3JVTC

Calcium-bound scallop myosin regulatory domain (lever arm) with reconstituted complete light chains
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated adductor muscle
publication title The on-off switch in regulated myosins: different triggers but related mechanisms.
pubmed doi rcsb
molecule tags Contractile protein
total genus 48
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3jvtC02
2KOTA 1F4QA 1QXPA 1SL9A 4AQJA 4ICBA 5CSJA 2WCFA 1G4YR 2A4JA 2FOTA 1WLZA 2HETA 5GQQC 4DUQA 2LP2A 1QX2A 3CR2A 4U8DA 2MHHA 4DRWA 1DJZA 4QJ4B 2BCAA 3I5IC 2MLFC 4HRHA 2M7LA 2PMYA 1YX8A 1OMRA 1OZSA 1SPYA 1WRLA 5I2QA 1E8AA 1TOPA 2CTNA 3NSKA 4BY5A 5HKYA 2KI6D 3SIAA 2H2KA 3TDZA 2H61A 4XJKB 3TDIA 5KSZA 2F3ZA 3RLZA 4L9MA 1CM1A 2IS9A 2AAOA 1N2DA 1PK0D 1MR8A 2LVIA 4M2PA 1DJIA 1NCXA 4XJKA 1IJ5A 2BL0B 2LC5A 2ZRTA 2BE4A 3LCPC 1IQ3A 3EK4A 4JWQA 1XYDA 3SJSA 3VRNA 4BY4A 1L2OC 1IWQA 1CKKA 2KDHA 2LUXA 4OR9B 1SKTA 4YRUA 3BXKA 1JUOA 1DGUA 2Y1MA 3GOFA 1UHHA 2NZ0A 1RWYA 2LLTA 2M49B 2ZN9A 1RJVA 2M8UA 4MVFA 1FPWA 3EVRA 4MZKA 2TN4A 1YURA 1KK8C 4NQGA 1IJ6A 2M3WA 2M1KB 2WNDA 4I5JA 1UHJA 1J1EA 1QVIY 4ZCVA 1PSBA 3CTNA 4AOMA 2L4IA 4E68A 1SNLA 1AK8A 3RM1A 1NCYA 3EVUA 1IGVA 3I5GB 4ORBB 5DKNA 2SASA 3NSIA 3I5FC 3JTDB 3WNXB 5D7FA 4GGFA 4GNKB 2F2OA 4N1GA 3CWGA 2BKHB 3KPXA 4YI9A 1RTP1 1Y1XA 3WHTB 2JTZA 4PE0A 1S6CA 1QJTA 1F8HA 1LA3A 2B1UA 2L5XB 5CSFA 5I8NA 2K0JA 4USLA 3VGOA 3AAKA 1B8RA 2LMVA 1XFVO 1A75A 4QJ5B 3FWBA 4GBAA 2KGRA 1Y0VH 1KQMC 2M7NA 1GGZA 2AUCA 2I94A 1B8LA 1F4OA 1RK9A 1SYMA 1SW8A 3PM8A 1XO5A 1FF1A 5HYDA 4C0KA 4MEWA 5HLVA 2F33A 1QV1A 2L2EA 4PHMA 1FBVA 4I5KA 2VRGA 1DT7B 5CPVA 5G08A 1NIWA 1DGVA 1PVBA 1OZOA 1B7TZ 1BODA 2MAZA 5HLOA 3OHMB 1TNQA 3PFVA 4PE1A 2KQYA 5I2OA 1KFUS 2KI4B 1EL4A 1XK4A 1IG5A 3PN7C 3TUYC 5PALA 3DVJA 3CS1A 1NX3A 1CFCA 1ZACA 1CB1A 4PE7A 2CXJA 1ZOTB 4HSZA 2WCEA 3BOWB 3O6BA 1BR4B 1CLLA 1XA5A 2PVBA 3LLEA 4JPZB 2QPTA 1NX1A 2OS8B 5AXIA 2O5GA 1QX7A 1JBAA 1BG1A 1DJGA 1UHIA 1HQVA 2I18A 1YUUA 3BOWA 1JSAA 4YGDB 3BUNB 1BLQA 1FI6A 4MBEA 1M45A 4M2OA 1M31A 1XFWO 1TNWA 1IQ5A 4FTGA 3FIAA 1N65A 4AQIA 1PVAA 4ORCB 1CLBA 2COLB 4N1FA 2PALA 1UUSA 1MQ1A 1PRWA 2K7CA 1DVIA 2L98A 1PALA 1TN4A 4YGBB 5ER5A 4WQ3A 2KNEA 3HX4A 1JFKA 1NUBA 1S1EA 2KHNA 2PSRA 1JFJA 1X02A 2CNPA 2KBIA 1A29A 1KFUL 1K8UA 4TNCA 1EH2A 1YVLA 3I5HB 4XYNA 1SBJA 2HF5A 2F2PA 1WDCC 3CLNA 1KCYA 2JTTA 2L4HA 3A8RA 1MXLC 1LKJA 3JVTC 2BL0C 1KSMA 2K7OA 4C0LA 1ALWA 3CR4X 3MSEB 4P5OE 1G8IA 1SR6B 2GGZA 3O4YA 1BT6A 2E30A 2JT8A 1C7WA 1B47A 2NLNA 1F71A 2OPOA 2RGIA 4I5LB 3AKAA 1QV0A 2L0PA 4I5NB 1H4BA 1WRKA 2JU0A 3EKHA 3DVKA 1YUSA 3EKJA 5B8IB 1BU3A 4MZJA 2I7AA 1F55A 4ZCUA 1QLSA 1RFJA 2KQ6A 3KF9A 3PATA 1XFXO 3I5IB 4PE4A 1TIZA 1LA0A 1J7QA 1CTRA 2BE6A 3TDUA 1H8BA 2KFFA 2MJWB 1B1GA 2LLSA 2Q4UA 2HQ8A 1KQVA 2MA2A 1SK6D 1TRFA 1BMOA 2K8MB 3I5GC 2KGBC 1NP8A 3SG6A 1CDPA 3JTDC 1OSAA 4OCIA 2F3YA 4C0JA 2JC2A 5KU1A 4HREE 1EXRA 1KK7Z 2HQWA 1RROA 2M29A 1J7RA 1Y1AA 4FQOA 4P2YB 5DKQA 3ZWHA 4CIDA 3M0WA 4WQ2A 1YR5A 1L2OB 2WORA 2M9GA 3NSLA 1IRJA 1J55A 2KAVA 2ISDA 2NCOA 3IQOA 1W7JB 3WXAA 1A75B 3DVEA 2FJUB 2LVVA 1YVHA 1J7PA 1YTZC 1KK8B 1DJHA 1CDLA 2GV5A 3DF0B 1AVSA 2LANA 3NSOA 2NCPA 4NDDA 5KTYA 2BKIB 4N5XA 2KBMA 2JRFA 1UHNA 3DVMA 1DMOA 4NDBA 3DF0A 2LMTA 1CMFA 1S5GZ 2EC6B 2LVKA 1M63B 3OX5A 1W7IB 2E6WA 1KSOA 3I5FB 3EK8A 3KHEA 1ZUZA 1K90D 2K2FA 4PHNA 1DF0A 1Q80A 4MRXA 3TS5B 3LL8B 3VRRA 3PLFB 4GGNA 1CDNA 1KWOC 1BOCA 1R6PA 1VRKA 1LINA 3FWCA 3QRXA 1SCMB 2MLEC 1J1DA 2BBNA 2LUCA 2QACA 2KSPA 1SMGA 5AERA 1EJ3A 1PSRA 3LK0A 2M97A 1KFXS 1JF2A 5BPJA 1UURA 1MF8B 1G33A 1C7VA 1QLKA 1KK7Y 1UHKA 2JT0A 1NSHA 4R1EA 4GUKA 4M2QA 4DS7A 4UPGA 1MWNA 1K96A 3PALA 3SG2A 3AKBA 2OTGC 3LK1A 4MLWA 3O2PA 1ODBA 3OB1B 1OQPA 2I2RE 4NDCA 2G9BA 3VRPA 5HKWA 4JQ0D 3BQ3A 3C1VA 2M0RA 3DD4A 5J3XA 3SG5A 3ICBA 1YRUB 1ALVA 1EG3A 1BF5A 4Q04A 3GK1A 4MN0A 2K7DA 1M46A 2K2AA 3F45A 1K9UA 1S3PA 1GGWA 2H61C 3PN7B 2F8PA 1S6IA 1AUIB 4PHJA 5I2LA 4DIRA 1NCZA 1RECA 1XFUO 5JJGA 5CSNA 2K7BA 1B8CA 1NYAA 2CT9A 2FCEA 2M1UA 4DCKA 1YUTA 1KFXL 5CSIA 2D8NA 1LXFC 5DKRA 5FYXA 1B7TY 1V1FA 2PASA 3O78A 4ETOA 4D1EA 3OX6A 1HT9A 5K89A 2G2BA 2JPTA 1A2XA 1Y6WA 2LNKA 3EK7A 1M39A 2FCDA 1L7ZA 1B9AA 1AJ5A 2LV7A 1SCVA 1SRAA 3BYAA 2AMIA 1AHRA 4MSPA 3KO0A 2BECA 2L50A 2ZFDA 2EHBA 1GQMA 5AFPA 1SL7A 1JC2A 4PCWA 1K95A 2LM5A 2ZKMX 1ZFSA 1K9PA 1CFFA 4A4BA 1S36A 2Y5IA 1QASA 2KFGA 1R2UA 1B4CA 4YGEB 1WY9A 1S6JA 1WDCB 3WHUB 3NXAA 2BCBA 5AEQA 1D1OA 2CCMA 3BUOB 3IF7A 1K93D 3IQQA 1QVIZ 3BUWB 1NPQA 4GGFC 3SG4A 4QJ3B 1JF0A 3JVTB 2KAXA 1MXEA 2ZRSA 1A03A 1QTXA 1YRTB 2ZN8A 4CFRA 3BUMB 2WOSA 1MUXA 2P6BB 2HPSA 4IL1A 1S26D 2L51A 4OVNF 2EGDA 1IKUA 1UP5A 4GAOA 2KAYA 1TCOB 1DJYA 4MRYA 3CGAA 1AP4A 5HKZA 1QX5B 3BUXB 1N0YA 3H4SE 4GPLB 3KEVA 2Q91A 2ZNEA 1V1GA 1WRZA 4PDZA 3OP0A 3CZTX 5JOLA 1J7OA 1AJ4A 4ORAB 2JXCA 2JT3A 3OB2B 4OV2A 1OE9B 1OMDA 2JWWA 2LHIA 1OOJA 1YX7A 2JXLA 1LVCD 1FI5A 2BCXA 2EC6C 3A4UB 1CM4A 5AANA 5F6TA 1CDMA 1DF0B 2JNXA 2SCPA 1A4PA 1BJFA 3AAJA 3TS5C 2WCBA 2KYCA 3CR5X 2PRUA 4A4CA 1QATA 2LCPA 1C07A 1U5IB 1QS7A 3ZNIA 1SCMC 1XK4C 1K94A 1IH0A 2Y1NA 3D10A 2K61A 2LAPA 2V53A 4F0ZB 3VROA 1CMGA 4YGAA 1U5IA 5ER4X 2KI4C 2DOQA 5D69A 1WLMA 4PALA 2R2IA 2WC8A 1F70A 1PULA 2JZIA 1SL8A 1CNPA 2KFHA 1CLMA 1DJXA 5IBWA 1K9KA 1KQMB 2MRDA 2JULA 1BR1B 3SG3A 1TNXA 1QIVA 2CBLA 2Y4QA 2OS8C 1XFYO 4CFQA 1OMVA 1TNPA 2KYFA 1NX0A 1EG4A 1QIWA 2GGMA 1TTXA 4OKHA 2JQ6A 4GFTA 3E3RA 4CLNA 1DJWA 1KWOB 1JWDA 1ZMZA 1SY9A 1NX2A 3HCMA 3GK4X 3K21A 1XFZO 2JOJA 2ZNDA 2JNFA 2KI6C 4WRIA 3GK2A 3TZ1A 2O60A 3D0YB 1UWOA 4MZLA 2NXQA 1TCFA 2LMUA 2LHLA 4YBHB 2LVJA 5TNCA 4HRGA 1S5GY 2LLUA 3TUYB 1GJYA 3SG7A 1NWDA 2BBMA 3EVVA 3SIBA 3I5HC 3D0YA 1MHOA 3PSRA 3FS7A 1FW4A 4PHKA 1CFPA 1XVJA 1Y1UA 1CFDA 4YGCB 2MBXA 1DTLA 1F54A 2OTGB 3VRQA 1K2HA 4CPVA 4YI8A 2LP3A 2LE9B 1SR6C
chains in the Genus database with same CATH superfamily
2KOTA 1F4QA 1QXPA 1SL9A 1OW4A 2JPOA 4ICBA 4AQJA 5CSJA 2WCFA 1G4YR 2A4JA 2FOTA 1WLZA 2HETA 5GQQC 3S0GA 4DUQA 2LP2A 1QX2A 3CR2A 4U8DA 2MHHA 4DRWA 1DJZA 4QJ4B 2BCAA 3L4AA 3I5IC 2MLFC 2YGUA 4HRHA 2M7LA 2PMYA 1YX8A 1OMRA 1OZSA 1ORGA 1SPYA 1WRLA 1E8AA 1TOPA 2CTNA 3NSKA 5FI2A 4BY5A 2KI6D 3SIAA 5HKYA 2H2KA 3TDZA 2H61A 4XJKB 3TDIA 5KSZA 2F3ZA 3DYEA 3RLZA 3VB1A 4L9MA 3SS5A 1CM1A 2IS9A 2AAOA 3BFBA 1IIOA 1N2DA 2P71A 1PK0D 1OOIX 1MR8A 2LVIA 4M2PA 1DJIA 1NCXA 4XJKA 1IJ5A 2BL0B 2LC5A 2ZRTA 2BE4A 3LCPC 1IQ3A 2GTEA 3EK4A 4JWQA 1XYDA 3SJSA 3VRNA 4BY4A 1L2OC 1IWQA 1CKKA 2KDHA 2LUXA 4OR9B 1SKTA 4YRUA 3BXKA 1JUOA 1DGUA 2Y1MA 3GOFA 1UHHA 2NZ0A 1RWYA 2LLTA 2M49B 2ZN9A 1RJVA 2M8UA 2WCJA 4MVFA 1FPWA 3EVRA 4MZKA 2TN4A 1YURA 1KK8C 4NQGA 1IJ6A 2M3WA 2M1KB 2WNDA 3RZSA 4I5JA 1UHJA 1J1EA 1QVIY 4ZCVA 1PSBA 3CTNA 4AOMA 2L4IA 4E68A 1SNLA 1AK8A 3RM1A 1NCYA 3EVUA 1IGVA 5I94A 3I5GB 4ORBB 3PM2A 5DKNA 2SASA 3NSIA 3I5FC 3JTDB 3WNXB 5D7FA 4GGFA 4GNKB 2F2OA 4N1GA 3CWGA 2BKHB 3KPXA 4YI9A 1RTP1 1Y1XA 3WHTB 2JTZA 4PE0A 2KLDA 1S6CA 1QJTA 1F8HA 1LA3A 2B1UA 2L5XB 5CSFA 5I8NA 2K0JA 4USLA 3VGOA 3AAKA 4FQTA 2WCLA 1B8RA 2LMVA 1XFVO 1A75A 4QJ5B 3FWBA 4GBAA 2KGRA 1Y0VH 1KQMC 2M7NA 1GGZA 1P28A 2AUCA 1B8LA 2I94A 3CZ2A 1F4OA 1RK9A 1SYMA 5D3OA 1SW8A 3PM8A 1XO5A 1FF1A 5HYDA 4C0KA 3D78A 4MEWA 2F33A 1QV1A 5HLVA 2L2EA 4PHMA 3UO9A 1FBVA 4I5KA 2VRGA 1DT7B 3DXLA 5CPVA 5G08A 1NIWA 1DGVA 1PVBA 1OZOA 1B7TZ 1BODA 2MAZA 5HLOA 3OHMB 3B88A 1TNQA 3PFVA 4PE1A 2KQYA 5I2OA 1KFUS 2KI4B 1EL4A 1XK4A 1IG5A 3PN7C 3TUYC 3SS3A 5PALA 3DVJA 3CS1A 1NX3A 1CFCA 1ZACA 1CB1A 4PE7A 2CXJA 1ZOTB 4HSZA 4INXA 1DQEA 2WCEA 3BOWB 3O6BA 1BR4B 1CLLA 1XA5A 2PVBA 3LLEA 4JPZB 2QEVA 2QPTA 1NX1A 1TWOA 2OS8B 5AXIA 2O5GA 1QX7A 1JBAA 1BG1A 1DJGA 1UHIA 1HQVA 2I18A 1Z2CB 1YUUA 3BOWA 1JSAA 4YGDB 3BUNB 4PT1A 1BLQA 1FI6A 4MBEA 1M45A 4M2OA 1M31A 1XFWO 1TNWA 1IQ5A 4FTGA 3CZ0A 3FIAA 1N65A 4AQIA 1PVAA 4ORCB 3FE8A 1CLBA 2COLB 4N1FA 2PALA 1UUSA 1MQ1A 1PRWA 2K7CA 1DVIA 2L98A 1PALA 1TN4A 4YGBB 3PJIA 5ER5A 3L47A 4WQ3A 2L2CA 2KNEA 3DZTA 3HX4A 1JFKA 1NUBA 1S1EA 2KHNA 2PSRA 1JFJA 1X02A 4IJ7A 2CNPA 2KBIA 1A29A 1KFUL 1K8UA 4TNCA 1EH2A 1YVLA 3I5HB 4XYNA 1SBJA 2HF5A 2F2PA 1WDCC 3CLNA 1KCYA 3R72A 3S0DA 4INWA 2JTTA 2L4HA 3A8RA 1MXLC 1LKJA 3JVTC 2BL0C 1KSMA 2K7OA 4C0LA 1ALWA 3CR4X 3MSEB 4P5OE 1G8IA 1SR6B 2GGZA 3O4YA 1BT6A 5DICA 2ERBA 2E30A 2JT8A 1C7WA 2P70A 1B47A 2NLNA 1F71A 2OPOA 2RGIA 4I5LB 3AKAA 1QV0A 2L0PA 3NGVA 4I5NB 1H4BA 1WRKA 2JU0A 3EKHA 3DVKA 1YUSA 3EKJA 5B8IB 1BU3A 4MZJA 2I7AA 1F55A 4ZCUA 1QLSA 1RFJA 2KQ6A 3KF9A 3PATA 1XFXO 3B6XA 3I5IB 3CDNA 4PE4A 1TIZA 1LA0A 1DC1A 1J7QA 3NHTA 1CTRA 4JKTA 2BE6A 3TDUA 1H8BA 2KFFA 2MJWB 1B1GA 2LLSA 2Q4UA 2HQ8A 1KQVA 2MA2A 1SK6D 1TRFA 1BMOA 2K8MB 3I5GC 2KGBC 2QEOA 3R1OA 2FJYA 1NP8A 3FE9A 1CDPA 3SG6A 3JTDC 1OSAA 4OCIA 2F3YA 4C0JA 2JC2A 5KU1A 4HREE 1EXRA 1KK7Z 2HQWA 1RROA 2M29A 1J7RA 1Y1AA 4FQOA 4P2YB 5DKQA 3ZWHA 4CIDA 3M0WA 4WQ2A 1YR5A 1L2OB 2WORA 3Q8IA 2M9GA 3NSLA 1GM0A 1IRJA 3BFHA 1J55A 2KAVA 2ISDA 2NCOA 3D75A 1W7JB 2WCHA 3IQOA 3WXAA 1A75B 3DVEA 2FJUB 2LVVA 1YVHA 1J7PA 1YTZC 1KK8B 1DJHA 1TUJA 1CDLA 2GV5A 3DF0B 3N7HA 1AVSA 2LANA 2WCMA 3NSOA 4KYNA 2NCPA 4NDDA 5KTYA 1SSEB 2BKIB 4N5XA 2KBMA 2JRFA 2WC5A 1DEKA 1UHNA 3S0EA 3DVMA 1DMOA 4NDBA 3D73A 3DF0A 2LMTA 3CYZA 1CMFA 1S5GZ 3V2LA 2EC6B 2LVKA 1M63B 3OX5A 1W7IB 2E6WA 1KSOA 3UNWA 1LS8A 3I5FB 3EK8A 3KHEA 1ZUZA 1K90D 2K2FA 4PHNA 1DF0A 1Q80A 3R1PA 4MRXA 3TS5B 3LL8B 3VRRA 3PLFB 4GGNA 1CDNA 1KWOC 1BOCA 1R6PA 1VRKA 1LINA 3FWCA 2PYQA 3QRXA 1SCMB 2MLEC 1J1DA 2BBNA 2LUCA 2QACA 2KSPA 1SMGA 5AERA 3S0AA 1EJ3A 1PSRA 2BNXA 3LK0A 2M97A 1KFXS 1JF2A 5BPJA 1UURA 1MF8B 1G33A 3BJHA 1C7VA 1QLKA 1KK7Y 1UHKA 2JT0A 1NSHA 3D74A 4R1EA 4GUKA 4M2QA 4DS7A 4UPGA 1MWNA 1K96A 3PALA 3SG2A 2BAPA 2OTGC 3AKBA 3LK1A 3O2PA 1ODBA 3OB1B 4MLWA 1OQPA 2I2RE 3B7AA 4NDCA 2G9BA 5FI7A 3SS4A 5HKWA 3VRPA 3QMEA 4JQ0D 3BQ3A 3C1VA 2M0RA 3DD4A 5J3XA 3SG5A 3ICBA 1YRUB 1ALVA 1EG3A 1BF5A 4Q04A 3GK1A 4MN0A 2K7DA 1M46A 2K2AA 3F45A 1K9UA 1S3PA 1GGWA 3OGNA 2WCKA 2QEHA 2H61C 3PN7B 2F8PA 1S6IA 1AUIB 4PHJA 5I2LA 4DIRA 1NCZA 1RECA 1XFUO 5JJGA 5CSNA 2K7BA 1B8CA 1NYAA 4OZDA 2CT9A 2FCEA 2M1UA 3B86A 4DCKA 1YUTA 1KFXL 5CSIA 2D8NA 1LXFC 5DKRA 5FYXA 1B7TY 1V1FA 2PASA 3O78A 4ETOA 4D1EA 3OX6A 1HT9A 5K89A 2G2BA 2JPTA 1A2XA 1Y6WA 2LNKA 3EK7A 1M39A 2FCDA 1L7ZA 1B9AA 1AJ5A 2LV7A 1SCVA 1SRAA 3BYAA 2AMIA 1AHRA 4MSPA 3KO0A 2BECA 2L50A 2ZFDA 2EHBA 1GQMA 4JD9A 5AFPA 1SL7A 1JC2A 1OOFA 3IVTA 4PCWA 1K95A 2LM5A 3EG5B 2ZKMX 3D76A 1ZFSA 1K9PA 1CFFA 4A4BA 1S36A 2Y5IA 1QASA 2KFGA 5EL2A 1R2UA 1B4CA 4YGEB 1QWVA 1S6JA 1WDCB 1WY9A 3NXAA 3WHUB 2BCBA 5AEQA 1D1OA 2CCMA 3BUOB 3IF7A 1K93D 1Z4HA 1QVIZ 3BUWB 3IQQA 1NPQA 4GGFC 3SG4A 2QEBA 1JF0A 1XFRA 3B87A 4QJ3B 3JVTB 2KAXA 1MXEA 2ZRSA 3D77A 1A03A 1QTXA 1YRTB 2ZN8A 4CFRA 3BUMB 2WOSA 1MUXA 2P6BB 2HPSA 4IL1A 1S26D 2L51A 1C3ZA 2EGDA 4OVNF 1IKUA 1UP5A 4GAOA 2KAYA 1TCOB 1DJYA 4MRYA 3CGAA 1AP4A 3NHIA 1DELA 5HKZA 1QX5B 3BUXB 1N0YA 3H4SE 4GPLB 3KEVA 2Q91A 2ZNEA 1OOHA 3BFAA 1V1GA 1WRZA 3OBVA 4PDZA 3OP0A 3CZTX 5JOLA 1J7OA 1AJ4A 4ORAB 2JXCA 2JT3A 3OB2B 4OV2A 1OE9B 1OMDA 2JWWA 2LHIA 1OOJA 1YX7A 2JXLA 1LVCD 1FI5A 2BCXA 2EC6C 3A4UB 1CM4A 5AANA 2KLEA 5F6TA 1CDMA 1DF0B 2JNXA 2SCPA 1A4PA 1BJFA 3AAJA 3TS5C 2WCBA 2KYCA 3CR5X 2K60A 2PRUA 1QATA 2LCPA 4A4CA 1C07A 1U5IB 1QS7A 3ZNIA 3L4LA 1SCMC 3DY9A 1XK4C 1K94A 1W9ZA 2H8VA 2Y1NA 1IH0A 1OOGA 3D10A 2K61A 2LAPA 2V53A 4F0ZB 3VROA 1CMGA 4YGAA 1U5IA 5ER4X 2KI4C 2DOQA 5D69A 5I2QA 1WLMA 4PALA 2R2IA 2WC8A 5HL1A 1F70A 2L5YA 1PULA 3R1VA 2JZIA 1SL8A 1CNPA 2KFHA 1T14A 1CLMA 1DJXA 5IBWA 1K9KA 1KQMB 2MRDA 2JULA 1BR1B 3SG3A 5FI6A 3FE6A 1TNXA 1QIVA 2CBLA 2Y4QA 2OS8C 1XFYO 4CFQA 1OMVA 1TNPA 2KYFA 1NX0A 1EG4A 1QIWA 2GGMA 1TTXA 3CABA 4OKHA 3S0BA 2JQ6A 4GFTA 3E3RA 4CLNA 1DJWA 1KWOB 1JWDA 3O4XA 1ZMZA 1SY9A 1NX2A 3HCMA 3GK4X 3K21A 1XFZO 2JOJA 2ZNDA 2JNFA 2KI6C 2WC6A 4WRIA 3GK2A 2KPHA 3TZ1A 2O60A 3CZ1A 3D0YB 1UWOA 4MZLA 2NXQA 1TCFA 2QDIA 2LMUA 2LHLA 4YBHB 2LVJA 5TNCA 1TUZA 1S5GY 2LLUA 4HRGA 3TUYB 1GJYA 3SG7A 1NWDA 2BBMA 3EVVA 3SIBA 3I5HC 3D0YA 1MHOA 1C3YA 3PSRA 3FS7A 3K1EA 1FW4A 4PHKA 1CFPA 1XVJA 4F7FA 1Y1UA 1CFDA 4YGCB 2MBXA 1DTLA 1F54A 2PQLA 3S0FA 2OTGB 3VRQA 1K2HA 4CPVA 4YI8A 2LP3A 2LE9B 1SR6C
chains in the Genus database with same CATH topology
2KOTA 1F4QA 1QXPA 1SL9A 4AQJA 4ICBA 5CSJA 2WCFA 1G4YR 2A4JA 2FOTA 1WLZA 2HETA 5GQQC 4DUQA 2LP2A 1QX2A 3CR2A 4U8DA 2MHHA 4DRWA 1DJZA 4QJ4B 2BCAA 3I5IC 2MLFC 4HRHA 2M7LA 2PMYA 1YX8A 1OMRA 1OZSA 1SPYA 1WRLA 5I2QA 1E8AA 1TOPA 2CTNA 3NSKA 4BY5A 5HKYA 2KI6D 3SIAA 2H2KA 3TDZA 2H61A 4XJKB 3TDIA 5KSZA 2F3ZA 3RLZA 4L9MA 1CM1A 2IS9A 2AAOA 1N2DA 1PK0D 1MR8A 2LVIA 4M2PA 1DJIA 1NCXA 4XJKA 1IJ5A 2BL0B 2LC5A 2ZRTA 2BE4A 3LCPC 1IQ3A 3EK4A 4JWQA 1XYDA 3SJSA 3VRNA 4BY4A 1L2OC 1IWQA 1CKKA 2KDHA 2LUXA 4OR9B 1SKTA 4YRUA 3BXKA 1JUOA 1DGUA 2Y1MA 3GOFA 1UHHA 2NZ0A 1RWYA 2LLTA 2M49B 2ZN9A 1RJVA 2M8UA 4MVFA 1FPWA 3EVRA 4MZKA 2TN4A 1YURA 1KK8C 4NQGA 1IJ6A 2M3WA 2M1KB 2WNDA 4I5JA 1UHJA 1J1EA 1QVIY 4ZCVA 1PSBA 3CTNA 4AOMA 2L4IA 4E68A 1SNLA 1AK8A 3RM1A 1NCYA 3EVUA 1IGVA 3I5GB 4ORBB 5DKNA 2SASA 3NSIA 3I5FC 3JTDB 3WNXB 5D7FA 4GGFA 4GNKB 2F2OA 4N1GA 3CWGA 2BKHB 3KPXA 4YI9A 1RTP1 1Y1XA 3WHTB 2JTZA 4PE0A 1S6CA 1QJTA 1F8HA 1LA3A 2B1UA 2L5XB 5CSFA 5I8NA 2K0JA 4USLA 3VGOA 3AAKA 1B8RA 2LMVA 1XFVO 1A75A 4QJ5B 3FWBA 4GBAA 2KGRA 1Y0VH 1KQMC 2M7NA 1GGZA 2AUCA 2I94A 1B8LA 1F4OA 1RK9A 1SYMA 1SW8A 3PM8A 1XO5A 1FF1A 5HYDA 4C0KA 4MEWA 5HLVA 2F33A 1QV1A 2L2EA 4PHMA 1FBVA 4I5KA 2VRGA 1DT7B 5CPVA 5G08A 1NIWA 1DGVA 1PVBA 1OZOA 1B7TZ 1BODA 2MAZA 5HLOA 3OHMB 1TNQA 3PFVA 4PE1A 2KQYA 5I2OA 1KFUS 2KI4B 1EL4A 1XK4A 1IG5A 3PN7C 3TUYC 5PALA 3DVJA 3CS1A 1NX3A 1CFCA 1ZACA 1CB1A 4PE7A 2CXJA 1ZOTB 4HSZA 2WCEA 3BOWB 3O6BA 1BR4B 1CLLA 1XA5A 2PVBA 3LLEA 4JPZB 2QPTA 1NX1A 2OS8B 5AXIA 2O5GA 1QX7A 1JBAA 1BG1A 1DJGA 1UHIA 1HQVA 2I18A 1YUUA 3BOWA 1JSAA 4YGDB 3BUNB 1BLQA 1FI6A 4MBEA 1M45A 4M2OA 1M31A 1XFWO 1TNWA 1IQ5A 4FTGA 3FIAA 1N65A 4AQIA 1PVAA 4ORCB 1CLBA 2COLB 4N1FA 2PALA 1UUSA 1MQ1A 1PRWA 2K7CA 1DVIA 2L98A 1PALA 1TN4A 4YGBB 5ER5A 4WQ3A 2KNEA 3HX4A 1JFKA 1NUBA 1S1EA 2KHNA 2PSRA 1JFJA 1X02A 2CNPA 2KBIA 1A29A 1KFUL 1K8UA 4TNCA 1EH2A 1YVLA 3I5HB 4XYNA 1SBJA 2HF5A 2F2PA 1WDCC 3CLNA 1KCYA 2JTTA 2L4HA 3A8RA 1MXLC 1LKJA 3JVTC 2BL0C 1KSMA 2K7OA 4C0LA 1ALWA 3CR4X 3MSEB 4P5OE 1G8IA 1SR6B 2GGZA 3O4YA 1BT6A 2E30A 2JT8A 1C7WA 1B47A 2NLNA 1F71A 2OPOA 2RGIA 4I5LB 3AKAA 1QV0A 2L0PA 4I5NB 1H4BA 1WRKA 2JU0A 3EKHA 3DVKA 1YUSA 3EKJA 5B8IB 1BU3A 4MZJA 2I7AA 1F55A 4ZCUA 1QLSA 1RFJA 2KQ6A 3KF9A 3PATA 1XFXO 3I5IB 4PE4A 1TIZA 1LA0A 1J7QA 1CTRA 2BE6A 3TDUA 1H8BA 2KFFA 2MJWB 1B1GA 2LLSA 2Q4UA 2HQ8A 1KQVA 2MA2A 1SK6D 1TRFA 1BMOA 2K8MB 3I5GC 2KGBC 1NP8A 3SG6A 1CDPA 3JTDC 1OSAA 4OCIA 2F3YA 4C0JA 2JC2A 5KU1A 4HREE 1EXRA 1KK7Z 2HQWA 1RROA 2M29A 1J7RA 1Y1AA 4FQOA 4P2YB 5DKQA 3ZWHA 4CIDA 3M0WA 4WQ2A 1YR5A 1L2OB 2WORA 2M9GA 3NSLA 1IRJA 1J55A 2KAVA 2ISDA 2NCOA 3IQOA 1W7JB 3WXAA 1A75B 3DVEA 2FJUB 2LVVA 1YVHA 1J7PA 1YTZC 1KK8B 1DJHA 1CDLA 2GV5A 3DF0B 1AVSA 2LANA 3NSOA 2NCPA 4NDDA 5KTYA 2BKIB 4N5XA 2KBMA 2JRFA 1UHNA 3DVMA 1DMOA 4NDBA 3DF0A 2LMTA 1CMFA 1S5GZ 2EC6B 2LVKA 1M63B 3OX5A 1W7IB 2E6WA 1KSOA 3I5FB 3EK8A 3KHEA 1ZUZA 1K90D 2K2FA 4PHNA 1DF0A 1Q80A 4MRXA 3TS5B 3LL8B 3VRRA 3PLFB 4GGNA 1CDNA 1KWOC 1BOCA 1R6PA 1VRKA 1LINA 3FWCA 3QRXA 1SCMB 2MLEC 1J1DA 2BBNA 2LUCA 2QACA 2KSPA 1SMGA 5AERA 1EJ3A 1PSRA 3LK0A 2M97A 1KFXS 1JF2A 5BPJA 1UURA 1MF8B 1G33A 1C7VA 1QLKA 1KK7Y 1UHKA 2JT0A 1NSHA 4R1EA 4GUKA 4M2QA 4DS7A 4UPGA 1MWNA 1K96A 3PALA 3SG2A 3AKBA 2OTGC 3LK1A 4MLWA 3O2PA 1ODBA 3OB1B 1OQPA 2I2RE 4NDCA 2G9BA 3VRPA 5HKWA 4JQ0D 3BQ3A 3C1VA 2M0RA 3DD4A 5J3XA 3SG5A 3ICBA 1YRUB 1ALVA 1EG3A 1BF5A 4Q04A 3GK1A 4MN0A 2K7DA 1M46A 2K2AA 3F45A 1K9UA 1S3PA 1GGWA 2H61C 3PN7B 2F8PA 1S6IA 1AUIB 4PHJA 5I2LA 4DIRA 1NCZA 1RECA 1XFUO 5JJGA 5CSNA 2K7BA 1B8CA 1NYAA 2CT9A 2FCEA 2M1UA 4DCKA 1YUTA 1KFXL 5CSIA 2D8NA 1LXFC 5DKRA 5FYXA 1B7TY 1V1FA 2PASA 3O78A 4ETOA 4D1EA 3OX6A 1HT9A 5K89A 2G2BA 2JPTA 1A2XA 1Y6WA 2LNKA 3EK7A 1M39A 2FCDA 1L7ZA 1B9AA 1AJ5A 2LV7A 1SCVA 1SRAA 3BYAA 2AMIA 1AHRA 4MSPA 3KO0A 2BECA 2L50A 2ZFDA 2EHBA 1GQMA 5AFPA 1SL7A 1JC2A 4PCWA 1K95A 2LM5A 2ZKMX 1ZFSA 1K9PA 1CFFA 4A4BA 1S36A 2Y5IA 1QASA 2KFGA 1R2UA 1B4CA 4YGEB 1WY9A 1S6JA 1WDCB 3WHUB 3NXAA 2BCBA 5AEQA 1D1OA 2CCMA 3BUOB 3IF7A 1K93D 3IQQA 1QVIZ 3BUWB 1NPQA 4GGFC 3SG4A 4QJ3B 1JF0A 3JVTB 2KAXA 1MXEA 2ZRSA 1A03A 1QTXA 1YRTB 2ZN8A 4CFRA 3BUMB 2WOSA 1MUXA 2P6BB 2HPSA 4IL1A 1S26D 2L51A 4OVNF 2EGDA 1IKUA 1UP5A 4GAOA 2KAYA 1TCOB 1DJYA 4MRYA 3CGAA 1AP4A 5HKZA 1QX5B 3BUXB 1N0YA 3H4SE 4GPLB 3KEVA 2Q91A 2ZNEA 1V1GA 1WRZA 4PDZA 3OP0A 3CZTX 5JOLA 1J7OA 1AJ4A 4ORAB 2JXCA 2JT3A 3OB2B 4OV2A 1OE9B 1OMDA 2JWWA 2LHIA 1OOJA 1YX7A 2JXLA 1LVCD 1FI5A 2BCXA 2EC6C 3A4UB 1CM4A 5AANA 5F6TA 1CDMA 1DF0B 2JNXA 2SCPA 1A4PA 1BJFA 3AAJA 3TS5C 2WCBA 2KYCA 3CR5X 2PRUA 4A4CA 1QATA 2LCPA 1C07A 1U5IB 1QS7A 3ZNIA 1SCMC 1XK4C 1K94A 1IH0A 2Y1NA 3D10A 2K61A 2LAPA 2V53A 4F0ZB 3VROA 1CMGA 4YGAA 1U5IA 5ER4X 2KI4C 2DOQA 5D69A 1WLMA 4PALA 2R2IA 2WC8A 1F70A 1PULA 2JZIA 1SL8A 1CNPA 2KFHA 1CLMA 1DJXA 5IBWA 1K9KA 1KQMB 2MRDA 2JULA 1BR1B 3SG3A 1TNXA 1QIVA 2CBLA 2Y4QA 2OS8C 1XFYO 4CFQA 1OMVA 1TNPA 2KYFA 1NX0A 1EG4A 1QIWA 2GGMA 1TTXA 4OKHA 2JQ6A 4GFTA 3E3RA 4CLNA 1DJWA 1KWOB 1JWDA 1ZMZA 1SY9A 1NX2A 3HCMA 3GK4X 3K21A 1XFZO 2JOJA 2ZNDA 2JNFA 2KI6C 4WRIA 3GK2A 3TZ1A 2O60A 3D0YB 1UWOA 4MZLA 2NXQA 1TCFA 2LMUA 2LHLA 4YBHB 2LVJA 5TNCA 4HRGA 1S5GY 2LLUA 3TUYB 1GJYA 3SG7A 1NWDA 2BBMA 3EVVA 3SIBA 3I5HC 3D0YA 1MHOA 3PSRA 3FS7A 1FW4A 4PHKA 1CFPA 1XVJA 1Y1UA 1CFDA 4YGCB 2MBXA 1DTLA 1F54A 2OTGB 3VRQA 1K2HA 4CPVA 4YI8A 2LP3A 2LE9B 1SR6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOT A;  1F4Q A;  1QXP A;  1SL9 A;  4AQJ A;  4ICB A;  5CSJ A;  2WCF A;  1G4Y R;  2A4J A;  2FOT A;  1WLZ A;  2HET A;  5GQQ C;  4DUQ A;  2LP2 A;  1QX2 A;  3CR2 A;  4U8D A;  2MHH A;  4DRW A;  1DJZ A;  4QJ4 B;  2BCA A;  3I5I C;  2MLF C;  4HRH A;  2M7L A;  2PMY A;  1YX8 A;  1OMR A;  1OZS A;  1SPY A;  1WRL A;  5I2Q A;  1E8A A;  1TOP A;  2CTN A;  3NSK A;  4BY5 A;  5HKY A;  2KI6 D;  3SIA A;  2H2K A;  3TDZ A;  2H61 A;  4XJK B;  3TDI A;  5KSZ A;  2F3Z A;  3RLZ A;  4L9M A;  1CM1 A;  2IS9 A;  2AAO A;  1N2D A;  1PK0 D;  1MR8 A;  2LVI A;  4M2P A;  1DJI A;  1NCX A;  4XJK A;  1IJ5 A;  2BL0 B;  2LC5 A;  2ZRT A;  2BE4 A;  3LCP C;  1IQ3 A;  3EK4 A;  4JWQ A;  1XYD A;  3SJS A;  3VRN A;  4BY4 A;  1L2O C;  1IWQ A;  1CKK A;  2KDH A;  2LUX A;  4OR9 B;  1SKT A;  4YRU A;  3BXK A;  1JUO A;  1DGU A;  2Y1M A;  3GOF A;  1UHH A;  2NZ0 A;  1RWY A;  2LLT A;  2M49 B;  2ZN9 A;  1RJV A;  2M8U A;  4MVF A;  1FPW A;  3EVR A;  4MZK A;  2TN4 A;  1YUR A;  1KK8 C;  4NQG A;  1IJ6 A;  2M3W A;  2M1K B;  2WND A;  4I5J A;  1UHJ A;  1J1E A;  1QVI Y;  4ZCV A;  1PSB A;  3CTN A;  4AOM A;  2L4I A;  4E68 A;  1SNL A;  1AK8 A;  3RM1 A;  1NCY A;  3EVU A;  1IGV A;  3I5G B;  4ORB B;  5DKN A;  2SAS A;  3NSI A;  3I5F C;  3JTD B;  3WNX B;  5D7F A;  4GGF A;  4GNK B;  2F2O A;  4N1G A;  3CWG A;  2BKH B;  3KPX A;  4YI9 A;  1RTP 1;  1Y1X A;  3WHT B;  2JTZ A;  4PE0 A;  1S6C A;  1QJT A;  1F8H A;  1LA3 A;  2B1U A;  2L5X B;  5CSF A;  5I8N A;  2K0J A;  4USL A;  3VGO A;  3AAK A;  1B8R A;  2LMV A;  1XFV O;  1A75 A;  4QJ5 B;  3FWB A;  4GBA A;  2KGR A;  1Y0V H;  1KQM C;  2M7N A;  1GGZ A;  2AUC A;  2I94 A;  1B8L A;  1F4O A;  1RK9 A;  1SYM A;  1SW8 A;  3PM8 A;  1XO5 A;  1FF1 A;  5HYD A;  4C0K A;  4MEW A;  5HLV A;  2F33 A;  1QV1 A;  2L2E A;  4PHM A;  1FBV A;  4I5K A;  2VRG A;  1DT7 B;  5CPV A;  5G08 A;  1NIW A;  1DGV A;  1PVB A;  1OZO A;  1B7T Z;  1BOD A;  2MAZ A;  5HLO A;  3OHM B;  1TNQ A;  3PFV A;  4PE1 A;  2KQY A;  5I2O A;  1KFU S;  2KI4 B;  1EL4 A;  1XK4 A;  1IG5 A;  3PN7 C;  3TUY C;  5PAL A;  3DVJ A;  3CS1 A;  1NX3 A;  1CFC A;  1ZAC A;  1CB1 A;  4PE7 A;  2CXJ A;  1ZOT B;  4HSZ A;  2WCE A;  3BOW B;  3O6B A;  1BR4 B;  1CLL A;  1XA5 A;  2PVB A;  3LLE A;  4JPZ B;  2QPT A;  1NX1 A;  2OS8 B;  5AXI A;  2O5G A;  1QX7 A;  1JBA A;  1BG1 A;  1DJG A;  1UHI A;  1HQV A;  2I18 A;  1YUU A;  3BOW A;  1JSA A;  4YGD B;  3BUN B;  1BLQ A;  1FI6 A;  4MBE A;  1M45 A;  4M2O A;  1M31 A;  1XFW O;  1TNW A;  1IQ5 A;  4FTG A;  3FIA A;  1N65 A;  4AQI A;  1PVA A;  4ORC B;  1CLB A;  2COL B;  4N1F A;  2PAL A;  1UUS A;  1MQ1 A;  1PRW A;  2K7C A;  1DVI A;  2L98 A;  1PAL A;  1TN4 A;  4YGB B;  5ER5 A;  4WQ3 A;  2KNE A;  3HX4 A;  1JFK A;  1NUB A;  1S1E A;  2KHN A;  2PSR A;  1JFJ A;  1X02 A;  2CNP A;  2KBI A;  1A29 A;  1KFU L;  1K8U A;  4TNC A;  1EH2 A;  1YVL A;  3I5H B;  4XYN A;  1SBJ A;  2HF5 A;  2F2P A;  1WDC C;  3CLN A;  1KCY A;  2JTT A;  2L4H A;  3A8R A;  1MXL C;  1LKJ A;  3JVT C;  2BL0 C;  1KSM A;  2K7O A;  4C0L A;  1ALW A;  3CR4 X;  3MSE B;  4P5O E;  1G8I A;  1SR6 B;  2GGZ A;  3O4Y A;  1BT6 A;  2E30 A;  2JT8 A;  1C7W A;  1B47 A;  2NLN A;  1F71 A;  2OPO A;  2RGI A;  4I5L B;  3AKA A;  1QV0 A;  2L0P A;  4I5N B;  1H4B A;  1WRK A;  2JU0 A;  3EKH A;  3DVK A;  1YUS A;  3EKJ A;  5B8I B;  1BU3 A;  4MZJ A;  2I7A A;  1F55 A;  4ZCU A;  1QLS A;  1RFJ A;  2KQ6 A;  3KF9 A;  3PAT A;  1XFX O;  3I5I B;  4PE4 A;  1TIZ A;  1LA0 A;  1J7Q A;  1CTR A;  2BE6 A;  3TDU A;  1H8B A;  2KFF A;  2MJW B;  1B1G A;  2LLS A;  2Q4U A;  2HQ8 A;  1KQV A;  2MA2 A;  1SK6 D;  1TRF A;  1BMO A;  2K8M B;  3I5G C;  2KGB C;  1NP8 A;  3SG6 A;  1CDP A;  3JTD C;  1OSA A;  4OCI A;  2F3Y A;  4C0J A;  2JC2 A;  5KU1 A;  4HRE E;  1EXR A;  1KK7 Z;  2HQW A;  1RRO A;  2M29 A;  1J7R A;  1Y1A A;  4FQO A;  4P2Y B;  5DKQ A;  3ZWH A;  4CID A;  3M0W A;  4WQ2 A;  1YR5 A;  1L2O B;  2WOR A;  2M9G A;  3NSL A;  1IRJ A;  1J55 A;  2KAV A;  2ISD A;  2NCO A;  3IQO A;  1W7J B;  3WXA A;  1A75 B;  3DVE A;  2FJU B;  2LVV A;  1YVH A;  1J7P A;  1YTZ C;  1KK8 B;  1DJH A;  1CDL A;  2GV5 A;  3DF0 B;  1AVS A;  2LAN A;  3NSO A;  2NCP A;  4NDD A;  5KTY A;  2BKI B;  4N5X A;  2KBM A;  2JRF A;  1UHN A;  3DVM A;  1DMO A;  4NDB A;  3DF0 A;  2LMT A;  1CMF A;  1S5G Z;  2EC6 B;  2LVK A;  1M63 B;  3OX5 A;  1W7I B;  2E6W A;  1KSO A;  3I5F B;  3EK8 A;  3KHE A;  1ZUZ A;  1K90 D;  2K2F A;  4PHN A;  1DF0 A;  1Q80 A;  4MRX A;  3TS5 B;  3LL8 B;  3VRR A;  3PLF B;  4GGN A;  1CDN A;  1KWO C;  1BOC A;  1R6P A;  1VRK A;  1LIN A;  3FWC A;  3QRX A;  1SCM B;  2MLE C;  1J1D A;  2BBN A;  2LUC A;  2QAC A;  2KSP A;  1SMG A;  5AER A;  1EJ3 A;  1PSR A;  3LK0 A;  2M97 A;  1KFX S;  1JF2 A;  5BPJ A;  1UUR A;  1MF8 B;  1G33 A;  1C7V A;  1QLK A;  1KK7 Y;  1UHK A;  2JT0 A;  1NSH A;  4R1E A;  4GUK A;  4M2Q A;  4DS7 A;  4UPG A;  1MWN A;  1K96 A;  3PAL A;  3SG2 A;  3AKB A;  2OTG C;  3LK1 A;  4MLW A;  3O2P A;  1ODB A;  3OB1 B;  1OQP A;  2I2R E;  4NDC A;  2G9B A;  3VRP A;  5HKW A;  4JQ0 D;  3BQ3 A;  3C1V A;  2M0R A;  3DD4 A;  5J3X A;  3SG5 A;  3ICB A;  1YRU B;  1ALV A;  1EG3 A;  1BF5 A;  4Q04 A;  3GK1 A;  4MN0 A;  2K7D A;  1M46 A;  2K2A A;  3F45 A;  1K9U A;  1S3P A;  1GGW A;  2H61 C;  3PN7 B;  2F8P A;  1S6I A;  1AUI B;  4PHJ A;  5I2L A;  4DIR A;  1NCZ A;  1REC A;  1XFU O;  5JJG A;  5CSN A;  2K7B A;  1B8C A;  1NYA A;  2CT9 A;  2FCE A;  2M1U A;  4DCK A;  1YUT A;  1KFX L;  5CSI A;  2D8N A;  1LXF C;  5DKR A;  5FYX A;  1B7T Y;  1V1F A;  2PAS A;  3O78 A;  4ETO A;  4D1E A;  3OX6 A;  1HT9 A;  5K89 A;  2G2B A;  2JPT A;  1A2X A;  1Y6W A;  2LNK A;  3EK7 A;  1M39 A;  2FCD A;  1L7Z A;  1B9A A;  1AJ5 A;  2LV7 A;  1SCV A;  1SRA A;  3BYA A;  2AMI A;  1AHR A;  4MSP A;  3KO0 A;  2BEC A;  2L50 A;  2ZFD A;  2EHB A;  1GQM A;  5AFP A;  1SL7 A;  1JC2 A;  4PCW A;  1K95 A;  2LM5 A;  2ZKM X;  1ZFS A;  1K9P A;  1CFF A;  4A4B A;  1S36 A;  2Y5I A;  1QAS A;  2KFG A;  1R2U A;  1B4C A;  4YGE B;  1WY9 A;  1S6J A;  1WDC B;  3WHU B;  3NXA A;  2BCB A;  5AEQ A;  1D1O A;  2CCM A;  3BUO B;  3IF7 A;  1K93 D;  3IQQ A;  1QVI Z;  3BUW B;  1NPQ A;  4GGF C;  3SG4 A;  4QJ3 B;  1JF0 A;  3JVT B;  2KAX A;  1MXE A;  2ZRS A;  1A03 A;  1QTX A;  1YRT B;  2ZN8 A;  4CFR A;  3BUM B;  2WOS A;  1MUX A;  2P6B B;  2HPS A;  4IL1 A;  1S26 D;  2L51 A;  4OVN F;  2EGD A;  1IKU A;  1UP5 A;  4GAO A;  2KAY A;  1TCO B;  1DJY A;  4MRY A;  3CGA A;  1AP4 A;  5HKZ A;  1QX5 B;  3BUX B;  1N0Y A;  3H4S E;  4GPL B;  3KEV A;  2Q91 A;  2ZNE A;  1V1G A;  1WRZ A;  4PDZ A;  3OP0 A;  3CZT X;  5JOL A;  1J7O A;  1AJ4 A;  4ORA B;  2JXC A;  2JT3 A;  3OB2 B;  4OV2 A;  1OE9 B;  1OMD A;  2JWW A;  2LHI A;  1OOJ A;  1YX7 A;  2JXL A;  1LVC D;  1FI5 A;  2BCX A;  2EC6 C;  3A4U B;  1CM4 A;  5AAN A;  5F6T A;  1CDM A;  1DF0 B;  2JNX A;  2SCP A;  1A4P A;  1BJF A;  3AAJ A;  3TS5 C;  2WCB A;  2KYC A;  3CR5 X;  2PRU A;  4A4C A;  1QAT A;  2LCP A;  1C07 A;  1U5I B;  1QS7 A;  3ZNI A;  1SCM C;  1XK4 C;  1K94 A;  1IH0 A;  2Y1N A;  3D10 A;  2K61 A;  2LAP A;  2V53 A;  4F0Z B;  3VRO A;  1CMG A;  4YGA A;  1U5I A;  5ER4 X;  2KI4 C;  2DOQ A;  5D69 A;  1WLM A;  4PAL A;  2R2I A;  2WC8 A;  1F70 A;  1PUL A;  2JZI A;  1SL8 A;  1CNP A;  2KFH A;  1CLM A;  1DJX A;  5IBW A;  1K9K A;  1KQM B;  2MRD A;  2JUL A;  1BR1 B;  3SG3 A;  1TNX A;  1QIV A;  2CBL A;  2Y4Q A;  2OS8 C;  1XFY O;  4CFQ A;  1OMV A;  1TNP A;  2KYF A;  1NX0 A;  1EG4 A;  1QIW A;  2GGM A;  1TTX A;  4OKH A;  2JQ6 A;  4GFT A;  3E3R A;  4CLN A;  1DJW A;  1KWO B;  1JWD A;  1ZMZ A;  1SY9 A;  1NX2 A;  3HCM A;  3GK4 X;  3K21 A;  1XFZ O;  2JOJ A;  2ZND A;  2JNF A;  2KI6 C;  4WRI A;  3GK2 A;  3TZ1 A;  2O60 A;  3D0Y B;  1UWO A;  4MZL A;  2NXQ A;  1TCF A;  2LMU A;  2LHL A;  4YBH B;  2LVJ A;  5TNC A;  4HRG A;  1S5G Y;  2LLU A;  3TUY B;  1GJY A;  3SG7 A;  1NWD A;  2BBM A;  3EVV A;  3SIB A;  3I5H C;  3D0Y A;  1MHO A;  3PSR A;  3FS7 A;  1FW4 A;  4PHK A;  1CFP A;  1XVJ A;  1Y1U A;  1CFD A;  4YGC B;  2MBX A;  1DTL A;  1F54 A;  2OTG B;  3VRQ A;  1K2H A;  4CPV A;  4YI8 A;  2LP3 A;  2LE9 B;  1SR6 C; 
#chains in the Genus database with same CATH topology
 2KOT A;  1F4Q A;  1QXP A;  1SL9 A;  1OW4 A;  2JPO A;  4ICB A;  4AQJ A;  5CSJ A;  2WCF A;  1G4Y R;  2A4J A;  2FOT A;  1WLZ A;  2HET A;  5GQQ C;  3S0G A;  4DUQ A;  2LP2 A;  1QX2 A;  3CR2 A;  4U8D A;  2MHH A;  4DRW A;  1DJZ A;  4QJ4 B;  2BCA A;  3L4A A;  3I5I C;  2MLF C;  2YGU A;  4HRH A;  2M7L A;  2PMY A;  1YX8 A;  1OMR A;  1OZS A;  1ORG A;  1SPY A;  1WRL A;  1E8A A;  1TOP A;  2CTN A;  3NSK A;  5FI2 A;  4BY5 A;  2KI6 D;  3SIA A;  5HKY A;  2H2K A;  3TDZ A;  2H61 A;  4XJK B;  3TDI A;  5KSZ A;  2F3Z A;  3DYE A;  3RLZ A;  3VB1 A;  4L9M A;  3SS5 A;  1CM1 A;  2IS9 A;  2AAO A;  3BFB A;  1IIO A;  1N2D A;  2P71 A;  1PK0 D;  1OOI X;  1MR8 A;  2LVI A;  4M2P A;  1DJI A;  1NCX A;  4XJK A;  1IJ5 A;  2BL0 B;  2LC5 A;  2ZRT A;  2BE4 A;  3LCP C;  1IQ3 A;  2GTE A;  3EK4 A;  4JWQ A;  1XYD A;  3SJS A;  3VRN A;  4BY4 A;  1L2O C;  1IWQ A;  1CKK A;  2KDH A;  2LUX A;  4OR9 B;  1SKT A;  4YRU A;  3BXK A;  1JUO A;  1DGU A;  2Y1M A;  3GOF A;  1UHH A;  2NZ0 A;  1RWY A;  2LLT A;  2M49 B;  2ZN9 A;  1RJV A;  2M8U A;  2WCJ A;  4MVF A;  1FPW A;  3EVR A;  4MZK A;  2TN4 A;  1YUR A;  1KK8 C;  4NQG A;  1IJ6 A;  2M3W A;  2M1K B;  2WND A;  3RZS A;  4I5J A;  1UHJ A;  1J1E A;  1QVI Y;  4ZCV A;  1PSB A;  3CTN A;  4AOM A;  2L4I A;  4E68 A;  1SNL A;  1AK8 A;  3RM1 A;  1NCY A;  3EVU A;  1IGV A;  5I94 A;  3I5G B;  4ORB B;  3PM2 A;  5DKN A;  2SAS A;  3NSI A;  3I5F C;  3JTD B;  3WNX B;  5D7F A;  4GGF A;  4GNK B;  2F2O A;  4N1G A;  3CWG A;  2BKH B;  3KPX A;  4YI9 A;  1RTP 1;  1Y1X A;  3WHT B;  2JTZ A;  4PE0 A;  2KLD A;  1S6C A;  1QJT A;  1F8H A;  1LA3 A;  2B1U A;  2L5X B;  5CSF A;  5I8N A;  2K0J A;  4USL A;  3VGO A;  3AAK A;  4FQT A;  2WCL A;  1B8R A;  2LMV A;  1XFV O;  1A75 A;  4QJ5 B;  3FWB A;  4GBA A;  2KGR A;  1Y0V H;  1KQM C;  2M7N A;  1GGZ A;  1P28 A;  2AUC A;  1B8L A;  2I94 A;  3CZ2 A;  1F4O A;  1RK9 A;  1SYM A;  5D3O A;  1SW8 A;  3PM8 A;  1XO5 A;  1FF1 A;  5HYD A;  4C0K A;  3D78 A;  4MEW A;  2F33 A;  1QV1 A;  5HLV A;  2L2E A;  4PHM A;  3UO9 A;  1FBV A;  4I5K A;  2VRG A;  1DT7 B;  3DXL A;  5CPV A;  5G08 A;  1NIW A;  1DGV A;  1PVB A;  1OZO A;  1B7T Z;  1BOD A;  2MAZ A;  5HLO A;  3OHM B;  3B88 A;  1TNQ A;  3PFV A;  4PE1 A;  2KQY A;  5I2O A;  1KFU S;  2KI4 B;  1EL4 A;  1XK4 A;  1IG5 A;  3PN7 C;  3TUY C;  3SS3 A;  5PAL A;  3DVJ A;  3CS1 A;  1NX3 A;  1CFC A;  1ZAC A;  1CB1 A;  4PE7 A;  2CXJ A;  1ZOT B;  4HSZ A;  4INX A;  1DQE A;  2WCE A;  3BOW B;  3O6B A;  1BR4 B;  1CLL A;  1XA5 A;  2PVB A;  3LLE A;  4JPZ B;  2QEV A;  2QPT A;  1NX1 A;  1TWO A;  2OS8 B;  5AXI A;  2O5G A;  1QX7 A;  1JBA A;  1BG1 A;  1DJG A;  1UHI A;  1HQV A;  2I18 A;  1Z2C B;  1YUU A;  3BOW A;  1JSA A;  4YGD B;  3BUN B;  4PT1 A;  1BLQ A;  1FI6 A;  4MBE A;  1M45 A;  4M2O A;  1M31 A;  1XFW O;  1TNW A;  1IQ5 A;  4FTG A;  3CZ0 A;  3FIA A;  1N65 A;  4AQI A;  1PVA A;  4ORC B;  3FE8 A;  1CLB A;  2COL B;  4N1F A;  2PAL A;  1UUS A;  1MQ1 A;  1PRW A;  2K7C A;  1DVI A;  2L98 A;  1PAL A;  1TN4 A;  4YGB B;  3PJI A;  5ER5 A;  3L47 A;  4WQ3 A;  2L2C A;  2KNE A;  3DZT A;  3HX4 A;  1JFK A;  1NUB A;  1S1E A;  2KHN A;  2PSR A;  1JFJ A;  1X02 A;  4IJ7 A;  2CNP A;  2KBI A;  1A29 A;  1KFU L;  1K8U A;  4TNC A;  1EH2 A;  1YVL A;  3I5H B;  4XYN A;  1SBJ A;  2HF5 A;  2F2P A;  1WDC C;  3CLN A;  1KCY A;  3R72 A;  3S0D A;  4INW A;  2JTT A;  2L4H A;  3A8R A;  1MXL C;  1LKJ A;  3JVT C;  2BL0 C;  1KSM A;  2K7O A;  4C0L A;  1ALW A;  3CR4 X;  3MSE B;  4P5O E;  1G8I A;  1SR6 B;  2GGZ A;  3O4Y A;  1BT6 A;  5DIC A;  2ERB A;  2E30 A;  2JT8 A;  1C7W A;  2P70 A;  1B47 A;  2NLN A;  1F71 A;  2OPO A;  2RGI A;  4I5L B;  3AKA A;  1QV0 A;  2L0P A;  3NGV A;  4I5N B;  1H4B A;  1WRK A;  2JU0 A;  3EKH A;  3DVK A;  1YUS A;  3EKJ A;  5B8I B;  1BU3 A;  4MZJ A;  2I7A A;  1F55 A;  4ZCU A;  1QLS A;  1RFJ A;  2KQ6 A;  3KF9 A;  3PAT A;  1XFX O;  3B6X A;  3I5I B;  3CDN A;  4PE4 A;  1TIZ A;  1LA0 A;  1DC1 A;  1J7Q A;  3NHT A;  1CTR A;  4JKT A;  2BE6 A;  3TDU A;  1H8B A;  2KFF A;  2MJW B;  1B1G A;  2LLS A;  2Q4U A;  2HQ8 A;  1KQV A;  2MA2 A;  1SK6 D;  1TRF A;  1BMO A;  2K8M B;  3I5G C;  2KGB C;  2QEO A;  3R1O A;  2FJY A;  1NP8 A;  3FE9 A;  1CDP A;  3SG6 A;  3JTD C;  1OSA A;  4OCI A;  2F3Y A;  4C0J A;  2JC2 A;  5KU1 A;  4HRE E;  1EXR A;  1KK7 Z;  2HQW A;  1RRO A;  2M29 A;  1J7R A;  1Y1A A;  4FQO A;  4P2Y B;  5DKQ A;  3ZWH A;  4CID A;  3M0W A;  4WQ2 A;  1YR5 A;  1L2O B;  2WOR A;  3Q8I A;  2M9G A;  3NSL A;  1GM0 A;  1IRJ A;  3BFH A;  1J55 A;  2KAV A;  2ISD A;  2NCO A;  3D75 A;  1W7J B;  2WCH A;  3IQO A;  3WXA A;  1A75 B;  3DVE A;  2FJU B;  2LVV A;  1YVH A;  1J7P A;  1YTZ C;  1KK8 B;  1DJH A;  1TUJ A;  1CDL A;  2GV5 A;  3DF0 B;  3N7H A;  1AVS A;  2LAN A;  2WCM A;  3NSO A;  4KYN A;  2NCP A;  4NDD A;  5KTY A;  1SSE B;  2BKI B;  4N5X A;  2KBM A;  2JRF A;  2WC5 A;  1DEK A;  1UHN A;  3S0E A;  3DVM A;  1DMO A;  4NDB A;  3D73 A;  3DF0 A;  2LMT A;  3CYZ A;  1CMF A;  1S5G Z;  3V2L A;  2EC6 B;  2LVK A;  1M63 B;  3OX5 A;  1W7I B;  2E6W A;  1KSO A;  3UNW A;  1LS8 A;  3I5F B;  3EK8 A;  3KHE A;  1ZUZ A;  1K90 D;  2K2F A;  4PHN A;  1DF0 A;  1Q80 A;  3R1P A;  4MRX A;  3TS5 B;  3LL8 B;  3VRR A;  3PLF B;  4GGN A;  1CDN A;  1KWO C;  1BOC A;  1R6P A;  1VRK A;  1LIN A;  3FWC A;  2PYQ A;  3QRX A;  1SCM B;  2MLE C;  1J1D A;  2BBN A;  2LUC A;  2QAC A;  2KSP A;  1SMG A;  5AER A;  3S0A A;  1EJ3 A;  1PSR A;  2BNX A;  3LK0 A;  2M97 A;  1KFX S;  1JF2 A;  5BPJ A;  1UUR A;  1MF8 B;  1G33 A;  3BJH A;  1C7V A;  1QLK A;  1KK7 Y;  1UHK A;  2JT0 A;  1NSH A;  3D74 A;  4R1E A;  4GUK A;  4M2Q A;  4DS7 A;  4UPG A;  1MWN A;  1K96 A;  3PAL A;  3SG2 A;  2BAP A;  2OTG C;  3AKB A;  3LK1 A;  3O2P A;  1ODB A;  3OB1 B;  4MLW A;  1OQP A;  2I2R E;  3B7A A;  4NDC A;  2G9B A;  5FI7 A;  3SS4 A;  5HKW A;  3VRP A;  3QME A;  4JQ0 D;  3BQ3 A;  3C1V A;  2M0R A;  3DD4 A;  5J3X A;  3SG5 A;  3ICB A;  1YRU B;  1ALV A;  1EG3 A;  1BF5 A;  4Q04 A;  3GK1 A;  4MN0 A;  2K7D A;  1M46 A;  2K2A A;  3F45 A;  1K9U A;  1S3P A;  1GGW A;  3OGN A;  2WCK A;  2QEH A;  2H61 C;  3PN7 B;  2F8P A;  1S6I A;  1AUI B;  4PHJ A;  5I2L A;  4DIR A;  1NCZ A;  1REC A;  1XFU O;  5JJG A;  5CSN A;  2K7B A;  1B8C A;  1NYA A;  4OZD A;  2CT9 A;  2FCE A;  2M1U A;  3B86 A;  4DCK A;  1YUT A;  1KFX L;  5CSI A;  2D8N A;  1LXF C;  5DKR A;  5FYX A;  1B7T Y;  1V1F A;  2PAS A;  3O78 A;  4ETO A;  4D1E A;  3OX6 A;  1HT9 A;  5K89 A;  2G2B A;  2JPT A;  1A2X A;  1Y6W A;  2LNK A;  3EK7 A;  1M39 A;  2FCD A;  1L7Z A;  1B9A A;  1AJ5 A;  2LV7 A;  1SCV A;  1SRA A;  3BYA A;  2AMI A;  1AHR A;  4MSP A;  3KO0 A;  2BEC A;  2L50 A;  2ZFD A;  2EHB A;  1GQM A;  4JD9 A;  5AFP A;  1SL7 A;  1JC2 A;  1OOF A;  3IVT A;  4PCW A;  1K95 A;  2LM5 A;  3EG5 B;  2ZKM X;  3D76 A;  1ZFS A;  1K9P A;  1CFF A;  4A4B A;  1S36 A;  2Y5I A;  1QAS A;  2KFG A;  5EL2 A;  1R2U A;  1B4C A;  4YGE B;  1QWV A;  1S6J A;  1WDC B;  1WY9 A;  3NXA A;  3WHU B;  2BCB A;  5AEQ A;  1D1O A;  2CCM A;  3BUO B;  3IF7 A;  1K93 D;  1Z4H A;  1QVI Z;  3BUW B;  3IQQ A;  1NPQ A;  4GGF C;  3SG4 A;  2QEB A;  1JF0 A;  1XFR A;  3B87 A;  4QJ3 B;  3JVT B;  2KAX A;  1MXE A;  2ZRS A;  3D77 A;  1A03 A;  1QTX A;  1YRT B;  2ZN8 A;  4CFR A;  3BUM B;  2WOS A;  1MUX A;  2P6B B;  2HPS A;  4IL1 A;  1S26 D;  2L51 A;  1C3Z A;  2EGD A;  4OVN F;  1IKU A;  1UP5 A;  4GAO A;  2KAY A;  1TCO B;  1DJY A;  4MRY A;  3CGA A;  1AP4 A;  3NHI A;  1DEL A;  5HKZ A;  1QX5 B;  3BUX B;  1N0Y A;  3H4S E;  4GPL B;  3KEV A;  2Q91 A;  2ZNE A;  1OOH A;  3BFA A;  1V1G A;  1WRZ A;  3OBV A;  4PDZ A;  3OP0 A;  3CZT X;  5JOL A;  1J7O A;  1AJ4 A;  4ORA B;  2JXC A;  2JT3 A;  3OB2 B;  4OV2 A;  1OE9 B;  1OMD A;  2JWW A;  2LHI A;  1OOJ A;  1YX7 A;  2JXL A;  1LVC D;  1FI5 A;  2BCX A;  2EC6 C;  3A4U B;  1CM4 A;  5AAN A;  2KLE A;  5F6T A;  1CDM A;  1DF0 B;  2JNX A;  2SCP A;  1A4P A;  1BJF A;  3AAJ A;  3TS5 C;  2WCB A;  2KYC A;  3CR5 X;  2K60 A;  2PRU A;  1QAT A;  2LCP A;  4A4C A;  1C07 A;  1U5I B;  1QS7 A;  3ZNI A;  3L4L A;  1SCM C;  3DY9 A;  1XK4 C;  1K94 A;  1W9Z A;  2H8V A;  2Y1N A;  1IH0 A;  1OOG A;  3D10 A;  2K61 A;  2LAP A;  2V53 A;  4F0Z B;  3VRO A;  1CMG A;  4YGA A;  1U5I A;  5ER4 X;  2KI4 C;  2DOQ A;  5D69 A;  5I2Q A;  1WLM A;  4PAL A;  2R2I A;  2WC8 A;  5HL1 A;  1F70 A;  2L5Y A;  1PUL A;  3R1V A;  2JZI A;  1SL8 A;  1CNP A;  2KFH A;  1T14 A;  1CLM A;  1DJX A;  5IBW A;  1K9K A;  1KQM B;  2MRD A;  2JUL A;  1BR1 B;  3SG3 A;  5FI6 A;  3FE6 A;  1TNX A;  1QIV A;  2CBL A;  2Y4Q A;  2OS8 C;  1XFY O;  4CFQ A;  1OMV A;  1TNP A;  2KYF A;  1NX0 A;  1EG4 A;  1QIW A;  2GGM A;  1TTX A;  3CAB A;  4OKH A;  3S0B A;  2JQ6 A;  4GFT A;  3E3R A;  4CLN A;  1DJW A;  1KWO B;  1JWD A;  3O4X A;  1ZMZ A;  1SY9 A;  1NX2 A;  3HCM A;  3GK4 X;  3K21 A;  1XFZ O;  2JOJ A;  2ZND A;  2JNF A;  2KI6 C;  2WC6 A;  4WRI A;  3GK2 A;  2KPH A;  3TZ1 A;  2O60 A;  3CZ1 A;  3D0Y B;  1UWO A;  4MZL A;  2NXQ A;  1TCF A;  2QDI A;  2LMU A;  2LHL A;  4YBH B;  2LVJ A;  5TNC A;  1TUZ A;  1S5G Y;  2LLU A;  4HRG A;  3TUY B;  1GJY A;  3SG7 A;  1NWD A;  2BBM A;  3EVV A;  3SIB A;  3I5H C;  3D0Y A;  1MHO A;  1C3Y A;  3PSR A;  3FS7 A;  3K1E A;  1FW4 A;  4PHK A;  1CFP A;  1XVJ A;  4F7F A;  1Y1U A;  1CFD A;  4YGC B;  2MBX A;  1DTL A;  1F54 A;  2PQL A;  3S0F A;  2OTG B;  3VRQ A;  1K2H A;  4CPV A;  4YI8 A;  2LP3 A;  2LE9 B;  1SR6 C; 
#chains in the Genus database with same CATH homology
 2KOT A;  1F4Q A;  1QXP A;  1SL9 A;  4AQJ A;  4ICB A;  5CSJ A;  2WCF A;  1G4Y R;  2A4J A;  2FOT A;  1WLZ A;  2HET A;  5GQQ C;  4DUQ A;  2LP2 A;  1QX2 A;  3CR2 A;  4U8D A;  2MHH A;  4DRW A;  1DJZ A;  4QJ4 B;  2BCA A;  3I5I C;  2MLF C;  4HRH A;  2M7L A;  2PMY A;  1YX8 A;  1OMR A;  1OZS A;  1SPY A;  1WRL A;  5I2Q A;  1E8A A;  1TOP A;  2CTN A;  3NSK A;  4BY5 A;  5HKY A;  2KI6 D;  3SIA A;  2H2K A;  3TDZ A;  2H61 A;  4XJK B;  3TDI A;  5KSZ A;  2F3Z A;  3RLZ A;  4L9M A;  1CM1 A;  2IS9 A;  2AAO A;  1N2D A;  1PK0 D;  1MR8 A;  2LVI A;  4M2P A;  1DJI A;  1NCX A;  4XJK A;  1IJ5 A;  2BL0 B;  2LC5 A;  2ZRT A;  2BE4 A;  3LCP C;  1IQ3 A;  3EK4 A;  4JWQ A;  1XYD A;  3SJS A;  3VRN A;  4BY4 A;  1L2O C;  1IWQ A;  1CKK A;  2KDH A;  2LUX A;  4OR9 B;  1SKT A;  4YRU A;  3BXK A;  1JUO A;  1DGU A;  2Y1M A;  3GOF A;  1UHH A;  2NZ0 A;  1RWY A;  2LLT A;  2M49 B;  2ZN9 A;  1RJV A;  2M8U A;  4MVF A;  1FPW A;  3EVR A;  4MZK A;  2TN4 A;  1YUR A;  1KK8 C;  4NQG A;  1IJ6 A;  2M3W A;  2M1K B;  2WND A;  4I5J A;  1UHJ A;  1J1E A;  1QVI Y;  4ZCV A;  1PSB A;  3CTN A;  4AOM A;  2L4I A;  4E68 A;  1SNL A;  1AK8 A;  3RM1 A;  1NCY A;  3EVU A;  1IGV A;  3I5G B;  4ORB B;  5DKN A;  2SAS A;  3NSI A;  3I5F C;  3JTD B;  3WNX B;  5D7F A;  4GGF A;  4GNK B;  2F2O A;  4N1G A;  3CWG A;  2BKH B;  3KPX A;  4YI9 A;  1RTP 1;  1Y1X A;  3WHT B;  2JTZ A;  4PE0 A;  1S6C A;  1QJT A;  1F8H A;  1LA3 A;  2B1U A;  2L5X B;  5CSF A;  5I8N A;  2K0J A;  4USL A;  3VGO A;  3AAK A;  1B8R A;  2LMV A;  1XFV O;  1A75 A;  4QJ5 B;  3FWB A;  4GBA A;  2KGR A;  1Y0V H;  1KQM C;  2M7N A;  1GGZ A;  2AUC A;  2I94 A;  1B8L A;  1F4O A;  1RK9 A;  1SYM A;  1SW8 A;  3PM8 A;  1XO5 A;  1FF1 A;  5HYD A;  4C0K A;  4MEW A;  5HLV A;  2F33 A;  1QV1 A;  2L2E A;  4PHM A;  1FBV A;  4I5K A;  2VRG A;  1DT7 B;  5CPV A;  5G08 A;  1NIW A;  1DGV A;  1PVB A;  1OZO A;  1B7T Z;  1BOD A;  2MAZ A;  5HLO A;  3OHM B;  1TNQ A;  3PFV A;  4PE1 A;  2KQY A;  5I2O A;  1KFU S;  2KI4 B;  1EL4 A;  1XK4 A;  1IG5 A;  3PN7 C;  3TUY C;  5PAL A;  3DVJ A;  3CS1 A;  1NX3 A;  1CFC A;  1ZAC A;  1CB1 A;  4PE7 A;  2CXJ A;  1ZOT B;  4HSZ A;  2WCE A;  3BOW B;  3O6B A;  1BR4 B;  1CLL A;  1XA5 A;  2PVB A;  3LLE A;  4JPZ B;  2QPT A;  1NX1 A;  2OS8 B;  5AXI A;  2O5G A;  1QX7 A;  1JBA A;  1BG1 A;  1DJG A;  1UHI A;  1HQV A;  2I18 A;  1YUU A;  3BOW A;  1JSA A;  4YGD B;  3BUN B;  1BLQ A;  1FI6 A;  4MBE A;  1M45 A;  4M2O A;  1M31 A;  1XFW O;  1TNW A;  1IQ5 A;  4FTG A;  3FIA A;  1N65 A;  4AQI A;  1PVA A;  4ORC B;  1CLB A;  2COL B;  4N1F A;  2PAL A;  1UUS A;  1MQ1 A;  1PRW A;  2K7C A;  1DVI A;  2L98 A;  1PAL A;  1TN4 A;  4YGB B;  5ER5 A;  4WQ3 A;  2KNE A;  3HX4 A;  1JFK A;  1NUB A;  1S1E A;  2KHN A;  2PSR A;  1JFJ A;  1X02 A;  2CNP A;  2KBI A;  1A29 A;  1KFU L;  1K8U A;  4TNC A;  1EH2 A;  1YVL A;  3I5H B;  4XYN A;  1SBJ A;  2HF5 A;  2F2P A;  1WDC C;  3CLN A;  1KCY A;  2JTT A;  2L4H A;  3A8R A;  1MXL C;  1LKJ A;  3JVT C;  2BL0 C;  1KSM A;  2K7O A;  4C0L A;  1ALW A;  3CR4 X;  3MSE B;  4P5O E;  1G8I A;  1SR6 B;  2GGZ A;  3O4Y A;  1BT6 A;  2E30 A;  2JT8 A;  1C7W A;  1B47 A;  2NLN A;  1F71 A;  2OPO A;  2RGI A;  4I5L B;  3AKA A;  1QV0 A;  2L0P A;  4I5N B;  1H4B A;  1WRK A;  2JU0 A;  3EKH A;  3DVK A;  1YUS A;  3EKJ A;  5B8I B;  1BU3 A;  4MZJ A;  2I7A A;  1F55 A;  4ZCU A;  1QLS A;  1RFJ A;  2KQ6 A;  3KF9 A;  3PAT A;  1XFX O;  3I5I B;  4PE4 A;  1TIZ A;  1LA0 A;  1J7Q A;  1CTR A;  2BE6 A;  3TDU A;  1H8B A;  2KFF A;  2MJW B;  1B1G A;  2LLS A;  2Q4U A;  2HQ8 A;  1KQV A;  2MA2 A;  1SK6 D;  1TRF A;  1BMO A;  2K8M B;  3I5G C;  2KGB C;  1NP8 A;  3SG6 A;  1CDP A;  3JTD C;  1OSA A;  4OCI A;  2F3Y A;  4C0J A;  2JC2 A;  5KU1 A;  4HRE E;  1EXR A;  1KK7 Z;  2HQW A;  1RRO A;  2M29 A;  1J7R A;  1Y1A A;  4FQO A;  4P2Y B;  5DKQ A;  3ZWH A;  4CID A;  3M0W A;  4WQ2 A;  1YR5 A;  1L2O B;  2WOR A;  2M9G A;  3NSL A;  1IRJ A;  1J55 A;  2KAV A;  2ISD A;  2NCO A;  3IQO A;  1W7J B;  3WXA A;  1A75 B;  3DVE A;  2FJU B;  2LVV A;  1YVH A;  1J7P A;  1YTZ C;  1KK8 B;  1DJH A;  1CDL A;  2GV5 A;  3DF0 B;  1AVS A;  2LAN A;  3NSO A;  2NCP A;  4NDD A;  5KTY A;  2BKI B;  4N5X A;  2KBM A;  2JRF A;  1UHN A;  3DVM A;  1DMO A;  4NDB A;  3DF0 A;  2LMT A;  1CMF A;  1S5G Z;  2EC6 B;  2LVK A;  1M63 B;  3OX5 A;  1W7I B;  2E6W A;  1KSO A;  3I5F B;  3EK8 A;  3KHE A;  1ZUZ A;  1K90 D;  2K2F A;  4PHN A;  1DF0 A;  1Q80 A;  4MRX A;  3TS5 B;  3LL8 B;  3VRR A;  3PLF B;  4GGN A;  1CDN A;  1KWO C;  1BOC A;  1R6P A;  1VRK A;  1LIN A;  3FWC A;  3QRX A;  1SCM B;  2MLE C;  1J1D A;  2BBN A;  2LUC A;  2QAC A;  2KSP A;  1SMG A;  5AER A;  1EJ3 A;  1PSR A;  3LK0 A;  2M97 A;  1KFX S;  1JF2 A;  5BPJ A;  1UUR A;  1MF8 B;  1G33 A;  1C7V A;  1QLK A;  1KK7 Y;  1UHK A;  2JT0 A;  1NSH A;  4R1E A;  4GUK A;  4M2Q A;  4DS7 A;  4UPG A;  1MWN A;  1K96 A;  3PAL A;  3SG2 A;  3AKB A;  2OTG C;  3LK1 A;  4MLW A;  3O2P A;  1ODB A;  3OB1 B;  1OQP A;  2I2R E;  4NDC A;  2G9B A;  3VRP A;  5HKW A;  4JQ0 D;  3BQ3 A;  3C1V A;  2M0R A;  3DD4 A;  5J3X A;  3SG5 A;  3ICB A;  1YRU B;  1ALV A;  1EG3 A;  1BF5 A;  4Q04 A;  3GK1 A;  4MN0 A;  2K7D A;  1M46 A;  2K2A A;  3F45 A;  1K9U A;  1S3P A;  1GGW A;  2H61 C;  3PN7 B;  2F8P A;  1S6I A;  1AUI B;  4PHJ A;  5I2L A;  4DIR A;  1NCZ A;  1REC A;  1XFU O;  5JJG A;  5CSN A;  2K7B A;  1B8C A;  1NYA A;  2CT9 A;  2FCE A;  2M1U A;  4DCK A;  1YUT A;  1KFX L;  5CSI A;  2D8N A;  1LXF C;  5DKR A;  5FYX A;  1B7T Y;  1V1F A;  2PAS A;  3O78 A;  4ETO A;  4D1E A;  3OX6 A;  1HT9 A;  5K89 A;  2G2B A;  2JPT A;  1A2X A;  1Y6W A;  2LNK A;  3EK7 A;  1M39 A;  2FCD A;  1L7Z A;  1B9A A;  1AJ5 A;  2LV7 A;  1SCV A;  1SRA A;  3BYA A;  2AMI A;  1AHR A;  4MSP A;  3KO0 A;  2BEC A;  2L50 A;  2ZFD A;  2EHB A;  1GQM A;  5AFP A;  1SL7 A;  1JC2 A;  4PCW A;  1K95 A;  2LM5 A;  2ZKM X;  1ZFS A;  1K9P A;  1CFF A;  4A4B A;  1S36 A;  2Y5I A;  1QAS A;  2KFG A;  1R2U A;  1B4C A;  4YGE B;  1WY9 A;  1S6J A;  1WDC B;  3WHU B;  3NXA A;  2BCB A;  5AEQ A;  1D1O A;  2CCM A;  3BUO B;  3IF7 A;  1K93 D;  3IQQ A;  1QVI Z;  3BUW B;  1NPQ A;  4GGF C;  3SG4 A;  4QJ3 B;  1JF0 A;  3JVT B;  2KAX A;  1MXE A;  2ZRS A;  1A03 A;  1QTX A;  1YRT B;  2ZN8 A;  4CFR A;  3BUM B;  2WOS A;  1MUX A;  2P6B B;  2HPS A;  4IL1 A;  1S26 D;  2L51 A;  4OVN F;  2EGD A;  1IKU A;  1UP5 A;  4GAO A;  2KAY A;  1TCO B;  1DJY A;  4MRY A;  3CGA A;  1AP4 A;  5HKZ A;  1QX5 B;  3BUX B;  1N0Y A;  3H4S E;  4GPL B;  3KEV A;  2Q91 A;  2ZNE A;  1V1G A;  1WRZ A;  4PDZ A;  3OP0 A;  3CZT X;  5JOL A;  1J7O A;  1AJ4 A;  4ORA B;  2JXC A;  2JT3 A;  3OB2 B;  4OV2 A;  1OE9 B;  1OMD A;  2JWW A;  2LHI A;  1OOJ A;  1YX7 A;  2JXL A;  1LVC D;  1FI5 A;  2BCX A;  2EC6 C;  3A4U B;  1CM4 A;  5AAN A;  5F6T A;  1CDM A;  1DF0 B;  2JNX A;  2SCP A;  1A4P A;  1BJF A;  3AAJ A;  3TS5 C;  2WCB A;  2KYC A;  3CR5 X;  2PRU A;  4A4C A;  1QAT A;  2LCP A;  1C07 A;  1U5I B;  1QS7 A;  3ZNI A;  1SCM C;  1XK4 C;  1K94 A;  1IH0 A;  2Y1N A;  3D10 A;  2K61 A;  2LAP A;  2V53 A;  4F0Z B;  3VRO A;  1CMG A;  4YGA A;  1U5I A;  5ER4 X;  2KI4 C;  2DOQ A;  5D69 A;  1WLM A;  4PAL A;  2R2I A;  2WC8 A;  1F70 A;  1PUL A;  2JZI A;  1SL8 A;  1CNP A;  2KFH A;  1CLM A;  1DJX A;  5IBW A;  1K9K A;  1KQM B;  2MRD A;  2JUL A;  1BR1 B;  3SG3 A;  1TNX A;  1QIV A;  2CBL A;  2Y4Q A;  2OS8 C;  1XFY O;  4CFQ A;  1OMV A;  1TNP A;  2KYF A;  1NX0 A;  1EG4 A;  1QIW A;  2GGM A;  1TTX A;  4OKH A;  2JQ6 A;  4GFT A;  3E3R A;  4CLN A;  1DJW A;  1KWO B;  1JWD A;  1ZMZ A;  1SY9 A;  1NX2 A;  3HCM A;  3GK4 X;  3K21 A;  1XFZ O;  2JOJ A;  2ZND A;  2JNF A;  2KI6 C;  4WRI A;  3GK2 A;  3TZ1 A;  2O60 A;  3D0Y B;  1UWO A;  4MZL A;  2NXQ A;  1TCF A;  2LMU A;  2LHL A;  4YBH B;  2LVJ A;  5TNC A;  4HRG A;  1S5G Y;  2LLU A;  3TUY B;  1GJY A;  3SG7 A;  1NWD A;  2BBM A;  3EVV A;  3SIB A;  3I5H C;  3D0Y A;  1MHO A;  3PSR A;  3FS7 A;  1FW4 A;  4PHK A;  1CFP A;  1XVJ A;  1Y1U A;  1CFD A;  4YGC B;  2MBX A;  1DTL A;  1F54 A;  2OTG B;  3VRQ A;  1K2H A;  4CPV A;  4YI8 A;  2LP3 A;  2LE9 B;  1SR6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...