 4CFQA 1A75B 1FW4A 4P5OE 1GQMA 2KYFA 1K96A 1B8CA 1QLKA 1CM4A 2LHIA 3GK2A 5ER4X 3EVVA 4HREE 3SG4A 2I94A 1LINA 5F6TA 3GOFA 3LL8B 1AK8A 3CR4X 3I5FC 3WHUB 3OB2B 4DRWA 2JT3A 2MAZA 1SCMC 2G9BA 1NPQA 1XFXO 2LHLA 2HQWA 1CDMA 1XFYO 2LVVA 1C7VA 1WRZA 2I2RE 1JSAA 2BL0B 2LCPA 2JTZA 2PRUA 2JNXA 3VROA 1SW8A 2LP3A 2BCXA 1CFPA 1U5IB 1G8IA 3DF0B 4U8DA 1M46A 1LA3A 1YVLA 1S26D 5AFPA 4R1EA 4JPZB 1UHHA 4QJ5B 4JWQA 1B7TY 4DIRA 2V53A 2OS8C 2FOTA 4MBEA 2GGZA 4CLNA 4YGCB 4DCKA 2Q4UA 5HKWA 4A4BA 1FI5A 2BE4A 3ZWHA 1IG5A 2ZKMX 4NDCA 2KQYA 1H8BA 1V1FA 4HRHA 2LC5A 2WCFA 1BT6A 2Y5IA 1RFJA 2LVIA 1F4QA 1SKTA 4GBAA 2F8PA 2LANA 2MLEC 1EL4A 1WLMA 4ORAB 1NX3A 2WC8A 1RROA 1U5IA 3DF0A 2BE6A 2LVKA 4HSZA 2FCDA 3DVJA 1DGUA 4M2PA 4DS7A 1PSRA 3CLNA 1OZSA 2JRFA 4YBHB 5KTYA 1YUSA 2R2IA 3HX4A 1MXLC 4MRYA 1BU3A 1CLMA 4MSPA 3PN7B 1KWOC 1AJ4A 2KI6D 3F45A 2K0JA 1V1GA 4QJ4B 2MJWB 2K7CA 1DTLA 2JT8A 3TUYB 2KI4C 4OR9B 1NSHA 1ZOTB 1DF0B 2NCOA 2JULA 3LCPC 2Q91A 2KFHA 1AVSA 5KSZA 1OMDA 1BG1A 3OP0A 1JWDA 4QJ3B 2NXQA 3PATA 1DJZA 1OSAA 1ALVA 1YVHA 1K9UA 1QS7A 1FPWA 2CXJA 3EVRA 1JF0A 5I2QA 2ZRTA 2EGDA 4ZCUA 4JQ0D 1QIWA 1J1DA 2L4IA 1DJGA 1SL9A 2PSRA 5JOLA 2JOJA 4OKHA 3LK1A 2JZIA 3NSKA 3DD4A 1QASA 2G2BA 2LNKA 5I2LA 5G08A 3JTDB 4PE7A 2QPTA 1D1OA 1J1EA 1JFKA 3KF9A 3OX6A 4DUQA 4IL1A 1NX1A 2LE9B 1PK0D 2LAPA 5BPJA 3SJSA 1QJTA 3TS5B 2F3ZA 2Y1MA 1N0YA 1QV0A 5AERA 5D7FA 5KU1A 1WY9A 1AJ5A 4MZJA 1KFUS 3AAJA 4GNKB 1J7OA 1X02A 1YRTB 1MF8B 3PLFB 2M7LA 2KOTA 3O4YA 4XJKB 1J55A 4ETOA 1JUOA 2I7AA 2ZNDA 1G33A 1UHIA 2HETA 2HF5A 4D1EA 1F55A 4ORCB 2L50A 1K90D 3AKAA 2LLUA 1EXRA 3D0YB 3PFVA 1OMVA 4OVNF 1S3PA 1KFXS 1QV1A 1S6CA 1CLLA 3CR2A 4WQ2A 4P2YB 4PE0A 1DGVA 1SR6B 4I5JA 1ZACA 3O78A 1AP4A 1B1GA 1K8UA 4PHKA 1NCYA 3NXAA 1XK4A 4C0KA 4PCWA 2M97A 4L9MA 4FTGA 3MSEB 3IQQA 2RGIA 1M39A 3FS7A 2OTGB 2LP2A 3FWCA 2L2EA 1F70A 2K2AA 3A8RA 3CWGA 3SG2A 1GGZA 5JJGA 4NDDA 5HLVA 1J7QA 2LM5A 1DJHA 3I5GB 3I5IB 4GGNA 3NSLA 3AKBA 1CNPA 2JU0A 2ZFDA 2JXLA 4I5KA 3EKHA 3EK4A 3A4UB 1S1EA 3SIAA 1JC2A 3FIAA 1MWNA 3QRXA 1M31A 5ER5A 1IWQA 4MZLA 3BUOB 1S6JA 2LLTA 1NCXA 4ICBA 2BKIB 1DF0A 3O6BA 2I18A 3RLZA 4C0LA 5B8IB 1K9PA 2JT0A 1NIWA 4PE1A 3M0WA 1XA5A 1QXPA 2KFGA 3VRRA 5I2OA 2L0PA 1QATA 1J7RA 2NCPA 3AAKA 2BECA 3HCMA 4GGFC 5PALA 2QACA 1YRUB 2MRDA 5AEQA 1XFVO 1M45A 4USLA 3ICBA 5AXIA 1Y0VH 1BR1B 1ALWA 1PSBA 1Y6WA 2M7NA 3PN7C 3SG6A 1EG3A 4MRXA 2E30A 2LUCA 2A4JA 1F71A 1QIVA 2KI4B 1SPYA 1KK8B 2KAXA 1SNLA 1B4CA 3WHTB 1QVIY 2KSPA 1LA0A 3PSRA 1MHOA 1IJ5A 4AQJA 4PHJA 1IJ6A 1BR4B 1G4YR 1TNQA 2KQ6A 1CTRA 1OQPA 1NX2A 3DVKA 1F4OA 1W7IB 3SG5A 2KAYA 1OE9B 1SL8A 2AAOA 1FBVA 2BCAA 1CDPA 2P6BB 1CFFA 1F8HA 2F2OA 5TNCA 1HQVA 3CS1A 3CR5X 3CZTX 1GGWA 2K8MB 1YUUA 5D69A 3I5GC 3H4SE 3I5IC 1CFDA 1SCVA 2CCMA 5CSFA 1TN4A 1W7JB 2L4HA 2PVBA 5HKYA 4E68A 2B1UA 3K21A 2WCBA 1K9KA 2EC6B 2M9GA 1K93D 1IRJA 1TOPA 4ZCVA 1WRKA 1KSOA 1UUSA 1SR6C 3IF7A 5IBWA 3KHEA 2FCEA 1FF1A 3C1VA 4NQGA 2H2KA 2OS8B 1IGVA 2KGBC 3JVTC 4GPLB 1KK7Z 2BKHB 3PM8A 3IQOA 1S6IA 1UP5A 2K7BA 2K2FA 1RK9A 3KO0A 4PHMA 5CSNA 1A2XA 2LMTA 1KQMB 1XYDA 4PHNA 1CFCA 1LKJA 1A75A 4MZKA 1BODA 1IKUA 1CMFA 3ZNIA 1CKKA 1DT7B 1SBJA 1SY9A 1KQMC 4M2QA 1DMOA 1QX2A 3BUNB 3GK4X 3RM1A 1YR5A 1A29A 2CTNA 1F54A 2AUCA 1NP8A 2DOQA 1BF5A 2L51A 3BUMB 1EH2A 1S5GY 2Y1NA 2NLNA 2ZN8A 1TCFA 1UWOA 1PVBA 3TS5C 2JC2A 1EG4A 1S5GZ 2F33A 3SIBA 4BY4A 2GV5A 3CTNA 1A4PA 2BBMA 3NSOA 4C0JA 2K61A 1L2OB 2KYCA 3VRNA 1BLQA 2KI6C 2H61C 1FI6A 1OMRA 1M63B 3BOWA 2CNPA 1AHRA 4N1FA 2M3WA 4I5NB 1NWDA 1PALA 4MEWA 4HRGA 4OV2A 1BJFA 1TCOB 1YUTA 3OHMB 1E8AA 2JQ6A 2SCPA 1BOCA 2LMVA 1K94A 4WRIA 2JPTA 1ZFSA 1DJYA 1WDCC 1Q80A 4Q04A 4ORBB 2M29A 3VRQA 2LMUA 2MBXA 5HYDA 4OCIA 1JFJA 2LLSA 2JNFA 4I5LB 4PALA 1RJVA 2WNDA 4YGBB 5HLOA 1LXFC 1WDCB 2M0RA 1CMGA 5DKQA 1RECA 2MHHA 3TZ1A 2BL0C 2KNEA 1YTZC 2HPSA 4M2OA 1DJIA 4MVFA 2IS9A 2KAVA 1XFUO 1JBAA 3PALA 3BUXB 3GK1A 1CLBA 3DVMA 2LVJA 1L7ZA 2KBMA 1Y1UA 2MA2A 4GUKA 5CPVA 1B47A 2M8UA 3O2PA 1R6PA 3SG3A 1K95A 1QLSA 2F2PA 2E6WA 1XVJA 2KDHA 5HKZA 1ZUZA 2PMYA 1QTXA 3BYAA 1DJXA 1RTP1 1C7WA 4XJKA 2PASA 1KFXL 2ZRSA 1NCZA 5CSJA 2K7OA 3TDUA 2TN4A 1CDNA 1HT9A 1XK4C 2ISDA 1BMOA 1K2HA 2L98A 4YGDB 4BY5A 1VRKA 4YGAA 1TTXA 1TRFA 2CT9A 2M49B 3TDIA 1KCYA 3BOWB 4PE4A 1JF2A 1H4BA 2O60A 1YURA 2OPOA 4XYNA 1QX5B 3NSIA 1EJ3A 1KK8C 1RWYA 4TNCA 5CSIA 3WXAA 3I5HC 1KSMA 2WOSA 2LV7A 1N65A 1OZOA 3SG7A 2GGMA 4CPVA 2OTGC 3LLEA 3WNXB 1IQ3A 3EVUA 2WCEA 1KK7Y 1SCMB 3I5HB 1LVCD 4GFTA 4AQIA 1YX8A 4N5XA
chains in the Genus database with same CATH superfamily
2K7DA 1TUJA 2VRGA 3EKJA 3O4XA 2H61A 1XFZO 2AMIA 1KWOB 3I5FB 3VGOA 2GTEA 1TNPA 3BFAA 3DXLA 3CGAA 3JVTB 2SASA 1MUXA 1A03A 2L5XB 1J7PA 1UHJA 3TUYC 2HQ8A 1OOIX 3DVEA 1PVAA 2ZNEA 5GQQC 2EHBA 1SL7A 4YRUA 2KBIA 3BQ3A 1TIZA 1MXEA 2JTTA 3FWBA 3EK7A 4NDBA 4YGEB 3RZSA 3EK8A 2QEHA 2WCHA 2KHNA 2JWWA 4YI9A 1IH0A 1PRWA 2CBLA 2PALA 4GAOA 1ZMZA 5DKRA 3VRPA 1SRAA 3FE8A 3D0YA 1OOJA 1PULA 1XO5A 4WQ3A 2BBNA 1Y1XA 1NUBA 4N1GA 4CIDA 4MN0A 1NX0A 3D74A 2WORA 3OBVA 1MR8A 5I8NA 5FYXA 1MQ1A 2ZN9A 2M1UA 3S0DA 1L2OC 1SK6D 5DKNA 2LUXA 3KEVA 1B9AA 3CZ1A 3S0GA 1B8LA 2JXCA 1S36A 2PYQA 3NHTA 1KQVA 3KPXA 4PDZA 1QX7A 1WLZA 3E3RA 1W9ZA 3BFHA 3LK0A 1Y1AA 1SYMA 5J3XA 1CM1A 5D3OA 4AOMA 5K89A 2F3YA 3BUWB 1GJYA 2L5YA 1ODBA 1AUIB 2M1KB 3OGNA 1N2DA 2D8NA 4A4CA 2BCBA 2NZ0A 3OX5A 1YX7A 1C07A 1KFUL 1XFWO 4MLWA 3D10A 1TNXA 1B8RA 3OB1B 3TDZA 1CDLA 1B7TZ 2FJUB 5EL2A 1IQ5A 2KGRA 1QVIZ 1TNWA 1WRLA 3BXKA 1CB1A 4YI8A 1DELA 2MLFC 3EG5B 4CFRA 1UHKA 3R1PA 2KFFA 2O5GA 4GGFA 1NYAA 1R2UA 4F0ZB 1UURA 1SMGA 1DVIA 1DJWA 2QEOA 5AANA 4FQOA 2Y4QA 1UHNA 2EC6C 3CZ0A 4UPGA 2COLB 3JTDC 4CFQA 1A75B 1FW4A 4P5OE 1GQMA 2KYFA 1K96A 1B8CA 1QLKA 1CM4A 2LHIA 3GK2A 5ER4X 3B88A 3EVVA 4HREE 2I94A 3SG4A 1LINA 3L4AA 5F6TA 3GOFA 3LL8B 1AK8A 3CR4X 3I5FC 3WHUB 3OB2B 4DRWA 2JT3A 2MAZA 1SCMC 2G9BA 1NPQA 1XFXO 2KLDA 2LHLA 1CDMA 2HQWA 1XFYO 2LVVA 1C7VA 1WRZA 2I2RE 1JSAA 2BL0B 2LCPA 2JTZA 3R1OA 2PRUA 2JNXA 3VROA 1SW8A 2LP3A 2BCXA 1CFPA 1U5IB 1G8IA 3DF0B 4U8DA 1M46A 1LA3A 1YVLA 1S26D 5AFPA 3SS3A 4R1EA 4JPZB 1UHHA 4QJ5B 4JWQA 1B7TY 4DIRA 2V53A 2OS8C 1OOHA 2FOTA 4MBEA 2GGZA 4CLNA 2YGUA 4YGCB 4DCKA 2Q4UA 5HKWA 4A4BA 1FI5A 2BE4A 3ZWHA 1IG5A 1Z4HA 2ZKMX 2KQYA 3NHIA 2K60A 4NDCA 1H8BA 1V1FA 4HRHA 2LC5A 2WCFA 1BT6A 2Y5IA 1RFJA 2LVIA 1F4QA 1SKTA 4GBAA 2F8PA 2LANA 2MLEC 1EL4A 1WLMA 4ORAB 3S0AA 1NX3A 2WC8A 1RROA 1U5IA 3DF0A 2BE6A 2LVKA 4HSZA 2WCJA 3CYZA 3BFBA 2FCDA 3DVJA 1DGUA 4M2PA 3B6XA 4DS7A 1PSRA 3R1VA 4FQTA 5FI6A 1OOGA 3CLNA 1OZSA 4IJ7A 2JRFA 4YBHB 5KTYA 1YUSA 2R2IA 3HX4A 1MXLC 4MRYA 1T14A 1BU3A 1CLMA 4MSPA 3PN7B 1KWOC 1AJ4A 3S0FA 2KI6D 3F45A 5FI2A 2K0JA 3CDNA 4F7FA 1V1GA 4QJ4B 2MJWB 2K7CA 1DTLA 2JT8A 3L4LA 2KI4C 3TUYB 4OR9B 1NSHA 1ZOTB 1DF0B 2NCOA 2JULA 3LCPC 2Q91A 2KFHA 1AVSA 2WC6A 1OMDA 5KSZA 1BG1A 3OP0A 1JWDA 4JKTA 2FJYA 4QJ3B 2NXQA 3B87A 3PATA 1DJZA 1OSAA 3CZ2A 1ALVA 1YVHA 1K9UA 1QS7A 1FPWA 2CXJA 3EVRA 1JF0A 3D75A 2ZRTA 5I2QA 2EGDA 4ZCUA 3PM2A 4JQ0D 1QIWA 1J1DA 2L4IA 1DJGA 1SL9A 2PSRA 5JOLA 3VB1A 2JOJA 4OKHA 3LK1A 2JZIA 3NSKA 3DD4A 1QASA 2G2BA 2LNKA 5I2LA 5G08A 3JTDB 4PE7A 3D77A 2QPTA 1D1OA 1J1EA 1JFKA 3KF9A 3OX6A 3S0EA 4IL1A 4DUQA 1NX1A 2LE9B 1PK0D 2LAPA 5BPJA 3SJSA 1QJTA 3UNWA 3TS5B 2F3ZA 1IIOA 2Y1MA 1N0YA 1QV0A 5AERA 5D7FA 5KU1A 1WY9A 1AJ5A 4MZJA 1KFUS 3AAJA 4GNKB 1J7OA 1X02A 1YRTB 1TWOA 3N7HA 1MF8B 3PLFB 2M7LA 2KOTA 2ERBA 2QEBA 3O4YA 4XJKB 1J55A 4ETOA 2H8VA 3FE6A 1JUOA 2I7AA 2ZNDA 1G33A 1UHIA 3SS5A 2HETA 2HF5A 3SS4A 4D1EA 1F55A 4ORCB 2L50A 1K90D 3AKAA 2WCKA 2LLUA 1EXRA 3D0YB 3PFVA 1OMVA 4OVNF 1S3PA 2KPHA 1KFXS 1QV1A 1S6CA 1CLLA 3CR2A 3B7AA 4WQ2A 4P2YB 4PE0A 1DGVA 1SR6B 4I5JA 1ZACA 3O78A 1AP4A 1B1GA 1K8UA 4PHKA 1NCYA 3NXAA 1XK4A 4C0KA 4PCWA 2M97A 4L9MA 4FTGA 3MSEB 3IQQA 2RGIA 1M39A 3FS7A 2OTGB 1DEKA 2LP2A 3DYEA 2L2EA 3FWCA 1F70A 2K2AA 3A8RA 3CWGA 3SG2A 1GGZA 5JJGA 4NDDA 5HLVA 1J7QA 2LM5A 1DJHA 3I5GB 3I5IB 4GGNA 3NSLA 3AKBA 3L47A 5HL1A 1CNPA 2JU0A 2ZFDA 2JXLA 1GM0A 4I5KA 3EKHA 3EK4A 3A4UB 1S1EA 3SIAA 1JC2A 3FIAA 1MWNA 3FE9A 3QRXA 1M31A 5ER5A 1IWQA 4MZLA 3BUOB 1S6JA 2LLTA 2P71A 1NCXA 4ICBA 2BKIB 2KLEA 1DF0A 3Q8IA 3O6BA 2I18A 3RLZA 4C0LA 5B8IB 1K9PA 2JT0A 1C3ZA 1NIWA 4PE1A 3M0WA 1XA5A 1QXPA 2KFGA 3VRRA 2BNXA 5I2OA 2L0PA 1QATA 3IVTA 1J7RA 2NCPA 3AAKA 2BECA 3HCMA 4GGFC 5PALA 2QACA 1YRUB 2MRDA 5AEQA 1XFVO 1M45A 4USLA 3ICBA 5AXIA 1Y0VH 1BR1B 1ALWA 1PSBA 1Y6WA 2M7NA 3PN7C 3SG6A 1EG3A 4MRXA 2E30A 2LUCA 2A4JA 1F71A 1QIVA 2KI4B 1SPYA 1QWVA 1KK8B 2KAXA 1SNLA 1B4CA 3WHTB 1QVIY 2KSPA 1LA0A 3PSRA 1MHOA 1IJ5A 4AQJA 4PHJA 4OZDA 1IJ6A 1BR4B 1G4YR 1TNQA 2KQ6A 1CTRA 1OQPA 1NX2A 3DVKA 1F4OA 3UO9A 1W7IB 3SG5A 2KAYA 1OE9B 1SL8A 2AAOA 1FBVA 2BCAA 1CDPA 2P6BB 1CFFA 1F8HA 2F2OA 2WCLA 5DICA 3B86A 5TNCA 1HQVA 3CS1A 1OW4A 3DY9A 3S0BA 3CR5X 3CZTX 1GGWA 2K8MB 1YUUA 1OOFA 3I5GC 5D69A 3H4SE 3I5IC 1CFDA 1SCVA 2CCMA 5CSFA 3DZTA 1TN4A 1W7JB 2L4HA 2PVBA 5HKYA 4E68A 1DC1A 2B1UA 3K21A 2WCBA 1K9KA 2EC6B 2M9GA 1K93D 1IRJA 1TOPA 3D78A 4ZCVA 1WRKA 1KSOA 1UUSA 1SR6C 2JPOA 3IF7A 5IBWA 3KHEA 2FCEA 1FF1A 4INXA 3C1VA 4NQGA 2H2KA 2OS8B 1IGVA 2KGBC 3JVTC 4GPLB 1KK7Z 2BKHB 3PM8A 3BJHA 3IQOA 1S6IA 1UP5A 2K7BA 2K2FA 1RK9A 3KO0A 4PHMA 5CSNA 1A2XA 2LMTA 1KQMB 1XYDA 4PHNA 4KYNA 1CFCA 1LKJA 1A75A 4MZKA 1BODA 1IKUA 1CMFA 3ZNIA 1CKKA 1DT7B 1SBJA 1SY9A 1KQMC 4M2QA 1DMOA 1QX2A 3BUNB 3GK4X 3K1EA 3RM1A 1YR5A 1A29A 2CTNA 1F54A 5I94A 1LS8A 2AUCA 1NP8A 2WC5A 2DOQA 1BF5A 2L51A 3BUMB 3R72A 1S5GY 4PT1A 2Y1NA 2NLNA 2ZN8A 3D73A 1EH2A 1TCFA 1UWOA 1PVBA 3TS5C 2JC2A 4JD9A 1EG4A 5FI7A 1S5GZ 2F33A 3SIBA 4BY4A 2GV5A 3CTNA 1A4PA 2BBMA 3NSOA 4C0JA 2K61A 1L2OB 2KYCA 3VRNA 1BLQA 1C3YA 2KI6C 2H61C 1FI6A 1OMRA 1M63B 3V2LA 3BOWA 2CNPA 1AHRA 4N1FA 2M3WA 4I5NB 1NWDA 1PALA 4MEWA 4HRGA 4OV2A 1BJFA 1TCOB 1YUTA 2BAPA 3OHMB 1E8AA 2JQ6A 2SCPA 1BOCA 2LMVA 1K94A 4WRIA 2JPTA 1ZFSA 1Z2CB 1DJYA 1WDCC 1Q80A 4Q04A 2WCMA 4ORBB 2M29A 3VRQA 2LMUA 2MBXA 5HYDA 4OCIA 1JFJA 2LLSA 2JNFA 4I5LB 4PALA 1RJVA 2WNDA 4YGBB 5HLOA 1LXFC 1WDCB 2M0RA 1CMGA 2QDIA 5DKQA 1RECA 2P70A 1SSEB 2MHHA 3CABA 3TZ1A 2BL0C 2KNEA 1YTZC 2HPSA 4M2OA 1DJIA 4MVFA 2IS9A 2KAVA 2PQLA 1XFUO 1JBAA 2L2CA 3PALA 3PJIA 3BUXB 3GK1A 1CLBA 3DVMA 2LVJA 1L7ZA 2KBMA 4INWA 3QMEA 1Y1UA 2MA2A 4GUKA 5CPVA 1B47A 2M8UA 3O2PA 1R6PA 3SG3A 1K95A 1QLSA 2F2PA 2E6WA 1XVJA 2KDHA 2QEVA 5HKZA 1ZUZA 2PMYA 1QTXA 3BYAA 1DJXA 1RTP1 1C7WA 4XJKA 2PASA 1KFXL 2ZRSA 1NCZA 3NGVA 5CSJA 2K7OA 3TDUA 2TN4A 1DQEA 1P28A 1CDNA 1HT9A 1XK4C 2ISDA 1BMOA 1K2HA 2L98A 4YGDB 4BY5A 1VRKA 4YGAA 1TTXA 1TRFA 2CT9A 2M49B 3D76A 3TDIA 1KCYA 3BOWB 4PE4A 1JF2A 1H4BA 2O60A 1YURA 2OPOA 4XYNA 1QX5B 3NSIA 1EJ3A 1KK8C 1RWYA 4TNCA 5CSIA 3WXAA 3I5HC 1KSMA 2WOSA 2LV7A 1N65A 1OZOA 3SG7A 2GGMA 4CPVA 2OTGC 1TUZA 3LLEA 3WNXB 1ORGA 1IQ3A 3EVUA 2WCEA 1KK7Y 1SCMB 1XFRA 3I5HB 1LVCD 4GFTA 4AQIA 1YX8A 4N5XA
chains in the Genus database with same CATH topology
2K7DA 2VRGA 3EKJA 2H61A 1XFZO 2AMIA 1KWOB 3I5FB 3VGOA 1TNPA 3CGAA 3JVTB 2SASA 1MUXA 1A03A 2L5XB 1J7PA 1UHJA 3TUYC 2HQ8A 3DVEA 1PVAA 2ZNEA 5GQQC 2EHBA 1SL7A 4YRUA 2KBIA 3BQ3A 1TIZA 1MXEA 2JTTA 3FWBA 3EK7A 4NDBA 4YGEB 3EK8A 2KHNA 2JWWA 4YI9A 1IH0A 1PRWA 2CBLA 2PALA 4GAOA 1ZMZA 5DKRA 3VRPA 1SRAA 3D0YA 1OOJA 1PULA 1XO5A 4WQ3A 2BBNA 1Y1XA 1NUBA 4N1GA 4CIDA 4MN0A 1NX0A 5I8NA 2WORA 1MR8A 5FYXA 1MQ1A 2ZN9A 2M1UA 1L2OC 1SK6D 5DKNA 2LUXA 3KEVA 1B9AA 1B8LA 2JXCA 1S36A 1KQVA 3KPXA 4PDZA 1QX7A 1WLZA 3E3RA 3LK0A 1Y1AA 1SYMA 5J3XA 1CM1A 4AOMA 5K89A 2F3YA 3BUWB 1GJYA 1ODBA 1AUIB 2M1KB 1N2DA 2D8NA 4A4CA 2BCBA 2NZ0A 3OX5A 1YX7A 1C07A 1KFUL 1XFWO 4MLWA 3D10A 1TNXA 1B8RA 3OB1B 3TDZA 2FJUB 1CDLA 1B7TZ 1IQ5A 2KGRA 1QVIZ 1TNWA 1WRLA 3BXKA 1CB1A 4YI8A 2MLFC 4CFRA 1UHKA 2KFFA 2O5GA 4GGFA 1NYAA 1R2UA 4F0ZB 1UURA 1SMGA 1DVIA 1DJWA 5AANA 4FQOA 2Y4QA 1UHNA 2EC6C 4UPGA 2COLB 3JTDC 4CFQA 1A75B 1FW4A 4P5OE 1GQMA 2KYFA 1K96A 1B8CA 1QLKA 1CM4A 2LHIA 3GK2A 5ER4X 3EVVA 4HREE 3SG4A 2I94A 1LINA 5F6TA 3GOFA 3LL8B 1AK8A 3CR4X 3I5FC 3WHUB 3OB2B 4DRWA 2JT3A 2MAZA 1SCMC 2G9BA 1NPQA 1XFXO 2LHLA 2HQWA 1CDMA 1XFYO 2LVVA 1C7VA 1WRZA 2I2RE 1JSAA 2BL0B 2LCPA 2JTZA 2PRUA 2JNXA 3VROA 1SW8A 2LP3A 2BCXA 1CFPA 1U5IB 1G8IA 3DF0B 4U8DA 1M46A 1LA3A 1YVLA 1S26D 5AFPA 4R1EA 4JPZB 1UHHA 4QJ5B 4JWQA 1B7TY 4DIRA 2V53A 2OS8C 2FOTA 4MBEA 2GGZA 4CLNA 4YGCB 4DCKA 2Q4UA 5HKWA 4A4BA 1FI5A 2BE4A 3ZWHA 1IG5A 2ZKMX 4NDCA 2KQYA 1H8BA 1V1FA 4HRHA 2LC5A 2WCFA 1BT6A 2Y5IA 1RFJA 2LVIA 1F4QA 1SKTA 4GBAA 2F8PA 2LANA 2MLEC 1EL4A 1WLMA 4ORAB 1NX3A 2WC8A 1RROA 1U5IA 3DF0A 2BE6A 2LVKA 4HSZA 2FCDA 3DVJA 1DGUA 4M2PA 4DS7A 1PSRA 3CLNA 1OZSA 2JRFA 4YBHB 5KTYA 1YUSA 2R2IA 3HX4A 1MXLC 4MRYA 1BU3A 1CLMA 4MSPA 3PN7B 1KWOC 1AJ4A 2KI6D 3F45A 2K0JA 1V1GA 4QJ4B 2MJWB 2K7CA 1DTLA 2JT8A 3TUYB 2KI4C 4OR9B 1NSHA 1ZOTB 1DF0B 2NCOA 2JULA 3LCPC 2Q91A 2KFHA 1AVSA 5KSZA 1OMDA 1BG1A 3OP0A 1JWDA 4QJ3B 2NXQA 3PATA 1DJZA 1OSAA 1ALVA 1YVHA 1K9UA 1QS7A 1FPWA 2CXJA 3EVRA 1JF0A 5I2QA 2ZRTA 2EGDA 4ZCUA 4JQ0D 1QIWA 1J1DA 2L4IA 1DJGA 1SL9A 2PSRA 5JOLA 2JOJA 4OKHA 3LK1A 2JZIA 3NSKA 3DD4A 1QASA 2G2BA 2LNKA 5I2LA 5G08A 3JTDB 4PE7A 2QPTA 1D1OA 1J1EA 1JFKA 3KF9A 3OX6A 4DUQA 4IL1A 1NX1A 2LE9B 1PK0D 2LAPA 5BPJA 3SJSA 1QJTA 3TS5B 2F3ZA 2Y1MA 1N0YA 1QV0A 5AERA 5D7FA 5KU1A 1WY9A 1AJ5A 4MZJA 1KFUS 3AAJA 4GNKB 1J7OA 1X02A 1YRTB 1MF8B 3PLFB 2M7LA 2KOTA 3O4YA 4XJKB 1J55A 4ETOA 1JUOA 2I7AA 2ZNDA 1G33A 1UHIA 2HETA 2HF5A 4D1EA 1F55A 4ORCB 2L50A 1K90D 3AKAA 2LLUA 1EXRA 3D0YB 3PFVA 1OMVA 4OVNF 1S3PA 1KFXS 1QV1A 1S6CA 1CLLA 3CR2A 4WQ2A 4P2YB 4PE0A 1DGVA 1SR6B 4I5JA 1ZACA 3O78A 1AP4A 1B1GA 1K8UA 4PHKA 1NCYA 3NXAA 1XK4A 4C0KA 4PCWA 2M97A 4L9MA 4FTGA 3MSEB 3IQQA 2RGIA 1M39A 3FS7A 2OTGB 2LP2A 3FWCA 2L2EA 1F70A 2K2AA 3A8RA 3CWGA 3SG2A 1GGZA 5JJGA 4NDDA 5HLVA 1J7QA 2LM5A 1DJHA 3I5GB 3I5IB 4GGNA 3NSLA 3AKBA 1CNPA 2JU0A 2ZFDA 2JXLA 4I5KA 3EKHA 3EK4A 3A4UB 1S1EA 3SIAA 1JC2A 3FIAA 1MWNA 3QRXA 1M31A 5ER5A 1IWQA 4MZLA 3BUOB 1S6JA 2LLTA 1NCXA 4ICBA 2BKIB 1DF0A 3O6BA 2I18A 3RLZA 4C0LA 5B8IB 1K9PA 2JT0A 1NIWA 4PE1A 3M0WA 1XA5A 1QXPA 2KFGA 3VRRA 5I2OA 2L0PA 1QATA 1J7RA 2NCPA 3AAKA 2BECA 3HCMA 4GGFC 5PALA 2QACA 1YRUB 2MRDA 5AEQA 1XFVO 1M45A 4USLA 3ICBA 5AXIA 1Y0VH 1BR1B 1ALWA 1PSBA 1Y6WA 2M7NA 3PN7C 3SG6A 1EG3A 4MRXA 2E30A 2LUCA 2A4JA 1F71A 1QIVA 2KI4B 1SPYA 1KK8B 2KAXA 1SNLA 1B4CA 3WHTB 1QVIY 2KSPA 1LA0A 3PSRA 1MHOA 1IJ5A 4AQJA 4PHJA 1IJ6A 1BR4B 1G4YR 1TNQA 2KQ6A 1CTRA 1OQPA 1NX2A 3DVKA 1F4OA 1W7IB 3SG5A 2KAYA 1OE9B 1SL8A 2AAOA 1FBVA 2BCAA 1CDPA 2P6BB 1CFFA 1F8HA 2F2OA 5TNCA 1HQVA 3CS1A 3CR5X 3CZTX 1GGWA 2K8MB 1YUUA 5D69A 3I5GC 3H4SE 3I5IC 1CFDA 1SCVA 2CCMA 5CSFA 1TN4A 1W7JB 2L4HA 2PVBA 5HKYA 4E68A 2B1UA 3K21A 2WCBA 1K9KA 2EC6B 2M9GA 1K93D 1IRJA 1TOPA 4ZCVA 1WRKA 1KSOA 1UUSA 1SR6C 3IF7A 5IBWA 3KHEA 2FCEA 1FF1A 3C1VA 4NQGA 2H2KA 2OS8B 1IGVA 2KGBC 3JVTC 4GPLB 1KK7Z 2BKHB 3PM8A 3IQOA 1S6IA 1UP5A 2K7BA 2K2FA 1RK9A 3KO0A 4PHMA 5CSNA 1A2XA 2LMTA 1KQMB 1XYDA 4PHNA 1CFCA 1LKJA 1A75A 4MZKA 1BODA 1IKUA 1CMFA 3ZNIA 1CKKA 1DT7B 1SBJA 1SY9A 1KQMC 4M2QA 1DMOA 1QX2A 3BUNB 3GK4X 3RM1A 1YR5A 1A29A 2CTNA 1F54A 2AUCA 1NP8A 2DOQA 1BF5A 2L51A 3BUMB 1EH2A 1S5GY 2Y1NA 2NLNA 2ZN8A 1TCFA 1UWOA 1PVBA 3TS5C 2JC2A 1EG4A 1S5GZ 2F33A 3SIBA 4BY4A 2GV5A 3CTNA 1A4PA 2BBMA 3NSOA 4C0JA 2K61A 1L2OB 2KYCA 3VRNA 1BLQA 2KI6C 2H61C 1FI6A 1OMRA 1M63B 3BOWA 2CNPA 1AHRA 4N1FA 2M3WA 4I5NB 1NWDA 1PALA 4MEWA 4HRGA 4OV2A 1BJFA 1TCOB 1YUTA 3OHMB 1E8AA 2JQ6A 2SCPA 1BOCA 2LMVA 1K94A 4WRIA 2JPTA 1ZFSA 1DJYA 1WDCC 1Q80A 4Q04A 4ORBB 2M29A 3VRQA 2LMUA 2MBXA 5HYDA 4OCIA 1JFJA 2LLSA 2JNFA 4I5LB 4PALA 1RJVA 2WNDA 4YGBB 5HLOA 1LXFC 1WDCB 2M0RA 1CMGA 5DKQA 1RECA 2MHHA 3TZ1A 2BL0C 2KNEA 1YTZC 2HPSA 4M2OA 1DJIA 4MVFA 2IS9A 2KAVA 1XFUO 1JBAA 3PALA 3BUXB 3GK1A 1CLBA 3DVMA 2LVJA 1L7ZA 2KBMA 1Y1UA 2MA2A 4GUKA 5CPVA 1B47A 2M8UA 3O2PA 1R6PA 3SG3A 1K95A 1QLSA 2F2PA 2E6WA 1XVJA 2KDHA 5HKZA 1ZUZA 2PMYA 1QTXA 3BYAA 1DJXA 1RTP1 1C7WA 4XJKA 2PASA 1KFXL 2ZRSA 1NCZA 5CSJA 2K7OA 3TDUA 2TN4A 1CDNA 1HT9A 1XK4C 2ISDA 1BMOA 1K2HA 2L98A 4YGDB 4BY5A 1VRKA 4YGAA 1TTXA 1TRFA 2CT9A 2M49B 3TDIA 1KCYA 3BOWB 4PE4A 1JF2A 1H4BA 2O60A 1YURA 2OPOA 4XYNA 1QX5B 3NSIA 1EJ3A 1KK8C 1RWYA 4TNCA 5CSIA 3WXAA 3I5HC 1KSMA 2WOSA 2LV7A 1N65A 1OZOA 3SG7A 2GGMA 4CPVA 2OTGC 3LLEA 3WNXB 1IQ3A 3EVUA 2WCEA 1KK7Y 1SCMB 3I5HB 1LVCD 4GFTA 4AQIA 1YX8A 4N5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7D A;  2VRG A;  3EKJ A;  2H61 A;  1XFZ O;  2AMI A;  1KWO B;  3I5F B;  3VGO A;  1TNP A;  3CGA A;  3JVT B;  2SAS A;  1MUX A;  1A03 A;  2L5X B;  1J7P A;  1UHJ A;  3TUY C;  2HQ8 A;  3DVE A;  1PVA A;  2ZNE A;  5GQQ C;  2EHB A;  1SL7 A;  4YRU A;  2KBI A;  3BQ3 A;  1TIZ A;  1MXE A;  2JTT A;  3FWB A;  3EK7 A;  4NDB A;  4YGE B;  3EK8 A;  2KHN A;  2JWW A;  4YI9 A;  1IH0 A;  1PRW A;  2CBL A;  2PAL A;  4GAO A;  1ZMZ A;  5DKR A;  3VRP A;  1SRA A;  3D0Y A;  1OOJ A;  1PUL A;  1XO5 A;  4WQ3 A;  2BBN A;  1Y1X A;  1NUB A;  4N1G A;  4CID A;  4MN0 A;  1NX0 A;  5I8N A;  2WOR A;  1MR8 A;  5FYX A;  1MQ1 A;  2ZN9 A;  2M1U A;  1L2O C;  1SK6 D;  5DKN A;  2LUX A;  3KEV A;  1B9A A;  1B8L A;  2JXC A;  1S36 A;  1KQV A;  3KPX A;  4PDZ A;  1QX7 A;  1WLZ A;  3E3R A;  3LK0 A;  1Y1A A;  1SYM A;  5J3X A;  1CM1 A;  4AOM A;  5K89 A;  2F3Y A;  3BUW B;  1GJY A;  1ODB A;  1AUI B;  2M1K B;  1N2D A;  2D8N A;  4A4C A;  2BCB A;  2NZ0 A;  3OX5 A;  1YX7 A;  1C07 A;  1KFU L;  1XFW O;  4MLW A;  3D10 A;  1TNX A;  1B8R A;  3OB1 B;  3TDZ A;  2FJU B;  1CDL A;  1B7T Z;  1IQ5 A;  2KGR A;  1QVI Z;  1TNW A;  1WRL A;  3BXK A;  1CB1 A;  4YI8 A;  2MLF C;  4CFR A;  1UHK A;  2KFF A;  2O5G A;  4GGF A;  1NYA A;  1R2U A;  4F0Z B;  1UUR A;  1SMG A;  1DVI A;  1DJW A;  5AAN A;  4FQO A;  2Y4Q A;  1UHN A;  2EC6 C;  4UPG A;  2COL B;  3JTD C;  4CFQ A;  1A75 B;  1FW4 A;  4P5O E;  1GQM A;  2KYF A;  1K96 A;  1B8C A;  1QLK A;  1CM4 A;  2LHI A;  3GK2 A;  5ER4 X;  3EVV A;  4HRE E;  3SG4 A;  2I94 A;  1LIN A;  5F6T A;  3GOF A;  3LL8 B;  1AK8 A;  3CR4 X;  3I5F C;  3WHU B;  3OB2 B;  4DRW A;  2JT3 A;  2MAZ A;  1SCM C;  2G9B A;  1NPQ A;  1XFX O;  2LHL A;  2HQW A;  1CDM A;  1XFY O;  2LVV A;  1C7V A;  1WRZ A;  2I2R E;  1JSA A;  2BL0 B;  2LCP A;  2JTZ A;  2PRU A;  2JNX A;  3VRO A;  1SW8 A;  2LP3 A;  2BCX A;  1CFP A;  1U5I B;  1G8I A;  3DF0 B;  4U8D A;  1M46 A;  1LA3 A;  1YVL A;  1S26 D;  5AFP A;  4R1E A;  4JPZ B;  1UHH A;  4QJ5 B;  4JWQ A;  1B7T Y;  4DIR A;  2V53 A;  2OS8 C;  2FOT A;  4MBE A;  2GGZ A;  4CLN A;  4YGC B;  4DCK A;  2Q4U A;  5HKW A;  4A4B A;  1FI5 A;  2BE4 A;  3ZWH A;  1IG5 A;  2ZKM X;  4NDC A;  2KQY A;  1H8B A;  1V1F A;  4HRH A;  2LC5 A;  2WCF A;  1BT6 A;  2Y5I A;  1RFJ A;  2LVI A;  1F4Q A;  1SKT A;  4GBA A;  2F8P A;  2LAN A;  2MLE C;  1EL4 A;  1WLM A;  4ORA B;  1NX3 A;  2WC8 A;  1RRO A;  1U5I A;  3DF0 A;  2BE6 A;  2LVK A;  4HSZ A;  2FCD A;  3DVJ A;  1DGU A;  4M2P A;  4DS7 A;  1PSR A;  3CLN A;  1OZS A;  2JRF A;  4YBH B;  5KTY A;  1YUS A;  2R2I A;  3HX4 A;  1MXL C;  4MRY A;  1BU3 A;  1CLM A;  4MSP A;  3PN7 B;  1KWO C;  1AJ4 A;  2KI6 D;  3F45 A;  2K0J A;  1V1G A;  4QJ4 B;  2MJW B;  2K7C A;  1DTL A;  2JT8 A;  3TUY B;  2KI4 C;  4OR9 B;  1NSH A;  1ZOT B;  1DF0 B;  2NCO A;  2JUL A;  3LCP C;  2Q91 A;  2KFH A;  1AVS A;  5KSZ A;  1OMD A;  1BG1 A;  3OP0 A;  1JWD A;  4QJ3 B;  2NXQ A;  3PAT A;  1DJZ A;  1OSA A;  1ALV A;  1YVH A;  1K9U A;  1QS7 A;  1FPW A;  2CXJ A;  3EVR A;  1JF0 A;  5I2Q A;  2ZRT A;  2EGD A;  4ZCU A;  4JQ0 D;  1QIW A;  1J1D A;  2L4I A;  1DJG A;  1SL9 A;  2PSR A;  5JOL A;  2JOJ A;  4OKH A;  3LK1 A;  2JZI A;  3NSK A;  3DD4 A;  1QAS A;  2G2B A;  2LNK A;  5I2L A;  5G08 A;  3JTD B;  4PE7 A;  2QPT A;  1D1O A;  1J1E A;  1JFK A;  3KF9 A;  3OX6 A;  4DUQ A;  4IL1 A;  1NX1 A;  2LE9 B;  1PK0 D;  2LAP A;  5BPJ A;  3SJS A;  1QJT A;  3TS5 B;  2F3Z A;  2Y1M A;  1N0Y A;  1QV0 A;  5AER A;  5D7F A;  5KU1 A;  1WY9 A;  1AJ5 A;  4MZJ A;  1KFU S;  3AAJ A;  4GNK B;  1J7O A;  1X02 A;  1YRT B;  1MF8 B;  3PLF B;  2M7L A;  2KOT A;  3O4Y A;  4XJK B;  1J55 A;  4ETO A;  1JUO A;  2I7A A;  2ZND A;  1G33 A;  1UHI A;  2HET A;  2HF5 A;  4D1E A;  1F55 A;  4ORC B;  2L50 A;  1K90 D;  3AKA A;  2LLU A;  1EXR A;  3D0Y B;  3PFV A;  1OMV A;  4OVN F;  1S3P A;  1KFX S;  1QV1 A;  1S6C A;  1CLL A;  3CR2 A;  4WQ2 A;  4P2Y B;  4PE0 A;  1DGV A;  1SR6 B;  4I5J A;  1ZAC A;  3O78 A;  1AP4 A;  1B1G A;  1K8U A;  4PHK A;  1NCY A;  3NXA A;  1XK4 A;  4C0K A;  4PCW A;  2M97 A;  4L9M A;  4FTG A;  3MSE B;  3IQQ A;  2RGI A;  1M39 A;  3FS7 A;  2OTG B;  2LP2 A;  3FWC A;  2L2E A;  1F70 A;  2K2A A;  3A8R A;  3CWG A;  3SG2 A;  1GGZ A;  5JJG A;  4NDD A;  5HLV A;  1J7Q A;  2LM5 A;  1DJH A;  3I5G B;  3I5I B;  4GGN A;  3NSL A;  3AKB A;  1CNP A;  2JU0 A;  2ZFD A;  2JXL A;  4I5K A;  3EKH A;  3EK4 A;  3A4U B;  1S1E A;  3SIA A;  1JC2 A;  3FIA A;  1MWN A;  3QRX A;  1M31 A;  5ER5 A;  1IWQ A;  4MZL A;  3BUO B;  1S6J A;  2LLT A;  1NCX A;  4ICB A;  2BKI B;  1DF0 A;  3O6B A;  2I18 A;  3RLZ A;  4C0L A;  5B8I B;  1K9P A;  2JT0 A;  1NIW A;  4PE1 A;  3M0W A;  1XA5 A;  1QXP A;  2KFG A;  3VRR A;  5I2O A;  2L0P A;  1QAT A;  1J7R A;  2NCP A;  3AAK A;  2BEC A;  3HCM A;  4GGF C;  5PAL A;  2QAC A;  1YRU B;  2MRD A;  5AEQ A;  1XFV O;  1M45 A;  4USL A;  3ICB A;  5AXI A;  1Y0V H;  1BR1 B;  1ALW A;  1PSB A;  1Y6W A;  2M7N A;  3PN7 C;  3SG6 A;  1EG3 A;  4MRX A;  2E30 A;  2LUC A;  2A4J A;  1F71 A;  1QIV A;  2KI4 B;  1SPY A;  1KK8 B;  2KAX A;  1SNL A;  1B4C A;  3WHT B;  1QVI Y;  2KSP A;  1LA0 A;  3PSR A;  1MHO A;  1IJ5 A;  4AQJ A;  4PHJ A;  1IJ6 A;  1BR4 B;  1G4Y R;  1TNQ A;  2KQ6 A;  1CTR A;  1OQP A;  1NX2 A;  3DVK A;  1F4O A;  1W7I B;  3SG5 A;  2KAY A;  1OE9 B;  1SL8 A;  2AAO A;  1FBV A;  2BCA A;  1CDP A;  2P6B B;  1CFF A;  1F8H A;  2F2O A;  5TNC A;  1HQV A;  3CS1 A;  3CR5 X;  3CZT X;  1GGW A;  2K8M B;  1YUU A;  5D69 A;  3I5G C;  3H4S E;  3I5I C;  1CFD A;  1SCV A;  2CCM A;  5CSF A;  1TN4 A;  1W7J B;  2L4H A;  2PVB A;  5HKY A;  4E68 A;  2B1U A;  3K21 A;  2WCB A;  1K9K A;  2EC6 B;  2M9G A;  1K93 D;  1IRJ A;  1TOP A;  4ZCV A;  1WRK A;  1KSO A;  1UUS A;  1SR6 C;  3IF7 A;  5IBW A;  3KHE A;  2FCE A;  1FF1 A;  3C1V A;  4NQG A;  2H2K A;  2OS8 B;  1IGV A;  2KGB C;  3JVT C;  4GPL B;  1KK7 Z;  2BKH B;  3PM8 A;  3IQO A;  1S6I A;  1UP5 A;  2K7B A;  2K2F A;  1RK9 A;  3KO0 A;  4PHM A;  5CSN A;  1A2X A;  2LMT A;  1KQM B;  1XYD A;  4PHN A;  1CFC A;  1LKJ A;  1A75 A;  4MZK A;  1BOD A;  1IKU A;  1CMF A;  3ZNI A;  1CKK A;  1DT7 B;  1SBJ A;  1SY9 A;  1KQM C;  4M2Q A;  1DMO A;  1QX2 A;  3BUN B;  3GK4 X;  3RM1 A;  1YR5 A;  1A29 A;  2CTN A;  1F54 A;  2AUC A;  1NP8 A;  2DOQ A;  1BF5 A;  2L51 A;  3BUM B;  1EH2 A;  1S5G Y;  2Y1N A;  2NLN A;  2ZN8 A;  1TCF A;  1UWO A;  1PVB A;  3TS5 C;  2JC2 A;  1EG4 A;  1S5G Z;  2F33 A;  3SIB A;  4BY4 A;  2GV5 A;  3CTN A;  1A4P A;  2BBM A;  3NSO A;  4C0J A;  2K61 A;  1L2O B;  2KYC A;  3VRN A;  1BLQ A;  2KI6 C;  2H61 C;  1FI6 A;  1OMR A;  1M63 B;  3BOW A;  2CNP A;  1AHR A;  4N1F A;  2M3W A;  4I5N B;  1NWD A;  1PAL A;  4MEW A;  4HRG A;  4OV2 A;  1BJF A;  1TCO B;  1YUT A;  3OHM B;  1E8A A;  2JQ6 A;  2SCP A;  1BOC A;  2LMV A;  1K94 A;  4WRI A;  2JPT A;  1ZFS A;  1DJY A;  1WDC C;  1Q80 A;  4Q04 A;  4ORB B;  2M29 A;  3VRQ A;  2LMU A;  2MBX A;  5HYD A;  4OCI A;  1JFJ A;  2LLS A;  2JNF A;  4I5L B;  4PAL A;  1RJV A;  2WND A;  4YGB B;  5HLO A;  1LXF C;  1WDC B;  2M0R A;  1CMG A;  5DKQ A;  1REC A;  2MHH A;  3TZ1 A;  2BL0 C;  2KNE A;  1YTZ C;  2HPS A;  4M2O A;  1DJI A;  4MVF A;  2IS9 A;  2KAV A;  1XFU O;  1JBA A;  3PAL A;  3BUX B;  3GK1 A;  1CLB A;  3DVM A;  2LVJ A;  1L7Z A;  2KBM A;  1Y1U A;  2MA2 A;  4GUK A;  5CPV A;  1B47 A;  2M8U A;  3O2P A;  1R6P A;  3SG3 A;  1K95 A;  1QLS A;  2F2P A;  2E6W A;  1XVJ A;  2KDH A;  5HKZ A;  1ZUZ A;  2PMY A;  1QTX A;  3BYA A;  1DJX A;  1RTP 1;  1C7W A;  4XJK A;  2PAS A;  1KFX L;  2ZRS A;  1NCZ A;  5CSJ A;  2K7O A;  3TDU A;  2TN4 A;  1CDN A;  1HT9 A;  1XK4 C;  2ISD A;  1BMO A;  1K2H A;  2L98 A;  4YGD B;  4BY5 A;  1VRK A;  4YGA A;  1TTX A;  1TRF A;  2CT9 A;  2M49 B;  3TDI A;  1KCY A;  3BOW B;  4PE4 A;  1JF2 A;  1H4B A;  2O60 A;  1YUR A;  2OPO A;  4XYN A;  1QX5 B;  3NSI A;  1EJ3 A;  1KK8 C;  1RWY A;  4TNC A;  5CSI A;  3WXA A;  3I5H C;  1KSM A;  2WOS A;  2LV7 A;  1N65 A;  1OZO A;  3SG7 A;  2GGM A;  4CPV A;  2OTG C;  3LLE A;  3WNX B;  1IQ3 A;  3EVU A;  2WCE A;  1KK7 Y;  1SCM B;  3I5H B;  1LVC D;  4GFT A;  4AQI A;  1YX8 A;  4N5X A; 
#chains in the Genus database with same CATH topology
 2K7D A;  1TUJ A;  2VRG A;  3EKJ A;  3O4X A;  2H61 A;  1XFZ O;  2AMI A;  1KWO B;  3I5F B;  3VGO A;  2GTE A;  1TNP A;  3BFA A;  3DXL A;  3CGA A;  3JVT B;  2SAS A;  1MUX A;  1A03 A;  2L5X B;  1J7P A;  1UHJ A;  3TUY C;  2HQ8 A;  1OOI X;  3DVE A;  1PVA A;  2ZNE A;  5GQQ C;  2EHB A;  1SL7 A;  4YRU A;  2KBI A;  3BQ3 A;  1TIZ A;  1MXE A;  2JTT A;  3FWB A;  3EK7 A;  4NDB A;  4YGE B;  3RZS A;  3EK8 A;  2QEH A;  2WCH A;  2KHN A;  2JWW A;  4YI9 A;  1IH0 A;  1PRW A;  2CBL A;  2PAL A;  4GAO A;  1ZMZ A;  5DKR A;  3VRP A;  1SRA A;  3FE8 A;  3D0Y A;  1OOJ A;  1PUL A;  1XO5 A;  4WQ3 A;  2BBN A;  1Y1X A;  1NUB A;  4N1G A;  4CID A;  4MN0 A;  1NX0 A;  3D74 A;  2WOR A;  3OBV A;  1MR8 A;  5I8N A;  5FYX A;  1MQ1 A;  2ZN9 A;  2M1U A;  3S0D A;  1L2O C;  1SK6 D;  5DKN A;  2LUX A;  3KEV A;  1B9A A;  3CZ1 A;  3S0G A;  1B8L A;  2JXC A;  1S36 A;  2PYQ A;  3NHT A;  1KQV A;  3KPX A;  4PDZ A;  1QX7 A;  1WLZ A;  3E3R A;  1W9Z A;  3BFH A;  3LK0 A;  1Y1A A;  1SYM A;  5J3X A;  1CM1 A;  5D3O A;  4AOM A;  5K89 A;  2F3Y A;  3BUW B;  1GJY A;  2L5Y A;  1ODB A;  1AUI B;  2M1K B;  3OGN A;  1N2D A;  2D8N A;  4A4C A;  2BCB A;  2NZ0 A;  3OX5 A;  1YX7 A;  1C07 A;  1KFU L;  1XFW O;  4MLW A;  3D10 A;  1TNX A;  1B8R A;  3OB1 B;  3TDZ A;  1CDL A;  1B7T Z;  2FJU B;  5EL2 A;  1IQ5 A;  2KGR A;  1QVI Z;  1TNW A;  1WRL A;  3BXK A;  1CB1 A;  4YI8 A;  1DEL A;  2MLF C;  3EG5 B;  4CFR A;  1UHK A;  3R1P A;  2KFF A;  2O5G A;  4GGF A;  1NYA A;  1R2U A;  4F0Z B;  1UUR A;  1SMG A;  1DVI A;  1DJW A;  2QEO A;  5AAN A;  4FQO A;  2Y4Q A;  1UHN A;  2EC6 C;  3CZ0 A;  4UPG A;  2COL B;  3JTD C;  4CFQ A;  1A75 B;  1FW4 A;  4P5O E;  1GQM A;  2KYF A;  1K96 A;  1B8C A;  1QLK A;  1CM4 A;  2LHI A;  3GK2 A;  5ER4 X;  3B88 A;  3EVV A;  4HRE E;  2I94 A;  3SG4 A;  1LIN A;  3L4A A;  5F6T A;  3GOF A;  3LL8 B;  1AK8 A;  3CR4 X;  3I5F C;  3WHU B;  3OB2 B;  4DRW A;  2JT3 A;  2MAZ A;  1SCM C;  2G9B A;  1NPQ A;  1XFX O;  2KLD A;  2LHL A;  1CDM A;  2HQW A;  1XFY O;  2LVV A;  1C7V A;  1WRZ A;  2I2R E;  1JSA A;  2BL0 B;  2LCP A;  2JTZ A;  3R1O A;  2PRU A;  2JNX A;  3VRO A;  1SW8 A;  2LP3 A;  2BCX A;  1CFP A;  1U5I B;  1G8I A;  3DF0 B;  4U8D A;  1M46 A;  1LA3 A;  1YVL A;  1S26 D;  5AFP A;  3SS3 A;  4R1E A;  4JPZ B;  1UHH A;  4QJ5 B;  4JWQ A;  1B7T Y;  4DIR A;  2V53 A;  2OS8 C;  1OOH A;  2FOT A;  4MBE A;  2GGZ A;  4CLN A;  2YGU A;  4YGC B;  4DCK A;  2Q4U A;  5HKW A;  4A4B A;  1FI5 A;  2BE4 A;  3ZWH A;  1IG5 A;  1Z4H A;  2ZKM X;  2KQY A;  3NHI A;  2K60 A;  4NDC A;  1H8B A;  1V1F A;  4HRH A;  2LC5 A;  2WCF A;  1BT6 A;  2Y5I A;  1RFJ A;  2LVI A;  1F4Q A;  1SKT A;  4GBA A;  2F8P A;  2LAN A;  2MLE C;  1EL4 A;  1WLM A;  4ORA B;  3S0A A;  1NX3 A;  2WC8 A;  1RRO A;  1U5I A;  3DF0 A;  2BE6 A;  2LVK A;  4HSZ A;  2WCJ A;  3CYZ A;  3BFB A;  2FCD A;  3DVJ A;  1DGU A;  4M2P A;  3B6X A;  4DS7 A;  1PSR A;  3R1V A;  4FQT A;  5FI6 A;  1OOG A;  3CLN A;  1OZS A;  4IJ7 A;  2JRF A;  4YBH B;  5KTY A;  1YUS A;  2R2I A;  3HX4 A;  1MXL C;  4MRY A;  1T14 A;  1BU3 A;  1CLM A;  4MSP A;  3PN7 B;  1KWO C;  1AJ4 A;  3S0F A;  2KI6 D;  3F45 A;  5FI2 A;  2K0J A;  3CDN A;  4F7F A;  1V1G A;  4QJ4 B;  2MJW B;  2K7C A;  1DTL A;  2JT8 A;  3L4L A;  2KI4 C;  3TUY B;  4OR9 B;  1NSH A;  1ZOT B;  1DF0 B;  2NCO A;  2JUL A;  3LCP C;  2Q91 A;  2KFH A;  1AVS A;  2WC6 A;  1OMD A;  5KSZ A;  1BG1 A;  3OP0 A;  1JWD A;  4JKT A;  2FJY A;  4QJ3 B;  2NXQ A;  3B87 A;  3PAT A;  1DJZ A;  1OSA A;  3CZ2 A;  1ALV A;  1YVH A;  1K9U A;  1QS7 A;  1FPW A;  2CXJ A;  3EVR A;  1JF0 A;  3D75 A;  2ZRT A;  5I2Q A;  2EGD A;  4ZCU A;  3PM2 A;  4JQ0 D;  1QIW A;  1J1D A;  2L4I A;  1DJG A;  1SL9 A;  2PSR A;  5JOL A;  3VB1 A;  2JOJ A;  4OKH A;  3LK1 A;  2JZI A;  3NSK A;  3DD4 A;  1QAS A;  2G2B A;  2LNK A;  5I2L A;  5G08 A;  3JTD B;  4PE7 A;  3D77 A;  2QPT A;  1D1O A;  1J1E A;  1JFK A;  3KF9 A;  3OX6 A;  3S0E A;  4IL1 A;  4DUQ A;  1NX1 A;  2LE9 B;  1PK0 D;  2LAP A;  5BPJ A;  3SJS A;  1QJT A;  3UNW A;  3TS5 B;  2F3Z A;  1IIO A;  2Y1M A;  1N0Y A;  1QV0 A;  5AER A;  5D7F A;  5KU1 A;  1WY9 A;  1AJ5 A;  4MZJ A;  1KFU S;  3AAJ A;  4GNK B;  1J7O A;  1X02 A;  1YRT B;  1TWO A;  3N7H A;  1MF8 B;  3PLF B;  2M7L A;  2KOT A;  2ERB A;  2QEB A;  3O4Y A;  4XJK B;  1J55 A;  4ETO A;  2H8V A;  3FE6 A;  1JUO A;  2I7A A;  2ZND A;  1G33 A;  1UHI A;  3SS5 A;  2HET A;  2HF5 A;  3SS4 A;  4D1E A;  1F55 A;  4ORC B;  2L50 A;  1K90 D;  3AKA A;  2WCK A;  2LLU A;  1EXR A;  3D0Y B;  3PFV A;  1OMV A;  4OVN F;  1S3P A;  2KPH A;  1KFX S;  1QV1 A;  1S6C A;  1CLL A;  3CR2 A;  3B7A A;  4WQ2 A;  4P2Y B;  4PE0 A;  1DGV A;  1SR6 B;  4I5J A;  1ZAC A;  3O78 A;  1AP4 A;  1B1G A;  1K8U A;  4PHK A;  1NCY A;  3NXA A;  1XK4 A;  4C0K A;  4PCW A;  2M97 A;  4L9M A;  4FTG A;  3MSE B;  3IQQ A;  2RGI A;  1M39 A;  3FS7 A;  2OTG B;  1DEK A;  2LP2 A;  3DYE A;  2L2E A;  3FWC A;  1F70 A;  2K2A A;  3A8R A;  3CWG A;  3SG2 A;  1GGZ A;  5JJG A;  4NDD A;  5HLV A;  1J7Q A;  2LM5 A;  1DJH A;  3I5G B;  3I5I B;  4GGN A;  3NSL A;  3AKB A;  3L47 A;  5HL1 A;  1CNP A;  2JU0 A;  2ZFD A;  2JXL A;  1GM0 A;  4I5K A;  3EKH A;  3EK4 A;  3A4U B;  1S1E A;  3SIA A;  1JC2 A;  3FIA A;  1MWN A;  3FE9 A;  3QRX A;  1M31 A;  5ER5 A;  1IWQ A;  4MZL A;  3BUO B;  1S6J A;  2LLT A;  2P71 A;  1NCX A;  4ICB A;  2BKI B;  2KLE A;  1DF0 A;  3Q8I A;  3O6B A;  2I18 A;  3RLZ A;  4C0L A;  5B8I B;  1K9P A;  2JT0 A;  1C3Z A;  1NIW A;  4PE1 A;  3M0W A;  1XA5 A;  1QXP A;  2KFG A;  3VRR A;  2BNX A;  5I2O A;  2L0P A;  1QAT A;  3IVT A;  1J7R A;  2NCP A;  3AAK A;  2BEC A;  3HCM A;  4GGF C;  5PAL A;  2QAC A;  1YRU B;  2MRD A;  5AEQ A;  1XFV O;  1M45 A;  4USL A;  3ICB A;  5AXI A;  1Y0V H;  1BR1 B;  1ALW A;  1PSB A;  1Y6W A;  2M7N A;  3PN7 C;  3SG6 A;  1EG3 A;  4MRX A;  2E30 A;  2LUC A;  2A4J A;  1F71 A;  1QIV A;  2KI4 B;  1SPY A;  1QWV A;  1KK8 B;  2KAX A;  1SNL A;  1B4C A;  3WHT B;  1QVI Y;  2KSP A;  1LA0 A;  3PSR A;  1MHO A;  1IJ5 A;  4AQJ A;  4PHJ A;  4OZD A;  1IJ6 A;  1BR4 B;  1G4Y R;  1TNQ A;  2KQ6 A;  1CTR A;  1OQP A;  1NX2 A;  3DVK A;  1F4O A;  3UO9 A;  1W7I B;  3SG5 A;  2KAY A;  1OE9 B;  1SL8 A;  2AAO A;  1FBV A;  2BCA A;  1CDP A;  2P6B B;  1CFF A;  1F8H A;  2F2O A;  2WCL A;  5DIC A;  3B86 A;  5TNC A;  1HQV A;  3CS1 A;  1OW4 A;  3DY9 A;  3S0B A;  3CR5 X;  3CZT X;  1GGW A;  2K8M B;  1YUU A;  1OOF A;  3I5G C;  5D69 A;  3H4S E;  3I5I C;  1CFD A;  1SCV A;  2CCM A;  5CSF A;  3DZT A;  1TN4 A;  1W7J B;  2L4H A;  2PVB A;  5HKY A;  4E68 A;  1DC1 A;  2B1U A;  3K21 A;  2WCB A;  1K9K A;  2EC6 B;  2M9G A;  1K93 D;  1IRJ A;  1TOP A;  3D78 A;  4ZCV A;  1WRK A;  1KSO A;  1UUS A;  1SR6 C;  2JPO A;  3IF7 A;  5IBW A;  3KHE A;  2FCE A;  1FF1 A;  4INX A;  3C1V A;  4NQG A;  2H2K A;  2OS8 B;  1IGV A;  2KGB C;  3JVT C;  4GPL B;  1KK7 Z;  2BKH B;  3PM8 A;  3BJH A;  3IQO A;  1S6I A;  1UP5 A;  2K7B A;  2K2F A;  1RK9 A;  3KO0 A;  4PHM A;  5CSN A;  1A2X A;  2LMT A;  1KQM B;  1XYD A;  4PHN A;  4KYN A;  1CFC A;  1LKJ A;  1A75 A;  4MZK A;  1BOD A;  1IKU A;  1CMF A;  3ZNI A;  1CKK A;  1DT7 B;  1SBJ A;  1SY9 A;  1KQM C;  4M2Q A;  1DMO A;  1QX2 A;  3BUN B;  3GK4 X;  3K1E A;  3RM1 A;  1YR5 A;  1A29 A;  2CTN A;  1F54 A;  5I94 A;  1LS8 A;  2AUC A;  1NP8 A;  2WC5 A;  2DOQ A;  1BF5 A;  2L51 A;  3BUM B;  3R72 A;  1S5G Y;  4PT1 A;  2Y1N A;  2NLN A;  2ZN8 A;  3D73 A;  1EH2 A;  1TCF A;  1UWO A;  1PVB A;  3TS5 C;  2JC2 A;  4JD9 A;  1EG4 A;  5FI7 A;  1S5G Z;  2F33 A;  3SIB A;  4BY4 A;  2GV5 A;  3CTN A;  1A4P A;  2BBM A;  3NSO A;  4C0J A;  2K61 A;  1L2O B;  2KYC A;  3VRN A;  1BLQ A;  1C3Y A;  2KI6 C;  2H61 C;  1FI6 A;  1OMR A;  1M63 B;  3V2L A;  3BOW A;  2CNP A;  1AHR A;  4N1F A;  2M3W A;  4I5N B;  1NWD A;  1PAL A;  4MEW A;  4HRG A;  4OV2 A;  1BJF A;  1TCO B;  1YUT A;  2BAP A;  3OHM B;  1E8A A;  2JQ6 A;  2SCP A;  1BOC A;  2LMV A;  1K94 A;  4WRI A;  2JPT A;  1ZFS A;  1Z2C B;  1DJY A;  1WDC C;  1Q80 A;  4Q04 A;  2WCM A;  4ORB B;  2M29 A;  3VRQ A;  2LMU A;  2MBX A;  5HYD A;  4OCI A;  1JFJ A;  2LLS A;  2JNF A;  4I5L B;  4PAL A;  1RJV A;  2WND A;  4YGB B;  5HLO A;  1LXF C;  1WDC B;  2M0R A;  1CMG A;  2QDI A;  5DKQ A;  1REC A;  2P70 A;  1SSE B;  2MHH A;  3CAB A;  3TZ1 A;  2BL0 C;  2KNE A;  1YTZ C;  2HPS A;  4M2O A;  1DJI A;  4MVF A;  2IS9 A;  2KAV A;  2PQL A;  1XFU O;  1JBA A;  2L2C A;  3PAL A;  3PJI A;  3BUX B;  3GK1 A;  1CLB A;  3DVM A;  2LVJ A;  1L7Z A;  2KBM A;  4INW A;  3QME A;  1Y1U A;  2MA2 A;  4GUK A;  5CPV A;  1B47 A;  2M8U A;  3O2P A;  1R6P A;  3SG3 A;  1K95 A;  1QLS A;  2F2P A;  2E6W A;  1XVJ A;  2KDH A;  2QEV A;  5HKZ A;  1ZUZ A;  2PMY A;  1QTX A;  3BYA A;  1DJX A;  1RTP 1;  1C7W A;  4XJK A;  2PAS A;  1KFX L;  2ZRS A;  1NCZ A;  3NGV A;  5CSJ A;  2K7O A;  3TDU A;  2TN4 A;  1DQE A;  1P28 A;  1CDN A;  1HT9 A;  1XK4 C;  2ISD A;  1BMO A;  1K2H A;  2L98 A;  4YGD B;  4BY5 A;  1VRK A;  4YGA A;  1TTX A;  1TRF A;  2CT9 A;  2M49 B;  3D76 A;  3TDI A;  1KCY A;  3BOW B;  4PE4 A;  1JF2 A;  1H4B A;  2O60 A;  1YUR A;  2OPO A;  4XYN A;  1QX5 B;  3NSI A;  1EJ3 A;  1KK8 C;  1RWY A;  4TNC A;  5CSI A;  3WXA A;  3I5H C;  1KSM A;  2WOS A;  2LV7 A;  1N65 A;  1OZO A;  3SG7 A;  2GGM A;  4CPV A;  2OTG C;  1TUZ A;  3LLE A;  3WNX B;  1ORG A;  1IQ3 A;  3EVU A;  2WCE A;  1KK7 Y;  1SCM B;  1XFR A;  3I5H B;  1LVC D;  4GFT A;  4AQI A;  1YX8 A;  4N5X A; 
#chains in the Genus database with same CATH homology
 2K7D A;  2VRG A;  3EKJ A;  2H61 A;  1XFZ O;  2AMI A;  1KWO B;  3I5F B;  3VGO A;  1TNP A;  3CGA A;  3JVT B;  2SAS A;  1MUX A;  1A03 A;  2L5X B;  1J7P A;  1UHJ A;  3TUY C;  2HQ8 A;  3DVE A;  1PVA A;  2ZNE A;  5GQQ C;  2EHB A;  1SL7 A;  4YRU A;  2KBI A;  3BQ3 A;  1TIZ A;  1MXE A;  2JTT A;  3FWB A;  3EK7 A;  4NDB A;  4YGE B;  3EK8 A;  2KHN A;  2JWW A;  4YI9 A;  1IH0 A;  1PRW A;  2CBL A;  2PAL A;  4GAO A;  1ZMZ A;  5DKR A;  3VRP A;  1SRA A;  3D0Y A;  1OOJ A;  1PUL A;  1XO5 A;  4WQ3 A;  2BBN A;  1Y1X A;  1NUB A;  4N1G A;  4CID A;  4MN0 A;  1NX0 A;  5I8N A;  2WOR A;  1MR8 A;  5FYX A;  1MQ1 A;  2ZN9 A;  2M1U A;  1L2O C;  1SK6 D;  5DKN A;  2LUX A;  3KEV A;  1B9A A;  1B8L A;  2JXC A;  1S36 A;  1KQV A;  3KPX A;  4PDZ A;  1QX7 A;  1WLZ A;  3E3R A;  3LK0 A;  1Y1A A;  1SYM A;  5J3X A;  1CM1 A;  4AOM A;  5K89 A;  2F3Y A;  3BUW B;  1GJY A;  1ODB A;  1AUI B;  2M1K B;  1N2D A;  2D8N A;  4A4C A;  2BCB A;  2NZ0 A;  3OX5 A;  1YX7 A;  1C07 A;  1KFU L;  1XFW O;  4MLW A;  3D10 A;  1TNX A;  1B8R A;  3OB1 B;  3TDZ A;  2FJU B;  1CDL A;  1B7T Z;  1IQ5 A;  2KGR A;  1QVI Z;  1TNW A;  1WRL A;  3BXK A;  1CB1 A;  4YI8 A;  2MLF C;  4CFR A;  1UHK A;  2KFF A;  2O5G A;  4GGF A;  1NYA A;  1R2U A;  4F0Z B;  1UUR A;  1SMG A;  1DVI A;  1DJW A;  5AAN A;  4FQO A;  2Y4Q A;  1UHN A;  2EC6 C;  4UPG A;  2COL B;  3JTD C;  4CFQ A;  1A75 B;  1FW4 A;  4P5O E;  1GQM A;  2KYF A;  1K96 A;  1B8C A;  1QLK A;  1CM4 A;  2LHI A;  3GK2 A;  5ER4 X;  3EVV A;  4HRE E;  3SG4 A;  2I94 A;  1LIN A;  5F6T A;  3GOF A;  3LL8 B;  1AK8 A;  3CR4 X;  3I5F C;  3WHU B;  3OB2 B;  4DRW A;  2JT3 A;  2MAZ A;  1SCM C;  2G9B A;  1NPQ A;  1XFX O;  2LHL A;  2HQW A;  1CDM A;  1XFY O;  2LVV A;  1C7V A;  1WRZ A;  2I2R E;  1JSA A;  2BL0 B;  2LCP A;  2JTZ A;  2PRU A;  2JNX A;  3VRO A;  1SW8 A;  2LP3 A;  2BCX A;  1CFP A;  1U5I B;  1G8I A;  3DF0 B;  4U8D A;  1M46 A;  1LA3 A;  1YVL A;  1S26 D;  5AFP A;  4R1E A;  4JPZ B;  1UHH A;  4QJ5 B;  4JWQ A;  1B7T Y;  4DIR A;  2V53 A;  2OS8 C;  2FOT A;  4MBE A;  2GGZ A;  4CLN A;  4YGC B;  4DCK A;  2Q4U A;  5HKW A;  4A4B A;  1FI5 A;  2BE4 A;  3ZWH A;  1IG5 A;  2ZKM X;  4NDC A;  2KQY A;  1H8B A;  1V1F A;  4HRH A;  2LC5 A;  2WCF A;  1BT6 A;  2Y5I A;  1RFJ A;  2LVI A;  1F4Q A;  1SKT A;  4GBA A;  2F8P A;  2LAN A;  2MLE C;  1EL4 A;  1WLM A;  4ORA B;  1NX3 A;  2WC8 A;  1RRO A;  1U5I A;  3DF0 A;  2BE6 A;  2LVK A;  4HSZ A;  2FCD A;  3DVJ A;  1DGU A;  4M2P A;  4DS7 A;  1PSR A;  3CLN A;  1OZS A;  2JRF A;  4YBH B;  5KTY A;  1YUS A;  2R2I A;  3HX4 A;  1MXL C;  4MRY A;  1BU3 A;  1CLM A;  4MSP A;  3PN7 B;  1KWO C;  1AJ4 A;  2KI6 D;  3F45 A;  2K0J A;  1V1G A;  4QJ4 B;  2MJW B;  2K7C A;  1DTL A;  2JT8 A;  3TUY B;  2KI4 C;  4OR9 B;  1NSH A;  1ZOT B;  1DF0 B;  2NCO A;  2JUL A;  3LCP C;  2Q91 A;  2KFH A;  1AVS A;  5KSZ A;  1OMD A;  1BG1 A;  3OP0 A;  1JWD A;  4QJ3 B;  2NXQ A;  3PAT A;  1DJZ A;  1OSA A;  1ALV A;  1YVH A;  1K9U A;  1QS7 A;  1FPW A;  2CXJ A;  3EVR A;  1JF0 A;  5I2Q A;  2ZRT A;  2EGD A;  4ZCU A;  4JQ0 D;  1QIW A;  1J1D A;  2L4I A;  1DJG A;  1SL9 A;  2PSR A;  5JOL A;  2JOJ A;  4OKH A;  3LK1 A;  2JZI A;  3NSK A;  3DD4 A;  1QAS A;  2G2B A;  2LNK A;  5I2L A;  5G08 A;  3JTD B;  4PE7 A;  2QPT A;  1D1O A;  1J1E A;  1JFK A;  3KF9 A;  3OX6 A;  4DUQ A;  4IL1 A;  1NX1 A;  2LE9 B;  1PK0 D;  2LAP A;  5BPJ A;  3SJS A;  1QJT A;  3TS5 B;  2F3Z A;  2Y1M A;  1N0Y A;  1QV0 A;  5AER A;  5D7F A;  5KU1 A;  1WY9 A;  1AJ5 A;  4MZJ A;  1KFU S;  3AAJ A;  4GNK B;  1J7O A;  1X02 A;  1YRT B;  1MF8 B;  3PLF B;  2M7L A;  2KOT A;  3O4Y A;  4XJK B;  1J55 A;  4ETO A;  1JUO A;  2I7A A;  2ZND A;  1G33 A;  1UHI A;  2HET A;  2HF5 A;  4D1E A;  1F55 A;  4ORC B;  2L50 A;  1K90 D;  3AKA A;  2LLU A;  1EXR A;  3D0Y B;  3PFV A;  1OMV A;  4OVN F;  1S3P A;  1KFX S;  1QV1 A;  1S6C A;  1CLL A;  3CR2 A;  4WQ2 A;  4P2Y B;  4PE0 A;  1DGV A;  1SR6 B;  4I5J A;  1ZAC A;  3O78 A;  1AP4 A;  1B1G A;  1K8U A;  4PHK A;  1NCY A;  3NXA A;  1XK4 A;  4C0K A;  4PCW A;  2M97 A;  4L9M A;  4FTG A;  3MSE B;  3IQQ A;  2RGI A;  1M39 A;  3FS7 A;  2OTG B;  2LP2 A;  3FWC A;  2L2E A;  1F70 A;  2K2A A;  3A8R A;  3CWG A;  3SG2 A;  1GGZ A;  5JJG A;  4NDD A;  5HLV A;  1J7Q A;  2LM5 A;  1DJH A;  3I5G B;  3I5I B;  4GGN A;  3NSL A;  3AKB A;  1CNP A;  2JU0 A;  2ZFD A;  2JXL A;  4I5K A;  3EKH A;  3EK4 A;  3A4U B;  1S1E A;  3SIA A;  1JC2 A;  3FIA A;  1MWN A;  3QRX A;  1M31 A;  5ER5 A;  1IWQ A;  4MZL A;  3BUO B;  1S6J A;  2LLT A;  1NCX A;  4ICB A;  2BKI B;  1DF0 A;  3O6B A;  2I18 A;  3RLZ A;  4C0L A;  5B8I B;  1K9P A;  2JT0 A;  1NIW A;  4PE1 A;  3M0W A;  1XA5 A;  1QXP A;  2KFG A;  3VRR A;  5I2O A;  2L0P A;  1QAT A;  1J7R A;  2NCP A;  3AAK A;  2BEC A;  3HCM A;  4GGF C;  5PAL A;  2QAC A;  1YRU B;  2MRD A;  5AEQ A;  1XFV O;  1M45 A;  4USL A;  3ICB A;  5AXI A;  1Y0V H;  1BR1 B;  1ALW A;  1PSB A;  1Y6W A;  2M7N A;  3PN7 C;  3SG6 A;  1EG3 A;  4MRX A;  2E30 A;  2LUC A;  2A4J A;  1F71 A;  1QIV A;  2KI4 B;  1SPY A;  1KK8 B;  2KAX A;  1SNL A;  1B4C A;  3WHT B;  1QVI Y;  2KSP A;  1LA0 A;  3PSR A;  1MHO A;  1IJ5 A;  4AQJ A;  4PHJ A;  1IJ6 A;  1BR4 B;  1G4Y R;  1TNQ A;  2KQ6 A;  1CTR A;  1OQP A;  1NX2 A;  3DVK A;  1F4O A;  1W7I B;  3SG5 A;  2KAY A;  1OE9 B;  1SL8 A;  2AAO A;  1FBV A;  2BCA A;  1CDP A;  2P6B B;  1CFF A;  1F8H A;  2F2O A;  5TNC A;  1HQV A;  3CS1 A;  3CR5 X;  3CZT X;  1GGW A;  2K8M B;  1YUU A;  5D69 A;  3I5G C;  3H4S E;  3I5I C;  1CFD A;  1SCV A;  2CCM A;  5CSF A;  1TN4 A;  1W7J B;  2L4H A;  2PVB A;  5HKY A;  4E68 A;  2B1U A;  3K21 A;  2WCB A;  1K9K A;  2EC6 B;  2M9G A;  1K93 D;  1IRJ A;  1TOP A;  4ZCV A;  1WRK A;  1KSO A;  1UUS A;  1SR6 C;  3IF7 A;  5IBW A;  3KHE A;  2FCE A;  1FF1 A;  3C1V A;  4NQG A;  2H2K A;  2OS8 B;  1IGV A;  2KGB C;  3JVT C;  4GPL B;  1KK7 Z;  2BKH B;  3PM8 A;  3IQO A;  1S6I A;  1UP5 A;  2K7B A;  2K2F A;  1RK9 A;  3KO0 A;  4PHM A;  5CSN A;  1A2X A;  2LMT A;  1KQM B;  1XYD A;  4PHN A;  1CFC A;  1LKJ A;  1A75 A;  4MZK A;  1BOD A;  1IKU A;  1CMF A;  3ZNI A;  1CKK A;  1DT7 B;  1SBJ A;  1SY9 A;  1KQM C;  4M2Q A;  1DMO A;  1QX2 A;  3BUN B;  3GK4 X;  3RM1 A;  1YR5 A;  1A29 A;  2CTN A;  1F54 A;  2AUC A;  1NP8 A;  2DOQ A;  1BF5 A;  2L51 A;  3BUM B;  1EH2 A;  1S5G Y;  2Y1N A;  2NLN A;  2ZN8 A;  1TCF A;  1UWO A;  1PVB A;  3TS5 C;  2JC2 A;  1EG4 A;  1S5G Z;  2F33 A;  3SIB A;  4BY4 A;  2GV5 A;  3CTN A;  1A4P A;  2BBM A;  3NSO A;  4C0J A;  2K61 A;  1L2O B;  2KYC A;  3VRN A;  1BLQ A;  2KI6 C;  2H61 C;  1FI6 A;  1OMR A;  1M63 B;  3BOW A;  2CNP A;  1AHR A;  4N1F A;  2M3W A;  4I5N B;  1NWD A;  1PAL A;  4MEW A;  4HRG A;  4OV2 A;  1BJF A;  1TCO B;  1YUT A;  3OHM B;  1E8A A;  2JQ6 A;  2SCP A;  1BOC A;  2LMV A;  1K94 A;  4WRI A;  2JPT A;  1ZFS A;  1DJY A;  1WDC C;  1Q80 A;  4Q04 A;  4ORB B;  2M29 A;  3VRQ A;  2LMU A;  2MBX A;  5HYD A;  4OCI A;  1JFJ A;  2LLS A;  2JNF A;  4I5L B;  4PAL A;  1RJV A;  2WND A;  4YGB B;  5HLO A;  1LXF C;  1WDC B;  2M0R A;  1CMG A;  5DKQ A;  1REC A;  2MHH A;  3TZ1 A;  2BL0 C;  2KNE A;  1YTZ C;  2HPS A;  4M2O A;  1DJI A;  4MVF A;  2IS9 A;  2KAV A;  1XFU O;  1JBA A;  3PAL A;  3BUX B;  3GK1 A;  1CLB A;  3DVM A;  2LVJ A;  1L7Z A;  2KBM A;  1Y1U A;  2MA2 A;  4GUK A;  5CPV A;  1B47 A;  2M8U A;  3O2P A;  1R6P A;  3SG3 A;  1K95 A;  1QLS A;  2F2P A;  2E6W A;  1XVJ A;  2KDH A;  5HKZ A;  1ZUZ A;  2PMY A;  1QTX A;  3BYA A;  1DJX A;  1RTP 1;  1C7W A;  4XJK A;  2PAS A;  1KFX L;  2ZRS A;  1NCZ A;  5CSJ A;  2K7O A;  3TDU A;  2TN4 A;  1CDN A;  1HT9 A;  1XK4 C;  2ISD A;  1BMO A;  1K2H A;  2L98 A;  4YGD B;  4BY5 A;  1VRK A;  4YGA A;  1TTX A;  1TRF A;  2CT9 A;  2M49 B;  3TDI A;  1KCY A;  3BOW B;  4PE4 A;  1JF2 A;  1H4B A;  2O60 A;  1YUR A;  2OPO A;  4XYN A;  1QX5 B;  3NSI A;  1EJ3 A;  1KK8 C;  1RWY A;  4TNC A;  5CSI A;  3WXA A;  3I5H C;  1KSM A;  2WOS A;  2LV7 A;  1N65 A;  1OZO A;  3SG7 A;  2GGM A;  4CPV A;  2OTG C;  3LLE A;  3WNX B;  1IQ3 A;  3EVU A;  2WCE A;  1KK7 Y;  1SCM B;  3I5H B;  1LVC D;  4GFT A;  4AQI A;  1YX8 A;  4N5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...