3JVTC

Calcium-bound scallop myosin regulatory domain (lever arm) with reconstituted complete light chains
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated adductor muscle
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
molecule tags Contractile protein
total genus 48
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtC02
1K95A 1PRWA 1CFDA 1NSHA 2H2KA 1C07A 5CSJA 1NX0A 1BR4B 4QJ4B 1NWDA 2LVVA 3ICBA 3PSRA 4YI9A 2JNFA 2Y1NA 1RWYA 3CWGA 1K94A 1SPYA 2K8MB 2VRGA 3IQOA 1F55A 1EL4A 1NCZA 1OMRA 2K2AA 3EK7A 1A03A 1VRKA 2GGZA 2JTTA 3PATA 2BCAA 3M0WA 3RLZA 3BUWB 1FF1A 1L2OB 1SCMB 3CR5X 1SBJA 1Q80A 1AP4A 2LMUA 1LXFC 4ORAB 1IJ6A 2F33A 1XFWO 1CMFA 4GGFC 4MZKA 4NDBA 4OVNF 3F45A 2BECA 1LVCD 4YI8A 2HPSA 2LP2A 2MJWB 3NXAA 4I5JA 1NX1A 5FYXA 3OB2B 1UWOA 1KCYA 1G4YR 1KK7Z 2WCEA 1SW8A 1QXPA 4OCIA 1S6IA 3IQQA 4USLA 1K8UA 1Y1UA 2NZ0A 1SYMA 2Y4QA 4I5KA 4CLNA 1IH0A 1QS7A 1FI6A 3I5HC 2A4JA 1BT6A 3C1VA 2JPTA 1B8CA 2BBMA 1PVBA 1EJ3A 1NX2A 1AJ4A 1IGVA 1J55A 2BE6A 3GK4X 1UHIA 4R1EA 1AHRA 2KFGA 2L50A 3NSIA 1NPQA 3TZ1A 1SCVA 2F2PA 1FPWA 1TTXA 1YUUA 1FW4A 2KHNA 1IJ5A 1B4CA 4ORCB 3KHEA 1H8BA 2HQ8A 1B7TY 3I5IC 4GGNA 2M7NA 1J7RA 5DKNA 1UHJA 5B8IB 3CGAA 2LUXA 5I2LA 5AANA 1PALA 1XFUO 2LMVA 1DJHA 3SJSA 3OX6A 4PE0A 1F4QA 2LC5A 1PVAA 1V1GA 4DCKA 2LVJA 3BUNB 3SG2A 4GGFA 1F4OA 2EGDA 1UHNA 1TCFA 3VRNA 1F70A 3CS1A 3PLFB 1AVSA 1A75A 4FQOA 1N2DA 4MN0A 1K9KA 1KWOB 3A4UB 2M8UA 2OTGB 3KO0A 2GV5A 1BJFA 2O5GA 1K9PA 1CDMA 1DGUA 3SG7A 2JXLA 1J7PA 2LP3A 1JF0A 3NSKA 1IRJA 1CDLA 1QV1A 3JVTB 3ZWHA 3AKAA 1B47A 1RFJA 1G33A 2LV7A 1BODA 1X02A 5PALA 1YVLA 2EC6C 4HREE 1CKKA 1U5IB 2WC8A 2WNDA 2PASA 5GQQC 5AXIA 2BCXA 1WLMA 1QIVA 1ZOTB 3NSLA 4JQ0D 2BL0C 5DKRA 1HT9A 5ER5A 2WCFA 1Y1XA 1YVHA 2K7DA 1M31A 3HCMA 4DIRA 2OPOA 2LAPA 2M29A 2K2FA 2LLTA 4HSZA 1NCXA 2R2IA 1PULA 2FCEA 1DF0B 1SRAA 3BUOB 2Q91A 1DMOA 5K89A 1CFCA 2BCBA 2KNEA 1TN4A 4YGDB 1MF8B 2KOTA 4U8DA 2JXCA 5BPJA 1SMGA 3EVRA 4MLWA 1MXLC 3VGOA 4JPZB 3NSOA 1YURA 2P6BB 3EVUA 1YR5A 4MZLA 1W7IB 2OS8B 1WDCB 1QX5B 2JNXA 2DOQA 1JUOA 1TNQA 2KAXA 5HKYA 5CPVA 1DVIA 1WDCC 1TIZA 1B7TZ 1MUXA 1E8AA 1L7ZA 3BXKA 5HLOA 1GQMA 1CM1A 2CBLA 2LHIA 2M97A 1YRUB 1F8HA 2M49B 4WRIA 1L2OC 1SCMC 1UHKA 5DKQA 2H61C 2M3WA 1KSMA 3VROA 5AFPA 3H4SE 2K7CA 2ZN8A 1U5IA 4XYNA 4MRYA 3KPXA 3FS7A 4ORBB 3KF9A 2O60A 1M45A 2LNKA 2KFHA 5KTYA 2I18A 3TDUA 3AKBA 1EG4A 2G2BA 3IF7A 1XFZO 1BMOA 3LL8B 1LINA 1PSRA 1DJIA 1XYDA 3D0YB 4OV2A 2LLSA 5HKZA 1CDNA 3DVMA 2KQYA 3VRPA 1IKUA 4P5OE 1KFUL 1OMDA 1R6PA 4YGEB 1TNWA 3KEVA 3JTDB 1DJGA 2LUCA 2RGIA 2WORA 1CFPA 1S5GY 1C7VA 1UURA 4OKHA 1YRTB 3WHUB 1OSAA 4GUKA 1HQVA 1H4BA 3CZTX 3GOFA 2LVIA 3JTDC 3SG6A 4N1FA 4PE4A 2JC2A 3EK4A 1F54A 1M63B 1Y6WA 2JTZA 2L2EA 4PHKA 4QJ3B 2AUCA 2ZKMX 3EKJA 5I2QA 1NUBA 1XFYO 4GPLB 1CFFA 4I5NB 2NCOA 4YBHB 1S36A 1JC2A 1QLKA 2JQ6A 2I94A 2M1UA 2Q4UA 1SL9A 4YGBB 2PSRA 3TUYB 1GJYA 2PALA 1A2XA 2KI4B 1YX8A 2F3ZA 4ETOA 1IWQA 4YGAA 1S6CA 4PHNA 1ODBA 1AJ5A 1SR6B 2I7AA 1KQMB 2H61A 2M1KB 3GK2A 1QASA 3BOWB 3QRXA 1KQMC 2KAVA 2LLUA 1QVIY 3FIAA 1CLBA 2FCDA 4CFQA 1CNPA 1N0YA 3SIAA 2ZRTA 2MRDA 5D69A 2CXJA 1M39A 2JT8A 1JF2A 3BYAA 1BF5A 2Y5IA 3AAJA 1S26D 2BBNA 1KWOC 4N5XA 2TN4A 1S3PA 1WLZA 2OTGC 3CR2A 3I5FB 2ZNEA 4C0LA 5IBWA 2M0RA 1AK8A 1OMVA 2MLEC 2GGMA 2KFFA 2MA2A 2LE9B 2MHHA 3DD4A 1S6JA 1XVJA 3DF0B 3JVTC 2M7LA 3SG4A 2E6WA 4A4CA 2JT0A 2JT3A 3OP0A 2LANA 1KK8B 1UHHA 4PHJA 2L98A 1J1DA 4MBEA 1J7QA 1RK9A 2G9BA 2JU0A 3TS5B 2K0JA 3LLEA 1EXRA 5KU1A 4WQ2A 1N65A 3DVJA 3AAKA 1OZSA 2KGBC 2L51A 2KSPA 1TOPA 1NP8A 1SL7A 4N1GA 2BE4A 2I2RE 5G08A 1CB1A 1K90D 1XFVO 1F71A 3HX4A 4NDCA 1EH2A 2HETA 1NCYA 5AERA 1UUSA 4C0KA 1S5GZ 1EG3A 3PFVA 1DTLA 5CSFA 3WNXB 1BU3A 2F2OA 2KBIA 1RROA 5HYDA 4PHMA 1TCOB 2KI6D 3BOWA 1BOCA 4XJKB 3EK8A 1SNLA 1QLSA 4CFRA 1ZFSA 2OS8C 4MVFA 4PE7A 4F0ZB 2B1UA 1B8RA 1XO5A 2QPTA 1KFUS 1JFKA 2AAOA 4MZJA 1D1OA 2HQWA 1LA0A 1CMGA 4L9MA 3D10A 1XA5A 1K93D 3A8RA 1KSOA 1RJVA 2CCMA 5TNCA 3CTNA 3DF0A 1YTZC 3O2PA 1QVIZ 4BY4A 2F8PA 2COLB 4C0JA 1TRFA 4MEWA 2WCBA 5AEQA 1GGZA 2D8NA 1ZMZA 2CTNA 2L4HA 1OE9B 2L0PA 1DJWA 2HF5A 3CR4X 5JJGA 1ALWA 1DGVA 1WRLA 1K2HA 1V1FA 2L5XB 1A29A 1MHOA 1R2UA 2KYCA 3I5GB 1JBAA 2KDHA 3O6BA 4GNKB 2LHLA 2ZNDA 3DVKA 1LKJA 3I5GC 1B8LA 1DF0A 1G8IA 1CDPA 1A75B 3BUMB 1NYAA 1ZUZA 1CM4A 1DJZA 4YGCB 1SL8A 3LK0A 1AUIB 5ER4X 2JRFA 1W7JB 1OOJA 4PCWA 4FTGA 3DVEA 3CLNA 3VRRA 2L4IA 2SASA 3K21A 4I5LB 4CPVA 1LA3A 3I5HB 1B9AA 1QV0A 1SY9A 1QX7A 1QIWA 3WHTB 4QJ5B 1NX3A 4XJKA 5HLVA 1FBVA 1MR8A 1JWDA 1DJYA 1YUTA 2LVKA 1K96A 4MSPA 1MXEA 2ISDA 3ZNIA 2BKIB 2E30A 3EVVA 2CT9A 3GK1A 4ZCUA 4GFTA 2NXQA 1NIWA 1S1EA 1BLQA 2QACA 2WOSA 2KAYA 4M2QA 2MBXA 1A4PA 4A4BA 1SK6D 2JOJA 2PMYA 4P2YB 2EHBA 2KI4C 1Y1AA 2NLNA 3TUYC 3BQ3A 3PALA 1OQPA 4DUQA 2JWWA 2JZIA 4HRHA 1SR6C 3LK1A 3I5IB 5JOLA 3SIBA 4PALA 1B1GA 3PN7B 3TDIA 5CSNA 1GGWA 1XK4C 2MAZA 4MRXA 1CLLA 5F6TA 3BUXB 1PSBA 2BKHB 1TNXA 1C7WA 2KYFA 2AMIA 3PN7C 2K7BA 3SG3A 1KFXS 1QX2A 3PM8A 1QJTA 4TNCA 2F3YA 2KI6C 2KBMA 1WY9A 1YX7A 4PDZA 1DJXA 2NCPA 3I5FC 1KQVA 4HRGA 3D0YA 1UP5A 3RM1A 3MSEB 2M9GA 1BG1A 2ZN9A 4Q04A 2K61A 2ZRSA 3OHMB 1IG5A 5I2OA 5I8NA 1ZACA 1DT7B 5D7FA 4JWQA 4OR9B 4ZCVA 4CIDA 1KK8C 4DRWA 2ZFDA 1RECA 1KK7Y 2IS9A 4AOMA 4NQGA 2SCPA 1JSAA 2FOTA 1TNPA 1QTXA 2LM5A 1WRZA 4YRUA 1JFJA 3TS5C 1J1EA 2EC6B 5CSIA 3VRQA 4AQIA 3E3RA 1XFXO 1QATA 2PVBA 1KFXL 4UPGA 2JULA 2KQ6A 3LCPC 3WXAA 2BL0B 4WQ3A 2LMTA 1MWNA 3OX5A 1OZOA 3TDZA 5HKWA 2V53A 1RTP1 2K7OA 1ALVA 3O4YA 4M2OA 4NDDA 4AQJA 5J3XA 2MLFC 1IQ5A 2CNPA 3OB1B 2FJUB 4ICBA 3FWBA 5KSZA 2Y1MA 2KGRA 1XK4A 4GBAA 1CTRA 4BY5A 3SG5A 1SKTA 4DS7A 1MQ1A 1M46A 3O78A 4GAOA 4E68A 1WRKA 1PK0D 4IL1A 1J7OA 1CLMA 4PE1A 2PRUA 2LCPA 1K9UA 1BR1B 3EKHA 1YUSA 4M2PA 4D1EA 1IQ3A 1Y0VH 3FWCA 1FI5A
chains in the Genus database with same CATH superfamily
1K95A 1PRWA 1CFDA 1NSHA 2H2KA 3B87A 3BFBA 1C07A 5CSJA 1NX0A 1BR4B 4QJ4B 1NWDA 2LVVA 3ICBA 3PSRA 4YI9A 2JNFA 2Y1NA 1P28A 1RWYA 1K94A 1SPYA 2K8MB 2VRGA 3CWGA 3IQOA 3CABA 1F55A 1EL4A 1NCZA 1OMRA 2K2AA 3EK7A 5HL1A 1DQEA 1VRKA 2GGZA 1A03A 2JTTA 3PATA 2BCAA 3M0WA 3RLZA 3BUWB 1FF1A 1L2OB 1SCMB 3CR5X 1SBJA 2KPHA 1Q80A 1AP4A 2LMUA 1LXFC 4ORAB 3PM2A 1IJ6A 3D77A 2F33A 1XFWO 1CMFA 4GGFC 4MZKA 4NDBA 4OVNF 3F45A 2BECA 1LVCD 4YI8A 2HPSA 2LP2A 2MJWB 3NXAA 2QEBA 4I5JA 1NX1A 5FYXA 3OB2B 1UWOA 1KCYA 1G4YR 1KK7Z 2WCEA 1SW8A 3D73A 1QXPA 5I2QA 3QMEA 4OCIA 1S6IA 3FE6A 3IQQA 4USLA 1K8UA 1Y1UA 2NZ0A 1SYMA 2Y4QA 3IVTA 4I5KA 4CLNA 1IH0A 1QS7A 1FI6A 3I5HC 2A4JA 1BT6A 3C1VA 2JPTA 1B8CA 2BBMA 1PVBA 1EJ3A 1NX2A 3S0EA 1AJ4A 1IGVA 1J55A 2BE6A 3GK4X 1UHIA 4R1EA 1AHRA 2KFGA 2L50A 3NSIA 1NPQA 3TZ1A 1SCVA 3S0AA 2F2PA 1TUZA 1FPWA 1TTXA 1YUUA 2H8VA 1FW4A 2KHNA 1IJ5A 4IJ7A 5FI6A 5ER5A 1B4CA 4ORCB 3KHEA 1H8BA 2HQ8A 1B7TY 3I5IC 4GGNA 2M7NA 1J7RA 5DKNA 1UHJA 5B8IB 3CGAA 2LUXA 5I2LA 5AANA 2FJYA 1PALA 1T14A 1XFUO 2LMVA 3SS5A 1DJHA 3SJSA 3OX6A 4PE0A 1F4QA 2LC5A 1PVAA 1V1GA 4DCKA 2LVJA 1OOIX 3BUNB 3SG2A 4GGFA 1F4OA 2EGDA 1UHNA 1TCFA 3VRNA 1F70A 3D76A 3CS1A 1OW4A 3PLFB 1AVSA 1A75A 4FQOA 1DC1A 1N2DA 4MN0A 5DICA 1K9KA 1KWOB 3A4UB 3CDNA 2M8UA 2OTGB 3KO0A 2GV5A 1BJFA 2O5GA 1K9PA 1CDMA 1DGUA 3SG7A 2JXLA 1J7PA 2LP3A 1JF0A 3NSKA 1IRJA 1CDLA 2K60A 1QV1A 3JVTB 3ZWHA 1DEKA 4FQTA 3NHIA 3AKAA 1B47A 1RFJA 1G33A 3VB1A 2LV7A 1BODA 1X02A 5PALA 1YVLA 2EC6C 4HREE 1CKKA 1U5IB 2WC8A 2WNDA 2PASA 5GQQC 3NHTA 5AXIA 2BCXA 1WLMA 1QIVA 1ZOTB 3EG5B 3NSLA 2BL0C 4JQ0D 1HT9A 5DKRA 2WCFA 1Y1XA 1YVHA 3S0BA 2K7DA 5FI2A 1M31A 3HCMA 4DIRA 2OPOA 2LAPA 2M29A 2K2FA 2LLTA 4HSZA 1NCXA 3UO9A 2R2IA 1PULA 3L4LA 2FCEA 3D75A 3SS3A 1DF0B 1SRAA 3BUOB 2Q91A 1DMOA 3BFAA 5K89A 1CFCA 2BCBA 2L2CA 2KNEA 1TN4A 4YGDB 1MF8B 2KOTA 4U8DA 2JXCA 5BPJA 2P71A 1SMGA 3EVRA 4MLWA 1MXLC 3VGOA 4JPZB 3NSOA 1YURA 2P6BB 3EVUA 1YR5A 3UNWA 4MZLA 1W7IB 2OS8B 1XFRA 1WDCB 1QX5B 2JNXA 2DOQA 1JUOA 2ERBA 1TNQA 2KAXA 4JD9A 5HKYA 5CPVA 1DVIA 1WDCC 1TIZA 1B7TZ 1MUXA 1E8AA 1L7ZA 3BXKA 5HLOA 1GQMA 1CM1A 2CBLA 2LHIA 2M97A 1YRUB 1F8HA 2M49B 4WRIA 1L2OC 1SCMC 1UHKA 2WC6A 2H61C 5DKQA 2M3WA 1KSMA 3VROA 5AFPA 3DY9A 3H4SE 2K7CA 2ZN8A 1U5IA 4XYNA 4MRYA 3KPXA 3Q8IA 3FS7A 4ORBB 1QWVA 3KF9A 2O60A 1C3YA 1M45A 2LNKA 2KFHA 5KTYA 2I18A 3TDUA 3AKBA 1EG4A 2G2BA 3IF7A 1XFZO 4INWA 1IIOA 3D78A 1BMOA 3LL8B 1LINA 1PSRA 1DJIA 1XYDA 3D0YB 4OV2A 4OZDA 2LLSA 5HKZA 1CDNA 3DVMA 2KQYA 3VRPA 1IKUA 3R1PA 4P5OE 1KFUL 1OMDA 1R6PA 4YGEB 1TNWA 3KEVA 3JTDB 1DJGA 2LUCA 2RGIA 2WORA 1CFPA 1S5GY 1C7VA 1UURA 4OKHA 1YRTB 3WHUB 1OSAA 4GUKA 1HQVA 1H4BA 3CZTX 3GOFA 2LVIA 3JTDC 3SG6A 3NGVA 4N1FA 4PE4A 2QEOA 2JC2A 3EK4A 1F54A 1M63B 1Y6WA 2JTZA 2L2EA 4PHKA 4QJ3B 2AUCA 2ZKMX 3DZTA 3CZ0A 1NUBA 1XFYO 3EKJA 4GPLB 1CFFA 4I5NB 2NCOA 4YBHB 1S36A 1JC2A 1QLKA 1DELA 2JQ6A 1OOGA 2I94A 2M1UA 2Q4UA 1SL9A 4YGBB 2PSRA 3TUYB 1GJYA 2PALA 1A2XA 2KI4B 1YX8A 2F3ZA 4ETOA 1IWQA 4YGAA 1S6CA 4PHNA 1ODBA 1AJ5A 1SR6B 2I7AA 1KQMB 2H61A 2M1KB 1W9ZA 3GK2A 1QASA 3BOWB 2WCHA 3QRXA 1KQMC 2KAVA 2LLUA 1QVIY 2PYQA 2QEVA 3FIAA 1CLBA 2FCDA 4CFQA 1CNPA 1N0YA 3SIAA 2ZRTA 2MRDA 5D69A 2CXJA 1M39A 2JT8A 1JF2A 3BYAA 1BF5A 2Y5IA 1Z2CB 1S26D 2BBNA 3AAJA 1KWOC 4N5XA 2TN4A 1S3PA 1TWOA 1WLZA 2OTGC 3CR2A 2ZNEA 3I5FB 4C0LA 2M0RA 5IBWA 1OMVA 1AK8A 2MLEC 2GGMA 2KFFA 2MA2A 2LE9B 2MHHA 3DD4A 1S6JA 1XVJA 3DF0B 3JVTC 2M7LA 3SG4A 2E6WA 4A4CA 2JT0A 2JT3A 3OP0A 3S0FA 2LANA 1KK8B 1UHHA 4PHJA 2L98A 3B6XA 3R1OA 2L5YA 1J1DA 4MBEA 1J7QA 1RK9A 2G9BA 3R72A 2JU0A 3TS5B 2K0JA 3LLEA 1EXRA 5KU1A 4WQ2A 1N65A 3DVJA 3AAKA 1OZSA 2KGBC 2L51A 2WCJA 2KSPA 1TOPA 1NP8A 1SL7A 1GM0A 4N1GA 2BE4A 2I2RE 5G08A 2WCLA 1CB1A 1K90D 1XFVO 1F71A 3HX4A 4PT1A 1OOFA 4NDCA 1EH2A 2HETA 1NCYA 5AERA 2P70A 1UUSA 4C0KA 1S5GZ 3CZ1A 1EG3A 3PFVA 1DTLA 5CSFA 3WNXB 1BU3A 2F2OA 2KBIA 1RROA 5HYDA 4PHMA 3CYZA 1TCOB 2KLEA 2KI6D 2QEHA 3BOWA 3L47A 3EK8A 4XJKB 1BOCA 1SNLA 1QLSA 4CFRA 5FI7A 1ZFSA 2PQLA 2OS8C 4MVFA 4PE7A 4F0ZB 3B86A 2B1UA 1B8RA 1XO5A 2QPTA 1KFUS 1JFKA 2AAOA 3CZ2A 4MZJA 3S0GA 3DXLA 2WCKA 1D1OA 2HQWA 1LA0A 1CMGA 3BJHA 3D10A 1XA5A 4L9MA 1K93D 3A8RA 1KSOA 1RJVA 2CCMA 5TNCA 3CTNA 3R1VA 3DF0A 3D74A 1YTZC 3O2PA 1QVIZ 4BY4A 2F8PA 2COLB 4C0JA 1TRFA 4MEWA 2WCBA 3B88A 5AEQA 1GGZA 2BNXA 2D8NA 1ZMZA 2CTNA 2L4HA 1OE9B 3BFHA 2L0PA 1DJWA 2HF5A 3CR4X 3L4AA 1ALWA 5JJGA 1DGVA 1WRLA 1K2HA 2QDIA 1V1FA 1C3ZA 2L5XB 1A29A 1MHOA 1R2UA 2KYCA 3I5GB 2JPOA 1JBAA 2BAPA 2KDHA 3O6BA 4GNKB 2LHLA 2ZNDA 3DVKA 1LKJA 3I5GC 1B8LA 1DF0A 1G8IA 5EL2A 1CDPA 1A75B 3BUMB 1NYAA 1ZUZA 1CM4A 1DJZA 4YGCB 1SL8A 3LK0A 1AUIB 5ER4X 2JRFA 4INXA 1W7JB 4JKTA 1OOJA 4PCWA 4FTGA 3DVEA 3CLNA 3VRRA 2L4IA 2SASA 3K21A 4I5LB 4CPVA 1LA3A 3I5HB 1B9AA 3OGNA 1QV0A 1SY9A 1QX7A 1QIWA 3WHTB 4QJ5B 1NX3A 4XJKA 5HLVA 1FBVA 1MR8A 1JWDA 1DJYA 1YUTA 2LVKA 5D3OA 1K96A 4MSPA 1MXEA 2ISDA 3ZNIA 3SS4A 2BKIB 2E30A 3EVVA 2CT9A 3GK1A 4ZCUA 4GFTA 1LS8A 1NIWA 1S1EA 2NXQA 1BLQA 2QACA 2WOSA 2KAYA 4M2QA 3FE8A 1A4PA 2MBXA 4A4BA 1SK6D 2JOJA 2PMYA 3N7HA 2EHBA 2KI4C 1Y1AA 2NLNA 4P2YB 3TUYC 3RZSA 3BQ3A 3PALA 1OQPA 4F7FA 4DUQA 2JWWA 2JZIA 4HRHA 1SR6C 3LK1A 1ORGA 3I5IB 5JOLA 3SIBA 4PALA 1B1GA 3PN7B 2YGUA 3TDIA 5CSNA 1GGWA 1XK4C 2MAZA 4MRXA 1CLLA 5F6TA 3BUXB 1PSBA 2BKHB 2GTEA 1TNXA 1C7WA 2KYFA 2AMIA 3PN7C 2K7BA 3SG3A 1KFXS 1QX2A 3PM8A 1QJTA 4TNCA 2F3YA 2KI6C 2KBMA 1WY9A 1YX7A 4PDZA 1DJXA 2NCPA 3I5FC 1KQVA 3DYEA 4HRGA 3D0YA 1UP5A 3RM1A 3MSEB 2M9GA 1BG1A 2ZN9A 1OOHA 4Q04A 2K61A 2ZRSA 3OHMB 1IG5A 5I2OA 5I8NA 1ZACA 1DT7B 5D7FA 2WC5A 4JWQA 4OR9B 4ZCVA 4CIDA 1KK8C 4DRWA 2ZFDA 1RECA 1KK7Y 2IS9A 4AOMA 2WCMA 4NQGA 2SCPA 1JSAA 3FE9A 2FOTA 1TNPA 1QTXA 2LM5A 1WRZA 3K1EA 4YRUA 1JFJA 3V2LA 3TS5C 1J1EA 2EC6B 5CSIA 3VRQA 4AQIA 2KLDA 3E3RA 1XFXO 3PJIA 1QATA 2PVBA 1KFXL 4KYNA 2JULA 2KQ6A 3LCPC 4UPGA 3WXAA 2BL0B 1TUJA 4WQ3A 2LMTA 1MWNA 3OX5A 1OZOA 3TDZA 5HKWA 2V53A 1RTP1 2K7OA 5I94A 1ALVA 3O4YA 4M2OA 4NDDA 4AQJA 5J3XA 2MLFC 1IQ5A 2CNPA 3OB1B 2FJUB 4ICBA 3FWBA 5KSZA 2Y1MA 3S0DA 2KGRA 1XK4A 4GBAA 1CTRA 4BY5A 3SG5A 1SKTA 4DS7A 1MQ1A 1M46A 3O78A 4GAOA 4E68A 1WRKA 1PK0D 4IL1A 1J7OA 3O4XA 1CLMA 4PE1A 2PRUA 2LCPA 1Z4HA 1K9UA 1SSEB 1BR1B 3EKHA 1YUSA 3B7AA 4M2PA 4D1EA 3OBVA 1IQ3A 1Y0VH 3FWCA 1FI5A
chains in the Genus database with same CATH topology
1K95A 1PRWA 1CFDA 1NSHA 2H2KA 1C07A 5CSJA 1NX0A 1BR4B 4QJ4B 1NWDA 2LVVA 3ICBA 3PSRA 4YI9A 2JNFA 2Y1NA 1RWYA 3CWGA 1K94A 1SPYA 2K8MB 2VRGA 3IQOA 1F55A 1EL4A 1NCZA 1OMRA 2K2AA 3EK7A 1A03A 1VRKA 2GGZA 2JTTA 3PATA 2BCAA 3M0WA 3RLZA 3BUWB 1FF1A 1L2OB 1SCMB 3CR5X 1SBJA 1Q80A 1AP4A 2LMUA 1LXFC 4ORAB 1IJ6A 2F33A 1XFWO 1CMFA 4GGFC 4MZKA 4NDBA 4OVNF 3F45A 2BECA 1LVCD 4YI8A 2HPSA 2LP2A 2MJWB 3NXAA 4I5JA 1NX1A 5FYXA 3OB2B 1UWOA 1KCYA 1G4YR 1KK7Z 2WCEA 1SW8A 1QXPA 4OCIA 1S6IA 3IQQA 4USLA 1K8UA 1Y1UA 2NZ0A 1SYMA 2Y4QA 4I5KA 4CLNA 1IH0A 1QS7A 1FI6A 3I5HC 2A4JA 1BT6A 3C1VA 2JPTA 1B8CA 2BBMA 1PVBA 1EJ3A 1NX2A 1AJ4A 1IGVA 1J55A 2BE6A 3GK4X 1UHIA 4R1EA 1AHRA 2KFGA 2L50A 3NSIA 1NPQA 3TZ1A 1SCVA 2F2PA 1FPWA 1TTXA 1YUUA 1FW4A 2KHNA 1IJ5A 1B4CA 4ORCB 3KHEA 1H8BA 2HQ8A 1B7TY 3I5IC 4GGNA 2M7NA 1J7RA 5DKNA 1UHJA 5B8IB 3CGAA 2LUXA 5I2LA 5AANA 1PALA 1XFUO 2LMVA 1DJHA 3SJSA 3OX6A 4PE0A 1F4QA 2LC5A 1PVAA 1V1GA 4DCKA 2LVJA 3BUNB 3SG2A 4GGFA 1F4OA 2EGDA 1UHNA 1TCFA 3VRNA 1F70A 3CS1A 3PLFB 1AVSA 1A75A 4FQOA 1N2DA 4MN0A 1K9KA 1KWOB 3A4UB 2M8UA 2OTGB 3KO0A 2GV5A 1BJFA 2O5GA 1K9PA 1CDMA 1DGUA 3SG7A 2JXLA 1J7PA 2LP3A 1JF0A 3NSKA 1IRJA 1CDLA 1QV1A 3JVTB 3ZWHA 3AKAA 1B47A 1RFJA 1G33A 2LV7A 1BODA 1X02A 5PALA 1YVLA 2EC6C 4HREE 1CKKA 1U5IB 2WC8A 2WNDA 2PASA 5GQQC 5AXIA 2BCXA 1WLMA 1QIVA 1ZOTB 3NSLA 4JQ0D 2BL0C 5DKRA 1HT9A 5ER5A 2WCFA 1Y1XA 1YVHA 2K7DA 1M31A 3HCMA 4DIRA 2OPOA 2LAPA 2M29A 2K2FA 2LLTA 4HSZA 1NCXA 2R2IA 1PULA 2FCEA 1DF0B 1SRAA 3BUOB 2Q91A 1DMOA 5K89A 1CFCA 2BCBA 2KNEA 1TN4A 4YGDB 1MF8B 2KOTA 4U8DA 2JXCA 5BPJA 1SMGA 3EVRA 4MLWA 1MXLC 3VGOA 4JPZB 3NSOA 1YURA 2P6BB 3EVUA 1YR5A 4MZLA 1W7IB 2OS8B 1WDCB 1QX5B 2JNXA 2DOQA 1JUOA 1TNQA 2KAXA 5HKYA 5CPVA 1DVIA 1WDCC 1TIZA 1B7TZ 1MUXA 1E8AA 1L7ZA 3BXKA 5HLOA 1GQMA 1CM1A 2CBLA 2LHIA 2M97A 1YRUB 1F8HA 2M49B 4WRIA 1L2OC 1SCMC 1UHKA 5DKQA 2H61C 2M3WA 1KSMA 3VROA 5AFPA 3H4SE 2K7CA 2ZN8A 1U5IA 4XYNA 4MRYA 3KPXA 3FS7A 4ORBB 3KF9A 2O60A 1M45A 2LNKA 2KFHA 5KTYA 2I18A 3TDUA 3AKBA 1EG4A 2G2BA 3IF7A 1XFZO 1BMOA 3LL8B 1LINA 1PSRA 1DJIA 1XYDA 3D0YB 4OV2A 2LLSA 5HKZA 1CDNA 3DVMA 2KQYA 3VRPA 1IKUA 4P5OE 1KFUL 1OMDA 1R6PA 4YGEB 1TNWA 3KEVA 3JTDB 1DJGA 2LUCA 2RGIA 2WORA 1CFPA 1S5GY 1C7VA 1UURA 4OKHA 1YRTB 3WHUB 1OSAA 4GUKA 1HQVA 1H4BA 3CZTX 3GOFA 2LVIA 3JTDC 3SG6A 4N1FA 4PE4A 2JC2A 3EK4A 1F54A 1M63B 1Y6WA 2JTZA 2L2EA 4PHKA 4QJ3B 2AUCA 2ZKMX 3EKJA 5I2QA 1NUBA 1XFYO 4GPLB 1CFFA 4I5NB 2NCOA 4YBHB 1S36A 1JC2A 1QLKA 2JQ6A 2I94A 2M1UA 2Q4UA 1SL9A 4YGBB 2PSRA 3TUYB 1GJYA 2PALA 1A2XA 2KI4B 1YX8A 2F3ZA 4ETOA 1IWQA 4YGAA 1S6CA 4PHNA 1ODBA 1AJ5A 1SR6B 2I7AA 1KQMB 2H61A 2M1KB 3GK2A 1QASA 3BOWB 3QRXA 1KQMC 2KAVA 2LLUA 1QVIY 3FIAA 1CLBA 2FCDA 4CFQA 1CNPA 1N0YA 3SIAA 2ZRTA 2MRDA 5D69A 2CXJA 1M39A 2JT8A 1JF2A 3BYAA 1BF5A 2Y5IA 3AAJA 1S26D 2BBNA 1KWOC 4N5XA 2TN4A 1S3PA 1WLZA 2OTGC 3CR2A 3I5FB 2ZNEA 4C0LA 5IBWA 2M0RA 1AK8A 1OMVA 2MLEC 2GGMA 2KFFA 2MA2A 2LE9B 2MHHA 3DD4A 1S6JA 1XVJA 3DF0B 3JVTC 2M7LA 3SG4A 2E6WA 4A4CA 2JT0A 2JT3A 3OP0A 2LANA 1KK8B 1UHHA 4PHJA 2L98A 1J1DA 4MBEA 1J7QA 1RK9A 2G9BA 2JU0A 3TS5B 2K0JA 3LLEA 1EXRA 5KU1A 4WQ2A 1N65A 3DVJA 3AAKA 1OZSA 2KGBC 2L51A 2KSPA 1TOPA 1NP8A 1SL7A 4N1GA 2BE4A 2I2RE 5G08A 1CB1A 1K90D 1XFVO 1F71A 3HX4A 4NDCA 1EH2A 2HETA 1NCYA 5AERA 1UUSA 4C0KA 1S5GZ 1EG3A 3PFVA 1DTLA 5CSFA 3WNXB 1BU3A 2F2OA 2KBIA 1RROA 5HYDA 4PHMA 1TCOB 2KI6D 3BOWA 1BOCA 4XJKB 3EK8A 1SNLA 1QLSA 4CFRA 1ZFSA 2OS8C 4MVFA 4PE7A 4F0ZB 2B1UA 1B8RA 1XO5A 2QPTA 1KFUS 1JFKA 2AAOA 4MZJA 1D1OA 2HQWA 1LA0A 1CMGA 4L9MA 3D10A 1XA5A 1K93D 3A8RA 1KSOA 1RJVA 2CCMA 5TNCA 3CTNA 3DF0A 1YTZC 3O2PA 1QVIZ 4BY4A 2F8PA 2COLB 4C0JA 1TRFA 4MEWA 2WCBA 5AEQA 1GGZA 2D8NA 1ZMZA 2CTNA 2L4HA 1OE9B 2L0PA 1DJWA 2HF5A 3CR4X 5JJGA 1ALWA 1DGVA 1WRLA 1K2HA 1V1FA 2L5XB 1A29A 1MHOA 1R2UA 2KYCA 3I5GB 1JBAA 2KDHA 3O6BA 4GNKB 2LHLA 2ZNDA 3DVKA 1LKJA 3I5GC 1B8LA 1DF0A 1G8IA 1CDPA 1A75B 3BUMB 1NYAA 1ZUZA 1CM4A 1DJZA 4YGCB 1SL8A 3LK0A 1AUIB 5ER4X 2JRFA 1W7JB 1OOJA 4PCWA 4FTGA 3DVEA 3CLNA 3VRRA 2L4IA 2SASA 3K21A 4I5LB 4CPVA 1LA3A 3I5HB 1B9AA 1QV0A 1SY9A 1QX7A 1QIWA 3WHTB 4QJ5B 1NX3A 4XJKA 5HLVA 1FBVA 1MR8A 1JWDA 1DJYA 1YUTA 2LVKA 1K96A 4MSPA 1MXEA 2ISDA 3ZNIA 2BKIB 2E30A 3EVVA 2CT9A 3GK1A 4ZCUA 4GFTA 2NXQA 1NIWA 1S1EA 1BLQA 2QACA 2WOSA 2KAYA 4M2QA 2MBXA 1A4PA 4A4BA 1SK6D 2JOJA 2PMYA 4P2YB 2EHBA 2KI4C 1Y1AA 2NLNA 3TUYC 3BQ3A 3PALA 1OQPA 4DUQA 2JWWA 2JZIA 4HRHA 1SR6C 3LK1A 3I5IB 5JOLA 3SIBA 4PALA 1B1GA 3PN7B 3TDIA 5CSNA 1GGWA 1XK4C 2MAZA 4MRXA 1CLLA 5F6TA 3BUXB 1PSBA 2BKHB 1TNXA 1C7WA 2KYFA 2AMIA 3PN7C 2K7BA 3SG3A 1KFXS 1QX2A 3PM8A 1QJTA 4TNCA 2F3YA 2KI6C 2KBMA 1WY9A 1YX7A 4PDZA 1DJXA 2NCPA 3I5FC 1KQVA 4HRGA 3D0YA 1UP5A 3RM1A 3MSEB 2M9GA 1BG1A 2ZN9A 4Q04A 2K61A 2ZRSA 3OHMB 1IG5A 5I2OA 5I8NA 1ZACA 1DT7B 5D7FA 4JWQA 4OR9B 4ZCVA 4CIDA 1KK8C 4DRWA 2ZFDA 1RECA 1KK7Y 2IS9A 4AOMA 4NQGA 2SCPA 1JSAA 2FOTA 1TNPA 1QTXA 2LM5A 1WRZA 4YRUA 1JFJA 3TS5C 1J1EA 2EC6B 5CSIA 3VRQA 4AQIA 3E3RA 1XFXO 1QATA 2PVBA 1KFXL 4UPGA 2JULA 2KQ6A 3LCPC 3WXAA 2BL0B 4WQ3A 2LMTA 1MWNA 3OX5A 1OZOA 3TDZA 5HKWA 2V53A 1RTP1 2K7OA 1ALVA 3O4YA 4M2OA 4NDDA 4AQJA 5J3XA 2MLFC 1IQ5A 2CNPA 3OB1B 2FJUB 4ICBA 3FWBA 5KSZA 2Y1MA 2KGRA 1XK4A 4GBAA 1CTRA 4BY5A 3SG5A 1SKTA 4DS7A 1MQ1A 1M46A 3O78A 4GAOA 4E68A 1WRKA 1PK0D 4IL1A 1J7OA 1CLMA 4PE1A 2PRUA 2LCPA 1K9UA 1BR1B 3EKHA 1YUSA 4M2PA 4D1EA 1IQ3A 1Y0VH 3FWCA 1FI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K95 A;  1PRW A;  1CFD A;  1NSH A;  2H2K A;  1C07 A;  5CSJ A;  1NX0 A;  1BR4 B;  4QJ4 B;  1NWD A;  2LVV A;  3ICB A;  3PSR A;  4YI9 A;  2JNF A;  2Y1N A;  1RWY A;  3CWG A;  1K94 A;  1SPY A;  2K8M B;  2VRG A;  3IQO A;  1F55 A;  1EL4 A;  1NCZ A;  1OMR A;  2K2A A;  3EK7 A;  1A03 A;  1VRK A;  2GGZ A;  2JTT A;  3PAT A;  2BCA A;  3M0W A;  3RLZ A;  3BUW B;  1FF1 A;  1L2O B;  1SCM B;  3CR5 X;  1SBJ A;  1Q80 A;  1AP4 A;  2LMU A;  1LXF C;  4ORA B;  1IJ6 A;  2F33 A;  1XFW O;  1CMF A;  4GGF C;  4MZK A;  4NDB A;  4OVN F;  3F45 A;  2BEC A;  1LVC D;  4YI8 A;  2HPS A;  2LP2 A;  2MJW B;  3NXA A;  4I5J A;  1NX1 A;  5FYX A;  3OB2 B;  1UWO A;  1KCY A;  1G4Y R;  1KK7 Z;  2WCE A;  1SW8 A;  1QXP A;  4OCI A;  1S6I A;  3IQQ A;  4USL A;  1K8U A;  1Y1U A;  2NZ0 A;  1SYM A;  2Y4Q A;  4I5K A;  4CLN A;  1IH0 A;  1QS7 A;  1FI6 A;  3I5H C;  2A4J A;  1BT6 A;  3C1V A;  2JPT A;  1B8C A;  2BBM A;  1PVB A;  1EJ3 A;  1NX2 A;  1AJ4 A;  1IGV A;  1J55 A;  2BE6 A;  3GK4 X;  1UHI A;  4R1E A;  1AHR A;  2KFG A;  2L50 A;  3NSI A;  1NPQ A;  3TZ1 A;  1SCV A;  2F2P A;  1FPW A;  1TTX A;  1YUU A;  1FW4 A;  2KHN A;  1IJ5 A;  1B4C A;  4ORC B;  3KHE A;  1H8B A;  2HQ8 A;  1B7T Y;  3I5I C;  4GGN A;  2M7N A;  1J7R A;  5DKN A;  1UHJ A;  5B8I B;  3CGA A;  2LUX A;  5I2L A;  5AAN A;  1PAL A;  1XFU O;  2LMV A;  1DJH A;  3SJS A;  3OX6 A;  4PE0 A;  1F4Q A;  2LC5 A;  1PVA A;  1V1G A;  4DCK A;  2LVJ A;  3BUN B;  3SG2 A;  4GGF A;  1F4O A;  2EGD A;  1UHN A;  1TCF A;  3VRN A;  1F70 A;  3CS1 A;  3PLF B;  1AVS A;  1A75 A;  4FQO A;  1N2D A;  4MN0 A;  1K9K A;  1KWO B;  3A4U B;  2M8U A;  2OTG B;  3KO0 A;  2GV5 A;  1BJF A;  2O5G A;  1K9P A;  1CDM A;  1DGU A;  3SG7 A;  2JXL A;  1J7P A;  2LP3 A;  1JF0 A;  3NSK A;  1IRJ A;  1CDL A;  1QV1 A;  3JVT B;  3ZWH A;  3AKA A;  1B47 A;  1RFJ A;  1G33 A;  2LV7 A;  1BOD A;  1X02 A;  5PAL A;  1YVL A;  2EC6 C;  4HRE E;  1CKK A;  1U5I B;  2WC8 A;  2WND A;  2PAS A;  5GQQ C;  5AXI A;  2BCX A;  1WLM A;  1QIV A;  1ZOT B;  3NSL A;  4JQ0 D;  2BL0 C;  5DKR A;  1HT9 A;  5ER5 A;  2WCF A;  1Y1X A;  1YVH A;  2K7D A;  1M31 A;  3HCM A;  4DIR A;  2OPO A;  2LAP A;  2M29 A;  2K2F A;  2LLT A;  4HSZ A;  1NCX A;  2R2I A;  1PUL A;  2FCE A;  1DF0 B;  1SRA A;  3BUO B;  2Q91 A;  1DMO A;  5K89 A;  1CFC A;  2BCB A;  2KNE A;  1TN4 A;  4YGD B;  1MF8 B;  2KOT A;  4U8D A;  2JXC A;  5BPJ A;  1SMG A;  3EVR A;  4MLW A;  1MXL C;  3VGO A;  4JPZ B;  3NSO A;  1YUR A;  2P6B B;  3EVU A;  1YR5 A;  4MZL A;  1W7I B;  2OS8 B;  1WDC B;  1QX5 B;  2JNX A;  2DOQ A;  1JUO A;  1TNQ A;  2KAX A;  5HKY A;  5CPV A;  1DVI A;  1WDC C;  1TIZ A;  1B7T Z;  1MUX A;  1E8A A;  1L7Z A;  3BXK A;  5HLO A;  1GQM A;  1CM1 A;  2CBL A;  2LHI A;  2M97 A;  1YRU B;  1F8H A;  2M49 B;  4WRI A;  1L2O C;  1SCM C;  1UHK A;  5DKQ A;  2H61 C;  2M3W A;  1KSM A;  3VRO A;  5AFP A;  3H4S E;  2K7C A;  2ZN8 A;  1U5I A;  4XYN A;  4MRY A;  3KPX A;  3FS7 A;  4ORB B;  3KF9 A;  2O60 A;  1M45 A;  2LNK A;  2KFH A;  5KTY A;  2I18 A;  3TDU A;  3AKB A;  1EG4 A;  2G2B A;  3IF7 A;  1XFZ O;  1BMO A;  3LL8 B;  1LIN A;  1PSR A;  1DJI A;  1XYD A;  3D0Y B;  4OV2 A;  2LLS A;  5HKZ A;  1CDN A;  3DVM A;  2KQY A;  3VRP A;  1IKU A;  4P5O E;  1KFU L;  1OMD A;  1R6P A;  4YGE B;  1TNW A;  3KEV A;  3JTD B;  1DJG A;  2LUC A;  2RGI A;  2WOR A;  1CFP A;  1S5G Y;  1C7V A;  1UUR A;  4OKH A;  1YRT B;  3WHU B;  1OSA A;  4GUK A;  1HQV A;  1H4B A;  3CZT X;  3GOF A;  2LVI A;  3JTD C;  3SG6 A;  4N1F A;  4PE4 A;  2JC2 A;  3EK4 A;  1F54 A;  1M63 B;  1Y6W A;  2JTZ A;  2L2E A;  4PHK A;  4QJ3 B;  2AUC A;  2ZKM X;  3EKJ A;  5I2Q A;  1NUB A;  1XFY O;  4GPL B;  1CFF A;  4I5N B;  2NCO A;  4YBH B;  1S36 A;  1JC2 A;  1QLK A;  2JQ6 A;  2I94 A;  2M1U A;  2Q4U A;  1SL9 A;  4YGB B;  2PSR A;  3TUY B;  1GJY A;  2PAL A;  1A2X A;  2KI4 B;  1YX8 A;  2F3Z A;  4ETO A;  1IWQ A;  4YGA A;  1S6C A;  4PHN A;  1ODB A;  1AJ5 A;  1SR6 B;  2I7A A;  1KQM B;  2H61 A;  2M1K B;  3GK2 A;  1QAS A;  3BOW B;  3QRX A;  1KQM C;  2KAV A;  2LLU A;  1QVI Y;  3FIA A;  1CLB A;  2FCD A;  4CFQ A;  1CNP A;  1N0Y A;  3SIA A;  2ZRT A;  2MRD A;  5D69 A;  2CXJ A;  1M39 A;  2JT8 A;  1JF2 A;  3BYA A;  1BF5 A;  2Y5I A;  3AAJ A;  1S26 D;  2BBN A;  1KWO C;  4N5X A;  2TN4 A;  1S3P A;  1WLZ A;  2OTG C;  3CR2 A;  3I5F B;  2ZNE A;  4C0L A;  5IBW A;  2M0R A;  1AK8 A;  1OMV A;  2MLE C;  2GGM A;  2KFF A;  2MA2 A;  2LE9 B;  2MHH A;  3DD4 A;  1S6J A;  1XVJ A;  3DF0 B;  3JVT C;  2M7L A;  3SG4 A;  2E6W A;  4A4C A;  2JT0 A;  2JT3 A;  3OP0 A;  2LAN A;  1KK8 B;  1UHH A;  4PHJ A;  2L98 A;  1J1D A;  4MBE A;  1J7Q A;  1RK9 A;  2G9B A;  2JU0 A;  3TS5 B;  2K0J A;  3LLE A;  1EXR A;  5KU1 A;  4WQ2 A;  1N65 A;  3DVJ A;  3AAK A;  1OZS A;  2KGB C;  2L51 A;  2KSP A;  1TOP A;  1NP8 A;  1SL7 A;  4N1G A;  2BE4 A;  2I2R E;  5G08 A;  1CB1 A;  1K90 D;  1XFV O;  1F71 A;  3HX4 A;  4NDC A;  1EH2 A;  2HET A;  1NCY A;  5AER A;  1UUS A;  4C0K A;  1S5G Z;  1EG3 A;  3PFV A;  1DTL A;  5CSF A;  3WNX B;  1BU3 A;  2F2O A;  2KBI A;  1RRO A;  5HYD A;  4PHM A;  1TCO B;  2KI6 D;  3BOW A;  1BOC A;  4XJK B;  3EK8 A;  1SNL A;  1QLS A;  4CFR A;  1ZFS A;  2OS8 C;  4MVF A;  4PE7 A;  4F0Z B;  2B1U A;  1B8R A;  1XO5 A;  2QPT A;  1KFU S;  1JFK A;  2AAO A;  4MZJ A;  1D1O A;  2HQW A;  1LA0 A;  1CMG A;  4L9M A;  3D10 A;  1XA5 A;  1K93 D;  3A8R A;  1KSO A;  1RJV A;  2CCM A;  5TNC A;  3CTN A;  3DF0 A;  1YTZ C;  3O2P A;  1QVI Z;  4BY4 A;  2F8P A;  2COL B;  4C0J A;  1TRF A;  4MEW A;  2WCB A;  5AEQ A;  1GGZ A;  2D8N A;  1ZMZ A;  2CTN A;  2L4H A;  1OE9 B;  2L0P A;  1DJW A;  2HF5 A;  3CR4 X;  5JJG A;  1ALW A;  1DGV A;  1WRL A;  1K2H A;  1V1F A;  2L5X B;  1A29 A;  1MHO A;  1R2U A;  2KYC A;  3I5G B;  1JBA A;  2KDH A;  3O6B A;  4GNK B;  2LHL A;  2ZND A;  3DVK A;  1LKJ A;  3I5G C;  1B8L A;  1DF0 A;  1G8I A;  1CDP A;  1A75 B;  3BUM B;  1NYA A;  1ZUZ A;  1CM4 A;  1DJZ A;  4YGC B;  1SL8 A;  3LK0 A;  1AUI B;  5ER4 X;  2JRF A;  1W7J B;  1OOJ A;  4PCW A;  4FTG A;  3DVE A;  3CLN A;  3VRR A;  2L4I A;  2SAS A;  3K21 A;  4I5L B;  4CPV A;  1LA3 A;  3I5H B;  1B9A A;  1QV0 A;  1SY9 A;  1QX7 A;  1QIW A;  3WHT B;  4QJ5 B;  1NX3 A;  4XJK A;  5HLV A;  1FBV A;  1MR8 A;  1JWD A;  1DJY A;  1YUT A;  2LVK A;  1K96 A;  4MSP A;  1MXE A;  2ISD A;  3ZNI A;  2BKI B;  2E30 A;  3EVV A;  2CT9 A;  3GK1 A;  4ZCU A;  4GFT A;  2NXQ A;  1NIW A;  1S1E A;  1BLQ A;  2QAC A;  2WOS A;  2KAY A;  4M2Q A;  2MBX A;  1A4P A;  4A4B A;  1SK6 D;  2JOJ A;  2PMY A;  4P2Y B;  2EHB A;  2KI4 C;  1Y1A A;  2NLN A;  3TUY C;  3BQ3 A;  3PAL A;  1OQP A;  4DUQ A;  2JWW A;  2JZI A;  4HRH A;  1SR6 C;  3LK1 A;  3I5I B;  5JOL A;  3SIB A;  4PAL A;  1B1G A;  3PN7 B;  3TDI A;  5CSN A;  1GGW A;  1XK4 C;  2MAZ A;  4MRX A;  1CLL A;  5F6T A;  3BUX B;  1PSB A;  2BKH B;  1TNX A;  1C7W A;  2KYF A;  2AMI A;  3PN7 C;  2K7B A;  3SG3 A;  1KFX S;  1QX2 A;  3PM8 A;  1QJT A;  4TNC A;  2F3Y A;  2KI6 C;  2KBM A;  1WY9 A;  1YX7 A;  4PDZ A;  1DJX A;  2NCP A;  3I5F C;  1KQV A;  4HRG A;  3D0Y A;  1UP5 A;  3RM1 A;  3MSE B;  2M9G A;  1BG1 A;  2ZN9 A;  4Q04 A;  2K61 A;  2ZRS A;  3OHM B;  1IG5 A;  5I2O A;  5I8N A;  1ZAC A;  1DT7 B;  5D7F A;  4JWQ A;  4OR9 B;  4ZCV A;  4CID A;  1KK8 C;  4DRW A;  2ZFD A;  1REC A;  1KK7 Y;  2IS9 A;  4AOM A;  4NQG A;  2SCP A;  1JSA A;  2FOT A;  1TNP A;  1QTX A;  2LM5 A;  1WRZ A;  4YRU A;  1JFJ A;  3TS5 C;  1J1E A;  2EC6 B;  5CSI A;  3VRQ A;  4AQI A;  3E3R A;  1XFX O;  1QAT A;  2PVB A;  1KFX L;  4UPG A;  2JUL A;  2KQ6 A;  3LCP C;  3WXA A;  2BL0 B;  4WQ3 A;  2LMT A;  1MWN A;  3OX5 A;  1OZO A;  3TDZ A;  5HKW A;  2V53 A;  1RTP 1;  2K7O A;  1ALV A;  3O4Y A;  4M2O A;  4NDD A;  4AQJ A;  5J3X A;  2MLF C;  1IQ5 A;  2CNP A;  3OB1 B;  2FJU B;  4ICB A;  3FWB A;  5KSZ A;  2Y1M A;  2KGR A;  1XK4 A;  4GBA A;  1CTR A;  4BY5 A;  3SG5 A;  1SKT A;  4DS7 A;  1MQ1 A;  1M46 A;  3O78 A;  4GAO A;  4E68 A;  1WRK A;  1PK0 D;  4IL1 A;  1J7O A;  1CLM A;  4PE1 A;  2PRU A;  2LCP A;  1K9U A;  1BR1 B;  3EKH A;  1YUS A;  4M2P A;  4D1E A;  1IQ3 A;  1Y0V H;  3FWC A;  1FI5 A; 
#chains in the Genus database with same CATH topology
 1K95 A;  1PRW A;  1CFD A;  1NSH A;  2H2K A;  3B87 A;  3BFB A;  1C07 A;  5CSJ A;  1NX0 A;  1BR4 B;  4QJ4 B;  1NWD A;  2LVV A;  3ICB A;  3PSR A;  4YI9 A;  2JNF A;  2Y1N A;  1P28 A;  1RWY A;  1K94 A;  1SPY A;  2K8M B;  2VRG A;  3CWG A;  3IQO A;  3CAB A;  1F55 A;  1EL4 A;  1NCZ A;  1OMR A;  2K2A A;  3EK7 A;  5HL1 A;  1DQE A;  1VRK A;  2GGZ A;  1A03 A;  2JTT A;  3PAT A;  2BCA A;  3M0W A;  3RLZ A;  3BUW B;  1FF1 A;  1L2O B;  1SCM B;  3CR5 X;  1SBJ A;  2KPH A;  1Q80 A;  1AP4 A;  2LMU A;  1LXF C;  4ORA B;  3PM2 A;  1IJ6 A;  3D77 A;  2F33 A;  1XFW O;  1CMF A;  4GGF C;  4MZK A;  4NDB A;  4OVN F;  3F45 A;  2BEC A;  1LVC D;  4YI8 A;  2HPS A;  2LP2 A;  2MJW B;  3NXA A;  2QEB A;  4I5J A;  1NX1 A;  5FYX A;  3OB2 B;  1UWO A;  1KCY A;  1G4Y R;  1KK7 Z;  2WCE A;  1SW8 A;  3D73 A;  1QXP A;  5I2Q A;  3QME A;  4OCI A;  1S6I A;  3FE6 A;  3IQQ A;  4USL A;  1K8U A;  1Y1U A;  2NZ0 A;  1SYM A;  2Y4Q A;  3IVT A;  4I5K A;  4CLN A;  1IH0 A;  1QS7 A;  1FI6 A;  3I5H C;  2A4J A;  1BT6 A;  3C1V A;  2JPT A;  1B8C A;  2BBM A;  1PVB A;  1EJ3 A;  1NX2 A;  3S0E A;  1AJ4 A;  1IGV A;  1J55 A;  2BE6 A;  3GK4 X;  1UHI A;  4R1E A;  1AHR A;  2KFG A;  2L50 A;  3NSI A;  1NPQ A;  3TZ1 A;  1SCV A;  3S0A A;  2F2P A;  1TUZ A;  1FPW A;  1TTX A;  1YUU A;  2H8V A;  1FW4 A;  2KHN A;  1IJ5 A;  4IJ7 A;  5FI6 A;  5ER5 A;  1B4C A;  4ORC B;  3KHE A;  1H8B A;  2HQ8 A;  1B7T Y;  3I5I C;  4GGN A;  2M7N A;  1J7R A;  5DKN A;  1UHJ A;  5B8I B;  3CGA A;  2LUX A;  5I2L A;  5AAN A;  2FJY A;  1PAL A;  1T14 A;  1XFU O;  2LMV A;  3SS5 A;  1DJH A;  3SJS A;  3OX6 A;  4PE0 A;  1F4Q A;  2LC5 A;  1PVA A;  1V1G A;  4DCK A;  2LVJ A;  1OOI X;  3BUN B;  3SG2 A;  4GGF A;  1F4O A;  2EGD A;  1UHN A;  1TCF A;  3VRN A;  1F70 A;  3D76 A;  3CS1 A;  1OW4 A;  3PLF B;  1AVS A;  1A75 A;  4FQO A;  1DC1 A;  1N2D A;  4MN0 A;  5DIC A;  1K9K A;  1KWO B;  3A4U B;  3CDN A;  2M8U A;  2OTG B;  3KO0 A;  2GV5 A;  1BJF A;  2O5G A;  1K9P A;  1CDM A;  1DGU A;  3SG7 A;  2JXL A;  1J7P A;  2LP3 A;  1JF0 A;  3NSK A;  1IRJ A;  1CDL A;  2K60 A;  1QV1 A;  3JVT B;  3ZWH A;  1DEK A;  4FQT A;  3NHI A;  3AKA A;  1B47 A;  1RFJ A;  1G33 A;  3VB1 A;  2LV7 A;  1BOD A;  1X02 A;  5PAL A;  1YVL A;  2EC6 C;  4HRE E;  1CKK A;  1U5I B;  2WC8 A;  2WND A;  2PAS A;  5GQQ C;  3NHT A;  5AXI A;  2BCX A;  1WLM A;  1QIV A;  1ZOT B;  3EG5 B;  3NSL A;  2BL0 C;  4JQ0 D;  1HT9 A;  5DKR A;  2WCF A;  1Y1X A;  1YVH A;  3S0B A;  2K7D A;  5FI2 A;  1M31 A;  3HCM A;  4DIR A;  2OPO A;  2LAP A;  2M29 A;  2K2F A;  2LLT A;  4HSZ A;  1NCX A;  3UO9 A;  2R2I A;  1PUL A;  3L4L A;  2FCE A;  3D75 A;  3SS3 A;  1DF0 B;  1SRA A;  3BUO B;  2Q91 A;  1DMO A;  3BFA A;  5K89 A;  1CFC A;  2BCB A;  2L2C A;  2KNE A;  1TN4 A;  4YGD B;  1MF8 B;  2KOT A;  4U8D A;  2JXC A;  5BPJ A;  2P71 A;  1SMG A;  3EVR A;  4MLW A;  1MXL C;  3VGO A;  4JPZ B;  3NSO A;  1YUR A;  2P6B B;  3EVU A;  1YR5 A;  3UNW A;  4MZL A;  1W7I B;  2OS8 B;  1XFR A;  1WDC B;  1QX5 B;  2JNX A;  2DOQ A;  1JUO A;  2ERB A;  1TNQ A;  2KAX A;  4JD9 A;  5HKY A;  5CPV A;  1DVI A;  1WDC C;  1TIZ A;  1B7T Z;  1MUX A;  1E8A A;  1L7Z A;  3BXK A;  5HLO A;  1GQM A;  1CM1 A;  2CBL A;  2LHI A;  2M97 A;  1YRU B;  1F8H A;  2M49 B;  4WRI A;  1L2O C;  1SCM C;  1UHK A;  2WC6 A;  2H61 C;  5DKQ A;  2M3W A;  1KSM A;  3VRO A;  5AFP A;  3DY9 A;  3H4S E;  2K7C A;  2ZN8 A;  1U5I A;  4XYN A;  4MRY A;  3KPX A;  3Q8I A;  3FS7 A;  4ORB B;  1QWV A;  3KF9 A;  2O60 A;  1C3Y A;  1M45 A;  2LNK A;  2KFH A;  5KTY A;  2I18 A;  3TDU A;  3AKB A;  1EG4 A;  2G2B A;  3IF7 A;  1XFZ O;  4INW A;  1IIO A;  3D78 A;  1BMO A;  3LL8 B;  1LIN A;  1PSR A;  1DJI A;  1XYD A;  3D0Y B;  4OV2 A;  4OZD A;  2LLS A;  5HKZ A;  1CDN A;  3DVM A;  2KQY A;  3VRP A;  1IKU A;  3R1P A;  4P5O E;  1KFU L;  1OMD A;  1R6P A;  4YGE B;  1TNW A;  3KEV A;  3JTD B;  1DJG A;  2LUC A;  2RGI A;  2WOR A;  1CFP A;  1S5G Y;  1C7V A;  1UUR A;  4OKH A;  1YRT B;  3WHU B;  1OSA A;  4GUK A;  1HQV A;  1H4B A;  3CZT X;  3GOF A;  2LVI A;  3JTD C;  3SG6 A;  3NGV A;  4N1F A;  4PE4 A;  2QEO A;  2JC2 A;  3EK4 A;  1F54 A;  1M63 B;  1Y6W A;  2JTZ A;  2L2E A;  4PHK A;  4QJ3 B;  2AUC A;  2ZKM X;  3DZT A;  3CZ0 A;  1NUB A;  1XFY O;  3EKJ A;  4GPL B;  1CFF A;  4I5N B;  2NCO A;  4YBH B;  1S36 A;  1JC2 A;  1QLK A;  1DEL A;  2JQ6 A;  1OOG A;  2I94 A;  2M1U A;  2Q4U A;  1SL9 A;  4YGB B;  2PSR A;  3TUY B;  1GJY A;  2PAL A;  1A2X A;  2KI4 B;  1YX8 A;  2F3Z A;  4ETO A;  1IWQ A;  4YGA A;  1S6C A;  4PHN A;  1ODB A;  1AJ5 A;  1SR6 B;  2I7A A;  1KQM B;  2H61 A;  2M1K B;  1W9Z A;  3GK2 A;  1QAS A;  3BOW B;  2WCH A;  3QRX A;  1KQM C;  2KAV A;  2LLU A;  1QVI Y;  2PYQ A;  2QEV A;  3FIA A;  1CLB A;  2FCD A;  4CFQ A;  1CNP A;  1N0Y A;  3SIA A;  2ZRT A;  2MRD A;  5D69 A;  2CXJ A;  1M39 A;  2JT8 A;  1JF2 A;  3BYA A;  1BF5 A;  2Y5I A;  1Z2C B;  1S26 D;  2BBN A;  3AAJ A;  1KWO C;  4N5X A;  2TN4 A;  1S3P A;  1TWO A;  1WLZ A;  2OTG C;  3CR2 A;  2ZNE A;  3I5F B;  4C0L A;  2M0R A;  5IBW A;  1OMV A;  1AK8 A;  2MLE C;  2GGM A;  2KFF A;  2MA2 A;  2LE9 B;  2MHH A;  3DD4 A;  1S6J A;  1XVJ A;  3DF0 B;  3JVT C;  2M7L A;  3SG4 A;  2E6W A;  4A4C A;  2JT0 A;  2JT3 A;  3OP0 A;  3S0F A;  2LAN A;  1KK8 B;  1UHH A;  4PHJ A;  2L98 A;  3B6X A;  3R1O A;  2L5Y A;  1J1D A;  4MBE A;  1J7Q A;  1RK9 A;  2G9B A;  3R72 A;  2JU0 A;  3TS5 B;  2K0J A;  3LLE A;  1EXR A;  5KU1 A;  4WQ2 A;  1N65 A;  3DVJ A;  3AAK A;  1OZS A;  2KGB C;  2L51 A;  2WCJ A;  2KSP A;  1TOP A;  1NP8 A;  1SL7 A;  1GM0 A;  4N1G A;  2BE4 A;  2I2R E;  5G08 A;  2WCL A;  1CB1 A;  1K90 D;  1XFV O;  1F71 A;  3HX4 A;  4PT1 A;  1OOF A;  4NDC A;  1EH2 A;  2HET A;  1NCY A;  5AER A;  2P70 A;  1UUS A;  4C0K A;  1S5G Z;  3CZ1 A;  1EG3 A;  3PFV A;  1DTL A;  5CSF A;  3WNX B;  1BU3 A;  2F2O A;  2KBI A;  1RRO A;  5HYD A;  4PHM A;  3CYZ A;  1TCO B;  2KLE A;  2KI6 D;  2QEH A;  3BOW A;  3L47 A;  3EK8 A;  4XJK B;  1BOC A;  1SNL A;  1QLS A;  4CFR A;  5FI7 A;  1ZFS A;  2PQL A;  2OS8 C;  4MVF A;  4PE7 A;  4F0Z B;  3B86 A;  2B1U A;  1B8R A;  1XO5 A;  2QPT A;  1KFU S;  1JFK A;  2AAO A;  3CZ2 A;  4MZJ A;  3S0G A;  3DXL A;  2WCK A;  1D1O A;  2HQW A;  1LA0 A;  1CMG A;  3BJH A;  3D10 A;  1XA5 A;  4L9M A;  1K93 D;  3A8R A;  1KSO A;  1RJV A;  2CCM A;  5TNC A;  3CTN A;  3R1V A;  3DF0 A;  3D74 A;  1YTZ C;  3O2P A;  1QVI Z;  4BY4 A;  2F8P A;  2COL B;  4C0J A;  1TRF A;  4MEW A;  2WCB A;  3B88 A;  5AEQ A;  1GGZ A;  2BNX A;  2D8N A;  1ZMZ A;  2CTN A;  2L4H A;  1OE9 B;  3BFH A;  2L0P A;  1DJW A;  2HF5 A;  3CR4 X;  3L4A A;  1ALW A;  5JJG A;  1DGV A;  1WRL A;  1K2H A;  2QDI A;  1V1F A;  1C3Z A;  2L5X B;  1A29 A;  1MHO A;  1R2U A;  2KYC A;  3I5G B;  2JPO A;  1JBA A;  2BAP A;  2KDH A;  3O6B A;  4GNK B;  2LHL A;  2ZND A;  3DVK A;  1LKJ A;  3I5G C;  1B8L A;  1DF0 A;  1G8I A;  5EL2 A;  1CDP A;  1A75 B;  3BUM B;  1NYA A;  1ZUZ A;  1CM4 A;  1DJZ A;  4YGC B;  1SL8 A;  3LK0 A;  1AUI B;  5ER4 X;  2JRF A;  4INX A;  1W7J B;  4JKT A;  1OOJ A;  4PCW A;  4FTG A;  3DVE A;  3CLN A;  3VRR A;  2L4I A;  2SAS A;  3K21 A;  4I5L B;  4CPV A;  1LA3 A;  3I5H B;  1B9A A;  3OGN A;  1QV0 A;  1SY9 A;  1QX7 A;  1QIW A;  3WHT B;  4QJ5 B;  1NX3 A;  4XJK A;  5HLV A;  1FBV A;  1MR8 A;  1JWD A;  1DJY A;  1YUT A;  2LVK A;  5D3O A;  1K96 A;  4MSP A;  1MXE A;  2ISD A;  3ZNI A;  3SS4 A;  2BKI B;  2E30 A;  3EVV A;  2CT9 A;  3GK1 A;  4ZCU A;  4GFT A;  1LS8 A;  1NIW A;  1S1E A;  2NXQ A;  1BLQ A;  2QAC A;  2WOS A;  2KAY A;  4M2Q A;  3FE8 A;  1A4P A;  2MBX A;  4A4B A;  1SK6 D;  2JOJ A;  2PMY A;  3N7H A;  2EHB A;  2KI4 C;  1Y1A A;  2NLN A;  4P2Y B;  3TUY C;  3RZS A;  3BQ3 A;  3PAL A;  1OQP A;  4F7F A;  4DUQ A;  2JWW A;  2JZI A;  4HRH A;  1SR6 C;  3LK1 A;  1ORG A;  3I5I B;  5JOL A;  3SIB A;  4PAL A;  1B1G A;  3PN7 B;  2YGU A;  3TDI A;  5CSN A;  1GGW A;  1XK4 C;  2MAZ A;  4MRX A;  1CLL A;  5F6T A;  3BUX B;  1PSB A;  2BKH B;  2GTE A;  1TNX A;  1C7W A;  2KYF A;  2AMI A;  3PN7 C;  2K7B A;  3SG3 A;  1KFX S;  1QX2 A;  3PM8 A;  1QJT A;  4TNC A;  2F3Y A;  2KI6 C;  2KBM A;  1WY9 A;  1YX7 A;  4PDZ A;  1DJX A;  2NCP A;  3I5F C;  1KQV A;  3DYE A;  4HRG A;  3D0Y A;  1UP5 A;  3RM1 A;  3MSE B;  2M9G A;  1BG1 A;  2ZN9 A;  1OOH A;  4Q04 A;  2K61 A;  2ZRS A;  3OHM B;  1IG5 A;  5I2O A;  5I8N A;  1ZAC A;  1DT7 B;  5D7F A;  2WC5 A;  4JWQ A;  4OR9 B;  4ZCV A;  4CID A;  1KK8 C;  4DRW A;  2ZFD A;  1REC A;  1KK7 Y;  2IS9 A;  4AOM A;  2WCM A;  4NQG A;  2SCP A;  1JSA A;  3FE9 A;  2FOT A;  1TNP A;  1QTX A;  2LM5 A;  1WRZ A;  3K1E A;  4YRU A;  1JFJ A;  3V2L A;  3TS5 C;  1J1E A;  2EC6 B;  5CSI A;  3VRQ A;  4AQI A;  2KLD A;  3E3R A;  1XFX O;  3PJI A;  1QAT A;  2PVB A;  1KFX L;  4KYN A;  2JUL A;  2KQ6 A;  3LCP C;  4UPG A;  3WXA A;  2BL0 B;  1TUJ A;  4WQ3 A;  2LMT A;  1MWN A;  3OX5 A;  1OZO A;  3TDZ A;  5HKW A;  2V53 A;  1RTP 1;  2K7O A;  5I94 A;  1ALV A;  3O4Y A;  4M2O A;  4NDD A;  4AQJ A;  5J3X A;  2MLF C;  1IQ5 A;  2CNP A;  3OB1 B;  2FJU B;  4ICB A;  3FWB A;  5KSZ A;  2Y1M A;  3S0D A;  2KGR A;  1XK4 A;  4GBA A;  1CTR A;  4BY5 A;  3SG5 A;  1SKT A;  4DS7 A;  1MQ1 A;  1M46 A;  3O78 A;  4GAO A;  4E68 A;  1WRK A;  1PK0 D;  4IL1 A;  1J7O A;  3O4X A;  1CLM A;  4PE1 A;  2PRU A;  2LCP A;  1Z4H A;  1K9U A;  1SSE B;  1BR1 B;  3EKH A;  1YUS A;  3B7A A;  4M2P A;  4D1E A;  3OBV A;  1IQ3 A;  1Y0V H;  3FWC A;  1FI5 A; 
#chains in the Genus database with same CATH homology
 1K95 A;  1PRW A;  1CFD A;  1NSH A;  2H2K A;  1C07 A;  5CSJ A;  1NX0 A;  1BR4 B;  4QJ4 B;  1NWD A;  2LVV A;  3ICB A;  3PSR A;  4YI9 A;  2JNF A;  2Y1N A;  1RWY A;  3CWG A;  1K94 A;  1SPY A;  2K8M B;  2VRG A;  3IQO A;  1F55 A;  1EL4 A;  1NCZ A;  1OMR A;  2K2A A;  3EK7 A;  1A03 A;  1VRK A;  2GGZ A;  2JTT A;  3PAT A;  2BCA A;  3M0W A;  3RLZ A;  3BUW B;  1FF1 A;  1L2O B;  1SCM B;  3CR5 X;  1SBJ A;  1Q80 A;  1AP4 A;  2LMU A;  1LXF C;  4ORA B;  1IJ6 A;  2F33 A;  1XFW O;  1CMF A;  4GGF C;  4MZK A;  4NDB A;  4OVN F;  3F45 A;  2BEC A;  1LVC D;  4YI8 A;  2HPS A;  2LP2 A;  2MJW B;  3NXA A;  4I5J A;  1NX1 A;  5FYX A;  3OB2 B;  1UWO A;  1KCY A;  1G4Y R;  1KK7 Z;  2WCE A;  1SW8 A;  1QXP A;  4OCI A;  1S6I A;  3IQQ A;  4USL A;  1K8U A;  1Y1U A;  2NZ0 A;  1SYM A;  2Y4Q A;  4I5K A;  4CLN A;  1IH0 A;  1QS7 A;  1FI6 A;  3I5H C;  2A4J A;  1BT6 A;  3C1V A;  2JPT A;  1B8C A;  2BBM A;  1PVB A;  1EJ3 A;  1NX2 A;  1AJ4 A;  1IGV A;  1J55 A;  2BE6 A;  3GK4 X;  1UHI A;  4R1E A;  1AHR A;  2KFG A;  2L50 A;  3NSI A;  1NPQ A;  3TZ1 A;  1SCV A;  2F2P A;  1FPW A;  1TTX A;  1YUU A;  1FW4 A;  2KHN A;  1IJ5 A;  1B4C A;  4ORC B;  3KHE A;  1H8B A;  2HQ8 A;  1B7T Y;  3I5I C;  4GGN A;  2M7N A;  1J7R A;  5DKN A;  1UHJ A;  5B8I B;  3CGA A;  2LUX A;  5I2L A;  5AAN A;  1PAL A;  1XFU O;  2LMV A;  1DJH A;  3SJS A;  3OX6 A;  4PE0 A;  1F4Q A;  2LC5 A;  1PVA A;  1V1G A;  4DCK A;  2LVJ A;  3BUN B;  3SG2 A;  4GGF A;  1F4O A;  2EGD A;  1UHN A;  1TCF A;  3VRN A;  1F70 A;  3CS1 A;  3PLF B;  1AVS A;  1A75 A;  4FQO A;  1N2D A;  4MN0 A;  1K9K A;  1KWO B;  3A4U B;  2M8U A;  2OTG B;  3KO0 A;  2GV5 A;  1BJF A;  2O5G A;  1K9P A;  1CDM A;  1DGU A;  3SG7 A;  2JXL A;  1J7P A;  2LP3 A;  1JF0 A;  3NSK A;  1IRJ A;  1CDL A;  1QV1 A;  3JVT B;  3ZWH A;  3AKA A;  1B47 A;  1RFJ A;  1G33 A;  2LV7 A;  1BOD A;  1X02 A;  5PAL A;  1YVL A;  2EC6 C;  4HRE E;  1CKK A;  1U5I B;  2WC8 A;  2WND A;  2PAS A;  5GQQ C;  5AXI A;  2BCX A;  1WLM A;  1QIV A;  1ZOT B;  3NSL A;  4JQ0 D;  2BL0 C;  5DKR A;  1HT9 A;  5ER5 A;  2WCF A;  1Y1X A;  1YVH A;  2K7D A;  1M31 A;  3HCM A;  4DIR A;  2OPO A;  2LAP A;  2M29 A;  2K2F A;  2LLT A;  4HSZ A;  1NCX A;  2R2I A;  1PUL A;  2FCE A;  1DF0 B;  1SRA A;  3BUO B;  2Q91 A;  1DMO A;  5K89 A;  1CFC A;  2BCB A;  2KNE A;  1TN4 A;  4YGD B;  1MF8 B;  2KOT A;  4U8D A;  2JXC A;  5BPJ A;  1SMG A;  3EVR A;  4MLW A;  1MXL C;  3VGO A;  4JPZ B;  3NSO A;  1YUR A;  2P6B B;  3EVU A;  1YR5 A;  4MZL A;  1W7I B;  2OS8 B;  1WDC B;  1QX5 B;  2JNX A;  2DOQ A;  1JUO A;  1TNQ A;  2KAX A;  5HKY A;  5CPV A;  1DVI A;  1WDC C;  1TIZ A;  1B7T Z;  1MUX A;  1E8A A;  1L7Z A;  3BXK A;  5HLO A;  1GQM A;  1CM1 A;  2CBL A;  2LHI A;  2M97 A;  1YRU B;  1F8H A;  2M49 B;  4WRI A;  1L2O C;  1SCM C;  1UHK A;  5DKQ A;  2H61 C;  2M3W A;  1KSM A;  3VRO A;  5AFP A;  3H4S E;  2K7C A;  2ZN8 A;  1U5I A;  4XYN A;  4MRY A;  3KPX A;  3FS7 A;  4ORB B;  3KF9 A;  2O60 A;  1M45 A;  2LNK A;  2KFH A;  5KTY A;  2I18 A;  3TDU A;  3AKB A;  1EG4 A;  2G2B A;  3IF7 A;  1XFZ O;  1BMO A;  3LL8 B;  1LIN A;  1PSR A;  1DJI A;  1XYD A;  3D0Y B;  4OV2 A;  2LLS A;  5HKZ A;  1CDN A;  3DVM A;  2KQY A;  3VRP A;  1IKU A;  4P5O E;  1KFU L;  1OMD A;  1R6P A;  4YGE B;  1TNW A;  3KEV A;  3JTD B;  1DJG A;  2LUC A;  2RGI A;  2WOR A;  1CFP A;  1S5G Y;  1C7V A;  1UUR A;  4OKH A;  1YRT B;  3WHU B;  1OSA A;  4GUK A;  1HQV A;  1H4B A;  3CZT X;  3GOF A;  2LVI A;  3JTD C;  3SG6 A;  4N1F A;  4PE4 A;  2JC2 A;  3EK4 A;  1F54 A;  1M63 B;  1Y6W A;  2JTZ A;  2L2E A;  4PHK A;  4QJ3 B;  2AUC A;  2ZKM X;  3EKJ A;  5I2Q A;  1NUB A;  1XFY O;  4GPL B;  1CFF A;  4I5N B;  2NCO A;  4YBH B;  1S36 A;  1JC2 A;  1QLK A;  2JQ6 A;  2I94 A;  2M1U A;  2Q4U A;  1SL9 A;  4YGB B;  2PSR A;  3TUY B;  1GJY A;  2PAL A;  1A2X A;  2KI4 B;  1YX8 A;  2F3Z A;  4ETO A;  1IWQ A;  4YGA A;  1S6C A;  4PHN A;  1ODB A;  1AJ5 A;  1SR6 B;  2I7A A;  1KQM B;  2H61 A;  2M1K B;  3GK2 A;  1QAS A;  3BOW B;  3QRX A;  1KQM C;  2KAV A;  2LLU A;  1QVI Y;  3FIA A;  1CLB A;  2FCD A;  4CFQ A;  1CNP A;  1N0Y A;  3SIA A;  2ZRT A;  2MRD A;  5D69 A;  2CXJ A;  1M39 A;  2JT8 A;  1JF2 A;  3BYA A;  1BF5 A;  2Y5I A;  3AAJ A;  1S26 D;  2BBN A;  1KWO C;  4N5X A;  2TN4 A;  1S3P A;  1WLZ A;  2OTG C;  3CR2 A;  3I5F B;  2ZNE A;  4C0L A;  5IBW A;  2M0R A;  1AK8 A;  1OMV A;  2MLE C;  2GGM A;  2KFF A;  2MA2 A;  2LE9 B;  2MHH A;  3DD4 A;  1S6J A;  1XVJ A;  3DF0 B;  3JVT C;  2M7L A;  3SG4 A;  2E6W A;  4A4C A;  2JT0 A;  2JT3 A;  3OP0 A;  2LAN A;  1KK8 B;  1UHH A;  4PHJ A;  2L98 A;  1J1D A;  4MBE A;  1J7Q A;  1RK9 A;  2G9B A;  2JU0 A;  3TS5 B;  2K0J A;  3LLE A;  1EXR A;  5KU1 A;  4WQ2 A;  1N65 A;  3DVJ A;  3AAK A;  1OZS A;  2KGB C;  2L51 A;  2KSP A;  1TOP A;  1NP8 A;  1SL7 A;  4N1G A;  2BE4 A;  2I2R E;  5G08 A;  1CB1 A;  1K90 D;  1XFV O;  1F71 A;  3HX4 A;  4NDC A;  1EH2 A;  2HET A;  1NCY A;  5AER A;  1UUS A;  4C0K A;  1S5G Z;  1EG3 A;  3PFV A;  1DTL A;  5CSF A;  3WNX B;  1BU3 A;  2F2O A;  2KBI A;  1RRO A;  5HYD A;  4PHM A;  1TCO B;  2KI6 D;  3BOW A;  1BOC A;  4XJK B;  3EK8 A;  1SNL A;  1QLS A;  4CFR A;  1ZFS A;  2OS8 C;  4MVF A;  4PE7 A;  4F0Z B;  2B1U A;  1B8R A;  1XO5 A;  2QPT A;  1KFU S;  1JFK A;  2AAO A;  4MZJ A;  1D1O A;  2HQW A;  1LA0 A;  1CMG A;  4L9M A;  3D10 A;  1XA5 A;  1K93 D;  3A8R A;  1KSO A;  1RJV A;  2CCM A;  5TNC A;  3CTN A;  3DF0 A;  1YTZ C;  3O2P A;  1QVI Z;  4BY4 A;  2F8P A;  2COL B;  4C0J A;  1TRF A;  4MEW A;  2WCB A;  5AEQ A;  1GGZ A;  2D8N A;  1ZMZ A;  2CTN A;  2L4H A;  1OE9 B;  2L0P A;  1DJW A;  2HF5 A;  3CR4 X;  5JJG A;  1ALW A;  1DGV A;  1WRL A;  1K2H A;  1V1F A;  2L5X B;  1A29 A;  1MHO A;  1R2U A;  2KYC A;  3I5G B;  1JBA A;  2KDH A;  3O6B A;  4GNK B;  2LHL A;  2ZND A;  3DVK A;  1LKJ A;  3I5G C;  1B8L A;  1DF0 A;  1G8I A;  1CDP A;  1A75 B;  3BUM B;  1NYA A;  1ZUZ A;  1CM4 A;  1DJZ A;  4YGC B;  1SL8 A;  3LK0 A;  1AUI B;  5ER4 X;  2JRF A;  1W7J B;  1OOJ A;  4PCW A;  4FTG A;  3DVE A;  3CLN A;  3VRR A;  2L4I A;  2SAS A;  3K21 A;  4I5L B;  4CPV A;  1LA3 A;  3I5H B;  1B9A A;  1QV0 A;  1SY9 A;  1QX7 A;  1QIW A;  3WHT B;  4QJ5 B;  1NX3 A;  4XJK A;  5HLV A;  1FBV A;  1MR8 A;  1JWD A;  1DJY A;  1YUT A;  2LVK A;  1K96 A;  4MSP A;  1MXE A;  2ISD A;  3ZNI A;  2BKI B;  2E30 A;  3EVV A;  2CT9 A;  3GK1 A;  4ZCU A;  4GFT A;  2NXQ A;  1NIW A;  1S1E A;  1BLQ A;  2QAC A;  2WOS A;  2KAY A;  4M2Q A;  2MBX A;  1A4P A;  4A4B A;  1SK6 D;  2JOJ A;  2PMY A;  4P2Y B;  2EHB A;  2KI4 C;  1Y1A A;  2NLN A;  3TUY C;  3BQ3 A;  3PAL A;  1OQP A;  4DUQ A;  2JWW A;  2JZI A;  4HRH A;  1SR6 C;  3LK1 A;  3I5I B;  5JOL A;  3SIB A;  4PAL A;  1B1G A;  3PN7 B;  3TDI A;  5CSN A;  1GGW A;  1XK4 C;  2MAZ A;  4MRX A;  1CLL A;  5F6T A;  3BUX B;  1PSB A;  2BKH B;  1TNX A;  1C7W A;  2KYF A;  2AMI A;  3PN7 C;  2K7B A;  3SG3 A;  1KFX S;  1QX2 A;  3PM8 A;  1QJT A;  4TNC A;  2F3Y A;  2KI6 C;  2KBM A;  1WY9 A;  1YX7 A;  4PDZ A;  1DJX A;  2NCP A;  3I5F C;  1KQV A;  4HRG A;  3D0Y A;  1UP5 A;  3RM1 A;  3MSE B;  2M9G A;  1BG1 A;  2ZN9 A;  4Q04 A;  2K61 A;  2ZRS A;  3OHM B;  1IG5 A;  5I2O A;  5I8N A;  1ZAC A;  1DT7 B;  5D7F A;  4JWQ A;  4OR9 B;  4ZCV A;  4CID A;  1KK8 C;  4DRW A;  2ZFD A;  1REC A;  1KK7 Y;  2IS9 A;  4AOM A;  4NQG A;  2SCP A;  1JSA A;  2FOT A;  1TNP A;  1QTX A;  2LM5 A;  1WRZ A;  4YRU A;  1JFJ A;  3TS5 C;  1J1E A;  2EC6 B;  5CSI A;  3VRQ A;  4AQI A;  3E3R A;  1XFX O;  1QAT A;  2PVB A;  1KFX L;  4UPG A;  2JUL A;  2KQ6 A;  3LCP C;  3WXA A;  2BL0 B;  4WQ3 A;  2LMT A;  1MWN A;  3OX5 A;  1OZO A;  3TDZ A;  5HKW A;  2V53 A;  1RTP 1;  2K7O A;  1ALV A;  3O4Y A;  4M2O A;  4NDD A;  4AQJ A;  5J3X A;  2MLF C;  1IQ5 A;  2CNP A;  3OB1 B;  2FJU B;  4ICB A;  3FWB A;  5KSZ A;  2Y1M A;  2KGR A;  1XK4 A;  4GBA A;  1CTR A;  4BY5 A;  3SG5 A;  1SKT A;  4DS7 A;  1MQ1 A;  1M46 A;  3O78 A;  4GAO A;  4E68 A;  1WRK A;  1PK0 D;  4IL1 A;  1J7O A;  1CLM A;  4PE1 A;  2PRU A;  2LCP A;  1K9U A;  1BR1 B;  3EKH A;  1YUS A;  4M2P A;  4D1E A;  1IQ3 A;  1Y0V H;  3FWC A;  1FI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...