2L51A

Solution structure of calcium bound s100a16
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
102
structure length
102
Chain Sequence
SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A16
publication title Structural characterization of human S100A16, a low-affinity calcium binder.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2l51A00
3CZTX 1TTXA 5CSNA 5JOLA 2A4JA 4BY4A 2Y5IA 3HCMA 2LUXA 3H4SE 1QVIY 5D69A 4M2OA 2JT0A 1VRKA 2WCFA 3FS7A 3PSRA 1XFXO 1KK8C 2F2OA 4A4CA 4PE1A 1BG1A 3GOFA 1XVJA 1DF0A 1M46A 5AANA 1TNXA 1UHJA 3JTDC 4BY5A 1L2OC 4MN0A 1IQ5A 1DT7B 1CLBA 1K9KA 4DS7A 2K7DA 3DD4A 1QATA 5I2OA 1EL4A 2L51A 2LP3A 1K9UA 3KO0A 3WXAA 1NSHA 2OS8C 3BUWB 1FF1A 2PVBA 2SCPA 3O6BA 3GK2A 2PALA 3CR2A 1B8CA 1BMOA 4I5KA 1JC2A 3DF0A 1G8IA 3OB2B 2NLNA 3OB1B 3IQOA 1QLKA 4JQ0D 4PHNA 3I5FC 2JXCA 2PRUA 2LLSA 1NCYA 2CTNA 2I2RE 2AAOA 5AEQA 4FQOA 3TUYB 4MLWA 4PCWA 2BCXA 3EK7A 2IS9A 2BKHB 5AXIA 5JJGA 4MSPA 3DVEA 4A4BA 1SCMC 3SG3A 4NDBA 3D0YB 2Y1NA 2JXLA 4I5LB 5CSIA 1SL8A 2K2FA 1KK8B 1UHNA 1RROA 3VRQA 3CR4X 3VRPA 2LHIA 2RGIA 1LVCD 2EGDA 1AUIB 4M2QA 1JBAA 1KFUL 2FOTA 3JTDB 1AJ4A 1L2OB 1MXEA 4DIRA 1YRUB 4JPZB 1YUSA 4PHJA 2M0RA 3I5GC 1CM4A 1TNPA 2KYFA 2L4HA 1FPWA 2M3WA 4N1FA 4XYNA 1J55A 1UHIA 2V53A 1DJIA 1NX3A 1IKUA 2OS8B 3DVKA 4AQJA 2LVVA 2MLEC 3O4YA 1WDCC 1X02A 1SCVA 1CTRA 2H61A 2MLFC 4I5NB 2MBXA 1FI6A 1QV1A 1Y6WA 1TNWA 1PSRA 2L50A 2Q4UA 1EG4A 3BUMB 1BODA 3PN7C 2K2AA 1LXFC 4USLA 1DF0B 1RFJA 4DCKA 3CGAA 1MF8B 3PALA 4P5OE 1A4PA 1TCOB 1A03A 4IL1A 1KQMB 1OMVA 3CS1A 2BCBA 4AQIA 4MRYA 4YI9A 1ZUZA 1PRWA 3NSKA 3KHEA 2HQWA 2SASA 3NXAA 2HQ8A 1B4CA 2MA2A 2AUCA 4C0LA 1TN4A 3I5HC 3TDUA 1SCMB 2WORA 4PHKA 1HT9A 3LK0A 4WRIA 1S5GZ 1QX7A 3D10A 1DJXA 4GNKB 3TDZA 1OMRA 4ICBA 4QJ5B 5HKWA 2G9BA 2OPOA 5IBWA 3DF0B 1F8HA 4XJKA 4MBEA 1WRLA 3BQ3A 1IRJA 2KBMA 3EVUA 2P6BB 1CM1A 2K61A 4U8DA 4MZJA 1BOCA 3KEVA 1UWOA 2KQYA 1PK0D 1SL9A 1AP4A 3FWCA 4N5XA 1DJWA 3O2PA 4OR9B 2F3YA 2I18A 1QVIZ 1L7ZA 4PE7A 4YI8A 3ZNIA 1M45A 2LV7A 1KWOC 4GAOA 1SKTA 1V1GA 1H8BA 2KI6D 1MR8A 2BECA 4NDCA 1FBVA 1XFUO 1KFXS 1B7TY 1S3PA 3BYAA 2LNKA 1DGUA 1WRZA 2BL0C 3PN7B 1CDPA 2Q91A 1XA5A 1KQVA 2LHLA 1YR5A 2QACA 1CB1A 1YURA 4OCIA 1QS7A 5CSJA 4HRHA 1FW4A 1SPYA 4CFQA 3EKHA 2VRGA 2L2EA 3SG2A 2E30A 2ZRSA 1EJ3A 1DVIA 2TN4A 3I5HB 4CIDA 2F8PA 1TCFA 1IQ3A 2Y4QA 5CSFA 1A75A 3TS5C 4TNCA 2JU0A 4MVFA 1RK9A 2LMUA 2NCPA 4HSZA 2OTGC 2JULA 1N65A 5DKRA 1BJFA 2HF5A 3IF7A 4DUQA 1B9AA 2FJUB 4GUKA 2M7LA 1AHRA 2M9GA 1JUOA 1OZSA 5KU1A 2LMVA 1K90D 2KI4C 1LINA 2ZN8A 4NQGA 5D7FA 2CNPA 4JWQA 1S6JA 1MQ1A 1SRAA 1XFYO 1KWOB 2CCMA 2KGRA 3JVTC 5PALA 2EC6C 3A4UB 4ORBB 1BT6A 2JTTA 2KAYA 2BL0B 2KSPA 1MUXA 5KTYA 2MHHA 3LCPC 3SIBA 1IH0A 1JSAA 4XJKB 2M7NA 1LA3A 1A2XA 1QLSA 1TNQA 2KGBC 2LE9B 2WC8A 3EK4A 4MZKA 1V1FA 1N2DA 1TRFA 3PATA 2KYCA 1OSAA 2KFFA 1NX0A 2NCOA 1UURA 1CLMA 1S6IA 4D1EA 1J7RA 3VGOA 1GJYA 2DOQA 2LUCA 1R2UA 4PE0A 1YX8A 3GK1A 4ORAB 4OV2A 1WLMA 2PMYA 3TS5B 2K8MB 2BKIB 2JOJA 2LC5A 3OP0A 2OTGB 1XFZO 1K96A 3C1VA 3SG5A 1G33A 2L0PA 4R1EA 2HETA 3WHTB 1K95A 2B1UA 5DKNA 4Q04A 4ZCUA 2KI4B 1NX2A 1KK7Y 2FCEA 1OQPA 2BBMA 5ER5A 4MZLA 1SY9A 2K7BA 1FI5A 3I5FB 1GGZA 1DJGA 2KNEA 2E6WA 4YGCB 3JVTB 1CNPA 1W7IB 2EC6B 2JPTA 5HLVA 2KDHA 2BE6A 1DGVA 1A75B 2KI6C 2WOSA 1C7VA 1YTZC 2MAZA 1ZOTB 3BOWA 1DJYA 1WRKA 2ZNDA 3ICBA 2G2BA 1NCXA 1PVBA 1XK4A 4C0KA 1BF5A 1ALVA 2I7AA 4C0JA 2PASA 1JFJA 1UHKA 1NP8A 3AAJA 5HYDA 1Y1AA 1BR1B 1B7TZ 1LKJA 3BUXB 1NCZA 2LMTA 3I5GB 3EVRA 1F55A 4YGBB 3BUNB 1M31A 1GQMA 4OVNF 1EH2A 1Y1XA 1F4QA 1IWQA 5HKZA 1SL7A 2JTZA 2K7CA 2Y1MA 3NSIA 5HLOA 2LLTA 3E3RA 4YRUA 4N1GA 4CLNA 1WDCB 2KAXA 1MHOA 1OZOA 2NXQA 5I2QA 1S6CA 5BPJA 1F71A 1ZMZA 3IQQA 2GV5A 3BXKA 1XK4C 3OHMB 2M49B 3NSLA 3LK1A 2JT3A 2M1UA 1K93D 2LP2A 2JQ6A 4I5JA 1Y0VH 1UUSA 1XO5A 2K0JA 1KSOA 2ZKMX 2FCDA 1M63B 1OOJA 2JRFA 2KAVA 1PULA 1G4YR 1M39A 2LLUA 3LLEA 2MJWB 1S26D 1SYMA 4YBHB 1F70A 1NWDA 2F2PA 2JWWA 5K89A 1JFKA 4ZCVA 3GK4X 3DVMA 1IJ5A 1PALA 1SR6C 2GGZA 4L9MA 3FIAA 3VROA 4GGFA 2LVIA 2JNXA 2M29A 1ZACA 4E68A 1QIWA 2K7OA 1RWYA 1PVAA 4M2PA 4MRXA 4PALA 1DTLA 2L98A 1QASA 3QRXA 1ALWA 1YUTA 2KHNA 4YGAA 1IGVA 3AKAA 1DJHA 1CDNA 1S1EA 5TNCA 1YX7A 4HREE 2ZNEA 3CR5X 2CBLA 2HPSA 1CMGA 3SIAA 1RJVA 2PSRA 5ER4X 2BBNA 1UP5A 3BOWB 5FYXA 2I94A 3ZWHA 1CMFA 3LL8B 1SBJA 2NZ0A 5CPVA 5GQQC 2JC2A 4ETOA 1DJZA 3OX6A 1WLZA 1YVLA 1JF2A 4YGDB 4AOMA 4GGFC 1ZFSA 1CLLA 3I5IC 1EG3A 1YVHA 3KPXA 1OE9B 3SG4A 1QX5B 2WNDA 2CT9A 1F4OA 1ODBA 4PDZA 5KSZA 1B8LA 1W7JB 3OX5A 5DKQA 1CFFA 2JZIA 2JT8A 1NYAA 2EHBA 2O5GA 1OMDA 1GGWA 1J7QA 2LVJA 3PM8A 2F3ZA 1KQMC 1SR6B 3CWGA 1KFXL 3HX4A 1KK7Z 4GPLB 1Y1UA 3RM1A 4GBAA 4F0ZB 3PLFB 1QJTA 1RTP1 3CTNA 3TZ1A 3AKBA 1K2HA 1U5IA 2M8UA 1HQVA 1QX2A 1QTXA 1J1DA 2GGMA 1F54A 2KBIA 1B47A 1XFWO 1J1EA 4WQ2A 1NPQA 1CFDA 5I2LA 4OKHA 3TDIA 3VRRA 4QJ4B 5I8NA 3M0WA 2LVKA 2AMIA 3SG7A 1E8AA 1J7PA 4DRWA 1QXPA 2O60A 1B8RA 1NIWA 2QPTA 3PFVA 5J3XA 1QV0A 1SW8A 3KF9A 3MSEB 5F6TA 1AK8A 4WQ3A 3I5IB 2MRDA 3RLZA 4FTGA 4PHMA 2D8NA 2LCPA 2H2KA 4MEWA 5AFPA 1JF0A 2ZRTA 1UHHA 3O78A 1CKKA 1J7OA 2ZN9A 3BUOB 1EXRA 2COLB 1C7WA 1LA0A 1S36A 3DVJA 2BCAA 1H4BA 1IG5A 2WCEA 1NX1A 4GFTA 1A29A 1BLQA 1K94A 5G08A 1CDLA 3CLNA 2LAPA 1MXLC 2L4IA 2LM5A 1SK6D 1YUUA 1D1OA 1BU3A 4GGNA 1CFCA 1CDMA 3EVVA 4P2YB 3VRNA 1DMOA 1KCYA 3SG6A 1RECA 3EK8A 1SNLA 2CXJA 3SJSA 1BR4B 1PSBA 1AJ5A 2H61C 2JNFA 5B8IB 1QIVA 1WY9A 1YRTB 2WCBA 4CPVA 4PE4A 1K8UA 3K21A 5HKYA 1KSMA 1SMGA 1K9PA 1NUBA 4UPGA 4CFRA 4QJ3B 3D0YA 1JWDA 3F45A 2LANA 1CFPA 2ISDA 1TIZA 2ZFDA 3WHUB 1S5GY 1XFVO 2F33A 3A8RA 3AAKA 4ORCB 2BE4A 1R6PA 5AERA 2KFGA 2R2IA 3NSOA 2M1KB 1KFUS 1AVSA 2L5XB 4YGEB 2M97A 1IJ6A 4HRGA 1U5IB 3WNXB 1C07A 1XYDA 2KFHA 4NDDA 1MWNA 1TOPA 1N0YA 2KQ6A 3FWBA 3TUYC 3EKJA 1Q80A 1B1GA 2KOTA
chains in the Genus database with same CATH superfamily
3CZTX 1TTXA 3B87A 5CSNA 1OOIX 5JOLA 2A4JA 4BY4A 2Y5IA 3HCMA 2LUXA 3H4SE 1QVIY 3L4AA 5D69A 4M2OA 2JT0A 1VRKA 4JKTA 2WCFA 3FS7A 3PSRA 1XFXO 1KK8C 2F2OA 4A4CA 2BAPA 4PE1A 1BG1A 3GOFA 1XVJA 1DF0A 1M46A 1ORGA 1TNXA 1UHJA 3JTDC 5AANA 4BY5A 1L2OC 3B88A 4MN0A 1IQ5A 1DT7B 1CLBA 1K9KA 4DS7A 2K7DA 3DD4A 1QATA 5I2OA 1EL4A 2L51A 2LP3A 1K9UA 3KO0A 3WXAA 1NSHA 2OS8C 3BUWB 1FF1A 2PVBA 2SCPA 3O6BA 3GK2A 2PALA 3CR2A 1B8CA 1BMOA 4I5KA 1JC2A 3DF0A 1G8IA 3OB2B 2NLNA 3OB1B 3IQOA 1QLKA 1Z2CB 4JQ0D 4PHNA 2KLEA 2JXCA 3I5FC 2PRUA 2LLSA 1NCYA 2CTNA 2I2RE 2AAOA 5AEQA 4FQOA 3TUYB 4MLWA 4PCWA 2BCXA 2JPOA 3EK7A 2IS9A 2BKHB 5AXIA 5JJGA 4MSPA 3DVEA 4A4BA 1SCMC 3SG3A 2WCKA 3DXLA 4NDBA 3D0YB 2Y1NA 2JXLA 3DZTA 4I5LB 1SL8A 2K2FA 3D74A 1KK8B 5CSIA 1UHNA 1RROA 3VRQA 3CR4X 4INXA 2LHIA 2RGIA 3FE9A 3VRPA 1LVCD 2EGDA 1AUIB 4M2QA 1JBAA 1KFUL 2FOTA 3JTDB 1AJ4A 1L2OB 1MXEA 4DIRA 1YRUB 4JPZB 1YUSA 4PHJA 2M0RA 3I5GC 1CM4A 1TNPA 2KYFA 2L4HA 1FPWA 2M3WA 4N1FA 4XYNA 1J55A 1UHIA 2V53A 1DJIA 1NX3A 1IKUA 2OS8B 3DVKA 4AQJA 2LVVA 2MLEC 3O4YA 1WDCC 1X02A 1SCVA 1OOFA 1CTRA 2H61A 2MLFC 4I5NB 2MBXA 1FI6A 1QV1A 1Y6WA 1TNWA 1PSRA 2L50A 2Q4UA 1EG4A 3BUMB 1BODA 3PN7C 2K2AA 1TUJA 1LXFC 4USLA 1DF0B 1RFJA 1W9ZA 3CGAA 1MF8B 3N7HA 3PALA 1A4PA 1TCOB 4P5OE 4DCKA 4IL1A 1KQMB 1A03A 1OMVA 2P71A 3CS1A 2BCBA 4AQIA 4MRYA 3DY9A 1ZUZA 1PRWA 3NSKA 4YI9A 3KHEA 2HQWA 2SASA 3NXAA 2HQ8A 3Q8IA 1B4CA 2MA2A 2AUCA 4C0LA 1TUZA 1TN4A 3I5HC 3TDUA 1SCMB 2WORA 4PHKA 3FE8A 3R72A 1HT9A 3LK0A 4WRIA 1S5GZ 1QX7A 3D10A 1DJXA 3D78A 4GNKB 3TDZA 1OMRA 4ICBA 4QJ5B 5HKWA 2G9BA 2OPOA 5IBWA 3DF0B 1F8HA 4XJKA 4MBEA 1WRLA 3NGVA 3BQ3A 1IRJA 2KBMA 3EVUA 2P6BB 1CM1A 2K61A 4U8DA 4MZJA 1BOCA 3KEVA 1UWOA 2KQYA 1PK0D 1SL9A 1AP4A 3FWCA 4N5XA 1DJWA 3O2PA 4OR9B 2F3YA 2I18A 2L2CA 1QVIZ 1L7ZA 4KYNA 3V2LA 4PE7A 4YI8A 3ZNIA 1M45A 2LV7A 1KWOC 4GAOA 1SKTA 1V1GA 1H8BA 2KI6D 1MR8A 3FE6A 2BECA 4NDCA 1FBVA 1XFUO 1KFXS 1B7TY 1S3PA 3BYAA 2LNKA 1DGUA 1WRZA 2BL0C 3PN7B 1CDPA 2Q91A 3PJIA 1XA5A 3CZ2A 1KQVA 2LHLA 1YR5A 1P28A 2QACA 3S0DA 1CB1A 1YURA 3SS3A 4OCIA 1QS7A 5CSJA 4HRHA 1FW4A 1SPYA 4CFQA 1C3ZA 2GTEA 3EKHA 2VRGA 2L2EA 3SG2A 2E30A 2ZRSA 1EJ3A 1DVIA 2TN4A 3I5HB 1DELA 4CIDA 2F8PA 1TCFA 1IQ3A 2Y4QA 5CSFA 1A75A 3TS5C 4TNCA 2JU0A 4MVFA 2QEBA 1RK9A 2LMUA 1DQEA 2NCPA 4HSZA 2OTGC 2JULA 1N65A 5DKRA 1BJFA 2HF5A 3IF7A 4DUQA 1B9AA 2FJUB 3QMEA 1TWOA 4GUKA 2M7LA 1AHRA 2M9GA 5FI7A 1JUOA 1OZSA 5KU1A 2LMVA 1K90D 2KI4C 4PT1A 1LINA 2ZN8A 4NQGA 5D7FA 2CNPA 4JWQA 1S6JA 1MQ1A 1SRAA 1XFYO 1KWOB 2CCMA 2KGRA 3JVTC 5PALA 2EC6C 3A4UB 4ORBB 1BT6A 2JTTA 2KAYA 2BL0B 2KSPA 1MUXA 5KTYA 2MHHA 3LCPC 3SIBA 1IH0A 3S0AA 3K1EA 1JSAA 4XJKB 2M7NA 1LA3A 1C3YA 1A2XA 1QLSA 1TNQA 2KGBC 2LE9B 2WC8A 3EK4A 3S0FA 4MZKA 1V1FA 3B6XA 1N2DA 1TRFA 3PATA 2KYCA 1OSAA 2KFFA 1NX0A 2NCOA 5HL1A 1UURA 2H8VA 3R1PA 1CLMA 2ERBA 1S6IA 4D1EA 1J7RA 1DC1A 3VGOA 1GJYA 2DOQA 2LUCA 1R2UA 4PE0A 1YX8A 3GK1A 4ORAB 4OV2A 1WLMA 2PMYA 3TS5B 2K8MB 2FJYA 5I94A 2BKIB 2JOJA 2LC5A 3OP0A 2OTGB 1XFZO 1K96A 2YGUA 3C1VA 1G33A 2L0PA 3SG5A 4R1EA 3R1VA 2HETA 3S0EA 3WHTB 3B7AA 1K95A 2B1UA 5DKNA 4OZDA 4Q04A 2WCLA 4ZCUA 2KI4B 1NX2A 1KK7Y 2FCEA 1OQPA 5FI2A 2BBMA 5ER5A 4MZLA 1OW4A 1SY9A 2PQLA 2K7BA 1FI5A 3I5FB 1IIOA 1GGZA 1DJGA 2KNEA 2E6WA 4YGCB 3JVTB 2QEVA 1CNPA 1W7IB 2EC6B 3OGNA 2JPTA 5HLVA 2KDHA 2BE6A 1DGVA 3CABA 1A75B 2KI6C 2WOSA 1C7VA 1YTZC 2MAZA 1ZOTB 3BOWA 1DJYA 1WRKA 2ZNDA 2PYQA 3ICBA 2G2BA 3CZ1A 1NCXA 1PVBA 1XK4A 4C0KA 1BF5A 1ALVA 2I7AA 4C0JA 2PASA 1JFJA 1UHKA 1NP8A 3AAJA 5HYDA 1Y1AA 1BR1B 1B7TZ 1LKJA 3BUXB 1NCZA 2LMTA 3I5GB 3EVRA 1F55A 3VB1A 4YGBB 3BUNB 1M31A 1GQMA 4OVNF 1EH2A 1Y1XA 3L47A 1F4QA 1IWQA 5HKZA 1SL7A 2JTZA 2K7CA 2Y1MA 3NSIA 5HLOA 2LLTA 2QEHA 3D77A 3S0BA 3E3RA 4YRUA 4N1GA 4CLNA 1WDCB 2KAXA 1MHOA 1OZOA 2KPHA 2NXQA 5I2QA 1GM0A 1S6CA 5BPJA 1F71A 1ZMZA 3OBVA 3IQQA 2GV5A 3BXKA 1XK4C 3OHMB 2M49B 3NSLA 3LK1A 2JT3A 2M1UA 1K93D 2LP2A 1OOHA 2JQ6A 4I5JA 1Y0VH 1UUSA 1XO5A 2K0JA 1KSOA 2ZKMX 2FCDA 1M63B 1OOJA 2JRFA 2KAVA 1PULA 1G4YR 1M39A 2LLUA 3LLEA 2MJWB 1S26D 1SYMA 4YBHB 1F70A 4FQTA 1NWDA 2F2PA 2JWWA 5K89A 1JFKA 4ZCVA 3GK4X 2L5YA 3DVMA 1Z4HA 1IJ5A 1PALA 1SR6C 2GGZA 4L9MA 3FIAA 3VROA 3UO9A 2KLDA 3BJHA 2LVIA 4GGFA 2JNXA 2M29A 1ZACA 4E68A 1QIWA 2K7OA 1RWYA 1PVAA 4M2PA 4MRXA 1OOGA 4PALA 3L4LA 1DTLA 2L98A 1QASA 3IVTA 3QRXA 1ALWA 1YUTA 2KHNA 4YGAA 1IGVA 3AKAA 2P70A 1DJHA 1CDNA 1S1EA 5TNCA 1YX7A 4HREE 2ZNEA 3CR5X 2CBLA 2HPSA 5EL2A 1CMGA 3BFHA 3SIAA 1RJVA 2PSRA 3O4XA 5ER4X 2BBNA 3UNWA 1UP5A 3BOWB 5FYXA 2I94A 3ZWHA 1CMFA 1XFRA 3LL8B 1SBJA 2NZ0A 3D73A 5CPVA 5GQQC 2JC2A 3CYZA 1DJZA 3OX6A 1WLZA 4ETOA 1YVLA 1JF2A 4YGDB 4AOMA 4GGFC 1ZFSA 1CLLA 3I5IC 1EG3A 1YVHA 3KPXA 1OE9B 3SG4A 1QX5B 2WNDA 2CT9A 1F4OA 1ODBA 4PDZA 5KSZA 1B8LA 1W7JB 3B86A 3OX5A 5DKQA 1CFFA 2JZIA 2JT8A 1NYAA 3D76A 2EHBA 2O5GA 1OMDA 1GGWA 1J7QA 2LVJA 3PM8A 2F3ZA 1KQMC 1SR6B 3CWGA 1KFXL 3HX4A 1SSEB 1KK7Z 4GPLB 1Y1UA 3RM1A 4GBAA 4F0ZB 3PLFB 3NHIA 1QJTA 1RTP1 3CTNA 5DICA 3TZ1A 3AKBA 1K2HA 1DEKA 1U5IA 2M8UA 1HQVA 1QX2A 1QTXA 1J1DA 2GGMA 1F54A 2KBIA 1B47A 1XFWO 1J1EA 4WQ2A 3EG5B 3SS4A 1NPQA 1CFDA 3PM2A 4JD9A 4OKHA 5I2LA 3TDIA 3VRRA 4QJ4B 5I8NA 3M0WA 1LS8A 2AMIA 2LVKA 2WCMA 3SG7A 1E8AA 1J7PA 4DRWA 2WCJA 2WC5A 1QXPA 2O60A 1B8RA 1NIWA 2QPTA 3PFVA 5J3XA 1QV0A 1QWVA 1SW8A 4F7FA 3KF9A 3MSEB 5F6TA 1AK8A 4WQ3A 3I5IB 4IJ7A 2MRDA 3RLZA 4FTGA 4PHMA 2K60A 2D8NA 2LCPA 2H2KA 4MEWA 5AFPA 1JF0A 2ZRTA 1UHHA 3O78A 1CKKA 1J7OA 2ZN9A 3BUOB 1EXRA 2COLB 1C7WA 1LA0A 1S36A 2QEOA 2BCAA 3DVJA 1IG5A 1H4BA 2WCEA 1NX1A 3DYEA 1A29A 4GFTA 1BLQA 1K94A 5G08A 3S0GA 1CDLA 3CLNA 5FI6A 2LAPA 1MXLC 2L4IA 2BNXA 2LM5A 1SK6D 1YUUA 3BFAA 1BU3A 3D75A 4GGNA 1D1OA 1CFCA 1CDMA 3EVVA 4P2YB 3VRNA 1DMOA 1KCYA 3SG6A 1RECA 3CZ0A 3EK8A 1SNLA 2CXJA 3RZSA 3CDNA 3SJSA 1BR4B 1PSBA 1AJ5A 2H61C 2JNFA 5B8IB 1QIVA 1WY9A 1YRTB 2WCBA 3NHTA 3SS5A 4CPVA 4PE4A 2WCHA 1K8UA 3K21A 5HKYA 1KSMA 1SMGA 1K9PA 1NUBA 4UPGA 4CFRA 4QJ3B 3D0YA 1JWDA 3F45A 2LANA 1CFPA 3BFBA 2ISDA 1TIZA 2ZFDA 3R1OA 3WHUB 4INWA 1S5GY 1XFVO 2F33A 3A8RA 3AAKA 1T14A 2BE4A 4ORCB 1R6PA 5AERA 2KFGA 2R2IA 3NSOA 2M1KB 5D3OA 1KFUS 2QDIA 1AVSA 2L5XB 4YGEB 2M97A 1IJ6A 4HRGA 1U5IB 3WNXB 1C07A 1XYDA 2KFHA 4NDDA 1MWNA 1TOPA 1N0YA 2KQ6A 3FWBA 3TUYC 3EKJA 2WC6A 1Q80A 1B1GA 2KOTA
chains in the Genus database with same CATH topology
3CZTX 1TTXA 5CSNA 5JOLA 2A4JA 4BY4A 2Y5IA 3HCMA 2LUXA 3H4SE 1QVIY 5D69A 4M2OA 2JT0A 1VRKA 2WCFA 3FS7A 3PSRA 1XFXO 1KK8C 2F2OA 4A4CA 4PE1A 1BG1A 3GOFA 1XVJA 1DF0A 1M46A 5AANA 1TNXA 1UHJA 3JTDC 4BY5A 1L2OC 4MN0A 1IQ5A 1DT7B 1CLBA 1K9KA 4DS7A 2K7DA 3DD4A 1QATA 5I2OA 1EL4A 2L51A 2LP3A 1K9UA 3KO0A 3WXAA 1NSHA 2OS8C 3BUWB 1FF1A 2PVBA 2SCPA 3O6BA 3GK2A 2PALA 3CR2A 1B8CA 1BMOA 4I5KA 1JC2A 3DF0A 1G8IA 3OB2B 2NLNA 3OB1B 3IQOA 1QLKA 4JQ0D 4PHNA 3I5FC 2JXCA 2PRUA 2LLSA 1NCYA 2CTNA 2I2RE 2AAOA 5AEQA 4FQOA 3TUYB 4MLWA 4PCWA 2BCXA 3EK7A 2IS9A 2BKHB 5AXIA 5JJGA 4MSPA 3DVEA 4A4BA 1SCMC 3SG3A 4NDBA 3D0YB 2Y1NA 2JXLA 4I5LB 5CSIA 1SL8A 2K2FA 1KK8B 1UHNA 1RROA 3VRQA 3CR4X 3VRPA 2LHIA 2RGIA 1LVCD 2EGDA 1AUIB 4M2QA 1JBAA 1KFUL 2FOTA 3JTDB 1AJ4A 1L2OB 1MXEA 4DIRA 1YRUB 4JPZB 1YUSA 4PHJA 2M0RA 3I5GC 1CM4A 1TNPA 2KYFA 2L4HA 1FPWA 2M3WA 4N1FA 4XYNA 1J55A 1UHIA 2V53A 1DJIA 1NX3A 1IKUA 2OS8B 3DVKA 4AQJA 2LVVA 2MLEC 3O4YA 1WDCC 1X02A 1SCVA 1CTRA 2H61A 2MLFC 4I5NB 2MBXA 1FI6A 1QV1A 1Y6WA 1TNWA 1PSRA 2L50A 2Q4UA 1EG4A 3BUMB 1BODA 3PN7C 2K2AA 1LXFC 4USLA 1DF0B 1RFJA 4DCKA 3CGAA 1MF8B 3PALA 4P5OE 1A4PA 1TCOB 1A03A 4IL1A 1KQMB 1OMVA 3CS1A 2BCBA 4AQIA 4MRYA 4YI9A 1ZUZA 1PRWA 3NSKA 3KHEA 2HQWA 2SASA 3NXAA 2HQ8A 1B4CA 2MA2A 2AUCA 4C0LA 1TN4A 3I5HC 3TDUA 1SCMB 2WORA 4PHKA 1HT9A 3LK0A 4WRIA 1S5GZ 1QX7A 3D10A 1DJXA 4GNKB 3TDZA 1OMRA 4ICBA 4QJ5B 5HKWA 2G9BA 2OPOA 5IBWA 3DF0B 1F8HA 4XJKA 4MBEA 1WRLA 3BQ3A 1IRJA 2KBMA 3EVUA 2P6BB 1CM1A 2K61A 4U8DA 4MZJA 1BOCA 3KEVA 1UWOA 2KQYA 1PK0D 1SL9A 1AP4A 3FWCA 4N5XA 1DJWA 3O2PA 4OR9B 2F3YA 2I18A 1QVIZ 1L7ZA 4PE7A 4YI8A 3ZNIA 1M45A 2LV7A 1KWOC 4GAOA 1SKTA 1V1GA 1H8BA 2KI6D 1MR8A 2BECA 4NDCA 1FBVA 1XFUO 1KFXS 1B7TY 1S3PA 3BYAA 2LNKA 1DGUA 1WRZA 2BL0C 3PN7B 1CDPA 2Q91A 1XA5A 1KQVA 2LHLA 1YR5A 2QACA 1CB1A 1YURA 4OCIA 1QS7A 5CSJA 4HRHA 1FW4A 1SPYA 4CFQA 3EKHA 2VRGA 2L2EA 3SG2A 2E30A 2ZRSA 1EJ3A 1DVIA 2TN4A 3I5HB 4CIDA 2F8PA 1TCFA 1IQ3A 2Y4QA 5CSFA 1A75A 3TS5C 4TNCA 2JU0A 4MVFA 1RK9A 2LMUA 2NCPA 4HSZA 2OTGC 2JULA 1N65A 5DKRA 1BJFA 2HF5A 3IF7A 4DUQA 1B9AA 2FJUB 4GUKA 2M7LA 1AHRA 2M9GA 1JUOA 1OZSA 5KU1A 2LMVA 1K90D 2KI4C 1LINA 2ZN8A 4NQGA 5D7FA 2CNPA 4JWQA 1S6JA 1MQ1A 1SRAA 1XFYO 1KWOB 2CCMA 2KGRA 3JVTC 5PALA 2EC6C 3A4UB 4ORBB 1BT6A 2JTTA 2KAYA 2BL0B 2KSPA 1MUXA 5KTYA 2MHHA 3LCPC 3SIBA 1IH0A 1JSAA 4XJKB 2M7NA 1LA3A 1A2XA 1QLSA 1TNQA 2KGBC 2LE9B 2WC8A 3EK4A 4MZKA 1V1FA 1N2DA 1TRFA 3PATA 2KYCA 1OSAA 2KFFA 1NX0A 2NCOA 1UURA 1CLMA 1S6IA 4D1EA 1J7RA 3VGOA 1GJYA 2DOQA 2LUCA 1R2UA 4PE0A 1YX8A 3GK1A 4ORAB 4OV2A 1WLMA 2PMYA 3TS5B 2K8MB 2BKIB 2JOJA 2LC5A 3OP0A 2OTGB 1XFZO 1K96A 3C1VA 3SG5A 1G33A 2L0PA 4R1EA 2HETA 3WHTB 1K95A 2B1UA 5DKNA 4Q04A 4ZCUA 2KI4B 1NX2A 1KK7Y 2FCEA 1OQPA 2BBMA 5ER5A 4MZLA 1SY9A 2K7BA 1FI5A 3I5FB 1GGZA 1DJGA 2KNEA 2E6WA 4YGCB 3JVTB 1CNPA 1W7IB 2EC6B 2JPTA 5HLVA 2KDHA 2BE6A 1DGVA 1A75B 2KI6C 2WOSA 1C7VA 1YTZC 2MAZA 1ZOTB 3BOWA 1DJYA 1WRKA 2ZNDA 3ICBA 2G2BA 1NCXA 1PVBA 1XK4A 4C0KA 1BF5A 1ALVA 2I7AA 4C0JA 2PASA 1JFJA 1UHKA 1NP8A 3AAJA 5HYDA 1Y1AA 1BR1B 1B7TZ 1LKJA 3BUXB 1NCZA 2LMTA 3I5GB 3EVRA 1F55A 4YGBB 3BUNB 1M31A 1GQMA 4OVNF 1EH2A 1Y1XA 1F4QA 1IWQA 5HKZA 1SL7A 2JTZA 2K7CA 2Y1MA 3NSIA 5HLOA 2LLTA 3E3RA 4YRUA 4N1GA 4CLNA 1WDCB 2KAXA 1MHOA 1OZOA 2NXQA 5I2QA 1S6CA 5BPJA 1F71A 1ZMZA 3IQQA 2GV5A 3BXKA 1XK4C 3OHMB 2M49B 3NSLA 3LK1A 2JT3A 2M1UA 1K93D 2LP2A 2JQ6A 4I5JA 1Y0VH 1UUSA 1XO5A 2K0JA 1KSOA 2ZKMX 2FCDA 1M63B 1OOJA 2JRFA 2KAVA 1PULA 1G4YR 1M39A 2LLUA 3LLEA 2MJWB 1S26D 1SYMA 4YBHB 1F70A 1NWDA 2F2PA 2JWWA 5K89A 1JFKA 4ZCVA 3GK4X 3DVMA 1IJ5A 1PALA 1SR6C 2GGZA 4L9MA 3FIAA 3VROA 4GGFA 2LVIA 2JNXA 2M29A 1ZACA 4E68A 1QIWA 2K7OA 1RWYA 1PVAA 4M2PA 4MRXA 4PALA 1DTLA 2L98A 1QASA 3QRXA 1ALWA 1YUTA 2KHNA 4YGAA 1IGVA 3AKAA 1DJHA 1CDNA 1S1EA 5TNCA 1YX7A 4HREE 2ZNEA 3CR5X 2CBLA 2HPSA 1CMGA 3SIAA 1RJVA 2PSRA 5ER4X 2BBNA 1UP5A 3BOWB 5FYXA 2I94A 3ZWHA 1CMFA 3LL8B 1SBJA 2NZ0A 5CPVA 5GQQC 2JC2A 4ETOA 1DJZA 3OX6A 1WLZA 1YVLA 1JF2A 4YGDB 4AOMA 4GGFC 1ZFSA 1CLLA 3I5IC 1EG3A 1YVHA 3KPXA 1OE9B 3SG4A 1QX5B 2WNDA 2CT9A 1F4OA 1ODBA 4PDZA 5KSZA 1B8LA 1W7JB 3OX5A 5DKQA 1CFFA 2JZIA 2JT8A 1NYAA 2EHBA 2O5GA 1OMDA 1GGWA 1J7QA 2LVJA 3PM8A 2F3ZA 1KQMC 1SR6B 3CWGA 1KFXL 3HX4A 1KK7Z 4GPLB 1Y1UA 3RM1A 4GBAA 4F0ZB 3PLFB 1QJTA 1RTP1 3CTNA 3TZ1A 3AKBA 1K2HA 1U5IA 2M8UA 1HQVA 1QX2A 1QTXA 1J1DA 2GGMA 1F54A 2KBIA 1B47A 1XFWO 1J1EA 4WQ2A 1NPQA 1CFDA 5I2LA 4OKHA 3TDIA 3VRRA 4QJ4B 5I8NA 3M0WA 2LVKA 2AMIA 3SG7A 1E8AA 1J7PA 4DRWA 1QXPA 2O60A 1B8RA 1NIWA 2QPTA 3PFVA 5J3XA 1QV0A 1SW8A 3KF9A 3MSEB 5F6TA 1AK8A 4WQ3A 3I5IB 2MRDA 3RLZA 4FTGA 4PHMA 2D8NA 2LCPA 2H2KA 4MEWA 5AFPA 1JF0A 2ZRTA 1UHHA 3O78A 1CKKA 1J7OA 2ZN9A 3BUOB 1EXRA 2COLB 1C7WA 1LA0A 1S36A 3DVJA 2BCAA 1H4BA 1IG5A 2WCEA 1NX1A 4GFTA 1A29A 1BLQA 1K94A 5G08A 1CDLA 3CLNA 2LAPA 1MXLC 2L4IA 2LM5A 1SK6D 1YUUA 1D1OA 1BU3A 4GGNA 1CFCA 1CDMA 3EVVA 4P2YB 3VRNA 1DMOA 1KCYA 3SG6A 1RECA 3EK8A 1SNLA 2CXJA 3SJSA 1BR4B 1PSBA 1AJ5A 2H61C 2JNFA 5B8IB 1QIVA 1WY9A 1YRTB 2WCBA 4CPVA 4PE4A 1K8UA 3K21A 5HKYA 1KSMA 1SMGA 1K9PA 1NUBA 4UPGA 4CFRA 4QJ3B 3D0YA 1JWDA 3F45A 2LANA 1CFPA 2ISDA 1TIZA 2ZFDA 3WHUB 1S5GY 1XFVO 2F33A 3A8RA 3AAKA 4ORCB 2BE4A 1R6PA 5AERA 2KFGA 2R2IA 3NSOA 2M1KB 1KFUS 1AVSA 2L5XB 4YGEB 2M97A 1IJ6A 4HRGA 1U5IB 3WNXB 1C07A 1XYDA 2KFHA 4NDDA 1MWNA 1TOPA 1N0YA 2KQ6A 3FWBA 3TUYC 3EKJA 1Q80A 1B1GA 2KOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZT X;  1TTX A;  5CSN A;  5JOL A;  2A4J A;  4BY4 A;  2Y5I A;  3HCM A;  2LUX A;  3H4S E;  1QVI Y;  5D69 A;  4M2O A;  2JT0 A;  1VRK A;  2WCF A;  3FS7 A;  3PSR A;  1XFX O;  1KK8 C;  2F2O A;  4A4C A;  4PE1 A;  1BG1 A;  3GOF A;  1XVJ A;  1DF0 A;  1M46 A;  5AAN A;  1TNX A;  1UHJ A;  3JTD C;  4BY5 A;  1L2O C;  4MN0 A;  1IQ5 A;  1DT7 B;  1CLB A;  1K9K A;  4DS7 A;  2K7D A;  3DD4 A;  1QAT A;  5I2O A;  1EL4 A;  2L51 A;  2LP3 A;  1K9U A;  3KO0 A;  3WXA A;  1NSH A;  2OS8 C;  3BUW B;  1FF1 A;  2PVB A;  2SCP A;  3O6B A;  3GK2 A;  2PAL A;  3CR2 A;  1B8C A;  1BMO A;  4I5K A;  1JC2 A;  3DF0 A;  1G8I A;  3OB2 B;  2NLN A;  3OB1 B;  3IQO A;  1QLK A;  4JQ0 D;  4PHN A;  3I5F C;  2JXC A;  2PRU A;  2LLS A;  1NCY A;  2CTN A;  2I2R E;  2AAO A;  5AEQ A;  4FQO A;  3TUY B;  4MLW A;  4PCW A;  2BCX A;  3EK7 A;  2IS9 A;  2BKH B;  5AXI A;  5JJG A;  4MSP A;  3DVE A;  4A4B A;  1SCM C;  3SG3 A;  4NDB A;  3D0Y B;  2Y1N A;  2JXL A;  4I5L B;  5CSI A;  1SL8 A;  2K2F A;  1KK8 B;  1UHN A;  1RRO A;  3VRQ A;  3CR4 X;  3VRP A;  2LHI A;  2RGI A;  1LVC D;  2EGD A;  1AUI B;  4M2Q A;  1JBA A;  1KFU L;  2FOT A;  3JTD B;  1AJ4 A;  1L2O B;  1MXE A;  4DIR A;  1YRU B;  4JPZ B;  1YUS A;  4PHJ A;  2M0R A;  3I5G C;  1CM4 A;  1TNP A;  2KYF A;  2L4H A;  1FPW A;  2M3W A;  4N1F A;  4XYN A;  1J55 A;  1UHI A;  2V53 A;  1DJI A;  1NX3 A;  1IKU A;  2OS8 B;  3DVK A;  4AQJ A;  2LVV A;  2MLE C;  3O4Y A;  1WDC C;  1X02 A;  1SCV A;  1CTR A;  2H61 A;  2MLF C;  4I5N B;  2MBX A;  1FI6 A;  1QV1 A;  1Y6W A;  1TNW A;  1PSR A;  2L50 A;  2Q4U A;  1EG4 A;  3BUM B;  1BOD A;  3PN7 C;  2K2A A;  1LXF C;  4USL A;  1DF0 B;  1RFJ A;  4DCK A;  3CGA A;  1MF8 B;  3PAL A;  4P5O E;  1A4P A;  1TCO B;  1A03 A;  4IL1 A;  1KQM B;  1OMV A;  3CS1 A;  2BCB A;  4AQI A;  4MRY A;  4YI9 A;  1ZUZ A;  1PRW A;  3NSK A;  3KHE A;  2HQW A;  2SAS A;  3NXA A;  2HQ8 A;  1B4C A;  2MA2 A;  2AUC A;  4C0L A;  1TN4 A;  3I5H C;  3TDU A;  1SCM B;  2WOR A;  4PHK A;  1HT9 A;  3LK0 A;  4WRI A;  1S5G Z;  1QX7 A;  3D10 A;  1DJX A;  4GNK B;  3TDZ A;  1OMR A;  4ICB A;  4QJ5 B;  5HKW A;  2G9B A;  2OPO A;  5IBW A;  3DF0 B;  1F8H A;  4XJK A;  4MBE A;  1WRL A;  3BQ3 A;  1IRJ A;  2KBM A;  3EVU A;  2P6B B;  1CM1 A;  2K61 A;  4U8D A;  4MZJ A;  1BOC A;  3KEV A;  1UWO A;  2KQY A;  1PK0 D;  1SL9 A;  1AP4 A;  3FWC A;  4N5X A;  1DJW A;  3O2P A;  4OR9 B;  2F3Y A;  2I18 A;  1QVI Z;  1L7Z A;  4PE7 A;  4YI8 A;  3ZNI A;  1M45 A;  2LV7 A;  1KWO C;  4GAO A;  1SKT A;  1V1G A;  1H8B A;  2KI6 D;  1MR8 A;  2BEC A;  4NDC A;  1FBV A;  1XFU O;  1KFX S;  1B7T Y;  1S3P A;  3BYA A;  2LNK A;  1DGU A;  1WRZ A;  2BL0 C;  3PN7 B;  1CDP A;  2Q91 A;  1XA5 A;  1KQV A;  2LHL A;  1YR5 A;  2QAC A;  1CB1 A;  1YUR A;  4OCI A;  1QS7 A;  5CSJ A;  4HRH A;  1FW4 A;  1SPY A;  4CFQ A;  3EKH A;  2VRG A;  2L2E A;  3SG2 A;  2E30 A;  2ZRS A;  1EJ3 A;  1DVI A;  2TN4 A;  3I5H B;  4CID A;  2F8P A;  1TCF A;  1IQ3 A;  2Y4Q A;  5CSF A;  1A75 A;  3TS5 C;  4TNC A;  2JU0 A;  4MVF A;  1RK9 A;  2LMU A;  2NCP A;  4HSZ A;  2OTG C;  2JUL A;  1N65 A;  5DKR A;  1BJF A;  2HF5 A;  3IF7 A;  4DUQ A;  1B9A A;  2FJU B;  4GUK A;  2M7L A;  1AHR A;  2M9G A;  1JUO A;  1OZS A;  5KU1 A;  2LMV A;  1K90 D;  2KI4 C;  1LIN A;  2ZN8 A;  4NQG A;  5D7F A;  2CNP A;  4JWQ A;  1S6J A;  1MQ1 A;  1SRA A;  1XFY O;  1KWO B;  2CCM A;  2KGR A;  3JVT C;  5PAL A;  2EC6 C;  3A4U B;  4ORB B;  1BT6 A;  2JTT A;  2KAY A;  2BL0 B;  2KSP A;  1MUX A;  5KTY A;  2MHH A;  3LCP C;  3SIB A;  1IH0 A;  1JSA A;  4XJK B;  2M7N A;  1LA3 A;  1A2X A;  1QLS A;  1TNQ A;  2KGB C;  2LE9 B;  2WC8 A;  3EK4 A;  4MZK A;  1V1F A;  1N2D A;  1TRF A;  3PAT A;  2KYC A;  1OSA A;  2KFF A;  1NX0 A;  2NCO A;  1UUR A;  1CLM A;  1S6I A;  4D1E A;  1J7R A;  3VGO A;  1GJY A;  2DOQ A;  2LUC A;  1R2U A;  4PE0 A;  1YX8 A;  3GK1 A;  4ORA B;  4OV2 A;  1WLM A;  2PMY A;  3TS5 B;  2K8M B;  2BKI B;  2JOJ A;  2LC5 A;  3OP0 A;  2OTG B;  1XFZ O;  1K96 A;  3C1V A;  3SG5 A;  1G33 A;  2L0P A;  4R1E A;  2HET A;  3WHT B;  1K95 A;  2B1U A;  5DKN A;  4Q04 A;  4ZCU A;  2KI4 B;  1NX2 A;  1KK7 Y;  2FCE A;  1OQP A;  2BBM A;  5ER5 A;  4MZL A;  1SY9 A;  2K7B A;  1FI5 A;  3I5F B;  1GGZ A;  1DJG A;  2KNE A;  2E6W A;  4YGC B;  3JVT B;  1CNP A;  1W7I B;  2EC6 B;  2JPT A;  5HLV A;  2KDH A;  2BE6 A;  1DGV A;  1A75 B;  2KI6 C;  2WOS A;  1C7V A;  1YTZ C;  2MAZ A;  1ZOT B;  3BOW A;  1DJY A;  1WRK A;  2ZND A;  3ICB A;  2G2B A;  1NCX A;  1PVB A;  1XK4 A;  4C0K A;  1BF5 A;  1ALV A;  2I7A A;  4C0J A;  2PAS A;  1JFJ A;  1UHK A;  1NP8 A;  3AAJ A;  5HYD A;  1Y1A A;  1BR1 B;  1B7T Z;  1LKJ A;  3BUX B;  1NCZ A;  2LMT A;  3I5G B;  3EVR A;  1F55 A;  4YGB B;  3BUN B;  1M31 A;  1GQM A;  4OVN F;  1EH2 A;  1Y1X A;  1F4Q A;  1IWQ A;  5HKZ A;  1SL7 A;  2JTZ A;  2K7C A;  2Y1M A;  3NSI A;  5HLO A;  2LLT A;  3E3R A;  4YRU A;  4N1G A;  4CLN A;  1WDC B;  2KAX A;  1MHO A;  1OZO A;  2NXQ A;  5I2Q A;  1S6C A;  5BPJ A;  1F71 A;  1ZMZ A;  3IQQ A;  2GV5 A;  3BXK A;  1XK4 C;  3OHM B;  2M49 B;  3NSL A;  3LK1 A;  2JT3 A;  2M1U A;  1K93 D;  2LP2 A;  2JQ6 A;  4I5J A;  1Y0V H;  1UUS A;  1XO5 A;  2K0J A;  1KSO A;  2ZKM X;  2FCD A;  1M63 B;  1OOJ A;  2JRF A;  2KAV A;  1PUL A;  1G4Y R;  1M39 A;  2LLU A;  3LLE A;  2MJW B;  1S26 D;  1SYM A;  4YBH B;  1F70 A;  1NWD A;  2F2P A;  2JWW A;  5K89 A;  1JFK A;  4ZCV A;  3GK4 X;  3DVM A;  1IJ5 A;  1PAL A;  1SR6 C;  2GGZ A;  4L9M A;  3FIA A;  3VRO A;  4GGF A;  2LVI A;  2JNX A;  2M29 A;  1ZAC A;  4E68 A;  1QIW A;  2K7O A;  1RWY A;  1PVA A;  4M2P A;  4MRX A;  4PAL A;  1DTL A;  2L98 A;  1QAS A;  3QRX A;  1ALW A;  1YUT A;  2KHN A;  4YGA A;  1IGV A;  3AKA A;  1DJH A;  1CDN A;  1S1E A;  5TNC A;  1YX7 A;  4HRE E;  2ZNE A;  3CR5 X;  2CBL A;  2HPS A;  1CMG A;  3SIA A;  1RJV A;  2PSR A;  5ER4 X;  2BBN A;  1UP5 A;  3BOW B;  5FYX A;  2I94 A;  3ZWH A;  1CMF A;  3LL8 B;  1SBJ A;  2NZ0 A;  5CPV A;  5GQQ C;  2JC2 A;  4ETO A;  1DJZ A;  3OX6 A;  1WLZ A;  1YVL A;  1JF2 A;  4YGD B;  4AOM A;  4GGF C;  1ZFS A;  1CLL A;  3I5I C;  1EG3 A;  1YVH A;  3KPX A;  1OE9 B;  3SG4 A;  1QX5 B;  2WND A;  2CT9 A;  1F4O A;  1ODB A;  4PDZ A;  5KSZ A;  1B8L A;  1W7J B;  3OX5 A;  5DKQ A;  1CFF A;  2JZI A;  2JT8 A;  1NYA A;  2EHB A;  2O5G A;  1OMD A;  1GGW A;  1J7Q A;  2LVJ A;  3PM8 A;  2F3Z A;  1KQM C;  1SR6 B;  3CWG A;  1KFX L;  3HX4 A;  1KK7 Z;  4GPL B;  1Y1U A;  3RM1 A;  4GBA A;  4F0Z B;  3PLF B;  1QJT A;  1RTP 1;  3CTN A;  3TZ1 A;  3AKB A;  1K2H A;  1U5I A;  2M8U A;  1HQV A;  1QX2 A;  1QTX A;  1J1D A;  2GGM A;  1F54 A;  2KBI A;  1B47 A;  1XFW O;  1J1E A;  4WQ2 A;  1NPQ A;  1CFD A;  5I2L A;  4OKH A;  3TDI A;  3VRR A;  4QJ4 B;  5I8N A;  3M0W A;  2LVK A;  2AMI A;  3SG7 A;  1E8A A;  1J7P A;  4DRW A;  1QXP A;  2O60 A;  1B8R A;  1NIW A;  2QPT A;  3PFV A;  5J3X A;  1QV0 A;  1SW8 A;  3KF9 A;  3MSE B;  5F6T A;  1AK8 A;  4WQ3 A;  3I5I B;  2MRD A;  3RLZ A;  4FTG A;  4PHM A;  2D8N A;  2LCP A;  2H2K A;  4MEW A;  5AFP A;  1JF0 A;  2ZRT A;  1UHH A;  3O78 A;  1CKK A;  1J7O A;  2ZN9 A;  3BUO B;  1EXR A;  2COL B;  1C7W A;  1LA0 A;  1S36 A;  3DVJ A;  2BCA A;  1H4B A;  1IG5 A;  2WCE A;  1NX1 A;  4GFT A;  1A29 A;  1BLQ A;  1K94 A;  5G08 A;  1CDL A;  3CLN A;  2LAP A;  1MXL C;  2L4I A;  2LM5 A;  1SK6 D;  1YUU A;  1D1O A;  1BU3 A;  4GGN A;  1CFC A;  1CDM A;  3EVV A;  4P2Y B;  3VRN A;  1DMO A;  1KCY A;  3SG6 A;  1REC A;  3EK8 A;  1SNL A;  2CXJ A;  3SJS A;  1BR4 B;  1PSB A;  1AJ5 A;  2H61 C;  2JNF A;  5B8I B;  1QIV A;  1WY9 A;  1YRT B;  2WCB A;  4CPV A;  4PE4 A;  1K8U A;  3K21 A;  5HKY A;  1KSM A;  1SMG A;  1K9P A;  1NUB A;  4UPG A;  4CFR A;  4QJ3 B;  3D0Y A;  1JWD A;  3F45 A;  2LAN A;  1CFP A;  2ISD A;  1TIZ A;  2ZFD A;  3WHU B;  1S5G Y;  1XFV O;  2F33 A;  3A8R A;  3AAK A;  4ORC B;  2BE4 A;  1R6P A;  5AER A;  2KFG A;  2R2I A;  3NSO A;  2M1K B;  1KFU S;  1AVS A;  2L5X B;  4YGE B;  2M97 A;  1IJ6 A;  4HRG A;  1U5I B;  3WNX B;  1C07 A;  1XYD A;  2KFH A;  4NDD A;  1MWN A;  1TOP A;  1N0Y A;  2KQ6 A;  3FWB A;  3TUY C;  3EKJ A;  1Q80 A;  1B1G A;  2KOT A; 
#chains in the Genus database with same CATH topology
 3CZT X;  1TTX A;  3B87 A;  5CSN A;  1OOI X;  5JOL A;  2A4J A;  4BY4 A;  2Y5I A;  3HCM A;  2LUX A;  3H4S E;  1QVI Y;  3L4A A;  5D69 A;  4M2O A;  2JT0 A;  1VRK A;  4JKT A;  2WCF A;  3FS7 A;  3PSR A;  1XFX O;  1KK8 C;  2F2O A;  4A4C A;  2BAP A;  4PE1 A;  1BG1 A;  3GOF A;  1XVJ A;  1DF0 A;  1M46 A;  1ORG A;  1TNX A;  1UHJ A;  3JTD C;  5AAN A;  4BY5 A;  1L2O C;  3B88 A;  4MN0 A;  1IQ5 A;  1DT7 B;  1CLB A;  1K9K A;  4DS7 A;  2K7D A;  3DD4 A;  1QAT A;  5I2O A;  1EL4 A;  2L51 A;  2LP3 A;  1K9U A;  3KO0 A;  3WXA A;  1NSH A;  2OS8 C;  3BUW B;  1FF1 A;  2PVB A;  2SCP A;  3O6B A;  3GK2 A;  2PAL A;  3CR2 A;  1B8C A;  1BMO A;  4I5K A;  1JC2 A;  3DF0 A;  1G8I A;  3OB2 B;  2NLN A;  3OB1 B;  3IQO A;  1QLK A;  1Z2C B;  4JQ0 D;  4PHN A;  2KLE A;  2JXC A;  3I5F C;  2PRU A;  2LLS A;  1NCY A;  2CTN A;  2I2R E;  2AAO A;  5AEQ A;  4FQO A;  3TUY B;  4MLW A;  4PCW A;  2BCX A;  2JPO A;  3EK7 A;  2IS9 A;  2BKH B;  5AXI A;  5JJG A;  4MSP A;  3DVE A;  4A4B A;  1SCM C;  3SG3 A;  2WCK A;  3DXL A;  4NDB A;  3D0Y B;  2Y1N A;  2JXL A;  3DZT A;  4I5L B;  1SL8 A;  2K2F A;  3D74 A;  1KK8 B;  5CSI A;  1UHN A;  1RRO A;  3VRQ A;  3CR4 X;  4INX A;  2LHI A;  2RGI A;  3FE9 A;  3VRP A;  1LVC D;  2EGD A;  1AUI B;  4M2Q A;  1JBA A;  1KFU L;  2FOT A;  3JTD B;  1AJ4 A;  1L2O B;  1MXE A;  4DIR A;  1YRU B;  4JPZ B;  1YUS A;  4PHJ A;  2M0R A;  3I5G C;  1CM4 A;  1TNP A;  2KYF A;  2L4H A;  1FPW A;  2M3W A;  4N1F A;  4XYN A;  1J55 A;  1UHI A;  2V53 A;  1DJI A;  1NX3 A;  1IKU A;  2OS8 B;  3DVK A;  4AQJ A;  2LVV A;  2MLE C;  3O4Y A;  1WDC C;  1X02 A;  1SCV A;  1OOF A;  1CTR A;  2H61 A;  2MLF C;  4I5N B;  2MBX A;  1FI6 A;  1QV1 A;  1Y6W A;  1TNW A;  1PSR A;  2L50 A;  2Q4U A;  1EG4 A;  3BUM B;  1BOD A;  3PN7 C;  2K2A A;  1TUJ A;  1LXF C;  4USL A;  1DF0 B;  1RFJ A;  1W9Z A;  3CGA A;  1MF8 B;  3N7H A;  3PAL A;  1A4P A;  1TCO B;  4P5O E;  4DCK A;  4IL1 A;  1KQM B;  1A03 A;  1OMV A;  2P71 A;  3CS1 A;  2BCB A;  4AQI A;  4MRY A;  3DY9 A;  1ZUZ A;  1PRW A;  3NSK A;  4YI9 A;  3KHE A;  2HQW A;  2SAS A;  3NXA A;  2HQ8 A;  3Q8I A;  1B4C A;  2MA2 A;  2AUC A;  4C0L A;  1TUZ A;  1TN4 A;  3I5H C;  3TDU A;  1SCM B;  2WOR A;  4PHK A;  3FE8 A;  3R72 A;  1HT9 A;  3LK0 A;  4WRI A;  1S5G Z;  1QX7 A;  3D10 A;  1DJX A;  3D78 A;  4GNK B;  3TDZ A;  1OMR A;  4ICB A;  4QJ5 B;  5HKW A;  2G9B A;  2OPO A;  5IBW A;  3DF0 B;  1F8H A;  4XJK A;  4MBE A;  1WRL A;  3NGV A;  3BQ3 A;  1IRJ A;  2KBM A;  3EVU A;  2P6B B;  1CM1 A;  2K61 A;  4U8D A;  4MZJ A;  1BOC A;  3KEV A;  1UWO A;  2KQY A;  1PK0 D;  1SL9 A;  1AP4 A;  3FWC A;  4N5X A;  1DJW A;  3O2P A;  4OR9 B;  2F3Y A;  2I18 A;  2L2C A;  1QVI Z;  1L7Z A;  4KYN A;  3V2L A;  4PE7 A;  4YI8 A;  3ZNI A;  1M45 A;  2LV7 A;  1KWO C;  4GAO A;  1SKT A;  1V1G A;  1H8B A;  2KI6 D;  1MR8 A;  3FE6 A;  2BEC A;  4NDC A;  1FBV A;  1XFU O;  1KFX S;  1B7T Y;  1S3P A;  3BYA A;  2LNK A;  1DGU A;  1WRZ A;  2BL0 C;  3PN7 B;  1CDP A;  2Q91 A;  3PJI A;  1XA5 A;  3CZ2 A;  1KQV A;  2LHL A;  1YR5 A;  1P28 A;  2QAC A;  3S0D A;  1CB1 A;  1YUR A;  3SS3 A;  4OCI A;  1QS7 A;  5CSJ A;  4HRH A;  1FW4 A;  1SPY A;  4CFQ A;  1C3Z A;  2GTE A;  3EKH A;  2VRG A;  2L2E A;  3SG2 A;  2E30 A;  2ZRS A;  1EJ3 A;  1DVI A;  2TN4 A;  3I5H B;  1DEL A;  4CID A;  2F8P A;  1TCF A;  1IQ3 A;  2Y4Q A;  5CSF A;  1A75 A;  3TS5 C;  4TNC A;  2JU0 A;  4MVF A;  2QEB A;  1RK9 A;  2LMU A;  1DQE A;  2NCP A;  4HSZ A;  2OTG C;  2JUL A;  1N65 A;  5DKR A;  1BJF A;  2HF5 A;  3IF7 A;  4DUQ A;  1B9A A;  2FJU B;  3QME A;  1TWO A;  4GUK A;  2M7L A;  1AHR A;  2M9G A;  5FI7 A;  1JUO A;  1OZS A;  5KU1 A;  2LMV A;  1K90 D;  2KI4 C;  4PT1 A;  1LIN A;  2ZN8 A;  4NQG A;  5D7F A;  2CNP A;  4JWQ A;  1S6J A;  1MQ1 A;  1SRA A;  1XFY O;  1KWO B;  2CCM A;  2KGR A;  3JVT C;  5PAL A;  2EC6 C;  3A4U B;  4ORB B;  1BT6 A;  2JTT A;  2KAY A;  2BL0 B;  2KSP A;  1MUX A;  5KTY A;  2MHH A;  3LCP C;  3SIB A;  1IH0 A;  3S0A A;  3K1E A;  1JSA A;  4XJK B;  2M7N A;  1LA3 A;  1C3Y A;  1A2X A;  1QLS A;  1TNQ A;  2KGB C;  2LE9 B;  2WC8 A;  3EK4 A;  3S0F A;  4MZK A;  1V1F A;  3B6X A;  1N2D A;  1TRF A;  3PAT A;  2KYC A;  1OSA A;  2KFF A;  1NX0 A;  2NCO A;  5HL1 A;  1UUR A;  2H8V A;  3R1P A;  1CLM A;  2ERB A;  1S6I A;  4D1E A;  1J7R A;  1DC1 A;  3VGO A;  1GJY A;  2DOQ A;  2LUC A;  1R2U A;  4PE0 A;  1YX8 A;  3GK1 A;  4ORA B;  4OV2 A;  1WLM A;  2PMY A;  3TS5 B;  2K8M B;  2FJY A;  5I94 A;  2BKI B;  2JOJ A;  2LC5 A;  3OP0 A;  2OTG B;  1XFZ O;  1K96 A;  2YGU A;  3C1V A;  1G33 A;  2L0P A;  3SG5 A;  4R1E A;  3R1V A;  2HET A;  3S0E A;  3WHT B;  3B7A A;  1K95 A;  2B1U A;  5DKN A;  4OZD A;  4Q04 A;  2WCL A;  4ZCU A;  2KI4 B;  1NX2 A;  1KK7 Y;  2FCE A;  1OQP A;  5FI2 A;  2BBM A;  5ER5 A;  4MZL A;  1OW4 A;  1SY9 A;  2PQL A;  2K7B A;  1FI5 A;  3I5F B;  1IIO A;  1GGZ A;  1DJG A;  2KNE A;  2E6W A;  4YGC B;  3JVT B;  2QEV A;  1CNP A;  1W7I B;  2EC6 B;  3OGN A;  2JPT A;  5HLV A;  2KDH A;  2BE6 A;  1DGV A;  3CAB A;  1A75 B;  2KI6 C;  2WOS A;  1C7V A;  1YTZ C;  2MAZ A;  1ZOT B;  3BOW A;  1DJY A;  1WRK A;  2ZND A;  2PYQ A;  3ICB A;  2G2B A;  3CZ1 A;  1NCX A;  1PVB A;  1XK4 A;  4C0K A;  1BF5 A;  1ALV A;  2I7A A;  4C0J A;  2PAS A;  1JFJ A;  1UHK A;  1NP8 A;  3AAJ A;  5HYD A;  1Y1A A;  1BR1 B;  1B7T Z;  1LKJ A;  3BUX B;  1NCZ A;  2LMT A;  3I5G B;  3EVR A;  1F55 A;  3VB1 A;  4YGB B;  3BUN B;  1M31 A;  1GQM A;  4OVN F;  1EH2 A;  1Y1X A;  3L47 A;  1F4Q A;  1IWQ A;  5HKZ A;  1SL7 A;  2JTZ A;  2K7C A;  2Y1M A;  3NSI A;  5HLO A;  2LLT A;  2QEH A;  3D77 A;  3S0B A;  3E3R A;  4YRU A;  4N1G A;  4CLN A;  1WDC B;  2KAX A;  1MHO A;  1OZO A;  2KPH A;  2NXQ A;  5I2Q A;  1GM0 A;  1S6C A;  5BPJ A;  1F71 A;  1ZMZ A;  3OBV A;  3IQQ A;  2GV5 A;  3BXK A;  1XK4 C;  3OHM B;  2M49 B;  3NSL A;  3LK1 A;  2JT3 A;  2M1U A;  1K93 D;  2LP2 A;  1OOH A;  2JQ6 A;  4I5J A;  1Y0V H;  1UUS A;  1XO5 A;  2K0J A;  1KSO A;  2ZKM X;  2FCD A;  1M63 B;  1OOJ A;  2JRF A;  2KAV A;  1PUL A;  1G4Y R;  1M39 A;  2LLU A;  3LLE A;  2MJW B;  1S26 D;  1SYM A;  4YBH B;  1F70 A;  4FQT A;  1NWD A;  2F2P A;  2JWW A;  5K89 A;  1JFK A;  4ZCV A;  3GK4 X;  2L5Y A;  3DVM A;  1Z4H A;  1IJ5 A;  1PAL A;  1SR6 C;  2GGZ A;  4L9M A;  3FIA A;  3VRO A;  3UO9 A;  2KLD A;  3BJH A;  2LVI A;  4GGF A;  2JNX A;  2M29 A;  1ZAC A;  4E68 A;  1QIW A;  2K7O A;  1RWY A;  1PVA A;  4M2P A;  4MRX A;  1OOG A;  4PAL A;  3L4L A;  1DTL A;  2L98 A;  1QAS A;  3IVT A;  3QRX A;  1ALW A;  1YUT A;  2KHN A;  4YGA A;  1IGV A;  3AKA A;  2P70 A;  1DJH A;  1CDN A;  1S1E A;  5TNC A;  1YX7 A;  4HRE E;  2ZNE A;  3CR5 X;  2CBL A;  2HPS A;  5EL2 A;  1CMG A;  3BFH A;  3SIA A;  1RJV A;  2PSR A;  3O4X A;  5ER4 X;  2BBN A;  3UNW A;  1UP5 A;  3BOW B;  5FYX A;  2I94 A;  3ZWH A;  1CMF A;  1XFR A;  3LL8 B;  1SBJ A;  2NZ0 A;  3D73 A;  5CPV A;  5GQQ C;  2JC2 A;  3CYZ A;  1DJZ A;  3OX6 A;  1WLZ A;  4ETO A;  1YVL A;  1JF2 A;  4YGD B;  4AOM A;  4GGF C;  1ZFS A;  1CLL A;  3I5I C;  1EG3 A;  1YVH A;  3KPX A;  1OE9 B;  3SG4 A;  1QX5 B;  2WND A;  2CT9 A;  1F4O A;  1ODB A;  4PDZ A;  5KSZ A;  1B8L A;  1W7J B;  3B86 A;  3OX5 A;  5DKQ A;  1CFF A;  2JZI A;  2JT8 A;  1NYA A;  3D76 A;  2EHB A;  2O5G A;  1OMD A;  1GGW A;  1J7Q A;  2LVJ A;  3PM8 A;  2F3Z A;  1KQM C;  1SR6 B;  3CWG A;  1KFX L;  3HX4 A;  1SSE B;  1KK7 Z;  4GPL B;  1Y1U A;  3RM1 A;  4GBA A;  4F0Z B;  3PLF B;  3NHI A;  1QJT A;  1RTP 1;  3CTN A;  5DIC A;  3TZ1 A;  3AKB A;  1K2H A;  1DEK A;  1U5I A;  2M8U A;  1HQV A;  1QX2 A;  1QTX A;  1J1D A;  2GGM A;  1F54 A;  2KBI A;  1B47 A;  1XFW O;  1J1E A;  4WQ2 A;  3EG5 B;  3SS4 A;  1NPQ A;  1CFD A;  3PM2 A;  4JD9 A;  4OKH A;  5I2L A;  3TDI A;  3VRR A;  4QJ4 B;  5I8N A;  3M0W A;  1LS8 A;  2AMI A;  2LVK A;  2WCM A;  3SG7 A;  1E8A A;  1J7P A;  4DRW A;  2WCJ A;  2WC5 A;  1QXP A;  2O60 A;  1B8R A;  1NIW A;  2QPT A;  3PFV A;  5J3X A;  1QV0 A;  1QWV A;  1SW8 A;  4F7F A;  3KF9 A;  3MSE B;  5F6T A;  1AK8 A;  4WQ3 A;  3I5I B;  4IJ7 A;  2MRD A;  3RLZ A;  4FTG A;  4PHM A;  2K60 A;  2D8N A;  2LCP A;  2H2K A;  4MEW A;  5AFP A;  1JF0 A;  2ZRT A;  1UHH A;  3O78 A;  1CKK A;  1J7O A;  2ZN9 A;  3BUO B;  1EXR A;  2COL B;  1C7W A;  1LA0 A;  1S36 A;  2QEO A;  2BCA A;  3DVJ A;  1IG5 A;  1H4B A;  2WCE A;  1NX1 A;  3DYE A;  1A29 A;  4GFT A;  1BLQ A;  1K94 A;  5G08 A;  3S0G A;  1CDL A;  3CLN A;  5FI6 A;  2LAP A;  1MXL C;  2L4I A;  2BNX A;  2LM5 A;  1SK6 D;  1YUU A;  3BFA A;  1BU3 A;  3D75 A;  4GGN A;  1D1O A;  1CFC A;  1CDM A;  3EVV A;  4P2Y B;  3VRN A;  1DMO A;  1KCY A;  3SG6 A;  1REC A;  3CZ0 A;  3EK8 A;  1SNL A;  2CXJ A;  3RZS A;  3CDN A;  3SJS A;  1BR4 B;  1PSB A;  1AJ5 A;  2H61 C;  2JNF A;  5B8I B;  1QIV A;  1WY9 A;  1YRT B;  2WCB A;  3NHT A;  3SS5 A;  4CPV A;  4PE4 A;  2WCH A;  1K8U A;  3K21 A;  5HKY A;  1KSM A;  1SMG A;  1K9P A;  1NUB A;  4UPG A;  4CFR A;  4QJ3 B;  3D0Y A;  1JWD A;  3F45 A;  2LAN A;  1CFP A;  3BFB A;  2ISD A;  1TIZ A;  2ZFD A;  3R1O A;  3WHU B;  4INW A;  1S5G Y;  1XFV O;  2F33 A;  3A8R A;  3AAK A;  1T14 A;  2BE4 A;  4ORC B;  1R6P A;  5AER A;  2KFG A;  2R2I A;  3NSO A;  2M1K B;  5D3O A;  1KFU S;  2QDI A;  1AVS A;  2L5X B;  4YGE B;  2M97 A;  1IJ6 A;  4HRG A;  1U5I B;  3WNX B;  1C07 A;  1XYD A;  2KFH A;  4NDD A;  1MWN A;  1TOP A;  1N0Y A;  2KQ6 A;  3FWB A;  3TUY C;  3EKJ A;  2WC6 A;  1Q80 A;  1B1G A;  2KOT A; 
#chains in the Genus database with same CATH homology
 3CZT X;  1TTX A;  5CSN A;  5JOL A;  2A4J A;  4BY4 A;  2Y5I A;  3HCM A;  2LUX A;  3H4S E;  1QVI Y;  5D69 A;  4M2O A;  2JT0 A;  1VRK A;  2WCF A;  3FS7 A;  3PSR A;  1XFX O;  1KK8 C;  2F2O A;  4A4C A;  4PE1 A;  1BG1 A;  3GOF A;  1XVJ A;  1DF0 A;  1M46 A;  5AAN A;  1TNX A;  1UHJ A;  3JTD C;  4BY5 A;  1L2O C;  4MN0 A;  1IQ5 A;  1DT7 B;  1CLB A;  1K9K A;  4DS7 A;  2K7D A;  3DD4 A;  1QAT A;  5I2O A;  1EL4 A;  2L51 A;  2LP3 A;  1K9U A;  3KO0 A;  3WXA A;  1NSH A;  2OS8 C;  3BUW B;  1FF1 A;  2PVB A;  2SCP A;  3O6B A;  3GK2 A;  2PAL A;  3CR2 A;  1B8C A;  1BMO A;  4I5K A;  1JC2 A;  3DF0 A;  1G8I A;  3OB2 B;  2NLN A;  3OB1 B;  3IQO A;  1QLK A;  4JQ0 D;  4PHN A;  3I5F C;  2JXC A;  2PRU A;  2LLS A;  1NCY A;  2CTN A;  2I2R E;  2AAO A;  5AEQ A;  4FQO A;  3TUY B;  4MLW A;  4PCW A;  2BCX A;  3EK7 A;  2IS9 A;  2BKH B;  5AXI A;  5JJG A;  4MSP A;  3DVE A;  4A4B A;  1SCM C;  3SG3 A;  4NDB A;  3D0Y B;  2Y1N A;  2JXL A;  4I5L B;  5CSI A;  1SL8 A;  2K2F A;  1KK8 B;  1UHN A;  1RRO A;  3VRQ A;  3CR4 X;  3VRP A;  2LHI A;  2RGI A;  1LVC D;  2EGD A;  1AUI B;  4M2Q A;  1JBA A;  1KFU L;  2FOT A;  3JTD B;  1AJ4 A;  1L2O B;  1MXE A;  4DIR A;  1YRU B;  4JPZ B;  1YUS A;  4PHJ A;  2M0R A;  3I5G C;  1CM4 A;  1TNP A;  2KYF A;  2L4H A;  1FPW A;  2M3W A;  4N1F A;  4XYN A;  1J55 A;  1UHI A;  2V53 A;  1DJI A;  1NX3 A;  1IKU A;  2OS8 B;  3DVK A;  4AQJ A;  2LVV A;  2MLE C;  3O4Y A;  1WDC C;  1X02 A;  1SCV A;  1CTR A;  2H61 A;  2MLF C;  4I5N B;  2MBX A;  1FI6 A;  1QV1 A;  1Y6W A;  1TNW A;  1PSR A;  2L50 A;  2Q4U A;  1EG4 A;  3BUM B;  1BOD A;  3PN7 C;  2K2A A;  1LXF C;  4USL A;  1DF0 B;  1RFJ A;  4DCK A;  3CGA A;  1MF8 B;  3PAL A;  4P5O E;  1A4P A;  1TCO B;  1A03 A;  4IL1 A;  1KQM B;  1OMV A;  3CS1 A;  2BCB A;  4AQI A;  4MRY A;  4YI9 A;  1ZUZ A;  1PRW A;  3NSK A;  3KHE A;  2HQW A;  2SAS A;  3NXA A;  2HQ8 A;  1B4C A;  2MA2 A;  2AUC A;  4C0L A;  1TN4 A;  3I5H C;  3TDU A;  1SCM B;  2WOR A;  4PHK A;  1HT9 A;  3LK0 A;  4WRI A;  1S5G Z;  1QX7 A;  3D10 A;  1DJX A;  4GNK B;  3TDZ A;  1OMR A;  4ICB A;  4QJ5 B;  5HKW A;  2G9B A;  2OPO A;  5IBW A;  3DF0 B;  1F8H A;  4XJK A;  4MBE A;  1WRL A;  3BQ3 A;  1IRJ A;  2KBM A;  3EVU A;  2P6B B;  1CM1 A;  2K61 A;  4U8D A;  4MZJ A;  1BOC A;  3KEV A;  1UWO A;  2KQY A;  1PK0 D;  1SL9 A;  1AP4 A;  3FWC A;  4N5X A;  1DJW A;  3O2P A;  4OR9 B;  2F3Y A;  2I18 A;  1QVI Z;  1L7Z A;  4PE7 A;  4YI8 A;  3ZNI A;  1M45 A;  2LV7 A;  1KWO C;  4GAO A;  1SKT A;  1V1G A;  1H8B A;  2KI6 D;  1MR8 A;  2BEC A;  4NDC A;  1FBV A;  1XFU O;  1KFX S;  1B7T Y;  1S3P A;  3BYA A;  2LNK A;  1DGU A;  1WRZ A;  2BL0 C;  3PN7 B;  1CDP A;  2Q91 A;  1XA5 A;  1KQV A;  2LHL A;  1YR5 A;  2QAC A;  1CB1 A;  1YUR A;  4OCI A;  1QS7 A;  5CSJ A;  4HRH A;  1FW4 A;  1SPY A;  4CFQ A;  3EKH A;  2VRG A;  2L2E A;  3SG2 A;  2E30 A;  2ZRS A;  1EJ3 A;  1DVI A;  2TN4 A;  3I5H B;  4CID A;  2F8P A;  1TCF A;  1IQ3 A;  2Y4Q A;  5CSF A;  1A75 A;  3TS5 C;  4TNC A;  2JU0 A;  4MVF A;  1RK9 A;  2LMU A;  2NCP A;  4HSZ A;  2OTG C;  2JUL A;  1N65 A;  5DKR A;  1BJF A;  2HF5 A;  3IF7 A;  4DUQ A;  1B9A A;  2FJU B;  4GUK A;  2M7L A;  1AHR A;  2M9G A;  1JUO A;  1OZS A;  5KU1 A;  2LMV A;  1K90 D;  2KI4 C;  1LIN A;  2ZN8 A;  4NQG A;  5D7F A;  2CNP A;  4JWQ A;  1S6J A;  1MQ1 A;  1SRA A;  1XFY O;  1KWO B;  2CCM A;  2KGR A;  3JVT C;  5PAL A;  2EC6 C;  3A4U B;  4ORB B;  1BT6 A;  2JTT A;  2KAY A;  2BL0 B;  2KSP A;  1MUX A;  5KTY A;  2MHH A;  3LCP C;  3SIB A;  1IH0 A;  1JSA A;  4XJK B;  2M7N A;  1LA3 A;  1A2X A;  1QLS A;  1TNQ A;  2KGB C;  2LE9 B;  2WC8 A;  3EK4 A;  4MZK A;  1V1F A;  1N2D A;  1TRF A;  3PAT A;  2KYC A;  1OSA A;  2KFF A;  1NX0 A;  2NCO A;  1UUR A;  1CLM A;  1S6I A;  4D1E A;  1J7R A;  3VGO A;  1GJY A;  2DOQ A;  2LUC A;  1R2U A;  4PE0 A;  1YX8 A;  3GK1 A;  4ORA B;  4OV2 A;  1WLM A;  2PMY A;  3TS5 B;  2K8M B;  2BKI B;  2JOJ A;  2LC5 A;  3OP0 A;  2OTG B;  1XFZ O;  1K96 A;  3C1V A;  3SG5 A;  1G33 A;  2L0P A;  4R1E A;  2HET A;  3WHT B;  1K95 A;  2B1U A;  5DKN A;  4Q04 A;  4ZCU A;  2KI4 B;  1NX2 A;  1KK7 Y;  2FCE A;  1OQP A;  2BBM A;  5ER5 A;  4MZL A;  1SY9 A;  2K7B A;  1FI5 A;  3I5F B;  1GGZ A;  1DJG A;  2KNE A;  2E6W A;  4YGC B;  3JVT B;  1CNP A;  1W7I B;  2EC6 B;  2JPT A;  5HLV A;  2KDH A;  2BE6 A;  1DGV A;  1A75 B;  2KI6 C;  2WOS A;  1C7V A;  1YTZ C;  2MAZ A;  1ZOT B;  3BOW A;  1DJY A;  1WRK A;  2ZND A;  3ICB A;  2G2B A;  1NCX A;  1PVB A;  1XK4 A;  4C0K A;  1BF5 A;  1ALV A;  2I7A A;  4C0J A;  2PAS A;  1JFJ A;  1UHK A;  1NP8 A;  3AAJ A;  5HYD A;  1Y1A A;  1BR1 B;  1B7T Z;  1LKJ A;  3BUX B;  1NCZ A;  2LMT A;  3I5G B;  3EVR A;  1F55 A;  4YGB B;  3BUN B;  1M31 A;  1GQM A;  4OVN F;  1EH2 A;  1Y1X A;  1F4Q A;  1IWQ A;  5HKZ A;  1SL7 A;  2JTZ A;  2K7C A;  2Y1M A;  3NSI A;  5HLO A;  2LLT A;  3E3R A;  4YRU A;  4N1G A;  4CLN A;  1WDC B;  2KAX A;  1MHO A;  1OZO A;  2NXQ A;  5I2Q A;  1S6C A;  5BPJ A;  1F71 A;  1ZMZ A;  3IQQ A;  2GV5 A;  3BXK A;  1XK4 C;  3OHM B;  2M49 B;  3NSL A;  3LK1 A;  2JT3 A;  2M1U A;  1K93 D;  2LP2 A;  2JQ6 A;  4I5J A;  1Y0V H;  1UUS A;  1XO5 A;  2K0J A;  1KSO A;  2ZKM X;  2FCD A;  1M63 B;  1OOJ A;  2JRF A;  2KAV A;  1PUL A;  1G4Y R;  1M39 A;  2LLU A;  3LLE A;  2MJW B;  1S26 D;  1SYM A;  4YBH B;  1F70 A;  1NWD A;  2F2P A;  2JWW A;  5K89 A;  1JFK A;  4ZCV A;  3GK4 X;  3DVM A;  1IJ5 A;  1PAL A;  1SR6 C;  2GGZ A;  4L9M A;  3FIA A;  3VRO A;  4GGF A;  2LVI A;  2JNX A;  2M29 A;  1ZAC A;  4E68 A;  1QIW A;  2K7O A;  1RWY A;  1PVA A;  4M2P A;  4MRX A;  4PAL A;  1DTL A;  2L98 A;  1QAS A;  3QRX A;  1ALW A;  1YUT A;  2KHN A;  4YGA A;  1IGV A;  3AKA A;  1DJH A;  1CDN A;  1S1E A;  5TNC A;  1YX7 A;  4HRE E;  2ZNE A;  3CR5 X;  2CBL A;  2HPS A;  1CMG A;  3SIA A;  1RJV A;  2PSR A;  5ER4 X;  2BBN A;  1UP5 A;  3BOW B;  5FYX A;  2I94 A;  3ZWH A;  1CMF A;  3LL8 B;  1SBJ A;  2NZ0 A;  5CPV A;  5GQQ C;  2JC2 A;  4ETO A;  1DJZ A;  3OX6 A;  1WLZ A;  1YVL A;  1JF2 A;  4YGD B;  4AOM A;  4GGF C;  1ZFS A;  1CLL A;  3I5I C;  1EG3 A;  1YVH A;  3KPX A;  1OE9 B;  3SG4 A;  1QX5 B;  2WND A;  2CT9 A;  1F4O A;  1ODB A;  4PDZ A;  5KSZ A;  1B8L A;  1W7J B;  3OX5 A;  5DKQ A;  1CFF A;  2JZI A;  2JT8 A;  1NYA A;  2EHB A;  2O5G A;  1OMD A;  1GGW A;  1J7Q A;  2LVJ A;  3PM8 A;  2F3Z A;  1KQM C;  1SR6 B;  3CWG A;  1KFX L;  3HX4 A;  1KK7 Z;  4GPL B;  1Y1U A;  3RM1 A;  4GBA A;  4F0Z B;  3PLF B;  1QJT A;  1RTP 1;  3CTN A;  3TZ1 A;  3AKB A;  1K2H A;  1U5I A;  2M8U A;  1HQV A;  1QX2 A;  1QTX A;  1J1D A;  2GGM A;  1F54 A;  2KBI A;  1B47 A;  1XFW O;  1J1E A;  4WQ2 A;  1NPQ A;  1CFD A;  5I2L A;  4OKH A;  3TDI A;  3VRR A;  4QJ4 B;  5I8N A;  3M0W A;  2LVK A;  2AMI A;  3SG7 A;  1E8A A;  1J7P A;  4DRW A;  1QXP A;  2O60 A;  1B8R A;  1NIW A;  2QPT A;  3PFV A;  5J3X A;  1QV0 A;  1SW8 A;  3KF9 A;  3MSE B;  5F6T A;  1AK8 A;  4WQ3 A;  3I5I B;  2MRD A;  3RLZ A;  4FTG A;  4PHM A;  2D8N A;  2LCP A;  2H2K A;  4MEW A;  5AFP A;  1JF0 A;  2ZRT A;  1UHH A;  3O78 A;  1CKK A;  1J7O A;  2ZN9 A;  3BUO B;  1EXR A;  2COL B;  1C7W A;  1LA0 A;  1S36 A;  3DVJ A;  2BCA A;  1H4B A;  1IG5 A;  2WCE A;  1NX1 A;  4GFT A;  1A29 A;  1BLQ A;  1K94 A;  5G08 A;  1CDL A;  3CLN A;  2LAP A;  1MXL C;  2L4I A;  2LM5 A;  1SK6 D;  1YUU A;  1D1O A;  1BU3 A;  4GGN A;  1CFC A;  1CDM A;  3EVV A;  4P2Y B;  3VRN A;  1DMO A;  1KCY A;  3SG6 A;  1REC A;  3EK8 A;  1SNL A;  2CXJ A;  3SJS A;  1BR4 B;  1PSB A;  1AJ5 A;  2H61 C;  2JNF A;  5B8I B;  1QIV A;  1WY9 A;  1YRT B;  2WCB A;  4CPV A;  4PE4 A;  1K8U A;  3K21 A;  5HKY A;  1KSM A;  1SMG A;  1K9P A;  1NUB A;  4UPG A;  4CFR A;  4QJ3 B;  3D0Y A;  1JWD A;  3F45 A;  2LAN A;  1CFP A;  2ISD A;  1TIZ A;  2ZFD A;  3WHU B;  1S5G Y;  1XFV O;  2F33 A;  3A8R A;  3AAK A;  4ORC B;  2BE4 A;  1R6P A;  5AER A;  2KFG A;  2R2I A;  3NSO A;  2M1K B;  1KFU S;  1AVS A;  2L5X B;  4YGE B;  2M97 A;  1IJ6 A;  4HRG A;  1U5I B;  3WNX B;  1C07 A;  1XYD A;  2KFH A;  4NDD A;  1MWN A;  1TOP A;  1N0Y A;  2KQ6 A;  3FWB A;  3TUY C;  3EKJ A;  1Q80 A;  1B1G A;  2KOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...