4N1GA

Crystal structure of ca(2+)- discharged f88y obelin mutant from obelia longissima at 1.50 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
194
structure length
194
Chain Sequence
b'ASKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQYLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Crystal structures of the F88Y obelin mutant before and after bioluminescence provide molecular insight into spectral tuning among hydromedusan photoproteins
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 88
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4n1gA00
4UPGA 4QJ3B 1QIVA 4MVFA 1UHKA 4GAOA 2F8PA 5G08A 1K8UA 4CLNA 4CFQA 2Y4QA 1IQ3A 3AAKA 1UHIA 2GGZA 2M8UA 4DS7A 1NX0A 3GOFA 1PVAA 4M2PA 1QASA 1BG1A 1CMGA 4XYNA 2LMVA 1F54A 1W7IB 2G2BA 2BCXA 4R1EA 3A8RA 2CNPA 2JC2A 2KI4C 5JJGA 2LP2A 3SIBA 1ZACA 1CDPA 2CCMA 1NX2A 1L2OB 1IJ6A 4PHKA 3CTNA 4M2QA 1SPYA 5D7FA 3OB1B 5D69A 1UP5A 1NPQA 2KI6C 3HX4A 3BUOB 1GJYA 3SG4A 1QXPA 4MZJA 3NSKA 2JNXA 1GGZA 1WRKA 3EK7A 1WLMA 1M39A 3DVJA 5AERA 4ICBA 1J7RA 4NDDA 1Y6WA 3CR4X 2L50A 2KOTA 3QRXA 1LXFC 2LP3A 2EHBA 1L2OC 2NXQA 1IG5A 2DOQA 5CSNA 1J7QA 1F71A 1PSRA 3OX6A 4JPZB 3EKHA 1SRAA 1ZUZA 2O60A 1C7WA 1UHHA 2L51A 3NSIA 1AK8A 2PVBA 2QPTA 1OMRA 1KSOA 4ORBB 3KHEA 5KSZA 5ER5A 2LMUA 1XA5A 1BOCA 1A2XA 2NCPA 2R2IA 2K7OA 2ZN9A 1SBJA 3VGOA 4GPLB 2V53A 3BOWA 4ORCB 4YGCB 1B8CA 4AQIA 1QVIY 1RK9A 1M45A 2KAVA 3NXAA 3FWBA 2WCEA 2M49B 3LK0A 4C0LA 1MF8B 1TRFA 1Y1UA 4YI9A 1N0YA 1IKUA 3WHTB 1OOJA 1V1GA 3AAJA 3TUYB 1S5GY 1QV0A 1WRZA 1CM1A 1KFUL 2PALA 2M29A 2LHIA 1B9AA 3KEVA 1J55A 3CZTX 1Y1XA 1K9PA 2FCEA 2IS9A 1AVSA 1B4CA 2KAYA 2LM5A 1CB1A 4M2OA 3RLZA 2JPTA 1D1OA 5CSJA 1B47A 1Q80A 2FJUB 1B7TY 2KYCA 1J7OA 4JQ0D 1FBVA 2BKIB 1H4BA 2F2PA 5HKWA 3TUYC 1XFUO 3EVUA 2E6WA 3TDIA 1TNXA 2G9BA 2BL0B 2LV7A 2OTGB 2LVVA 2Y5IA 2ZFDA 3BUWB 3GK4X 1WRLA 5FYXA 3TS5B 3BQ3A 1QVIZ 3I5GB 2I2RE 4CPVA 1S26D 3LK1A 4C0KA 2M3WA 1S36A 3LCPC 1A75A 4MSPA 1TOPA 1QLSA 2NZ0A 3O2PA 5J3XA 3O6BA 4MN0A 1GGWA 1A29A 3AKAA 2KYFA 2BL0C 1YUUA 1KFUS 1HT9A 3SG3A 3IQOA 2OTGC 1FI6A 2JT8A 4PE1A 2WNDA 2B1UA 3PALA 1QJTA 3DD4A 3TS5C 2LVJA 1AUIB 3I5GC 2KQYA 4GGNA 3VRPA 2JULA 2K2FA 1BLQA 1TTXA 4YGDB 3EK8A 1OMVA 4MRXA 1C07A 2I7AA 1A75B 1QX7A 1WDCC 1DJWA 5HYDA 3CS1A 1M46A 1PALA 2F33A 2KI6D 2LAPA 3DF0B 1G33A 2AMIA 1CFDA 2K2AA 1BT6A 1SKTA 1K95A 1C7VA 1YX7A 2PMYA 1MXLC 3EVVA 3VROA 3GK1A 3CLNA 3M0WA 1E8AA 4A4CA 1CLLA 3WXAA 1F4OA 2M7NA 1X02A 2KHNA 3TDZA 2WC8A 2FCDA 3TDUA 2COLB 1TCFA 3A4UB 1L7ZA 3E3RA 2LLTA 1RECA 2D8NA 1CDNA 1YVLA 3F45A 5AEQA 5HLOA 2ZRSA 2HETA 4JWQA 3VRQA 1YVHA 2KSPA 1K2HA 1FI5A 2L4IA 1NIWA 4PCWA 5I8NA 1SCVA 1PVBA 1XFYO 1KFXL 2WOSA 3HCMA 3WHUB 1A4PA 1U5IA 1DF0A 2JXLA 5I2LA 2K0JA 2JWWA 1M31A 1XYDA 2CBLA 1LA0A 3ICBA 1IJ5A 1AJ4A 1FW4A 2K7DA 1LINA 4I5NB 1PK0D 2PRUA 4TNCA 5KU1A 1NWDA 2MA2A 1OQPA 2F3YA 1K9UA 3SG2A 2ZNDA 1DJYA 2P6BB 2LVIA 1SCMB 5PALA 1JF2A 1CKKA 1ZMZA 4GGFA 2JRFA 2BBMA 1PSBA 1CFPA 2JNFA 1DF0B 3EVRA 1YR5A 1R6PA 3SJSA 1RWYA 1XK4A 2CXJA 3VRRA 1AJ5A 1WY9A 1DJGA 3RM1A 5BPJA 2LVKA 5TNCA 1Y0VH 1QATA 1S6JA 4IL1A 1BF5A 2BCBA 4GBAA 1DTLA 2KBMA 1ODBA 1SCMC 1YRTB 1S6IA 4PE7A 2KGRA 1H8BA 1AHRA 3CGAA 1YX8A 2JXCA 1R2UA 3BOWB 2O5GA 1IH0A 1BU3A 2ZNEA 1SW8A 1B8RA 1KK7Y 1KWOB 1PULA 4A4BA 2WORA 4BY5A 3TZ1A 3CR2A 2ZKMX 1JFJA 4XJKA 1TCOB 1GQMA 2M1UA 4WQ3A 1YRUB 1Y1AA 1NX3A 3DVEA 4GGFC 3JVTB 1OMDA 2NLNA 3CR5X 1YURA 3LLEA 4WRIA 3KO0A 2LLSA 1XK4C 2KDHA 3OX5A 1BR4B 2MHHA 4OVNF 4YI8A 1KWOC 2M7LA 3PFVA 1JSAA 3SG6A 2M9GA 3SIAA 2JTTA 1NX1A 1AP4A 1PRWA 1F4QA 1KSMA 3IQQA 5I2QA 4PHJA 5HLVA 5AFPA 1FPWA 2K8MB 4MBEA 1N65A 2MRDA 4PALA 1WDCB 1DVIA 2JZIA 1QTXA 4N1GA 5K89A 1S5GZ 3JVTC 4MEWA 1UHJA 2HQ8A 2JQ6A 1NCZA 1OE9B 4CIDA 1EG4A 4YRUA 1KQVA 3PATA 1UWOA 3BXKA 4BY4A 1CMFA 1S3PA 2EGDA 1YTZC 1LVCD 2EC6B 1JBAA 4GNKB 4HREE 1XFVO 1SNLA 1KK8B 2WCFA 4U8DA 1SY9A 1B7TZ 1SL9A 1XO5A 3SG7A 2KFFA 2LCPA 2Q91A 1DGVA 2OS8B 3KPXA 3NSOA 1EG3A 1B8LA 1UHNA 2MAZA 4FQOA 1K94A 2KFGA 1DJXA 3JTDB 4ORAB 1KQMC 4PHMA 2EC6C 4QJ4B 3H4SE 5F6TA 1YUSA 2BBNA 3PSRA 3DVKA 3LL8B 1KK8C 4E68A 2K61A 1NCXA 1W7JB 1XVJA 3GK2A 4D1EA 1IRJA 1NCYA 2BCAA 5ER4X 3D10A 1J7PA 4WQ2A 2OS8C 2HPSA 3I5IB 2L2EA 1XFWO 2LUCA 2KGBC 4ETOA 2KBIA 4YGEB 1WLZA 2QACA 1V1FA 4PE4A 2BE6A 3JTDC 4ZCUA 1DJHA 1CFCA 4F0ZB 1OZOA 3OHMB 1MWNA 5CPVA 1MXEA 1UUSA 4PDZA 1KCYA 2LE9B 3K21A 4AOMA 2LC5A 2M0RA 2Y1MA 1TNPA 3I5IC 4YGBB 2BE4A 4DIRA 5B8IB 1CLBA 1DGUA 1BODA 1VRKA 1EXRA 1TN4A 1XFXO 3O4YA 4HSZA 3IF7A 2JTZA 1YUTA 2CTNA 1QX2A 5AANA 3MSEB 2JU0A 4FTGA 1B1GA 1NYAA 1JWDA 1SL7A 2JT3A 5JOLA 2PSRA 5DKRA 1NP8A 5HKZA 3ZNIA 4QJ5B 1EL4A 3OB2B 2I94A 4NDCA 1U5IB 4P5OE 2PASA 2AUCA 2I18A 1N2DA 1OZSA 5AXIA 5GQQC 1SR6B 1LA3A 1ZOTB 1TNWA 2LNKA 3I5FB 2E30A 3AKBA 2SCPA 1BMOA 3OP0A 4L9MA 5CSIA 2A4JA 2TN4A 1JUOA 1SL8A 1IQ5A 1TNQA 2MJWB 3PLFB 1SK6D 1F8HA 3PM8A 3EKJA 1NUBA 4MZLA 1F55A 5CSFA 4GUKA 2H61A 1CM4A 1DT7B 3FWCA 1KFXS 2F2OA 3ZWHA 1SR6C 1DJZA 1NSHA 3I5FC 4NQGA 1EH2A 1K9KA 1CDLA 2K7BA 1ZFSA 2H2KA 1DJIA 1MQ1A 2JOJA 4MLWA 1CNPA 4HRGA 4MRYA 1QX5B 2KFHA 1CLMA 1J1DA 1CDMA 1IGVA 4NDBA 1F70A 1TIZA 1M63B 1OSAA 3BUNB 1RFJA 3EK4A 4N5XA 4N1FA 4PHNA 4CFRA 4ZCVA 4PE0A 1LKJA 2RGIA 4HRHA 1IWQA 2HF5A 2VRGA 5DKQA 4AQJA 1CFFA 4OCIA 1SYMA 4Q04A 2MLEC 2Y1NA 4I5KA 2L98A 1K90D 1JFKA 2KQ6A 2K7CA 1S6CA 2HQWA 2BECA 2F3ZA 3BUXB 4OR9B 1ALWA 1QV1A 5HKYA 1JC2A 4C0JA 4XJKB 3VRNA 3I5HB 3O78A 1UURA 5I2OA 5IBWA 3FS7A 2WCBA 3C1VA 4YBHB 1A03A 1HQVA 2LHLA 2H61C 2Q4UA 4I5LB 5KTYA 3NSLA 2ZRTA 3PN7B 1MUXA 2L4HA 4GFTA 1QLKA 2FOTA 4OV2A 1SMGA 2JT0A 1QIWA 2M97A 1KQMB 1KK7Z 1K93D 1K96A 1QS7A 3I5HC 3KF9A 1RTP1 2LMTA 3FIAA 2OPOA 1MR8A 1EJ3A 2LLUA 3SG5A 3WNXB 1J1EA 3D0YA 2KAXA 4I5JA 1BR1B 2LUXA 4DRWA 2L0PA 1S1EA 1BJFA 1RROA 2BKHB 2ZN8A 4P2YB 2SASA 1ALVA 2CT9A 3DVMA 3PN7C 4DCKA 4MZKA 2M1KB 1G4YR 2GV5A 3BYAA 2MBXA 4DUQA 4YGAA 1RJVA 1JF0A 1DMOA 4OKHA 3DF0A 2MLFC 3CWGA 1MHOA 5DKNA 4USLA 1XFZO 1G8IA 2NCOA 3BUMB 1FF1A 2GGMA 3D0YB 2KNEA 2KI4B 2AAOA 1CTRA 2LANA 2L5XB 2ISDA
chains in the Genus database with same CATH superfamily
4UPGA 4QJ3B 1QIVA 3OBVA 1UHKA 4MVFA 4GAOA 2F8PA 5G08A 1K8UA 4CLNA 4CFQA 1DELA 2Y4QA 1IQ3A 3AAKA 1UHIA 2GGZA 2M8UA 4DS7A 1NX0A 2WC6A 3GOFA 3S0FA 1PVAA 1DEKA 1QASA 4M2PA 1BG1A 1CMGA 4XYNA 2LMVA 3PM2A 1W7IB 2G2BA 1F54A 2BCXA 4R1EA 3A8RA 3QMEA 2CNPA 2JC2A 2KI4C 5JJGA 2LP2A 3SIBA 1ZACA 1P28A 1CDPA 2CCMA 1NX2A 1L2OB 1GM0A 1IJ6A 4PHKA 3CTNA 3PJIA 1SPYA 4M2QA 5D7FA 3OB1B 1T14A 5D69A 1UP5A 1NPQA 2KI6C 3HX4A 3BUOB 1GJYA 3SG4A 1QXPA 4MZJA 3NSKA 2JNXA 1GGZA 1WRKA 3EK7A 4IJ7A 1WLMA 3DVJA 5AERA 4ICBA 1J7RA 3NGVA 1Y6WA 3CR4X 4INXA 4NDDA 2L50A 2KOTA 3QRXA 1LXFC 1OW4A 2LP3A 2EHBA 1L2OC 2NXQA 1IG5A 2DOQA 4INWA 5CSNA 1J7QA 1F71A 1PSRA 3NHTA 3OX6A 4JPZB 3EKHA 1SRAA 1ZUZA 2O60A 1C7WA 4KYNA 1UHHA 2L51A 3NSIA 1AK8A 2PVBA 2QPTA 1OMRA 1KSOA 4ORBB 3KHEA 5KSZA 2QEVA 5ER5A 2LMUA 1XA5A 1BOCA 1A2XA 2NCPA 2R2IA 2K7OA 2ZN9A 1SBJA 1SSEB 2QEHA 3VGOA 4GPLB 2V53A 3BOWA 5I94A 4ORCB 4YGCB 1B8CA 4AQIA 1QVIY 1RK9A 3L4LA 1M45A 2KAVA 4JKTA 3NXAA 3FWBA 2WCEA 2M49B 3LK0A 3EG5B 4C0LA 1MF8B 1TRFA 1Y1UA 4YI9A 5DICA 1N0YA 1IKUA 3WHTB 1OOJA 1V1GA 3AAJA 3DZTA 3TUYB 1S5GY 1QV0A 3S0GA 1WRZA 1Z2CB 1CM1A 1KFUL 2PALA 2M29A 2LHIA 5FI7A 1B9AA 3KEVA 1J55A 3CZTX 1Y1XA 1K9PA 2FCEA 2IS9A 1AVSA 1B4CA 2KAYA 2LM5A 1CB1A 3D78A 4M2OA 3RLZA 2JPTA 1D1OA 5CSJA 1B47A 1Q80A 2FJUB 3CZ0A 1B7TY 2KYCA 3R1VA 4JQ0D 1J7OA 1FBVA 2BKIB 1H4BA 2F2PA 1TUJA 5HKWA 3TUYC 1XFUO 3EVUA 5D3OA 2E6WA 3TDIA 1TNXA 2G9BA 2BL0B 2LV7A 2OTGB 2LVVA 2Y5IA 2ZFDA 3BUWB 3GK4X 2ISDA 1WRLA 5FYXA 3TS5B 3BQ3A 3CDNA 1QVIZ 3I5GB 2I2RE 3B87A 4CPVA 1S26D 3LK1A 4C0KA 2M3WA 1S36A 3LCPC 1A75A 4MSPA 1TUZA 1TOPA 1QLSA 1IIOA 2NZ0A 3O2PA 5J3XA 3O6BA 4MN0A 2BAPA 1GGWA 1A29A 3AKAA 2KYFA 2BL0C 1YUUA 1KFUS 1HT9A 3SG3A 3IQOA 2OTGC 1FI6A 2JT8A 4PE1A 2WNDA 2B1UA 3PALA 1QJTA 2L2CA 3DD4A 3TS5C 2LVJA 1AUIB 2K60A 3I5GC 3B6XA 2KQYA 4GGNA 3VRPA 2JULA 2K2FA 1BLQA 1TTXA 4YGDB 3EK8A 1OMVA 4MRXA 1C07A 1W9ZA 1A75B 2I7AA 3BFHA 1XFRA 1QX7A 1WDCC 1QWVA 3CZ1A 1DJWA 5HYDA 1OOFA 3CS1A 1M46A 1PALA 2F33A 2QEBA 2KI6D 2LAPA 3DF0B 1G33A 2AMIA 1CFDA 2K2AA 1BT6A 1SKTA 1K95A 1C7VA 1YX7A 2PMYA 1MXLC 3EVVA 3VROA 3GK1A 3CLNA 3M0WA 1E8AA 3R72A 4A4CA 1CLLA 3WXAA 1F4OA 2M7NA 1X02A 2KHNA 3TDZA 2WC8A 2FCDA 3TDUA 2COLB 1TCFA 3A4UB 1L7ZA 3E3RA 2LLTA 1RECA 2D8NA 1CDNA 1YVLA 3F45A 5AEQA 3RZSA 5HLOA 2ZRSA 2HETA 4JWQA 3VRQA 1YVHA 2KSPA 1K2HA 1OOGA 1FI5A 2L4IA 1NIWA 2L5YA 4PCWA 5I8NA 1SCVA 1PVBA 1XFYO 1KFXL 2WOSA 3D76A 3HCMA 3WHUB 1A4PA 1U5IA 1DF0A 2JXLA 5I2LA 2K0JA 2JWWA 1M31A 1XYDA 2CBLA 1LA0A 3ICBA 1IJ5A 1AJ4A 1FW4A 5EL2A 2K7DA 1LINA 4I5NB 1PK0D 2PRUA 4TNCA 5KU1A 1NWDA 2MA2A 1OQPA 2F3YA 1K9UA 3SG2A 3SS4A 2ZNDA 1DJYA 2P6BB 2WC5A 3D74A 2LVIA 1SCMB 5PALA 3B7AA 1DQEA 1JF2A 1CKKA 1ZMZA 4GGFA 2JRFA 2BBMA 1PSBA 1CFPA 2JNFA 1C3YA 1DF0B 3EVRA 2H8VA 1YR5A 1R6PA 3S0AA 3SJSA 1RWYA 2ERBA 1XK4A 2CXJA 3VRRA 1AJ5A 1WY9A 1DJGA 3RM1A 5BPJA 3FE8A 2LVKA 5TNCA 1Y0VH 1QATA 1S6JA 4IL1A 1BF5A 3BFAA 2BCBA 4GBAA 1DTLA 2KBMA 1ODBA 1SCMC 1YRTB 1S6IA 4PE7A 2KGRA 3FE9A 1AHRA 1H8BA 3CGAA 1YX8A 2JXCA 1R2UA 3BOWB 2O5GA 3S0BA 1IH0A 2KPHA 1BU3A 2ZNEA 1SW8A 1B8RA 1KK7Y 1KWOB 1PULA 4A4BA 2WORA 4BY5A 3TZ1A 3CR2A 2ZKMX 1JFJA 4XJKA 1TCOB 4F7FA 1GQMA 2M1UA 4WQ3A 1YRUB 1Y1AA 1NX3A 2P71A 3DVEA 4GGFC 3JVTB 1OMDA 3D75A 2NLNA 3IVTA 3CR5X 1YURA 3LLEA 4WRIA 3KO0A 3R1PA 2PQLA 2LLSA 1XK4C 2KDHA 3OX5A 1BR4B 2MHHA 4OVNF 2KLDA 1KWOC 4YI8A 2M7LA 3PFVA 1JSAA 2WCKA 2M9GA 3SG6A 3SIAA 2JTTA 3S0EA 1NX1A 1AP4A 1PRWA 1F4QA 1KSMA 3IQQA 5I2QA 1Z4HA 4PHJA 5HLVA 3D73A 3NHIA 5AFPA 1FPWA 2K8MB 4MBEA 1N65A 2MRDA 4PALA 1WDCB 1DVIA 2JZIA 1QTXA 4N1GA 5K89A 1S5GZ 5FI6A 3JVTC 4MEWA 1UHJA 2HQ8A 3OGNA 2JQ6A 1NCZA 1OE9B 4CIDA 1EG4A 4YRUA 1KQVA 3PATA 1UWOA 3B88A 3BXKA 2BNXA 3BFBA 4BY4A 1CMFA 1S3PA 2EGDA 1YTZC 1LVCD 2EC6B 3DXLA 4GNKB 4HREE 1JBAA 1XFVO 1SNLA 1KK8B 2WCFA 4U8DA 1SY9A 1B7TZ 1SL9A 1XO5A 3SG7A 2KFFA 2LCPA 2Q91A 3D77A 1DGVA 2OS8B 4JD9A 3KPXA 3NSOA 1EG3A 1B8LA 1UHNA 2MAZA 4FQOA 3L4AA 1K94A 2KFGA 1DJXA 3JTDB 4ORAB 1KQMC 4PHMA 2EC6C 1C3ZA 4QJ4B 3H4SE 5F6TA 1YUSA 2BBNA 3PSRA 3DVKA 3LL8B 1KK8C 4E68A 2K61A 1NCXA 1W7JB 2KLEA 1XVJA 3GK2A 3S0DA 4D1EA 1IRJA 1NCYA 3VB1A 2BCAA 5ER4X 3D10A 1J7PA 4WQ2A 2OS8C 2HPSA 3I5IB 2L2EA 1XFWO 2LUCA 2KGBC 3SS5A 4ETOA 2KBIA 4YGEB 1WLZA 2QACA 1V1FA 4PE4A 2BE6A 3JTDC 1DC1A 4ZCUA 1DJHA 1CFCA 4F0ZB 1OZOA 3CZ2A 3OHMB 1MWNA 5CPVA 3SS3A 1MXEA 1UUSA 4PDZA 1KCYA 2LE9B 3K21A 4AOMA 1LS8A 2LC5A 2M0RA 2Y1MA 1TNPA 3I5IC 4YGBB 2BE4A 4DIRA 5B8IB 3CYZA 1DGUA 1CLBA 1BODA 1VRKA 1EXRA 1TN4A 1XFXO 3O4YA 4HSZA 3IF7A 2JTZA 1YUTA 2CTNA 2GTEA 1QX2A 5AANA 3FE6A 3MSEB 2JU0A 4FTGA 1B1GA 1NYAA 1JWDA 1SL7A 2AAOA 2JT3A 5JOLA 2PSRA 2QDIA 5DKRA 1NP8A 5HKZA 3BJHA 3ZNIA 4QJ5B 1EL4A 3OB2B 4PT1A 2I94A 4NDCA 1U5IB 4P5OE 2PASA 2AUCA 2I18A 1N2DA 1OZSA 5AXIA 5GQQC 1SR6B 1LA3A 1ZOTB 1TNWA 2FJYA 2LNKA 3I5FB 3N7HA 2E30A 3AKBA 2SCPA 1BMOA 3OP0A 3V2LA 4L9MA 5CSIA 3Q8IA 2A4JA 2TN4A 1JUOA 3UNWA 2JPOA 1SL8A 1IQ5A 1TNQA 2MJWB 3PLFB 1SK6D 1F8HA 2PYQA 3PM8A 3EKJA 1NUBA 4MZLA 1F55A 5CSFA 4GUKA 2H61A 1CM4A 1DT7B 2P70A 3FWCA 1KFXS 4FQTA 2F2OA 3ZWHA 1SR6C 1DJZA 1NSHA 3I5FC 4NQGA 1EH2A 1K9KA 1CDLA 2K7BA 1ZFSA 2H2KA 1DJIA 1MQ1A 1ORGA 2JOJA 4MLWA 1CNPA 4HRGA 4MRYA 1QX5B 2KFHA 1CLMA 1J1DA 1CDMA 1IGVA 4NDBA 1F70A 1TIZA 1M63B 2WCJA 1OSAA 3BUNB 1RFJA 4OZDA 3EK4A 5HL1A 4N5XA 4N1FA 3B86A 4PHNA 4CFRA 4ZCVA 4PE0A 1LKJA 2RGIA 4HRHA 1IWQA 2HF5A 2VRGA 5DKQA 4AQJA 1CFFA 4OCIA 1SYMA 4Q04A 2MLEC 2Y1NA 4I5KA 2L98A 1K90D 1JFKA 2KQ6A 2YGUA 2K7CA 1S6CA 2HQWA 2BECA 2F3ZA 3BUXB 4OR9B 1ALWA 1QV1A 5HKYA 1JC2A 3DYEA 4C0JA 4XJKB 3VRNA 3I5HB 3O78A 1UURA 5I2OA 5IBWA 3FS7A 2WCBA 3C1VA 4YBHB 2WCLA 1A03A 1HQVA 2LHLA 2H61C 2Q4UA 4I5LB 3L47A 5KTYA 3NSLA 2ZRTA 3PN7B 1MUXA 2L4HA 4GFTA 1QLKA 2FOTA 4OV2A 1SMGA 2WCHA 2WCMA 2JT0A 1QIWA 2M97A 1KQMB 1KK7Z 1K93D 1K96A 1QS7A 3I5HC 3KF9A 1RTP1 3O4XA 2LMTA 3FIAA 2OPOA 1MR8A 1EJ3A 2LLUA 3SG5A 3WNXB 1J1EA 3D0YA 2KAXA 4I5JA 1BR1B 1OOIX 2LUXA 4DRWA 2L0PA 1S1EA 1BJFA 1RROA 2BKHB 2ZN8A 4P2YB 2SASA 1ALVA 2CT9A 3DVMA 3PN7C 4DCKA 3DY9A 4MZKA 2M1KB 3UO9A 1G4YR 2GV5A 3BYAA 3R1OA 2MBXA 4DUQA 4YGAA 1RJVA 1JF0A 1DMOA 4OKHA 1OOHA 3DF0A 2MLFC 3CWGA 1MHOA 5DKNA 4USLA 1XFZO 1G8IA 2NCOA 3BUMB 1FF1A 1TWOA 2GGMA 3D0YB 2KNEA 3K1EA 2KI4B 3CABA 1M39A 1CTRA 2LANA 2QEOA 2L5XB 5FI2A
chains in the Genus database with same CATH topology
4UPGA 4QJ3B 1QIVA 4MVFA 1UHKA 4GAOA 2F8PA 5G08A 1K8UA 4CLNA 4CFQA 2Y4QA 1IQ3A 3AAKA 1UHIA 2GGZA 2M8UA 4DS7A 1NX0A 3GOFA 1PVAA 4M2PA 1QASA 1BG1A 1CMGA 4XYNA 2LMVA 1F54A 1W7IB 2G2BA 2BCXA 4R1EA 3A8RA 2CNPA 2JC2A 2KI4C 5JJGA 2LP2A 3SIBA 1ZACA 1CDPA 2CCMA 1NX2A 1L2OB 1IJ6A 4PHKA 3CTNA 4M2QA 1SPYA 5D7FA 3OB1B 5D69A 1UP5A 1NPQA 2KI6C 3HX4A 3BUOB 1GJYA 3SG4A 1QXPA 4MZJA 3NSKA 2JNXA 1GGZA 1WRKA 3EK7A 1WLMA 1M39A 3DVJA 5AERA 4ICBA 1J7RA 4NDDA 1Y6WA 3CR4X 2L50A 2KOTA 3QRXA 1LXFC 2LP3A 2EHBA 1L2OC 2NXQA 1IG5A 2DOQA 5CSNA 1J7QA 1F71A 1PSRA 3OX6A 4JPZB 3EKHA 1SRAA 1ZUZA 2O60A 1C7WA 1UHHA 2L51A 3NSIA 1AK8A 2PVBA 2QPTA 1OMRA 1KSOA 4ORBB 3KHEA 5KSZA 5ER5A 2LMUA 1XA5A 1BOCA 1A2XA 2NCPA 2R2IA 2K7OA 2ZN9A 1SBJA 3VGOA 4GPLB 2V53A 3BOWA 4ORCB 4YGCB 1B8CA 4AQIA 1QVIY 1RK9A 1M45A 2KAVA 3NXAA 3FWBA 2WCEA 2M49B 3LK0A 4C0LA 1MF8B 1TRFA 1Y1UA 4YI9A 1N0YA 1IKUA 3WHTB 1OOJA 1V1GA 3AAJA 3TUYB 1S5GY 1QV0A 1WRZA 1CM1A 1KFUL 2PALA 2M29A 2LHIA 1B9AA 3KEVA 1J55A 3CZTX 1Y1XA 1K9PA 2FCEA 2IS9A 1AVSA 1B4CA 2KAYA 2LM5A 1CB1A 4M2OA 3RLZA 2JPTA 1D1OA 5CSJA 1B47A 1Q80A 2FJUB 1B7TY 2KYCA 1J7OA 4JQ0D 1FBVA 2BKIB 1H4BA 2F2PA 5HKWA 3TUYC 1XFUO 3EVUA 2E6WA 3TDIA 1TNXA 2G9BA 2BL0B 2LV7A 2OTGB 2LVVA 2Y5IA 2ZFDA 3BUWB 3GK4X 1WRLA 5FYXA 3TS5B 3BQ3A 1QVIZ 3I5GB 2I2RE 4CPVA 1S26D 3LK1A 4C0KA 2M3WA 1S36A 3LCPC 1A75A 4MSPA 1TOPA 1QLSA 2NZ0A 3O2PA 5J3XA 3O6BA 4MN0A 1GGWA 1A29A 3AKAA 2KYFA 2BL0C 1YUUA 1KFUS 1HT9A 3SG3A 3IQOA 2OTGC 1FI6A 2JT8A 4PE1A 2WNDA 2B1UA 3PALA 1QJTA 3DD4A 3TS5C 2LVJA 1AUIB 3I5GC 2KQYA 4GGNA 3VRPA 2JULA 2K2FA 1BLQA 1TTXA 4YGDB 3EK8A 1OMVA 4MRXA 1C07A 2I7AA 1A75B 1QX7A 1WDCC 1DJWA 5HYDA 3CS1A 1M46A 1PALA 2F33A 2KI6D 2LAPA 3DF0B 1G33A 2AMIA 1CFDA 2K2AA 1BT6A 1SKTA 1K95A 1C7VA 1YX7A 2PMYA 1MXLC 3EVVA 3VROA 3GK1A 3CLNA 3M0WA 1E8AA 4A4CA 1CLLA 3WXAA 1F4OA 2M7NA 1X02A 2KHNA 3TDZA 2WC8A 2FCDA 3TDUA 2COLB 1TCFA 3A4UB 1L7ZA 3E3RA 2LLTA 1RECA 2D8NA 1CDNA 1YVLA 3F45A 5AEQA 5HLOA 2ZRSA 2HETA 4JWQA 3VRQA 1YVHA 2KSPA 1K2HA 1FI5A 2L4IA 1NIWA 4PCWA 5I8NA 1SCVA 1PVBA 1XFYO 1KFXL 2WOSA 3HCMA 3WHUB 1A4PA 1U5IA 1DF0A 2JXLA 5I2LA 2K0JA 2JWWA 1M31A 1XYDA 2CBLA 1LA0A 3ICBA 1IJ5A 1AJ4A 1FW4A 2K7DA 1LINA 4I5NB 1PK0D 2PRUA 4TNCA 5KU1A 1NWDA 2MA2A 1OQPA 2F3YA 1K9UA 3SG2A 2ZNDA 1DJYA 2P6BB 2LVIA 1SCMB 5PALA 1JF2A 1CKKA 1ZMZA 4GGFA 2JRFA 2BBMA 1PSBA 1CFPA 2JNFA 1DF0B 3EVRA 1YR5A 1R6PA 3SJSA 1RWYA 1XK4A 2CXJA 3VRRA 1AJ5A 1WY9A 1DJGA 3RM1A 5BPJA 2LVKA 5TNCA 1Y0VH 1QATA 1S6JA 4IL1A 1BF5A 2BCBA 4GBAA 1DTLA 2KBMA 1ODBA 1SCMC 1YRTB 1S6IA 4PE7A 2KGRA 1H8BA 1AHRA 3CGAA 1YX8A 2JXCA 1R2UA 3BOWB 2O5GA 1IH0A 1BU3A 2ZNEA 1SW8A 1B8RA 1KK7Y 1KWOB 1PULA 4A4BA 2WORA 4BY5A 3TZ1A 3CR2A 2ZKMX 1JFJA 4XJKA 1TCOB 1GQMA 2M1UA 4WQ3A 1YRUB 1Y1AA 1NX3A 3DVEA 4GGFC 3JVTB 1OMDA 2NLNA 3CR5X 1YURA 3LLEA 4WRIA 3KO0A 2LLSA 1XK4C 2KDHA 3OX5A 1BR4B 2MHHA 4OVNF 4YI8A 1KWOC 2M7LA 3PFVA 1JSAA 3SG6A 2M9GA 3SIAA 2JTTA 1NX1A 1AP4A 1PRWA 1F4QA 1KSMA 3IQQA 5I2QA 4PHJA 5HLVA 5AFPA 1FPWA 2K8MB 4MBEA 1N65A 2MRDA 4PALA 1WDCB 1DVIA 2JZIA 1QTXA 4N1GA 5K89A 1S5GZ 3JVTC 4MEWA 1UHJA 2HQ8A 2JQ6A 1NCZA 1OE9B 4CIDA 1EG4A 4YRUA 1KQVA 3PATA 1UWOA 3BXKA 4BY4A 1CMFA 1S3PA 2EGDA 1YTZC 1LVCD 2EC6B 1JBAA 4GNKB 4HREE 1XFVO 1SNLA 1KK8B 2WCFA 4U8DA 1SY9A 1B7TZ 1SL9A 1XO5A 3SG7A 2KFFA 2LCPA 2Q91A 1DGVA 2OS8B 3KPXA 3NSOA 1EG3A 1B8LA 1UHNA 2MAZA 4FQOA 1K94A 2KFGA 1DJXA 3JTDB 4ORAB 1KQMC 4PHMA 2EC6C 4QJ4B 3H4SE 5F6TA 1YUSA 2BBNA 3PSRA 3DVKA 3LL8B 1KK8C 4E68A 2K61A 1NCXA 1W7JB 1XVJA 3GK2A 4D1EA 1IRJA 1NCYA 2BCAA 5ER4X 3D10A 1J7PA 4WQ2A 2OS8C 2HPSA 3I5IB 2L2EA 1XFWO 2LUCA 2KGBC 4ETOA 2KBIA 4YGEB 1WLZA 2QACA 1V1FA 4PE4A 2BE6A 3JTDC 4ZCUA 1DJHA 1CFCA 4F0ZB 1OZOA 3OHMB 1MWNA 5CPVA 1MXEA 1UUSA 4PDZA 1KCYA 2LE9B 3K21A 4AOMA 2LC5A 2M0RA 2Y1MA 1TNPA 3I5IC 4YGBB 2BE4A 4DIRA 5B8IB 1CLBA 1DGUA 1BODA 1VRKA 1EXRA 1TN4A 1XFXO 3O4YA 4HSZA 3IF7A 2JTZA 1YUTA 2CTNA 1QX2A 5AANA 3MSEB 2JU0A 4FTGA 1B1GA 1NYAA 1JWDA 1SL7A 2JT3A 5JOLA 2PSRA 5DKRA 1NP8A 5HKZA 3ZNIA 4QJ5B 1EL4A 3OB2B 2I94A 4NDCA 1U5IB 4P5OE 2PASA 2AUCA 2I18A 1N2DA 1OZSA 5AXIA 5GQQC 1SR6B 1LA3A 1ZOTB 1TNWA 2LNKA 3I5FB 2E30A 3AKBA 2SCPA 1BMOA 3OP0A 4L9MA 5CSIA 2A4JA 2TN4A 1JUOA 1SL8A 1IQ5A 1TNQA 2MJWB 3PLFB 1SK6D 1F8HA 3PM8A 3EKJA 1NUBA 4MZLA 1F55A 5CSFA 4GUKA 2H61A 1CM4A 1DT7B 3FWCA 1KFXS 2F2OA 3ZWHA 1SR6C 1DJZA 1NSHA 3I5FC 4NQGA 1EH2A 1K9KA 1CDLA 2K7BA 1ZFSA 2H2KA 1DJIA 1MQ1A 2JOJA 4MLWA 1CNPA 4HRGA 4MRYA 1QX5B 2KFHA 1CLMA 1J1DA 1CDMA 1IGVA 4NDBA 1F70A 1TIZA 1M63B 1OSAA 3BUNB 1RFJA 3EK4A 4N5XA 4N1FA 4PHNA 4CFRA 4ZCVA 4PE0A 1LKJA 2RGIA 4HRHA 1IWQA 2HF5A 2VRGA 5DKQA 4AQJA 1CFFA 4OCIA 1SYMA 4Q04A 2MLEC 2Y1NA 4I5KA 2L98A 1K90D 1JFKA 2KQ6A 2K7CA 1S6CA 2HQWA 2BECA 2F3ZA 3BUXB 4OR9B 1ALWA 1QV1A 5HKYA 1JC2A 4C0JA 4XJKB 3VRNA 3I5HB 3O78A 1UURA 5I2OA 5IBWA 3FS7A 2WCBA 3C1VA 4YBHB 1A03A 1HQVA 2LHLA 2H61C 2Q4UA 4I5LB 5KTYA 3NSLA 2ZRTA 3PN7B 1MUXA 2L4HA 4GFTA 1QLKA 2FOTA 4OV2A 1SMGA 2JT0A 1QIWA 2M97A 1KQMB 1KK7Z 1K93D 1K96A 1QS7A 3I5HC 3KF9A 1RTP1 2LMTA 3FIAA 2OPOA 1MR8A 1EJ3A 2LLUA 3SG5A 3WNXB 1J1EA 3D0YA 2KAXA 4I5JA 1BR1B 2LUXA 4DRWA 2L0PA 1S1EA 1BJFA 1RROA 2BKHB 2ZN8A 4P2YB 2SASA 1ALVA 2CT9A 3DVMA 3PN7C 4DCKA 4MZKA 2M1KB 1G4YR 2GV5A 3BYAA 2MBXA 4DUQA 4YGAA 1RJVA 1JF0A 1DMOA 4OKHA 3DF0A 2MLFC 3CWGA 1MHOA 5DKNA 4USLA 1XFZO 1G8IA 2NCOA 3BUMB 1FF1A 2GGMA 3D0YB 2KNEA 2KI4B 2AAOA 1CTRA 2LANA 2L5XB 2ISDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UPG A;  4QJ3 B;  1QIV A;  4MVF A;  1UHK A;  4GAO A;  2F8P A;  5G08 A;  1K8U A;  4CLN A;  4CFQ A;  2Y4Q A;  1IQ3 A;  3AAK A;  1UHI A;  2GGZ A;  2M8U A;  4DS7 A;  1NX0 A;  3GOF A;  1PVA A;  4M2P A;  1QAS A;  1BG1 A;  1CMG A;  4XYN A;  2LMV A;  1F54 A;  1W7I B;  2G2B A;  2BCX A;  4R1E A;  3A8R A;  2CNP A;  2JC2 A;  2KI4 C;  5JJG A;  2LP2 A;  3SIB A;  1ZAC A;  1CDP A;  2CCM A;  1NX2 A;  1L2O B;  1IJ6 A;  4PHK A;  3CTN A;  4M2Q A;  1SPY A;  5D7F A;  3OB1 B;  5D69 A;  1UP5 A;  1NPQ A;  2KI6 C;  3HX4 A;  3BUO B;  1GJY A;  3SG4 A;  1QXP A;  4MZJ A;  3NSK A;  2JNX A;  1GGZ A;  1WRK A;  3EK7 A;  1WLM A;  1M39 A;  3DVJ A;  5AER A;  4ICB A;  1J7R A;  4NDD A;  1Y6W A;  3CR4 X;  2L50 A;  2KOT A;  3QRX A;  1LXF C;  2LP3 A;  2EHB A;  1L2O C;  2NXQ A;  1IG5 A;  2DOQ A;  5CSN A;  1J7Q A;  1F71 A;  1PSR A;  3OX6 A;  4JPZ B;  3EKH A;  1SRA A;  1ZUZ A;  2O60 A;  1C7W A;  1UHH A;  2L51 A;  3NSI A;  1AK8 A;  2PVB A;  2QPT A;  1OMR A;  1KSO A;  4ORB B;  3KHE A;  5KSZ A;  5ER5 A;  2LMU A;  1XA5 A;  1BOC A;  1A2X A;  2NCP A;  2R2I A;  2K7O A;  2ZN9 A;  1SBJ A;  3VGO A;  4GPL B;  2V53 A;  3BOW A;  4ORC B;  4YGC B;  1B8C A;  4AQI A;  1QVI Y;  1RK9 A;  1M45 A;  2KAV A;  3NXA A;  3FWB A;  2WCE A;  2M49 B;  3LK0 A;  4C0L A;  1MF8 B;  1TRF A;  1Y1U A;  4YI9 A;  1N0Y A;  1IKU A;  3WHT B;  1OOJ A;  1V1G A;  3AAJ A;  3TUY B;  1S5G Y;  1QV0 A;  1WRZ A;  1CM1 A;  1KFU L;  2PAL A;  2M29 A;  2LHI A;  1B9A A;  3KEV A;  1J55 A;  3CZT X;  1Y1X A;  1K9P A;  2FCE A;  2IS9 A;  1AVS A;  1B4C A;  2KAY A;  2LM5 A;  1CB1 A;  4M2O A;  3RLZ A;  2JPT A;  1D1O A;  5CSJ A;  1B47 A;  1Q80 A;  2FJU B;  1B7T Y;  2KYC A;  1J7O A;  4JQ0 D;  1FBV A;  2BKI B;  1H4B A;  2F2P A;  5HKW A;  3TUY C;  1XFU O;  3EVU A;  2E6W A;  3TDI A;  1TNX A;  2G9B A;  2BL0 B;  2LV7 A;  2OTG B;  2LVV A;  2Y5I A;  2ZFD A;  3BUW B;  3GK4 X;  1WRL A;  5FYX A;  3TS5 B;  3BQ3 A;  1QVI Z;  3I5G B;  2I2R E;  4CPV A;  1S26 D;  3LK1 A;  4C0K A;  2M3W A;  1S36 A;  3LCP C;  1A75 A;  4MSP A;  1TOP A;  1QLS A;  2NZ0 A;  3O2P A;  5J3X A;  3O6B A;  4MN0 A;  1GGW A;  1A29 A;  3AKA A;  2KYF A;  2BL0 C;  1YUU A;  1KFU S;  1HT9 A;  3SG3 A;  3IQO A;  2OTG C;  1FI6 A;  2JT8 A;  4PE1 A;  2WND A;  2B1U A;  3PAL A;  1QJT A;  3DD4 A;  3TS5 C;  2LVJ A;  1AUI B;  3I5G C;  2KQY A;  4GGN A;  3VRP A;  2JUL A;  2K2F A;  1BLQ A;  1TTX A;  4YGD B;  3EK8 A;  1OMV A;  4MRX A;  1C07 A;  2I7A A;  1A75 B;  1QX7 A;  1WDC C;  1DJW A;  5HYD A;  3CS1 A;  1M46 A;  1PAL A;  2F33 A;  2KI6 D;  2LAP A;  3DF0 B;  1G33 A;  2AMI A;  1CFD A;  2K2A A;  1BT6 A;  1SKT A;  1K95 A;  1C7V A;  1YX7 A;  2PMY A;  1MXL C;  3EVV A;  3VRO A;  3GK1 A;  3CLN A;  3M0W A;  1E8A A;  4A4C A;  1CLL A;  3WXA A;  1F4O A;  2M7N A;  1X02 A;  2KHN A;  3TDZ A;  2WC8 A;  2FCD A;  3TDU A;  2COL B;  1TCF A;  3A4U B;  1L7Z A;  3E3R A;  2LLT A;  1REC A;  2D8N A;  1CDN A;  1YVL A;  3F45 A;  5AEQ A;  5HLO A;  2ZRS A;  2HET A;  4JWQ A;  3VRQ A;  1YVH A;  2KSP A;  1K2H A;  1FI5 A;  2L4I A;  1NIW A;  4PCW A;  5I8N A;  1SCV A;  1PVB A;  1XFY O;  1KFX L;  2WOS A;  3HCM A;  3WHU B;  1A4P A;  1U5I A;  1DF0 A;  2JXL A;  5I2L A;  2K0J A;  2JWW A;  1M31 A;  1XYD A;  2CBL A;  1LA0 A;  3ICB A;  1IJ5 A;  1AJ4 A;  1FW4 A;  2K7D A;  1LIN A;  4I5N B;  1PK0 D;  2PRU A;  4TNC A;  5KU1 A;  1NWD A;  2MA2 A;  1OQP A;  2F3Y A;  1K9U A;  3SG2 A;  2ZND A;  1DJY A;  2P6B B;  2LVI A;  1SCM B;  5PAL A;  1JF2 A;  1CKK A;  1ZMZ A;  4GGF A;  2JRF A;  2BBM A;  1PSB A;  1CFP A;  2JNF A;  1DF0 B;  3EVR A;  1YR5 A;  1R6P A;  3SJS A;  1RWY A;  1XK4 A;  2CXJ A;  3VRR A;  1AJ5 A;  1WY9 A;  1DJG A;  3RM1 A;  5BPJ A;  2LVK A;  5TNC A;  1Y0V H;  1QAT A;  1S6J A;  4IL1 A;  1BF5 A;  2BCB A;  4GBA A;  1DTL A;  2KBM A;  1ODB A;  1SCM C;  1YRT B;  1S6I A;  4PE7 A;  2KGR A;  1H8B A;  1AHR A;  3CGA A;  1YX8 A;  2JXC A;  1R2U A;  3BOW B;  2O5G A;  1IH0 A;  1BU3 A;  2ZNE A;  1SW8 A;  1B8R A;  1KK7 Y;  1KWO B;  1PUL A;  4A4B A;  2WOR A;  4BY5 A;  3TZ1 A;  3CR2 A;  2ZKM X;  1JFJ A;  4XJK A;  1TCO B;  1GQM A;  2M1U A;  4WQ3 A;  1YRU B;  1Y1A A;  1NX3 A;  3DVE A;  4GGF C;  3JVT B;  1OMD A;  2NLN A;  3CR5 X;  1YUR A;  3LLE A;  4WRI A;  3KO0 A;  2LLS A;  1XK4 C;  2KDH A;  3OX5 A;  1BR4 B;  2MHH A;  4OVN F;  4YI8 A;  1KWO C;  2M7L A;  3PFV A;  1JSA A;  3SG6 A;  2M9G A;  3SIA A;  2JTT A;  1NX1 A;  1AP4 A;  1PRW A;  1F4Q A;  1KSM A;  3IQQ A;  5I2Q A;  4PHJ A;  5HLV A;  5AFP A;  1FPW A;  2K8M B;  4MBE A;  1N65 A;  2MRD A;  4PAL A;  1WDC B;  1DVI A;  2JZI A;  1QTX A;  4N1G A;  5K89 A;  1S5G Z;  3JVT C;  4MEW A;  1UHJ A;  2HQ8 A;  2JQ6 A;  1NCZ A;  1OE9 B;  4CID A;  1EG4 A;  4YRU A;  1KQV A;  3PAT A;  1UWO A;  3BXK A;  4BY4 A;  1CMF A;  1S3P A;  2EGD A;  1YTZ C;  1LVC D;  2EC6 B;  1JBA A;  4GNK B;  4HRE E;  1XFV O;  1SNL A;  1KK8 B;  2WCF A;  4U8D A;  1SY9 A;  1B7T Z;  1SL9 A;  1XO5 A;  3SG7 A;  2KFF A;  2LCP A;  2Q91 A;  1DGV A;  2OS8 B;  3KPX A;  3NSO A;  1EG3 A;  1B8L A;  1UHN A;  2MAZ A;  4FQO A;  1K94 A;  2KFG A;  1DJX A;  3JTD B;  4ORA B;  1KQM C;  4PHM A;  2EC6 C;  4QJ4 B;  3H4S E;  5F6T A;  1YUS A;  2BBN A;  3PSR A;  3DVK A;  3LL8 B;  1KK8 C;  4E68 A;  2K61 A;  1NCX A;  1W7J B;  1XVJ A;  3GK2 A;  4D1E A;  1IRJ A;  1NCY A;  2BCA A;  5ER4 X;  3D10 A;  1J7P A;  4WQ2 A;  2OS8 C;  2HPS A;  3I5I B;  2L2E A;  1XFW O;  2LUC A;  2KGB C;  4ETO A;  2KBI A;  4YGE B;  1WLZ A;  2QAC A;  1V1F A;  4PE4 A;  2BE6 A;  3JTD C;  4ZCU A;  1DJH A;  1CFC A;  4F0Z B;  1OZO A;  3OHM B;  1MWN A;  5CPV A;  1MXE A;  1UUS A;  4PDZ A;  1KCY A;  2LE9 B;  3K21 A;  4AOM A;  2LC5 A;  2M0R A;  2Y1M A;  1TNP A;  3I5I C;  4YGB B;  2BE4 A;  4DIR A;  5B8I B;  1CLB A;  1DGU A;  1BOD A;  1VRK A;  1EXR A;  1TN4 A;  1XFX O;  3O4Y A;  4HSZ A;  3IF7 A;  2JTZ A;  1YUT A;  2CTN A;  1QX2 A;  5AAN A;  3MSE B;  2JU0 A;  4FTG A;  1B1G A;  1NYA A;  1JWD A;  1SL7 A;  2JT3 A;  5JOL A;  2PSR A;  5DKR A;  1NP8 A;  5HKZ A;  3ZNI A;  4QJ5 B;  1EL4 A;  3OB2 B;  2I94 A;  4NDC A;  1U5I B;  4P5O E;  2PAS A;  2AUC A;  2I18 A;  1N2D A;  1OZS A;  5AXI A;  5GQQ C;  1SR6 B;  1LA3 A;  1ZOT B;  1TNW A;  2LNK A;  3I5F B;  2E30 A;  3AKB A;  2SCP A;  1BMO A;  3OP0 A;  4L9M A;  5CSI A;  2A4J A;  2TN4 A;  1JUO A;  1SL8 A;  1IQ5 A;  1TNQ A;  2MJW B;  3PLF B;  1SK6 D;  1F8H A;  3PM8 A;  3EKJ A;  1NUB A;  4MZL A;  1F55 A;  5CSF A;  4GUK A;  2H61 A;  1CM4 A;  1DT7 B;  3FWC A;  1KFX S;  2F2O A;  3ZWH A;  1SR6 C;  1DJZ A;  1NSH A;  3I5F C;  4NQG A;  1EH2 A;  1K9K A;  1CDL A;  2K7B A;  1ZFS A;  2H2K A;  1DJI A;  1MQ1 A;  2JOJ A;  4MLW A;  1CNP A;  4HRG A;  4MRY A;  1QX5 B;  2KFH A;  1CLM A;  1J1D A;  1CDM A;  1IGV A;  4NDB A;  1F70 A;  1TIZ A;  1M63 B;  1OSA A;  3BUN B;  1RFJ A;  3EK4 A;  4N5X A;  4N1F A;  4PHN A;  4CFR A;  4ZCV A;  4PE0 A;  1LKJ A;  2RGI A;  4HRH A;  1IWQ A;  2HF5 A;  2VRG A;  5DKQ A;  4AQJ A;  1CFF A;  4OCI A;  1SYM A;  4Q04 A;  2MLE C;  2Y1N A;  4I5K A;  2L98 A;  1K90 D;  1JFK A;  2KQ6 A;  2K7C A;  1S6C A;  2HQW A;  2BEC A;  2F3Z A;  3BUX B;  4OR9 B;  1ALW A;  1QV1 A;  5HKY A;  1JC2 A;  4C0J A;  4XJK B;  3VRN A;  3I5H B;  3O78 A;  1UUR A;  5I2O A;  5IBW A;  3FS7 A;  2WCB A;  3C1V A;  4YBH B;  1A03 A;  1HQV A;  2LHL A;  2H61 C;  2Q4U A;  4I5L B;  5KTY A;  3NSL A;  2ZRT A;  3PN7 B;  1MUX A;  2L4H A;  4GFT A;  1QLK A;  2FOT A;  4OV2 A;  1SMG A;  2JT0 A;  1QIW A;  2M97 A;  1KQM B;  1KK7 Z;  1K93 D;  1K96 A;  1QS7 A;  3I5H C;  3KF9 A;  1RTP 1;  2LMT A;  3FIA A;  2OPO A;  1MR8 A;  1EJ3 A;  2LLU A;  3SG5 A;  3WNX B;  1J1E A;  3D0Y A;  2KAX A;  4I5J A;  1BR1 B;  2LUX A;  4DRW A;  2L0P A;  1S1E A;  1BJF A;  1RRO A;  2BKH B;  2ZN8 A;  4P2Y B;  2SAS A;  1ALV A;  2CT9 A;  3DVM A;  3PN7 C;  4DCK A;  4MZK A;  2M1K B;  1G4Y R;  2GV5 A;  3BYA A;  2MBX A;  4DUQ A;  4YGA A;  1RJV A;  1JF0 A;  1DMO A;  4OKH A;  3DF0 A;  2MLF C;  3CWG A;  1MHO A;  5DKN A;  4USL A;  1XFZ O;  1G8I A;  2NCO A;  3BUM B;  1FF1 A;  2GGM A;  3D0Y B;  2KNE A;  2KI4 B;  2AAO A;  1CTR A;  2LAN A;  2L5X B;  2ISD A; 
#chains in the Genus database with same CATH topology
 4UPG A;  4QJ3 B;  1QIV A;  3OBV A;  1UHK A;  4MVF A;  4GAO A;  2F8P A;  5G08 A;  1K8U A;  4CLN A;  4CFQ A;  1DEL A;  2Y4Q A;  1IQ3 A;  3AAK A;  1UHI A;  2GGZ A;  2M8U A;  4DS7 A;  1NX0 A;  2WC6 A;  3GOF A;  3S0F A;  1PVA A;  1DEK A;  1QAS A;  4M2P A;  1BG1 A;  1CMG A;  4XYN A;  2LMV A;  3PM2 A;  1W7I B;  2G2B A;  1F54 A;  2BCX A;  4R1E A;  3A8R A;  3QME A;  2CNP A;  2JC2 A;  2KI4 C;  5JJG A;  2LP2 A;  3SIB A;  1ZAC A;  1P28 A;  1CDP A;  2CCM A;  1NX2 A;  1L2O B;  1GM0 A;  1IJ6 A;  4PHK A;  3CTN A;  3PJI A;  1SPY A;  4M2Q A;  5D7F A;  3OB1 B;  1T14 A;  5D69 A;  1UP5 A;  1NPQ A;  2KI6 C;  3HX4 A;  3BUO B;  1GJY A;  3SG4 A;  1QXP A;  4MZJ A;  3NSK A;  2JNX A;  1GGZ A;  1WRK A;  3EK7 A;  4IJ7 A;  1WLM A;  3DVJ A;  5AER A;  4ICB A;  1J7R A;  3NGV A;  1Y6W A;  3CR4 X;  4INX A;  4NDD A;  2L50 A;  2KOT A;  3QRX A;  1LXF C;  1OW4 A;  2LP3 A;  2EHB A;  1L2O C;  2NXQ A;  1IG5 A;  2DOQ A;  4INW A;  5CSN A;  1J7Q A;  1F71 A;  1PSR A;  3NHT A;  3OX6 A;  4JPZ B;  3EKH A;  1SRA A;  1ZUZ A;  2O60 A;  1C7W A;  4KYN A;  1UHH A;  2L51 A;  3NSI A;  1AK8 A;  2PVB A;  2QPT A;  1OMR A;  1KSO A;  4ORB B;  3KHE A;  5KSZ A;  2QEV A;  5ER5 A;  2LMU A;  1XA5 A;  1BOC A;  1A2X A;  2NCP A;  2R2I A;  2K7O A;  2ZN9 A;  1SBJ A;  1SSE B;  2QEH A;  3VGO A;  4GPL B;  2V53 A;  3BOW A;  5I94 A;  4ORC B;  4YGC B;  1B8C A;  4AQI A;  1QVI Y;  1RK9 A;  3L4L A;  1M45 A;  2KAV A;  4JKT A;  3NXA A;  3FWB A;  2WCE A;  2M49 B;  3LK0 A;  3EG5 B;  4C0L A;  1MF8 B;  1TRF A;  1Y1U A;  4YI9 A;  5DIC A;  1N0Y A;  1IKU A;  3WHT B;  1OOJ A;  1V1G A;  3AAJ A;  3DZT A;  3TUY B;  1S5G Y;  1QV0 A;  3S0G A;  1WRZ A;  1Z2C B;  1CM1 A;  1KFU L;  2PAL A;  2M29 A;  2LHI A;  5FI7 A;  1B9A A;  3KEV A;  1J55 A;  3CZT X;  1Y1X A;  1K9P A;  2FCE A;  2IS9 A;  1AVS A;  1B4C A;  2KAY A;  2LM5 A;  1CB1 A;  3D78 A;  4M2O A;  3RLZ A;  2JPT A;  1D1O A;  5CSJ A;  1B47 A;  1Q80 A;  2FJU B;  3CZ0 A;  1B7T Y;  2KYC A;  3R1V A;  4JQ0 D;  1J7O A;  1FBV A;  2BKI B;  1H4B A;  2F2P A;  1TUJ A;  5HKW A;  3TUY C;  1XFU O;  3EVU A;  5D3O A;  2E6W A;  3TDI A;  1TNX A;  2G9B A;  2BL0 B;  2LV7 A;  2OTG B;  2LVV A;  2Y5I A;  2ZFD A;  3BUW B;  3GK4 X;  2ISD A;  1WRL A;  5FYX A;  3TS5 B;  3BQ3 A;  3CDN A;  1QVI Z;  3I5G B;  2I2R E;  3B87 A;  4CPV A;  1S26 D;  3LK1 A;  4C0K A;  2M3W A;  1S36 A;  3LCP C;  1A75 A;  4MSP A;  1TUZ A;  1TOP A;  1QLS A;  1IIO A;  2NZ0 A;  3O2P A;  5J3X A;  3O6B A;  4MN0 A;  2BAP A;  1GGW A;  1A29 A;  3AKA A;  2KYF A;  2BL0 C;  1YUU A;  1KFU S;  1HT9 A;  3SG3 A;  3IQO A;  2OTG C;  1FI6 A;  2JT8 A;  4PE1 A;  2WND A;  2B1U A;  3PAL A;  1QJT A;  2L2C A;  3DD4 A;  3TS5 C;  2LVJ A;  1AUI B;  2K60 A;  3I5G C;  3B6X A;  2KQY A;  4GGN A;  3VRP A;  2JUL A;  2K2F A;  1BLQ A;  1TTX A;  4YGD B;  3EK8 A;  1OMV A;  4MRX A;  1C07 A;  1W9Z A;  1A75 B;  2I7A A;  3BFH A;  1XFR A;  1QX7 A;  1WDC C;  1QWV A;  3CZ1 A;  1DJW A;  5HYD A;  1OOF A;  3CS1 A;  1M46 A;  1PAL A;  2F33 A;  2QEB A;  2KI6 D;  2LAP A;  3DF0 B;  1G33 A;  2AMI A;  1CFD A;  2K2A A;  1BT6 A;  1SKT A;  1K95 A;  1C7V A;  1YX7 A;  2PMY A;  1MXL C;  3EVV A;  3VRO A;  3GK1 A;  3CLN A;  3M0W A;  1E8A A;  3R72 A;  4A4C A;  1CLL A;  3WXA A;  1F4O A;  2M7N A;  1X02 A;  2KHN A;  3TDZ A;  2WC8 A;  2FCD A;  3TDU A;  2COL B;  1TCF A;  3A4U B;  1L7Z A;  3E3R A;  2LLT A;  1REC A;  2D8N A;  1CDN A;  1YVL A;  3F45 A;  5AEQ A;  3RZS A;  5HLO A;  2ZRS A;  2HET A;  4JWQ A;  3VRQ A;  1YVH A;  2KSP A;  1K2H A;  1OOG A;  1FI5 A;  2L4I A;  1NIW A;  2L5Y A;  4PCW A;  5I8N A;  1SCV A;  1PVB A;  1XFY O;  1KFX L;  2WOS A;  3D76 A;  3HCM A;  3WHU B;  1A4P A;  1U5I A;  1DF0 A;  2JXL A;  5I2L A;  2K0J A;  2JWW A;  1M31 A;  1XYD A;  2CBL A;  1LA0 A;  3ICB A;  1IJ5 A;  1AJ4 A;  1FW4 A;  5EL2 A;  2K7D A;  1LIN A;  4I5N B;  1PK0 D;  2PRU A;  4TNC A;  5KU1 A;  1NWD A;  2MA2 A;  1OQP A;  2F3Y A;  1K9U A;  3SG2 A;  3SS4 A;  2ZND A;  1DJY A;  2P6B B;  2WC5 A;  3D74 A;  2LVI A;  1SCM B;  5PAL A;  3B7A A;  1DQE A;  1JF2 A;  1CKK A;  1ZMZ A;  4GGF A;  2JRF A;  2BBM A;  1PSB A;  1CFP A;  2JNF A;  1C3Y A;  1DF0 B;  3EVR A;  2H8V A;  1YR5 A;  1R6P A;  3S0A A;  3SJS A;  1RWY A;  2ERB A;  1XK4 A;  2CXJ A;  3VRR A;  1AJ5 A;  1WY9 A;  1DJG A;  3RM1 A;  5BPJ A;  3FE8 A;  2LVK A;  5TNC A;  1Y0V H;  1QAT A;  1S6J A;  4IL1 A;  1BF5 A;  3BFA A;  2BCB A;  4GBA A;  1DTL A;  2KBM A;  1ODB A;  1SCM C;  1YRT B;  1S6I A;  4PE7 A;  2KGR A;  3FE9 A;  1AHR A;  1H8B A;  3CGA A;  1YX8 A;  2JXC A;  1R2U A;  3BOW B;  2O5G A;  3S0B A;  1IH0 A;  2KPH A;  1BU3 A;  2ZNE A;  1SW8 A;  1B8R A;  1KK7 Y;  1KWO B;  1PUL A;  4A4B A;  2WOR A;  4BY5 A;  3TZ1 A;  3CR2 A;  2ZKM X;  1JFJ A;  4XJK A;  1TCO B;  4F7F A;  1GQM A;  2M1U A;  4WQ3 A;  1YRU B;  1Y1A A;  1NX3 A;  2P71 A;  3DVE A;  4GGF C;  3JVT B;  1OMD A;  3D75 A;  2NLN A;  3IVT A;  3CR5 X;  1YUR A;  3LLE A;  4WRI A;  3KO0 A;  3R1P A;  2PQL A;  2LLS A;  1XK4 C;  2KDH A;  3OX5 A;  1BR4 B;  2MHH A;  4OVN F;  2KLD A;  1KWO C;  4YI8 A;  2M7L A;  3PFV A;  1JSA A;  2WCK A;  2M9G A;  3SG6 A;  3SIA A;  2JTT A;  3S0E A;  1NX1 A;  1AP4 A;  1PRW A;  1F4Q A;  1KSM A;  3IQQ A;  5I2Q A;  1Z4H A;  4PHJ A;  5HLV A;  3D73 A;  3NHI A;  5AFP A;  1FPW A;  2K8M B;  4MBE A;  1N65 A;  2MRD A;  4PAL A;  1WDC B;  1DVI A;  2JZI A;  1QTX A;  4N1G A;  5K89 A;  1S5G Z;  5FI6 A;  3JVT C;  4MEW A;  1UHJ A;  2HQ8 A;  3OGN A;  2JQ6 A;  1NCZ A;  1OE9 B;  4CID A;  1EG4 A;  4YRU A;  1KQV A;  3PAT A;  1UWO A;  3B88 A;  3BXK A;  2BNX A;  3BFB A;  4BY4 A;  1CMF A;  1S3P A;  2EGD A;  1YTZ C;  1LVC D;  2EC6 B;  3DXL A;  4GNK B;  4HRE E;  1JBA A;  1XFV O;  1SNL A;  1KK8 B;  2WCF A;  4U8D A;  1SY9 A;  1B7T Z;  1SL9 A;  1XO5 A;  3SG7 A;  2KFF A;  2LCP A;  2Q91 A;  3D77 A;  1DGV A;  2OS8 B;  4JD9 A;  3KPX A;  3NSO A;  1EG3 A;  1B8L A;  1UHN A;  2MAZ A;  4FQO A;  3L4A A;  1K94 A;  2KFG A;  1DJX A;  3JTD B;  4ORA B;  1KQM C;  4PHM A;  2EC6 C;  1C3Z A;  4QJ4 B;  3H4S E;  5F6T A;  1YUS A;  2BBN A;  3PSR A;  3DVK A;  3LL8 B;  1KK8 C;  4E68 A;  2K61 A;  1NCX A;  1W7J B;  2KLE A;  1XVJ A;  3GK2 A;  3S0D A;  4D1E A;  1IRJ A;  1NCY A;  3VB1 A;  2BCA A;  5ER4 X;  3D10 A;  1J7P A;  4WQ2 A;  2OS8 C;  2HPS A;  3I5I B;  2L2E A;  1XFW O;  2LUC A;  2KGB C;  3SS5 A;  4ETO A;  2KBI A;  4YGE B;  1WLZ A;  2QAC A;  1V1F A;  4PE4 A;  2BE6 A;  3JTD C;  1DC1 A;  4ZCU A;  1DJH A;  1CFC A;  4F0Z B;  1OZO A;  3CZ2 A;  3OHM B;  1MWN A;  5CPV A;  3SS3 A;  1MXE A;  1UUS A;  4PDZ A;  1KCY A;  2LE9 B;  3K21 A;  4AOM A;  1LS8 A;  2LC5 A;  2M0R A;  2Y1M A;  1TNP A;  3I5I C;  4YGB B;  2BE4 A;  4DIR A;  5B8I B;  3CYZ A;  1DGU A;  1CLB A;  1BOD A;  1VRK A;  1EXR A;  1TN4 A;  1XFX O;  3O4Y A;  4HSZ A;  3IF7 A;  2JTZ A;  1YUT A;  2CTN A;  2GTE A;  1QX2 A;  5AAN A;  3FE6 A;  3MSE B;  2JU0 A;  4FTG A;  1B1G A;  1NYA A;  1JWD A;  1SL7 A;  2AAO A;  2JT3 A;  5JOL A;  2PSR A;  2QDI A;  5DKR A;  1NP8 A;  5HKZ A;  3BJH A;  3ZNI A;  4QJ5 B;  1EL4 A;  3OB2 B;  4PT1 A;  2I94 A;  4NDC A;  1U5I B;  4P5O E;  2PAS A;  2AUC A;  2I18 A;  1N2D A;  1OZS A;  5AXI A;  5GQQ C;  1SR6 B;  1LA3 A;  1ZOT B;  1TNW A;  2FJY A;  2LNK A;  3I5F B;  3N7H A;  2E30 A;  3AKB A;  2SCP A;  1BMO A;  3OP0 A;  3V2L A;  4L9M A;  5CSI A;  3Q8I A;  2A4J A;  2TN4 A;  1JUO A;  3UNW A;  2JPO A;  1SL8 A;  1IQ5 A;  1TNQ A;  2MJW B;  3PLF B;  1SK6 D;  1F8H A;  2PYQ A;  3PM8 A;  3EKJ A;  1NUB A;  4MZL A;  1F55 A;  5CSF A;  4GUK A;  2H61 A;  1CM4 A;  1DT7 B;  2P70 A;  3FWC A;  1KFX S;  4FQT A;  2F2O A;  3ZWH A;  1SR6 C;  1DJZ A;  1NSH A;  3I5F C;  4NQG A;  1EH2 A;  1K9K A;  1CDL A;  2K7B A;  1ZFS A;  2H2K A;  1DJI A;  1MQ1 A;  1ORG A;  2JOJ A;  4MLW A;  1CNP A;  4HRG A;  4MRY A;  1QX5 B;  2KFH A;  1CLM A;  1J1D A;  1CDM A;  1IGV A;  4NDB A;  1F70 A;  1TIZ A;  1M63 B;  2WCJ A;  1OSA A;  3BUN B;  1RFJ A;  4OZD A;  3EK4 A;  5HL1 A;  4N5X A;  4N1F A;  3B86 A;  4PHN A;  4CFR A;  4ZCV A;  4PE0 A;  1LKJ A;  2RGI A;  4HRH A;  1IWQ A;  2HF5 A;  2VRG A;  5DKQ A;  4AQJ A;  1CFF A;  4OCI A;  1SYM A;  4Q04 A;  2MLE C;  2Y1N A;  4I5K A;  2L98 A;  1K90 D;  1JFK A;  2KQ6 A;  2YGU A;  2K7C A;  1S6C A;  2HQW A;  2BEC A;  2F3Z A;  3BUX B;  4OR9 B;  1ALW A;  1QV1 A;  5HKY A;  1JC2 A;  3DYE A;  4C0J A;  4XJK B;  3VRN A;  3I5H B;  3O78 A;  1UUR A;  5I2O A;  5IBW A;  3FS7 A;  2WCB A;  3C1V A;  4YBH B;  2WCL A;  1A03 A;  1HQV A;  2LHL A;  2H61 C;  2Q4U A;  4I5L B;  3L47 A;  5KTY A;  3NSL A;  2ZRT A;  3PN7 B;  1MUX A;  2L4H A;  4GFT A;  1QLK A;  2FOT A;  4OV2 A;  1SMG A;  2WCH A;  2WCM A;  2JT0 A;  1QIW A;  2M97 A;  1KQM B;  1KK7 Z;  1K93 D;  1K96 A;  1QS7 A;  3I5H C;  3KF9 A;  1RTP 1;  3O4X A;  2LMT A;  3FIA A;  2OPO A;  1MR8 A;  1EJ3 A;  2LLU A;  3SG5 A;  3WNX B;  1J1E A;  3D0Y A;  2KAX A;  4I5J A;  1BR1 B;  1OOI X;  2LUX A;  4DRW A;  2L0P A;  1S1E A;  1BJF A;  1RRO A;  2BKH B;  2ZN8 A;  4P2Y B;  2SAS A;  1ALV A;  2CT9 A;  3DVM A;  3PN7 C;  4DCK A;  3DY9 A;  4MZK A;  2M1K B;  3UO9 A;  1G4Y R;  2GV5 A;  3BYA A;  3R1O A;  2MBX A;  4DUQ A;  4YGA A;  1RJV A;  1JF0 A;  1DMO A;  4OKH A;  1OOH A;  3DF0 A;  2MLF C;  3CWG A;  1MHO A;  5DKN A;  4USL A;  1XFZ O;  1G8I A;  2NCO A;  3BUM B;  1FF1 A;  1TWO A;  2GGM A;  3D0Y B;  2KNE A;  3K1E A;  2KI4 B;  3CAB A;  1M39 A;  1CTR A;  2LAN A;  2QEO A;  2L5X B;  5FI2 A; 
#chains in the Genus database with same CATH homology
 4UPG A;  4QJ3 B;  1QIV A;  4MVF A;  1UHK A;  4GAO A;  2F8P A;  5G08 A;  1K8U A;  4CLN A;  4CFQ A;  2Y4Q A;  1IQ3 A;  3AAK A;  1UHI A;  2GGZ A;  2M8U A;  4DS7 A;  1NX0 A;  3GOF A;  1PVA A;  4M2P A;  1QAS A;  1BG1 A;  1CMG A;  4XYN A;  2LMV A;  1F54 A;  1W7I B;  2G2B A;  2BCX A;  4R1E A;  3A8R A;  2CNP A;  2JC2 A;  2KI4 C;  5JJG A;  2LP2 A;  3SIB A;  1ZAC A;  1CDP A;  2CCM A;  1NX2 A;  1L2O B;  1IJ6 A;  4PHK A;  3CTN A;  4M2Q A;  1SPY A;  5D7F A;  3OB1 B;  5D69 A;  1UP5 A;  1NPQ A;  2KI6 C;  3HX4 A;  3BUO B;  1GJY A;  3SG4 A;  1QXP A;  4MZJ A;  3NSK A;  2JNX A;  1GGZ A;  1WRK A;  3EK7 A;  1WLM A;  1M39 A;  3DVJ A;  5AER A;  4ICB A;  1J7R A;  4NDD A;  1Y6W A;  3CR4 X;  2L50 A;  2KOT A;  3QRX A;  1LXF C;  2LP3 A;  2EHB A;  1L2O C;  2NXQ A;  1IG5 A;  2DOQ A;  5CSN A;  1J7Q A;  1F71 A;  1PSR A;  3OX6 A;  4JPZ B;  3EKH A;  1SRA A;  1ZUZ A;  2O60 A;  1C7W A;  1UHH A;  2L51 A;  3NSI A;  1AK8 A;  2PVB A;  2QPT A;  1OMR A;  1KSO A;  4ORB B;  3KHE A;  5KSZ A;  5ER5 A;  2LMU A;  1XA5 A;  1BOC A;  1A2X A;  2NCP A;  2R2I A;  2K7O A;  2ZN9 A;  1SBJ A;  3VGO A;  4GPL B;  2V53 A;  3BOW A;  4ORC B;  4YGC B;  1B8C A;  4AQI A;  1QVI Y;  1RK9 A;  1M45 A;  2KAV A;  3NXA A;  3FWB A;  2WCE A;  2M49 B;  3LK0 A;  4C0L A;  1MF8 B;  1TRF A;  1Y1U A;  4YI9 A;  1N0Y A;  1IKU A;  3WHT B;  1OOJ A;  1V1G A;  3AAJ A;  3TUY B;  1S5G Y;  1QV0 A;  1WRZ A;  1CM1 A;  1KFU L;  2PAL A;  2M29 A;  2LHI A;  1B9A A;  3KEV A;  1J55 A;  3CZT X;  1Y1X A;  1K9P A;  2FCE A;  2IS9 A;  1AVS A;  1B4C A;  2KAY A;  2LM5 A;  1CB1 A;  4M2O A;  3RLZ A;  2JPT A;  1D1O A;  5CSJ A;  1B47 A;  1Q80 A;  2FJU B;  1B7T Y;  2KYC A;  1J7O A;  4JQ0 D;  1FBV A;  2BKI B;  1H4B A;  2F2P A;  5HKW A;  3TUY C;  1XFU O;  3EVU A;  2E6W A;  3TDI A;  1TNX A;  2G9B A;  2BL0 B;  2LV7 A;  2OTG B;  2LVV A;  2Y5I A;  2ZFD A;  3BUW B;  3GK4 X;  1WRL A;  5FYX A;  3TS5 B;  3BQ3 A;  1QVI Z;  3I5G B;  2I2R E;  4CPV A;  1S26 D;  3LK1 A;  4C0K A;  2M3W A;  1S36 A;  3LCP C;  1A75 A;  4MSP A;  1TOP A;  1QLS A;  2NZ0 A;  3O2P A;  5J3X A;  3O6B A;  4MN0 A;  1GGW A;  1A29 A;  3AKA A;  2KYF A;  2BL0 C;  1YUU A;  1KFU S;  1HT9 A;  3SG3 A;  3IQO A;  2OTG C;  1FI6 A;  2JT8 A;  4PE1 A;  2WND A;  2B1U A;  3PAL A;  1QJT A;  3DD4 A;  3TS5 C;  2LVJ A;  1AUI B;  3I5G C;  2KQY A;  4GGN A;  3VRP A;  2JUL A;  2K2F A;  1BLQ A;  1TTX A;  4YGD B;  3EK8 A;  1OMV A;  4MRX A;  1C07 A;  2I7A A;  1A75 B;  1QX7 A;  1WDC C;  1DJW A;  5HYD A;  3CS1 A;  1M46 A;  1PAL A;  2F33 A;  2KI6 D;  2LAP A;  3DF0 B;  1G33 A;  2AMI A;  1CFD A;  2K2A A;  1BT6 A;  1SKT A;  1K95 A;  1C7V A;  1YX7 A;  2PMY A;  1MXL C;  3EVV A;  3VRO A;  3GK1 A;  3CLN A;  3M0W A;  1E8A A;  4A4C A;  1CLL A;  3WXA A;  1F4O A;  2M7N A;  1X02 A;  2KHN A;  3TDZ A;  2WC8 A;  2FCD A;  3TDU A;  2COL B;  1TCF A;  3A4U B;  1L7Z A;  3E3R A;  2LLT A;  1REC A;  2D8N A;  1CDN A;  1YVL A;  3F45 A;  5AEQ A;  5HLO A;  2ZRS A;  2HET A;  4JWQ A;  3VRQ A;  1YVH A;  2KSP A;  1K2H A;  1FI5 A;  2L4I A;  1NIW A;  4PCW A;  5I8N A;  1SCV A;  1PVB A;  1XFY O;  1KFX L;  2WOS A;  3HCM A;  3WHU B;  1A4P A;  1U5I A;  1DF0 A;  2JXL A;  5I2L A;  2K0J A;  2JWW A;  1M31 A;  1XYD A;  2CBL A;  1LA0 A;  3ICB A;  1IJ5 A;  1AJ4 A;  1FW4 A;  2K7D A;  1LIN A;  4I5N B;  1PK0 D;  2PRU A;  4TNC A;  5KU1 A;  1NWD A;  2MA2 A;  1OQP A;  2F3Y A;  1K9U A;  3SG2 A;  2ZND A;  1DJY A;  2P6B B;  2LVI A;  1SCM B;  5PAL A;  1JF2 A;  1CKK A;  1ZMZ A;  4GGF A;  2JRF A;  2BBM A;  1PSB A;  1CFP A;  2JNF A;  1DF0 B;  3EVR A;  1YR5 A;  1R6P A;  3SJS A;  1RWY A;  1XK4 A;  2CXJ A;  3VRR A;  1AJ5 A;  1WY9 A;  1DJG A;  3RM1 A;  5BPJ A;  2LVK A;  5TNC A;  1Y0V H;  1QAT A;  1S6J A;  4IL1 A;  1BF5 A;  2BCB A;  4GBA A;  1DTL A;  2KBM A;  1ODB A;  1SCM C;  1YRT B;  1S6I A;  4PE7 A;  2KGR A;  1H8B A;  1AHR A;  3CGA A;  1YX8 A;  2JXC A;  1R2U A;  3BOW B;  2O5G A;  1IH0 A;  1BU3 A;  2ZNE A;  1SW8 A;  1B8R A;  1KK7 Y;  1KWO B;  1PUL A;  4A4B A;  2WOR A;  4BY5 A;  3TZ1 A;  3CR2 A;  2ZKM X;  1JFJ A;  4XJK A;  1TCO B;  1GQM A;  2M1U A;  4WQ3 A;  1YRU B;  1Y1A A;  1NX3 A;  3DVE A;  4GGF C;  3JVT B;  1OMD A;  2NLN A;  3CR5 X;  1YUR A;  3LLE A;  4WRI A;  3KO0 A;  2LLS A;  1XK4 C;  2KDH A;  3OX5 A;  1BR4 B;  2MHH A;  4OVN F;  4YI8 A;  1KWO C;  2M7L A;  3PFV A;  1JSA A;  3SG6 A;  2M9G A;  3SIA A;  2JTT A;  1NX1 A;  1AP4 A;  1PRW A;  1F4Q A;  1KSM A;  3IQQ A;  5I2Q A;  4PHJ A;  5HLV A;  5AFP A;  1FPW A;  2K8M B;  4MBE A;  1N65 A;  2MRD A;  4PAL A;  1WDC B;  1DVI A;  2JZI A;  1QTX A;  4N1G A;  5K89 A;  1S5G Z;  3JVT C;  4MEW A;  1UHJ A;  2HQ8 A;  2JQ6 A;  1NCZ A;  1OE9 B;  4CID A;  1EG4 A;  4YRU A;  1KQV A;  3PAT A;  1UWO A;  3BXK A;  4BY4 A;  1CMF A;  1S3P A;  2EGD A;  1YTZ C;  1LVC D;  2EC6 B;  1JBA A;  4GNK B;  4HRE E;  1XFV O;  1SNL A;  1KK8 B;  2WCF A;  4U8D A;  1SY9 A;  1B7T Z;  1SL9 A;  1XO5 A;  3SG7 A;  2KFF A;  2LCP A;  2Q91 A;  1DGV A;  2OS8 B;  3KPX A;  3NSO A;  1EG3 A;  1B8L A;  1UHN A;  2MAZ A;  4FQO A;  1K94 A;  2KFG A;  1DJX A;  3JTD B;  4ORA B;  1KQM C;  4PHM A;  2EC6 C;  4QJ4 B;  3H4S E;  5F6T A;  1YUS A;  2BBN A;  3PSR A;  3DVK A;  3LL8 B;  1KK8 C;  4E68 A;  2K61 A;  1NCX A;  1W7J B;  1XVJ A;  3GK2 A;  4D1E A;  1IRJ A;  1NCY A;  2BCA A;  5ER4 X;  3D10 A;  1J7P A;  4WQ2 A;  2OS8 C;  2HPS A;  3I5I B;  2L2E A;  1XFW O;  2LUC A;  2KGB C;  4ETO A;  2KBI A;  4YGE B;  1WLZ A;  2QAC A;  1V1F A;  4PE4 A;  2BE6 A;  3JTD C;  4ZCU A;  1DJH A;  1CFC A;  4F0Z B;  1OZO A;  3OHM B;  1MWN A;  5CPV A;  1MXE A;  1UUS A;  4PDZ A;  1KCY A;  2LE9 B;  3K21 A;  4AOM A;  2LC5 A;  2M0R A;  2Y1M A;  1TNP A;  3I5I C;  4YGB B;  2BE4 A;  4DIR A;  5B8I B;  1CLB A;  1DGU A;  1BOD A;  1VRK A;  1EXR A;  1TN4 A;  1XFX O;  3O4Y A;  4HSZ A;  3IF7 A;  2JTZ A;  1YUT A;  2CTN A;  1QX2 A;  5AAN A;  3MSE B;  2JU0 A;  4FTG A;  1B1G A;  1NYA A;  1JWD A;  1SL7 A;  2JT3 A;  5JOL A;  2PSR A;  5DKR A;  1NP8 A;  5HKZ A;  3ZNI A;  4QJ5 B;  1EL4 A;  3OB2 B;  2I94 A;  4NDC A;  1U5I B;  4P5O E;  2PAS A;  2AUC A;  2I18 A;  1N2D A;  1OZS A;  5AXI A;  5GQQ C;  1SR6 B;  1LA3 A;  1ZOT B;  1TNW A;  2LNK A;  3I5F B;  2E30 A;  3AKB A;  2SCP A;  1BMO A;  3OP0 A;  4L9M A;  5CSI A;  2A4J A;  2TN4 A;  1JUO A;  1SL8 A;  1IQ5 A;  1TNQ A;  2MJW B;  3PLF B;  1SK6 D;  1F8H A;  3PM8 A;  3EKJ A;  1NUB A;  4MZL A;  1F55 A;  5CSF A;  4GUK A;  2H61 A;  1CM4 A;  1DT7 B;  3FWC A;  1KFX S;  2F2O A;  3ZWH A;  1SR6 C;  1DJZ A;  1NSH A;  3I5F C;  4NQG A;  1EH2 A;  1K9K A;  1CDL A;  2K7B A;  1ZFS A;  2H2K A;  1DJI A;  1MQ1 A;  2JOJ A;  4MLW A;  1CNP A;  4HRG A;  4MRY A;  1QX5 B;  2KFH A;  1CLM A;  1J1D A;  1CDM A;  1IGV A;  4NDB A;  1F70 A;  1TIZ A;  1M63 B;  1OSA A;  3BUN B;  1RFJ A;  3EK4 A;  4N5X A;  4N1F A;  4PHN A;  4CFR A;  4ZCV A;  4PE0 A;  1LKJ A;  2RGI A;  4HRH A;  1IWQ A;  2HF5 A;  2VRG A;  5DKQ A;  4AQJ A;  1CFF A;  4OCI A;  1SYM A;  4Q04 A;  2MLE C;  2Y1N A;  4I5K A;  2L98 A;  1K90 D;  1JFK A;  2KQ6 A;  2K7C A;  1S6C A;  2HQW A;  2BEC A;  2F3Z A;  3BUX B;  4OR9 B;  1ALW A;  1QV1 A;  5HKY A;  1JC2 A;  4C0J A;  4XJK B;  3VRN A;  3I5H B;  3O78 A;  1UUR A;  5I2O A;  5IBW A;  3FS7 A;  2WCB A;  3C1V A;  4YBH B;  1A03 A;  1HQV A;  2LHL A;  2H61 C;  2Q4U A;  4I5L B;  5KTY A;  3NSL A;  2ZRT A;  3PN7 B;  1MUX A;  2L4H A;  4GFT A;  1QLK A;  2FOT A;  4OV2 A;  1SMG A;  2JT0 A;  1QIW A;  2M97 A;  1KQM B;  1KK7 Z;  1K93 D;  1K96 A;  1QS7 A;  3I5H C;  3KF9 A;  1RTP 1;  2LMT A;  3FIA A;  2OPO A;  1MR8 A;  1EJ3 A;  2LLU A;  3SG5 A;  3WNX B;  1J1E A;  3D0Y A;  2KAX A;  4I5J A;  1BR1 B;  2LUX A;  4DRW A;  2L0P A;  1S1E A;  1BJF A;  1RRO A;  2BKH B;  2ZN8 A;  4P2Y B;  2SAS A;  1ALV A;  2CT9 A;  3DVM A;  3PN7 C;  4DCK A;  4MZK A;  2M1K B;  1G4Y R;  2GV5 A;  3BYA A;  2MBX A;  4DUQ A;  4YGA A;  1RJV A;  1JF0 A;  1DMO A;  4OKH A;  3DF0 A;  2MLF C;  3CWG A;  1MHO A;  5DKN A;  4USL A;  1XFZ O;  1G8I A;  2NCO A;  3BUM B;  1FF1 A;  2GGM A;  3D0Y B;  2KNE A;  2KI4 B;  2AAO A;  1CTR A;  2LAN A;  2L5X B;  2ISD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...