4N1GA

Crystal structure of ca(2+)- discharged f88y obelin mutant from obelia longissima at 1.50 angstrom resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
194
structure length
194
Chain Sequence
ASKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQYLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Crystal structures of the F88Y obelin mutant before and after bioluminescence provide molecular insight into spectral tuning among hydromedusan photoproteins
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 88
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4n1gA00
3KHEA 5GQQC 1A75B 2EC6C 3EK4A 5AEQA 3ZNIA 1BMOA 1SKTA 2BL0C 2L4IA 1M45A 1BJFA 1MWNA 2JT8A 4USLA 3O2PA 4ZCVA 1RK9A 1N65A 2BKHB 1UHNA 3DD4A 3I5IB 4YI9A 2KFGA 2LE9B 2LP2A 2MA2A 1K9PA 4I5LB 1BOCA 3LCPC 2G2BA 5DKRA 1OMRA 1CTRA 1KK7Z 4GBAA 1A75A 2EC6B 1OQPA 2BL0B 1KQMC 2H2KA 1IRJA 3OX5A 3EK7A 1S1EA 2OPOA 3I5HC 4YGAA 1H8BA 1DJGA 1NX3A 1M46A 1AUIB 1YVLA 4WQ3A 2WCEA 3PLFB 3DVJA 2NXQA 1DJIA 1OMDA 4GGFC 3TDIA 3E3RA 2JTZA 1EG3A 1R2UA 1JSAA 2AMIA 1KWOC 1KFUS 2K7DA 1B8CA 1KSOA 3I5HB 1YRTB 4DCKA 3AAJA 1S6JA 3I5GC 5PALA 2Y1MA 3GOFA 4I5JA 2F2PA 3EK8A 1EG4A 2DOQA 3OHMB 1CFCA 1LVCD 4M2QA 1QX7A 1ZOTB 5HKZA 2M9GA 1A4PA 1Y1AA 3ICBA 3QRXA 1IGVA 1QTXA 1YUUA 1HT9A 3BQ3A 1AHRA 1B47A 5B8IB 2KOTA 4NDBA 3CR4X 1KWOB 4CPVA 1K9UA 2JPTA 3TZ1A 1LA3A 4WQ2A 2JXCA 2JZIA 3I5GB 1TNXA 4PHNA 1KSMA 2I94A 1OE9B 3WHTB 4GUKA 3F45A 1K90D 2JT3A 1K8UA 2BBMA 3LL8B 5ER4X 1XYDA 1MQ1A 2FJUB 2LCPA 4OVNF 2M97A 1QVIZ 1IQ5A 4M2OA 2KBIA 2ZKMX 2LMVA 3JVTC 3SIAA 3TUYC 2MAZA 1RFJA 5AFPA 1QIVA 4YGBB 2LV7A 2MHHA 1J7PA 2BECA 3GK4X 2LM5A 1K2HA 4OCIA 2MBXA 3SG4A 4R1EA 3BUXB 1JC2A 1C07A 2MRDA 1DGVA 3EVRA 4N1FA 1G4YR 1B7TZ 3CWGA 1UP5A 1Y1UA 3MSEB 3NSLA 2KI4C 1XVJA 4L9MA 4P2YB 1PK0D 4IL1A 1U5IB 3DVEA 3JVTB 1SRAA 2F33A 1QX2A 1FBVA 3TUYB 3SG5A 5CSIA 1BR4B 3HX4A 1UURA 2TN4A 2HF5A 2OS8C 2R2IA 3DVMA 3KPXA 3TS5C 3D0YB 3PN7C 1TRFA 2K2AA 1PRWA 3KO0A 3M0WA 1B9AA 4OKHA 1NX0A 1RTP1 1JFJA 2CCMA 1XFVO 2KI4B 2JNFA 1QLKA 4GFTA 4HREE 2HPSA 2M1KB 1FPWA 1U5IA 4JWQA 1KFUL 4MRXA 3PFVA 1TNWA 2PSRA 1GJYA 3EVUA 2ZNEA 2MJWB 1IH0A 1LA0A 3O4YA 2OS8B 2K7CA 3TS5B 3D0YA 1N2DA 3OB1B 3PN7B 1AK8A 2L2EA 1QV1A 2AAOA 3OX6A 4NDDA 3VRNA 2O5GA 4YI8A 3TDUA 1CB1A 3PSRA 1W7IB 1KFXS 1IJ6A 5F6TA 2LUXA 5JJGA 4BY5A 3WHUB 1FI5A 1BLQA 1HQVA 1NPQA 2VRGA 3PATA 3BYAA 4QJ3B 2LUCA 2KI6D 3FWCA 3OP0A 1NWDA 3PM8A 2KDHA 1S26D 1JUOA 1QS7A 1S6CA 2H61A 2KNEA 1XK4C 1KK8C 4JPZB 1NCXA 2M8UA 1PVAA 2CBLA 1Y0VH 1QIWA 2WNDA 3BUOB 1IKUA 1DF0A 5JOLA 2ZFDA 1QJTA 1WRKA 2WCBA 2BCXA 1PVBA 1RJVA 4MVFA 1S5GZ 1TCOB 2COLB 4PCWA 1OZSA 2CXJA 3CR2A 4YGCB 1EH2A 2M49B 1UHJA 2LLUA 2F3ZA 4BY4A 1KK8B 2HQ8A 1SMGA 3HCMA 3CLNA 4AQIA 1M39A 4I5NB 3VRRA 4A4BA 1C7VA 4MZLA 1YX8A 2SCPA 3FWBA 1FI6A 2SASA 1NX1A 2O60A 4HRHA 1DTLA 1S6IA 4OR9B 1F54A 1J1DA 2FOTA 1KQMB 5TNCA 1XK4A 1NCZA 1AVSA 2PALA 5HLOA 3BUMB 1CFPA 1CDPA 1B8RA 3EKJA 1J7RA 3VRPA 1ALVA 1B1GA 4YGEB 1YR5A 1CM4A 1SBJA 1CDLA 3VROA 1KK7Y 2L0PA 2B1UA 5K89A 5KSZA 2PASA 3SIBA 4QJ4B 2ZRTA 4XJKB 1UWOA 1M31A 1MHOA 3CZTX 2L98A 1LXFC 2K7BA 1LKJA 2AUCA 2KFHA 1DJZA 4AOMA 5HYDA 1L7ZA 5HLVA 1V1GA 4GPLB 1WLMA 1QASA 2Y4QA 4E68A 2F8PA 2KAXA 1ZFSA 4YBHB 4PE7A 5HKWA 4MRYA 1BG1A 3CR5X 4NQGA 1SYMA 4XJKA 4N1GA 1GGZA 1WDCC 1CLMA 3CGAA 1EJ3A 1MUXA 1WY9A 3A8RA 3NSOA 2LC5A 2PMYA 2BE4A 2BCBA 2KAVA 3BUNB 4Q04A 1PSBA 4D1EA 2KQYA 1NIWA 4MZKA 2KSPA 2ZN9A 1OZOA 1XFXO 2M7NA 2KHNA 2L4HA 1SY9A 2LNKA 1JF2A 1RWYA 2BKIB 1F55A 1WDCB 1G33A 4WRIA 4HRGA 1MXEA 4CFQA 2BE6A 1DJWA 2QPTA 3KEVA 2H61C 5KU1A 1DT7B 1V1FA 2LVIA 4MZJA 2M3WA 2WORA 1CMGA 2JQ6A 2ZRSA 5CSJA 1QVIY 3JTDC 1Y6WA 1XFYO 4C0JA 1CM1A 1TCFA 1EXRA 3C1VA 2LVJA 1J1EA 1D1OA 3BOWA 1NYAA 1QLSA 1K95A 2KBMA 3BXKA 1IQ3A 4ZCUA 1BT6A 1B7TY 3D10A 2ISDA 2JU0A 1JFKA 1S36A 2Q4UA 3AKAA 3LLEA 4C0LA 4PE1A 2E30A 3JTDB 1BU3A 1NX2A 2GGMA 3RM1A 5BPJA 2FCDA 1DF0B 3RLZA 2F3YA 4FQOA 2E6WA 3SG7A 4DIRA 1TN4A 3SG6A 1BR1B 1F4OA 3SJSA 2JULA 1SNLA 1ODBA 1SCVA 1DVIA 2KAYA 4A4CA 1N0YA 2PRUA 2P6BB 2KGBC 5AERA 1AP4A 1SPYA 1CDMA 3GK1A 2EGDA 2JXLA 1G8IA 5I2OA 3NXAA 4PDZA 4P5OE 1NUBA 1QXPA 1R6PA 2CT9A 2K61A 4OV2A 3GK2A 2I18A 1XO5A 1OOJA 1Y1XA 2K2FA 2KI6C 4MLWA 1CFDA 1GQMA 2QACA 4TNCA 4CFRA 4M2PA 1TTXA 4MEWA 5FYXA 3IQQA 1QATA 2OTGC 2F2OA 4I5KA 3O78A 3VRQA 4YGDB 2NLNA 2CNPA 1K9KA 4U8DA 3VGOA 1CDNA 2LLTA 1AJ4A 5G08A 2MLFC 1A03A 4GGNA 1UUSA 3I5FC 1XFZO 1B4CA 2M7LA 1K94A 1OSAA 5J3XA 1KQVA 1DMOA 2JNXA 4PE4A 3H4SE 4HSZA 3O6BA 2OTGB 1TNQA 2NZ0A 2Y5IA 5I2LA 2LHLA 1MXLC 1NP8A 4ORBB 4PHMA 3WXAA 1S5GY 1FF1A 1SR6C 1PALA 1X02A 4XYNA 3AKBA 2CTNA 2IS9A 1SW8A 2BCAA 2Y1NA 1C7WA 1L2OC 3I5FB 2LLSA 5D69A 4GNKB 2KGRA 1UHIA 5D7FA 1F8HA 3SG3A 5I8NA 4MN0A 2V53A 4NDCA 1BODA 1K96A 2EHBA 1TOPA 4MSPA 2LMUA 3LK0A 3K21A 1MF8B 1UHHA 4FTGA 5I2QA 4YRUA 1K93D 1KFXL 1M63B 1TNPA 1ZUZA 2LMTA 1SR6B 1ZMZA 1WRLA 1NCYA 1DGUA 1XA5A 3PALA 1L2OB 3FS7A 5CSNA 1PULA 1CMFA 1WRZA 1JBAA 5DKNA 5AANA 1SK6D 2LVKA 3BUWB 3A4UB 2G9BA 1SL9A 1DJHA 1AJ5A 1F4QA 3IF7A 4ICBA 1YRUB 2JTTA 2ZN8A 1KCYA 1TIZA 1RECA 1QV0A 1VRKA 1WLZA 1YVHA 2WOSA 2BBNA 2NCPA 1LINA 3NSIA 4C0KA 2K8MB 2L51A 4GGFA 5IBWA 3OB2B 1JF0A 3KF9A 1A29A 2JRFA 1IG5A 2KFFA 2Q91A 3EVVA 3SG2A 4DS7A 4UPGA 1DJYA 2GV5A 1SL8A 1ZACA 1J7OA 1A2XA 4ORAB 3EKHA 1JWDA 4AQJA 4QJ5B 1YUSA 4ETOA 1XFUO 1S3PA 2M29A 3BOWB 2D8NA 1YTZC 4ORCB 1F70A 4PE0A 1NSHA 1ALWA 1E8AA 1CLLA 2JT0A 3IQOA 5DKQA 4MBEA 2ZNDA 2K0JA 1B8LA 3NSKA 3WNXB 3DF0B 4PALA 3ZWHA 4F0ZB 1UHKA 5CSFA 2WC8A 1CNPA 1F71A 2L50A 1EL4A 1DJXA 3CTNA 1CFFA 1H4BA 1OMVA 3CS1A 4JQ0D 2K7OA 2A4JA 1CLBA 1J7QA 1MR8A 4GAOA 4DUQA 1CKKA 1IWQA 1W7JB 2FCEA 3DVKA 3TDZA 4N5XA 1XFWO 4CLNA 3DF0A 2M1UA 2I7AA 1PSRA 2LP3A 2PVBA 2KQ6A 5HKYA 5ER5A 1BF5A 1FW4A 1SCMC 5AXIA 3AAKA 1YURA 2KYCA 2JC2A 4DRWA 2JOJA 2LHIA 2NCOA 4PHKA 2LVVA 5KTYA 1YUTA 2JWWA 5CPVA 2KYFA 2MLEC 1QX5B 2I2RE 3FIAA 4CIDA 3LK1A 2HQWA 2RGIA 4PHJA 1IJ5A 2M0RA 1RROA 1Q80A 1SCMB 1GGWA 2L5XB 3I5IC 1J55A 2LAPA 2GGZA 2LANA 2WCFA 1YX7A 2HETA 1SL7A
chains in the Genus database with same CATH superfamily
3KHEA 3RZSA 5GQQC 1A75B 2EC6C 1XFRA 3EK4A 5AEQA 3ZNIA 1BMOA 1SKTA 2BL0C 2L4IA 1M45A 2QDIA 1BJFA 1MWNA 2JT8A 2WCJA 4USLA 4F7FA 3S0FA 3BJHA 3O2PA 4ZCVA 1RK9A 1N65A 2BKHB 1UHNA 3DD4A 3I5IB 4YI9A 2KFGA 2LE9B 2LP2A 2MA2A 1K9PA 4I5LB 1BOCA 3LCPC 2G2BA 5DKRA 1OMRA 1CTRA 1C3ZA 1KK7Z 2QEHA 1A75A 2EC6B 4GBAA 3VB1A 1OQPA 2BL0B 1KQMC 2H2KA 1IRJA 3OX5A 3EK7A 1S1EA 1Z2CB 2OPOA 3I5HC 4YGAA 1H8BA 1DJGA 1NX3A 1M46A 1AUIB 1YVLA 4WQ3A 2WCEA 3PLFB 3DVJA 5I94A 2NXQA 1DJIA 1OMDA 4GGFC 3TDIA 3E3RA 3PJIA 2JTZA 1EG3A 1R2UA 1JSAA 2AMIA 1KWOC 1KFUS 2K7DA 1B8CA 1KSOA 3I5HB 1YRTB 4DCKA 3AAJA 1S6JA 3I5GC 5PALA 2Y1MA 3D77A 3GOFA 4I5JA 2F2PA 3EK8A 3SS5A 1EG4A 2DOQA 3OHMB 1CFCA 1LVCD 4M2QA 1QX7A 1ZOTB 2QEBA 2M9GA 5HKZA 3IVTA 1A4PA 1Y1AA 3CZ1A 3ICBA 1IGVA 3QRXA 1QTXA 1YUUA 4OZDA 1HT9A 3BQ3A 1AHRA 1B47A 5B8IB 2KOTA 4NDBA 3CR4X 1KWOB 4CPVA 1K9UA 2JPTA 3TZ1A 1LA3A 3UO9A 4WQ2A 3BFAA 2JXCA 2JZIA 3I5GB 1TNXA 4PHNA 3S0BA 2KLDA 1KSMA 2I94A 1OE9B 1P28A 3WHTB 4GUKA 3F45A 1K90D 2JT3A 1K8UA 3Q8IA 1Z4HA 2BBMA 3LL8B 5ER4X 3FE9A 1XYDA 1MQ1A 2FJUB 2LCPA 4OVNF 2M97A 1QVIZ 1IQ5A 4M2OA 2KBIA 2ZKMX 2LMVA 3JVTC 3SIAA 3TUYC 2MAZA 1RFJA 5AFPA 1QIVA 4YGBB 2LV7A 2MHHA 3R1VA 2BECA 1J7PA 3GK4X 1T14A 2LM5A 1K2HA 4OCIA 2MBXA 3SG4A 4R1EA 3BUXB 1JC2A 3B7AA 1C07A 2MRDA 1DGVA 3EVRA 4N1FA 1G4YR 1B7TZ 3CWGA 1UP5A 1Y1UA 3MSEB 3NSLA 2KI4C 1XVJA 4L9MA 4P2YB 1PK0D 4IL1A 1U5IB 3DVEA 3JVTB 1SRAA 2F33A 1QX2A 1FBVA 3EG5B 3TUYB 3SG5A 5CSIA 1BR4B 3HX4A 1UURA 2TN4A 2HF5A 2OS8C 2R2IA 3DVMA 3KPXA 3L4LA 3TS5C 3D0YB 3PN7C 1TRFA 2K2AA 1PRWA 3KO0A 3M0WA 1B9AA 4OKHA 1NX0A 1RTP1 1JFJA 2CCMA 1XFVO 2KI4B 3S0DA 2JNFA 1QLKA 4GFTA 1W9ZA 4HREE 2HPSA 2M1KB 2P70A 1FPWA 1U5IA 3CABA 4JWQA 1KFUL 4MRXA 3PFVA 1TNWA 2PSRA 1GJYA 3EVUA 2ZNEA 2MJWB 2WC6A 1IH0A 4INXA 1LA0A 3O4YA 2OS8B 2K7CA 3TS5B 3D0YA 1N2DA 3OB1B 3PN7B 1AK8A 2L2EA 1QV1A 3CZ2A 2AAOA 3OX6A 4NDDA 3VRNA 5EL2A 2O5GA 4YI8A 3TDUA 1CB1A 3PSRA 1W7IB 1KFXS 1IJ6A 3OBVA 5F6TA 2LUXA 5JJGA 4BY5A 3WHUB 1FI5A 1BLQA 1HQVA 1NPQA 2VRGA 3PATA 3BYAA 4QJ3B 2LUCA 2KI6D 3FWCA 3OP0A 1NWDA 3PM8A 2KDHA 1S26D 2P71A 1JUOA 1QS7A 1S6CA 2H61A 2KNEA 1XK4C 1KK8C 4JPZB 1NCXA 2M8UA 1PVAA 2CBLA 1Y0VH 1QIWA 2WNDA 3BUOB 3S0AA 1IKUA 1DF0A 5JOLA 2ZFDA 1QJTA 1WRKA 2WCBA 3R1PA 3D75A 2BCXA 1PVBA 1RJVA 4MVFA 1S5GZ 1TCOB 3D78A 1SSEB 2COLB 4PCWA 1OZSA 2CXJA 3CR2A 4YGCB 1EH2A 2M49B 1UHJA 2HETA 2LLUA 2F3ZA 4BY4A 1KK8B 2HQ8A 1SMGA 1OOIX 3HCMA 3CLNA 4AQIA 1TUZA 1M39A 4I5NB 3VRRA 4A4BA 1C7VA 4MZLA 1TUJA 1YX8A 2SCPA 5D3OA 3FWBA 1FI6A 2SASA 1NX1A 5FI2A 2O60A 4HRHA 1DTLA 1S6IA 4OR9B 1F54A 1J1DA 2FOTA 1KQMB 5TNCA 1XK4A 1NCZA 1AVSA 2PALA 5HLOA 3BUMB 1CFPA 4FQTA 1CDPA 3DZTA 3SS4A 1B8RA 3EKJA 1J7RA 3S0EA 2JPOA 3VRPA 1ALVA 1B1GA 4YGEB 1YR5A 1CM4A 1SBJA 2BAPA 1CDLA 3VROA 1KK7Y 2L0PA 4PT1A 2B1UA 5K89A 5KSZA 2PASA 3SIBA 4QJ4B 2BNXA 3B87A 2ZRTA 4XJKB 1UWOA 1M31A 1MHOA 3CZTX 2L98A 3K1EA 1LXFC 2K7BA 1LKJA 2AUCA 2KFHA 2WCMA 1DJZA 4AOMA 5HYDA 1L7ZA 5HLVA 3B6XA 1V1GA 1DC1A 4GPLB 1WLMA 1QASA 2Y4QA 3CDNA 4E68A 2F8PA 2KAXA 3CYZA 5FI6A 1ZFSA 4YBHB 4PE7A 5HKWA 4MRYA 1BG1A 3CR5X 4NQGA 1SYMA 4XJKA 4N1GA 3OGNA 1GGZA 1WDCC 1CLMA 3S0GA 3CGAA 1EJ3A 1MUXA 1WY9A 3A8RA 3NSOA 2LC5A 2PMYA 2BE4A 2BCBA 2KAVA 3BUNB 4Q04A 1PSBA 4D1EA 2WCLA 2KQYA 1NIWA 4MZKA 2KSPA 2ZN9A 1OZOA 1XFXO 2M7NA 1QWVA 2KHNA 2L4HA 1SY9A 2LNKA 1JF2A 1RWYA 2BKIB 1F55A 1WDCB 1G33A 4WRIA 4HRGA 1MXEA 4IJ7A 3L4AA 4CFQA 2PYQA 2BE6A 1DJWA 2QPTA 3KEVA 2H61C 5KU1A 1DT7B 1V1FA 2LVIA 4MZJA 2M3WA 2WORA 1CMGA 2JQ6A 2ZRSA 5CSJA 1QVIY 3JTDC 1Y6WA 1XFYO 3D74A 4C0JA 1CM1A 1TCFA 3V2LA 2ERBA 1EXRA 3C1VA 2LVJA 1J1EA 3DXLA 2GTEA 1D1OA 1ORGA 1NYAA 3BOWA 1QLSA 1K95A 2KBMA 3FE8A 3BXKA 1IQ3A 4ZCUA 1BT6A 1B7TY 3D10A 2ISDA 2QEVA 2JU0A 1JFKA 1S36A 2Q4UA 3AKAA 3LLEA 3DYEA 2KLEA 4PE1A 2E30A 4C0LA 3JTDB 2K60A 1BU3A 1NX2A 2GGMA 3RM1A 5BPJA 2FCDA 1DF0B 3RLZA 2F3YA 4FQOA 2E6WA 3SG7A 4DIRA 1TN4A 4JD9A 3SG6A 1BR1B 1F4OA 2KPHA 2H8VA 3SJSA 2JULA 1SNLA 1ODBA 1SCVA 1DVIA 2KAYA 4A4CA 1N0YA 2PRUA 2YGUA 1OOHA 2P6BB 2KGBC 5AERA 1OOFA 1SPYA 1AP4A 1CDMA 2WCHA 3GK1A 2EGDA 2JXLA 1G8IA 5I2OA 5DICA 3NXAA 4PDZA 4P5OE 2L5YA 1NUBA 1QXPA 1LS8A 1R6PA 2CT9A 2K61A 4OV2A 3SS3A 3NHTA 3GK2A 2I18A 1XO5A 1OOJA 1Y1XA 2K2FA 2FJYA 2KI6C 4MLWA 1CFDA 1GQMA 2QACA 4TNCA 4CFRA 4M2PA 1TTXA 4MEWA 3D76A 3L47A 5FYXA 3IQQA 1QATA 2OTGC 2F2OA 3QMEA 4I5KA 3UNWA 3O78A 3VRQA 4YGDB 2NLNA 2CNPA 1K9KA 4U8DA 3VGOA 1CDNA 2LLTA 1AJ4A 5G08A 2MLFC 1A03A 3O4XA 4GGNA 1UUSA 3I5FC 1XFZO 1B4CA 2M7LA 1K94A 1OSAA 5J3XA 1KQVA 1DMOA 2JNXA 4PE4A 3H4SE 1DELA 4HSZA 3O6BA 2OTGB 1TNQA 2NZ0A 2Y5IA 5I2LA 2LHLA 1MXLC 1NP8A 4ORBB 4PHMA 3WXAA 1S5GY 1FF1A 1SR6C 1PALA 5FI7A 1X02A 4XYNA 3AKBA 2CTNA 2IS9A 1SW8A 2BCAA 2Y1NA 1C7WA 1L2OC 3I5FB 2LLSA 5D69A 4GNKB 2KGRA 1UHIA 5D7FA 3R1OA 3SG3A 4KYNA 1F8HA 5I8NA 4MN0A 2V53A 4NDCA 1BODA 1K96A 2EHBA 1TOPA 4MSPA 2LMUA 3LK0A 3K21A 1MF8B 1UHHA 3BFHA 4FTGA 4YRUA 5I2QA 1K93D 1KFXL 1M63B 1TNPA 1ZUZA 2LMTA 1GM0A 1SR6B 1ZMZA 1WRLA 1NCYA 1DGUA 1XA5A 3PALA 1L2OB 2WC5A 3FS7A 5CSNA 1PULA 1CMFA 1WRZA 1JBAA 5DKNA 5AANA 1SK6D 2LVKA 3BUWB 3A4UB 2G9BA 1SL9A 1DJHA 1AJ5A 1F4QA 3NGVA 3CZ0A 3IF7A 1YRUB 2JTTA 2ZN8A 3DY9A 4ICBA 1KCYA 1TIZA 1RECA 1C3YA 1QV0A 1VRKA 1WLZA 1YVHA 2WOSA 2BBNA 2NCPA 1LINA 3NSIA 4C0KA 2L2CA 2K8MB 2L51A 4GGFA 5IBWA 3OB2B 1JF0A 3KF9A 1A29A 2JRFA 1IG5A 2KFFA 2Q91A 3EVVA 3SG2A 4DS7A 4UPGA 1DJYA 2GV5A 1SL8A 1ZACA 1J7OA 1A2XA 4ORAB 3B86A 3EKHA 1JWDA 3B88A 4AQJA 1YUSA 4ETOA 1XFUO 1S3PA 2M29A 3BOWB 4QJ5B 2D8NA 1YTZC 4ORCB 1F70A 4PE0A 1NSHA 1ALWA 1E8AA 1CLLA 2JT0A 3IQOA 5DKQA 4MBEA 2ZNDA 2K0JA 3FE6A 1B8LA 3NSKA 3WNXB 1DEKA 3DF0B 4PALA 2QEOA 3ZWHA 4F0ZB 1UHKA 5CSFA 2WC8A 1CNPA 1F71A 2L50A 1EL4A 1DJXA 3BFBA 3CTNA 3D73A 1CFFA 1H4BA 1OMVA 3CS1A 4JQ0D 2WCKA 1OOGA 2K7OA 2A4JA 1CLBA 1J7QA 1MR8A 4GAOA 4DUQA 1CKKA 1IWQA 1W7JB 2FCEA 3DVKA 3TDZA 4N5XA 3NHIA 1XFWO 4CLNA 3DF0A 2M1UA 2I7AA 1PSRA 2LP3A 2PVBA 2KQ6A 3N7HA 5HKYA 5ER5A 1BF5A 1FW4A 1SCMC 5AXIA 1OW4A 2PQLA 1DQEA 3AAKA 1YURA 2KYCA 2JC2A 4DRWA 2JOJA 2LHIA 2NCOA 4PHKA 2LVVA 5KTYA 1YUTA 2JWWA 5CPVA 2KYFA 2MLEC 1QX5B 2I2RE 3FIAA 4CIDA 4JKTA 3LK1A 4INWA 2HQWA 2RGIA 4PHJA 1IJ5A 1IIOA 2M0RA 1RROA 1Q80A 1SCMB 3R72A 2L5XB 1GGWA 3PM2A 3I5IC 1J55A 2LAPA 2GGZA 2LANA 5HL1A 2WCFA 1YX7A 1TWOA 1SL7A
chains in the Genus database with same CATH topology
3KHEA 5GQQC 1A75B 2EC6C 3EK4A 5AEQA 3ZNIA 1BMOA 1SKTA 2BL0C 2L4IA 1M45A 1BJFA 1MWNA 2JT8A 4USLA 3O2PA 4ZCVA 1RK9A 1N65A 2BKHB 1UHNA 3DD4A 3I5IB 4YI9A 2KFGA 2LE9B 2LP2A 2MA2A 1K9PA 4I5LB 1BOCA 3LCPC 2G2BA 5DKRA 1OMRA 1CTRA 1KK7Z 4GBAA 1A75A 2EC6B 1OQPA 2BL0B 1KQMC 2H2KA 1IRJA 3OX5A 3EK7A 1S1EA 2OPOA 3I5HC 4YGAA 1H8BA 1DJGA 1NX3A 1M46A 1AUIB 1YVLA 4WQ3A 2WCEA 3PLFB 3DVJA 2NXQA 1DJIA 1OMDA 4GGFC 3TDIA 3E3RA 2JTZA 1EG3A 1R2UA 1JSAA 2AMIA 1KWOC 1KFUS 2K7DA 1B8CA 1KSOA 3I5HB 1YRTB 4DCKA 3AAJA 1S6JA 3I5GC 5PALA 2Y1MA 3GOFA 4I5JA 2F2PA 3EK8A 1EG4A 2DOQA 3OHMB 1CFCA 1LVCD 4M2QA 1QX7A 1ZOTB 5HKZA 2M9GA 1A4PA 1Y1AA 3ICBA 3QRXA 1IGVA 1QTXA 1YUUA 1HT9A 3BQ3A 1AHRA 1B47A 5B8IB 2KOTA 4NDBA 3CR4X 1KWOB 4CPVA 1K9UA 2JPTA 3TZ1A 1LA3A 4WQ2A 2JXCA 2JZIA 3I5GB 1TNXA 4PHNA 1KSMA 2I94A 1OE9B 3WHTB 4GUKA 3F45A 1K90D 2JT3A 1K8UA 2BBMA 3LL8B 5ER4X 1XYDA 1MQ1A 2FJUB 2LCPA 4OVNF 2M97A 1QVIZ 1IQ5A 4M2OA 2KBIA 2ZKMX 2LMVA 3JVTC 3SIAA 3TUYC 2MAZA 1RFJA 5AFPA 1QIVA 4YGBB 2LV7A 2MHHA 1J7PA 2BECA 3GK4X 2LM5A 1K2HA 4OCIA 2MBXA 3SG4A 4R1EA 3BUXB 1JC2A 1C07A 2MRDA 1DGVA 3EVRA 4N1FA 1G4YR 1B7TZ 3CWGA 1UP5A 1Y1UA 3MSEB 3NSLA 2KI4C 1XVJA 4L9MA 4P2YB 1PK0D 4IL1A 1U5IB 3DVEA 3JVTB 1SRAA 2F33A 1QX2A 1FBVA 3TUYB 3SG5A 5CSIA 1BR4B 3HX4A 1UURA 2TN4A 2HF5A 2OS8C 2R2IA 3DVMA 3KPXA 3TS5C 3D0YB 3PN7C 1TRFA 2K2AA 1PRWA 3KO0A 3M0WA 1B9AA 4OKHA 1NX0A 1RTP1 1JFJA 2CCMA 1XFVO 2KI4B 2JNFA 1QLKA 4GFTA 4HREE 2HPSA 2M1KB 1FPWA 1U5IA 4JWQA 1KFUL 4MRXA 3PFVA 1TNWA 2PSRA 1GJYA 3EVUA 2ZNEA 2MJWB 1IH0A 1LA0A 3O4YA 2OS8B 2K7CA 3TS5B 3D0YA 1N2DA 3OB1B 3PN7B 1AK8A 2L2EA 1QV1A 2AAOA 3OX6A 4NDDA 3VRNA 2O5GA 4YI8A 3TDUA 1CB1A 3PSRA 1W7IB 1KFXS 1IJ6A 5F6TA 2LUXA 5JJGA 4BY5A 3WHUB 1FI5A 1BLQA 1HQVA 1NPQA 2VRGA 3PATA 3BYAA 4QJ3B 2LUCA 2KI6D 3FWCA 3OP0A 1NWDA 3PM8A 2KDHA 1S26D 1JUOA 1QS7A 1S6CA 2H61A 2KNEA 1XK4C 1KK8C 4JPZB 1NCXA 2M8UA 1PVAA 2CBLA 1Y0VH 1QIWA 2WNDA 3BUOB 1IKUA 1DF0A 5JOLA 2ZFDA 1QJTA 1WRKA 2WCBA 2BCXA 1PVBA 1RJVA 4MVFA 1S5GZ 1TCOB 2COLB 4PCWA 1OZSA 2CXJA 3CR2A 4YGCB 1EH2A 2M49B 1UHJA 2LLUA 2F3ZA 4BY4A 1KK8B 2HQ8A 1SMGA 3HCMA 3CLNA 4AQIA 1M39A 4I5NB 3VRRA 4A4BA 1C7VA 4MZLA 1YX8A 2SCPA 3FWBA 1FI6A 2SASA 1NX1A 2O60A 4HRHA 1DTLA 1S6IA 4OR9B 1F54A 1J1DA 2FOTA 1KQMB 5TNCA 1XK4A 1NCZA 1AVSA 2PALA 5HLOA 3BUMB 1CFPA 1CDPA 1B8RA 3EKJA 1J7RA 3VRPA 1ALVA 1B1GA 4YGEB 1YR5A 1CM4A 1SBJA 1CDLA 3VROA 1KK7Y 2L0PA 2B1UA 5K89A 5KSZA 2PASA 3SIBA 4QJ4B 2ZRTA 4XJKB 1UWOA 1M31A 1MHOA 3CZTX 2L98A 1LXFC 2K7BA 1LKJA 2AUCA 2KFHA 1DJZA 4AOMA 5HYDA 1L7ZA 5HLVA 1V1GA 4GPLB 1WLMA 1QASA 2Y4QA 4E68A 2F8PA 2KAXA 1ZFSA 4YBHB 4PE7A 5HKWA 4MRYA 1BG1A 3CR5X 4NQGA 1SYMA 4XJKA 4N1GA 1GGZA 1WDCC 1CLMA 3CGAA 1EJ3A 1MUXA 1WY9A 3A8RA 3NSOA 2LC5A 2PMYA 2BE4A 2BCBA 2KAVA 3BUNB 4Q04A 1PSBA 4D1EA 2KQYA 1NIWA 4MZKA 2KSPA 2ZN9A 1OZOA 1XFXO 2M7NA 2KHNA 2L4HA 1SY9A 2LNKA 1JF2A 1RWYA 2BKIB 1F55A 1WDCB 1G33A 4WRIA 4HRGA 1MXEA 4CFQA 2BE6A 1DJWA 2QPTA 3KEVA 2H61C 5KU1A 1DT7B 1V1FA 2LVIA 4MZJA 2M3WA 2WORA 1CMGA 2JQ6A 2ZRSA 5CSJA 1QVIY 3JTDC 1Y6WA 1XFYO 4C0JA 1CM1A 1TCFA 1EXRA 3C1VA 2LVJA 1J1EA 1D1OA 3BOWA 1NYAA 1QLSA 1K95A 2KBMA 3BXKA 1IQ3A 4ZCUA 1BT6A 1B7TY 3D10A 2ISDA 2JU0A 1JFKA 1S36A 2Q4UA 3AKAA 3LLEA 4C0LA 4PE1A 2E30A 3JTDB 1BU3A 1NX2A 2GGMA 3RM1A 5BPJA 2FCDA 1DF0B 3RLZA 2F3YA 4FQOA 2E6WA 3SG7A 4DIRA 1TN4A 3SG6A 1BR1B 1F4OA 3SJSA 2JULA 1SNLA 1ODBA 1SCVA 1DVIA 2KAYA 4A4CA 1N0YA 2PRUA 2P6BB 2KGBC 5AERA 1AP4A 1SPYA 1CDMA 3GK1A 2EGDA 2JXLA 1G8IA 5I2OA 3NXAA 4PDZA 4P5OE 1NUBA 1QXPA 1R6PA 2CT9A 2K61A 4OV2A 3GK2A 2I18A 1XO5A 1OOJA 1Y1XA 2K2FA 2KI6C 4MLWA 1CFDA 1GQMA 2QACA 4TNCA 4CFRA 4M2PA 1TTXA 4MEWA 5FYXA 3IQQA 1QATA 2OTGC 2F2OA 4I5KA 3O78A 3VRQA 4YGDB 2NLNA 2CNPA 1K9KA 4U8DA 3VGOA 1CDNA 2LLTA 1AJ4A 5G08A 2MLFC 1A03A 4GGNA 1UUSA 3I5FC 1XFZO 1B4CA 2M7LA 1K94A 1OSAA 5J3XA 1KQVA 1DMOA 2JNXA 4PE4A 3H4SE 4HSZA 3O6BA 2OTGB 1TNQA 2NZ0A 2Y5IA 5I2LA 2LHLA 1MXLC 1NP8A 4ORBB 4PHMA 3WXAA 1S5GY 1FF1A 1SR6C 1PALA 1X02A 4XYNA 3AKBA 2CTNA 2IS9A 1SW8A 2BCAA 2Y1NA 1C7WA 1L2OC 3I5FB 2LLSA 5D69A 4GNKB 2KGRA 1UHIA 5D7FA 1F8HA 3SG3A 5I8NA 4MN0A 2V53A 4NDCA 1BODA 1K96A 2EHBA 1TOPA 4MSPA 2LMUA 3LK0A 3K21A 1MF8B 1UHHA 4FTGA 5I2QA 4YRUA 1K93D 1KFXL 1M63B 1TNPA 1ZUZA 2LMTA 1SR6B 1ZMZA 1WRLA 1NCYA 1DGUA 1XA5A 3PALA 1L2OB 3FS7A 5CSNA 1PULA 1CMFA 1WRZA 1JBAA 5DKNA 5AANA 1SK6D 2LVKA 3BUWB 3A4UB 2G9BA 1SL9A 1DJHA 1AJ5A 1F4QA 3IF7A 4ICBA 1YRUB 2JTTA 2ZN8A 1KCYA 1TIZA 1RECA 1QV0A 1VRKA 1WLZA 1YVHA 2WOSA 2BBNA 2NCPA 1LINA 3NSIA 4C0KA 2K8MB 2L51A 4GGFA 5IBWA 3OB2B 1JF0A 3KF9A 1A29A 2JRFA 1IG5A 2KFFA 2Q91A 3EVVA 3SG2A 4DS7A 4UPGA 1DJYA 2GV5A 1SL8A 1ZACA 1J7OA 1A2XA 4ORAB 3EKHA 1JWDA 4AQJA 4QJ5B 1YUSA 4ETOA 1XFUO 1S3PA 2M29A 3BOWB 2D8NA 1YTZC 4ORCB 1F70A 4PE0A 1NSHA 1ALWA 1E8AA 1CLLA 2JT0A 3IQOA 5DKQA 4MBEA 2ZNDA 2K0JA 1B8LA 3NSKA 3WNXB 3DF0B 4PALA 3ZWHA 4F0ZB 1UHKA 5CSFA 2WC8A 1CNPA 1F71A 2L50A 1EL4A 1DJXA 3CTNA 1CFFA 1H4BA 1OMVA 3CS1A 4JQ0D 2K7OA 2A4JA 1CLBA 1J7QA 1MR8A 4GAOA 4DUQA 1CKKA 1IWQA 1W7JB 2FCEA 3DVKA 3TDZA 4N5XA 1XFWO 4CLNA 3DF0A 2M1UA 2I7AA 1PSRA 2LP3A 2PVBA 2KQ6A 5HKYA 5ER5A 1BF5A 1FW4A 1SCMC 5AXIA 3AAKA 1YURA 2KYCA 2JC2A 4DRWA 2JOJA 2LHIA 2NCOA 4PHKA 2LVVA 5KTYA 1YUTA 2JWWA 5CPVA 2KYFA 2MLEC 1QX5B 2I2RE 3FIAA 4CIDA 3LK1A 2HQWA 2RGIA 4PHJA 1IJ5A 2M0RA 1RROA 1Q80A 1SCMB 1GGWA 2L5XB 3I5IC 1J55A 2LAPA 2GGZA 2LANA 2WCFA 1YX7A 2HETA 1SL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHE A;  5GQQ C;  1A75 B;  2EC6 C;  3EK4 A;  5AEQ A;  3ZNI A;  1BMO A;  1SKT A;  2BL0 C;  2L4I A;  1M45 A;  1BJF A;  1MWN A;  2JT8 A;  4USL A;  3O2P A;  4ZCV A;  1RK9 A;  1N65 A;  2BKH B;  1UHN A;  3DD4 A;  3I5I B;  4YI9 A;  2KFG A;  2LE9 B;  2LP2 A;  2MA2 A;  1K9P A;  4I5L B;  1BOC A;  3LCP C;  2G2B A;  5DKR A;  1OMR A;  1CTR A;  1KK7 Z;  4GBA A;  1A75 A;  2EC6 B;  1OQP A;  2BL0 B;  1KQM C;  2H2K A;  1IRJ A;  3OX5 A;  3EK7 A;  1S1E A;  2OPO A;  3I5H C;  4YGA A;  1H8B A;  1DJG A;  1NX3 A;  1M46 A;  1AUI B;  1YVL A;  4WQ3 A;  2WCE A;  3PLF B;  3DVJ A;  2NXQ A;  1DJI A;  1OMD A;  4GGF C;  3TDI A;  3E3R A;  2JTZ A;  1EG3 A;  1R2U A;  1JSA A;  2AMI A;  1KWO C;  1KFU S;  2K7D A;  1B8C A;  1KSO A;  3I5H B;  1YRT B;  4DCK A;  3AAJ A;  1S6J A;  3I5G C;  5PAL A;  2Y1M A;  3GOF A;  4I5J A;  2F2P A;  3EK8 A;  1EG4 A;  2DOQ A;  3OHM B;  1CFC A;  1LVC D;  4M2Q A;  1QX7 A;  1ZOT B;  5HKZ A;  2M9G A;  1A4P A;  1Y1A A;  3ICB A;  3QRX A;  1IGV A;  1QTX A;  1YUU A;  1HT9 A;  3BQ3 A;  1AHR A;  1B47 A;  5B8I B;  2KOT A;  4NDB A;  3CR4 X;  1KWO B;  4CPV A;  1K9U A;  2JPT A;  3TZ1 A;  1LA3 A;  4WQ2 A;  2JXC A;  2JZI A;  3I5G B;  1TNX A;  4PHN A;  1KSM A;  2I94 A;  1OE9 B;  3WHT B;  4GUK A;  3F45 A;  1K90 D;  2JT3 A;  1K8U A;  2BBM A;  3LL8 B;  5ER4 X;  1XYD A;  1MQ1 A;  2FJU B;  2LCP A;  4OVN F;  2M97 A;  1QVI Z;  1IQ5 A;  4M2O A;  2KBI A;  2ZKM X;  2LMV A;  3JVT C;  3SIA A;  3TUY C;  2MAZ A;  1RFJ A;  5AFP A;  1QIV A;  4YGB B;  2LV7 A;  2MHH A;  1J7P A;  2BEC A;  3GK4 X;  2LM5 A;  1K2H A;  4OCI A;  2MBX A;  3SG4 A;  4R1E A;  3BUX B;  1JC2 A;  1C07 A;  2MRD A;  1DGV A;  3EVR A;  4N1F A;  1G4Y R;  1B7T Z;  3CWG A;  1UP5 A;  1Y1U A;  3MSE B;  3NSL A;  2KI4 C;  1XVJ A;  4L9M A;  4P2Y B;  1PK0 D;  4IL1 A;  1U5I B;  3DVE A;  3JVT B;  1SRA A;  2F33 A;  1QX2 A;  1FBV A;  3TUY B;  3SG5 A;  5CSI A;  1BR4 B;  3HX4 A;  1UUR A;  2TN4 A;  2HF5 A;  2OS8 C;  2R2I A;  3DVM A;  3KPX A;  3TS5 C;  3D0Y B;  3PN7 C;  1TRF A;  2K2A A;  1PRW A;  3KO0 A;  3M0W A;  1B9A A;  4OKH A;  1NX0 A;  1RTP 1;  1JFJ A;  2CCM A;  1XFV O;  2KI4 B;  2JNF A;  1QLK A;  4GFT A;  4HRE E;  2HPS A;  2M1K B;  1FPW A;  1U5I A;  4JWQ A;  1KFU L;  4MRX A;  3PFV A;  1TNW A;  2PSR A;  1GJY A;  3EVU A;  2ZNE A;  2MJW B;  1IH0 A;  1LA0 A;  3O4Y A;  2OS8 B;  2K7C A;  3TS5 B;  3D0Y A;  1N2D A;  3OB1 B;  3PN7 B;  1AK8 A;  2L2E A;  1QV1 A;  2AAO A;  3OX6 A;  4NDD A;  3VRN A;  2O5G A;  4YI8 A;  3TDU A;  1CB1 A;  3PSR A;  1W7I B;  1KFX S;  1IJ6 A;  5F6T A;  2LUX A;  5JJG A;  4BY5 A;  3WHU B;  1FI5 A;  1BLQ A;  1HQV A;  1NPQ A;  2VRG A;  3PAT A;  3BYA A;  4QJ3 B;  2LUC A;  2KI6 D;  3FWC A;  3OP0 A;  1NWD A;  3PM8 A;  2KDH A;  1S26 D;  1JUO A;  1QS7 A;  1S6C A;  2H61 A;  2KNE A;  1XK4 C;  1KK8 C;  4JPZ B;  1NCX A;  2M8U A;  1PVA A;  2CBL A;  1Y0V H;  1QIW A;  2WND A;  3BUO B;  1IKU A;  1DF0 A;  5JOL A;  2ZFD A;  1QJT A;  1WRK A;  2WCB A;  2BCX A;  1PVB A;  1RJV A;  4MVF A;  1S5G Z;  1TCO B;  2COL B;  4PCW A;  1OZS A;  2CXJ A;  3CR2 A;  4YGC B;  1EH2 A;  2M49 B;  1UHJ A;  2LLU A;  2F3Z A;  4BY4 A;  1KK8 B;  2HQ8 A;  1SMG A;  3HCM A;  3CLN A;  4AQI A;  1M39 A;  4I5N B;  3VRR A;  4A4B A;  1C7V A;  4MZL A;  1YX8 A;  2SCP A;  3FWB A;  1FI6 A;  2SAS A;  1NX1 A;  2O60 A;  4HRH A;  1DTL A;  1S6I A;  4OR9 B;  1F54 A;  1J1D A;  2FOT A;  1KQM B;  5TNC A;  1XK4 A;  1NCZ A;  1AVS A;  2PAL A;  5HLO A;  3BUM B;  1CFP A;  1CDP A;  1B8R A;  3EKJ A;  1J7R A;  3VRP A;  1ALV A;  1B1G A;  4YGE B;  1YR5 A;  1CM4 A;  1SBJ A;  1CDL A;  3VRO A;  1KK7 Y;  2L0P A;  2B1U A;  5K89 A;  5KSZ A;  2PAS A;  3SIB A;  4QJ4 B;  2ZRT A;  4XJK B;  1UWO A;  1M31 A;  1MHO A;  3CZT X;  2L98 A;  1LXF C;  2K7B A;  1LKJ A;  2AUC A;  2KFH A;  1DJZ A;  4AOM A;  5HYD A;  1L7Z A;  5HLV A;  1V1G A;  4GPL B;  1WLM A;  1QAS A;  2Y4Q A;  4E68 A;  2F8P A;  2KAX A;  1ZFS A;  4YBH B;  4PE7 A;  5HKW A;  4MRY A;  1BG1 A;  3CR5 X;  4NQG A;  1SYM A;  4XJK A;  4N1G A;  1GGZ A;  1WDC C;  1CLM A;  3CGA A;  1EJ3 A;  1MUX A;  1WY9 A;  3A8R A;  3NSO A;  2LC5 A;  2PMY A;  2BE4 A;  2BCB A;  2KAV A;  3BUN B;  4Q04 A;  1PSB A;  4D1E A;  2KQY A;  1NIW A;  4MZK A;  2KSP A;  2ZN9 A;  1OZO A;  1XFX O;  2M7N A;  2KHN A;  2L4H A;  1SY9 A;  2LNK A;  1JF2 A;  1RWY A;  2BKI B;  1F55 A;  1WDC B;  1G33 A;  4WRI A;  4HRG A;  1MXE A;  4CFQ A;  2BE6 A;  1DJW A;  2QPT A;  3KEV A;  2H61 C;  5KU1 A;  1DT7 B;  1V1F A;  2LVI A;  4MZJ A;  2M3W A;  2WOR A;  1CMG A;  2JQ6 A;  2ZRS A;  5CSJ A;  1QVI Y;  3JTD C;  1Y6W A;  1XFY O;  4C0J A;  1CM1 A;  1TCF A;  1EXR A;  3C1V A;  2LVJ A;  1J1E A;  1D1O A;  3BOW A;  1NYA A;  1QLS A;  1K95 A;  2KBM A;  3BXK A;  1IQ3 A;  4ZCU A;  1BT6 A;  1B7T Y;  3D10 A;  2ISD A;  2JU0 A;  1JFK A;  1S36 A;  2Q4U A;  3AKA A;  3LLE A;  4C0L A;  4PE1 A;  2E30 A;  3JTD B;  1BU3 A;  1NX2 A;  2GGM A;  3RM1 A;  5BPJ A;  2FCD A;  1DF0 B;  3RLZ A;  2F3Y A;  4FQO A;  2E6W A;  3SG7 A;  4DIR A;  1TN4 A;  3SG6 A;  1BR1 B;  1F4O A;  3SJS A;  2JUL A;  1SNL A;  1ODB A;  1SCV A;  1DVI A;  2KAY A;  4A4C A;  1N0Y A;  2PRU A;  2P6B B;  2KGB C;  5AER A;  1AP4 A;  1SPY A;  1CDM A;  3GK1 A;  2EGD A;  2JXL A;  1G8I A;  5I2O A;  3NXA A;  4PDZ A;  4P5O E;  1NUB A;  1QXP A;  1R6P A;  2CT9 A;  2K61 A;  4OV2 A;  3GK2 A;  2I18 A;  1XO5 A;  1OOJ A;  1Y1X A;  2K2F A;  2KI6 C;  4MLW A;  1CFD A;  1GQM A;  2QAC A;  4TNC A;  4CFR A;  4M2P A;  1TTX A;  4MEW A;  5FYX A;  3IQQ A;  1QAT A;  2OTG C;  2F2O A;  4I5K A;  3O78 A;  3VRQ A;  4YGD B;  2NLN A;  2CNP A;  1K9K A;  4U8D A;  3VGO A;  1CDN A;  2LLT A;  1AJ4 A;  5G08 A;  2MLF C;  1A03 A;  4GGN A;  1UUS A;  3I5F C;  1XFZ O;  1B4C A;  2M7L A;  1K94 A;  1OSA A;  5J3X A;  1KQV A;  1DMO A;  2JNX A;  4PE4 A;  3H4S E;  4HSZ A;  3O6B A;  2OTG B;  1TNQ A;  2NZ0 A;  2Y5I A;  5I2L A;  2LHL A;  1MXL C;  1NP8 A;  4ORB B;  4PHM A;  3WXA A;  1S5G Y;  1FF1 A;  1SR6 C;  1PAL A;  1X02 A;  4XYN A;  3AKB A;  2CTN A;  2IS9 A;  1SW8 A;  2BCA A;  2Y1N A;  1C7W A;  1L2O C;  3I5F B;  2LLS A;  5D69 A;  4GNK B;  2KGR A;  1UHI A;  5D7F A;  1F8H A;  3SG3 A;  5I8N A;  4MN0 A;  2V53 A;  4NDC A;  1BOD A;  1K96 A;  2EHB A;  1TOP A;  4MSP A;  2LMU A;  3LK0 A;  3K21 A;  1MF8 B;  1UHH A;  4FTG A;  5I2Q A;  4YRU A;  1K93 D;  1KFX L;  1M63 B;  1TNP A;  1ZUZ A;  2LMT A;  1SR6 B;  1ZMZ A;  1WRL A;  1NCY A;  1DGU A;  1XA5 A;  3PAL A;  1L2O B;  3FS7 A;  5CSN A;  1PUL A;  1CMF A;  1WRZ A;  1JBA A;  5DKN A;  5AAN A;  1SK6 D;  2LVK A;  3BUW B;  3A4U B;  2G9B A;  1SL9 A;  1DJH A;  1AJ5 A;  1F4Q A;  3IF7 A;  4ICB A;  1YRU B;  2JTT A;  2ZN8 A;  1KCY A;  1TIZ A;  1REC A;  1QV0 A;  1VRK A;  1WLZ A;  1YVH A;  2WOS A;  2BBN A;  2NCP A;  1LIN A;  3NSI A;  4C0K A;  2K8M B;  2L51 A;  4GGF A;  5IBW A;  3OB2 B;  1JF0 A;  3KF9 A;  1A29 A;  2JRF A;  1IG5 A;  2KFF A;  2Q91 A;  3EVV A;  3SG2 A;  4DS7 A;  4UPG A;  1DJY A;  2GV5 A;  1SL8 A;  1ZAC A;  1J7O A;  1A2X A;  4ORA B;  3EKH A;  1JWD A;  4AQJ A;  4QJ5 B;  1YUS A;  4ETO A;  1XFU O;  1S3P A;  2M29 A;  3BOW B;  2D8N A;  1YTZ C;  4ORC B;  1F70 A;  4PE0 A;  1NSH A;  1ALW A;  1E8A A;  1CLL A;  2JT0 A;  3IQO A;  5DKQ A;  4MBE A;  2ZND A;  2K0J A;  1B8L A;  3NSK A;  3WNX B;  3DF0 B;  4PAL A;  3ZWH A;  4F0Z B;  1UHK A;  5CSF A;  2WC8 A;  1CNP A;  1F71 A;  2L50 A;  1EL4 A;  1DJX A;  3CTN A;  1CFF A;  1H4B A;  1OMV A;  3CS1 A;  4JQ0 D;  2K7O A;  2A4J A;  1CLB A;  1J7Q A;  1MR8 A;  4GAO A;  4DUQ A;  1CKK A;  1IWQ A;  1W7J B;  2FCE A;  3DVK A;  3TDZ A;  4N5X A;  1XFW O;  4CLN A;  3DF0 A;  2M1U A;  2I7A A;  1PSR A;  2LP3 A;  2PVB A;  2KQ6 A;  5HKY A;  5ER5 A;  1BF5 A;  1FW4 A;  1SCM C;  5AXI A;  3AAK A;  1YUR A;  2KYC A;  2JC2 A;  4DRW A;  2JOJ A;  2LHI A;  2NCO A;  4PHK A;  2LVV A;  5KTY A;  1YUT A;  2JWW A;  5CPV A;  2KYF A;  2MLE C;  1QX5 B;  2I2R E;  3FIA A;  4CID A;  3LK1 A;  2HQW A;  2RGI A;  4PHJ A;  1IJ5 A;  2M0R A;  1RRO A;  1Q80 A;  1SCM B;  1GGW A;  2L5X B;  3I5I C;  1J55 A;  2LAP A;  2GGZ A;  2LAN A;  2WCF A;  1YX7 A;  2HET A;  1SL7 A; 
#chains in the Genus database with same CATH topology
 3KHE A;  3RZS A;  5GQQ C;  1A75 B;  2EC6 C;  1XFR A;  3EK4 A;  5AEQ A;  3ZNI A;  1BMO A;  1SKT A;  2BL0 C;  2L4I A;  1M45 A;  2QDI A;  1BJF A;  1MWN A;  2JT8 A;  2WCJ A;  4USL A;  4F7F A;  3S0F A;  3BJH A;  3O2P A;  4ZCV A;  1RK9 A;  1N65 A;  2BKH B;  1UHN A;  3DD4 A;  3I5I B;  4YI9 A;  2KFG A;  2LE9 B;  2LP2 A;  2MA2 A;  1K9P A;  4I5L B;  1BOC A;  3LCP C;  2G2B A;  5DKR A;  1OMR A;  1CTR A;  1C3Z A;  1KK7 Z;  2QEH A;  1A75 A;  2EC6 B;  4GBA A;  3VB1 A;  1OQP A;  2BL0 B;  1KQM C;  2H2K A;  1IRJ A;  3OX5 A;  3EK7 A;  1S1E A;  1Z2C B;  2OPO A;  3I5H C;  4YGA A;  1H8B A;  1DJG A;  1NX3 A;  1M46 A;  1AUI B;  1YVL A;  4WQ3 A;  2WCE A;  3PLF B;  3DVJ A;  5I94 A;  2NXQ A;  1DJI A;  1OMD A;  4GGF C;  3TDI A;  3E3R A;  3PJI A;  2JTZ A;  1EG3 A;  1R2U A;  1JSA A;  2AMI A;  1KWO C;  1KFU S;  2K7D A;  1B8C A;  1KSO A;  3I5H B;  1YRT B;  4DCK A;  3AAJ A;  1S6J A;  3I5G C;  5PAL A;  2Y1M A;  3D77 A;  3GOF A;  4I5J A;  2F2P A;  3EK8 A;  3SS5 A;  1EG4 A;  2DOQ A;  3OHM B;  1CFC A;  1LVC D;  4M2Q A;  1QX7 A;  1ZOT B;  2QEB A;  2M9G A;  5HKZ A;  3IVT A;  1A4P A;  1Y1A A;  3CZ1 A;  3ICB A;  1IGV A;  3QRX A;  1QTX A;  1YUU A;  4OZD A;  1HT9 A;  3BQ3 A;  1AHR A;  1B47 A;  5B8I B;  2KOT A;  4NDB A;  3CR4 X;  1KWO B;  4CPV A;  1K9U A;  2JPT A;  3TZ1 A;  1LA3 A;  3UO9 A;  4WQ2 A;  3BFA A;  2JXC A;  2JZI A;  3I5G B;  1TNX A;  4PHN A;  3S0B A;  2KLD A;  1KSM A;  2I94 A;  1OE9 B;  1P28 A;  3WHT B;  4GUK A;  3F45 A;  1K90 D;  2JT3 A;  1K8U A;  3Q8I A;  1Z4H A;  2BBM A;  3LL8 B;  5ER4 X;  3FE9 A;  1XYD A;  1MQ1 A;  2FJU B;  2LCP A;  4OVN F;  2M97 A;  1QVI Z;  1IQ5 A;  4M2O A;  2KBI A;  2ZKM X;  2LMV A;  3JVT C;  3SIA A;  3TUY C;  2MAZ A;  1RFJ A;  5AFP A;  1QIV A;  4YGB B;  2LV7 A;  2MHH A;  3R1V A;  2BEC A;  1J7P A;  3GK4 X;  1T14 A;  2LM5 A;  1K2H A;  4OCI A;  2MBX A;  3SG4 A;  4R1E A;  3BUX B;  1JC2 A;  3B7A A;  1C07 A;  2MRD A;  1DGV A;  3EVR A;  4N1F A;  1G4Y R;  1B7T Z;  3CWG A;  1UP5 A;  1Y1U A;  3MSE B;  3NSL A;  2KI4 C;  1XVJ A;  4L9M A;  4P2Y B;  1PK0 D;  4IL1 A;  1U5I B;  3DVE A;  3JVT B;  1SRA A;  2F33 A;  1QX2 A;  1FBV A;  3EG5 B;  3TUY B;  3SG5 A;  5CSI A;  1BR4 B;  3HX4 A;  1UUR A;  2TN4 A;  2HF5 A;  2OS8 C;  2R2I A;  3DVM A;  3KPX A;  3L4L A;  3TS5 C;  3D0Y B;  3PN7 C;  1TRF A;  2K2A A;  1PRW A;  3KO0 A;  3M0W A;  1B9A A;  4OKH A;  1NX0 A;  1RTP 1;  1JFJ A;  2CCM A;  1XFV O;  2KI4 B;  3S0D A;  2JNF A;  1QLK A;  4GFT A;  1W9Z A;  4HRE E;  2HPS A;  2M1K B;  2P70 A;  1FPW A;  1U5I A;  3CAB A;  4JWQ A;  1KFU L;  4MRX A;  3PFV A;  1TNW A;  2PSR A;  1GJY A;  3EVU A;  2ZNE A;  2MJW B;  2WC6 A;  1IH0 A;  4INX A;  1LA0 A;  3O4Y A;  2OS8 B;  2K7C A;  3TS5 B;  3D0Y A;  1N2D A;  3OB1 B;  3PN7 B;  1AK8 A;  2L2E A;  1QV1 A;  3CZ2 A;  2AAO A;  3OX6 A;  4NDD A;  3VRN A;  5EL2 A;  2O5G A;  4YI8 A;  3TDU A;  1CB1 A;  3PSR A;  1W7I B;  1KFX S;  1IJ6 A;  3OBV A;  5F6T A;  2LUX A;  5JJG A;  4BY5 A;  3WHU B;  1FI5 A;  1BLQ A;  1HQV A;  1NPQ A;  2VRG A;  3PAT A;  3BYA A;  4QJ3 B;  2LUC A;  2KI6 D;  3FWC A;  3OP0 A;  1NWD A;  3PM8 A;  2KDH A;  1S26 D;  2P71 A;  1JUO A;  1QS7 A;  1S6C A;  2H61 A;  2KNE A;  1XK4 C;  1KK8 C;  4JPZ B;  1NCX A;  2M8U A;  1PVA A;  2CBL A;  1Y0V H;  1QIW A;  2WND A;  3BUO B;  3S0A A;  1IKU A;  1DF0 A;  5JOL A;  2ZFD A;  1QJT A;  1WRK A;  2WCB A;  3R1P A;  3D75 A;  2BCX A;  1PVB A;  1RJV A;  4MVF A;  1S5G Z;  1TCO B;  3D78 A;  1SSE B;  2COL B;  4PCW A;  1OZS A;  2CXJ A;  3CR2 A;  4YGC B;  1EH2 A;  2M49 B;  1UHJ A;  2HET A;  2LLU A;  2F3Z A;  4BY4 A;  1KK8 B;  2HQ8 A;  1SMG A;  1OOI X;  3HCM A;  3CLN A;  4AQI A;  1TUZ A;  1M39 A;  4I5N B;  3VRR A;  4A4B A;  1C7V A;  4MZL A;  1TUJ A;  1YX8 A;  2SCP A;  5D3O A;  3FWB A;  1FI6 A;  2SAS A;  1NX1 A;  5FI2 A;  2O60 A;  4HRH A;  1DTL A;  1S6I A;  4OR9 B;  1F54 A;  1J1D A;  2FOT A;  1KQM B;  5TNC A;  1XK4 A;  1NCZ A;  1AVS A;  2PAL A;  5HLO A;  3BUM B;  1CFP A;  4FQT A;  1CDP A;  3DZT A;  3SS4 A;  1B8R A;  3EKJ A;  1J7R A;  3S0E A;  2JPO A;  3VRP A;  1ALV A;  1B1G A;  4YGE B;  1YR5 A;  1CM4 A;  1SBJ A;  2BAP A;  1CDL A;  3VRO A;  1KK7 Y;  2L0P A;  4PT1 A;  2B1U A;  5K89 A;  5KSZ A;  2PAS A;  3SIB A;  4QJ4 B;  2BNX A;  3B87 A;  2ZRT A;  4XJK B;  1UWO A;  1M31 A;  1MHO A;  3CZT X;  2L98 A;  3K1E A;  1LXF C;  2K7B A;  1LKJ A;  2AUC A;  2KFH A;  2WCM A;  1DJZ A;  4AOM A;  5HYD A;  1L7Z A;  5HLV A;  3B6X A;  1V1G A;  1DC1 A;  4GPL B;  1WLM A;  1QAS A;  2Y4Q A;  3CDN A;  4E68 A;  2F8P A;  2KAX A;  3CYZ A;  5FI6 A;  1ZFS A;  4YBH B;  4PE7 A;  5HKW A;  4MRY A;  1BG1 A;  3CR5 X;  4NQG A;  1SYM A;  4XJK A;  4N1G A;  3OGN A;  1GGZ A;  1WDC C;  1CLM A;  3S0G A;  3CGA A;  1EJ3 A;  1MUX A;  1WY9 A;  3A8R A;  3NSO A;  2LC5 A;  2PMY A;  2BE4 A;  2BCB A;  2KAV A;  3BUN B;  4Q04 A;  1PSB A;  4D1E A;  2WCL A;  2KQY A;  1NIW A;  4MZK A;  2KSP A;  2ZN9 A;  1OZO A;  1XFX O;  2M7N A;  1QWV A;  2KHN A;  2L4H A;  1SY9 A;  2LNK A;  1JF2 A;  1RWY A;  2BKI B;  1F55 A;  1WDC B;  1G33 A;  4WRI A;  4HRG A;  1MXE A;  4IJ7 A;  3L4A A;  4CFQ A;  2PYQ A;  2BE6 A;  1DJW A;  2QPT A;  3KEV A;  2H61 C;  5KU1 A;  1DT7 B;  1V1F A;  2LVI A;  4MZJ A;  2M3W A;  2WOR A;  1CMG A;  2JQ6 A;  2ZRS A;  5CSJ A;  1QVI Y;  3JTD C;  1Y6W A;  1XFY O;  3D74 A;  4C0J A;  1CM1 A;  1TCF A;  3V2L A;  2ERB A;  1EXR A;  3C1V A;  2LVJ A;  1J1E A;  3DXL A;  2GTE A;  1D1O A;  1ORG A;  1NYA A;  3BOW A;  1QLS A;  1K95 A;  2KBM A;  3FE8 A;  3BXK A;  1IQ3 A;  4ZCU A;  1BT6 A;  1B7T Y;  3D10 A;  2ISD A;  2QEV A;  2JU0 A;  1JFK A;  1S36 A;  2Q4U A;  3AKA A;  3LLE A;  3DYE A;  2KLE A;  4PE1 A;  2E30 A;  4C0L A;  3JTD B;  2K60 A;  1BU3 A;  1NX2 A;  2GGM A;  3RM1 A;  5BPJ A;  2FCD A;  1DF0 B;  3RLZ A;  2F3Y A;  4FQO A;  2E6W A;  3SG7 A;  4DIR A;  1TN4 A;  4JD9 A;  3SG6 A;  1BR1 B;  1F4O A;  2KPH A;  2H8V A;  3SJS A;  2JUL A;  1SNL A;  1ODB A;  1SCV A;  1DVI A;  2KAY A;  4A4C A;  1N0Y A;  2PRU A;  2YGU A;  1OOH A;  2P6B B;  2KGB C;  5AER A;  1OOF A;  1SPY A;  1AP4 A;  1CDM A;  2WCH A;  3GK1 A;  2EGD A;  2JXL A;  1G8I A;  5I2O A;  5DIC A;  3NXA A;  4PDZ A;  4P5O E;  2L5Y A;  1NUB A;  1QXP A;  1LS8 A;  1R6P A;  2CT9 A;  2K61 A;  4OV2 A;  3SS3 A;  3NHT A;  3GK2 A;  2I18 A;  1XO5 A;  1OOJ A;  1Y1X A;  2K2F A;  2FJY A;  2KI6 C;  4MLW A;  1CFD A;  1GQM A;  2QAC A;  4TNC A;  4CFR A;  4M2P A;  1TTX A;  4MEW A;  3D76 A;  3L47 A;  5FYX A;  3IQQ A;  1QAT A;  2OTG C;  2F2O A;  3QME A;  4I5K A;  3UNW A;  3O78 A;  3VRQ A;  4YGD B;  2NLN A;  2CNP A;  1K9K A;  4U8D A;  3VGO A;  1CDN A;  2LLT A;  1AJ4 A;  5G08 A;  2MLF C;  1A03 A;  3O4X A;  4GGN A;  1UUS A;  3I5F C;  1XFZ O;  1B4C A;  2M7L A;  1K94 A;  1OSA A;  5J3X A;  1KQV A;  1DMO A;  2JNX A;  4PE4 A;  3H4S E;  1DEL A;  4HSZ A;  3O6B A;  2OTG B;  1TNQ A;  2NZ0 A;  2Y5I A;  5I2L A;  2LHL A;  1MXL C;  1NP8 A;  4ORB B;  4PHM A;  3WXA A;  1S5G Y;  1FF1 A;  1SR6 C;  1PAL A;  5FI7 A;  1X02 A;  4XYN A;  3AKB A;  2CTN A;  2IS9 A;  1SW8 A;  2BCA A;  2Y1N A;  1C7W A;  1L2O C;  3I5F B;  2LLS A;  5D69 A;  4GNK B;  2KGR A;  1UHI A;  5D7F A;  3R1O A;  3SG3 A;  4KYN A;  1F8H A;  5I8N A;  4MN0 A;  2V53 A;  4NDC A;  1BOD A;  1K96 A;  2EHB A;  1TOP A;  4MSP A;  2LMU A;  3LK0 A;  3K21 A;  1MF8 B;  1UHH A;  3BFH A;  4FTG A;  4YRU A;  5I2Q A;  1K93 D;  1KFX L;  1M63 B;  1TNP A;  1ZUZ A;  2LMT A;  1GM0 A;  1SR6 B;  1ZMZ A;  1WRL A;  1NCY A;  1DGU A;  1XA5 A;  3PAL A;  1L2O B;  2WC5 A;  3FS7 A;  5CSN A;  1PUL A;  1CMF A;  1WRZ A;  1JBA A;  5DKN A;  5AAN A;  1SK6 D;  2LVK A;  3BUW B;  3A4U B;  2G9B A;  1SL9 A;  1DJH A;  1AJ5 A;  1F4Q A;  3NGV A;  3CZ0 A;  3IF7 A;  1YRU B;  2JTT A;  2ZN8 A;  3DY9 A;  4ICB A;  1KCY A;  1TIZ A;  1REC A;  1C3Y A;  1QV0 A;  1VRK A;  1WLZ A;  1YVH A;  2WOS A;  2BBN A;  2NCP A;  1LIN A;  3NSI A;  4C0K A;  2L2C A;  2K8M B;  2L51 A;  4GGF A;  5IBW A;  3OB2 B;  1JF0 A;  3KF9 A;  1A29 A;  2JRF A;  1IG5 A;  2KFF A;  2Q91 A;  3EVV A;  3SG2 A;  4DS7 A;  4UPG A;  1DJY A;  2GV5 A;  1SL8 A;  1ZAC A;  1J7O A;  1A2X A;  4ORA B;  3B86 A;  3EKH A;  1JWD A;  3B88 A;  4AQJ A;  1YUS A;  4ETO A;  1XFU O;  1S3P A;  2M29 A;  3BOW B;  4QJ5 B;  2D8N A;  1YTZ C;  4ORC B;  1F70 A;  4PE0 A;  1NSH A;  1ALW A;  1E8A A;  1CLL A;  2JT0 A;  3IQO A;  5DKQ A;  4MBE A;  2ZND A;  2K0J A;  3FE6 A;  1B8L A;  3NSK A;  3WNX B;  1DEK A;  3DF0 B;  4PAL A;  2QEO A;  3ZWH A;  4F0Z B;  1UHK A;  5CSF A;  2WC8 A;  1CNP A;  1F71 A;  2L50 A;  1EL4 A;  1DJX A;  3BFB A;  3CTN A;  3D73 A;  1CFF A;  1H4B A;  1OMV A;  3CS1 A;  4JQ0 D;  2WCK A;  1OOG A;  2K7O A;  2A4J A;  1CLB A;  1J7Q A;  1MR8 A;  4GAO A;  4DUQ A;  1CKK A;  1IWQ A;  1W7J B;  2FCE A;  3DVK A;  3TDZ A;  4N5X A;  3NHI A;  1XFW O;  4CLN A;  3DF0 A;  2M1U A;  2I7A A;  1PSR A;  2LP3 A;  2PVB A;  2KQ6 A;  3N7H A;  5HKY A;  5ER5 A;  1BF5 A;  1FW4 A;  1SCM C;  5AXI A;  1OW4 A;  2PQL A;  1DQE A;  3AAK A;  1YUR A;  2KYC A;  2JC2 A;  4DRW A;  2JOJ A;  2LHI A;  2NCO A;  4PHK A;  2LVV A;  5KTY A;  1YUT A;  2JWW A;  5CPV A;  2KYF A;  2MLE C;  1QX5 B;  2I2R E;  3FIA A;  4CID A;  4JKT A;  3LK1 A;  4INW A;  2HQW A;  2RGI A;  4PHJ A;  1IJ5 A;  1IIO A;  2M0R A;  1RRO A;  1Q80 A;  1SCM B;  3R72 A;  2L5X B;  1GGW A;  3PM2 A;  3I5I C;  1J55 A;  2LAP A;  2GGZ A;  2LAN A;  5HL1 A;  2WCF A;  1YX7 A;  1TWO A;  1SL7 A; 
#chains in the Genus database with same CATH homology
 3KHE A;  5GQQ C;  1A75 B;  2EC6 C;  3EK4 A;  5AEQ A;  3ZNI A;  1BMO A;  1SKT A;  2BL0 C;  2L4I A;  1M45 A;  1BJF A;  1MWN A;  2JT8 A;  4USL A;  3O2P A;  4ZCV A;  1RK9 A;  1N65 A;  2BKH B;  1UHN A;  3DD4 A;  3I5I B;  4YI9 A;  2KFG A;  2LE9 B;  2LP2 A;  2MA2 A;  1K9P A;  4I5L B;  1BOC A;  3LCP C;  2G2B A;  5DKR A;  1OMR A;  1CTR A;  1KK7 Z;  4GBA A;  1A75 A;  2EC6 B;  1OQP A;  2BL0 B;  1KQM C;  2H2K A;  1IRJ A;  3OX5 A;  3EK7 A;  1S1E A;  2OPO A;  3I5H C;  4YGA A;  1H8B A;  1DJG A;  1NX3 A;  1M46 A;  1AUI B;  1YVL A;  4WQ3 A;  2WCE A;  3PLF B;  3DVJ A;  2NXQ A;  1DJI A;  1OMD A;  4GGF C;  3TDI A;  3E3R A;  2JTZ A;  1EG3 A;  1R2U A;  1JSA A;  2AMI A;  1KWO C;  1KFU S;  2K7D A;  1B8C A;  1KSO A;  3I5H B;  1YRT B;  4DCK A;  3AAJ A;  1S6J A;  3I5G C;  5PAL A;  2Y1M A;  3GOF A;  4I5J A;  2F2P A;  3EK8 A;  1EG4 A;  2DOQ A;  3OHM B;  1CFC A;  1LVC D;  4M2Q A;  1QX7 A;  1ZOT B;  5HKZ A;  2M9G A;  1A4P A;  1Y1A A;  3ICB A;  3QRX A;  1IGV A;  1QTX A;  1YUU A;  1HT9 A;  3BQ3 A;  1AHR A;  1B47 A;  5B8I B;  2KOT A;  4NDB A;  3CR4 X;  1KWO B;  4CPV A;  1K9U A;  2JPT A;  3TZ1 A;  1LA3 A;  4WQ2 A;  2JXC A;  2JZI A;  3I5G B;  1TNX A;  4PHN A;  1KSM A;  2I94 A;  1OE9 B;  3WHT B;  4GUK A;  3F45 A;  1K90 D;  2JT3 A;  1K8U A;  2BBM A;  3LL8 B;  5ER4 X;  1XYD A;  1MQ1 A;  2FJU B;  2LCP A;  4OVN F;  2M97 A;  1QVI Z;  1IQ5 A;  4M2O A;  2KBI A;  2ZKM X;  2LMV A;  3JVT C;  3SIA A;  3TUY C;  2MAZ A;  1RFJ A;  5AFP A;  1QIV A;  4YGB B;  2LV7 A;  2MHH A;  1J7P A;  2BEC A;  3GK4 X;  2LM5 A;  1K2H A;  4OCI A;  2MBX A;  3SG4 A;  4R1E A;  3BUX B;  1JC2 A;  1C07 A;  2MRD A;  1DGV A;  3EVR A;  4N1F A;  1G4Y R;  1B7T Z;  3CWG A;  1UP5 A;  1Y1U A;  3MSE B;  3NSL A;  2KI4 C;  1XVJ A;  4L9M A;  4P2Y B;  1PK0 D;  4IL1 A;  1U5I B;  3DVE A;  3JVT B;  1SRA A;  2F33 A;  1QX2 A;  1FBV A;  3TUY B;  3SG5 A;  5CSI A;  1BR4 B;  3HX4 A;  1UUR A;  2TN4 A;  2HF5 A;  2OS8 C;  2R2I A;  3DVM A;  3KPX A;  3TS5 C;  3D0Y B;  3PN7 C;  1TRF A;  2K2A A;  1PRW A;  3KO0 A;  3M0W A;  1B9A A;  4OKH A;  1NX0 A;  1RTP 1;  1JFJ A;  2CCM A;  1XFV O;  2KI4 B;  2JNF A;  1QLK A;  4GFT A;  4HRE E;  2HPS A;  2M1K B;  1FPW A;  1U5I A;  4JWQ A;  1KFU L;  4MRX A;  3PFV A;  1TNW A;  2PSR A;  1GJY A;  3EVU A;  2ZNE A;  2MJW B;  1IH0 A;  1LA0 A;  3O4Y A;  2OS8 B;  2K7C A;  3TS5 B;  3D0Y A;  1N2D A;  3OB1 B;  3PN7 B;  1AK8 A;  2L2E A;  1QV1 A;  2AAO A;  3OX6 A;  4NDD A;  3VRN A;  2O5G A;  4YI8 A;  3TDU A;  1CB1 A;  3PSR A;  1W7I B;  1KFX S;  1IJ6 A;  5F6T A;  2LUX A;  5JJG A;  4BY5 A;  3WHU B;  1FI5 A;  1BLQ A;  1HQV A;  1NPQ A;  2VRG A;  3PAT A;  3BYA A;  4QJ3 B;  2LUC A;  2KI6 D;  3FWC A;  3OP0 A;  1NWD A;  3PM8 A;  2KDH A;  1S26 D;  1JUO A;  1QS7 A;  1S6C A;  2H61 A;  2KNE A;  1XK4 C;  1KK8 C;  4JPZ B;  1NCX A;  2M8U A;  1PVA A;  2CBL A;  1Y0V H;  1QIW A;  2WND A;  3BUO B;  1IKU A;  1DF0 A;  5JOL A;  2ZFD A;  1QJT A;  1WRK A;  2WCB A;  2BCX A;  1PVB A;  1RJV A;  4MVF A;  1S5G Z;  1TCO B;  2COL B;  4PCW A;  1OZS A;  2CXJ A;  3CR2 A;  4YGC B;  1EH2 A;  2M49 B;  1UHJ A;  2LLU A;  2F3Z A;  4BY4 A;  1KK8 B;  2HQ8 A;  1SMG A;  3HCM A;  3CLN A;  4AQI A;  1M39 A;  4I5N B;  3VRR A;  4A4B A;  1C7V A;  4MZL A;  1YX8 A;  2SCP A;  3FWB A;  1FI6 A;  2SAS A;  1NX1 A;  2O60 A;  4HRH A;  1DTL A;  1S6I A;  4OR9 B;  1F54 A;  1J1D A;  2FOT A;  1KQM B;  5TNC A;  1XK4 A;  1NCZ A;  1AVS A;  2PAL A;  5HLO A;  3BUM B;  1CFP A;  1CDP A;  1B8R A;  3EKJ A;  1J7R A;  3VRP A;  1ALV A;  1B1G A;  4YGE B;  1YR5 A;  1CM4 A;  1SBJ A;  1CDL A;  3VRO A;  1KK7 Y;  2L0P A;  2B1U A;  5K89 A;  5KSZ A;  2PAS A;  3SIB A;  4QJ4 B;  2ZRT A;  4XJK B;  1UWO A;  1M31 A;  1MHO A;  3CZT X;  2L98 A;  1LXF C;  2K7B A;  1LKJ A;  2AUC A;  2KFH A;  1DJZ A;  4AOM A;  5HYD A;  1L7Z A;  5HLV A;  1V1G A;  4GPL B;  1WLM A;  1QAS A;  2Y4Q A;  4E68 A;  2F8P A;  2KAX A;  1ZFS A;  4YBH B;  4PE7 A;  5HKW A;  4MRY A;  1BG1 A;  3CR5 X;  4NQG A;  1SYM A;  4XJK A;  4N1G A;  1GGZ A;  1WDC C;  1CLM A;  3CGA A;  1EJ3 A;  1MUX A;  1WY9 A;  3A8R A;  3NSO A;  2LC5 A;  2PMY A;  2BE4 A;  2BCB A;  2KAV A;  3BUN B;  4Q04 A;  1PSB A;  4D1E A;  2KQY A;  1NIW A;  4MZK A;  2KSP A;  2ZN9 A;  1OZO A;  1XFX O;  2M7N A;  2KHN A;  2L4H A;  1SY9 A;  2LNK A;  1JF2 A;  1RWY A;  2BKI B;  1F55 A;  1WDC B;  1G33 A;  4WRI A;  4HRG A;  1MXE A;  4CFQ A;  2BE6 A;  1DJW A;  2QPT A;  3KEV A;  2H61 C;  5KU1 A;  1DT7 B;  1V1F A;  2LVI A;  4MZJ A;  2M3W A;  2WOR A;  1CMG A;  2JQ6 A;  2ZRS A;  5CSJ A;  1QVI Y;  3JTD C;  1Y6W A;  1XFY O;  4C0J A;  1CM1 A;  1TCF A;  1EXR A;  3C1V A;  2LVJ A;  1J1E A;  1D1O A;  3BOW A;  1NYA A;  1QLS A;  1K95 A;  2KBM A;  3BXK A;  1IQ3 A;  4ZCU A;  1BT6 A;  1B7T Y;  3D10 A;  2ISD A;  2JU0 A;  1JFK A;  1S36 A;  2Q4U A;  3AKA A;  3LLE A;  4C0L A;  4PE1 A;  2E30 A;  3JTD B;  1BU3 A;  1NX2 A;  2GGM A;  3RM1 A;  5BPJ A;  2FCD A;  1DF0 B;  3RLZ A;  2F3Y A;  4FQO A;  2E6W A;  3SG7 A;  4DIR A;  1TN4 A;  3SG6 A;  1BR1 B;  1F4O A;  3SJS A;  2JUL A;  1SNL A;  1ODB A;  1SCV A;  1DVI A;  2KAY A;  4A4C A;  1N0Y A;  2PRU A;  2P6B B;  2KGB C;  5AER A;  1AP4 A;  1SPY A;  1CDM A;  3GK1 A;  2EGD A;  2JXL A;  1G8I A;  5I2O A;  3NXA A;  4PDZ A;  4P5O E;  1NUB A;  1QXP A;  1R6P A;  2CT9 A;  2K61 A;  4OV2 A;  3GK2 A;  2I18 A;  1XO5 A;  1OOJ A;  1Y1X A;  2K2F A;  2KI6 C;  4MLW A;  1CFD A;  1GQM A;  2QAC A;  4TNC A;  4CFR A;  4M2P A;  1TTX A;  4MEW A;  5FYX A;  3IQQ A;  1QAT A;  2OTG C;  2F2O A;  4I5K A;  3O78 A;  3VRQ A;  4YGD B;  2NLN A;  2CNP A;  1K9K A;  4U8D A;  3VGO A;  1CDN A;  2LLT A;  1AJ4 A;  5G08 A;  2MLF C;  1A03 A;  4GGN A;  1UUS A;  3I5F C;  1XFZ O;  1B4C A;  2M7L A;  1K94 A;  1OSA A;  5J3X A;  1KQV A;  1DMO A;  2JNX A;  4PE4 A;  3H4S E;  4HSZ A;  3O6B A;  2OTG B;  1TNQ A;  2NZ0 A;  2Y5I A;  5I2L A;  2LHL A;  1MXL C;  1NP8 A;  4ORB B;  4PHM A;  3WXA A;  1S5G Y;  1FF1 A;  1SR6 C;  1PAL A;  1X02 A;  4XYN A;  3AKB A;  2CTN A;  2IS9 A;  1SW8 A;  2BCA A;  2Y1N A;  1C7W A;  1L2O C;  3I5F B;  2LLS A;  5D69 A;  4GNK B;  2KGR A;  1UHI A;  5D7F A;  1F8H A;  3SG3 A;  5I8N A;  4MN0 A;  2V53 A;  4NDC A;  1BOD A;  1K96 A;  2EHB A;  1TOP A;  4MSP A;  2LMU A;  3LK0 A;  3K21 A;  1MF8 B;  1UHH A;  4FTG A;  5I2Q A;  4YRU A;  1K93 D;  1KFX L;  1M63 B;  1TNP A;  1ZUZ A;  2LMT A;  1SR6 B;  1ZMZ A;  1WRL A;  1NCY A;  1DGU A;  1XA5 A;  3PAL A;  1L2O B;  3FS7 A;  5CSN A;  1PUL A;  1CMF A;  1WRZ A;  1JBA A;  5DKN A;  5AAN A;  1SK6 D;  2LVK A;  3BUW B;  3A4U B;  2G9B A;  1SL9 A;  1DJH A;  1AJ5 A;  1F4Q A;  3IF7 A;  4ICB A;  1YRU B;  2JTT A;  2ZN8 A;  1KCY A;  1TIZ A;  1REC A;  1QV0 A;  1VRK A;  1WLZ A;  1YVH A;  2WOS A;  2BBN A;  2NCP A;  1LIN A;  3NSI A;  4C0K A;  2K8M B;  2L51 A;  4GGF A;  5IBW A;  3OB2 B;  1JF0 A;  3KF9 A;  1A29 A;  2JRF A;  1IG5 A;  2KFF A;  2Q91 A;  3EVV A;  3SG2 A;  4DS7 A;  4UPG A;  1DJY A;  2GV5 A;  1SL8 A;  1ZAC A;  1J7O A;  1A2X A;  4ORA B;  3EKH A;  1JWD A;  4AQJ A;  4QJ5 B;  1YUS A;  4ETO A;  1XFU O;  1S3P A;  2M29 A;  3BOW B;  2D8N A;  1YTZ C;  4ORC B;  1F70 A;  4PE0 A;  1NSH A;  1ALW A;  1E8A A;  1CLL A;  2JT0 A;  3IQO A;  5DKQ A;  4MBE A;  2ZND A;  2K0J A;  1B8L A;  3NSK A;  3WNX B;  3DF0 B;  4PAL A;  3ZWH A;  4F0Z B;  1UHK A;  5CSF A;  2WC8 A;  1CNP A;  1F71 A;  2L50 A;  1EL4 A;  1DJX A;  3CTN A;  1CFF A;  1H4B A;  1OMV A;  3CS1 A;  4JQ0 D;  2K7O A;  2A4J A;  1CLB A;  1J7Q A;  1MR8 A;  4GAO A;  4DUQ A;  1CKK A;  1IWQ A;  1W7J B;  2FCE A;  3DVK A;  3TDZ A;  4N5X A;  1XFW O;  4CLN A;  3DF0 A;  2M1U A;  2I7A A;  1PSR A;  2LP3 A;  2PVB A;  2KQ6 A;  5HKY A;  5ER5 A;  1BF5 A;  1FW4 A;  1SCM C;  5AXI A;  3AAK A;  1YUR A;  2KYC A;  2JC2 A;  4DRW A;  2JOJ A;  2LHI A;  2NCO A;  4PHK A;  2LVV A;  5KTY A;  1YUT A;  2JWW A;  5CPV A;  2KYF A;  2MLE C;  1QX5 B;  2I2R E;  3FIA A;  4CID A;  3LK1 A;  2HQW A;  2RGI A;  4PHJ A;  1IJ5 A;  2M0R A;  1RRO A;  1Q80 A;  1SCM B;  1GGW A;  2L5X B;  3I5I C;  1J55 A;  2LAP A;  2GGZ A;  2LAN A;  2WCF A;  1YX7 A;  2HET A;  1SL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...