1SR6C

Structure of nucleotide-free scallop myosin s1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated muscle
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
molecule tags Contractile protein
total genus 39
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sr6C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sr6C02
3M0WA 3DVEA 1K9KA 1JFJA 3PALA 4OR9B 1ZACA 1XK4A 2JXLA 1KSMA 1B7TY 1SKTA 1XK4C 2K7BA 1OMDA 2MA2A 3ZWHA 2LMUA 2JTZA 2JT3A 2EHBA 2JNXA 1ZFSA 4MBEA 2LP3A 2Q91A 3NXAA 4GGFA 1BF5A 5HLOA 4DIRA 2DOQA 2LUCA 2K7OA 3E3RA 4C0JA 4UPGA 4BY4A 2CTNA 4XJKB 1UP5A 3TDZA 1XYDA 2H61A 2F2PA 4QJ4B 1OQPA 2E6WA 4AOMA 2H61C 3LCPC 3PATA 1DJXA 3BUNB 2JULA 1F70A 2CCMA 4GGNA 5GQQC 4DRWA 3KEVA 1NCZA 2LMVA 3BUOB 1A75B 3BUWB 3IF7A 1E8AA 4F0ZB 1AHRA 3WHUB 1F4QA 2LAPA 1EG4A 2JNFA 3SIBA 2BBMA 3VRNA 2ZNEA 4GBAA 5CPVA 2O60A 1K96A 4PALA 4HRHA 2LP2A 3DVMA 1AK8A 1F55A 1QASA 1DJGA 2M0RA 4NDDA 3NSLA 1U5IA 4MRXA 4N1GA 3ZNIA 1OMVA 2L5XB 2CT9A 1SNLA 1SMGA 2JC2A 1Y0VH 2KBMA 3K21A 3AKBA 1X02A 3SG2A 4CPVA 5HLVA 3A4UB 5I2LA 1K8UA 1IJ6A 1TOPA 2F3ZA 2LNKA 3PFVA 1BU3A 1TTXA 4D1EA 3GK4X 1BT6A 1DJHA 1DF0B 1LA3A 2IS9A 2OPOA 3BQ3A 1NCYA 1NSHA 3EKJA 3SG6A 1GGZA 3TZ1A 1FI5A 2M49B 3TS5B 1TNXA 2NCPA 1DT7B 4AQIA 1Y1UA 1NIWA 2JOJA 2L0PA 1UWOA 2PALA 4FTGA 3JTDB 1SW8A 1SL9A 2L4HA 2KI6C 1XFUO 3DVJA 1XA5A 4DS7A 1YX7A 2LLTA 1LA0A 1RK9A 1RECA 2KFHA 1WRKA 1MUXA 4YGEB 1EJ3A 5I8NA 1B8LA 3TUYB 1A2XA 1N2DA 1XFZO 2JT8A 5G08A 1IGVA 4PHMA 1JF0A 3KF9A 3AAKA 2PSRA 4NDCA 1GQMA 1SCMB 1BJFA 3DF0B 4WQ2A 5AEQA 4GFTA 2GGMA 2WOSA 1SBJA 2K61A 1WLMA 5HKWA 2BKIB 1NPQA 3HCMA 1WLZA 3GK1A 3CR5X 2BECA 4CFQA 2L2EA 1QLSA 3BXKA 3I5GC 2LVKA 3PLFB 4P2YB 2L50A 3NSKA 3QRXA 1TCOB 1K90D 2LC5A 4FQOA 4I5LB 2LV7A 5TNCA 1YVHA 1KFUL 5DKQA 1ZUZA 1K94A 1RJVA 3ICBA 4DUQA 3CZTX 2HQWA 2VRGA 2KAYA 4C0LA 2KFGA 1NWDA 3BOWA 3CR2A 4CIDA 4M2PA 4M2QA 1KK8B 2I18A 2LVJA 1DJIA 5AXIA 1EL4A 1KQMC 4QJ5B 3PN7C 4ORAB 4PCWA 1L7ZA 1YUSA 2ZKMX 4YGDB 1PRWA 2HETA 3EK4A 1ALVA 2H2KA 3OX6A 3MSEB 2QACA 1SR6C 1ODBA 1M46A 3JVTB 1IRJA 1IJ5A 1XO5A 1G8IA 2WCFA 1KFUS 2G2BA 1CTRA 2KI4B 3AAJA 4NQGA 1BMOA 3EVRA 5DKRA 3SG3A 1V1FA 4P5OE 5PALA 2PMYA 1UHJA 2G9BA 3BUMB 3I5IC 1QIWA 1CDLA 1UHNA 1EH2A 1SL8A 1MF8B 2Q4UA 1K95A 3OX5A 4YRUA 1AP4A 4PE4A 1B8CA 4GGFC 3A8RA 2Y4QA 4MLWA 2BL0C 1WDCB 2FCDA 3O78A 2BCBA 1KSOA 2BCXA 2K2AA 4GAOA 3SG7A 3EK7A 2AAOA 1OZSA 2M1KB 2WC8A 1Y1XA 2JTTA 4YGAA 2MRDA 1KFXL 4JQ0D 1LXFC 2OS8C 2NXQA 4M2OA 2FCEA 4U8DA 3FWCA 2CNPA 1KCYA 2F33A 1MWNA 4L9MA 2MHHA 2Y1NA 5CSJA 1B1GA 1AUIB 3BYAA 3VRPA 1G4YR 3CGAA 4HRGA 1RROA 1S5GZ 2OTGC 2EGDA 3D0YA 3O4YA 1WRLA 4PHJA 2GGZA 1CNPA 3LK0A 3BUXB 1IKUA 3HX4A 4YGBB 3O2PA 3OP0A 3WXAA 1YRTB 2KGBC 1YX8A 2LUXA 1MR8A 4PE7A 1BOCA 2I94A 3I5GB 3D10A 1C07A 1KFXS 2LLUA 2F8PA 2ZFDA 1PK0D 2ZRTA 2KGRA 5HKYA 2JU0A 4XYNA 3IQOA 4HREE 4GUKA 1L2OC 2ZN9A 1Y6WA 4PE1A 2WCBA 1ZOTB 1DVIA 3IQQA 1N65A 2Y1MA 3EVUA 5FYXA 4ICBA 1TRFA 3EVVA 3PN7B 2COLB 5CSNA 2PRUA 2WNDA 1UURA 2JRFA 3DD4A 4YI8A 1NX0A 2ZNDA 2RGIA 1OMRA 1DJYA 1CLLA 3KPXA 1SR6B 2LHIA 4DCKA 1CDMA 1SYMA 5K89A 1CLMA 2LVIA 1J7OA 1QX5B 5I2QA 1K93D 1K2HA 1S5GY 2M9GA 1S6CA 2M97A 3LK1A 1A03A 1B4CA 2K7CA 5J3XA 1TIZA 3CWGA 1F8HA 2B1UA 5DKNA 2M7NA 3I5IB 1S6IA 2MAZA 1TN4A 2GV5A 1RTP1 1OOJA 1NYAA 1N0YA 2L4IA 4XJKA 2KQ6A 4USLA 3SJSA 2JZIA 1B8RA 3EK8A 1XVJA 4MEWA 3SIAA 2EC6C 1BR4B 1DGVA 2D8NA 2KAXA 3I5HC 3FS7A 4CFRA 2BL0B 1A75A 1IQ3A 1PVBA 4QJ3B 2BE4A 1IQ5A 4YI9A 1HQVA 1JBAA 4YGCB 2MLEC 4WQ3A 1FI6A 3WHTB 1F71A 2LM5A 2NZ0A 4OCIA 2AUCA 2A4JA 1CKKA 1JF2A 2KYFA 2CXJA 2M1UA 1UHKA 5AANA 2NLNA 3SG5A 1EXRA 1IH0A 1S3PA 4GNKB 3RM1A 1QV0A 2K0JA 3F45A 2LLSA 1M63B 2JWWA 2LMTA 1CFFA 2JT0A 4MRYA 2ZN8A 1SRAA 1V1GA 2R2IA 2KAVA 1XFVO 4BY5A 1PULA 2WCEA 3TDUA 3AKAA 1U5IB 3KO0A 1B47A 4ZCUA 4ZCVA 2F3YA 1DF0A 1R2UA 2BE6A 2L51A 4PE0A 2KHNA 1B9AA 1F54A 1W7IB 2CBLA 1PALA 2PVBA 1RFJA 1UHIA 1DMOA 1HT9A 1JUOA 1QX7A 3SG4A 4Q04A 1A4PA 2F2OA 2M8UA 1Y1AA 1D1OA 2TN4A 3NSIA 1OZOA 3NSOA 4JPZB 5KTYA 3GK2A 1PVAA 3OB2B 2KBIA 4MSPA 1SY9A 3DVKA 1ZMZA 1MHOA 2MLFC 1WRZA 2PASA 5HYDA 3CTNA 1NUBA 3OB1B 2FJUB 1J1EA 1UHHA 3TUYC 4I5KA 1PSBA 1J7RA 1QTXA 1CFDA 1XFXO 1QVIZ 2JQ6A 4WRIA 2MBXA 1UUSA 5I2OA 1QIVA 4MN0A 1YRUB 3OHMB 2M7LA 3VROA 3WNXB 1K9UA 2L98A 3DF0A 3VRRA 1SCMC 1WY9A 1MQ1A 3PSRA 2ZRSA 2LHLA 4PHNA 3KHEA 1DJWA 1M45A 1S6JA 5HKZA 1NX2A 5AERA 1S36A 1J7PA 1TNQA 4I5JA 4JWQA 1IG5A 1F4OA 1KWOC 1YUTA 1YVLA 1M31A 1H8BA 2HQ8A 1QLKA 1AJ4A 2EC6B 1C7WA 1K9PA 3PM8A 1J55A 2BBNA 3I5HB 3I5FC 2KYCA 1EG3A 2QPTA 1CM1A 4NDBA 2K7DA 4IL1A 1Q80A 2M29A 5AFPA 1KK8C 1CM4A 1QV1A 1CFCA 2I2RE 4A4CA 4MZLA 3RLZA 5IBWA 1YR5A 4PDZA 1DGUA 1JWDA 1OE9B 2LANA 1SPYA 3BOWB 1FW4A 1NP8A 3CR4X 1KQMB 4ETOA 2KFFA 4E68A 4TNCA 1QVIY 3JVTC 1J7QA 1SCVA 3CS1A 4HSZA 1CB1A 2KI4C 4YBHB 4OVNF 1S26D 4C0KA 1BG1A 1NX1A 3C1VA 1C7VA 1CFPA 2E30A 2WORA 1LKJA 1NCXA 4N5XA 1QX2A 1AJ5A 1QJTA 4MZKA 1A29A 1AVSA 1WDCC 1G33A 1TNPA 2V53A 3GOFA 5KSZA 3EKHA 2KQYA 1DTLA 2M3WA 2KNEA 1MXLC 2O5GA 1LINA 2P6BB 3O6BA 1LVCD 5F6TA 1DJZA 4OV2A 2JPTA 1MXEA 1PSRA 1FPWA 1SL7A 2ISDA 1CDNA 2HPSA 1CMGA 5B8IB 2AMIA 1JSAA 3LLEA 4GPLB 3FIAA 1KK7Z 2K2FA 5D7FA 5KU1A 2OS8B 1M39A 2Y5IA 1VRKA 1TCFA 1SK6D 4MZJA 4OKHA 2I7AA 1IWQA 3FWBA 3H4SE 1FBVA 4CLNA 2KOTA 1YTZC 5JJGA 1B7TZ 1KQVA 1GJYA 2OTGB 2K8MB 1BODA 1TNWA 3D0YB 1YUUA 1KWOB 1XFWO 2KDHA 4I5NB 2SASA 2HF5A 4PHKA 5CSFA 4A4BA 1GGWA 3I5FB 1QXPA 2LCPA 1CLBA 1JFKA 4ORCB 2JXCA 1FF1A 1OSAA 1J1DA 2LE9B 2FOTA 1JC2A 1XFYO 4MVFA 1R6PA 1CDPA 1ALWA 2KI6D 5JOLA 5BPJA 3VRQA 3LL8B 1H4BA 2KSPA 1QATA 5D69A 3TS5C 2BCAA 5ER5A 3TDIA 2LVVA 3CLNA 1S1EA 1L2OB 1NX3A 1RWYA 3JTDC 1BLQA 2NCOA 4R1EA 2SCPA 4AQJA 4ORBB 5ER4X 4N1FA 2MJWB 1CMFA 1KK7Y 1BR1B 1YURA 3VGOA 5CSIA 1QS7A 2BKHB 1W7JB
chains in the Genus database with same CATH superfamily
3M0WA 3DVEA 1K9KA 3VB1A 1JFJA 3PALA 4OR9B 1ZACA 1XK4A 2JXLA 1KSMA 1B7TY 1SKTA 1XK4C 2K7BA 1OMDA 2MA2A 2PQLA 3DZTA 2JPOA 2LMUA 2JTZA 3ZWHA 2JT3A 2EHBA 2JNXA 1ZFSA 4MBEA 2LP3A 2Q91A 3NXAA 4GGFA 1BF5A 5HLOA 4DIRA 2DOQA 2LUCA 2K7OA 3E3RA 4C0JA 4UPGA 4BY4A 2CTNA 4XJKB 1UP5A 3TDZA 1XYDA 2H61A 2F2PA 4QJ4B 1OQPA 2E6WA 4FQTA 4AOMA 2H61C 3LCPC 3PATA 1DJXA 3BUNB 2JULA 1F70A 2CCMA 4GGNA 5GQQC 4DRWA 3KEVA 1NCZA 1Z4HA 2LMVA 3BUOB 1A75B 3BUWB 3V2LA 3IF7A 1E8AA 1OOHA 4F0ZB 1AHRA 3WHUB 1F4QA 3K1EA 2LAPA 1OOFA 1EG4A 2JNFA 3SIBA 2BBMA 3VRNA 2ZNEA 4GBAA 5CPVA 2O60A 1K96A 3B7AA 4PALA 1OOIX 4HRHA 2LP2A 3DVMA 1AK8A 1F55A 1QASA 3CZ1A 1DJGA 2M0RA 4NDDA 3NSLA 1U5IA 4MRXA 4N1GA 3ZNIA 1OMVA 3PM2A 2L5XB 2QEBA 2CT9A 1SNLA 1SMGA 3D76A 2JC2A 1Y0VH 2KBMA 3D73A 3K21A 3AKBA 1X02A 3SG2A 4CPVA 5HLVA 3A4UB 5I2LA 1K8UA 1IJ6A 1TOPA 2F3ZA 2LNKA 3PFVA 1BU3A 1TTXA 3S0DA 4D1EA 3GK4X 1BT6A 1DJHA 1DF0B 1LA3A 2IS9A 2OPOA 3BQ3A 1NCYA 1NSHA 3EKJA 3SG6A 1GGZA 3TZ1A 1FI5A 2M49B 3TS5B 1TNXA 2NCPA 4JD9A 5EL2A 4AQIA 1Y1UA 1DT7B 1NIWA 2JOJA 2L0PA 2QEHA 1UWOA 2PALA 4FTGA 3JTDB 1SW8A 1SL9A 2L4HA 2KI6C 1XFUO 3DVJA 1XA5A 4DS7A 1YX7A 2LLTA 1LA0A 1RK9A 1RECA 2KFHA 2P70A 1WRKA 1MUXA 3DYEA 4YGEB 1EJ3A 5I8NA 3D77A 1B8LA 3TUYB 1A2XA 1N2DA 1XFZO 2JT8A 3SS5A 5G08A 1IGVA 4PHMA 1JF0A 3NHIA 3KF9A 3AAKA 3R1OA 2PSRA 4NDCA 2FJYA 1GQMA 1SCMB 1BJFA 3DF0B 4WQ2A 5AEQA 1SSEB 4GFTA 2GGMA 2WOSA 1SBJA 2K61A 1WLMA 5HKWA 2BKIB 1NPQA 3HCMA 2PYQA 1WLZA 3GK1A 3CR5X 2BECA 4CFQA 2L2EA 1QLSA 3BXKA 3I5GC 2LVKA 3PLFB 4P2YB 2L50A 3NSKA 3QRXA 1TCOB 1K90D 2LC5A 4FQOA 4I5LB 2LV7A 5TNCA 1YVHA 1KFUL 5DKQA 1ZUZA 3UO9A 1K94A 1RJVA 3ICBA 4DUQA 3CZTX 1QWVA 2HQWA 2VRGA 2KAYA 1DC1A 4C0LA 2KFGA 1NWDA 3BOWA 3CR2A 4CIDA 4M2PA 4M2QA 1KK8B 2I18A 2LVJA 1DJIA 5AXIA 3NGVA 1EL4A 1KQMC 4QJ5B 3PN7C 4ORAB 4PCWA 1L7ZA 1YUSA 2ZKMX 1C3ZA 4YGDB 1PRWA 2HETA 3EK4A 1ALVA 2H2KA 3OX6A 3MSEB 2QACA 1SR6C 1ODBA 1M46A 3JVTB 1IRJA 1IJ5A 1XO5A 2H8VA 1G8IA 2WCFA 1KFUS 2G2BA 1CTRA 2KI4B 3AAJA 4NQGA 1BMOA 3EVRA 2QEVA 5DKRA 3SG3A 5D3OA 1V1FA 4P5OE 5PALA 2PMYA 1UHJA 3IVTA 3S0FA 2G9BA 3BUMB 3I5IC 1QIWA 1CDLA 1UHNA 1EH2A 1SL8A 3R72A 3D75A 1MF8B 3B6XA 2Q4UA 1TWOA 1K95A 3OX5A 4YRUA 1AP4A 4PE4A 1B8CA 4GGFC 3A8RA 2Y4QA 4MLWA 2BL0C 1WDCB 2FCDA 2WC6A 3O78A 2BCBA 4PT1A 1KSOA 2BCXA 2K2AA 3BFBA 4GAOA 3SG7A 3EK7A 2AAOA 1OZSA 2M1KB 2WC8A 1Y1XA 2JTTA 3B86A 3DY9A 2MRDA 1KFXL 4JQ0D 1LXFC 4YGAA 2OS8C 2NXQA 4M2OA 2FCEA 4U8DA 3FWCA 2CNPA 3SS3A 1KCYA 2F33A 1MWNA 4L9MA 2MHHA 2Y1NA 5CSJA 1B1GA 1AUIB 3BYAA 3VRPA 1G4YR 3CGAA 4HRGA 1RROA 1S5GZ 3FE6A 3D74A 2OTGC 2EGDA 3D0YA 3O4YA 3B88A 2KLEA 2KPHA 1WRLA 4PHJA 2GGZA 1CNPA 3LK0A 3BUXB 1IKUA 4JKTA 3HX4A 4YGBB 3O2PA 3OP0A 3WXAA 1YRTB 2KGBC 1YX8A 2LUXA 1MR8A 4PE7A 1BOCA 2I94A 3I5GB 3D10A 1C07A 1KFXS 2LLUA 2F8PA 2ZFDA 1PK0D 4INWA 2ZRTA 2KGRA 5I94A 5HKYA 2JU0A 4XYNA 3IQOA 4HREE 3QMEA 2KLDA 4GUKA 1L2OC 2ZN9A 1Y6WA 4PE1A 4IJ7A 1OW4A 2WCBA 1ZOTB 1DVIA 3FE9A 3IQQA 1N65A 2Y1MA 3EVUA 5FYXA 4ICBA 1TRFA 3EVVA 3PN7B 2COLB 2WCMA 5CSNA 2QEOA 2PRUA 2WCHA 2WNDA 1UURA 2JRFA 3DD4A 4YI8A 1NX0A 2ZNDA 2RGIA 1OMRA 1DJYA 1CLLA 3KPXA 1SR6B 2LHIA 4DCKA 1CDMA 1SYMA 5K89A 1CLMA 2LVIA 2BNXA 1J7OA 1QX5B 5I2QA 1K93D 1TUZA 1K2HA 1S5GY 2M9GA 1S6CA 2M97A 3LK1A 1A03A 1B4CA 2K7CA 5J3XA 1TIZA 3CWGA 5HL1A 1F8HA 2B1UA 5DKNA 2M7NA 3I5IB 1S6IA 2MAZA 1TN4A 2GV5A 1RTP1 1OOJA 1NYAA 1N0YA 2L4IA 4XJKA 2KQ6A 4USLA 3SJSA 3UNWA 2JZIA 1B8RA 3EK8A 1XVJA 4MEWA 3SIAA 2EC6C 1BR4B 1DGVA 2D8NA 2KAXA 3SS4A 3I5HC 3FS7A 4KYNA 4CFRA 2BL0B 3B87A 1A75A 1IQ3A 1PVBA 4QJ3B 2BE4A 2WCLA 1IQ5A 3R1VA 4YI9A 2QDIA 3RZSA 1HQVA 2YGUA 1JBAA 3N7HA 4YGCB 2MLEC 3R1PA 4WQ3A 1Z2CB 3D78A 2LM5A 2NZ0A 3WHTB 4OCIA 1F71A 1FI6A 2AUCA 2A4JA 1CKKA 1JF2A 2KYFA 2BAPA 2CXJA 2M1UA 1UHKA 2GTEA 5AANA 2NLNA 3SG5A 1EXRA 3OGNA 1S3PA 4GNKB 3RM1A 1IH0A 1QV0A 2K0JA 3F45A 2LLSA 3S0GA 1M63B 2JWWA 2LMTA 1CFFA 2JT0A 4MRYA 2ZN8A 1DELA 2WC5A 1SRAA 1V1GA 2R2IA 2KAVA 1XFVO 3S0EA 1PULA 4BY5A 2WCEA 3TDUA 3AKAA 3BFHA 1U5IB 3KO0A 1B47A 4ZCUA 4ZCVA 2F3YA 1DF0A 1R2UA 2BE6A 2L51A 4PE0A 2KHNA 1B9AA 1F54A 1W7IB 3NHTA 2CBLA 1PALA 2PVBA 1RFJA 1UHIA 1DMOA 1HT9A 1JUOA 1QX7A 3SG4A 4Q04A 1A4PA 1T14A 2F2OA 2M8UA 1Y1AA 1D1OA 3WNXB 2TN4A 3NSIA 1OZOA 3NSOA 4JPZB 5KTYA 3GK2A 1PVAA 3OB2B 2KBIA 4MSPA 1SY9A 3DVKA 1ZMZA 1MHOA 2MLFC 1WRZA 2PASA 5HYDA 3CTNA 1NUBA 3CZ0A 3OB1B 2FJUB 1J1EA 1UHHA 3TUYC 4I5KA 1PSBA 1J7RA 1QTXA 1CFDA 1XFXO 1QVIZ 2JQ6A 4WRIA 2MBXA 2WCJA 1UUSA 5I2OA 4F7FA 1QIVA 4MN0A 5DICA 1YRUB 4INXA 3OHMB 4OZDA 2K60A 2M7LA 3VROA 1XFRA 1K9UA 2L98A 1P28A 3DF0A 3VRRA 1SCMC 1WY9A 1MQ1A 3PSRA 2ZRSA 2LHLA 4PHNA 3KHEA 1DJWA 1M45A 1S6JA 5HKZA 1NX2A 5AERA 1S36A 1J7PA 1TNQA 4I5JA 4JWQA 1IG5A 1F4OA 1KWOC 3S0BA 1YUTA 1YVLA 1M31A 3CABA 1H8BA 2HQ8A 1QLKA 1AJ4A 2EC6B 1C7WA 1K9PA 3L4LA 3PM8A 1J55A 2BBNA 3I5HB 3I5FC 2KYCA 1EG3A 2QPTA 1CM1A 3Q8IA 4NDBA 2K7DA 4IL1A 1Q80A 2M29A 3OBVA 5FI2A 5AFPA 1KK8C 1CM4A 1QV1A 1CFCA 2I2RE 4A4CA 4MZLA 1LS8A 3RLZA 1GM0A 5IBWA 1YR5A 4PDZA 1DGUA 1JWDA 1OE9B 2LANA 1SPYA 3BOWB 1FW4A 1NP8A 3CR4X 1KQMB 2P71A 4ETOA 1DEKA 2KFFA 3L47A 4E68A 4TNCA 1QVIY 3CZ2A 3JVTC 1J7QA 1SCVA 3CS1A 4HSZA 1CB1A 2KI4C 4YBHB 4OVNF 1S26D 3CYZA 3EG5B 4C0KA 1BG1A 1NX1A 3C1VA 1C7VA 1CFPA 2E30A 2WORA 1LKJA 1NCXA 3L4AA 1IIOA 4N5XA 1QX2A 1AJ5A 1QJTA 4MZKA 1A29A 1AVSA 1WDCC 1G33A 1TNPA 2V53A 3GOFA 5KSZA 3EKHA 2KQYA 1DTLA 3DXLA 2M3WA 1DQEA 2KNEA 1MXLC 2O5GA 1LINA 2P6BB 3O6BA 1LVCD 5F6TA 1DJZA 4OV2A 2JPTA 1MXEA 1PSRA 2WCKA 1FPWA 1SL7A 2ISDA 1CDNA 2HPSA 1CMGA 5B8IB 2AMIA 3FE8A 3LLEA 4GPLB 1JSAA 3FIAA 1KK7Z 2K2FA 5D7FA 5KU1A 2OS8B 3BJHA 1M39A 2Y5IA 3PJIA 1VRKA 1TCFA 1SK6D 4MZJA 4OKHA 2L2CA 2I7AA 1IWQA 3FWBA 3H4SE 1FBVA 4CLNA 2KOTA 1YTZC 5JJGA 1B7TZ 1KQVA 1GJYA 1OOGA 2OTGB 2K8MB 1BODA 1TNWA 3D0YB 1YUUA 1KWOB 3S0AA 1XFWO 2KDHA 4I5NB 3CDNA 2SASA 2ERBA 2HF5A 4PHKA 5FI7A 5CSFA 4A4BA 1GGWA 3I5FB 1QXPA 2LCPA 1ORGA 1CLBA 1JFKA 4ORCB 2JXCA 1FF1A 1OSAA 1J1DA 1TUJA 1W9ZA 2LE9B 3BFAA 2FOTA 1JC2A 1XFYO 4MVFA 1R6PA 1CDPA 1ALWA 2KI6D 5JOLA 5BPJA 3VRQA 3LL8B 1H4BA 2KSPA 1QATA 5D69A 3TS5C 2BCAA 5ER5A 3TDIA 2LVVA 3CLNA 1S1EA 3O4XA 1L2OB 1NX3A 1RWYA 3JTDC 1BLQA 2NCOA 4R1EA 1C3YA 2SCPA 4AQJA 4ORBB 5ER4X 4N1FA 5FI6A 2MJWB 1CMFA 1KK7Y 1BR1B 2L5YA 1YURA 3VGOA 5CSIA 1QS7A 2BKHB 1W7JB
chains in the Genus database with same CATH topology
3M0WA 3DVEA 1K9KA 1JFJA 3PALA 4OR9B 1ZACA 1XK4A 2JXLA 1KSMA 1B7TY 1SKTA 1XK4C 2K7BA 1OMDA 2MA2A 3ZWHA 2LMUA 2JTZA 2JT3A 2EHBA 2JNXA 1ZFSA 4MBEA 2LP3A 2Q91A 3NXAA 4GGFA 1BF5A 5HLOA 4DIRA 2DOQA 2LUCA 2K7OA 3E3RA 4C0JA 4UPGA 4BY4A 2CTNA 4XJKB 1UP5A 3TDZA 1XYDA 2H61A 2F2PA 4QJ4B 1OQPA 2E6WA 4AOMA 2H61C 3LCPC 3PATA 1DJXA 3BUNB 2JULA 1F70A 2CCMA 4GGNA 5GQQC 4DRWA 3KEVA 1NCZA 2LMVA 3BUOB 1A75B 3BUWB 3IF7A 1E8AA 4F0ZB 1AHRA 3WHUB 1F4QA 2LAPA 1EG4A 2JNFA 3SIBA 2BBMA 3VRNA 2ZNEA 4GBAA 5CPVA 2O60A 1K96A 4PALA 4HRHA 2LP2A 3DVMA 1AK8A 1F55A 1QASA 1DJGA 2M0RA 4NDDA 3NSLA 1U5IA 4MRXA 4N1GA 3ZNIA 1OMVA 2L5XB 2CT9A 1SNLA 1SMGA 2JC2A 1Y0VH 2KBMA 3K21A 3AKBA 1X02A 3SG2A 4CPVA 5HLVA 3A4UB 5I2LA 1K8UA 1IJ6A 1TOPA 2F3ZA 2LNKA 3PFVA 1BU3A 1TTXA 4D1EA 3GK4X 1BT6A 1DJHA 1DF0B 1LA3A 2IS9A 2OPOA 3BQ3A 1NCYA 1NSHA 3EKJA 3SG6A 1GGZA 3TZ1A 1FI5A 2M49B 3TS5B 1TNXA 2NCPA 1DT7B 4AQIA 1Y1UA 1NIWA 2JOJA 2L0PA 1UWOA 2PALA 4FTGA 3JTDB 1SW8A 1SL9A 2L4HA 2KI6C 1XFUO 3DVJA 1XA5A 4DS7A 1YX7A 2LLTA 1LA0A 1RK9A 1RECA 2KFHA 1WRKA 1MUXA 4YGEB 1EJ3A 5I8NA 1B8LA 3TUYB 1A2XA 1N2DA 1XFZO 2JT8A 5G08A 1IGVA 4PHMA 1JF0A 3KF9A 3AAKA 2PSRA 4NDCA 1GQMA 1SCMB 1BJFA 3DF0B 4WQ2A 5AEQA 4GFTA 2GGMA 2WOSA 1SBJA 2K61A 1WLMA 5HKWA 2BKIB 1NPQA 3HCMA 1WLZA 3GK1A 3CR5X 2BECA 4CFQA 2L2EA 1QLSA 3BXKA 3I5GC 2LVKA 3PLFB 4P2YB 2L50A 3NSKA 3QRXA 1TCOB 1K90D 2LC5A 4FQOA 4I5LB 2LV7A 5TNCA 1YVHA 1KFUL 5DKQA 1ZUZA 1K94A 1RJVA 3ICBA 4DUQA 3CZTX 2HQWA 2VRGA 2KAYA 4C0LA 2KFGA 1NWDA 3BOWA 3CR2A 4CIDA 4M2PA 4M2QA 1KK8B 2I18A 2LVJA 1DJIA 5AXIA 1EL4A 1KQMC 4QJ5B 3PN7C 4ORAB 4PCWA 1L7ZA 1YUSA 2ZKMX 4YGDB 1PRWA 2HETA 3EK4A 1ALVA 2H2KA 3OX6A 3MSEB 2QACA 1SR6C 1ODBA 1M46A 3JVTB 1IRJA 1IJ5A 1XO5A 1G8IA 2WCFA 1KFUS 2G2BA 1CTRA 2KI4B 3AAJA 4NQGA 1BMOA 3EVRA 5DKRA 3SG3A 1V1FA 4P5OE 5PALA 2PMYA 1UHJA 2G9BA 3BUMB 3I5IC 1QIWA 1CDLA 1UHNA 1EH2A 1SL8A 1MF8B 2Q4UA 1K95A 3OX5A 4YRUA 1AP4A 4PE4A 1B8CA 4GGFC 3A8RA 2Y4QA 4MLWA 2BL0C 1WDCB 2FCDA 3O78A 2BCBA 1KSOA 2BCXA 2K2AA 4GAOA 3SG7A 3EK7A 2AAOA 1OZSA 2M1KB 2WC8A 1Y1XA 2JTTA 4YGAA 2MRDA 1KFXL 4JQ0D 1LXFC 2OS8C 2NXQA 4M2OA 2FCEA 4U8DA 3FWCA 2CNPA 1KCYA 2F33A 1MWNA 4L9MA 2MHHA 2Y1NA 5CSJA 1B1GA 1AUIB 3BYAA 3VRPA 1G4YR 3CGAA 4HRGA 1RROA 1S5GZ 2OTGC 2EGDA 3D0YA 3O4YA 1WRLA 4PHJA 2GGZA 1CNPA 3LK0A 3BUXB 1IKUA 3HX4A 4YGBB 3O2PA 3OP0A 3WXAA 1YRTB 2KGBC 1YX8A 2LUXA 1MR8A 4PE7A 1BOCA 2I94A 3I5GB 3D10A 1C07A 1KFXS 2LLUA 2F8PA 2ZFDA 1PK0D 2ZRTA 2KGRA 5HKYA 2JU0A 4XYNA 3IQOA 4HREE 4GUKA 1L2OC 2ZN9A 1Y6WA 4PE1A 2WCBA 1ZOTB 1DVIA 3IQQA 1N65A 2Y1MA 3EVUA 5FYXA 4ICBA 1TRFA 3EVVA 3PN7B 2COLB 5CSNA 2PRUA 2WNDA 1UURA 2JRFA 3DD4A 4YI8A 1NX0A 2ZNDA 2RGIA 1OMRA 1DJYA 1CLLA 3KPXA 1SR6B 2LHIA 4DCKA 1CDMA 1SYMA 5K89A 1CLMA 2LVIA 1J7OA 1QX5B 5I2QA 1K93D 1K2HA 1S5GY 2M9GA 1S6CA 2M97A 3LK1A 1A03A 1B4CA 2K7CA 5J3XA 1TIZA 3CWGA 1F8HA 2B1UA 5DKNA 2M7NA 3I5IB 1S6IA 2MAZA 1TN4A 2GV5A 1RTP1 1OOJA 1NYAA 1N0YA 2L4IA 4XJKA 2KQ6A 4USLA 3SJSA 2JZIA 1B8RA 3EK8A 1XVJA 4MEWA 3SIAA 2EC6C 1BR4B 1DGVA 2D8NA 2KAXA 3I5HC 3FS7A 4CFRA 2BL0B 1A75A 1IQ3A 1PVBA 4QJ3B 2BE4A 1IQ5A 4YI9A 1HQVA 1JBAA 4YGCB 2MLEC 4WQ3A 1FI6A 3WHTB 1F71A 2LM5A 2NZ0A 4OCIA 2AUCA 2A4JA 1CKKA 1JF2A 2KYFA 2CXJA 2M1UA 1UHKA 5AANA 2NLNA 3SG5A 1EXRA 1IH0A 1S3PA 4GNKB 3RM1A 1QV0A 2K0JA 3F45A 2LLSA 1M63B 2JWWA 2LMTA 1CFFA 2JT0A 4MRYA 2ZN8A 1SRAA 1V1GA 2R2IA 2KAVA 1XFVO 4BY5A 1PULA 2WCEA 3TDUA 3AKAA 1U5IB 3KO0A 1B47A 4ZCUA 4ZCVA 2F3YA 1DF0A 1R2UA 2BE6A 2L51A 4PE0A 2KHNA 1B9AA 1F54A 1W7IB 2CBLA 1PALA 2PVBA 1RFJA 1UHIA 1DMOA 1HT9A 1JUOA 1QX7A 3SG4A 4Q04A 1A4PA 2F2OA 2M8UA 1Y1AA 1D1OA 2TN4A 3NSIA 1OZOA 3NSOA 4JPZB 5KTYA 3GK2A 1PVAA 3OB2B 2KBIA 4MSPA 1SY9A 3DVKA 1ZMZA 1MHOA 2MLFC 1WRZA 2PASA 5HYDA 3CTNA 1NUBA 3OB1B 2FJUB 1J1EA 1UHHA 3TUYC 4I5KA 1PSBA 1J7RA 1QTXA 1CFDA 1XFXO 1QVIZ 2JQ6A 4WRIA 2MBXA 1UUSA 5I2OA 1QIVA 4MN0A 1YRUB 3OHMB 2M7LA 3VROA 3WNXB 1K9UA 2L98A 3DF0A 3VRRA 1SCMC 1WY9A 1MQ1A 3PSRA 2ZRSA 2LHLA 4PHNA 3KHEA 1DJWA 1M45A 1S6JA 5HKZA 1NX2A 5AERA 1S36A 1J7PA 1TNQA 4I5JA 4JWQA 1IG5A 1F4OA 1KWOC 1YUTA 1YVLA 1M31A 1H8BA 2HQ8A 1QLKA 1AJ4A 2EC6B 1C7WA 1K9PA 3PM8A 1J55A 2BBNA 3I5HB 3I5FC 2KYCA 1EG3A 2QPTA 1CM1A 4NDBA 2K7DA 4IL1A 1Q80A 2M29A 5AFPA 1KK8C 1CM4A 1QV1A 1CFCA 2I2RE 4A4CA 4MZLA 3RLZA 5IBWA 1YR5A 4PDZA 1DGUA 1JWDA 1OE9B 2LANA 1SPYA 3BOWB 1FW4A 1NP8A 3CR4X 1KQMB 4ETOA 2KFFA 4E68A 4TNCA 1QVIY 3JVTC 1J7QA 1SCVA 3CS1A 4HSZA 1CB1A 2KI4C 4YBHB 4OVNF 1S26D 4C0KA 1BG1A 1NX1A 3C1VA 1C7VA 1CFPA 2E30A 2WORA 1LKJA 1NCXA 4N5XA 1QX2A 1AJ5A 1QJTA 4MZKA 1A29A 1AVSA 1WDCC 1G33A 1TNPA 2V53A 3GOFA 5KSZA 3EKHA 2KQYA 1DTLA 2M3WA 2KNEA 1MXLC 2O5GA 1LINA 2P6BB 3O6BA 1LVCD 5F6TA 1DJZA 4OV2A 2JPTA 1MXEA 1PSRA 1FPWA 1SL7A 2ISDA 1CDNA 2HPSA 1CMGA 5B8IB 2AMIA 1JSAA 3LLEA 4GPLB 3FIAA 1KK7Z 2K2FA 5D7FA 5KU1A 2OS8B 1M39A 2Y5IA 1VRKA 1TCFA 1SK6D 4MZJA 4OKHA 2I7AA 1IWQA 3FWBA 3H4SE 1FBVA 4CLNA 2KOTA 1YTZC 5JJGA 1B7TZ 1KQVA 1GJYA 2OTGB 2K8MB 1BODA 1TNWA 3D0YB 1YUUA 1KWOB 1XFWO 2KDHA 4I5NB 2SASA 2HF5A 4PHKA 5CSFA 4A4BA 1GGWA 3I5FB 1QXPA 2LCPA 1CLBA 1JFKA 4ORCB 2JXCA 1FF1A 1OSAA 1J1DA 2LE9B 2FOTA 1JC2A 1XFYO 4MVFA 1R6PA 1CDPA 1ALWA 2KI6D 5JOLA 5BPJA 3VRQA 3LL8B 1H4BA 2KSPA 1QATA 5D69A 3TS5C 2BCAA 5ER5A 3TDIA 2LVVA 3CLNA 1S1EA 1L2OB 1NX3A 1RWYA 3JTDC 1BLQA 2NCOA 4R1EA 2SCPA 4AQJA 4ORBB 5ER4X 4N1FA 2MJWB 1CMFA 1KK7Y 1BR1B 1YURA 3VGOA 5CSIA 1QS7A 2BKHB 1W7JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0W A;  3DVE A;  1K9K A;  1JFJ A;  3PAL A;  4OR9 B;  1ZAC A;  1XK4 A;  2JXL A;  1KSM A;  1B7T Y;  1SKT A;  1XK4 C;  2K7B A;  1OMD A;  2MA2 A;  3ZWH A;  2LMU A;  2JTZ A;  2JT3 A;  2EHB A;  2JNX A;  1ZFS A;  4MBE A;  2LP3 A;  2Q91 A;  3NXA A;  4GGF A;  1BF5 A;  5HLO A;  4DIR A;  2DOQ A;  2LUC A;  2K7O A;  3E3R A;  4C0J A;  4UPG A;  4BY4 A;  2CTN A;  4XJK B;  1UP5 A;  3TDZ A;  1XYD A;  2H61 A;  2F2P A;  4QJ4 B;  1OQP A;  2E6W A;  4AOM A;  2H61 C;  3LCP C;  3PAT A;  1DJX A;  3BUN B;  2JUL A;  1F70 A;  2CCM A;  4GGN A;  5GQQ C;  4DRW A;  3KEV A;  1NCZ A;  2LMV A;  3BUO B;  1A75 B;  3BUW B;  3IF7 A;  1E8A A;  4F0Z B;  1AHR A;  3WHU B;  1F4Q A;  2LAP A;  1EG4 A;  2JNF A;  3SIB A;  2BBM A;  3VRN A;  2ZNE A;  4GBA A;  5CPV A;  2O60 A;  1K96 A;  4PAL A;  4HRH A;  2LP2 A;  3DVM A;  1AK8 A;  1F55 A;  1QAS A;  1DJG A;  2M0R A;  4NDD A;  3NSL A;  1U5I A;  4MRX A;  4N1G A;  3ZNI A;  1OMV A;  2L5X B;  2CT9 A;  1SNL A;  1SMG A;  2JC2 A;  1Y0V H;  2KBM A;  3K21 A;  3AKB A;  1X02 A;  3SG2 A;  4CPV A;  5HLV A;  3A4U B;  5I2L A;  1K8U A;  1IJ6 A;  1TOP A;  2F3Z A;  2LNK A;  3PFV A;  1BU3 A;  1TTX A;  4D1E A;  3GK4 X;  1BT6 A;  1DJH A;  1DF0 B;  1LA3 A;  2IS9 A;  2OPO A;  3BQ3 A;  1NCY A;  1NSH A;  3EKJ A;  3SG6 A;  1GGZ A;  3TZ1 A;  1FI5 A;  2M49 B;  3TS5 B;  1TNX A;  2NCP A;  1DT7 B;  4AQI A;  1Y1U A;  1NIW A;  2JOJ A;  2L0P A;  1UWO A;  2PAL A;  4FTG A;  3JTD B;  1SW8 A;  1SL9 A;  2L4H A;  2KI6 C;  1XFU O;  3DVJ A;  1XA5 A;  4DS7 A;  1YX7 A;  2LLT A;  1LA0 A;  1RK9 A;  1REC A;  2KFH A;  1WRK A;  1MUX A;  4YGE B;  1EJ3 A;  5I8N A;  1B8L A;  3TUY B;  1A2X A;  1N2D A;  1XFZ O;  2JT8 A;  5G08 A;  1IGV A;  4PHM A;  1JF0 A;  3KF9 A;  3AAK A;  2PSR A;  4NDC A;  1GQM A;  1SCM B;  1BJF A;  3DF0 B;  4WQ2 A;  5AEQ A;  4GFT A;  2GGM A;  2WOS A;  1SBJ A;  2K61 A;  1WLM A;  5HKW A;  2BKI B;  1NPQ A;  3HCM A;  1WLZ A;  3GK1 A;  3CR5 X;  2BEC A;  4CFQ A;  2L2E A;  1QLS A;  3BXK A;  3I5G C;  2LVK A;  3PLF B;  4P2Y B;  2L50 A;  3NSK A;  3QRX A;  1TCO B;  1K90 D;  2LC5 A;  4FQO A;  4I5L B;  2LV7 A;  5TNC A;  1YVH A;  1KFU L;  5DKQ A;  1ZUZ A;  1K94 A;  1RJV A;  3ICB A;  4DUQ A;  3CZT X;  2HQW A;  2VRG A;  2KAY A;  4C0L A;  2KFG A;  1NWD A;  3BOW A;  3CR2 A;  4CID A;  4M2P A;  4M2Q A;  1KK8 B;  2I18 A;  2LVJ A;  1DJI A;  5AXI A;  1EL4 A;  1KQM C;  4QJ5 B;  3PN7 C;  4ORA B;  4PCW A;  1L7Z A;  1YUS A;  2ZKM X;  4YGD B;  1PRW A;  2HET A;  3EK4 A;  1ALV A;  2H2K A;  3OX6 A;  3MSE B;  2QAC A;  1SR6 C;  1ODB A;  1M46 A;  3JVT B;  1IRJ A;  1IJ5 A;  1XO5 A;  1G8I A;  2WCF A;  1KFU S;  2G2B A;  1CTR A;  2KI4 B;  3AAJ A;  4NQG A;  1BMO A;  3EVR A;  5DKR A;  3SG3 A;  1V1F A;  4P5O E;  5PAL A;  2PMY A;  1UHJ A;  2G9B A;  3BUM B;  3I5I C;  1QIW A;  1CDL A;  1UHN A;  1EH2 A;  1SL8 A;  1MF8 B;  2Q4U A;  1K95 A;  3OX5 A;  4YRU A;  1AP4 A;  4PE4 A;  1B8C A;  4GGF C;  3A8R A;  2Y4Q A;  4MLW A;  2BL0 C;  1WDC B;  2FCD A;  3O78 A;  2BCB A;  1KSO A;  2BCX A;  2K2A A;  4GAO A;  3SG7 A;  3EK7 A;  2AAO A;  1OZS A;  2M1K B;  2WC8 A;  1Y1X A;  2JTT A;  4YGA A;  2MRD A;  1KFX L;  4JQ0 D;  1LXF C;  2OS8 C;  2NXQ A;  4M2O A;  2FCE A;  4U8D A;  3FWC A;  2CNP A;  1KCY A;  2F33 A;  1MWN A;  4L9M A;  2MHH A;  2Y1N A;  5CSJ A;  1B1G A;  1AUI B;  3BYA A;  3VRP A;  1G4Y R;  3CGA A;  4HRG A;  1RRO A;  1S5G Z;  2OTG C;  2EGD A;  3D0Y A;  3O4Y A;  1WRL A;  4PHJ A;  2GGZ A;  1CNP A;  3LK0 A;  3BUX B;  1IKU A;  3HX4 A;  4YGB B;  3O2P A;  3OP0 A;  3WXA A;  1YRT B;  2KGB C;  1YX8 A;  2LUX A;  1MR8 A;  4PE7 A;  1BOC A;  2I94 A;  3I5G B;  3D10 A;  1C07 A;  1KFX S;  2LLU A;  2F8P A;  2ZFD A;  1PK0 D;  2ZRT A;  2KGR A;  5HKY A;  2JU0 A;  4XYN A;  3IQO A;  4HRE E;  4GUK A;  1L2O C;  2ZN9 A;  1Y6W A;  4PE1 A;  2WCB A;  1ZOT B;  1DVI A;  3IQQ A;  1N65 A;  2Y1M A;  3EVU A;  5FYX A;  4ICB A;  1TRF A;  3EVV A;  3PN7 B;  2COL B;  5CSN A;  2PRU A;  2WND A;  1UUR A;  2JRF A;  3DD4 A;  4YI8 A;  1NX0 A;  2ZND A;  2RGI A;  1OMR A;  1DJY A;  1CLL A;  3KPX A;  1SR6 B;  2LHI A;  4DCK A;  1CDM A;  1SYM A;  5K89 A;  1CLM A;  2LVI A;  1J7O A;  1QX5 B;  5I2Q A;  1K93 D;  1K2H A;  1S5G Y;  2M9G A;  1S6C A;  2M97 A;  3LK1 A;  1A03 A;  1B4C A;  2K7C A;  5J3X A;  1TIZ A;  3CWG A;  1F8H A;  2B1U A;  5DKN A;  2M7N A;  3I5I B;  1S6I A;  2MAZ A;  1TN4 A;  2GV5 A;  1RTP 1;  1OOJ A;  1NYA A;  1N0Y A;  2L4I A;  4XJK A;  2KQ6 A;  4USL A;  3SJS A;  2JZI A;  1B8R A;  3EK8 A;  1XVJ A;  4MEW A;  3SIA A;  2EC6 C;  1BR4 B;  1DGV A;  2D8N A;  2KAX A;  3I5H C;  3FS7 A;  4CFR A;  2BL0 B;  1A75 A;  1IQ3 A;  1PVB A;  4QJ3 B;  2BE4 A;  1IQ5 A;  4YI9 A;  1HQV A;  1JBA A;  4YGC B;  2MLE C;  4WQ3 A;  1FI6 A;  3WHT B;  1F71 A;  2LM5 A;  2NZ0 A;  4OCI A;  2AUC A;  2A4J A;  1CKK A;  1JF2 A;  2KYF A;  2CXJ A;  2M1U A;  1UHK A;  5AAN A;  2NLN A;  3SG5 A;  1EXR A;  1IH0 A;  1S3P A;  4GNK B;  3RM1 A;  1QV0 A;  2K0J A;  3F45 A;  2LLS A;  1M63 B;  2JWW A;  2LMT A;  1CFF A;  2JT0 A;  4MRY A;  2ZN8 A;  1SRA A;  1V1G A;  2R2I A;  2KAV A;  1XFV O;  4BY5 A;  1PUL A;  2WCE A;  3TDU A;  3AKA A;  1U5I B;  3KO0 A;  1B47 A;  4ZCU A;  4ZCV A;  2F3Y A;  1DF0 A;  1R2U A;  2BE6 A;  2L51 A;  4PE0 A;  2KHN A;  1B9A A;  1F54 A;  1W7I B;  2CBL A;  1PAL A;  2PVB A;  1RFJ A;  1UHI A;  1DMO A;  1HT9 A;  1JUO A;  1QX7 A;  3SG4 A;  4Q04 A;  1A4P A;  2F2O A;  2M8U A;  1Y1A A;  1D1O A;  2TN4 A;  3NSI A;  1OZO A;  3NSO A;  4JPZ B;  5KTY A;  3GK2 A;  1PVA A;  3OB2 B;  2KBI A;  4MSP A;  1SY9 A;  3DVK A;  1ZMZ A;  1MHO A;  2MLF C;  1WRZ A;  2PAS A;  5HYD A;  3CTN A;  1NUB A;  3OB1 B;  2FJU B;  1J1E A;  1UHH A;  3TUY C;  4I5K A;  1PSB A;  1J7R A;  1QTX A;  1CFD A;  1XFX O;  1QVI Z;  2JQ6 A;  4WRI A;  2MBX A;  1UUS A;  5I2O A;  1QIV A;  4MN0 A;  1YRU B;  3OHM B;  2M7L A;  3VRO A;  3WNX B;  1K9U A;  2L98 A;  3DF0 A;  3VRR A;  1SCM C;  1WY9 A;  1MQ1 A;  3PSR A;  2ZRS A;  2LHL A;  4PHN A;  3KHE A;  1DJW A;  1M45 A;  1S6J A;  5HKZ A;  1NX2 A;  5AER A;  1S36 A;  1J7P A;  1TNQ A;  4I5J A;  4JWQ A;  1IG5 A;  1F4O A;  1KWO C;  1YUT A;  1YVL A;  1M31 A;  1H8B A;  2HQ8 A;  1QLK A;  1AJ4 A;  2EC6 B;  1C7W A;  1K9P A;  3PM8 A;  1J55 A;  2BBN A;  3I5H B;  3I5F C;  2KYC A;  1EG3 A;  2QPT A;  1CM1 A;  4NDB A;  2K7D A;  4IL1 A;  1Q80 A;  2M29 A;  5AFP A;  1KK8 C;  1CM4 A;  1QV1 A;  1CFC A;  2I2R E;  4A4C A;  4MZL A;  3RLZ A;  5IBW A;  1YR5 A;  4PDZ A;  1DGU A;  1JWD A;  1OE9 B;  2LAN A;  1SPY A;  3BOW B;  1FW4 A;  1NP8 A;  3CR4 X;  1KQM B;  4ETO A;  2KFF A;  4E68 A;  4TNC A;  1QVI Y;  3JVT C;  1J7Q A;  1SCV A;  3CS1 A;  4HSZ A;  1CB1 A;  2KI4 C;  4YBH B;  4OVN F;  1S26 D;  4C0K A;  1BG1 A;  1NX1 A;  3C1V A;  1C7V A;  1CFP A;  2E30 A;  2WOR A;  1LKJ A;  1NCX A;  4N5X A;  1QX2 A;  1AJ5 A;  1QJT A;  4MZK A;  1A29 A;  1AVS A;  1WDC C;  1G33 A;  1TNP A;  2V53 A;  3GOF A;  5KSZ A;  3EKH A;  2KQY A;  1DTL A;  2M3W A;  2KNE A;  1MXL C;  2O5G A;  1LIN A;  2P6B B;  3O6B A;  1LVC D;  5F6T A;  1DJZ A;  4OV2 A;  2JPT A;  1MXE A;  1PSR A;  1FPW A;  1SL7 A;  2ISD A;  1CDN A;  2HPS A;  1CMG A;  5B8I B;  2AMI A;  1JSA A;  3LLE A;  4GPL B;  3FIA A;  1KK7 Z;  2K2F A;  5D7F A;  5KU1 A;  2OS8 B;  1M39 A;  2Y5I A;  1VRK A;  1TCF A;  1SK6 D;  4MZJ A;  4OKH A;  2I7A A;  1IWQ A;  3FWB A;  3H4S E;  1FBV A;  4CLN A;  2KOT A;  1YTZ C;  5JJG A;  1B7T Z;  1KQV A;  1GJY A;  2OTG B;  2K8M B;  1BOD A;  1TNW A;  3D0Y B;  1YUU A;  1KWO B;  1XFW O;  2KDH A;  4I5N B;  2SAS A;  2HF5 A;  4PHK A;  5CSF A;  4A4B A;  1GGW A;  3I5F B;  1QXP A;  2LCP A;  1CLB A;  1JFK A;  4ORC B;  2JXC A;  1FF1 A;  1OSA A;  1J1D A;  2LE9 B;  2FOT A;  1JC2 A;  1XFY O;  4MVF A;  1R6P A;  1CDP A;  1ALW A;  2KI6 D;  5JOL A;  5BPJ A;  3VRQ A;  3LL8 B;  1H4B A;  2KSP A;  1QAT A;  5D69 A;  3TS5 C;  2BCA A;  5ER5 A;  3TDI A;  2LVV A;  3CLN A;  1S1E A;  1L2O B;  1NX3 A;  1RWY A;  3JTD C;  1BLQ A;  2NCO A;  4R1E A;  2SCP A;  4AQJ A;  4ORB B;  5ER4 X;  4N1F A;  2MJW B;  1CMF A;  1KK7 Y;  1BR1 B;  1YUR A;  3VGO A;  5CSI A;  1QS7 A;  2BKH B;  1W7J B; 
#chains in the Genus database with same CATH topology
 3M0W A;  3DVE A;  1K9K A;  3VB1 A;  1JFJ A;  3PAL A;  4OR9 B;  1ZAC A;  1XK4 A;  2JXL A;  1KSM A;  1B7T Y;  1SKT A;  1XK4 C;  2K7B A;  1OMD A;  2MA2 A;  2PQL A;  3DZT A;  2JPO A;  2LMU A;  2JTZ A;  3ZWH A;  2JT3 A;  2EHB A;  2JNX A;  1ZFS A;  4MBE A;  2LP3 A;  2Q91 A;  3NXA A;  4GGF A;  1BF5 A;  5HLO A;  4DIR A;  2DOQ A;  2LUC A;  2K7O A;  3E3R A;  4C0J A;  4UPG A;  4BY4 A;  2CTN A;  4XJK B;  1UP5 A;  3TDZ A;  1XYD A;  2H61 A;  2F2P A;  4QJ4 B;  1OQP A;  2E6W A;  4FQT A;  4AOM A;  2H61 C;  3LCP C;  3PAT A;  1DJX A;  3BUN B;  2JUL A;  1F70 A;  2CCM A;  4GGN A;  5GQQ C;  4DRW A;  3KEV A;  1NCZ A;  1Z4H A;  2LMV A;  3BUO B;  1A75 B;  3BUW B;  3V2L A;  3IF7 A;  1E8A A;  1OOH A;  4F0Z B;  1AHR A;  3WHU B;  1F4Q A;  3K1E A;  2LAP A;  1OOF A;  1EG4 A;  2JNF A;  3SIB A;  2BBM A;  3VRN A;  2ZNE A;  4GBA A;  5CPV A;  2O60 A;  1K96 A;  3B7A A;  4PAL A;  1OOI X;  4HRH A;  2LP2 A;  3DVM A;  1AK8 A;  1F55 A;  1QAS A;  3CZ1 A;  1DJG A;  2M0R A;  4NDD A;  3NSL A;  1U5I A;  4MRX A;  4N1G A;  3ZNI A;  1OMV A;  3PM2 A;  2L5X B;  2QEB A;  2CT9 A;  1SNL A;  1SMG A;  3D76 A;  2JC2 A;  1Y0V H;  2KBM A;  3D73 A;  3K21 A;  3AKB A;  1X02 A;  3SG2 A;  4CPV A;  5HLV A;  3A4U B;  5I2L A;  1K8U A;  1IJ6 A;  1TOP A;  2F3Z A;  2LNK A;  3PFV A;  1BU3 A;  1TTX A;  3S0D A;  4D1E A;  3GK4 X;  1BT6 A;  1DJH A;  1DF0 B;  1LA3 A;  2IS9 A;  2OPO A;  3BQ3 A;  1NCY A;  1NSH A;  3EKJ A;  3SG6 A;  1GGZ A;  3TZ1 A;  1FI5 A;  2M49 B;  3TS5 B;  1TNX A;  2NCP A;  4JD9 A;  5EL2 A;  4AQI A;  1Y1U A;  1DT7 B;  1NIW A;  2JOJ A;  2L0P A;  2QEH A;  1UWO A;  2PAL A;  4FTG A;  3JTD B;  1SW8 A;  1SL9 A;  2L4H A;  2KI6 C;  1XFU O;  3DVJ A;  1XA5 A;  4DS7 A;  1YX7 A;  2LLT A;  1LA0 A;  1RK9 A;  1REC A;  2KFH A;  2P70 A;  1WRK A;  1MUX A;  3DYE A;  4YGE B;  1EJ3 A;  5I8N A;  3D77 A;  1B8L A;  3TUY B;  1A2X A;  1N2D A;  1XFZ O;  2JT8 A;  3SS5 A;  5G08 A;  1IGV A;  4PHM A;  1JF0 A;  3NHI A;  3KF9 A;  3AAK A;  3R1O A;  2PSR A;  4NDC A;  2FJY A;  1GQM A;  1SCM B;  1BJF A;  3DF0 B;  4WQ2 A;  5AEQ A;  1SSE B;  4GFT A;  2GGM A;  2WOS A;  1SBJ A;  2K61 A;  1WLM A;  5HKW A;  2BKI B;  1NPQ A;  3HCM A;  2PYQ A;  1WLZ A;  3GK1 A;  3CR5 X;  2BEC A;  4CFQ A;  2L2E A;  1QLS A;  3BXK A;  3I5G C;  2LVK A;  3PLF B;  4P2Y B;  2L50 A;  3NSK A;  3QRX A;  1TCO B;  1K90 D;  2LC5 A;  4FQO A;  4I5L B;  2LV7 A;  5TNC A;  1YVH A;  1KFU L;  5DKQ A;  1ZUZ A;  3UO9 A;  1K94 A;  1RJV A;  3ICB A;  4DUQ A;  3CZT X;  1QWV A;  2HQW A;  2VRG A;  2KAY A;  1DC1 A;  4C0L A;  2KFG A;  1NWD A;  3BOW A;  3CR2 A;  4CID A;  4M2P A;  4M2Q A;  1KK8 B;  2I18 A;  2LVJ A;  1DJI A;  5AXI A;  3NGV A;  1EL4 A;  1KQM C;  4QJ5 B;  3PN7 C;  4ORA B;  4PCW A;  1L7Z A;  1YUS A;  2ZKM X;  1C3Z A;  4YGD B;  1PRW A;  2HET A;  3EK4 A;  1ALV A;  2H2K A;  3OX6 A;  3MSE B;  2QAC A;  1SR6 C;  1ODB A;  1M46 A;  3JVT B;  1IRJ A;  1IJ5 A;  1XO5 A;  2H8V A;  1G8I A;  2WCF A;  1KFU S;  2G2B A;  1CTR A;  2KI4 B;  3AAJ A;  4NQG A;  1BMO A;  3EVR A;  2QEV A;  5DKR A;  3SG3 A;  5D3O A;  1V1F A;  4P5O E;  5PAL A;  2PMY A;  1UHJ A;  3IVT A;  3S0F A;  2G9B A;  3BUM B;  3I5I C;  1QIW A;  1CDL A;  1UHN A;  1EH2 A;  1SL8 A;  3R72 A;  3D75 A;  1MF8 B;  3B6X A;  2Q4U A;  1TWO A;  1K95 A;  3OX5 A;  4YRU A;  1AP4 A;  4PE4 A;  1B8C A;  4GGF C;  3A8R A;  2Y4Q A;  4MLW A;  2BL0 C;  1WDC B;  2FCD A;  2WC6 A;  3O78 A;  2BCB A;  4PT1 A;  1KSO A;  2BCX A;  2K2A A;  3BFB A;  4GAO A;  3SG7 A;  3EK7 A;  2AAO A;  1OZS A;  2M1K B;  2WC8 A;  1Y1X A;  2JTT A;  3B86 A;  3DY9 A;  2MRD A;  1KFX L;  4JQ0 D;  1LXF C;  4YGA A;  2OS8 C;  2NXQ A;  4M2O A;  2FCE A;  4U8D A;  3FWC A;  2CNP A;  3SS3 A;  1KCY A;  2F33 A;  1MWN A;  4L9M A;  2MHH A;  2Y1N A;  5CSJ A;  1B1G A;  1AUI B;  3BYA A;  3VRP A;  1G4Y R;  3CGA A;  4HRG A;  1RRO A;  1S5G Z;  3FE6 A;  3D74 A;  2OTG C;  2EGD A;  3D0Y A;  3O4Y A;  3B88 A;  2KLE A;  2KPH A;  1WRL A;  4PHJ A;  2GGZ A;  1CNP A;  3LK0 A;  3BUX B;  1IKU A;  4JKT A;  3HX4 A;  4YGB B;  3O2P A;  3OP0 A;  3WXA A;  1YRT B;  2KGB C;  1YX8 A;  2LUX A;  1MR8 A;  4PE7 A;  1BOC A;  2I94 A;  3I5G B;  3D10 A;  1C07 A;  1KFX S;  2LLU A;  2F8P A;  2ZFD A;  1PK0 D;  4INW A;  2ZRT A;  2KGR A;  5I94 A;  5HKY A;  2JU0 A;  4XYN A;  3IQO A;  4HRE E;  3QME A;  2KLD A;  4GUK A;  1L2O C;  2ZN9 A;  1Y6W A;  4PE1 A;  4IJ7 A;  1OW4 A;  2WCB A;  1ZOT B;  1DVI A;  3FE9 A;  3IQQ A;  1N65 A;  2Y1M A;  3EVU A;  5FYX A;  4ICB A;  1TRF A;  3EVV A;  3PN7 B;  2COL B;  2WCM A;  5CSN A;  2QEO A;  2PRU A;  2WCH A;  2WND A;  1UUR A;  2JRF A;  3DD4 A;  4YI8 A;  1NX0 A;  2ZND A;  2RGI A;  1OMR A;  1DJY A;  1CLL A;  3KPX A;  1SR6 B;  2LHI A;  4DCK A;  1CDM A;  1SYM A;  5K89 A;  1CLM A;  2LVI A;  2BNX A;  1J7O A;  1QX5 B;  5I2Q A;  1K93 D;  1TUZ A;  1K2H A;  1S5G Y;  2M9G A;  1S6C A;  2M97 A;  3LK1 A;  1A03 A;  1B4C A;  2K7C A;  5J3X A;  1TIZ A;  3CWG A;  5HL1 A;  1F8H A;  2B1U A;  5DKN A;  2M7N A;  3I5I B;  1S6I A;  2MAZ A;  1TN4 A;  2GV5 A;  1RTP 1;  1OOJ A;  1NYA A;  1N0Y A;  2L4I A;  4XJK A;  2KQ6 A;  4USL A;  3SJS A;  3UNW A;  2JZI A;  1B8R A;  3EK8 A;  1XVJ A;  4MEW A;  3SIA A;  2EC6 C;  1BR4 B;  1DGV A;  2D8N A;  2KAX A;  3SS4 A;  3I5H C;  3FS7 A;  4KYN A;  4CFR A;  2BL0 B;  3B87 A;  1A75 A;  1IQ3 A;  1PVB A;  4QJ3 B;  2BE4 A;  2WCL A;  1IQ5 A;  3R1V A;  4YI9 A;  2QDI A;  3RZS A;  1HQV A;  2YGU A;  1JBA A;  3N7H A;  4YGC B;  2MLE C;  3R1P A;  4WQ3 A;  1Z2C B;  3D78 A;  2LM5 A;  2NZ0 A;  3WHT B;  4OCI A;  1F71 A;  1FI6 A;  2AUC A;  2A4J A;  1CKK A;  1JF2 A;  2KYF A;  2BAP A;  2CXJ A;  2M1U A;  1UHK A;  2GTE A;  5AAN A;  2NLN A;  3SG5 A;  1EXR A;  3OGN A;  1S3P A;  4GNK B;  3RM1 A;  1IH0 A;  1QV0 A;  2K0J A;  3F45 A;  2LLS A;  3S0G A;  1M63 B;  2JWW A;  2LMT A;  1CFF A;  2JT0 A;  4MRY A;  2ZN8 A;  1DEL A;  2WC5 A;  1SRA A;  1V1G A;  2R2I A;  2KAV A;  1XFV O;  3S0E A;  1PUL A;  4BY5 A;  2WCE A;  3TDU A;  3AKA A;  3BFH A;  1U5I B;  3KO0 A;  1B47 A;  4ZCU A;  4ZCV A;  2F3Y A;  1DF0 A;  1R2U A;  2BE6 A;  2L51 A;  4PE0 A;  2KHN A;  1B9A A;  1F54 A;  1W7I B;  3NHT A;  2CBL A;  1PAL A;  2PVB A;  1RFJ A;  1UHI A;  1DMO A;  1HT9 A;  1JUO A;  1QX7 A;  3SG4 A;  4Q04 A;  1A4P A;  1T14 A;  2F2O A;  2M8U A;  1Y1A A;  1D1O A;  3WNX B;  2TN4 A;  3NSI A;  1OZO A;  3NSO A;  4JPZ B;  5KTY A;  3GK2 A;  1PVA A;  3OB2 B;  2KBI A;  4MSP A;  1SY9 A;  3DVK A;  1ZMZ A;  1MHO A;  2MLF C;  1WRZ A;  2PAS A;  5HYD A;  3CTN A;  1NUB A;  3CZ0 A;  3OB1 B;  2FJU B;  1J1E A;  1UHH A;  3TUY C;  4I5K A;  1PSB A;  1J7R A;  1QTX A;  1CFD A;  1XFX O;  1QVI Z;  2JQ6 A;  4WRI A;  2MBX A;  2WCJ A;  1UUS A;  5I2O A;  4F7F A;  1QIV A;  4MN0 A;  5DIC A;  1YRU B;  4INX A;  3OHM B;  4OZD A;  2K60 A;  2M7L A;  3VRO A;  1XFR A;  1K9U A;  2L98 A;  1P28 A;  3DF0 A;  3VRR A;  1SCM C;  1WY9 A;  1MQ1 A;  3PSR A;  2ZRS A;  2LHL A;  4PHN A;  3KHE A;  1DJW A;  1M45 A;  1S6J A;  5HKZ A;  1NX2 A;  5AER A;  1S36 A;  1J7P A;  1TNQ A;  4I5J A;  4JWQ A;  1IG5 A;  1F4O A;  1KWO C;  3S0B A;  1YUT A;  1YVL A;  1M31 A;  3CAB A;  1H8B A;  2HQ8 A;  1QLK A;  1AJ4 A;  2EC6 B;  1C7W A;  1K9P A;  3L4L A;  3PM8 A;  1J55 A;  2BBN A;  3I5H B;  3I5F C;  2KYC A;  1EG3 A;  2QPT A;  1CM1 A;  3Q8I A;  4NDB A;  2K7D A;  4IL1 A;  1Q80 A;  2M29 A;  3OBV A;  5FI2 A;  5AFP A;  1KK8 C;  1CM4 A;  1QV1 A;  1CFC A;  2I2R E;  4A4C A;  4MZL A;  1LS8 A;  3RLZ A;  1GM0 A;  5IBW A;  1YR5 A;  4PDZ A;  1DGU A;  1JWD A;  1OE9 B;  2LAN A;  1SPY A;  3BOW B;  1FW4 A;  1NP8 A;  3CR4 X;  1KQM B;  2P71 A;  4ETO A;  1DEK A;  2KFF A;  3L47 A;  4E68 A;  4TNC A;  1QVI Y;  3CZ2 A;  3JVT C;  1J7Q A;  1SCV A;  3CS1 A;  4HSZ A;  1CB1 A;  2KI4 C;  4YBH B;  4OVN F;  1S26 D;  3CYZ A;  3EG5 B;  4C0K A;  1BG1 A;  1NX1 A;  3C1V A;  1C7V A;  1CFP A;  2E30 A;  2WOR A;  1LKJ A;  1NCX A;  3L4A A;  1IIO A;  4N5X A;  1QX2 A;  1AJ5 A;  1QJT A;  4MZK A;  1A29 A;  1AVS A;  1WDC C;  1G33 A;  1TNP A;  2V53 A;  3GOF A;  5KSZ A;  3EKH A;  2KQY A;  1DTL A;  3DXL A;  2M3W A;  1DQE A;  2KNE A;  1MXL C;  2O5G A;  1LIN A;  2P6B B;  3O6B A;  1LVC D;  5F6T A;  1DJZ A;  4OV2 A;  2JPT A;  1MXE A;  1PSR A;  2WCK A;  1FPW A;  1SL7 A;  2ISD A;  1CDN A;  2HPS A;  1CMG A;  5B8I B;  2AMI A;  3FE8 A;  3LLE A;  4GPL B;  1JSA A;  3FIA A;  1KK7 Z;  2K2F A;  5D7F A;  5KU1 A;  2OS8 B;  3BJH A;  1M39 A;  2Y5I A;  3PJI A;  1VRK A;  1TCF A;  1SK6 D;  4MZJ A;  4OKH A;  2L2C A;  2I7A A;  1IWQ A;  3FWB A;  3H4S E;  1FBV A;  4CLN A;  2KOT A;  1YTZ C;  5JJG A;  1B7T Z;  1KQV A;  1GJY A;  1OOG A;  2OTG B;  2K8M B;  1BOD A;  1TNW A;  3D0Y B;  1YUU A;  1KWO B;  3S0A A;  1XFW O;  2KDH A;  4I5N B;  3CDN A;  2SAS A;  2ERB A;  2HF5 A;  4PHK A;  5FI7 A;  5CSF A;  4A4B A;  1GGW A;  3I5F B;  1QXP A;  2LCP A;  1ORG A;  1CLB A;  1JFK A;  4ORC B;  2JXC A;  1FF1 A;  1OSA A;  1J1D A;  1TUJ A;  1W9Z A;  2LE9 B;  3BFA A;  2FOT A;  1JC2 A;  1XFY O;  4MVF A;  1R6P A;  1CDP A;  1ALW A;  2KI6 D;  5JOL A;  5BPJ A;  3VRQ A;  3LL8 B;  1H4B A;  2KSP A;  1QAT A;  5D69 A;  3TS5 C;  2BCA A;  5ER5 A;  3TDI A;  2LVV A;  3CLN A;  1S1E A;  3O4X A;  1L2O B;  1NX3 A;  1RWY A;  3JTD C;  1BLQ A;  2NCO A;  4R1E A;  1C3Y A;  2SCP A;  4AQJ A;  4ORB B;  5ER4 X;  4N1F A;  5FI6 A;  2MJW B;  1CMF A;  1KK7 Y;  1BR1 B;  2L5Y A;  1YUR A;  3VGO A;  5CSI A;  1QS7 A;  2BKH B;  1W7J B; 
#chains in the Genus database with same CATH homology
 3M0W A;  3DVE A;  1K9K A;  1JFJ A;  3PAL A;  4OR9 B;  1ZAC A;  1XK4 A;  2JXL A;  1KSM A;  1B7T Y;  1SKT A;  1XK4 C;  2K7B A;  1OMD A;  2MA2 A;  3ZWH A;  2LMU A;  2JTZ A;  2JT3 A;  2EHB A;  2JNX A;  1ZFS A;  4MBE A;  2LP3 A;  2Q91 A;  3NXA A;  4GGF A;  1BF5 A;  5HLO A;  4DIR A;  2DOQ A;  2LUC A;  2K7O A;  3E3R A;  4C0J A;  4UPG A;  4BY4 A;  2CTN A;  4XJK B;  1UP5 A;  3TDZ A;  1XYD A;  2H61 A;  2F2P A;  4QJ4 B;  1OQP A;  2E6W A;  4AOM A;  2H61 C;  3LCP C;  3PAT A;  1DJX A;  3BUN B;  2JUL A;  1F70 A;  2CCM A;  4GGN A;  5GQQ C;  4DRW A;  3KEV A;  1NCZ A;  2LMV A;  3BUO B;  1A75 B;  3BUW B;  3IF7 A;  1E8A A;  4F0Z B;  1AHR A;  3WHU B;  1F4Q A;  2LAP A;  1EG4 A;  2JNF A;  3SIB A;  2BBM A;  3VRN A;  2ZNE A;  4GBA A;  5CPV A;  2O60 A;  1K96 A;  4PAL A;  4HRH A;  2LP2 A;  3DVM A;  1AK8 A;  1F55 A;  1QAS A;  1DJG A;  2M0R A;  4NDD A;  3NSL A;  1U5I A;  4MRX A;  4N1G A;  3ZNI A;  1OMV A;  2L5X B;  2CT9 A;  1SNL A;  1SMG A;  2JC2 A;  1Y0V H;  2KBM A;  3K21 A;  3AKB A;  1X02 A;  3SG2 A;  4CPV A;  5HLV A;  3A4U B;  5I2L A;  1K8U A;  1IJ6 A;  1TOP A;  2F3Z A;  2LNK A;  3PFV A;  1BU3 A;  1TTX A;  4D1E A;  3GK4 X;  1BT6 A;  1DJH A;  1DF0 B;  1LA3 A;  2IS9 A;  2OPO A;  3BQ3 A;  1NCY A;  1NSH A;  3EKJ A;  3SG6 A;  1GGZ A;  3TZ1 A;  1FI5 A;  2M49 B;  3TS5 B;  1TNX A;  2NCP A;  1DT7 B;  4AQI A;  1Y1U A;  1NIW A;  2JOJ A;  2L0P A;  1UWO A;  2PAL A;  4FTG A;  3JTD B;  1SW8 A;  1SL9 A;  2L4H A;  2KI6 C;  1XFU O;  3DVJ A;  1XA5 A;  4DS7 A;  1YX7 A;  2LLT A;  1LA0 A;  1RK9 A;  1REC A;  2KFH A;  1WRK A;  1MUX A;  4YGE B;  1EJ3 A;  5I8N A;  1B8L A;  3TUY B;  1A2X A;  1N2D A;  1XFZ O;  2JT8 A;  5G08 A;  1IGV A;  4PHM A;  1JF0 A;  3KF9 A;  3AAK A;  2PSR A;  4NDC A;  1GQM A;  1SCM B;  1BJF A;  3DF0 B;  4WQ2 A;  5AEQ A;  4GFT A;  2GGM A;  2WOS A;  1SBJ A;  2K61 A;  1WLM A;  5HKW A;  2BKI B;  1NPQ A;  3HCM A;  1WLZ A;  3GK1 A;  3CR5 X;  2BEC A;  4CFQ A;  2L2E A;  1QLS A;  3BXK A;  3I5G C;  2LVK A;  3PLF B;  4P2Y B;  2L50 A;  3NSK A;  3QRX A;  1TCO B;  1K90 D;  2LC5 A;  4FQO A;  4I5L B;  2LV7 A;  5TNC A;  1YVH A;  1KFU L;  5DKQ A;  1ZUZ A;  1K94 A;  1RJV A;  3ICB A;  4DUQ A;  3CZT X;  2HQW A;  2VRG A;  2KAY A;  4C0L A;  2KFG A;  1NWD A;  3BOW A;  3CR2 A;  4CID A;  4M2P A;  4M2Q A;  1KK8 B;  2I18 A;  2LVJ A;  1DJI A;  5AXI A;  1EL4 A;  1KQM C;  4QJ5 B;  3PN7 C;  4ORA B;  4PCW A;  1L7Z A;  1YUS A;  2ZKM X;  4YGD B;  1PRW A;  2HET A;  3EK4 A;  1ALV A;  2H2K A;  3OX6 A;  3MSE B;  2QAC A;  1SR6 C;  1ODB A;  1M46 A;  3JVT B;  1IRJ A;  1IJ5 A;  1XO5 A;  1G8I A;  2WCF A;  1KFU S;  2G2B A;  1CTR A;  2KI4 B;  3AAJ A;  4NQG A;  1BMO A;  3EVR A;  5DKR A;  3SG3 A;  1V1F A;  4P5O E;  5PAL A;  2PMY A;  1UHJ A;  2G9B A;  3BUM B;  3I5I C;  1QIW A;  1CDL A;  1UHN A;  1EH2 A;  1SL8 A;  1MF8 B;  2Q4U A;  1K95 A;  3OX5 A;  4YRU A;  1AP4 A;  4PE4 A;  1B8C A;  4GGF C;  3A8R A;  2Y4Q A;  4MLW A;  2BL0 C;  1WDC B;  2FCD A;  3O78 A;  2BCB A;  1KSO A;  2BCX A;  2K2A A;  4GAO A;  3SG7 A;  3EK7 A;  2AAO A;  1OZS A;  2M1K B;  2WC8 A;  1Y1X A;  2JTT A;  4YGA A;  2MRD A;  1KFX L;  4JQ0 D;  1LXF C;  2OS8 C;  2NXQ A;  4M2O A;  2FCE A;  4U8D A;  3FWC A;  2CNP A;  1KCY A;  2F33 A;  1MWN A;  4L9M A;  2MHH A;  2Y1N A;  5CSJ A;  1B1G A;  1AUI B;  3BYA A;  3VRP A;  1G4Y R;  3CGA A;  4HRG A;  1RRO A;  1S5G Z;  2OTG C;  2EGD A;  3D0Y A;  3O4Y A;  1WRL A;  4PHJ A;  2GGZ A;  1CNP A;  3LK0 A;  3BUX B;  1IKU A;  3HX4 A;  4YGB B;  3O2P A;  3OP0 A;  3WXA A;  1YRT B;  2KGB C;  1YX8 A;  2LUX A;  1MR8 A;  4PE7 A;  1BOC A;  2I94 A;  3I5G B;  3D10 A;  1C07 A;  1KFX S;  2LLU A;  2F8P A;  2ZFD A;  1PK0 D;  2ZRT A;  2KGR A;  5HKY A;  2JU0 A;  4XYN A;  3IQO A;  4HRE E;  4GUK A;  1L2O C;  2ZN9 A;  1Y6W A;  4PE1 A;  2WCB A;  1ZOT B;  1DVI A;  3IQQ A;  1N65 A;  2Y1M A;  3EVU A;  5FYX A;  4ICB A;  1TRF A;  3EVV A;  3PN7 B;  2COL B;  5CSN A;  2PRU A;  2WND A;  1UUR A;  2JRF A;  3DD4 A;  4YI8 A;  1NX0 A;  2ZND A;  2RGI A;  1OMR A;  1DJY A;  1CLL A;  3KPX A;  1SR6 B;  2LHI A;  4DCK A;  1CDM A;  1SYM A;  5K89 A;  1CLM A;  2LVI A;  1J7O A;  1QX5 B;  5I2Q A;  1K93 D;  1K2H A;  1S5G Y;  2M9G A;  1S6C A;  2M97 A;  3LK1 A;  1A03 A;  1B4C A;  2K7C A;  5J3X A;  1TIZ A;  3CWG A;  1F8H A;  2B1U A;  5DKN A;  2M7N A;  3I5I B;  1S6I A;  2MAZ A;  1TN4 A;  2GV5 A;  1RTP 1;  1OOJ A;  1NYA A;  1N0Y A;  2L4I A;  4XJK A;  2KQ6 A;  4USL A;  3SJS A;  2JZI A;  1B8R A;  3EK8 A;  1XVJ A;  4MEW A;  3SIA A;  2EC6 C;  1BR4 B;  1DGV A;  2D8N A;  2KAX A;  3I5H C;  3FS7 A;  4CFR A;  2BL0 B;  1A75 A;  1IQ3 A;  1PVB A;  4QJ3 B;  2BE4 A;  1IQ5 A;  4YI9 A;  1HQV A;  1JBA A;  4YGC B;  2MLE C;  4WQ3 A;  1FI6 A;  3WHT B;  1F71 A;  2LM5 A;  2NZ0 A;  4OCI A;  2AUC A;  2A4J A;  1CKK A;  1JF2 A;  2KYF A;  2CXJ A;  2M1U A;  1UHK A;  5AAN A;  2NLN A;  3SG5 A;  1EXR A;  1IH0 A;  1S3P A;  4GNK B;  3RM1 A;  1QV0 A;  2K0J A;  3F45 A;  2LLS A;  1M63 B;  2JWW A;  2LMT A;  1CFF A;  2JT0 A;  4MRY A;  2ZN8 A;  1SRA A;  1V1G A;  2R2I A;  2KAV A;  1XFV O;  4BY5 A;  1PUL A;  2WCE A;  3TDU A;  3AKA A;  1U5I B;  3KO0 A;  1B47 A;  4ZCU A;  4ZCV A;  2F3Y A;  1DF0 A;  1R2U A;  2BE6 A;  2L51 A;  4PE0 A;  2KHN A;  1B9A A;  1F54 A;  1W7I B;  2CBL A;  1PAL A;  2PVB A;  1RFJ A;  1UHI A;  1DMO A;  1HT9 A;  1JUO A;  1QX7 A;  3SG4 A;  4Q04 A;  1A4P A;  2F2O A;  2M8U A;  1Y1A A;  1D1O A;  2TN4 A;  3NSI A;  1OZO A;  3NSO A;  4JPZ B;  5KTY A;  3GK2 A;  1PVA A;  3OB2 B;  2KBI A;  4MSP A;  1SY9 A;  3DVK A;  1ZMZ A;  1MHO A;  2MLF C;  1WRZ A;  2PAS A;  5HYD A;  3CTN A;  1NUB A;  3OB1 B;  2FJU B;  1J1E A;  1UHH A;  3TUY C;  4I5K A;  1PSB A;  1J7R A;  1QTX A;  1CFD A;  1XFX O;  1QVI Z;  2JQ6 A;  4WRI A;  2MBX A;  1UUS A;  5I2O A;  1QIV A;  4MN0 A;  1YRU B;  3OHM B;  2M7L A;  3VRO A;  3WNX B;  1K9U A;  2L98 A;  3DF0 A;  3VRR A;  1SCM C;  1WY9 A;  1MQ1 A;  3PSR A;  2ZRS A;  2LHL A;  4PHN A;  3KHE A;  1DJW A;  1M45 A;  1S6J A;  5HKZ A;  1NX2 A;  5AER A;  1S36 A;  1J7P A;  1TNQ A;  4I5J A;  4JWQ A;  1IG5 A;  1F4O A;  1KWO C;  1YUT A;  1YVL A;  1M31 A;  1H8B A;  2HQ8 A;  1QLK A;  1AJ4 A;  2EC6 B;  1C7W A;  1K9P A;  3PM8 A;  1J55 A;  2BBN A;  3I5H B;  3I5F C;  2KYC A;  1EG3 A;  2QPT A;  1CM1 A;  4NDB A;  2K7D A;  4IL1 A;  1Q80 A;  2M29 A;  5AFP A;  1KK8 C;  1CM4 A;  1QV1 A;  1CFC A;  2I2R E;  4A4C A;  4MZL A;  3RLZ A;  5IBW A;  1YR5 A;  4PDZ A;  1DGU A;  1JWD A;  1OE9 B;  2LAN A;  1SPY A;  3BOW B;  1FW4 A;  1NP8 A;  3CR4 X;  1KQM B;  4ETO A;  2KFF A;  4E68 A;  4TNC A;  1QVI Y;  3JVT C;  1J7Q A;  1SCV A;  3CS1 A;  4HSZ A;  1CB1 A;  2KI4 C;  4YBH B;  4OVN F;  1S26 D;  4C0K A;  1BG1 A;  1NX1 A;  3C1V A;  1C7V A;  1CFP A;  2E30 A;  2WOR A;  1LKJ A;  1NCX A;  4N5X A;  1QX2 A;  1AJ5 A;  1QJT A;  4MZK A;  1A29 A;  1AVS A;  1WDC C;  1G33 A;  1TNP A;  2V53 A;  3GOF A;  5KSZ A;  3EKH A;  2KQY A;  1DTL A;  2M3W A;  2KNE A;  1MXL C;  2O5G A;  1LIN A;  2P6B B;  3O6B A;  1LVC D;  5F6T A;  1DJZ A;  4OV2 A;  2JPT A;  1MXE A;  1PSR A;  1FPW A;  1SL7 A;  2ISD A;  1CDN A;  2HPS A;  1CMG A;  5B8I B;  2AMI A;  1JSA A;  3LLE A;  4GPL B;  3FIA A;  1KK7 Z;  2K2F A;  5D7F A;  5KU1 A;  2OS8 B;  1M39 A;  2Y5I A;  1VRK A;  1TCF A;  1SK6 D;  4MZJ A;  4OKH A;  2I7A A;  1IWQ A;  3FWB A;  3H4S E;  1FBV A;  4CLN A;  2KOT A;  1YTZ C;  5JJG A;  1B7T Z;  1KQV A;  1GJY A;  2OTG B;  2K8M B;  1BOD A;  1TNW A;  3D0Y B;  1YUU A;  1KWO B;  1XFW O;  2KDH A;  4I5N B;  2SAS A;  2HF5 A;  4PHK A;  5CSF A;  4A4B A;  1GGW A;  3I5F B;  1QXP A;  2LCP A;  1CLB A;  1JFK A;  4ORC B;  2JXC A;  1FF1 A;  1OSA A;  1J1D A;  2LE9 B;  2FOT A;  1JC2 A;  1XFY O;  4MVF A;  1R6P A;  1CDP A;  1ALW A;  2KI6 D;  5JOL A;  5BPJ A;  3VRQ A;  3LL8 B;  1H4B A;  2KSP A;  1QAT A;  5D69 A;  3TS5 C;  2BCA A;  5ER5 A;  3TDI A;  2LVV A;  3CLN A;  1S1E A;  1L2O B;  1NX3 A;  1RWY A;  3JTD C;  1BLQ A;  2NCO A;  4R1E A;  2SCP A;  4AQJ A;  4ORB B;  5ER4 X;  4N1F A;  2MJW B;  1CMF A;  1KK7 Y;  1BR1 B;  1YUR A;  3VGO A;  5CSI A;  1QS7 A;  2BKH B;  1W7J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...