4N1GA

Crystal structure of ca(2+)- discharged f88y obelin mutant from obelia longissima at 1.50 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
194
structure length
194
Chain Sequence
ASKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQYLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Obelin
publication title Crystal structures of the F88Y obelin mutant before and after bioluminescence provide molecular insight into spectral tuning among hydromedusan photoproteins
pubmed doi rcsb
source organism Obelia longissima
total genus 88
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4n1gA00
4GBAA 1S6JA 3DVEA 1BF5A 4MSPA 2WOSA 2WNDA 5HLOA 1NCZA 2HQ8A 1F70A 2LANA 1FI5A 2KGBC 3CZTX 1BLQA 1CTRA 3I5GC 4XJKB 1CFPA 2CNPA 2JULA 1U5IB 4DCKA 1RWYA 1DT7B 1WRZA 2I2RE 3EKHA 4N1FA 4CFQA 2RGIA 4YGEB 3SG2A 1TNPA 2BCXA 5HKZA 1JSAA 1DJZA 2KFHA 1PVAA 3AAJA 3I5FC 3GK1A 1RTP1 1XK4A 4USLA 3M0WA 1UP5A 1Y6WA 5JJGA 1RROA 5I2LA 2IS9A 4C0KA 3CR4X 3VROA 1F71A 1CMFA 1KFUS 5ER4X 5KSZA 1CB1A 3WHTB 2M7NA 2QACA 2JXLA 3KF9A 1IRJA 4MN0A 4ORBB 4D1EA 2CXJA 1J7RA 5F6TA 1CDLA 5PALA 1ODBA 2JRFA 1AJ4A 2M0RA 3LK0A 1F54A 1IJ6A 4MVFA 4QJ3B 2EC6C 5AEQA 2H61A 1KWOB 3EK7A 1VRKA 1AUIB 3CLNA 4GNKB 1UURA 1YX7A 1QXPA 5TNCA 1DJWA 4I5NB 4M2OA 1CM4A 1XFXO 2WORA 1M31A 4DIRA 1S26D 2JNFA 2LV7A 2R2IA 1NP8A 2M1KB 2L4HA 2E6WA 2JOJA 3D0YA 2L2EA 4ORAB 1V1GA 1PVBA 1J7PA 3VRRA 1J1DA 1K96A 2MLFC 3PALA 4OVNF 2NLNA 2LMTA 2JTTA 4NDDA 1K9PA 1FBVA 3KHEA 3PN7B 2KQ6A 2O60A 1B47A 1CKKA 4XJKA 3OHMB 2L98A 3FS7A 1U5IA 3C1VA 2CBLA 2M97A 2Y1NA 1DTLA 1SY9A 3I5HC 1H4BA 4Q04A 1SMGA 1ZUZA 3VGOA 1QX7A 2BE6A 3PFVA 1A75B 2KBIA 2LHLA 5D69A 3IF7A 1G4YR 3FWCA 4AQIA 1NPQA 1K90D 1G33A 3TZ1A 4PHMA 5J3XA 3SG6A 2L51A 1S3PA 2GGZA 2JWWA 1KFXS 1KQMB 2I18A 3PLFB 4AOMA 1IH0A 2KNEA 3FIAA 2Y4QA 5CSNA 2K7OA 4MZKA 3LLEA 5AANA 2MHHA 2PVBA 3D10A 1IQ3A 1WRKA 1WY9A 1KQMC 2L50A 4GAOA 1XO5A 2LLUA 1BODA 1QVIZ 1WRLA 3K21A 1Y1UA 1X02A 4PHJA 1IKUA 1XK4C 1A2XA 2F8PA 2F3ZA 3ICBA 1B8RA 1QX2A 3BUWB 3BXKA 3TUYB 2BKIB 3SG4A 5IBWA 1SRAA 1UHIA 1TNWA 2M49B 1N65A 1BR1B 1CFDA 1QV0A 2LP3A 1SNLA 1PSRA 3JVTB 1S1EA 5ER5A 1XFVO 3KPXA 1EG3A 1TOPA 3EKJA 2LNKA 1EXRA 1QX5B 1OSAA 2M3WA 1K2HA 2WC8A 2F2OA 2SCPA 2JXCA 2H2KA 3AAKA 1PALA 2PASA 1JFJA 1XFYO 1AHRA 1WLMA 2VRGA 4MEWA 5FYXA 3DVKA 1QLKA 2JC2A 2LVIA 3NSOA 1F4OA 1YVLA 3NSLA 5CSIA 3LK1A 4MZLA 1A75A 3DF0B 2M9GA 1FW4A 1AVSA 1IG5A 1QV1A 1SL8A 2DOQA 2GV5A 1YUSA 2KQYA 2LCPA 2LUCA 4P5OE 1CDNA 2K2FA 1PRWA 2FOTA 1KK7Z 1AJ5A 3WNXB 1QS7A 2LAPA 2LVKA 3DD4A 1Y1AA 1R2UA 1LKJA 1M39A 2JT0A 1RJVA 4OCIA 5DKQA 1MXLC 3CTNA 1IQ5A 2M29A 2KI4B 5DKRA 1IGVA 1EL4A 2EGDA 2KYCA 2TN4A 5I8NA 1IWQA 4CFRA 3EVVA 4DUQA 4YGAA 5I2OA 3BYAA 1FI6A 3EVUA 1K9KA 1XVJA 1BT6A 4BY5A 1QASA 4L9MA 4CLNA 1LA0A 1BMOA 1NX0A 2F33A 2KFGA 2KSPA 5DKNA 3WHUB 4BY4A 3GK2A 3TS5B 3A4UB 1M45A 1CLBA 2LM5A 4M2PA 4ZCVA 3LL8B 1DJXA 2OTGB 1UHHA 2K7DA 1NCXA 3AKBA 2ZNEA 3ZWHA 1OE9B 1Y1XA 1NIWA 4GFTA 1DGVA 1KK7Y 3A8RA 5HLVA 2LLSA 2BL0B 1KWOC 2A4JA 1PSBA 2F3YA 1FF1A 2JU0A 1V1FA 1XFWO 2LLTA 3NXAA 1YX8A 3F45A 1G8IA 1BU3A 2I94A 2JT3A 4R1EA 1WDCB 3RLZA 1K9UA 1MF8B 2P6BB 1KCYA 4ETOA 1TNQA 4PE0A 1YURA 1B8CA 2M7LA 2EHBA 2LP2A 1EJ3A 3DF0A 1K8UA 4PHNA 1YUTA 1PULA 3JTDB 3CS1A 1W7IB 3BUMB 1SW8A 3BUXB 4PDZA 3E3RA 4PE1A 2JPTA 3O78A 1YR5A 3PN7C 2LE9B 2ZKMX 1JBAA 1J7OA 4I5KA 3CGAA 2V53A 3JTDC 1B7TZ 3BQ3A 1KK8B 5HKWA 4ORCB 1UHJA 1TCFA 4HRHA 4NDBA 1CFCA 1ZFSA 4MLWA 2COLB 3OX5A 2LMUA 1JF2A 1K94A 2ISDA 1SKTA 2NZ0A 1S36A 1QTXA 3CR5X 4N5XA 2KFFA 2ZNDA 1KK8C 1UUSA 2CT9A 3DVJA 5CSJA 3SG7A 3SIAA 1J55A 1NUBA 1SR6B 1CM1A 2MRDA 4HSZA 3TDIA 2LVVA 1UWOA 4PE7A 4OR9B 1MXEA 3WXAA 1RECA 4MZJA 1QIVA 1L7ZA 3I5IB 3SG5A 1SL9A 1QLSA 1XYDA 2JNXA 2WCEA 4C0LA 1GGZA 5D7FA 1DJYA 5AFPA 3O4YA 1F8HA 3HX4A 1Q80A 4GPLB 1B7TY 3OP0A 4QJ5B 4M2QA 4DRWA 1FPWA 1NCYA 1B1GA 2NCOA 1C7WA 2JTZA 3TDUA 2JZIA 1K95A 2KGRA 2MLEC 2KI6D 2CCMA 2QPTA 2ZFDA 4HRGA 4P2YB 3TUYC 1JC2A 4YBHB 2K2AA 2KOTA 1KSOA 2HETA 2AAOA 4YGDB 4AQJA 2M1UA 3JVTC 4ZCUA 2Y1MA 4U8DA 2FCEA 2PSRA 2JT8A 2Q4UA 2WCBA 4YGBB 2K8MB 1QVIY 4TNCA 2OS8B 3PATA 1BOCA 4JPZB 2KYFA 2MBXA 1QATA 4N1GA 3HCMA 3MSEB 2KAYA 2Q91A 2SASA 1B4CA 1ALWA 1DJGA 1CLLA 2I7AA 3LCPC 4UPGA 4NQGA 3AKAA 2BBMA 4I5JA 1EH2A 4I5LB 2PALA 5CSFA 3I5GB 3NSKA 1MQ1A 1MUXA 3NSIA 2FJUB 1HT9A 3CWGA 1GGWA 2LMVA 3BUNB 3DVMA 1UHKA 1SYMA 3EK4A 1C7VA 1N2DA 1SPYA 1OZSA 1CDPA 1TN4A 2NXQA 4A4CA 5G08A 1KFUL 3OX6A 4QJ4B 5KTYA 5BPJA 5GQQC 1R6PA 3I5FB 3QRXA 1EG4A 1M63B 1M46A 2PRUA 3KO0A 4MBEA 2BE4A 1C07A 1DVIA 2HF5A 1MHOA 3BUOB 4IL1A 2KI4C 4YRUA 1TRFA 2JQ6A 1PK0D 1GJYA 1RFJA 1YUUA 3CR2A 4OKHA 5I2QA 2LC5A 4WQ2A 4YGCB 4WRIA 4CPVA 1BJFA 2EC6B 2LUXA 5JOLA 4MRYA 3TS5C 5HYDA 3TDZA 2FCDA 3SJSA 5B8IB 2OTGC 1DJIA 1TNXA 1N0YA 4HREE 5KU1A 1J7QA 2AUCA 1NX2A 1LXFC 2E30A 4XYNA 1SCMB 2BECA 1LA3A 1S5GZ 2K7BA 1KQVA 1OQPA 1A4PA 3BOWB 4GGFC 5HKYA 2BL0C 1SBJA 1ZOTB 1DF0B 2WCFA 1YRTB 4FQOA 1JF0A 2AMIA 2OPOA 2LHIA 1OZOA 1WDCC 1SCMC 4OV2A 1WLZA 1DJHA 3H4SE 5AXIA 1CFFA 1S6CA 1NWDA 1ZACA 2HQWA 2CTNA 2PMYA 1LVCD 1E8AA 2KDHA 1CLMA 2MA2A 3GK4X 3O2PA 4A4BA 5AERA 1J1EA 1A29A 1DGUA 4F0ZB 3EVRA 4JQ0D 1KFXL 2KHNA 3I5HB 1DMOA 2L4IA 1OMDA 1XFUO 3RM1A 1JUOA 1YVHA 1SL7A 1OMVA 4NDCA 2KAXA 1OMRA 1Y0VH 2K0JA 2BBNA 2BCAA 2L5XB 3OB1B 1TTXA 4FTGA 2KBMA 1QJTA 1CDMA 2G9BA 4E68A 1B8LA 2GGMA 3VRPA 3O6BA 4MRXA 1CNPA 1S5GY 2KI6C 1NX3A 4YI9A 1MR8A 1AP4A 2ZRSA 1W7JB 2ZN9A 1CMGA 1SK6D 4ICBA 3OB2B 2K7CA 3VRNA 1QIWA 2MAZA 5K89A 5CPVA 1BG1A 1JFKA 2MJWB 1NYAA 1SR6C 3PM8A 4YI8A 1BR4B 2Y5IA 2NCPA 3GOFA 2L0PA 1UHNA 4GGFA 1LINA 1L2OB 3EK8A 3FWBA 1D1OA 4PCWA 2BKHB 2KAVA 1H8BA 1HQVA 3ZNIA 4PALA 4DS7A 2B1UA 3I5IC 1NSHA 3IQQA 1F4QA 2ZRTA 3BOWA 2ZN8A 2M8UA 2LVJA 1YTZC 1L2OC 1DF0A 3VRQA 3PSRA 1YRUB 1B9AA 4CIDA 1F55A 3SG3A 4GUKA 1XA5A 2G2BA 4PE4A 4JWQA 1KSMA 1K93D 1ALVA 1TCOB 1SCVA 4GGNA 1JWDA 1NX1A 2F2PA 1A03A 1S6IA 4WQ3A 1IJ5A 2D8NA 1MWNA 1XFZO 1TIZA 4PHKA 2H61C 1GQMA 1OOJA 3KEVA 2OS8C 2K61A 2HPSA 3IQOA 1AK8A 1ZMZA 2O5GA 4C0JA 3D0YB 3SIBA 1RK9A 2BCBA
chains in the Genus database with same CATH superfamily
1C3ZA 4GBAA 1S6JA 3DVEA 1BF5A 2KLDA 4MSPA 2WOSA 2WNDA 5HLOA 1NCZA 2HQ8A 1F70A 2LANA 1FI5A 2KGBC 3CYZA 3CZTX 1CTRA 1BLQA 3I5GC 4XJKB 1CFPA 2CNPA 2JULA 1U5IB 4DCKA 1RWYA 1W9ZA 5EL2A 1DT7B 1WRZA 2FJYA 2I2RE 1Z4HA 3EKHA 4N1FA 4CFQA 2RGIA 4YGEB 3SG2A 1TNPA 2BCXA 5HKZA 3OBVA 1DJZA 1JSAA 2KFHA 1PVAA 3AAJA 3I5FC 3GK1A 1RTP1 3UNWA 1XK4A 4USLA 3M0WA 1UP5A 1Y6WA 1OOHA 5JJGA 1RROA 5I2LA 2IS9A 4C0KA 3CR4X 3VROA 1F71A 1CMFA 1KFUS 2JPOA 5ER4X 5KSZA 1CB1A 3WHTB 2M7NA 2QACA 2JXLA 2WC5A 3KF9A 1IRJA 4MN0A 4ORBB 4D1EA 2CXJA 1J7RA 4OZDA 5F6TA 1CDLA 5PALA 1ODBA 2JRFA 1AJ4A 2M0RA 3LK0A 1F54A 1IJ6A 4MVFA 4QJ3B 2EC6C 5AEQA 2H61A 1KWOB 3EK7A 1VRKA 1AUIB 3CLNA 4FQTA 4GNKB 1UURA 5DICA 1YX7A 1SSEB 4F7FA 1OOFA 1QXPA 5TNCA 1DJWA 4I5NB 4PT1A 4M2OA 1CM4A 1XFXO 2WORA 1M31A 4DIRA 1S26D 2JNFA 2LV7A 3S0AA 2R2IA 1NP8A 2M1KB 2L4HA 3DYEA 2E6WA 2JOJA 3D0YA 2L2EA 4ORAB 3S0EA 1V1GA 1PVBA 1J7PA 3VRRA 1J1DA 1K96A 2MLFC 3PALA 4OVNF 1OW4A 1QWVA 2LMTA 2NLNA 3S0FA 2JTTA 4NDDA 3N7HA 1K9PA 1FBVA 3KHEA 3PN7B 2KQ6A 2O60A 1TWOA 1B47A 1CKKA 4XJKA 3OHMB 2L98A 3FS7A 1U5IA 3C1VA 2CBLA 2M97A 2Y1NA 1DTLA 1SY9A 2QEBA 3I5HC 1H4BA 4Q04A 1SMGA 1ZUZA 3VGOA 1QX7A 2BE6A 3PFVA 1A75B 2KBIA 2LHLA 5D69A 3IF7A 1XFRA 1G4YR 3FWCA 4AQIA 1NPQA 1K90D 3BJHA 1G33A 3TZ1A 4PHMA 5J3XA 3SG6A 2L51A 1S3PA 2GGZA 2JWWA 1KFXS 1KQMB 2I18A 2WC6A 3PLFB 4AOMA 1IH0A 2KNEA 3FIAA 2GTEA 2Y4QA 3SS5A 5CSNA 2K7OA 4MZKA 3LLEA 5AANA 2MHHA 2PVBA 3D10A 1IQ3A 1WRKA 1WY9A 1KQMC 2L50A 4GAOA 1OOGA 1XO5A 2LLUA 1BODA 1QVIZ 1WRLA 3K21A 1Y1UA 1X02A 4PHJA 1IKUA 1XK4C 1A2XA 2F8PA 2F3ZA 3CZ1A 3B87A 3ICBA 5FI7A 3FE8A 1B8RA 1QX2A 3BUWB 3BXKA 3TUYB 2BKIB 3DZTA 3BFBA 3SG4A 1SRAA 5IBWA 1UHIA 1TNWA 2M49B 1N65A 1BR1B 1CFDA 3D73A 1QV0A 2LP3A 1SNLA 1PSRA 3JVTB 1IIOA 1S1EA 5ER5A 1XFVO 2WCJA 2BAPA 3KPXA 1EG3A 1TOPA 3EKJA 2LNKA 5HL1A 1EXRA 1QX5B 1OSAA 2M3WA 4IJ7A 1K2HA 2WC8A 2F2OA 2SCPA 4KYNA 2JXCA 2H2KA 3AAKA 3DXLA 1PALA 5FI2A 2PASA 3CZ2A 1JFJA 1XFYO 2PQLA 1AHRA 1WLMA 2VRGA 4MEWA 5FYXA 3DVKA 1QLKA 2JC2A 2LVIA 3NSOA 2KPHA 1LS8A 1F4OA 1YVLA 3NSLA 5CSIA 3LK1A 4MZLA 1A75A 3DF0B 2M9GA 1FW4A 1AVSA 1IG5A 1QV1A 1SL8A 2DOQA 2GV5A 1YUSA 2KQYA 2LCPA 2LUCA 4P5OE 1CDNA 2K2FA 1PRWA 2FOTA 1KK7Z 1AJ5A 3WNXB 3NHIA 5D3OA 1QS7A 2LAPA 2LVKA 3DD4A 1Y1AA 1R2UA 1LKJA 1M39A 2JT0A 1RJVA 2YGUA 4OCIA 5DKQA 1MXLC 3CTNA 3S0GA 1IQ5A 2M29A 1GM0A 2KI4B 3B6XA 5DKRA 1IGVA 1EL4A 2EGDA 2KYCA 2TN4A 5I8NA 1IWQA 4CFRA 3EVVA 4DUQA 4YGAA 5I2OA 3BYAA 1FI6A 3CZ0A 3EVUA 1K9KA 1XVJA 1BT6A 4JKTA 1QASA 4L9MA 4BY5A 4CLNA 1LA0A 1BMOA 1NX0A 2F33A 2KFGA 2KSPA 5DKNA 3WHUB 4BY4A 3GK2A 3TS5B 3A4UB 1M45A 4INXA 1CLBA 2LM5A 4M2PA 4ZCVA 3LL8B 1DJXA 2OTGB 3R72A 1UHHA 2K7DA 1NCXA 3AKBA 2ZNEA 3ZWHA 1OE9B 1Y1XA 1NIWA 4GFTA 1DGVA 1KK7Y 3A8RA 5HLVA 2LLSA 2BL0B 1KWOC 2A4JA 1PSBA 2F3YA 1FF1A 2JU0A 3L4AA 4INWA 1V1FA 1XFWO 2LLTA 3NHTA 3NXAA 1YX8A 3F45A 3D77A 1G8IA 1BU3A 2I94A 2JT3A 4R1EA 1WDCB 3RLZA 1K9UA 1MF8B 2P6BB 1KCYA 4ETOA 1TNQA 4PE0A 1YURA 1B8CA 2M7LA 2EHBA 2LP2A 1EJ3A 3DF0A 1K8UA 4PHNA 2P70A 1YUTA 1PULA 3JTDB 3CS1A 1W7IB 3BUMB 1SW8A 3BUXB 4PDZA 3E3RA 4PE1A 2JPTA 3O78A 1YR5A 3PN7C 2LE9B 2ZKMX 1JBAA 1J7OA 4I5KA 3CGAA 2V53A 3JTDC 1B7TZ 3BQ3A 1KK8B 5HKWA 3R1PA 4ORCB 3DY9A 1UHJA 1TCFA 4HRHA 4NDBA 1CFCA 1ZFSA 4MLWA 1T14A 2COLB 3OX5A 2LMUA 3VB1A 1JF2A 1K94A 3FE6A 1SKTA 2ISDA 2NZ0A 1S36A 1QTXA 3CR5X 4N5XA 2KFFA 2ZNDA 1KK8C 1UUSA 3S0BA 2CT9A 3IVTA 3DVJA 5CSJA 3SG7A 3SIAA 1J55A 1NUBA 1SR6B 1TUJA 1CM1A 2H8VA 2MRDA 4HSZA 3TDIA 2LVVA 1UWOA 4PE7A 4OR9B 1MXEA 3WXAA 1RECA 3D75A 4MZJA 1QIVA 1L7ZA 5I94A 3S0DA 3I5IB 3B7AA 3SG5A 1SL9A 1QLSA 1TUZA 3L47A 1XYDA 2JNXA 2WCEA 4C0LA 1GGZA 5D7FA 1DJYA 5AFPA 3O4YA 1F8HA 3HX4A 1Q80A 4GPLB 1B7TY 3OP0A 4QJ5B 4M2QA 1DQEA 4DRWA 1FPWA 1NCYA 1B1GA 2NCOA 1C7WA 2JTZA 3TDUA 2JZIA 1K95A 2KGRA 2MLEC 2KI6D 2CCMA 2QPTA 2ZFDA 3D76A 4HRGA 4P2YB 3TUYC 1JC2A 4YBHB 2K2AA 2KOTA 3RZSA 1KSOA 2HETA 2AAOA 4YGDB 4AQJA 2M1UA 3JVTC 4ZCUA 2Y1MA 2QEOA 2FCEA 2PSRA 4U8DA 2JT8A 3R1OA 2Q4UA 2WCBA 4YGBB 2K8MB 1QVIY 3BFAA 4TNCA 2OS8B 3PATA 3SS4A 4JPZB 2KYFA 2MBXA 1BOCA 1QATA 4N1GA 3HCMA 3MSEB 2KAYA 2Q91A 2SASA 1B4CA 1ALWA 1DJGA 1CLLA 2I7AA 3LCPC 4UPGA 4NQGA 3AKAA 2BBMA 2WCLA 4I5JA 1EH2A 2WCHA 4I5LB 2PALA 5CSFA 3I5GB 2BNXA 3NSKA 1MQ1A 1MUXA 3NSIA 2FJUB 1HT9A 3CWGA 1GGWA 2LMVA 3BUNB 2QEHA 1UHKA 3CABA 1SYMA 3D78A 3DVMA 1N2DA 3EK4A 1C7VA 1SPYA 1OZSA 1CDPA 1TN4A 3K1EA 3OGNA 2NXQA 4A4CA 5G08A 2QDIA 3EG5B 3PJIA 1KFUL 3OX6A 4QJ4B 5KTYA 5BPJA 5GQQC 1R6PA 3I5FB 3QRXA 1EG4A 1M63B 1M46A 2PRUA 3CDNA 3KO0A 2BE4A 4MBEA 1DVIA 2HF5A 1C07A 1MHOA 3O4XA 3BUOB 4IL1A 2KI4C 4YRUA 1TRFA 2WCMA 2JQ6A 1PK0D 1GJYA 1RFJA 1YUUA 3CR2A 3UO9A 4OKHA 5I2QA 2LC5A 4WQ2A 4YGCB 4WRIA 4CPVA 3Q8IA 1BJFA 2EC6B 2LUXA 5JOLA 4MRYA 3TS5C 5HYDA 3TDZA 2FCDA 3SJSA 5B8IB 2OTGC 1DJIA 1TNXA 1N0YA 4HREE 5KU1A 1J7QA 2AUCA 2K60A 1NX2A 1LXFC 2E30A 2KLEA 2QEVA 1SCMB 2BECA 4XYNA 1LA3A 1S5GZ 3B88A 2K7BA 1KQVA 1OQPA 1A4PA 3BOWB 4GGFC 5HKYA 2BL0C 1SBJA 1ZOTB 1DF0B 2WCFA 1YRTB 4FQOA 2L5YA 1JF0A 2AMIA 2OPOA 2LHIA 1OZOA 1WDCC 1SCMC 4OV2A 1WLZA 1DJHA 3H4SE 5AXIA 1CFFA 1S6CA 1NWDA 1ZACA 2HQWA 2CTNA 2PMYA 3R1VA 1LVCD 1E8AA 2KDHA 1CLMA 2MA2A 3GK4X 3O2PA 3FE9A 3PM2A 4A4BA 1J1EA 5AERA 1A29A 1DGUA 1C3YA 4F0ZB 3EVRA 4JQ0D 1KFXL 2KHNA 3I5HB 1DMOA 2L4IA 1OMDA 1XFUO 3RM1A 1JUOA 1YVHA 1SL7A 1OMVA 4NDCA 2KAXA 1OMRA 1Y0VH 2K0JA 2BBNA 2BCAA 1OOIX 2L5XB 3OB1B 1TTXA 2P71A 4FTGA 2KBMA 1QJTA 1CDMA 2G9BA 4E68A 1B8LA 2GGMA 3VRPA 3O6BA 4MRXA 1CNPA 1S5GY 2KI6C 1NX3A 4YI9A 1MR8A 5FI6A 1AP4A 2WCKA 2ZRSA 1W7JB 2ZN9A 1CMGA 1SK6D 4ICBA 3OB2B 2K7CA 3VRNA 1DC1A 1QIWA 2MAZA 5K89A 5CPVA 1BG1A 1Z2CB 1JFKA 2MJWB 1NYAA 3D74A 1SR6C 3NGVA 3PM8A 4YI8A 3V2LA 1BR4B 2Y5IA 2NCPA 3GOFA 2L0PA 1UHNA 4GGFA 1DELA 1LINA 1L2OB 3EK8A 3FWBA 1D1OA 4PCWA 2BKHB 2KAVA 1H8BA 1HQVA 3ZNIA 4PALA 4DS7A 2B1UA 4JD9A 3I5IC 1DEKA 1NSHA 3IQQA 1F4QA 2ZRTA 3BOWA 2ZN8A 2M8UA 2LVJA 1YTZC 1L2OC 2L2CA 1DF0A 3VRQA 3PSRA 1YRUB 1B9AA 3SS3A 4CIDA 1F55A 3SG3A 4GUKA 1XA5A 2G2BA 4PE4A 4JWQA 1KSMA 1K93D 3BFHA 1ALVA 3L4LA 1TCOB 2PYQA 1SCVA 4GGNA 1JWDA 1NX1A 2F2PA 3B86A 1S6IA 4WQ3A 1A03A 1IJ5A 2ERBA 2D8NA 1MWNA 1XFZO 1TIZA 4PHKA 2H61C 1GQMA 1OOJA 1ORGA 3KEVA 2OS8C 2K61A 2HPSA 3IQOA 1AK8A 3QMEA 1ZMZA 2O5GA 1P28A 4C0JA 3D0YB 3SIBA 1RK9A 2BCBA
chains in the Genus database with same CATH topology
4GBAA 1S6JA 3DVEA 1BF5A 4MSPA 2WOSA 2WNDA 5HLOA 1NCZA 2HQ8A 1F70A 2LANA 1FI5A 2KGBC 3CZTX 1BLQA 1CTRA 3I5GC 4XJKB 1CFPA 2CNPA 2JULA 1U5IB 4DCKA 1RWYA 1DT7B 1WRZA 2I2RE 3EKHA 4N1FA 4CFQA 2RGIA 4YGEB 3SG2A 1TNPA 2BCXA 5HKZA 1JSAA 1DJZA 2KFHA 1PVAA 3AAJA 3I5FC 3GK1A 1RTP1 1XK4A 4USLA 3M0WA 1UP5A 1Y6WA 5JJGA 1RROA 5I2LA 2IS9A 4C0KA 3CR4X 3VROA 1F71A 1CMFA 1KFUS 5ER4X 5KSZA 1CB1A 3WHTB 2M7NA 2QACA 2JXLA 3KF9A 1IRJA 4MN0A 4ORBB 4D1EA 2CXJA 1J7RA 5F6TA 1CDLA 5PALA 1ODBA 2JRFA 1AJ4A 2M0RA 3LK0A 1F54A 1IJ6A 4MVFA 4QJ3B 2EC6C 5AEQA 2H61A 1KWOB 3EK7A 1VRKA 1AUIB 3CLNA 4GNKB 1UURA 1YX7A 1QXPA 5TNCA 1DJWA 4I5NB 4M2OA 1CM4A 1XFXO 2WORA 1M31A 4DIRA 1S26D 2JNFA 2LV7A 2R2IA 1NP8A 2M1KB 2L4HA 2E6WA 2JOJA 3D0YA 2L2EA 4ORAB 1V1GA 1PVBA 1J7PA 3VRRA 1J1DA 1K96A 2MLFC 3PALA 4OVNF 2NLNA 2LMTA 2JTTA 4NDDA 1K9PA 1FBVA 3KHEA 3PN7B 2KQ6A 2O60A 1B47A 1CKKA 4XJKA 3OHMB 2L98A 3FS7A 1U5IA 3C1VA 2CBLA 2M97A 2Y1NA 1DTLA 1SY9A 3I5HC 1H4BA 4Q04A 1SMGA 1ZUZA 3VGOA 1QX7A 2BE6A 3PFVA 1A75B 2KBIA 2LHLA 5D69A 3IF7A 1G4YR 3FWCA 4AQIA 1NPQA 1K90D 1G33A 3TZ1A 4PHMA 5J3XA 3SG6A 2L51A 1S3PA 2GGZA 2JWWA 1KFXS 1KQMB 2I18A 3PLFB 4AOMA 1IH0A 2KNEA 3FIAA 2Y4QA 5CSNA 2K7OA 4MZKA 3LLEA 5AANA 2MHHA 2PVBA 3D10A 1IQ3A 1WRKA 1WY9A 1KQMC 2L50A 4GAOA 1XO5A 2LLUA 1BODA 1QVIZ 1WRLA 3K21A 1Y1UA 1X02A 4PHJA 1IKUA 1XK4C 1A2XA 2F8PA 2F3ZA 3ICBA 1B8RA 1QX2A 3BUWB 3BXKA 3TUYB 2BKIB 3SG4A 5IBWA 1SRAA 1UHIA 1TNWA 2M49B 1N65A 1BR1B 1CFDA 1QV0A 2LP3A 1SNLA 1PSRA 3JVTB 1S1EA 5ER5A 1XFVO 3KPXA 1EG3A 1TOPA 3EKJA 2LNKA 1EXRA 1QX5B 1OSAA 2M3WA 1K2HA 2WC8A 2F2OA 2SCPA 2JXCA 2H2KA 3AAKA 1PALA 2PASA 1JFJA 1XFYO 1AHRA 1WLMA 2VRGA 4MEWA 5FYXA 3DVKA 1QLKA 2JC2A 2LVIA 3NSOA 1F4OA 1YVLA 3NSLA 5CSIA 3LK1A 4MZLA 1A75A 3DF0B 2M9GA 1FW4A 1AVSA 1IG5A 1QV1A 1SL8A 2DOQA 2GV5A 1YUSA 2KQYA 2LCPA 2LUCA 4P5OE 1CDNA 2K2FA 1PRWA 2FOTA 1KK7Z 1AJ5A 3WNXB 1QS7A 2LAPA 2LVKA 3DD4A 1Y1AA 1R2UA 1LKJA 1M39A 2JT0A 1RJVA 4OCIA 5DKQA 1MXLC 3CTNA 1IQ5A 2M29A 2KI4B 5DKRA 1IGVA 1EL4A 2EGDA 2KYCA 2TN4A 5I8NA 1IWQA 4CFRA 3EVVA 4DUQA 4YGAA 5I2OA 3BYAA 1FI6A 3EVUA 1K9KA 1XVJA 1BT6A 4BY5A 1QASA 4L9MA 4CLNA 1LA0A 1BMOA 1NX0A 2F33A 2KFGA 2KSPA 5DKNA 3WHUB 4BY4A 3GK2A 3TS5B 3A4UB 1M45A 1CLBA 2LM5A 4M2PA 4ZCVA 3LL8B 1DJXA 2OTGB 1UHHA 2K7DA 1NCXA 3AKBA 2ZNEA 3ZWHA 1OE9B 1Y1XA 1NIWA 4GFTA 1DGVA 1KK7Y 3A8RA 5HLVA 2LLSA 2BL0B 1KWOC 2A4JA 1PSBA 2F3YA 1FF1A 2JU0A 1V1FA 1XFWO 2LLTA 3NXAA 1YX8A 3F45A 1G8IA 1BU3A 2I94A 2JT3A 4R1EA 1WDCB 3RLZA 1K9UA 1MF8B 2P6BB 1KCYA 4ETOA 1TNQA 4PE0A 1YURA 1B8CA 2M7LA 2EHBA 2LP2A 1EJ3A 3DF0A 1K8UA 4PHNA 1YUTA 1PULA 3JTDB 3CS1A 1W7IB 3BUMB 1SW8A 3BUXB 4PDZA 3E3RA 4PE1A 2JPTA 3O78A 1YR5A 3PN7C 2LE9B 2ZKMX 1JBAA 1J7OA 4I5KA 3CGAA 2V53A 3JTDC 1B7TZ 3BQ3A 1KK8B 5HKWA 4ORCB 1UHJA 1TCFA 4HRHA 4NDBA 1CFCA 1ZFSA 4MLWA 2COLB 3OX5A 2LMUA 1JF2A 1K94A 2ISDA 1SKTA 2NZ0A 1S36A 1QTXA 3CR5X 4N5XA 2KFFA 2ZNDA 1KK8C 1UUSA 2CT9A 3DVJA 5CSJA 3SG7A 3SIAA 1J55A 1NUBA 1SR6B 1CM1A 2MRDA 4HSZA 3TDIA 2LVVA 1UWOA 4PE7A 4OR9B 1MXEA 3WXAA 1RECA 4MZJA 1QIVA 1L7ZA 3I5IB 3SG5A 1SL9A 1QLSA 1XYDA 2JNXA 2WCEA 4C0LA 1GGZA 5D7FA 1DJYA 5AFPA 3O4YA 1F8HA 3HX4A 1Q80A 4GPLB 1B7TY 3OP0A 4QJ5B 4M2QA 4DRWA 1FPWA 1NCYA 1B1GA 2NCOA 1C7WA 2JTZA 3TDUA 2JZIA 1K95A 2KGRA 2MLEC 2KI6D 2CCMA 2QPTA 2ZFDA 4HRGA 4P2YB 3TUYC 1JC2A 4YBHB 2K2AA 2KOTA 1KSOA 2HETA 2AAOA 4YGDB 4AQJA 2M1UA 3JVTC 4ZCUA 2Y1MA 4U8DA 2FCEA 2PSRA 2JT8A 2Q4UA 2WCBA 4YGBB 2K8MB 1QVIY 4TNCA 2OS8B 3PATA 1BOCA 4JPZB 2KYFA 2MBXA 1QATA 4N1GA 3HCMA 3MSEB 2KAYA 2Q91A 2SASA 1B4CA 1ALWA 1DJGA 1CLLA 2I7AA 3LCPC 4UPGA 4NQGA 3AKAA 2BBMA 4I5JA 1EH2A 4I5LB 2PALA 5CSFA 3I5GB 3NSKA 1MQ1A 1MUXA 3NSIA 2FJUB 1HT9A 3CWGA 1GGWA 2LMVA 3BUNB 3DVMA 1UHKA 1SYMA 3EK4A 1C7VA 1N2DA 1SPYA 1OZSA 1CDPA 1TN4A 2NXQA 4A4CA 5G08A 1KFUL 3OX6A 4QJ4B 5KTYA 5BPJA 5GQQC 1R6PA 3I5FB 3QRXA 1EG4A 1M63B 1M46A 2PRUA 3KO0A 4MBEA 2BE4A 1C07A 1DVIA 2HF5A 1MHOA 3BUOB 4IL1A 2KI4C 4YRUA 1TRFA 2JQ6A 1PK0D 1GJYA 1RFJA 1YUUA 3CR2A 4OKHA 5I2QA 2LC5A 4WQ2A 4YGCB 4WRIA 4CPVA 1BJFA 2EC6B 2LUXA 5JOLA 4MRYA 3TS5C 5HYDA 3TDZA 2FCDA 3SJSA 5B8IB 2OTGC 1DJIA 1TNXA 1N0YA 4HREE 5KU1A 1J7QA 2AUCA 1NX2A 1LXFC 2E30A 4XYNA 1SCMB 2BECA 1LA3A 1S5GZ 2K7BA 1KQVA 1OQPA 1A4PA 3BOWB 4GGFC 5HKYA 2BL0C 1SBJA 1ZOTB 1DF0B 2WCFA 1YRTB 4FQOA 1JF0A 2AMIA 2OPOA 2LHIA 1OZOA 1WDCC 1SCMC 4OV2A 1WLZA 1DJHA 3H4SE 5AXIA 1CFFA 1S6CA 1NWDA 1ZACA 2HQWA 2CTNA 2PMYA 1LVCD 1E8AA 2KDHA 1CLMA 2MA2A 3GK4X 3O2PA 4A4BA 5AERA 1J1EA 1A29A 1DGUA 4F0ZB 3EVRA 4JQ0D 1KFXL 2KHNA 3I5HB 1DMOA 2L4IA 1OMDA 1XFUO 3RM1A 1JUOA 1YVHA 1SL7A 1OMVA 4NDCA 2KAXA 1OMRA 1Y0VH 2K0JA 2BBNA 2BCAA 2L5XB 3OB1B 1TTXA 4FTGA 2KBMA 1QJTA 1CDMA 2G9BA 4E68A 1B8LA 2GGMA 3VRPA 3O6BA 4MRXA 1CNPA 1S5GY 2KI6C 1NX3A 4YI9A 1MR8A 1AP4A 2ZRSA 1W7JB 2ZN9A 1CMGA 1SK6D 4ICBA 3OB2B 2K7CA 3VRNA 1QIWA 2MAZA 5K89A 5CPVA 1BG1A 1JFKA 2MJWB 1NYAA 1SR6C 3PM8A 4YI8A 1BR4B 2Y5IA 2NCPA 3GOFA 2L0PA 1UHNA 4GGFA 1LINA 1L2OB 3EK8A 3FWBA 1D1OA 4PCWA 2BKHB 2KAVA 1H8BA 1HQVA 3ZNIA 4PALA 4DS7A 2B1UA 3I5IC 1NSHA 3IQQA 1F4QA 2ZRTA 3BOWA 2ZN8A 2M8UA 2LVJA 1YTZC 1L2OC 1DF0A 3VRQA 3PSRA 1YRUB 1B9AA 4CIDA 1F55A 3SG3A 4GUKA 1XA5A 2G2BA 4PE4A 4JWQA 1KSMA 1K93D 1ALVA 1TCOB 1SCVA 4GGNA 1JWDA 1NX1A 2F2PA 1A03A 1S6IA 4WQ3A 1IJ5A 2D8NA 1MWNA 1XFZO 1TIZA 4PHKA 2H61C 1GQMA 1OOJA 3KEVA 2OS8C 2K61A 2HPSA 3IQOA 1AK8A 1ZMZA 2O5GA 4C0JA 3D0YB 3SIBA 1RK9A 2BCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBA A;  1S6J A;  3DVE A;  1BF5 A;  4MSP A;  2WOS A;  2WND A;  5HLO A;  1NCZ A;  2HQ8 A;  1F70 A;  2LAN A;  1FI5 A;  2KGB C;  3CZT X;  1BLQ A;  1CTR A;  3I5G C;  4XJK B;  1CFP A;  2CNP A;  2JUL A;  1U5I B;  4DCK A;  1RWY A;  1DT7 B;  1WRZ A;  2I2R E;  3EKH A;  4N1F A;  4CFQ A;  2RGI A;  4YGE B;  3SG2 A;  1TNP A;  2BCX A;  5HKZ A;  1JSA A;  1DJZ A;  2KFH A;  1PVA A;  3AAJ A;  3I5F C;  3GK1 A;  1RTP 1;  1XK4 A;  4USL A;  3M0W A;  1UP5 A;  1Y6W A;  5JJG A;  1RRO A;  5I2L A;  2IS9 A;  4C0K A;  3CR4 X;  3VRO A;  1F71 A;  1CMF A;  1KFU S;  5ER4 X;  5KSZ A;  1CB1 A;  3WHT B;  2M7N A;  2QAC A;  2JXL A;  3KF9 A;  1IRJ A;  4MN0 A;  4ORB B;  4D1E A;  2CXJ A;  1J7R A;  5F6T A;  1CDL A;  5PAL A;  1ODB A;  2JRF A;  1AJ4 A;  2M0R A;  3LK0 A;  1F54 A;  1IJ6 A;  4MVF A;  4QJ3 B;  2EC6 C;  5AEQ A;  2H61 A;  1KWO B;  3EK7 A;  1VRK A;  1AUI B;  3CLN A;  4GNK B;  1UUR A;  1YX7 A;  1QXP A;  5TNC A;  1DJW A;  4I5N B;  4M2O A;  1CM4 A;  1XFX O;  2WOR A;  1M31 A;  4DIR A;  1S26 D;  2JNF A;  2LV7 A;  2R2I A;  1NP8 A;  2M1K B;  2L4H A;  2E6W A;  2JOJ A;  3D0Y A;  2L2E A;  4ORA B;  1V1G A;  1PVB A;  1J7P A;  3VRR A;  1J1D A;  1K96 A;  2MLF C;  3PAL A;  4OVN F;  2NLN A;  2LMT A;  2JTT A;  4NDD A;  1K9P A;  1FBV A;  3KHE A;  3PN7 B;  2KQ6 A;  2O60 A;  1B47 A;  1CKK A;  4XJK A;  3OHM B;  2L98 A;  3FS7 A;  1U5I A;  3C1V A;  2CBL A;  2M97 A;  2Y1N A;  1DTL A;  1SY9 A;  3I5H C;  1H4B A;  4Q04 A;  1SMG A;  1ZUZ A;  3VGO A;  1QX7 A;  2BE6 A;  3PFV A;  1A75 B;  2KBI A;  2LHL A;  5D69 A;  3IF7 A;  1G4Y R;  3FWC A;  4AQI A;  1NPQ A;  1K90 D;  1G33 A;  3TZ1 A;  4PHM A;  5J3X A;  3SG6 A;  2L51 A;  1S3P A;  2GGZ A;  2JWW A;  1KFX S;  1KQM B;  2I18 A;  3PLF B;  4AOM A;  1IH0 A;  2KNE A;  3FIA A;  2Y4Q A;  5CSN A;  2K7O A;  4MZK A;  3LLE A;  5AAN A;  2MHH A;  2PVB A;  3D10 A;  1IQ3 A;  1WRK A;  1WY9 A;  1KQM C;  2L50 A;  4GAO A;  1XO5 A;  2LLU A;  1BOD A;  1QVI Z;  1WRL A;  3K21 A;  1Y1U A;  1X02 A;  4PHJ A;  1IKU A;  1XK4 C;  1A2X A;  2F8P A;  2F3Z A;  3ICB A;  1B8R A;  1QX2 A;  3BUW B;  3BXK A;  3TUY B;  2BKI B;  3SG4 A;  5IBW A;  1SRA A;  1UHI A;  1TNW A;  2M49 B;  1N65 A;  1BR1 B;  1CFD A;  1QV0 A;  2LP3 A;  1SNL A;  1PSR A;  3JVT B;  1S1E A;  5ER5 A;  1XFV O;  3KPX A;  1EG3 A;  1TOP A;  3EKJ A;  2LNK A;  1EXR A;  1QX5 B;  1OSA A;  2M3W A;  1K2H A;  2WC8 A;  2F2O A;  2SCP A;  2JXC A;  2H2K A;  3AAK A;  1PAL A;  2PAS A;  1JFJ A;  1XFY O;  1AHR A;  1WLM A;  2VRG A;  4MEW A;  5FYX A;  3DVK A;  1QLK A;  2JC2 A;  2LVI A;  3NSO A;  1F4O A;  1YVL A;  3NSL A;  5CSI A;  3LK1 A;  4MZL A;  1A75 A;  3DF0 B;  2M9G A;  1FW4 A;  1AVS A;  1IG5 A;  1QV1 A;  1SL8 A;  2DOQ A;  2GV5 A;  1YUS A;  2KQY A;  2LCP A;  2LUC A;  4P5O E;  1CDN A;  2K2F A;  1PRW A;  2FOT A;  1KK7 Z;  1AJ5 A;  3WNX B;  1QS7 A;  2LAP A;  2LVK A;  3DD4 A;  1Y1A A;  1R2U A;  1LKJ A;  1M39 A;  2JT0 A;  1RJV A;  4OCI A;  5DKQ A;  1MXL C;  3CTN A;  1IQ5 A;  2M29 A;  2KI4 B;  5DKR A;  1IGV A;  1EL4 A;  2EGD A;  2KYC A;  2TN4 A;  5I8N A;  1IWQ A;  4CFR A;  3EVV A;  4DUQ A;  4YGA A;  5I2O A;  3BYA A;  1FI6 A;  3EVU A;  1K9K A;  1XVJ A;  1BT6 A;  4BY5 A;  1QAS A;  4L9M A;  4CLN A;  1LA0 A;  1BMO A;  1NX0 A;  2F33 A;  2KFG A;  2KSP A;  5DKN A;  3WHU B;  4BY4 A;  3GK2 A;  3TS5 B;  3A4U B;  1M45 A;  1CLB A;  2LM5 A;  4M2P A;  4ZCV A;  3LL8 B;  1DJX A;  2OTG B;  1UHH A;  2K7D A;  1NCX A;  3AKB A;  2ZNE A;  3ZWH A;  1OE9 B;  1Y1X A;  1NIW A;  4GFT A;  1DGV A;  1KK7 Y;  3A8R A;  5HLV A;  2LLS A;  2BL0 B;  1KWO C;  2A4J A;  1PSB A;  2F3Y A;  1FF1 A;  2JU0 A;  1V1F A;  1XFW O;  2LLT A;  3NXA A;  1YX8 A;  3F45 A;  1G8I A;  1BU3 A;  2I94 A;  2JT3 A;  4R1E A;  1WDC B;  3RLZ A;  1K9U A;  1MF8 B;  2P6B B;  1KCY A;  4ETO A;  1TNQ A;  4PE0 A;  1YUR A;  1B8C A;  2M7L A;  2EHB A;  2LP2 A;  1EJ3 A;  3DF0 A;  1K8U A;  4PHN A;  1YUT A;  1PUL A;  3JTD B;  3CS1 A;  1W7I B;  3BUM B;  1SW8 A;  3BUX B;  4PDZ A;  3E3R A;  4PE1 A;  2JPT A;  3O78 A;  1YR5 A;  3PN7 C;  2LE9 B;  2ZKM X;  1JBA A;  1J7O A;  4I5K A;  3CGA A;  2V53 A;  3JTD C;  1B7T Z;  3BQ3 A;  1KK8 B;  5HKW A;  4ORC B;  1UHJ A;  1TCF A;  4HRH A;  4NDB A;  1CFC A;  1ZFS A;  4MLW A;  2COL B;  3OX5 A;  2LMU A;  1JF2 A;  1K94 A;  2ISD A;  1SKT A;  2NZ0 A;  1S36 A;  1QTX A;  3CR5 X;  4N5X A;  2KFF A;  2ZND A;  1KK8 C;  1UUS A;  2CT9 A;  3DVJ A;  5CSJ A;  3SG7 A;  3SIA A;  1J55 A;  1NUB A;  1SR6 B;  1CM1 A;  2MRD A;  4HSZ A;  3TDI A;  2LVV A;  1UWO A;  4PE7 A;  4OR9 B;  1MXE A;  3WXA A;  1REC A;  4MZJ A;  1QIV A;  1L7Z A;  3I5I B;  3SG5 A;  1SL9 A;  1QLS A;  1XYD A;  2JNX A;  2WCE A;  4C0L A;  1GGZ A;  5D7F A;  1DJY A;  5AFP A;  3O4Y A;  1F8H A;  3HX4 A;  1Q80 A;  4GPL B;  1B7T Y;  3OP0 A;  4QJ5 B;  4M2Q A;  4DRW A;  1FPW A;  1NCY A;  1B1G A;  2NCO A;  1C7W A;  2JTZ A;  3TDU A;  2JZI A;  1K95 A;  2KGR A;  2MLE C;  2KI6 D;  2CCM A;  2QPT A;  2ZFD A;  4HRG A;  4P2Y B;  3TUY C;  1JC2 A;  4YBH B;  2K2A A;  2KOT A;  1KSO A;  2HET A;  2AAO A;  4YGD B;  4AQJ A;  2M1U A;  3JVT C;  4ZCU A;  2Y1M A;  4U8D A;  2FCE A;  2PSR A;  2JT8 A;  2Q4U A;  2WCB A;  4YGB B;  2K8M B;  1QVI Y;  4TNC A;  2OS8 B;  3PAT A;  1BOC A;  4JPZ B;  2KYF A;  2MBX A;  1QAT A;  4N1G A;  3HCM A;  3MSE B;  2KAY A;  2Q91 A;  2SAS A;  1B4C A;  1ALW A;  1DJG A;  1CLL A;  2I7A A;  3LCP C;  4UPG A;  4NQG A;  3AKA A;  2BBM A;  4I5J A;  1EH2 A;  4I5L B;  2PAL A;  5CSF A;  3I5G B;  3NSK A;  1MQ1 A;  1MUX A;  3NSI A;  2FJU B;  1HT9 A;  3CWG A;  1GGW A;  2LMV A;  3BUN B;  3DVM A;  1UHK A;  1SYM A;  3EK4 A;  1C7V A;  1N2D A;  1SPY A;  1OZS A;  1CDP A;  1TN4 A;  2NXQ A;  4A4C A;  5G08 A;  1KFU L;  3OX6 A;  4QJ4 B;  5KTY A;  5BPJ A;  5GQQ C;  1R6P A;  3I5F B;  3QRX A;  1EG4 A;  1M63 B;  1M46 A;  2PRU A;  3KO0 A;  4MBE A;  2BE4 A;  1C07 A;  1DVI A;  2HF5 A;  1MHO A;  3BUO B;  4IL1 A;  2KI4 C;  4YRU A;  1TRF A;  2JQ6 A;  1PK0 D;  1GJY A;  1RFJ A;  1YUU A;  3CR2 A;  4OKH A;  5I2Q A;  2LC5 A;  4WQ2 A;  4YGC B;  4WRI A;  4CPV A;  1BJF A;  2EC6 B;  2LUX A;  5JOL A;  4MRY A;  3TS5 C;  5HYD A;  3TDZ A;  2FCD A;  3SJS A;  5B8I B;  2OTG C;  1DJI A;  1TNX A;  1N0Y A;  4HRE E;  5KU1 A;  1J7Q A;  2AUC A;  1NX2 A;  1LXF C;  2E30 A;  4XYN A;  1SCM B;  2BEC A;  1LA3 A;  1S5G Z;  2K7B A;  1KQV A;  1OQP A;  1A4P A;  3BOW B;  4GGF C;  5HKY A;  2BL0 C;  1SBJ A;  1ZOT B;  1DF0 B;  2WCF A;  1YRT B;  4FQO A;  1JF0 A;  2AMI A;  2OPO A;  2LHI A;  1OZO A;  1WDC C;  1SCM C;  4OV2 A;  1WLZ A;  1DJH A;  3H4S E;  5AXI A;  1CFF A;  1S6C A;  1NWD A;  1ZAC A;  2HQW A;  2CTN A;  2PMY A;  1LVC D;  1E8A A;  2KDH A;  1CLM A;  2MA2 A;  3GK4 X;  3O2P A;  4A4B A;  5AER A;  1J1E A;  1A29 A;  1DGU A;  4F0Z B;  3EVR A;  4JQ0 D;  1KFX L;  2KHN A;  3I5H B;  1DMO A;  2L4I A;  1OMD A;  1XFU O;  3RM1 A;  1JUO A;  1YVH A;  1SL7 A;  1OMV A;  4NDC A;  2KAX A;  1OMR A;  1Y0V H;  2K0J A;  2BBN A;  2BCA A;  2L5X B;  3OB1 B;  1TTX A;  4FTG A;  2KBM A;  1QJT A;  1CDM A;  2G9B A;  4E68 A;  1B8L A;  2GGM A;  3VRP A;  3O6B A;  4MRX A;  1CNP A;  1S5G Y;  2KI6 C;  1NX3 A;  4YI9 A;  1MR8 A;  1AP4 A;  2ZRS A;  1W7J B;  2ZN9 A;  1CMG A;  1SK6 D;  4ICB A;  3OB2 B;  2K7C A;  3VRN A;  1QIW A;  2MAZ A;  5K89 A;  5CPV A;  1BG1 A;  1JFK A;  2MJW B;  1NYA A;  1SR6 C;  3PM8 A;  4YI8 A;  1BR4 B;  2Y5I A;  2NCP A;  3GOF A;  2L0P A;  1UHN A;  4GGF A;  1LIN A;  1L2O B;  3EK8 A;  3FWB A;  1D1O A;  4PCW A;  2BKH B;  2KAV A;  1H8B A;  1HQV A;  3ZNI A;  4PAL A;  4DS7 A;  2B1U A;  3I5I C;  1NSH A;  3IQQ A;  1F4Q A;  2ZRT A;  3BOW A;  2ZN8 A;  2M8U A;  2LVJ A;  1YTZ C;  1L2O C;  1DF0 A;  3VRQ A;  3PSR A;  1YRU B;  1B9A A;  4CID A;  1F55 A;  3SG3 A;  4GUK A;  1XA5 A;  2G2B A;  4PE4 A;  4JWQ A;  1KSM A;  1K93 D;  1ALV A;  1TCO B;  1SCV A;  4GGN A;  1JWD A;  1NX1 A;  2F2P A;  1A03 A;  1S6I A;  4WQ3 A;  1IJ5 A;  2D8N A;  1MWN A;  1XFZ O;  1TIZ A;  4PHK A;  2H61 C;  1GQM A;  1OOJ A;  3KEV A;  2OS8 C;  2K61 A;  2HPS A;  3IQO A;  1AK8 A;  1ZMZ A;  2O5G A;  4C0J A;  3D0Y B;  3SIB A;  1RK9 A;  2BCB A; 
#chains in the Genus database with same CATH topology
 1C3Z A;  4GBA A;  1S6J A;  3DVE A;  1BF5 A;  2KLD A;  4MSP A;  2WOS A;  2WND A;  5HLO A;  1NCZ A;  2HQ8 A;  1F70 A;  2LAN A;  1FI5 A;  2KGB C;  3CYZ A;  3CZT X;  1CTR A;  1BLQ A;  3I5G C;  4XJK B;  1CFP A;  2CNP A;  2JUL A;  1U5I B;  4DCK A;  1RWY A;  1W9Z A;  5EL2 A;  1DT7 B;  1WRZ A;  2FJY A;  2I2R E;  1Z4H A;  3EKH A;  4N1F A;  4CFQ A;  2RGI A;  4YGE B;  3SG2 A;  1TNP A;  2BCX A;  5HKZ A;  3OBV A;  1DJZ A;  1JSA A;  2KFH A;  1PVA A;  3AAJ A;  3I5F C;  3GK1 A;  1RTP 1;  3UNW A;  1XK4 A;  4USL A;  3M0W A;  1UP5 A;  1Y6W A;  1OOH A;  5JJG A;  1RRO A;  5I2L A;  2IS9 A;  4C0K A;  3CR4 X;  3VRO A;  1F71 A;  1CMF A;  1KFU S;  2JPO A;  5ER4 X;  5KSZ A;  1CB1 A;  3WHT B;  2M7N A;  2QAC A;  2JXL A;  2WC5 A;  3KF9 A;  1IRJ A;  4MN0 A;  4ORB B;  4D1E A;  2CXJ A;  1J7R A;  4OZD A;  5F6T A;  1CDL A;  5PAL A;  1ODB A;  2JRF A;  1AJ4 A;  2M0R A;  3LK0 A;  1F54 A;  1IJ6 A;  4MVF A;  4QJ3 B;  2EC6 C;  5AEQ A;  2H61 A;  1KWO B;  3EK7 A;  1VRK A;  1AUI B;  3CLN A;  4FQT A;  4GNK B;  1UUR A;  5DIC A;  1YX7 A;  1SSE B;  4F7F A;  1OOF A;  1QXP A;  5TNC A;  1DJW A;  4I5N B;  4PT1 A;  4M2O A;  1CM4 A;  1XFX O;  2WOR A;  1M31 A;  4DIR A;  1S26 D;  2JNF A;  2LV7 A;  3S0A A;  2R2I A;  1NP8 A;  2M1K B;  2L4H A;  3DYE A;  2E6W A;  2JOJ A;  3D0Y A;  2L2E A;  4ORA B;  3S0E A;  1V1G A;  1PVB A;  1J7P A;  3VRR A;  1J1D A;  1K96 A;  2MLF C;  3PAL A;  4OVN F;  1OW4 A;  1QWV A;  2LMT A;  2NLN A;  3S0F A;  2JTT A;  4NDD A;  3N7H A;  1K9P A;  1FBV A;  3KHE A;  3PN7 B;  2KQ6 A;  2O60 A;  1TWO A;  1B47 A;  1CKK A;  4XJK A;  3OHM B;  2L98 A;  3FS7 A;  1U5I A;  3C1V A;  2CBL A;  2M97 A;  2Y1N A;  1DTL A;  1SY9 A;  2QEB A;  3I5H C;  1H4B A;  4Q04 A;  1SMG A;  1ZUZ A;  3VGO A;  1QX7 A;  2BE6 A;  3PFV A;  1A75 B;  2KBI A;  2LHL A;  5D69 A;  3IF7 A;  1XFR A;  1G4Y R;  3FWC A;  4AQI A;  1NPQ A;  1K90 D;  3BJH A;  1G33 A;  3TZ1 A;  4PHM A;  5J3X A;  3SG6 A;  2L51 A;  1S3P A;  2GGZ A;  2JWW A;  1KFX S;  1KQM B;  2I18 A;  2WC6 A;  3PLF B;  4AOM A;  1IH0 A;  2KNE A;  3FIA A;  2GTE A;  2Y4Q A;  3SS5 A;  5CSN A;  2K7O A;  4MZK A;  3LLE A;  5AAN A;  2MHH A;  2PVB A;  3D10 A;  1IQ3 A;  1WRK A;  1WY9 A;  1KQM C;  2L50 A;  4GAO A;  1OOG A;  1XO5 A;  2LLU A;  1BOD A;  1QVI Z;  1WRL A;  3K21 A;  1Y1U A;  1X02 A;  4PHJ A;  1IKU A;  1XK4 C;  1A2X A;  2F8P A;  2F3Z A;  3CZ1 A;  3B87 A;  3ICB A;  5FI7 A;  3FE8 A;  1B8R A;  1QX2 A;  3BUW B;  3BXK A;  3TUY B;  2BKI B;  3DZT A;  3BFB A;  3SG4 A;  1SRA A;  5IBW A;  1UHI A;  1TNW A;  2M49 B;  1N65 A;  1BR1 B;  1CFD A;  3D73 A;  1QV0 A;  2LP3 A;  1SNL A;  1PSR A;  3JVT B;  1IIO A;  1S1E A;  5ER5 A;  1XFV O;  2WCJ A;  2BAP A;  3KPX A;  1EG3 A;  1TOP A;  3EKJ A;  2LNK A;  5HL1 A;  1EXR A;  1QX5 B;  1OSA A;  2M3W A;  4IJ7 A;  1K2H A;  2WC8 A;  2F2O A;  2SCP A;  4KYN A;  2JXC A;  2H2K A;  3AAK A;  3DXL A;  1PAL A;  5FI2 A;  2PAS A;  3CZ2 A;  1JFJ A;  1XFY O;  2PQL A;  1AHR A;  1WLM A;  2VRG A;  4MEW A;  5FYX A;  3DVK A;  1QLK A;  2JC2 A;  2LVI A;  3NSO A;  2KPH A;  1LS8 A;  1F4O A;  1YVL A;  3NSL A;  5CSI A;  3LK1 A;  4MZL A;  1A75 A;  3DF0 B;  2M9G A;  1FW4 A;  1AVS A;  1IG5 A;  1QV1 A;  1SL8 A;  2DOQ A;  2GV5 A;  1YUS A;  2KQY A;  2LCP A;  2LUC A;  4P5O E;  1CDN A;  2K2F A;  1PRW A;  2FOT A;  1KK7 Z;  1AJ5 A;  3WNX B;  3NHI A;  5D3O A;  1QS7 A;  2LAP A;  2LVK A;  3DD4 A;  1Y1A A;  1R2U A;  1LKJ A;  1M39 A;  2JT0 A;  1RJV A;  2YGU A;  4OCI A;  5DKQ A;  1MXL C;  3CTN A;  3S0G A;  1IQ5 A;  2M29 A;  1GM0 A;  2KI4 B;  3B6X A;  5DKR A;  1IGV A;  1EL4 A;  2EGD A;  2KYC A;  2TN4 A;  5I8N A;  1IWQ A;  4CFR A;  3EVV A;  4DUQ A;  4YGA A;  5I2O A;  3BYA A;  1FI6 A;  3CZ0 A;  3EVU A;  1K9K A;  1XVJ A;  1BT6 A;  4JKT A;  1QAS A;  4L9M A;  4BY5 A;  4CLN A;  1LA0 A;  1BMO A;  1NX0 A;  2F33 A;  2KFG A;  2KSP A;  5DKN A;  3WHU B;  4BY4 A;  3GK2 A;  3TS5 B;  3A4U B;  1M45 A;  4INX A;  1CLB A;  2LM5 A;  4M2P A;  4ZCV A;  3LL8 B;  1DJX A;  2OTG B;  3R72 A;  1UHH A;  2K7D A;  1NCX A;  3AKB A;  2ZNE A;  3ZWH A;  1OE9 B;  1Y1X A;  1NIW A;  4GFT A;  1DGV A;  1KK7 Y;  3A8R A;  5HLV A;  2LLS A;  2BL0 B;  1KWO C;  2A4J A;  1PSB A;  2F3Y A;  1FF1 A;  2JU0 A;  3L4A A;  4INW A;  1V1F A;  1XFW O;  2LLT A;  3NHT A;  3NXA A;  1YX8 A;  3F45 A;  3D77 A;  1G8I A;  1BU3 A;  2I94 A;  2JT3 A;  4R1E A;  1WDC B;  3RLZ A;  1K9U A;  1MF8 B;  2P6B B;  1KCY A;  4ETO A;  1TNQ A;  4PE0 A;  1YUR A;  1B8C A;  2M7L A;  2EHB A;  2LP2 A;  1EJ3 A;  3DF0 A;  1K8U A;  4PHN A;  2P70 A;  1YUT A;  1PUL A;  3JTD B;  3CS1 A;  1W7I B;  3BUM B;  1SW8 A;  3BUX B;  4PDZ A;  3E3R A;  4PE1 A;  2JPT A;  3O78 A;  1YR5 A;  3PN7 C;  2LE9 B;  2ZKM X;  1JBA A;  1J7O A;  4I5K A;  3CGA A;  2V53 A;  3JTD C;  1B7T Z;  3BQ3 A;  1KK8 B;  5HKW A;  3R1P A;  4ORC B;  3DY9 A;  1UHJ A;  1TCF A;  4HRH A;  4NDB A;  1CFC A;  1ZFS A;  4MLW A;  1T14 A;  2COL B;  3OX5 A;  2LMU A;  3VB1 A;  1JF2 A;  1K94 A;  3FE6 A;  1SKT A;  2ISD A;  2NZ0 A;  1S36 A;  1QTX A;  3CR5 X;  4N5X A;  2KFF A;  2ZND A;  1KK8 C;  1UUS A;  3S0B A;  2CT9 A;  3IVT A;  3DVJ A;  5CSJ A;  3SG7 A;  3SIA A;  1J55 A;  1NUB A;  1SR6 B;  1TUJ A;  1CM1 A;  2H8V A;  2MRD A;  4HSZ A;  3TDI A;  2LVV A;  1UWO A;  4PE7 A;  4OR9 B;  1MXE A;  3WXA A;  1REC A;  3D75 A;  4MZJ A;  1QIV A;  1L7Z A;  5I94 A;  3S0D A;  3I5I B;  3B7A A;  3SG5 A;  1SL9 A;  1QLS A;  1TUZ A;  3L47 A;  1XYD A;  2JNX A;  2WCE A;  4C0L A;  1GGZ A;  5D7F A;  1DJY A;  5AFP A;  3O4Y A;  1F8H A;  3HX4 A;  1Q80 A;  4GPL B;  1B7T Y;  3OP0 A;  4QJ5 B;  4M2Q A;  1DQE A;  4DRW A;  1FPW A;  1NCY A;  1B1G A;  2NCO A;  1C7W A;  2JTZ A;  3TDU A;  2JZI A;  1K95 A;  2KGR A;  2MLE C;  2KI6 D;  2CCM A;  2QPT A;  2ZFD A;  3D76 A;  4HRG A;  4P2Y B;  3TUY C;  1JC2 A;  4YBH B;  2K2A A;  2KOT A;  3RZS A;  1KSO A;  2HET A;  2AAO A;  4YGD B;  4AQJ A;  2M1U A;  3JVT C;  4ZCU A;  2Y1M A;  2QEO A;  2FCE A;  2PSR A;  4U8D A;  2JT8 A;  3R1O A;  2Q4U A;  2WCB A;  4YGB B;  2K8M B;  1QVI Y;  3BFA A;  4TNC A;  2OS8 B;  3PAT A;  3SS4 A;  4JPZ B;  2KYF A;  2MBX A;  1BOC A;  1QAT A;  4N1G A;  3HCM A;  3MSE B;  2KAY A;  2Q91 A;  2SAS A;  1B4C A;  1ALW A;  1DJG A;  1CLL A;  2I7A A;  3LCP C;  4UPG A;  4NQG A;  3AKA A;  2BBM A;  2WCL A;  4I5J A;  1EH2 A;  2WCH A;  4I5L B;  2PAL A;  5CSF A;  3I5G B;  2BNX A;  3NSK A;  1MQ1 A;  1MUX A;  3NSI A;  2FJU B;  1HT9 A;  3CWG A;  1GGW A;  2LMV A;  3BUN B;  2QEH A;  1UHK A;  3CAB A;  1SYM A;  3D78 A;  3DVM A;  1N2D A;  3EK4 A;  1C7V A;  1SPY A;  1OZS A;  1CDP A;  1TN4 A;  3K1E A;  3OGN A;  2NXQ A;  4A4C A;  5G08 A;  2QDI A;  3EG5 B;  3PJI A;  1KFU L;  3OX6 A;  4QJ4 B;  5KTY A;  5BPJ A;  5GQQ C;  1R6P A;  3I5F B;  3QRX A;  1EG4 A;  1M63 B;  1M46 A;  2PRU A;  3CDN A;  3KO0 A;  2BE4 A;  4MBE A;  1DVI A;  2HF5 A;  1C07 A;  1MHO A;  3O4X A;  3BUO B;  4IL1 A;  2KI4 C;  4YRU A;  1TRF A;  2WCM A;  2JQ6 A;  1PK0 D;  1GJY A;  1RFJ A;  1YUU A;  3CR2 A;  3UO9 A;  4OKH A;  5I2Q A;  2LC5 A;  4WQ2 A;  4YGC B;  4WRI A;  4CPV A;  3Q8I A;  1BJF A;  2EC6 B;  2LUX A;  5JOL A;  4MRY A;  3TS5 C;  5HYD A;  3TDZ A;  2FCD A;  3SJS A;  5B8I B;  2OTG C;  1DJI A;  1TNX A;  1N0Y A;  4HRE E;  5KU1 A;  1J7Q A;  2AUC A;  2K60 A;  1NX2 A;  1LXF C;  2E30 A;  2KLE A;  2QEV A;  1SCM B;  2BEC A;  4XYN A;  1LA3 A;  1S5G Z;  3B88 A;  2K7B A;  1KQV A;  1OQP A;  1A4P A;  3BOW B;  4GGF C;  5HKY A;  2BL0 C;  1SBJ A;  1ZOT B;  1DF0 B;  2WCF A;  1YRT B;  4FQO A;  2L5Y A;  1JF0 A;  2AMI A;  2OPO A;  2LHI A;  1OZO A;  1WDC C;  1SCM C;  4OV2 A;  1WLZ A;  1DJH A;  3H4S E;  5AXI A;  1CFF A;  1S6C A;  1NWD A;  1ZAC A;  2HQW A;  2CTN A;  2PMY A;  3R1V A;  1LVC D;  1E8A A;  2KDH A;  1CLM A;  2MA2 A;  3GK4 X;  3O2P A;  3FE9 A;  3PM2 A;  4A4B A;  1J1E A;  5AER A;  1A29 A;  1DGU A;  1C3Y A;  4F0Z B;  3EVR A;  4JQ0 D;  1KFX L;  2KHN A;  3I5H B;  1DMO A;  2L4I A;  1OMD A;  1XFU O;  3RM1 A;  1JUO A;  1YVH A;  1SL7 A;  1OMV A;  4NDC A;  2KAX A;  1OMR A;  1Y0V H;  2K0J A;  2BBN A;  2BCA A;  1OOI X;  2L5X B;  3OB1 B;  1TTX A;  2P71 A;  4FTG A;  2KBM A;  1QJT A;  1CDM A;  2G9B A;  4E68 A;  1B8L A;  2GGM A;  3VRP A;  3O6B A;  4MRX A;  1CNP A;  1S5G Y;  2KI6 C;  1NX3 A;  4YI9 A;  1MR8 A;  5FI6 A;  1AP4 A;  2WCK A;  2ZRS A;  1W7J B;  2ZN9 A;  1CMG A;  1SK6 D;  4ICB A;  3OB2 B;  2K7C A;  3VRN A;  1DC1 A;  1QIW A;  2MAZ A;  5K89 A;  5CPV A;  1BG1 A;  1Z2C B;  1JFK A;  2MJW B;  1NYA A;  3D74 A;  1SR6 C;  3NGV A;  3PM8 A;  4YI8 A;  3V2L A;  1BR4 B;  2Y5I A;  2NCP A;  3GOF A;  2L0P A;  1UHN A;  4GGF A;  1DEL A;  1LIN A;  1L2O B;  3EK8 A;  3FWB A;  1D1O A;  4PCW A;  2BKH B;  2KAV A;  1H8B A;  1HQV A;  3ZNI A;  4PAL A;  4DS7 A;  2B1U A;  4JD9 A;  3I5I C;  1DEK A;  1NSH A;  3IQQ A;  1F4Q A;  2ZRT A;  3BOW A;  2ZN8 A;  2M8U A;  2LVJ A;  1YTZ C;  1L2O C;  2L2C A;  1DF0 A;  3VRQ A;  3PSR A;  1YRU B;  1B9A A;  3SS3 A;  4CID A;  1F55 A;  3SG3 A;  4GUK A;  1XA5 A;  2G2B A;  4PE4 A;  4JWQ A;  1KSM A;  1K93 D;  3BFH A;  1ALV A;  3L4L A;  1TCO B;  2PYQ A;  1SCV A;  4GGN A;  1JWD A;  1NX1 A;  2F2P A;  3B86 A;  1S6I A;  4WQ3 A;  1A03 A;  1IJ5 A;  2ERB A;  2D8N A;  1MWN A;  1XFZ O;  1TIZ A;  4PHK A;  2H61 C;  1GQM A;  1OOJ A;  1ORG A;  3KEV A;  2OS8 C;  2K61 A;  2HPS A;  3IQO A;  1AK8 A;  3QME A;  1ZMZ A;  2O5G A;  1P28 A;  4C0J A;  3D0Y B;  3SIB A;  1RK9 A;  2BCB A; 
#chains in the Genus database with same CATH homology
 4GBA A;  1S6J A;  3DVE A;  1BF5 A;  4MSP A;  2WOS A;  2WND A;  5HLO A;  1NCZ A;  2HQ8 A;  1F70 A;  2LAN A;  1FI5 A;  2KGB C;  3CZT X;  1BLQ A;  1CTR A;  3I5G C;  4XJK B;  1CFP A;  2CNP A;  2JUL A;  1U5I B;  4DCK A;  1RWY A;  1DT7 B;  1WRZ A;  2I2R E;  3EKH A;  4N1F A;  4CFQ A;  2RGI A;  4YGE B;  3SG2 A;  1TNP A;  2BCX A;  5HKZ A;  1JSA A;  1DJZ A;  2KFH A;  1PVA A;  3AAJ A;  3I5F C;  3GK1 A;  1RTP 1;  1XK4 A;  4USL A;  3M0W A;  1UP5 A;  1Y6W A;  5JJG A;  1RRO A;  5I2L A;  2IS9 A;  4C0K A;  3CR4 X;  3VRO A;  1F71 A;  1CMF A;  1KFU S;  5ER4 X;  5KSZ A;  1CB1 A;  3WHT B;  2M7N A;  2QAC A;  2JXL A;  3KF9 A;  1IRJ A;  4MN0 A;  4ORB B;  4D1E A;  2CXJ A;  1J7R A;  5F6T A;  1CDL A;  5PAL A;  1ODB A;  2JRF A;  1AJ4 A;  2M0R A;  3LK0 A;  1F54 A;  1IJ6 A;  4MVF A;  4QJ3 B;  2EC6 C;  5AEQ A;  2H61 A;  1KWO B;  3EK7 A;  1VRK A;  1AUI B;  3CLN A;  4GNK B;  1UUR A;  1YX7 A;  1QXP A;  5TNC A;  1DJW A;  4I5N B;  4M2O A;  1CM4 A;  1XFX O;  2WOR A;  1M31 A;  4DIR A;  1S26 D;  2JNF A;  2LV7 A;  2R2I A;  1NP8 A;  2M1K B;  2L4H A;  2E6W A;  2JOJ A;  3D0Y A;  2L2E A;  4ORA B;  1V1G A;  1PVB A;  1J7P A;  3VRR A;  1J1D A;  1K96 A;  2MLF C;  3PAL A;  4OVN F;  2NLN A;  2LMT A;  2JTT A;  4NDD A;  1K9P A;  1FBV A;  3KHE A;  3PN7 B;  2KQ6 A;  2O60 A;  1B47 A;  1CKK A;  4XJK A;  3OHM B;  2L98 A;  3FS7 A;  1U5I A;  3C1V A;  2CBL A;  2M97 A;  2Y1N A;  1DTL A;  1SY9 A;  3I5H C;  1H4B A;  4Q04 A;  1SMG A;  1ZUZ A;  3VGO A;  1QX7 A;  2BE6 A;  3PFV A;  1A75 B;  2KBI A;  2LHL A;  5D69 A;  3IF7 A;  1G4Y R;  3FWC A;  4AQI A;  1NPQ A;  1K90 D;  1G33 A;  3TZ1 A;  4PHM A;  5J3X A;  3SG6 A;  2L51 A;  1S3P A;  2GGZ A;  2JWW A;  1KFX S;  1KQM B;  2I18 A;  3PLF B;  4AOM A;  1IH0 A;  2KNE A;  3FIA A;  2Y4Q A;  5CSN A;  2K7O A;  4MZK A;  3LLE A;  5AAN A;  2MHH A;  2PVB A;  3D10 A;  1IQ3 A;  1WRK A;  1WY9 A;  1KQM C;  2L50 A;  4GAO A;  1XO5 A;  2LLU A;  1BOD A;  1QVI Z;  1WRL A;  3K21 A;  1Y1U A;  1X02 A;  4PHJ A;  1IKU A;  1XK4 C;  1A2X A;  2F8P A;  2F3Z A;  3ICB A;  1B8R A;  1QX2 A;  3BUW B;  3BXK A;  3TUY B;  2BKI B;  3SG4 A;  5IBW A;  1SRA A;  1UHI A;  1TNW A;  2M49 B;  1N65 A;  1BR1 B;  1CFD A;  1QV0 A;  2LP3 A;  1SNL A;  1PSR A;  3JVT B;  1S1E A;  5ER5 A;  1XFV O;  3KPX A;  1EG3 A;  1TOP A;  3EKJ A;  2LNK A;  1EXR A;  1QX5 B;  1OSA A;  2M3W A;  1K2H A;  2WC8 A;  2F2O A;  2SCP A;  2JXC A;  2H2K A;  3AAK A;  1PAL A;  2PAS A;  1JFJ A;  1XFY O;  1AHR A;  1WLM A;  2VRG A;  4MEW A;  5FYX A;  3DVK A;  1QLK A;  2JC2 A;  2LVI A;  3NSO A;  1F4O A;  1YVL A;  3NSL A;  5CSI A;  3LK1 A;  4MZL A;  1A75 A;  3DF0 B;  2M9G A;  1FW4 A;  1AVS A;  1IG5 A;  1QV1 A;  1SL8 A;  2DOQ A;  2GV5 A;  1YUS A;  2KQY A;  2LCP A;  2LUC A;  4P5O E;  1CDN A;  2K2F A;  1PRW A;  2FOT A;  1KK7 Z;  1AJ5 A;  3WNX B;  1QS7 A;  2LAP A;  2LVK A;  3DD4 A;  1Y1A A;  1R2U A;  1LKJ A;  1M39 A;  2JT0 A;  1RJV A;  4OCI A;  5DKQ A;  1MXL C;  3CTN A;  1IQ5 A;  2M29 A;  2KI4 B;  5DKR A;  1IGV A;  1EL4 A;  2EGD A;  2KYC A;  2TN4 A;  5I8N A;  1IWQ A;  4CFR A;  3EVV A;  4DUQ A;  4YGA A;  5I2O A;  3BYA A;  1FI6 A;  3EVU A;  1K9K A;  1XVJ A;  1BT6 A;  4BY5 A;  1QAS A;  4L9M A;  4CLN A;  1LA0 A;  1BMO A;  1NX0 A;  2F33 A;  2KFG A;  2KSP A;  5DKN A;  3WHU B;  4BY4 A;  3GK2 A;  3TS5 B;  3A4U B;  1M45 A;  1CLB A;  2LM5 A;  4M2P A;  4ZCV A;  3LL8 B;  1DJX A;  2OTG B;  1UHH A;  2K7D A;  1NCX A;  3AKB A;  2ZNE A;  3ZWH A;  1OE9 B;  1Y1X A;  1NIW A;  4GFT A;  1DGV A;  1KK7 Y;  3A8R A;  5HLV A;  2LLS A;  2BL0 B;  1KWO C;  2A4J A;  1PSB A;  2F3Y A;  1FF1 A;  2JU0 A;  1V1F A;  1XFW O;  2LLT A;  3NXA A;  1YX8 A;  3F45 A;  1G8I A;  1BU3 A;  2I94 A;  2JT3 A;  4R1E A;  1WDC B;  3RLZ A;  1K9U A;  1MF8 B;  2P6B B;  1KCY A;  4ETO A;  1TNQ A;  4PE0 A;  1YUR A;  1B8C A;  2M7L A;  2EHB A;  2LP2 A;  1EJ3 A;  3DF0 A;  1K8U A;  4PHN A;  1YUT A;  1PUL A;  3JTD B;  3CS1 A;  1W7I B;  3BUM B;  1SW8 A;  3BUX B;  4PDZ A;  3E3R A;  4PE1 A;  2JPT A;  3O78 A;  1YR5 A;  3PN7 C;  2LE9 B;  2ZKM X;  1JBA A;  1J7O A;  4I5K A;  3CGA A;  2V53 A;  3JTD C;  1B7T Z;  3BQ3 A;  1KK8 B;  5HKW A;  4ORC B;  1UHJ A;  1TCF A;  4HRH A;  4NDB A;  1CFC A;  1ZFS A;  4MLW A;  2COL B;  3OX5 A;  2LMU A;  1JF2 A;  1K94 A;  2ISD A;  1SKT A;  2NZ0 A;  1S36 A;  1QTX A;  3CR5 X;  4N5X A;  2KFF A;  2ZND A;  1KK8 C;  1UUS A;  2CT9 A;  3DVJ A;  5CSJ A;  3SG7 A;  3SIA A;  1J55 A;  1NUB A;  1SR6 B;  1CM1 A;  2MRD A;  4HSZ A;  3TDI A;  2LVV A;  1UWO A;  4PE7 A;  4OR9 B;  1MXE A;  3WXA A;  1REC A;  4MZJ A;  1QIV A;  1L7Z A;  3I5I B;  3SG5 A;  1SL9 A;  1QLS A;  1XYD A;  2JNX A;  2WCE A;  4C0L A;  1GGZ A;  5D7F A;  1DJY A;  5AFP A;  3O4Y A;  1F8H A;  3HX4 A;  1Q80 A;  4GPL B;  1B7T Y;  3OP0 A;  4QJ5 B;  4M2Q A;  4DRW A;  1FPW A;  1NCY A;  1B1G A;  2NCO A;  1C7W A;  2JTZ A;  3TDU A;  2JZI A;  1K95 A;  2KGR A;  2MLE C;  2KI6 D;  2CCM A;  2QPT A;  2ZFD A;  4HRG A;  4P2Y B;  3TUY C;  1JC2 A;  4YBH B;  2K2A A;  2KOT A;  1KSO A;  2HET A;  2AAO A;  4YGD B;  4AQJ A;  2M1U A;  3JVT C;  4ZCU A;  2Y1M A;  4U8D A;  2FCE A;  2PSR A;  2JT8 A;  2Q4U A;  2WCB A;  4YGB B;  2K8M B;  1QVI Y;  4TNC A;  2OS8 B;  3PAT A;  1BOC A;  4JPZ B;  2KYF A;  2MBX A;  1QAT A;  4N1G A;  3HCM A;  3MSE B;  2KAY A;  2Q91 A;  2SAS A;  1B4C A;  1ALW A;  1DJG A;  1CLL A;  2I7A A;  3LCP C;  4UPG A;  4NQG A;  3AKA A;  2BBM A;  4I5J A;  1EH2 A;  4I5L B;  2PAL A;  5CSF A;  3I5G B;  3NSK A;  1MQ1 A;  1MUX A;  3NSI A;  2FJU B;  1HT9 A;  3CWG A;  1GGW A;  2LMV A;  3BUN B;  3DVM A;  1UHK A;  1SYM A;  3EK4 A;  1C7V A;  1N2D A;  1SPY A;  1OZS A;  1CDP A;  1TN4 A;  2NXQ A;  4A4C A;  5G08 A;  1KFU L;  3OX6 A;  4QJ4 B;  5KTY A;  5BPJ A;  5GQQ C;  1R6P A;  3I5F B;  3QRX A;  1EG4 A;  1M63 B;  1M46 A;  2PRU A;  3KO0 A;  4MBE A;  2BE4 A;  1C07 A;  1DVI A;  2HF5 A;  1MHO A;  3BUO B;  4IL1 A;  2KI4 C;  4YRU A;  1TRF A;  2JQ6 A;  1PK0 D;  1GJY A;  1RFJ A;  1YUU A;  3CR2 A;  4OKH A;  5I2Q A;  2LC5 A;  4WQ2 A;  4YGC B;  4WRI A;  4CPV A;  1BJF A;  2EC6 B;  2LUX A;  5JOL A;  4MRY A;  3TS5 C;  5HYD A;  3TDZ A;  2FCD A;  3SJS A;  5B8I B;  2OTG C;  1DJI A;  1TNX A;  1N0Y A;  4HRE E;  5KU1 A;  1J7Q A;  2AUC A;  1NX2 A;  1LXF C;  2E30 A;  4XYN A;  1SCM B;  2BEC A;  1LA3 A;  1S5G Z;  2K7B A;  1KQV A;  1OQP A;  1A4P A;  3BOW B;  4GGF C;  5HKY A;  2BL0 C;  1SBJ A;  1ZOT B;  1DF0 B;  2WCF A;  1YRT B;  4FQO A;  1JF0 A;  2AMI A;  2OPO A;  2LHI A;  1OZO A;  1WDC C;  1SCM C;  4OV2 A;  1WLZ A;  1DJH A;  3H4S E;  5AXI A;  1CFF A;  1S6C A;  1NWD A;  1ZAC A;  2HQW A;  2CTN A;  2PMY A;  1LVC D;  1E8A A;  2KDH A;  1CLM A;  2MA2 A;  3GK4 X;  3O2P A;  4A4B A;  5AER A;  1J1E A;  1A29 A;  1DGU A;  4F0Z B;  3EVR A;  4JQ0 D;  1KFX L;  2KHN A;  3I5H B;  1DMO A;  2L4I A;  1OMD A;  1XFU O;  3RM1 A;  1JUO A;  1YVH A;  1SL7 A;  1OMV A;  4NDC A;  2KAX A;  1OMR A;  1Y0V H;  2K0J A;  2BBN A;  2BCA A;  2L5X B;  3OB1 B;  1TTX A;  4FTG A;  2KBM A;  1QJT A;  1CDM A;  2G9B A;  4E68 A;  1B8L A;  2GGM A;  3VRP A;  3O6B A;  4MRX A;  1CNP A;  1S5G Y;  2KI6 C;  1NX3 A;  4YI9 A;  1MR8 A;  1AP4 A;  2ZRS A;  1W7J B;  2ZN9 A;  1CMG A;  1SK6 D;  4ICB A;  3OB2 B;  2K7C A;  3VRN A;  1QIW A;  2MAZ A;  5K89 A;  5CPV A;  1BG1 A;  1JFK A;  2MJW B;  1NYA A;  1SR6 C;  3PM8 A;  4YI8 A;  1BR4 B;  2Y5I A;  2NCP A;  3GOF A;  2L0P A;  1UHN A;  4GGF A;  1LIN A;  1L2O B;  3EK8 A;  3FWB A;  1D1O A;  4PCW A;  2BKH B;  2KAV A;  1H8B A;  1HQV A;  3ZNI A;  4PAL A;  4DS7 A;  2B1U A;  3I5I C;  1NSH A;  3IQQ A;  1F4Q A;  2ZRT A;  3BOW A;  2ZN8 A;  2M8U A;  2LVJ A;  1YTZ C;  1L2O C;  1DF0 A;  3VRQ A;  3PSR A;  1YRU B;  1B9A A;  4CID A;  1F55 A;  3SG3 A;  4GUK A;  1XA5 A;  2G2B A;  4PE4 A;  4JWQ A;  1KSM A;  1K93 D;  1ALV A;  1TCO B;  1SCV A;  4GGN A;  1JWD A;  1NX1 A;  2F2P A;  1A03 A;  1S6I A;  4WQ3 A;  1IJ5 A;  2D8N A;  1MWN A;  1XFZ O;  1TIZ A;  4PHK A;  2H61 C;  1GQM A;  1OOJ A;  3KEV A;  2OS8 C;  2K61 A;  2HPS A;  3IQO A;  1AK8 A;  1ZMZ A;  2O5G A;  4C0J A;  3D0Y B;  3SIB A;  1RK9 A;  2BCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...