2L51A

Solution structure of calcium bound s100a16
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
102
structure length
102
Chain Sequence
SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A16
publication title Structural characterization of human S100A16, a low-affinity calcium binder.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2l51A00
2L5XB 1B7TZ 1TRFA 3WHTB 2KI6D 2EC6C 1KCYA 1KQMC 2WNDA 2GGMA 1RTP1 1PVBA 1QATA 2JT0A 2KYFA 2HETA 3E3RA 1QVIY 1Y1XA 2Y1NA 3I5GB 2V53A 1F70A 4OVNF 3KF9A 4GBAA 2LP3A 3H4SE 3PSRA 1A03A 1FF1A 1K2HA 3I5FC 2QACA 4YRUA 1RECA 1B8CA 3HCMA 1BMOA 1KFXS 2JTZA 1IJ5A 2JPTA 4CLNA 1BOCA 1QX7A 1WLMA 2PASA 1UURA 3KPXA 2M3WA 2OS8B 2ISDA 2MA2A 1B7TY 2NCOA 4Q04A 2KNEA 1ZACA 1M31A 1XK4A 2I94A 5DKQA 4DS7A 1YURA 2LC5A 1A75B 4GGNA 4PALA 1K9PA 4YI9A 1JWDA 1BT6A 3TS5C 1BJFA 2L4IA 3EVUA 1CKKA 3EK7A 1EH2A 3I5FB 2M7LA 1B9AA 1LA3A 1LA0A 2AUCA 1KFXL 2K7CA 5AEQA 1OOJA 4OV2A 2KFFA 2MHHA 1MF8B 1NPQA 1TNWA 1DJHA 4N1GA 4D1EA 1SYMA 1YX7A 1V1FA 5HLVA 2BKHB 2ZN8A 2R2IA 1N65A 2I7AA 1K94A 1Y1UA 1TCFA 1F4QA 3JVTC 1IJ6A 1WDCC 3NSOA 2IS9A 1UHIA 3ZWHA 1S6CA 1RJVA 1C07A 1NX0A 3AAKA 3I5HC 4PHNA 1KQVA 1DJWA 1AJ4A 1MUXA 1QJTA 1TCOB 2KSPA 1CLLA 3BUOB 3FIAA 4R1EA 1IRJA 3DVMA 2M9GA 1LXFC 3PN7C 3CWGA 1J7QA 1FI6A 4GAOA 1MR8A 2PSRA 1AHRA 4JQ0D 2K2FA 4ZCUA 1F54A 1F4OA 4GPLB 2BBNA 2M7NA 2A4JA 1XA5A 2G9BA 2CBLA 1DJGA 3GK4X 1WDCB 2M0RA 1CM4A 1S36A 4E68A 2CNPA 3OHMB 4NQGA 2ZRTA 2H61A 1ZFSA 3I5IB 2F2PA 3I5HB 4A4CA 1K9KA 1NCZA 4OKHA 1GJYA 1XO5A 5KSZA 1PSBA 1J1EA 1A75A 1NX2A 4N1FA 4MZLA 4TNCA 1DVIA 1SK6D 1W7IB 3O78A 2P6BB 1SPYA 1OSAA 1WLZA 1DF0A 2KAXA 1XFUO 2JRFA 2LHLA 1H4BA 3PLFB 4GNKB 1B4CA 2JXCA 2K61A 1CFDA 1PRWA 1SCMC 1M63B 1DJYA 1KWOC 2L2EA 1BF5A 2HF5A 3BUMB 1PULA 4CFQA 3PFVA 2B1UA 1C7WA 2L4HA 1GGWA 2K8MB 3A4UB 3LK0A 2LVVA 4USLA 1JFJA 2TN4A 2Y5IA 3NSIA 1QTXA 1XFYO 1QX5B 1NCYA 4DIRA 1SL8A 2H61C 4HREE 2WCEA 1E8AA 4NDBA 5JJGA 1NSHA 2WCBA 1CNPA 1SY9A 3SG7A 4YI8A 1K90D 2FOTA 2OS8C 3BUNB 3GK1A 2JZIA 1AP4A 1PVAA 1SR6B 1NX3A 2JWWA 2I18A 2BCXA 5CSNA 4ORAB 5HKYA 4MBEA 1GQMA 1KK7Z 1QX2A 3TDZA 2Y1MA 3RM1A 1CFCA 4DCKA 2FCEA 1BR1B 2Y4QA 1A4PA 1TNQA 3EVVA 1QV0A 1G33A 1JF2A 1AVSA 2JU0A 2PALA 3VRQA 1HT9A 1DJIA 1MXLC 4YGBB 1CMGA 5HYDA 1F55A 1K93D 1IG5A 1RROA 3DF0A 1G4YR 2LCPA 1OZSA 3TDUA 4BY4A 5BPJA 2LNKA 1BG1A 1XFWO 1KK7Y 3CR5X 4ICBA 3D10A 4F0ZB 1UWOA 1DF0B 4MLWA 3FWBA 5F6TA 1S6JA 3VRRA 1QASA 2F3ZA 3CGAA 1F71A 2M97A 3O6BA 4C0JA 5CSFA 4L9MA 2K7OA 1S1EA 2BCAA 2OPOA 1DTLA 5I8NA 4YGAA 1CDPA 1N2DA 2JNFA 3BOWA 2COLB 1GGZA 1M46A 2K7BA 3OX5A 4FTGA 4M2PA 3SG3A 2BE6A 1CFPA 1QLSA 3OP0A 1DGUA 2K2AA 1SL7A 5CSJA 1C7VA 2LANA 1R6PA 1EL4A 1XFXO 1JUOA 1KK8B 1RFJA 3EKJA 2PRUA 5G08A 1YTZC 1PSRA 1AJ5A 1OMRA 4NDDA 1S3PA 1U5IA 3I5IC 1S26D 1YUTA 2JT8A 3LCPC 1YVLA 2JC2A 1NUBA 1QV1A 3OB1B 3A8RA 2L0PA 1TNPA 2KBMA 2LMTA 3KEVA 1XK4C 1CDMA 3RLZA 2ZN9A 2LVIA 1N0YA 3BUWB 4JWQA 2BECA 1WRZA 4GFTA 3DVEA 3OB2B 1D1OA 1M39A 3LL8B 3SIBA 1X02A 1NX1A 3BUXB 3KO0A 2LVJA 3SG5A 1SBJA 1SW8A 3WHUB 4MSPA 4CFRA 4I5JA 1J55A 1B8LA 5D69A 2CTNA 1TN4A 2CT9A 2NLNA 1MQ1A 5KTYA 1KFUS 3SG6A 1CTRA 3IF7A 4PHJA 1CLBA 2MLFC 3WXAA 1CB1A 1OMDA 4GGFA 3TUYB 3DF0B 2ZNEA 3AKBA 2LHIA 1DJZA 1YRUB 2NZ0A 1AK8A 5JOLA 4MRXA 1EG3A 3AAJA 4MVFA 1IWQA 3SG2A 1ZOTB 1LINA 4A4BA 2O60A 4AQJA 2JXLA 4CIDA 3F45A 2LE9B 1AUIB 1YR5A 3CLNA 1SNLA 1UHNA 5ER4X 4PHMA 1KFUL 4PDZA 2OTGB 1IQ3A 2ZRSA 1F8HA 2F8PA 5I2LA 4ORCB 4HRHA 4MEWA 3BOWB 2M8UA 2F3YA 1UHHA 3LLEA 1SRAA 1SR6C 1SCVA 2KI6C 1YVHA 1ZMZA 5AANA 1QXPA 1EXRA 2LUCA 2WORA 2G2BA 2CXJA 3BXKA 1NCXA 5K89A 2QPTA 3VGOA 3FS7A 2MRDA 2E30A 2HQWA 2LMUA 4OR9B 2D8NA 4P2YB 3SG4A 1L7ZA 2SCPA 2MAZA 5AERA 3VRNA 1U5IB 2AMIA 2KHNA 4YGCB 3D0YA 1QIWA 4MZJA 4MN0A 4PHKA 5HKWA 1W7JB 3PALA 1SKTA 1MXEA 2E6WA 2HPSA 2HQ8A 2KFHA 2KI4B 1L2OC 4PE4A 1SMGA 4DUQA 1J7OA 2JTTA 2JQ6A 1Y6WA 1OZOA 3HX4A 2M1UA 2LUXA 1J7PA 2F33A 1KSOA 4QJ5B 4PE1A 5HLOA 1B47A 5TNCA 2NXQA 2KQ6A 2K7DA 2WOSA 2SASA 1RWYA 1XFZO 1S5GZ 1OE9B 1IGVA 1EG4A 1UUSA 4WQ3A 1UHKA 5DKNA 4XYNA 4PCWA 2ZFDA 2BL0B 1L2OB 4UPGA 5KU1A 4XJKB 1NIWA 2L98A 5DKRA 3C1VA 4YGDB 1NP8A 1G8IA 2KFGA 4M2QA 2KYCA 2VRGA 2RGIA 3CR4X 1OQPA 2KAYA 2KDHA 1NWDA 4IL1A 4MRYA 1KK8C 3EK8A 1K95A 5AXIA 1MWNA 3GK2A 1S5GY 2FCDA 4GUKA 1CM1A 1WRKA 2LAPA 3KHEA 5GQQC 2I2RE 3OX6A 1A2XA 1PK0D 1WRLA 2KQYA 5FYXA 2GV5A 4AOMA 4I5KA 2MLEC 2FJUB 3QRXA 2KOTA 1Y0VH 3VRPA 1JSAA 3DVJA 1NYAA 4QJ3B 3WNXB 1CDLA 1IQ5A 2EC6B 4ORBB 2JNXA 3MSEB 1KQMB 4P5OE 2WC8A 3FWCA 5I2QA 3O2PA 4MZKA 1K96A 2KGRA 5ER5A 3IQQA 3O4YA 1IKUA 2MJWB 1FBVA 3EVRA 1J1DA 1A29A 3NSKA 1JF0A 4I5LB 3PM8A 1YX8A 1XFVO 4YBHB 1PALA 3D0YB 4CPVA 2JOJA 2WCFA 3BQ3A 1BODA 1QLKA 2M1KB 5D7FA 3CR2A 4BY5A 2LLUA 1MHOA 3NXAA 2BCBA 1ALWA 3TUYC 1DGVA 2ZKMX 1H8BA 2AAOA 1K8UA 1M45A 1DJXA 1QS7A 1FPWA 2DOQA 2PMYA 4FQOA 1UP5A 5PALA 2MBXA 3TDIA 2LMVA 3TS5B 2F2OA 2PVBA 1RK9A 1CFFA 3AKAA 4YGEB 5B8IB 1B1GA 1XVJA 3NSLA 2OTGC 4M2OA 1Q80A 1EJ3A 3EK4A 5CSIA 3ZNIA 2L51A 1ALVA 1LVCD 2NCPA 2BE4A 4XJKA 3CS1A 1BLQA 2ZNDA 1XYDA 1BU3A 2LM5A 1CMFA 2Q4UA 2LLTA 3ICBA 1IH0A 4I5NB 1LKJA 3JVTB 4WQ2A 3LK1A 1CDNA 5I2OA 1Y1AA 5IBWA 5HKZA 1JC2A 1J7RA 4C0KA 1FI5A 1TNXA 5J3XA 1HQVA 1TIZA 2JT3A 1JFKA 2KAVA 4N5XA 3PN7B 4JPZB 1SL9A 1DMOA 1TOPA 2KI4C 3SJSA 3DD4A 3CZTX 1JBAA 3BYAA 2K0JA 1R2UA 4QJ4B 3DVKA 1V1GA 4OCIA 1S6IA 3PATA 3IQOA 2O5GA 4HSZA 1YUSA 3SIAA 3JTDC 1K9UA 4ETOA 1YRTB 2BKIB 2M29A 1WY9A 1QIVA 1DT7B 2M49B 2JULA 2L50A 1BR4B 2H2KA 1ODBA 4WRIA 2EHBA 2CCMA 3CTNA 4PE7A 3TZ1A 4C0LA 1OMVA 2Q91A 1YUUA 2BL0C 2KBIA 1VRKA 2GGZA 1FW4A 2KGBC 3K21A 4GGFC 4ZCVA 3GOFA 4DRWA 4U8DA 4NDCA 4HRGA 1KSMA 1B8RA 5CPVA 3I5GC 3VROA 1QVIZ 1CLMA 3EKHA 3JTDB 2LLSA 2EGDA 4AQIA 2BBMA 5AFPA 1ZUZA 1TTXA 1UHJA 2LVKA 1SCMB 3M0WA 4PE0A 1KWOB 2LV7A 2LP2A
chains in the Genus database with same CATH superfamily
2L5XB 1B7TZ 1TRFA 2BNXA 3WHTB 2KI6D 2EC6C 4INXA 1KCYA 1KQMC 2WNDA 2GGMA 1RTP1 1PVBA 1QATA 2JT0A 2KYFA 3IVTA 2HETA 3E3RA 3S0EA 1QVIY 1Y1XA 2Y1NA 3I5GB 2V53A 1F70A 2KLEA 4OVNF 1TWOA 3FE6A 3KF9A 4GBAA 2LP3A 3H4SE 3PSRA 1A03A 1FF1A 1K2HA 3I5FC 2QACA 4YRUA 1RECA 1B8CA 3HCMA 1BMOA 1KFXS 2JTZA 1IJ5A 2JPTA 4CLNA 1BOCA 1QX7A 1WLMA 2PASA 1UURA 3KPXA 2M3WA 2OS8B 2ISDA 2MA2A 1B7TY 2NCOA 4Q04A 2KNEA 1ZACA 1M31A 2L5YA 1XK4A 2I94A 5DKQA 4DS7A 1YURA 2LC5A 1A75B 3FE9A 4GGNA 4PALA 1LS8A 1K9PA 4YI9A 1JWDA 1BT6A 3TS5C 3D73A 2WCLA 5FI6A 1BJFA 3N7HA 3BFBA 1DEKA 2L4IA 3EVUA 1CKKA 3EK7A 1EH2A 3I5FB 2M7LA 1B9AA 1LA3A 1LA0A 2AUCA 3BJHA 4JD9A 3UO9A 1KFXL 2K7CA 3K1EA 5AEQA 1OOJA 1DELA 4OV2A 2KFFA 2MHHA 1MF8B 1NPQA 1TNWA 1DJHA 2YGUA 4N1GA 4D1EA 1SYMA 1YX7A 1V1FA 5HLVA 2BKHB 1C3ZA 2ZN8A 2R2IA 1N65A 2WCMA 2I7AA 1K94A 1Y1UA 3B88A 1TCFA 1F4QA 3JVTC 1IJ6A 1WDCC 3NSOA 2IS9A 1UHIA 2WC6A 1S6CA 3ZWHA 1RJVA 2QEVA 1C07A 1NX0A 3AAKA 3I5HC 4PHNA 1KQVA 3D75A 1DJWA 1AJ4A 1MUXA 1QJTA 1TCOB 2KSPA 1CLLA 3BUOB 3FIAA 3OGNA 4R1EA 1IRJA 3DVMA 2M9GA 1LXFC 3PN7C 3CWGA 1J7QA 1FI6A 4GAOA 1MR8A 2PSRA 1AHRA 4JQ0D 2K2FA 4ZCUA 1F54A 1F4OA 4GPLB 2BBNA 2M7NA 2A4JA 1XA5A 2G9BA 3L4AA 2CBLA 1DJGA 3GK4X 1WDCB 2M0RA 1CM4A 1S36A 4E68A 2CNPA 3OHMB 4NQGA 2ZRTA 2H61A 1ZFSA 3I5IB 2F2PA 3I5HB 4A4CA 1K9KA 1NCZA 4OKHA 2P71A 1GJYA 1XO5A 3DYEA 5KSZA 1DC1A 1PSBA 3S0DA 1J1EA 1A75A 1NX2A 4N1FA 1Z4HA 4MZLA 4TNCA 5EL2A 1DVIA 1OOFA 5DICA 1SK6D 1W7IB 3O78A 2P6BB 1SPYA 1OSAA 1WLZA 1DF0A 2KAXA 1XFUO 2JRFA 2LHLA 1H4BA 3PLFB 4GNKB 1B4CA 2JXCA 2K61A 1CFDA 1PRWA 1SCMC 1M63B 1DJYA 1KWOC 2L2EA 1BF5A 2HF5A 3BUMB 1PULA 4CFQA 3PFVA 2B1UA 1C7WA 2L4HA 1GGWA 2K8MB 3A4UB 1OW4A 3LK0A 2QEHA 3B86A 2LVVA 1C3YA 4USLA 1JFJA 2TN4A 2Y5IA 3NSIA 1QTXA 1XFYO 1QX5B 1NCYA 1GM0A 4DIRA 1SL8A 2H61C 1TUJA 4HREE 2WCEA 1E8AA 4NDBA 5JJGA 1NSHA 2WCBA 3SG3A 1CNPA 1SY9A 2WC5A 3SG7A 4YI8A 1K90D 2FOTA 2OS8C 3BUNB 2GTEA 3GK1A 2JZIA 1AP4A 1PVAA 3PM2A 1SR6B 1NX3A 2JWWA 2I18A 2BCXA 5CSNA 4ORAB 5HKYA 4MBEA 1GQMA 1KK7Z 1QX2A 3TDZA 2Y1MA 3RM1A 1CFCA 3CABA 4DCKA 2FCEA 1BR1B 2Y4QA 1A4PA 1TNQA 3EVVA 1QV0A 1G33A 1JF2A 1AVSA 2JU0A 2PALA 3VRQA 1HT9A 1DJIA 1MXLC 4YGBB 1CMGA 5HYDA 1F55A 1K93D 3S0AA 1IG5A 1RROA 3DF0A 2K60A 1G4YR 2LCPA 1OZSA 3TDUA 4BY4A 5BPJA 2LNKA 2QEOA 1XFWO 1KK7Y 3CR5X 4ICBA 3D10A 3NGVA 1BG1A 4F0ZB 1UWOA 1DF0B 3NHTA 4MLWA 3FWBA 5F6TA 1S6JA 3VRRA 3S0FA 3BFAA 1QASA 3CDNA 2F3ZA 3CGAA 1F71A 2M97A 3O6BA 4C0JA 2KLDA 5CSFA 4L9MA 2K7OA 5I94A 1S1EA 2PYQA 2BCAA 2OPOA 1DTLA 3DZTA 3PJIA 5I8NA 4YGAA 1CDPA 1N2DA 2JNFA 2FJYA 2COLB 1GGZA 1M46A 2K7BA 3BOWA 3OX5A 4FTGA 2KPHA 2BE6A 4M2PA 1CFPA 1QLSA 3OP0A 1DGUA 2K2AA 4IJ7A 1SL7A 5CSJA 1C7VA 2LANA 4F7FA 1R6PA 1EL4A 1XFXO 1JUOA 1KK8B 1RFJA 3EKJA 2PRUA 5G08A 1YTZC 1PSRA 1AJ5A 1OMRA 4NDDA 3R1OA 1S3PA 1U5IA 2BAPA 3I5IC 1S26D 1YUTA 2JT8A 3LCPC 2QDIA 1YVLA 3NHIA 2JC2A 1NUBA 1QV1A 3OB1B 3A8RA 2L0PA 1TNPA 2KBMA 2LMTA 3KEVA 1XK4C 1CDMA 3RLZA 2ZN9A 2LVIA 1N0YA 3BUWB 4JWQA 3S0GA 2BECA 1WRZA 4GFTA 3DVEA 3OB2B 1D1OA 1XFRA 1M39A 3LL8B 3Q8IA 3SIBA 1X02A 1NX1A 3BUXB 5FI2A 3KO0A 2LVJA 3SG5A 1SBJA 1SW8A 3WHUB 4MSPA 4CFRA 4I5JA 1J55A 1B8LA 5D69A 2CTNA 1TN4A 2CT9A 2NLNA 3D76A 1MQ1A 5KTYA 1KFUS 3SG6A 4JKTA 1CTRA 3IF7A 4PHJA 1CLBA 2MLFC 3WXAA 1CB1A 1OMDA 4INWA 3CZ0A 4GGFA 3TUYB 3DF0B 3RZSA 2ZNEA 3AKBA 3B87A 2LHIA 1DJZA 1YRUB 2NZ0A 1AK8A 5JOLA 4MRXA 1EG3A 2PQLA 1OOIX 3AAJA 4MVFA 1IWQA 3SG2A 1ZOTB 1LINA 1OOHA 4A4BA 2O60A 4AQJA 2JXLA 4CIDA 3F45A 2LE9B 1AUIB 1YR5A 3CLNA 1SNLA 1UHNA 5ER4X 4PHMA 3D78A 1KFUL 4PDZA 2OTGB 1IQ3A 2ZRSA 2L2CA 1F8HA 2F8PA 5I2LA 4ORCB 4HRHA 4MEWA 3BOWB 2M8UA 2F3YA 1UHHA 3V2LA 3LLEA 1SRAA 1SR6C 1SCVA 2KI6C 1YVHA 1ZMZA 5AANA 1QXPA 1EXRA 2LUCA 2WORA 2G2BA 2CXJA 3BXKA 1NCXA 5K89A 2QPTA 3VGOA 2JPOA 3FS7A 2MRDA 2E30A 2HQWA 2LMUA 4OR9B 2D8NA 4P2YB 3SG4A 1L7ZA 2SCPA 2MAZA 5FI7A 5AERA 3SS5A 1U5IB 2AMIA 3VRNA 2KHNA 4YGCB 3D0YA 1QIWA 4MZJA 4MN0A 4PHKA 5HKWA 1W7JB 3PALA 1SKTA 1T14A 1MXEA 2E6WA 2HPSA 2HQ8A 2KFHA 2KI4B 1L2OC 4PE4A 1SMGA 4DUQA 1J7OA 2JTTA 2JQ6A 3S0BA 1Y6WA 1OZOA 3HX4A 2M1UA 2LUXA 1J7PA 3SS4A 2F33A 1KSOA 4QJ5B 3VB1A 2WCKA 4PE1A 5HLOA 1B47A 5TNCA 2NXQA 2KQ6A 2K7DA 2WOSA 2SASA 1RWYA 1XFZO 1S5GZ 1OE9B 1IGVA 1EG4A 1UUSA 4WQ3A 1UHKA 5DKNA 4XYNA 4PCWA 2ZFDA 2BL0B 3OBVA 1L2OB 4UPGA 5KU1A 4XJKB 1NIWA 2L98A 5DKRA 3C1VA 4YGDB 1NP8A 1G8IA 2KFGA 4M2QA 2KYCA 2VRGA 2RGIA 3CR4X 1OQPA 1SSEB 2KDHA 1NWDA 2KAYA 4IL1A 4MRYA 1KK8C 3EK8A 1K95A 1TUZA 3B6XA 2ERBA 1QWVA 5AXIA 1MWNA 1ORGA 3GK2A 1S5GY 2FCDA 3B7AA 1CM1A 1WRKA 2LAPA 3KHEA 2WCJA 2I2RE 4GUKA 5GQQC 3OX6A 1A2XA 1PK0D 1WRLA 2KQYA 5FYXA 2GV5A 4AOMA 2QEBA 4I5KA 2MLEC 2FJUB 3QRXA 2KOTA 1Y0VH 3VRPA 1JSAA 3DVJA 1NYAA 4QJ3B 3WNXB 1CDLA 3SS3A 1IQ5A 2EC6B 4ORBB 2JNXA 3MSEB 1KQMB 4P5OE 2WC8A 3FWCA 5I2QA 3O2PA 4MZKA 3DY9A 1P28A 1K96A 2KGRA 5ER5A 3IQQA 3O4YA 1IKUA 2MJWB 1FBVA 3BFHA 3EVRA 1J1DA 1A29A 3NSKA 3DXLA 3FE8A 3O4XA 1JF0A 4I5LB 3PM8A 1YX8A 1XFVO 4YBHB 1PALA 3D0YB 4CPVA 2JOJA 2WCFA 3BQ3A 1BODA 1IIOA 1QLKA 2M1KB 3CYZA 5D7FA 3CR2A 4BY5A 2LLUA 1MHOA 3NXAA 2BCBA 1ALWA 3TUYC 1DGVA 2ZKMX 1H8BA 2AAOA 1K8UA 1M45A 1DJXA 1QS7A 1FPWA 2DOQA 2PMYA 4FQOA 1UP5A 5PALA 2MBXA 3TDIA 2LMVA 3TS5B 1W9ZA 3L4LA 2F2OA 2PVBA 1DQEA 1RK9A 1CFFA 3AKAA 3CZ2A 3L47A 4YGEB 5B8IB 1B1GA 5D3OA 1XVJA 3NSLA 2OTGC 4M2OA 1Q80A 1EJ3A 3EK4A 5CSIA 3ZNIA 2L51A 1ALVA 1LVCD 2NCPA 4OZDA 2BE4A 3CZ1A 4XJKA 3CS1A 1BLQA 2ZNDA 1XYDA 1BU3A 2LM5A 1CMFA 3EG5B 2Q4UA 2LLTA 3ICBA 1IH0A 4I5NB 1LKJA 3JVTB 4WQ2A 3LK1A 1CDNA 4FQTA 1Y1AA 5I2OA 5IBWA 5HKZA 1JC2A 1J7RA 4C0KA 1FI5A 1TNXA 5J3XA 1HQVA 1TIZA 2JT3A 1JFKA 2KAVA 4N5XA 3PN7B 4JPZB 1SL9A 5HL1A 1DMOA 1TOPA 2KI4C 3SJSA 3DD4A 3CZTX 1JBAA 3R72A 3BYAA 2K0JA 2WCHA 1R2UA 4QJ4B 3DVKA 1V1GA 4OCIA 1S6IA 3PATA 3IQOA 2O5GA 4HSZA 1YUSA 3SIAA 3JTDC 1K9UA 4ETOA 1OOGA 1YRTB 2BKIB 2M29A 1WY9A 3R1VA 1QIVA 3D74A 1DT7B 2M49B 2JULA 3UNWA 2L50A 1BR4B 2H2KA 1ODBA 4WRIA 2EHBA 2CCMA 3CTNA 4PE7A 3TZ1A 4C0LA 1OMVA 2Q91A 1YUUA 2BL0C 2KBIA 1VRKA 2GGZA 1FW4A 2KGBC 3K21A 4GGFC 4ZCVA 3R1PA 3QMEA 3GOFA 4DRWA 4U8DA 4NDCA 2H8VA 4HRGA 4KYNA 1KSMA 1B8RA 5CPVA 3I5GC 3VROA 1QVIZ 1CLMA 3EKHA 3JTDB 2LLSA 2EGDA 4AQIA 2BBMA 4PT1A 5AFPA 2P70A 1ZUZA 1TTXA 1UHJA 1Z2CB 1SCMB 2LVKA 3M0WA 4PE0A 1KWOB 2LV7A 3D77A 2LP2A
chains in the Genus database with same CATH topology
2L5XB 1B7TZ 1TRFA 3WHTB 2KI6D 2EC6C 1KCYA 1KQMC 2WNDA 2GGMA 1RTP1 1PVBA 1QATA 2JT0A 2KYFA 2HETA 3E3RA 1QVIY 1Y1XA 2Y1NA 3I5GB 2V53A 1F70A 4OVNF 3KF9A 4GBAA 2LP3A 3H4SE 3PSRA 1A03A 1FF1A 1K2HA 3I5FC 2QACA 4YRUA 1RECA 1B8CA 3HCMA 1BMOA 1KFXS 2JTZA 1IJ5A 2JPTA 4CLNA 1BOCA 1QX7A 1WLMA 2PASA 1UURA 3KPXA 2M3WA 2OS8B 2ISDA 2MA2A 1B7TY 2NCOA 4Q04A 2KNEA 1ZACA 1M31A 1XK4A 2I94A 5DKQA 4DS7A 1YURA 2LC5A 1A75B 4GGNA 4PALA 1K9PA 4YI9A 1JWDA 1BT6A 3TS5C 1BJFA 2L4IA 3EVUA 1CKKA 3EK7A 1EH2A 3I5FB 2M7LA 1B9AA 1LA3A 1LA0A 2AUCA 1KFXL 2K7CA 5AEQA 1OOJA 4OV2A 2KFFA 2MHHA 1MF8B 1NPQA 1TNWA 1DJHA 4N1GA 4D1EA 1SYMA 1YX7A 1V1FA 5HLVA 2BKHB 2ZN8A 2R2IA 1N65A 2I7AA 1K94A 1Y1UA 1TCFA 1F4QA 3JVTC 1IJ6A 1WDCC 3NSOA 2IS9A 1UHIA 3ZWHA 1S6CA 1RJVA 1C07A 1NX0A 3AAKA 3I5HC 4PHNA 1KQVA 1DJWA 1AJ4A 1MUXA 1QJTA 1TCOB 2KSPA 1CLLA 3BUOB 3FIAA 4R1EA 1IRJA 3DVMA 2M9GA 1LXFC 3PN7C 3CWGA 1J7QA 1FI6A 4GAOA 1MR8A 2PSRA 1AHRA 4JQ0D 2K2FA 4ZCUA 1F54A 1F4OA 4GPLB 2BBNA 2M7NA 2A4JA 1XA5A 2G9BA 2CBLA 1DJGA 3GK4X 1WDCB 2M0RA 1CM4A 1S36A 4E68A 2CNPA 3OHMB 4NQGA 2ZRTA 2H61A 1ZFSA 3I5IB 2F2PA 3I5HB 4A4CA 1K9KA 1NCZA 4OKHA 1GJYA 1XO5A 5KSZA 1PSBA 1J1EA 1A75A 1NX2A 4N1FA 4MZLA 4TNCA 1DVIA 1SK6D 1W7IB 3O78A 2P6BB 1SPYA 1OSAA 1WLZA 1DF0A 2KAXA 1XFUO 2JRFA 2LHLA 1H4BA 3PLFB 4GNKB 1B4CA 2JXCA 2K61A 1CFDA 1PRWA 1SCMC 1M63B 1DJYA 1KWOC 2L2EA 1BF5A 2HF5A 3BUMB 1PULA 4CFQA 3PFVA 2B1UA 1C7WA 2L4HA 1GGWA 2K8MB 3A4UB 3LK0A 2LVVA 4USLA 1JFJA 2TN4A 2Y5IA 3NSIA 1QTXA 1XFYO 1QX5B 1NCYA 4DIRA 1SL8A 2H61C 4HREE 2WCEA 1E8AA 4NDBA 5JJGA 1NSHA 2WCBA 1CNPA 1SY9A 3SG7A 4YI8A 1K90D 2FOTA 2OS8C 3BUNB 3GK1A 2JZIA 1AP4A 1PVAA 1SR6B 1NX3A 2JWWA 2I18A 2BCXA 5CSNA 4ORAB 5HKYA 4MBEA 1GQMA 1KK7Z 1QX2A 3TDZA 2Y1MA 3RM1A 1CFCA 4DCKA 2FCEA 1BR1B 2Y4QA 1A4PA 1TNQA 3EVVA 1QV0A 1G33A 1JF2A 1AVSA 2JU0A 2PALA 3VRQA 1HT9A 1DJIA 1MXLC 4YGBB 1CMGA 5HYDA 1F55A 1K93D 1IG5A 1RROA 3DF0A 1G4YR 2LCPA 1OZSA 3TDUA 4BY4A 5BPJA 2LNKA 1BG1A 1XFWO 1KK7Y 3CR5X 4ICBA 3D10A 4F0ZB 1UWOA 1DF0B 4MLWA 3FWBA 5F6TA 1S6JA 3VRRA 1QASA 2F3ZA 3CGAA 1F71A 2M97A 3O6BA 4C0JA 5CSFA 4L9MA 2K7OA 1S1EA 2BCAA 2OPOA 1DTLA 5I8NA 4YGAA 1CDPA 1N2DA 2JNFA 3BOWA 2COLB 1GGZA 1M46A 2K7BA 3OX5A 4FTGA 4M2PA 3SG3A 2BE6A 1CFPA 1QLSA 3OP0A 1DGUA 2K2AA 1SL7A 5CSJA 1C7VA 2LANA 1R6PA 1EL4A 1XFXO 1JUOA 1KK8B 1RFJA 3EKJA 2PRUA 5G08A 1YTZC 1PSRA 1AJ5A 1OMRA 4NDDA 1S3PA 1U5IA 3I5IC 1S26D 1YUTA 2JT8A 3LCPC 1YVLA 2JC2A 1NUBA 1QV1A 3OB1B 3A8RA 2L0PA 1TNPA 2KBMA 2LMTA 3KEVA 1XK4C 1CDMA 3RLZA 2ZN9A 2LVIA 1N0YA 3BUWB 4JWQA 2BECA 1WRZA 4GFTA 3DVEA 3OB2B 1D1OA 1M39A 3LL8B 3SIBA 1X02A 1NX1A 3BUXB 3KO0A 2LVJA 3SG5A 1SBJA 1SW8A 3WHUB 4MSPA 4CFRA 4I5JA 1J55A 1B8LA 5D69A 2CTNA 1TN4A 2CT9A 2NLNA 1MQ1A 5KTYA 1KFUS 3SG6A 1CTRA 3IF7A 4PHJA 1CLBA 2MLFC 3WXAA 1CB1A 1OMDA 4GGFA 3TUYB 3DF0B 2ZNEA 3AKBA 2LHIA 1DJZA 1YRUB 2NZ0A 1AK8A 5JOLA 4MRXA 1EG3A 3AAJA 4MVFA 1IWQA 3SG2A 1ZOTB 1LINA 4A4BA 2O60A 4AQJA 2JXLA 4CIDA 3F45A 2LE9B 1AUIB 1YR5A 3CLNA 1SNLA 1UHNA 5ER4X 4PHMA 1KFUL 4PDZA 2OTGB 1IQ3A 2ZRSA 1F8HA 2F8PA 5I2LA 4ORCB 4HRHA 4MEWA 3BOWB 2M8UA 2F3YA 1UHHA 3LLEA 1SRAA 1SR6C 1SCVA 2KI6C 1YVHA 1ZMZA 5AANA 1QXPA 1EXRA 2LUCA 2WORA 2G2BA 2CXJA 3BXKA 1NCXA 5K89A 2QPTA 3VGOA 3FS7A 2MRDA 2E30A 2HQWA 2LMUA 4OR9B 2D8NA 4P2YB 3SG4A 1L7ZA 2SCPA 2MAZA 5AERA 3VRNA 1U5IB 2AMIA 2KHNA 4YGCB 3D0YA 1QIWA 4MZJA 4MN0A 4PHKA 5HKWA 1W7JB 3PALA 1SKTA 1MXEA 2E6WA 2HPSA 2HQ8A 2KFHA 2KI4B 1L2OC 4PE4A 1SMGA 4DUQA 1J7OA 2JTTA 2JQ6A 1Y6WA 1OZOA 3HX4A 2M1UA 2LUXA 1J7PA 2F33A 1KSOA 4QJ5B 4PE1A 5HLOA 1B47A 5TNCA 2NXQA 2KQ6A 2K7DA 2WOSA 2SASA 1RWYA 1XFZO 1S5GZ 1OE9B 1IGVA 1EG4A 1UUSA 4WQ3A 1UHKA 5DKNA 4XYNA 4PCWA 2ZFDA 2BL0B 1L2OB 4UPGA 5KU1A 4XJKB 1NIWA 2L98A 5DKRA 3C1VA 4YGDB 1NP8A 1G8IA 2KFGA 4M2QA 2KYCA 2VRGA 2RGIA 3CR4X 1OQPA 2KAYA 2KDHA 1NWDA 4IL1A 4MRYA 1KK8C 3EK8A 1K95A 5AXIA 1MWNA 3GK2A 1S5GY 2FCDA 4GUKA 1CM1A 1WRKA 2LAPA 3KHEA 5GQQC 2I2RE 3OX6A 1A2XA 1PK0D 1WRLA 2KQYA 5FYXA 2GV5A 4AOMA 4I5KA 2MLEC 2FJUB 3QRXA 2KOTA 1Y0VH 3VRPA 1JSAA 3DVJA 1NYAA 4QJ3B 3WNXB 1CDLA 1IQ5A 2EC6B 4ORBB 2JNXA 3MSEB 1KQMB 4P5OE 2WC8A 3FWCA 5I2QA 3O2PA 4MZKA 1K96A 2KGRA 5ER5A 3IQQA 3O4YA 1IKUA 2MJWB 1FBVA 3EVRA 1J1DA 1A29A 3NSKA 1JF0A 4I5LB 3PM8A 1YX8A 1XFVO 4YBHB 1PALA 3D0YB 4CPVA 2JOJA 2WCFA 3BQ3A 1BODA 1QLKA 2M1KB 5D7FA 3CR2A 4BY5A 2LLUA 1MHOA 3NXAA 2BCBA 1ALWA 3TUYC 1DGVA 2ZKMX 1H8BA 2AAOA 1K8UA 1M45A 1DJXA 1QS7A 1FPWA 2DOQA 2PMYA 4FQOA 1UP5A 5PALA 2MBXA 3TDIA 2LMVA 3TS5B 2F2OA 2PVBA 1RK9A 1CFFA 3AKAA 4YGEB 5B8IB 1B1GA 1XVJA 3NSLA 2OTGC 4M2OA 1Q80A 1EJ3A 3EK4A 5CSIA 3ZNIA 2L51A 1ALVA 1LVCD 2NCPA 2BE4A 4XJKA 3CS1A 1BLQA 2ZNDA 1XYDA 1BU3A 2LM5A 1CMFA 2Q4UA 2LLTA 3ICBA 1IH0A 4I5NB 1LKJA 3JVTB 4WQ2A 3LK1A 1CDNA 5I2OA 1Y1AA 5IBWA 5HKZA 1JC2A 1J7RA 4C0KA 1FI5A 1TNXA 5J3XA 1HQVA 1TIZA 2JT3A 1JFKA 2KAVA 4N5XA 3PN7B 4JPZB 1SL9A 1DMOA 1TOPA 2KI4C 3SJSA 3DD4A 3CZTX 1JBAA 3BYAA 2K0JA 1R2UA 4QJ4B 3DVKA 1V1GA 4OCIA 1S6IA 3PATA 3IQOA 2O5GA 4HSZA 1YUSA 3SIAA 3JTDC 1K9UA 4ETOA 1YRTB 2BKIB 2M29A 1WY9A 1QIVA 1DT7B 2M49B 2JULA 2L50A 1BR4B 2H2KA 1ODBA 4WRIA 2EHBA 2CCMA 3CTNA 4PE7A 3TZ1A 4C0LA 1OMVA 2Q91A 1YUUA 2BL0C 2KBIA 1VRKA 2GGZA 1FW4A 2KGBC 3K21A 4GGFC 4ZCVA 3GOFA 4DRWA 4U8DA 4NDCA 4HRGA 1KSMA 1B8RA 5CPVA 3I5GC 3VROA 1QVIZ 1CLMA 3EKHA 3JTDB 2LLSA 2EGDA 4AQIA 2BBMA 5AFPA 1ZUZA 1TTXA 1UHJA 2LVKA 1SCMB 3M0WA 4PE0A 1KWOB 2LV7A 2LP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5X B;  1B7T Z;  1TRF A;  3WHT B;  2KI6 D;  2EC6 C;  1KCY A;  1KQM C;  2WND A;  2GGM A;  1RTP 1;  1PVB A;  1QAT A;  2JT0 A;  2KYF A;  2HET A;  3E3R A;  1QVI Y;  1Y1X A;  2Y1N A;  3I5G B;  2V53 A;  1F70 A;  4OVN F;  3KF9 A;  4GBA A;  2LP3 A;  3H4S E;  3PSR A;  1A03 A;  1FF1 A;  1K2H A;  3I5F C;  2QAC A;  4YRU A;  1REC A;  1B8C A;  3HCM A;  1BMO A;  1KFX S;  2JTZ A;  1IJ5 A;  2JPT A;  4CLN A;  1BOC A;  1QX7 A;  1WLM A;  2PAS A;  1UUR A;  3KPX A;  2M3W A;  2OS8 B;  2ISD A;  2MA2 A;  1B7T Y;  2NCO A;  4Q04 A;  2KNE A;  1ZAC A;  1M31 A;  1XK4 A;  2I94 A;  5DKQ A;  4DS7 A;  1YUR A;  2LC5 A;  1A75 B;  4GGN A;  4PAL A;  1K9P A;  4YI9 A;  1JWD A;  1BT6 A;  3TS5 C;  1BJF A;  2L4I A;  3EVU A;  1CKK A;  3EK7 A;  1EH2 A;  3I5F B;  2M7L A;  1B9A A;  1LA3 A;  1LA0 A;  2AUC A;  1KFX L;  2K7C A;  5AEQ A;  1OOJ A;  4OV2 A;  2KFF A;  2MHH A;  1MF8 B;  1NPQ A;  1TNW A;  1DJH A;  4N1G A;  4D1E A;  1SYM A;  1YX7 A;  1V1F A;  5HLV A;  2BKH B;  2ZN8 A;  2R2I A;  1N65 A;  2I7A A;  1K94 A;  1Y1U A;  1TCF A;  1F4Q A;  3JVT C;  1IJ6 A;  1WDC C;  3NSO A;  2IS9 A;  1UHI A;  3ZWH A;  1S6C A;  1RJV A;  1C07 A;  1NX0 A;  3AAK A;  3I5H C;  4PHN A;  1KQV A;  1DJW A;  1AJ4 A;  1MUX A;  1QJT A;  1TCO B;  2KSP A;  1CLL A;  3BUO B;  3FIA A;  4R1E A;  1IRJ A;  3DVM A;  2M9G A;  1LXF C;  3PN7 C;  3CWG A;  1J7Q A;  1FI6 A;  4GAO A;  1MR8 A;  2PSR A;  1AHR A;  4JQ0 D;  2K2F A;  4ZCU A;  1F54 A;  1F4O A;  4GPL B;  2BBN A;  2M7N A;  2A4J A;  1XA5 A;  2G9B A;  2CBL A;  1DJG A;  3GK4 X;  1WDC B;  2M0R A;  1CM4 A;  1S36 A;  4E68 A;  2CNP A;  3OHM B;  4NQG A;  2ZRT A;  2H61 A;  1ZFS A;  3I5I B;  2F2P A;  3I5H B;  4A4C A;  1K9K A;  1NCZ A;  4OKH A;  1GJY A;  1XO5 A;  5KSZ A;  1PSB A;  1J1E A;  1A75 A;  1NX2 A;  4N1F A;  4MZL A;  4TNC A;  1DVI A;  1SK6 D;  1W7I B;  3O78 A;  2P6B B;  1SPY A;  1OSA A;  1WLZ A;  1DF0 A;  2KAX A;  1XFU O;  2JRF A;  2LHL A;  1H4B A;  3PLF B;  4GNK B;  1B4C A;  2JXC A;  2K61 A;  1CFD A;  1PRW A;  1SCM C;  1M63 B;  1DJY A;  1KWO C;  2L2E A;  1BF5 A;  2HF5 A;  3BUM B;  1PUL A;  4CFQ A;  3PFV A;  2B1U A;  1C7W A;  2L4H A;  1GGW A;  2K8M B;  3A4U B;  3LK0 A;  2LVV A;  4USL A;  1JFJ A;  2TN4 A;  2Y5I A;  3NSI A;  1QTX A;  1XFY O;  1QX5 B;  1NCY A;  4DIR A;  1SL8 A;  2H61 C;  4HRE E;  2WCE A;  1E8A A;  4NDB A;  5JJG A;  1NSH A;  2WCB A;  1CNP A;  1SY9 A;  3SG7 A;  4YI8 A;  1K90 D;  2FOT A;  2OS8 C;  3BUN B;  3GK1 A;  2JZI A;  1AP4 A;  1PVA A;  1SR6 B;  1NX3 A;  2JWW A;  2I18 A;  2BCX A;  5CSN A;  4ORA B;  5HKY A;  4MBE A;  1GQM A;  1KK7 Z;  1QX2 A;  3TDZ A;  2Y1M A;  3RM1 A;  1CFC A;  4DCK A;  2FCE A;  1BR1 B;  2Y4Q A;  1A4P A;  1TNQ A;  3EVV A;  1QV0 A;  1G33 A;  1JF2 A;  1AVS A;  2JU0 A;  2PAL A;  3VRQ A;  1HT9 A;  1DJI A;  1MXL C;  4YGB B;  1CMG A;  5HYD A;  1F55 A;  1K93 D;  1IG5 A;  1RRO A;  3DF0 A;  1G4Y R;  2LCP A;  1OZS A;  3TDU A;  4BY4 A;  5BPJ A;  2LNK A;  1BG1 A;  1XFW O;  1KK7 Y;  3CR5 X;  4ICB A;  3D10 A;  4F0Z B;  1UWO A;  1DF0 B;  4MLW A;  3FWB A;  5F6T A;  1S6J A;  3VRR A;  1QAS A;  2F3Z A;  3CGA A;  1F71 A;  2M97 A;  3O6B A;  4C0J A;  5CSF A;  4L9M A;  2K7O A;  1S1E A;  2BCA A;  2OPO A;  1DTL A;  5I8N A;  4YGA A;  1CDP A;  1N2D A;  2JNF A;  3BOW A;  2COL B;  1GGZ A;  1M46 A;  2K7B A;  3OX5 A;  4FTG A;  4M2P A;  3SG3 A;  2BE6 A;  1CFP A;  1QLS A;  3OP0 A;  1DGU A;  2K2A A;  1SL7 A;  5CSJ A;  1C7V A;  2LAN A;  1R6P A;  1EL4 A;  1XFX O;  1JUO A;  1KK8 B;  1RFJ A;  3EKJ A;  2PRU A;  5G08 A;  1YTZ C;  1PSR A;  1AJ5 A;  1OMR A;  4NDD A;  1S3P A;  1U5I A;  3I5I C;  1S26 D;  1YUT A;  2JT8 A;  3LCP C;  1YVL A;  2JC2 A;  1NUB A;  1QV1 A;  3OB1 B;  3A8R A;  2L0P A;  1TNP A;  2KBM A;  2LMT A;  3KEV A;  1XK4 C;  1CDM A;  3RLZ A;  2ZN9 A;  2LVI A;  1N0Y A;  3BUW B;  4JWQ A;  2BEC A;  1WRZ A;  4GFT A;  3DVE A;  3OB2 B;  1D1O A;  1M39 A;  3LL8 B;  3SIB A;  1X02 A;  1NX1 A;  3BUX B;  3KO0 A;  2LVJ A;  3SG5 A;  1SBJ A;  1SW8 A;  3WHU B;  4MSP A;  4CFR A;  4I5J A;  1J55 A;  1B8L A;  5D69 A;  2CTN A;  1TN4 A;  2CT9 A;  2NLN A;  1MQ1 A;  5KTY A;  1KFU S;  3SG6 A;  1CTR A;  3IF7 A;  4PHJ A;  1CLB A;  2MLF C;  3WXA A;  1CB1 A;  1OMD A;  4GGF A;  3TUY B;  3DF0 B;  2ZNE A;  3AKB A;  2LHI A;  1DJZ A;  1YRU B;  2NZ0 A;  1AK8 A;  5JOL A;  4MRX A;  1EG3 A;  3AAJ A;  4MVF A;  1IWQ A;  3SG2 A;  1ZOT B;  1LIN A;  4A4B A;  2O60 A;  4AQJ A;  2JXL A;  4CID A;  3F45 A;  2LE9 B;  1AUI B;  1YR5 A;  3CLN A;  1SNL A;  1UHN A;  5ER4 X;  4PHM A;  1KFU L;  4PDZ A;  2OTG B;  1IQ3 A;  2ZRS A;  1F8H A;  2F8P A;  5I2L A;  4ORC B;  4HRH A;  4MEW A;  3BOW B;  2M8U A;  2F3Y A;  1UHH A;  3LLE A;  1SRA A;  1SR6 C;  1SCV A;  2KI6 C;  1YVH A;  1ZMZ A;  5AAN A;  1QXP A;  1EXR A;  2LUC A;  2WOR A;  2G2B A;  2CXJ A;  3BXK A;  1NCX A;  5K89 A;  2QPT A;  3VGO A;  3FS7 A;  2MRD A;  2E30 A;  2HQW A;  2LMU A;  4OR9 B;  2D8N A;  4P2Y B;  3SG4 A;  1L7Z A;  2SCP A;  2MAZ A;  5AER A;  3VRN A;  1U5I B;  2AMI A;  2KHN A;  4YGC B;  3D0Y A;  1QIW A;  4MZJ A;  4MN0 A;  4PHK A;  5HKW A;  1W7J B;  3PAL A;  1SKT A;  1MXE A;  2E6W A;  2HPS A;  2HQ8 A;  2KFH A;  2KI4 B;  1L2O C;  4PE4 A;  1SMG A;  4DUQ A;  1J7O A;  2JTT A;  2JQ6 A;  1Y6W A;  1OZO A;  3HX4 A;  2M1U A;  2LUX A;  1J7P A;  2F33 A;  1KSO A;  4QJ5 B;  4PE1 A;  5HLO A;  1B47 A;  5TNC A;  2NXQ A;  2KQ6 A;  2K7D A;  2WOS A;  2SAS A;  1RWY A;  1XFZ O;  1S5G Z;  1OE9 B;  1IGV A;  1EG4 A;  1UUS A;  4WQ3 A;  1UHK A;  5DKN A;  4XYN A;  4PCW A;  2ZFD A;  2BL0 B;  1L2O B;  4UPG A;  5KU1 A;  4XJK B;  1NIW A;  2L98 A;  5DKR A;  3C1V A;  4YGD B;  1NP8 A;  1G8I A;  2KFG A;  4M2Q A;  2KYC A;  2VRG A;  2RGI A;  3CR4 X;  1OQP A;  2KAY A;  2KDH A;  1NWD A;  4IL1 A;  4MRY A;  1KK8 C;  3EK8 A;  1K95 A;  5AXI A;  1MWN A;  3GK2 A;  1S5G Y;  2FCD A;  4GUK A;  1CM1 A;  1WRK A;  2LAP A;  3KHE A;  5GQQ C;  2I2R E;  3OX6 A;  1A2X A;  1PK0 D;  1WRL A;  2KQY A;  5FYX A;  2GV5 A;  4AOM A;  4I5K A;  2MLE C;  2FJU B;  3QRX A;  2KOT A;  1Y0V H;  3VRP A;  1JSA A;  3DVJ A;  1NYA A;  4QJ3 B;  3WNX B;  1CDL A;  1IQ5 A;  2EC6 B;  4ORB B;  2JNX A;  3MSE B;  1KQM B;  4P5O E;  2WC8 A;  3FWC A;  5I2Q A;  3O2P A;  4MZK A;  1K96 A;  2KGR A;  5ER5 A;  3IQQ A;  3O4Y A;  1IKU A;  2MJW B;  1FBV A;  3EVR A;  1J1D A;  1A29 A;  3NSK A;  1JF0 A;  4I5L B;  3PM8 A;  1YX8 A;  1XFV O;  4YBH B;  1PAL A;  3D0Y B;  4CPV A;  2JOJ A;  2WCF A;  3BQ3 A;  1BOD A;  1QLK A;  2M1K B;  5D7F A;  3CR2 A;  4BY5 A;  2LLU A;  1MHO A;  3NXA A;  2BCB A;  1ALW A;  3TUY C;  1DGV A;  2ZKM X;  1H8B A;  2AAO A;  1K8U A;  1M45 A;  1DJX A;  1QS7 A;  1FPW A;  2DOQ A;  2PMY A;  4FQO A;  1UP5 A;  5PAL A;  2MBX A;  3TDI A;  2LMV A;  3TS5 B;  2F2O A;  2PVB A;  1RK9 A;  1CFF A;  3AKA A;  4YGE B;  5B8I B;  1B1G A;  1XVJ A;  3NSL A;  2OTG C;  4M2O A;  1Q80 A;  1EJ3 A;  3EK4 A;  5CSI A;  3ZNI A;  2L51 A;  1ALV A;  1LVC D;  2NCP A;  2BE4 A;  4XJK A;  3CS1 A;  1BLQ A;  2ZND A;  1XYD A;  1BU3 A;  2LM5 A;  1CMF A;  2Q4U A;  2LLT A;  3ICB A;  1IH0 A;  4I5N B;  1LKJ A;  3JVT B;  4WQ2 A;  3LK1 A;  1CDN A;  5I2O A;  1Y1A A;  5IBW A;  5HKZ A;  1JC2 A;  1J7R A;  4C0K A;  1FI5 A;  1TNX A;  5J3X A;  1HQV A;  1TIZ A;  2JT3 A;  1JFK A;  2KAV A;  4N5X A;  3PN7 B;  4JPZ B;  1SL9 A;  1DMO A;  1TOP A;  2KI4 C;  3SJS A;  3DD4 A;  3CZT X;  1JBA A;  3BYA A;  2K0J A;  1R2U A;  4QJ4 B;  3DVK A;  1V1G A;  4OCI A;  1S6I A;  3PAT A;  3IQO A;  2O5G A;  4HSZ A;  1YUS A;  3SIA A;  3JTD C;  1K9U A;  4ETO A;  1YRT B;  2BKI B;  2M29 A;  1WY9 A;  1QIV A;  1DT7 B;  2M49 B;  2JUL A;  2L50 A;  1BR4 B;  2H2K A;  1ODB A;  4WRI A;  2EHB A;  2CCM A;  3CTN A;  4PE7 A;  3TZ1 A;  4C0L A;  1OMV A;  2Q91 A;  1YUU A;  2BL0 C;  2KBI A;  1VRK A;  2GGZ A;  1FW4 A;  2KGB C;  3K21 A;  4GGF C;  4ZCV A;  3GOF A;  4DRW A;  4U8D A;  4NDC A;  4HRG A;  1KSM A;  1B8R A;  5CPV A;  3I5G C;  3VRO A;  1QVI Z;  1CLM A;  3EKH A;  3JTD B;  2LLS A;  2EGD A;  4AQI A;  2BBM A;  5AFP A;  1ZUZ A;  1TTX A;  1UHJ A;  2LVK A;  1SCM B;  3M0W A;  4PE0 A;  1KWO B;  2LV7 A;  2LP2 A; 
#chains in the Genus database with same CATH topology
 2L5X B;  1B7T Z;  1TRF A;  2BNX A;  3WHT B;  2KI6 D;  2EC6 C;  4INX A;  1KCY A;  1KQM C;  2WND A;  2GGM A;  1RTP 1;  1PVB A;  1QAT A;  2JT0 A;  2KYF A;  3IVT A;  2HET A;  3E3R A;  3S0E A;  1QVI Y;  1Y1X A;  2Y1N A;  3I5G B;  2V53 A;  1F70 A;  2KLE A;  4OVN F;  1TWO A;  3FE6 A;  3KF9 A;  4GBA A;  2LP3 A;  3H4S E;  3PSR A;  1A03 A;  1FF1 A;  1K2H A;  3I5F C;  2QAC A;  4YRU A;  1REC A;  1B8C A;  3HCM A;  1BMO A;  1KFX S;  2JTZ A;  1IJ5 A;  2JPT A;  4CLN A;  1BOC A;  1QX7 A;  1WLM A;  2PAS A;  1UUR A;  3KPX A;  2M3W A;  2OS8 B;  2ISD A;  2MA2 A;  1B7T Y;  2NCO A;  4Q04 A;  2KNE A;  1ZAC A;  1M31 A;  2L5Y A;  1XK4 A;  2I94 A;  5DKQ A;  4DS7 A;  1YUR A;  2LC5 A;  1A75 B;  3FE9 A;  4GGN A;  4PAL A;  1LS8 A;  1K9P A;  4YI9 A;  1JWD A;  1BT6 A;  3TS5 C;  3D73 A;  2WCL A;  5FI6 A;  1BJF A;  3N7H A;  3BFB A;  1DEK A;  2L4I A;  3EVU A;  1CKK A;  3EK7 A;  1EH2 A;  3I5F B;  2M7L A;  1B9A A;  1LA3 A;  1LA0 A;  2AUC A;  3BJH A;  4JD9 A;  3UO9 A;  1KFX L;  2K7C A;  3K1E A;  5AEQ A;  1OOJ A;  1DEL A;  4OV2 A;  2KFF A;  2MHH A;  1MF8 B;  1NPQ A;  1TNW A;  1DJH A;  2YGU A;  4N1G A;  4D1E A;  1SYM A;  1YX7 A;  1V1F A;  5HLV A;  2BKH B;  1C3Z A;  2ZN8 A;  2R2I A;  1N65 A;  2WCM A;  2I7A A;  1K94 A;  1Y1U A;  3B88 A;  1TCF A;  1F4Q A;  3JVT C;  1IJ6 A;  1WDC C;  3NSO A;  2IS9 A;  1UHI A;  2WC6 A;  1S6C A;  3ZWH A;  1RJV A;  2QEV A;  1C07 A;  1NX0 A;  3AAK A;  3I5H C;  4PHN A;  1KQV A;  3D75 A;  1DJW A;  1AJ4 A;  1MUX A;  1QJT A;  1TCO B;  2KSP A;  1CLL A;  3BUO B;  3FIA A;  3OGN A;  4R1E A;  1IRJ A;  3DVM A;  2M9G A;  1LXF C;  3PN7 C;  3CWG A;  1J7Q A;  1FI6 A;  4GAO A;  1MR8 A;  2PSR A;  1AHR A;  4JQ0 D;  2K2F A;  4ZCU A;  1F54 A;  1F4O A;  4GPL B;  2BBN A;  2M7N A;  2A4J A;  1XA5 A;  2G9B A;  3L4A A;  2CBL A;  1DJG A;  3GK4 X;  1WDC B;  2M0R A;  1CM4 A;  1S36 A;  4E68 A;  2CNP A;  3OHM B;  4NQG A;  2ZRT A;  2H61 A;  1ZFS A;  3I5I B;  2F2P A;  3I5H B;  4A4C A;  1K9K A;  1NCZ A;  4OKH A;  2P71 A;  1GJY A;  1XO5 A;  3DYE A;  5KSZ A;  1DC1 A;  1PSB A;  3S0D A;  1J1E A;  1A75 A;  1NX2 A;  4N1F A;  1Z4H A;  4MZL A;  4TNC A;  5EL2 A;  1DVI A;  1OOF A;  5DIC A;  1SK6 D;  1W7I B;  3O78 A;  2P6B B;  1SPY A;  1OSA A;  1WLZ A;  1DF0 A;  2KAX A;  1XFU O;  2JRF A;  2LHL A;  1H4B A;  3PLF B;  4GNK B;  1B4C A;  2JXC A;  2K61 A;  1CFD A;  1PRW A;  1SCM C;  1M63 B;  1DJY A;  1KWO C;  2L2E A;  1BF5 A;  2HF5 A;  3BUM B;  1PUL A;  4CFQ A;  3PFV A;  2B1U A;  1C7W A;  2L4H A;  1GGW A;  2K8M B;  3A4U B;  1OW4 A;  3LK0 A;  2QEH A;  3B86 A;  2LVV A;  1C3Y A;  4USL A;  1JFJ A;  2TN4 A;  2Y5I A;  3NSI A;  1QTX A;  1XFY O;  1QX5 B;  1NCY A;  1GM0 A;  4DIR A;  1SL8 A;  2H61 C;  1TUJ A;  4HRE E;  2WCE A;  1E8A A;  4NDB A;  5JJG A;  1NSH A;  2WCB A;  3SG3 A;  1CNP A;  1SY9 A;  2WC5 A;  3SG7 A;  4YI8 A;  1K90 D;  2FOT A;  2OS8 C;  3BUN B;  2GTE A;  3GK1 A;  2JZI A;  1AP4 A;  1PVA A;  3PM2 A;  1SR6 B;  1NX3 A;  2JWW A;  2I18 A;  2BCX A;  5CSN A;  4ORA B;  5HKY A;  4MBE A;  1GQM A;  1KK7 Z;  1QX2 A;  3TDZ A;  2Y1M A;  3RM1 A;  1CFC A;  3CAB A;  4DCK A;  2FCE A;  1BR1 B;  2Y4Q A;  1A4P A;  1TNQ A;  3EVV A;  1QV0 A;  1G33 A;  1JF2 A;  1AVS A;  2JU0 A;  2PAL A;  3VRQ A;  1HT9 A;  1DJI A;  1MXL C;  4YGB B;  1CMG A;  5HYD A;  1F55 A;  1K93 D;  3S0A A;  1IG5 A;  1RRO A;  3DF0 A;  2K60 A;  1G4Y R;  2LCP A;  1OZS A;  3TDU A;  4BY4 A;  5BPJ A;  2LNK A;  2QEO A;  1XFW O;  1KK7 Y;  3CR5 X;  4ICB A;  3D10 A;  3NGV A;  1BG1 A;  4F0Z B;  1UWO A;  1DF0 B;  3NHT A;  4MLW A;  3FWB A;  5F6T A;  1S6J A;  3VRR A;  3S0F A;  3BFA A;  1QAS A;  3CDN A;  2F3Z A;  3CGA A;  1F71 A;  2M97 A;  3O6B A;  4C0J A;  2KLD A;  5CSF A;  4L9M A;  2K7O A;  5I94 A;  1S1E A;  2PYQ A;  2BCA A;  2OPO A;  1DTL A;  3DZT A;  3PJI A;  5I8N A;  4YGA A;  1CDP A;  1N2D A;  2JNF A;  2FJY A;  2COL B;  1GGZ A;  1M46 A;  2K7B A;  3BOW A;  3OX5 A;  4FTG A;  2KPH A;  2BE6 A;  4M2P A;  1CFP A;  1QLS A;  3OP0 A;  1DGU A;  2K2A A;  4IJ7 A;  1SL7 A;  5CSJ A;  1C7V A;  2LAN A;  4F7F A;  1R6P A;  1EL4 A;  1XFX O;  1JUO A;  1KK8 B;  1RFJ A;  3EKJ A;  2PRU A;  5G08 A;  1YTZ C;  1PSR A;  1AJ5 A;  1OMR A;  4NDD A;  3R1O A;  1S3P A;  1U5I A;  2BAP A;  3I5I C;  1S26 D;  1YUT A;  2JT8 A;  3LCP C;  2QDI A;  1YVL A;  3NHI A;  2JC2 A;  1NUB A;  1QV1 A;  3OB1 B;  3A8R A;  2L0P A;  1TNP A;  2KBM A;  2LMT A;  3KEV A;  1XK4 C;  1CDM A;  3RLZ A;  2ZN9 A;  2LVI A;  1N0Y A;  3BUW B;  4JWQ A;  3S0G A;  2BEC A;  1WRZ A;  4GFT A;  3DVE A;  3OB2 B;  1D1O A;  1XFR A;  1M39 A;  3LL8 B;  3Q8I A;  3SIB A;  1X02 A;  1NX1 A;  3BUX B;  5FI2 A;  3KO0 A;  2LVJ A;  3SG5 A;  1SBJ A;  1SW8 A;  3WHU B;  4MSP A;  4CFR A;  4I5J A;  1J55 A;  1B8L A;  5D69 A;  2CTN A;  1TN4 A;  2CT9 A;  2NLN A;  3D76 A;  1MQ1 A;  5KTY A;  1KFU S;  3SG6 A;  4JKT A;  1CTR A;  3IF7 A;  4PHJ A;  1CLB A;  2MLF C;  3WXA A;  1CB1 A;  1OMD A;  4INW A;  3CZ0 A;  4GGF A;  3TUY B;  3DF0 B;  3RZS A;  2ZNE A;  3AKB A;  3B87 A;  2LHI A;  1DJZ A;  1YRU B;  2NZ0 A;  1AK8 A;  5JOL A;  4MRX A;  1EG3 A;  2PQL A;  1OOI X;  3AAJ A;  4MVF A;  1IWQ A;  3SG2 A;  1ZOT B;  1LIN A;  1OOH A;  4A4B A;  2O60 A;  4AQJ A;  2JXL A;  4CID A;  3F45 A;  2LE9 B;  1AUI B;  1YR5 A;  3CLN A;  1SNL A;  1UHN A;  5ER4 X;  4PHM A;  3D78 A;  1KFU L;  4PDZ A;  2OTG B;  1IQ3 A;  2ZRS A;  2L2C A;  1F8H A;  2F8P A;  5I2L A;  4ORC B;  4HRH A;  4MEW A;  3BOW B;  2M8U A;  2F3Y A;  1UHH A;  3V2L A;  3LLE A;  1SRA A;  1SR6 C;  1SCV A;  2KI6 C;  1YVH A;  1ZMZ A;  5AAN A;  1QXP A;  1EXR A;  2LUC A;  2WOR A;  2G2B A;  2CXJ A;  3BXK A;  1NCX A;  5K89 A;  2QPT A;  3VGO A;  2JPO A;  3FS7 A;  2MRD A;  2E30 A;  2HQW A;  2LMU A;  4OR9 B;  2D8N A;  4P2Y B;  3SG4 A;  1L7Z A;  2SCP A;  2MAZ A;  5FI7 A;  5AER A;  3SS5 A;  1U5I B;  2AMI A;  3VRN A;  2KHN A;  4YGC B;  3D0Y A;  1QIW A;  4MZJ A;  4MN0 A;  4PHK A;  5HKW A;  1W7J B;  3PAL A;  1SKT A;  1T14 A;  1MXE A;  2E6W A;  2HPS A;  2HQ8 A;  2KFH A;  2KI4 B;  1L2O C;  4PE4 A;  1SMG A;  4DUQ A;  1J7O A;  2JTT A;  2JQ6 A;  3S0B A;  1Y6W A;  1OZO A;  3HX4 A;  2M1U A;  2LUX A;  1J7P A;  3SS4 A;  2F33 A;  1KSO A;  4QJ5 B;  3VB1 A;  2WCK A;  4PE1 A;  5HLO A;  1B47 A;  5TNC A;  2NXQ A;  2KQ6 A;  2K7D A;  2WOS A;  2SAS A;  1RWY A;  1XFZ O;  1S5G Z;  1OE9 B;  1IGV A;  1EG4 A;  1UUS A;  4WQ3 A;  1UHK A;  5DKN A;  4XYN A;  4PCW A;  2ZFD A;  2BL0 B;  3OBV A;  1L2O B;  4UPG A;  5KU1 A;  4XJK B;  1NIW A;  2L98 A;  5DKR A;  3C1V A;  4YGD B;  1NP8 A;  1G8I A;  2KFG A;  4M2Q A;  2KYC A;  2VRG A;  2RGI A;  3CR4 X;  1OQP A;  1SSE B;  2KDH A;  1NWD A;  2KAY A;  4IL1 A;  4MRY A;  1KK8 C;  3EK8 A;  1K95 A;  1TUZ A;  3B6X A;  2ERB A;  1QWV A;  5AXI A;  1MWN A;  1ORG A;  3GK2 A;  1S5G Y;  2FCD A;  3B7A A;  1CM1 A;  1WRK A;  2LAP A;  3KHE A;  2WCJ A;  2I2R E;  4GUK A;  5GQQ C;  3OX6 A;  1A2X A;  1PK0 D;  1WRL A;  2KQY A;  5FYX A;  2GV5 A;  4AOM A;  2QEB A;  4I5K A;  2MLE C;  2FJU B;  3QRX A;  2KOT A;  1Y0V H;  3VRP A;  1JSA A;  3DVJ A;  1NYA A;  4QJ3 B;  3WNX B;  1CDL A;  3SS3 A;  1IQ5 A;  2EC6 B;  4ORB B;  2JNX A;  3MSE B;  1KQM B;  4P5O E;  2WC8 A;  3FWC A;  5I2Q A;  3O2P A;  4MZK A;  3DY9 A;  1P28 A;  1K96 A;  2KGR A;  5ER5 A;  3IQQ A;  3O4Y A;  1IKU A;  2MJW B;  1FBV A;  3BFH A;  3EVR A;  1J1D A;  1A29 A;  3NSK A;  3DXL A;  3FE8 A;  3O4X A;  1JF0 A;  4I5L B;  3PM8 A;  1YX8 A;  1XFV O;  4YBH B;  1PAL A;  3D0Y B;  4CPV A;  2JOJ A;  2WCF A;  3BQ3 A;  1BOD A;  1IIO A;  1QLK A;  2M1K B;  3CYZ A;  5D7F A;  3CR2 A;  4BY5 A;  2LLU A;  1MHO A;  3NXA A;  2BCB A;  1ALW A;  3TUY C;  1DGV A;  2ZKM X;  1H8B A;  2AAO A;  1K8U A;  1M45 A;  1DJX A;  1QS7 A;  1FPW A;  2DOQ A;  2PMY A;  4FQO A;  1UP5 A;  5PAL A;  2MBX A;  3TDI A;  2LMV A;  3TS5 B;  1W9Z A;  3L4L A;  2F2O A;  2PVB A;  1DQE A;  1RK9 A;  1CFF A;  3AKA A;  3CZ2 A;  3L47 A;  4YGE B;  5B8I B;  1B1G A;  5D3O A;  1XVJ A;  3NSL A;  2OTG C;  4M2O A;  1Q80 A;  1EJ3 A;  3EK4 A;  5CSI A;  3ZNI A;  2L51 A;  1ALV A;  1LVC D;  2NCP A;  4OZD A;  2BE4 A;  3CZ1 A;  4XJK A;  3CS1 A;  1BLQ A;  2ZND A;  1XYD A;  1BU3 A;  2LM5 A;  1CMF A;  3EG5 B;  2Q4U A;  2LLT A;  3ICB A;  1IH0 A;  4I5N B;  1LKJ A;  3JVT B;  4WQ2 A;  3LK1 A;  1CDN A;  4FQT A;  1Y1A A;  5I2O A;  5IBW A;  5HKZ A;  1JC2 A;  1J7R A;  4C0K A;  1FI5 A;  1TNX A;  5J3X A;  1HQV A;  1TIZ A;  2JT3 A;  1JFK A;  2KAV A;  4N5X A;  3PN7 B;  4JPZ B;  1SL9 A;  5HL1 A;  1DMO A;  1TOP A;  2KI4 C;  3SJS A;  3DD4 A;  3CZT X;  1JBA A;  3R72 A;  3BYA A;  2K0J A;  2WCH A;  1R2U A;  4QJ4 B;  3DVK A;  1V1G A;  4OCI A;  1S6I A;  3PAT A;  3IQO A;  2O5G A;  4HSZ A;  1YUS A;  3SIA A;  3JTD C;  1K9U A;  4ETO A;  1OOG A;  1YRT B;  2BKI B;  2M29 A;  1WY9 A;  3R1V A;  1QIV A;  3D74 A;  1DT7 B;  2M49 B;  2JUL A;  3UNW A;  2L50 A;  1BR4 B;  2H2K A;  1ODB A;  4WRI A;  2EHB A;  2CCM A;  3CTN A;  4PE7 A;  3TZ1 A;  4C0L A;  1OMV A;  2Q91 A;  1YUU A;  2BL0 C;  2KBI A;  1VRK A;  2GGZ A;  1FW4 A;  2KGB C;  3K21 A;  4GGF C;  4ZCV A;  3R1P A;  3QME A;  3GOF A;  4DRW A;  4U8D A;  4NDC A;  2H8V A;  4HRG A;  4KYN A;  1KSM A;  1B8R A;  5CPV A;  3I5G C;  3VRO A;  1QVI Z;  1CLM A;  3EKH A;  3JTD B;  2LLS A;  2EGD A;  4AQI A;  2BBM A;  4PT1 A;  5AFP A;  2P70 A;  1ZUZ A;  1TTX A;  1UHJ A;  1Z2C B;  1SCM B;  2LVK A;  3M0W A;  4PE0 A;  1KWO B;  2LV7 A;  3D77 A;  2LP2 A; 
#chains in the Genus database with same CATH homology
 2L5X B;  1B7T Z;  1TRF A;  3WHT B;  2KI6 D;  2EC6 C;  1KCY A;  1KQM C;  2WND A;  2GGM A;  1RTP 1;  1PVB A;  1QAT A;  2JT0 A;  2KYF A;  2HET A;  3E3R A;  1QVI Y;  1Y1X A;  2Y1N A;  3I5G B;  2V53 A;  1F70 A;  4OVN F;  3KF9 A;  4GBA A;  2LP3 A;  3H4S E;  3PSR A;  1A03 A;  1FF1 A;  1K2H A;  3I5F C;  2QAC A;  4YRU A;  1REC A;  1B8C A;  3HCM A;  1BMO A;  1KFX S;  2JTZ A;  1IJ5 A;  2JPT A;  4CLN A;  1BOC A;  1QX7 A;  1WLM A;  2PAS A;  1UUR A;  3KPX A;  2M3W A;  2OS8 B;  2ISD A;  2MA2 A;  1B7T Y;  2NCO A;  4Q04 A;  2KNE A;  1ZAC A;  1M31 A;  1XK4 A;  2I94 A;  5DKQ A;  4DS7 A;  1YUR A;  2LC5 A;  1A75 B;  4GGN A;  4PAL A;  1K9P A;  4YI9 A;  1JWD A;  1BT6 A;  3TS5 C;  1BJF A;  2L4I A;  3EVU A;  1CKK A;  3EK7 A;  1EH2 A;  3I5F B;  2M7L A;  1B9A A;  1LA3 A;  1LA0 A;  2AUC A;  1KFX L;  2K7C A;  5AEQ A;  1OOJ A;  4OV2 A;  2KFF A;  2MHH A;  1MF8 B;  1NPQ A;  1TNW A;  1DJH A;  4N1G A;  4D1E A;  1SYM A;  1YX7 A;  1V1F A;  5HLV A;  2BKH B;  2ZN8 A;  2R2I A;  1N65 A;  2I7A A;  1K94 A;  1Y1U A;  1TCF A;  1F4Q A;  3JVT C;  1IJ6 A;  1WDC C;  3NSO A;  2IS9 A;  1UHI A;  3ZWH A;  1S6C A;  1RJV A;  1C07 A;  1NX0 A;  3AAK A;  3I5H C;  4PHN A;  1KQV A;  1DJW A;  1AJ4 A;  1MUX A;  1QJT A;  1TCO B;  2KSP A;  1CLL A;  3BUO B;  3FIA A;  4R1E A;  1IRJ A;  3DVM A;  2M9G A;  1LXF C;  3PN7 C;  3CWG A;  1J7Q A;  1FI6 A;  4GAO A;  1MR8 A;  2PSR A;  1AHR A;  4JQ0 D;  2K2F A;  4ZCU A;  1F54 A;  1F4O A;  4GPL B;  2BBN A;  2M7N A;  2A4J A;  1XA5 A;  2G9B A;  2CBL A;  1DJG A;  3GK4 X;  1WDC B;  2M0R A;  1CM4 A;  1S36 A;  4E68 A;  2CNP A;  3OHM B;  4NQG A;  2ZRT A;  2H61 A;  1ZFS A;  3I5I B;  2F2P A;  3I5H B;  4A4C A;  1K9K A;  1NCZ A;  4OKH A;  1GJY A;  1XO5 A;  5KSZ A;  1PSB A;  1J1E A;  1A75 A;  1NX2 A;  4N1F A;  4MZL A;  4TNC A;  1DVI A;  1SK6 D;  1W7I B;  3O78 A;  2P6B B;  1SPY A;  1OSA A;  1WLZ A;  1DF0 A;  2KAX A;  1XFU O;  2JRF A;  2LHL A;  1H4B A;  3PLF B;  4GNK B;  1B4C A;  2JXC A;  2K61 A;  1CFD A;  1PRW A;  1SCM C;  1M63 B;  1DJY A;  1KWO C;  2L2E A;  1BF5 A;  2HF5 A;  3BUM B;  1PUL A;  4CFQ A;  3PFV A;  2B1U A;  1C7W A;  2L4H A;  1GGW A;  2K8M B;  3A4U B;  3LK0 A;  2LVV A;  4USL A;  1JFJ A;  2TN4 A;  2Y5I A;  3NSI A;  1QTX A;  1XFY O;  1QX5 B;  1NCY A;  4DIR A;  1SL8 A;  2H61 C;  4HRE E;  2WCE A;  1E8A A;  4NDB A;  5JJG A;  1NSH A;  2WCB A;  1CNP A;  1SY9 A;  3SG7 A;  4YI8 A;  1K90 D;  2FOT A;  2OS8 C;  3BUN B;  3GK1 A;  2JZI A;  1AP4 A;  1PVA A;  1SR6 B;  1NX3 A;  2JWW A;  2I18 A;  2BCX A;  5CSN A;  4ORA B;  5HKY A;  4MBE A;  1GQM A;  1KK7 Z;  1QX2 A;  3TDZ A;  2Y1M A;  3RM1 A;  1CFC A;  4DCK A;  2FCE A;  1BR1 B;  2Y4Q A;  1A4P A;  1TNQ A;  3EVV A;  1QV0 A;  1G33 A;  1JF2 A;  1AVS A;  2JU0 A;  2PAL A;  3VRQ A;  1HT9 A;  1DJI A;  1MXL C;  4YGB B;  1CMG A;  5HYD A;  1F55 A;  1K93 D;  1IG5 A;  1RRO A;  3DF0 A;  1G4Y R;  2LCP A;  1OZS A;  3TDU A;  4BY4 A;  5BPJ A;  2LNK A;  1BG1 A;  1XFW O;  1KK7 Y;  3CR5 X;  4ICB A;  3D10 A;  4F0Z B;  1UWO A;  1DF0 B;  4MLW A;  3FWB A;  5F6T A;  1S6J A;  3VRR A;  1QAS A;  2F3Z A;  3CGA A;  1F71 A;  2M97 A;  3O6B A;  4C0J A;  5CSF A;  4L9M A;  2K7O A;  1S1E A;  2BCA A;  2OPO A;  1DTL A;  5I8N A;  4YGA A;  1CDP A;  1N2D A;  2JNF A;  3BOW A;  2COL B;  1GGZ A;  1M46 A;  2K7B A;  3OX5 A;  4FTG A;  4M2P A;  3SG3 A;  2BE6 A;  1CFP A;  1QLS A;  3OP0 A;  1DGU A;  2K2A A;  1SL7 A;  5CSJ A;  1C7V A;  2LAN A;  1R6P A;  1EL4 A;  1XFX O;  1JUO A;  1KK8 B;  1RFJ A;  3EKJ A;  2PRU A;  5G08 A;  1YTZ C;  1PSR A;  1AJ5 A;  1OMR A;  4NDD A;  1S3P A;  1U5I A;  3I5I C;  1S26 D;  1YUT A;  2JT8 A;  3LCP C;  1YVL A;  2JC2 A;  1NUB A;  1QV1 A;  3OB1 B;  3A8R A;  2L0P A;  1TNP A;  2KBM A;  2LMT A;  3KEV A;  1XK4 C;  1CDM A;  3RLZ A;  2ZN9 A;  2LVI A;  1N0Y A;  3BUW B;  4JWQ A;  2BEC A;  1WRZ A;  4GFT A;  3DVE A;  3OB2 B;  1D1O A;  1M39 A;  3LL8 B;  3SIB A;  1X02 A;  1NX1 A;  3BUX B;  3KO0 A;  2LVJ A;  3SG5 A;  1SBJ A;  1SW8 A;  3WHU B;  4MSP A;  4CFR A;  4I5J A;  1J55 A;  1B8L A;  5D69 A;  2CTN A;  1TN4 A;  2CT9 A;  2NLN A;  1MQ1 A;  5KTY A;  1KFU S;  3SG6 A;  1CTR A;  3IF7 A;  4PHJ A;  1CLB A;  2MLF C;  3WXA A;  1CB1 A;  1OMD A;  4GGF A;  3TUY B;  3DF0 B;  2ZNE A;  3AKB A;  2LHI A;  1DJZ A;  1YRU B;  2NZ0 A;  1AK8 A;  5JOL A;  4MRX A;  1EG3 A;  3AAJ A;  4MVF A;  1IWQ A;  3SG2 A;  1ZOT B;  1LIN A;  4A4B A;  2O60 A;  4AQJ A;  2JXL A;  4CID A;  3F45 A;  2LE9 B;  1AUI B;  1YR5 A;  3CLN A;  1SNL A;  1UHN A;  5ER4 X;  4PHM A;  1KFU L;  4PDZ A;  2OTG B;  1IQ3 A;  2ZRS A;  1F8H A;  2F8P A;  5I2L A;  4ORC B;  4HRH A;  4MEW A;  3BOW B;  2M8U A;  2F3Y A;  1UHH A;  3LLE A;  1SRA A;  1SR6 C;  1SCV A;  2KI6 C;  1YVH A;  1ZMZ A;  5AAN A;  1QXP A;  1EXR A;  2LUC A;  2WOR A;  2G2B A;  2CXJ A;  3BXK A;  1NCX A;  5K89 A;  2QPT A;  3VGO A;  3FS7 A;  2MRD A;  2E30 A;  2HQW A;  2LMU A;  4OR9 B;  2D8N A;  4P2Y B;  3SG4 A;  1L7Z A;  2SCP A;  2MAZ A;  5AER A;  3VRN A;  1U5I B;  2AMI A;  2KHN A;  4YGC B;  3D0Y A;  1QIW A;  4MZJ A;  4MN0 A;  4PHK A;  5HKW A;  1W7J B;  3PAL A;  1SKT A;  1MXE A;  2E6W A;  2HPS A;  2HQ8 A;  2KFH A;  2KI4 B;  1L2O C;  4PE4 A;  1SMG A;  4DUQ A;  1J7O A;  2JTT A;  2JQ6 A;  1Y6W A;  1OZO A;  3HX4 A;  2M1U A;  2LUX A;  1J7P A;  2F33 A;  1KSO A;  4QJ5 B;  4PE1 A;  5HLO A;  1B47 A;  5TNC A;  2NXQ A;  2KQ6 A;  2K7D A;  2WOS A;  2SAS A;  1RWY A;  1XFZ O;  1S5G Z;  1OE9 B;  1IGV A;  1EG4 A;  1UUS A;  4WQ3 A;  1UHK A;  5DKN A;  4XYN A;  4PCW A;  2ZFD A;  2BL0 B;  1L2O B;  4UPG A;  5KU1 A;  4XJK B;  1NIW A;  2L98 A;  5DKR A;  3C1V A;  4YGD B;  1NP8 A;  1G8I A;  2KFG A;  4M2Q A;  2KYC A;  2VRG A;  2RGI A;  3CR4 X;  1OQP A;  2KAY A;  2KDH A;  1NWD A;  4IL1 A;  4MRY A;  1KK8 C;  3EK8 A;  1K95 A;  5AXI A;  1MWN A;  3GK2 A;  1S5G Y;  2FCD A;  4GUK A;  1CM1 A;  1WRK A;  2LAP A;  3KHE A;  5GQQ C;  2I2R E;  3OX6 A;  1A2X A;  1PK0 D;  1WRL A;  2KQY A;  5FYX A;  2GV5 A;  4AOM A;  4I5K A;  2MLE C;  2FJU B;  3QRX A;  2KOT A;  1Y0V H;  3VRP A;  1JSA A;  3DVJ A;  1NYA A;  4QJ3 B;  3WNX B;  1CDL A;  1IQ5 A;  2EC6 B;  4ORB B;  2JNX A;  3MSE B;  1KQM B;  4P5O E;  2WC8 A;  3FWC A;  5I2Q A;  3O2P A;  4MZK A;  1K96 A;  2KGR A;  5ER5 A;  3IQQ A;  3O4Y A;  1IKU A;  2MJW B;  1FBV A;  3EVR A;  1J1D A;  1A29 A;  3NSK A;  1JF0 A;  4I5L B;  3PM8 A;  1YX8 A;  1XFV O;  4YBH B;  1PAL A;  3D0Y B;  4CPV A;  2JOJ A;  2WCF A;  3BQ3 A;  1BOD A;  1QLK A;  2M1K B;  5D7F A;  3CR2 A;  4BY5 A;  2LLU A;  1MHO A;  3NXA A;  2BCB A;  1ALW A;  3TUY C;  1DGV A;  2ZKM X;  1H8B A;  2AAO A;  1K8U A;  1M45 A;  1DJX A;  1QS7 A;  1FPW A;  2DOQ A;  2PMY A;  4FQO A;  1UP5 A;  5PAL A;  2MBX A;  3TDI A;  2LMV A;  3TS5 B;  2F2O A;  2PVB A;  1RK9 A;  1CFF A;  3AKA A;  4YGE B;  5B8I B;  1B1G A;  1XVJ A;  3NSL A;  2OTG C;  4M2O A;  1Q80 A;  1EJ3 A;  3EK4 A;  5CSI A;  3ZNI A;  2L51 A;  1ALV A;  1LVC D;  2NCP A;  2BE4 A;  4XJK A;  3CS1 A;  1BLQ A;  2ZND A;  1XYD A;  1BU3 A;  2LM5 A;  1CMF A;  2Q4U A;  2LLT A;  3ICB A;  1IH0 A;  4I5N B;  1LKJ A;  3JVT B;  4WQ2 A;  3LK1 A;  1CDN A;  5I2O A;  1Y1A A;  5IBW A;  5HKZ A;  1JC2 A;  1J7R A;  4C0K A;  1FI5 A;  1TNX A;  5J3X A;  1HQV A;  1TIZ A;  2JT3 A;  1JFK A;  2KAV A;  4N5X A;  3PN7 B;  4JPZ B;  1SL9 A;  1DMO A;  1TOP A;  2KI4 C;  3SJS A;  3DD4 A;  3CZT X;  1JBA A;  3BYA A;  2K0J A;  1R2U A;  4QJ4 B;  3DVK A;  1V1G A;  4OCI A;  1S6I A;  3PAT A;  3IQO A;  2O5G A;  4HSZ A;  1YUS A;  3SIA A;  3JTD C;  1K9U A;  4ETO A;  1YRT B;  2BKI B;  2M29 A;  1WY9 A;  1QIV A;  1DT7 B;  2M49 B;  2JUL A;  2L50 A;  1BR4 B;  2H2K A;  1ODB A;  4WRI A;  2EHB A;  2CCM A;  3CTN A;  4PE7 A;  3TZ1 A;  4C0L A;  1OMV A;  2Q91 A;  1YUU A;  2BL0 C;  2KBI A;  1VRK A;  2GGZ A;  1FW4 A;  2KGB C;  3K21 A;  4GGF C;  4ZCV A;  3GOF A;  4DRW A;  4U8D A;  4NDC A;  4HRG A;  1KSM A;  1B8R A;  5CPV A;  3I5G C;  3VRO A;  1QVI Z;  1CLM A;  3EKH A;  3JTD B;  2LLS A;  2EGD A;  4AQI A;  2BBM A;  5AFP A;  1ZUZ A;  1TTX A;  1UHJ A;  2LVK A;  1SCM B;  3M0W A;  4PE0 A;  1KWO B;  2LV7 A;  2LP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...