1SR6C

Structure of nucleotide-free scallop myosin s1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated muscle
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
total genus 39
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sr6C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sr6C02
3PN7C 2L2EA 1AJ5A 1L7ZA 1DJXA 1KK7Z 1S1EA 1QATA 1SCMC 2FCDA 2PMYA 3KEVA 1KK7Y 5FYXA 2LMTA 3I5IC 2NCOA 2L51A 2I2RE 3KO0A 3A4UB 2EC6C 5CSFA 4YGAA 5I2QA 2M1KB 4PHJA 1CKKA 3BUOB 2L98A 1RFJA 1UHHA 1CFPA 1KK8C 1QVIZ 3LK1A 2KQYA 1CFDA 2P6BB 1XVJA 1QVIY 1N2DA 1NSHA 3DVJA 2Y5IA 5HKYA 2OS8B 2WCEA 2JRFA 1GGZA 2GV5A 2BKIB 1F8HA 1JFKA 1F4QA 1SMGA 1DJYA 1FPWA 2DOQA 1B8CA 1B8LA 1MR8A 4PE7A 1NX3A 3OX6A 3CGAA 4HRGA 3VRRA 1S26D 4NDCA 4QJ3B 3VROA 1KWOB 1A2XA 4YRUA 1RJVA 1QX7A 1PALA 1SKTA 1V1GA 3O6BA 1K9PA 2LVJA 1XFZO 3I5GC 1C7WA 1MXEA 1WRZA 1XK4C 4YBHB 4TNCA 1X02A 2LP3A 1KFUS 1IKUA 2KDHA 2MHHA 2NCPA 1N0YA 2JXCA 1DTLA 2NXQA 3I5FB 4HRHA 1K96A 4ZCUA 3RM1A 2H61A 1F70A 4I5NB 2H61C 1NP8A 3EKJA 4JPZB 2KGRA 3SIAA 1FBVA 3EK8A 5AEQA 5B8IB 3ICBA 3TUYC 2I18A 4JQ0D 2BL0C 1TRFA 3NSIA 1OZSA 4GAOA 3C1VA 1CB1A 1Y1AA 1NYAA 1V1FA 3TS5B 1DVIA 2CCMA 1XFXO 1KFUL 2JC2A 2KYCA 2L0PA 1LKJA 1YVHA 1A4PA 5JOLA 4MZLA 4CIDA 1YTZC 2KBMA 2L4HA 5ER4X 1SR6C 1J1EA 1QIVA 1WY9A 2E30A 3DVEA 1QLSA 2O60A 3KF9A 5DKRA 1CFFA 2LLTA 2CT9A 1NPQA 2MA2A 1LXFC 1ALWA 2KI6C 1J1DA 2L5XB 5CPVA 2MBXA 5HYDA 2B1UA 2BECA 1DJIA 2OS8C 4L9MA 3EVVA 1XFVO 4YGBB 2JZIA 2FCEA 4GFTA 1QTXA 3TDUA 4ORCB 1CNPA 1B8RA 2LV7A 3F45A 4GPLB 1L2OB 1BMOA 1M46A 2MJWB 2ZFDA 3JTDB 4Q04A 5HKWA 3TDZA 3D0YB 1S6CA 4OR9B 1JFJA 1VRKA 2JWWA 2F8PA 2M7LA 1Q80A 3GK4X 1AUIB 1TTXA 1JSAA 1SL7A 2KFHA 1CM4A 1EG3A 1PRWA 1BR1B 1J7OA 1QS7A 1MF8B 2M1UA 2OPOA 4MSPA 4UPGA 1S6JA 3MSEB 2OTGB 1FW4A 2K8MB 3O78A 3PATA 1DF0B 2WCFA 4OKHA 1YRTB 4A4BA 3FWBA 4GGFA 3DVMA 5D7FA 1CDNA 1NIWA 3FS7A 2GGMA 4OCIA 1EG4A 2PASA 2ZNDA 2LANA 3NSKA 3LLEA 1M39A 3OB2B 1TIZA 1KFXS 2LVIA 4PE4A 2R2IA 2KBIA 3RLZA 4C0JA 3HX4A 5KU1A 4QJ5B 1ZOTB 1CLBA 1H4BA 1ALVA 4XJKB 1XFYO 2M7NA 1GQMA 1KQVA 3WHTB 1WRKA 2KAXA 4I5JA 4PHKA 1EXRA 1YRUB 4ORBB 4MBEA 4F0ZB 2CXJA 1J7RA 3FWCA 1QLKA 2TN4A 4YGCB 1KSMA 2CBLA 3BOWA 1RECA 1Y6WA 1LA0A 2JNFA 4MRYA 4DS7A 1KFXL 2JULA 1CLLA 1WRLA 1J55A 2JT3A 3IF7A 1B9AA 2BKHB 2KHNA 2KYFA 5D69A 2SCPA 3CZTX 1B47A 1BR4B 5GQQC 1A29A 3AKAA 1BODA 3IQOA 2K7BA 2M8UA 1WLZA 1SCVA 2LMUA 4MVFA 2KI6D 5AERA 3BQ3A 1CDLA 1UHNA 1SPYA 2E6WA 3SG4A 1OE9B 2ZN9A 1L2OC 4PE0A 2O5GA 2ZRSA 1SL9A 4YGEB 3JVTB 4PDZA 1M63B 1A75B 1PVBA 4AQIA 2F3ZA 2LMVA 5CSNA 2LVKA 1QX2A 2Q4UA 1AK8A 4OVNF 2L50A 2OTGC 4I5LB 1XK4A 1PULA 1UUSA 1ODBA 1CDPA 4MRXA 1ZFSA 2H2KA 1EH2A 1U5IB 1OQPA 4DRWA 4M2PA 1SNLA 1JWDA 4NDBA 5CSJA 1OOJA 2D8NA 2RGIA 2QACA 1QASA 3OHMB 1RK9A 1EJ3A 1AJ4A 1BU3A 1IQ5A 1TNPA 2BE4A 4XJKA 1SBJA 1XO5A 2JOJA 1R2UA 4PE1A 3O2PA 2HQ8A 2JU0A 2KOTA 3FIAA 1K2HA 5KTYA 2K7CA 2F33A 2LP2A 3EKHA 3GOFA 1IH0A 1SL8A 2LUCA 1HT9A 1UHJA 2A4JA 1FF1A 3DF0B 2G2BA 4M2OA 1ZACA 2HETA 2KFFA 1WDCB 2M9GA 2LHIA 4D1EA 2PSRA 3CTNA 3TDIA 1M31A 2GGZA 4FTGA 1BT6A 1XFWO 5JJGA 2BCXA 2PALA 1AHRA 5BPJA 1JC2A 2KSPA 5F6TA 1NX1A 2JT0A 1OSAA 3JVTC 5DKQA 2MRDA 4WQ2A 2F2OA 2LAPA 1KWOC 1BLQA 2KI4B 4BY4A 4WQ3A 1DJWA 2HF5A 3CR5X 1SRAA 4I5KA 2WORA 2KAYA 1NX0A 1RTP1 3D10A 4MN0A 3NXAA 1QIWA 3I5FC 5G08A 4QJ4B 2MLEC 3PALA 2LE9B 1TN4A 4N1GA 4ORAB 1K90D 3EK7A 2Y1MA 1A03A 1S36A 3EK4A 1N65A 2LUXA 1G8IA 1M45A 4MZJA 4DCKA 2K0JA 2WNDA 1YURA 2JPTA 3OB1B 5IBWA 2ISDA 1IRJA 1B7TZ 1YUSA 3AKBA 4GBAA 4NQGA 2MLFC 3TS5C 1FI6A 1NUBA 2BCAA 4P5OE 1R6PA 1C07A 4N5XA 5ER5A 3WXAA 1B7TY 5I8NA 1S3PA 1TNXA 2JNXA 3CR4X 2SASA 3CR2A 1JUOA 3BUWB 2V53A 1PSRA 2KFGA 1UWOA 5PALA 5K89A 2M49B 4ETOA 3PSRA 2Q91A 1B4CA 1YUUA 3TUYB 1G33A 1RROA 1NCZA 2EGDA 3I5HB 2KNEA 2LM5A 1WDCC 2AMIA 1DJGA 4A4CA 2LC5A 4U8DA 2AAOA 4C0KA 2CTNA 2EHBA 1TCFA 1MQ1A 5HKZA 4C0LA 5DKNA 1NCYA 1K8UA 2WC8A 3NSOA 3AAKA 1JBAA 1KQMB 1CMFA 1K94A 4IL1A 1DGUA 1LINA 1IJ6A 3GK2A 1GJYA 3JTDC 1SR6B 1D1OA 1IWQA 4PCWA 3D0YA 1K9UA 3DVKA 5HLVA 1UHIA 4XYNA 1JF0A 2I94A 1K9KA 1DGVA 1YX7A 2IS9A 4MLWA 2LLUA 4P2YB 1DJZA 3H4SE 1KSOA 1LVCD 3LK0A 2JTZA 2KI4C 1NX2A 4PHMA 3ZNIA 2Y1NA 3SIBA 4WRIA 3O4YA 1XFUO 1AP4A 1J7QA 3VGOA 1DF0A 3K21A 3TZ1A 4USLA 1OMVA 2MAZA 4BY5A 1NWDA 3CLNA 1SW8A 3PM8A 3SG5A 1MUXA 1ZMZA 1IGVA 5I2OA 1WLMA 1YX8A 1BOCA 1YUTA 2K2AA 1CTRA 2LNKA 1TOPA 1TNWA 1MWNA 3ZWHA 3EVRA 2KGBC 5CSIA 3WHUB 4FQOA 1MXLC 1ZUZA 2COLB 3IQQA 1AVSA 4YGDB 1CM1A 1C7VA 2L4IA 2M97A 4DUQA 2BE6A 4ICBA 4GUKA 5AXIA 3PLFB 5AFPA 3SG6A 2FJUB 1Y1UA 4N1FA 3BUNB 4GGNA 4HSZA 4CFRA 2KAVA 1JF2A 2LHLA 4AQJA 1W7JB 2PVBA 3AAJA 3OX5A 1UP5A 2ZN8A 3VRNA 4CFQA 2LVVA 2M0RA 1PK0D 3SG2A 1QV1A 1OMDA 3KHEA 1RWYA 3PFVA 1DT7B 2M3WA 1K93D 2Y4QA 3WNXB 2WOSA 1J7PA 1KCYA 3I5HC 2JXLA 3PN7B 3KPXA 4YI8A 3QRXA 4JWQA 5I2LA 4MEWA 1BF5A 1UURA 2WCBA 1W7IB 1F54A 2NZ0A 4YI9A 3HCMA 1CMGA 2F3YA 1HQVA 2QPTA 1XA5A 1OZOA 1KQMC 4R1EA 1SCMB 3VRQA 2ZKMX 1IG5A 4NDDA 2F2PA 2LCPA 2VRGA 3I5IB 1Y1XA 1Y0VH 3VRPA 5KSZA 3BOWB 3LCPC 2EC6B 2G9BA 4AOMA 1F71A 2K7OA 1BJFA 3M0WA 1A75A 1S5GZ 1KK8B 2HQWA 1OMRA 1MHOA 2BBNA 1BG1A 3SG7A 4M2QA 5AANA 1S5GY 2K2FA 1E8AA 2LLSA 1IJ5A 2BBMA 2JT8A 4DIRA 3SJSA 1U5IA 3E3RA 1TNQA 4GNKB 1K95A 3GK1A 3OP0A 4HREE 3DD4A 1CLMA 3SG3A 2KQ6A 5HLOA 1PSBA 4PHNA 1YVLA 1S6IA 4OV2A 4ZCVA 3EVUA 4E68A 5J3XA 1DJHA 2AUCA 1SK6D 2FOTA 1NCXA 2HPSA 2I7AA 3BXKA 3NSLA 2K7DA 1SY9A 3BUXB 4PALA 1IQ3A 2PRUA 1B1GA 1QX5B 1G4YR 4MZKA 3A8RA 1CFCA 1FI5A 2BCBA 1YR5A 2JQ6A 1LA3A 3I5GB 1TCOB 1PVAA 1QJTA 1F55A 2JTTA 3CS1A 4CPVA 1EL4A 1SYMA 4GGFC 1CDMA 1QXPA 2K61A 2M29A 1F4OA 2ZRTA 3BYAA 1H8BA 1DMOA 2NLNA 3BUMB 1QV0A 3DF0A 4CLNA 1GGWA 2CNPA 3CWGA 3LL8B 1XYDA 2ZNEA 2BL0B 5TNCA 1UHKA
chains in the Genus database with same CATH superfamily
3PN7C 2L2EA 1AJ5A 1L7ZA 3B87A 5K89A 4JKTA 1DJXA 1KK7Z 1OOHA 1S1EA 1QATA 1SCMC 2FCDA 2PMYA 3KEVA 1KK7Y 1P28A 3S0BA 5FYXA 2LMTA 3I5IC 2NCOA 4FQTA 2L51A 2I2RE 3KO0A 3A4UB 2EC6C 5CSFA 4YGAA 5I2QA 2M1KB 4PHJA 1CKKA 3BUOB 2L98A 1RFJA 1UHHA 1TWOA 1Z4HA 1CFPA 1KK8C 1QVIZ 3LK1A 2KQYA 3FE6A 1CFDA 2P6BB 1XVJA 1QVIY 1N2DA 1NSHA 3DVJA 2Y5IA 2FJYA 5HKYA 2OS8B 2WCEA 4F7FA 3UNWA 2JRFA 1GGZA 1IIOA 2KPHA 1DELA 2GV5A 1W9ZA 2BKIB 1F8HA 1JFKA 1F4QA 1SMGA 1DJYA 3S0GA 1FPWA 4INXA 2DOQA 1B8CA 1B8LA 1MR8A 4PE7A 1NX3A 3B86A 2YGUA 3CGAA 3OX6A 4HRGA 3VRRA 1S26D 4NDCA 4QJ3B 4INWA 1KWOB 3VROA 1A2XA 4YRUA 1RJVA 1QX7A 1PALA 1SKTA 1V1GA 3O6BA 3BFBA 1K9PA 2LVJA 1XFZO 3I5GC 1C7WA 1MXEA 1WRZA 1XK4C 4YBHB 4TNCA 1X02A 2LP3A 1KFUS 1IKUA 5D3OA 2KDHA 2MHHA 2NCPA 1N0YA 2JXCA 1DTLA 2NXQA 3I5FB 4HRHA 1K96A 4ZCUA 3RM1A 2H61A 1F70A 4I5NB 2H61C 3R1PA 1NP8A 3EKJA 4JPZB 2KGRA 3SIAA 1FBVA 3EK8A 3D76A 2JPOA 5AEQA 5B8IB 3ICBA 3TUYC 2I18A 4JQ0D 2BL0C 1TRFA 3NSIA 1OZSA 4GAOA 3C1VA 2BNXA 1CB1A 1Y1AA 1NYAA 1V1FA 3TS5B 1DVIA 1SSEB 1XFXO 2CCMA 1KFUL 2JC2A 2KYCA 3PM2A 2L0PA 1LKJA 1YVHA 1A4PA 5JOLA 4MZLA 4CIDA 1YTZC 2KBMA 2L4HA 3BJHA 1SR6C 5ER4X 2QDIA 3OBVA 1J1EA 1QIVA 1WY9A 2E30A 3DVEA 1QLSA 2O60A 3KF9A 5DKRA 1CFFA 2LLTA 2CT9A 3CYZA 3DZTA 3SS4A 3CABA 1NPQA 2MA2A 1LXFC 1ALWA 3R1OA 2KI6C 1J1DA 2L5XB 5CPVA 2MBXA 5HYDA 3IVTA 2WCLA 2B1UA 2BECA 1DJIA 2OS8C 4L9MA 3EVVA 1XFVO 4YGBB 2JZIA 1C3ZA 3S0FA 2FCEA 4GFTA 1QTXA 3TDUA 4ORCB 1CNPA 1B8RA 1TUZA 2LV7A 3F45A 4GPLB 1L2OB 1BMOA 1M46A 2MJWB 2ZFDA 3JTDB 4Q04A 5HKWA 5EL2A 3TDZA 3D0YB 1S6CA 4OR9B 1JFJA 1VRKA 2JWWA 2F8PA 2M7LA 1Q80A 3GK4X 1AUIB 4JD9A 1TTXA 1JSAA 1SL7A 2KFHA 1CM4A 3DXLA 1EG3A 1PRWA 1BR1B 3S0EA 1J7OA 1QS7A 1MF8B 2M1UA 2OPOA 4MSPA 4UPGA 1S6JA 3MSEB 2OTGB 1FW4A 2K8MB 3FE8A 3K1EA 1DF0B 2WCFA 3O78A 3PATA 1YRTB 4A4BA 3FWBA 4GGFA 3FE9A 3DVMA 5D7FA 1CDNA 1NIWA 3FS7A 2GGMA 4OCIA 1EG4A 2PASA 2ZNDA 2LANA 2QEBA 3LLEA 3NSKA 1M39A 3OB2B 1TIZA 1KFXS 2LVIA 4PE4A 2R2IA 2KBIA 3RLZA 4C0JA 3HX4A 5KU1A 4QJ5B 1ZOTB 1CLBA 1H4BA 1ALVA 3DY9A 4XJKB 1XFYO 2M7NA 1GQMA 4OKHA 1KQVA 3WHTB 1WRKA 2KAXA 4I5JA 4PHKA 1EXRA 1YRUB 4ORBB 4MBEA 4F0ZB 2CXJA 1J7RA 3FWCA 1QLKA 2TN4A 4YGCB 1KSMA 2CBLA 3BOWA 1RECA 1Y6WA 1LA0A 2JNFA 2KLDA 4MRYA 4DS7A 1KFXL 2JULA 2WC6A 1CLLA 1WRLA 3B7AA 4PT1A 1J55A 2JT3A 3IF7A 1B9AA 2BKHB 2KHNA 2KYFA 5D69A 2SCPA 5DICA 3CZTX 1B47A 1BR4B 2PYQA 5GQQC 3D74A 1A29A 3AKAA 1BODA 3IQOA 2K7BA 2M8UA 1WLZA 1SCVA 2LMUA 4MVFA 2KI6D 5AERA 3BQ3A 1UHNA 1SPYA 2E6WA 3SG4A 1OE9B 2ZN9A 1L2OC 4PE0A 2O5GA 3D77A 2ZRSA 1Z2CB 3N7HA 1SL9A 4YGEB 3JVTB 4PDZA 1QWVA 1GM0A 1M63B 3UO9A 1A75B 1PVBA 2H8VA 4AQIA 2F3ZA 2LMVA 2QEVA 5CSNA 2LVKA 1QX2A 2Q4UA 1AK8A 4OVNF 2L50A 2OTGC 4I5LB 1XK4A 1PULA 1UUSA 1ODBA 1CDPA 4MRXA 1ZFSA 2H2KA 1EH2A 1U5IB 1OQPA 3OGNA 4DRWA 4M2PA 1SNLA 1JWDA 4NDBA 5CSJA 1OOJA 3B6XA 2D8NA 2RGIA 3NHTA 2QACA 1QASA 3OHMB 1RK9A 1EJ3A 1AJ4A 3SS5A 1BU3A 1IQ5A 1TNPA 2BE4A 4XJKA 1SBJA 1XO5A 2JOJA 1R2UA 3NGVA 4PE1A 3O2PA 1OOIX 2HQ8A 2JU0A 2KOTA 3FIAA 1K2HA 5KTYA 2K7CA 2F33A 2LP2A 3EKHA 3GOFA 1IH0A 1SL8A 3D75A 2LUCA 1HT9A 1UHJA 2A4JA 1FF1A 2QEOA 3DF0B 2G2BA 4M2OA 1ZACA 2HETA 2KFFA 1WDCB 2M9GA 2WCJA 2LHIA 4D1EA 2PSRA 3CTNA 3TDIA 1M31A 1XFRA 2GGZA 4FTGA 1T14A 1BT6A 2BL0B 1ORGA 1XFWO 5JJGA 2BCXA 2PALA 2PQLA 1AHRA 5BPJA 1JC2A 2KSPA 5F6TA 1NX1A 2JT0A 1OSAA 3JVTC 5DKQA 2MRDA 4WQ2A 2P71A 2F2OA 2LAPA 1KWOC 3O4XA 1BLQA 2KI4B 4BY4A 4WQ3A 1DJWA 2HF5A 3CR5X 1SRAA 4I5KA 2WORA 2KAYA 1NX0A 1RTP1 3D10A 4MN0A 3NXAA 1QIWA 3I5FC 5G08A 4QJ4B 2MLEC 3PALA 2LE9B 3CDNA 1TN4A 4N1GA 4ORAB 1K90D 3EK7A 2Y1MA 5FI2A 1A03A 1S36A 3L47A 3EK4A 1N65A 2LUXA 3R72A 1G8IA 1M45A 4MZJA 4DCKA 2K0JA 3BFAA 2P70A 2WNDA 1YURA 2JPTA 3OB1B 5IBWA 2ISDA 1IRJA 1B7TZ 1YUSA 3AKBA 4GBAA 4NQGA 2MLFC 3D78A 3TS5C 1NUBA 2BCAA 4P5OE 1R6PA 1C07A 1FI6A 4N5XA 1DC1A 5ER5A 3WXAA 1B7TY 5I8NA 3S0AA 1S3PA 1TNXA 2JNXA 3CR4X 2SASA 3CR2A 1JUOA 3BUWB 2V53A 1PSRA 2KFGA 1UWOA 5PALA 3SS3A 2M49B 1OOFA 4ETOA 3PSRA 2Q91A 1B4CA 2WCKA 1YUUA 3TUYB 1G33A 1RROA 1NCZA 2EGDA 3VB1A 3I5HB 2KNEA 2LM5A 1DQEA 1WDCC 2AMIA 1DJGA 3CZ2A 4A4CA 2LC5A 4U8DA 2AAOA 4C0KA 2CTNA 1C3YA 2EHBA 1TCFA 3B88A 1MQ1A 3PJIA 5HKZA 3CZ0A 4C0LA 5DKNA 1LS8A 1DEKA 1K8UA 1NCYA 2WC8A 3D73A 3NSOA 3AAKA 5FI7A 1KQMB 1CMFA 3L4AA 1JBAA 1K94A 4IL1A 1DGUA 1LINA 1IJ6A 3RZSA 5I94A 3GK2A 1GJYA 1OOGA 3JTDC 1SR6B 1D1OA 1IWQA 4PCWA 3D0YA 1K9UA 3EG5B 3DVKA 5HLVA 1UHIA 4XYNA 1JF0A 2I94A 1K9KA 1DGVA 1YX7A 2IS9A 4MLWA 2LLUA 4P2YB 1DJZA 3H4SE 3DYEA 1KSOA 1LVCD 3LK0A 2JTZA 2KI4C 1NX2A 4PHMA 3ZNIA 2Y1NA 3SIBA 4WRIA 3O4YA 1XFUO 1AP4A 1J7QA 3VGOA 1DF0A 3K21A 3TZ1A 4USLA 1OMVA 2MAZA 4BY5A 1NWDA 3CLNA 1SW8A 3PM8A 5FI6A 3SG5A 1MUXA 1ZMZA 1IGVA 5I2OA 2QEHA 1WLMA 2KLEA 1YX8A 1OW4A 1BOCA 3QMEA 1YUTA 2K2AA 1CTRA 2LNKA 1TOPA 1TNWA 1MWNA 3ZWHA 3EVRA 2KGBC 5CSIA 3WHUB 4FQOA 1MXLC 1ZUZA 2COLB 3IQQA 1AVSA 4YGDB 1CM1A 1C7VA 2L4IA 2M97A 4DUQA 2BE6A 4ICBA 4GUKA 5AXIA 3PLFB 5AFPA 3SG6A 2FJUB 1Y1UA 4N1FA 3BUNB 4GGNA 4HSZA 4CFRA 2ERBA 2KAVA 1JF2A 2LHLA 4AQJA 1W7JB 2PVBA 3AAJA 3OX5A 1UP5A 2ZN8A 3VRNA 4CFQA 2LVVA 2M0RA 1PK0D 3V2LA 3SG2A 1QV1A 1OMDA 3KHEA 1RWYA 3PFVA 1DT7B 2M3WA 1K93D 2Y4QA 3WNXB 2WOSA 1J7PA 1KCYA 3I5HC 2JXLA 3CZ1A 3BFHA 3PN7B 3KPXA 4YI8A 3QRXA 4JWQA 5I2LA 4MEWA 1BF5A 1UURA 2WCBA 1W7IB 2L5YA 1F54A 2NZ0A 2K60A 3HCMA 3L4LA 4YI9A 1CMGA 2F3YA 1HQVA 2QPTA 1XA5A 1OZOA 1KQMC 5HL1A 4R1EA 2WCMA 1SCMB 3VRQA 2ZKMX 1IG5A 4NDDA 2F2PA 2LCPA 2VRGA 3I5IB 1Y1XA 1Y0VH 3VRPA 5KSZA 2L2CA 3BOWB 3LCPC 2EC6B 2G9BA 4AOMA 3Q8IA 1F71A 2K7OA 1BJFA 3M0WA 1TUJA 1A75A 1S5GZ 3NHIA 1KK8B 2HQWA 1OMRA 1MHOA 2BBNA 1BG1A 3SG7A 4M2QA 3R1VA 1S5GY 2K2FA 5AANA 1E8AA 2LLSA 1IJ5A 2BBMA 2JT8A 2WC5A 4DIRA 3SJSA 1U5IA 3E3RA 1TNQA 4GNKB 1K95A 3GK1A 3OP0A 2GTEA 4HREE 3DD4A 1CLMA 2BAPA 3SG3A 2KQ6A 5HLOA 1PSBA 4PHNA 1YVLA 1S6IA 4OV2A 4ZCVA 2WCHA 3EVUA 4IJ7A 4E68A 5J3XA 1DJHA 2AUCA 1SK6D 2FOTA 1NCXA 2HPSA 2I7AA 3BXKA 3NSLA 2K7DA 1SY9A 3BUXB 4PALA 1IQ3A 2PRUA 1B1GA 1QX5B 1G4YR 4MZKA 3A8RA 1CFCA 1FI5A 2BCBA 1YR5A 2JQ6A 1LA3A 3I5GB 1TCOB 1PVAA 1QJTA 1F55A 4KYNA 3S0DA 2JTTA 3CS1A 4CPVA 1EL4A 1SYMA 4GGFC 1CDMA 1QXPA 2K61A 2M29A 1F4OA 2ZRTA 3BYAA 4OZDA 1H8BA 1DMOA 2NLNA 3BUMB 1QV0A 3DF0A 4CLNA 1GGWA 2CNPA 3CWGA 3LL8B 1XYDA 2ZNEA 1CDLA 5TNCA 1UHKA
chains in the Genus database with same CATH topology
3PN7C 2L2EA 1AJ5A 1L7ZA 1DJXA 1KK7Z 1S1EA 1QATA 1SCMC 2FCDA 2PMYA 3KEVA 1KK7Y 5FYXA 2LMTA 3I5IC 2NCOA 2L51A 2I2RE 3KO0A 3A4UB 2EC6C 5CSFA 4YGAA 5I2QA 2M1KB 4PHJA 1CKKA 3BUOB 2L98A 1RFJA 1UHHA 1CFPA 1KK8C 1QVIZ 3LK1A 2KQYA 1CFDA 2P6BB 1XVJA 1QVIY 1N2DA 1NSHA 3DVJA 2Y5IA 5HKYA 2OS8B 2WCEA 2JRFA 1GGZA 2GV5A 2BKIB 1F8HA 1JFKA 1F4QA 1SMGA 1DJYA 1FPWA 2DOQA 1B8CA 1B8LA 1MR8A 4PE7A 1NX3A 3OX6A 3CGAA 4HRGA 3VRRA 1S26D 4NDCA 4QJ3B 3VROA 1KWOB 1A2XA 4YRUA 1RJVA 1QX7A 1PALA 1SKTA 1V1GA 3O6BA 1K9PA 2LVJA 1XFZO 3I5GC 1C7WA 1MXEA 1WRZA 1XK4C 4YBHB 4TNCA 1X02A 2LP3A 1KFUS 1IKUA 2KDHA 2MHHA 2NCPA 1N0YA 2JXCA 1DTLA 2NXQA 3I5FB 4HRHA 1K96A 4ZCUA 3RM1A 2H61A 1F70A 4I5NB 2H61C 1NP8A 3EKJA 4JPZB 2KGRA 3SIAA 1FBVA 3EK8A 5AEQA 5B8IB 3ICBA 3TUYC 2I18A 4JQ0D 2BL0C 1TRFA 3NSIA 1OZSA 4GAOA 3C1VA 1CB1A 1Y1AA 1NYAA 1V1FA 3TS5B 1DVIA 2CCMA 1XFXO 1KFUL 2JC2A 2KYCA 2L0PA 1LKJA 1YVHA 1A4PA 5JOLA 4MZLA 4CIDA 1YTZC 2KBMA 2L4HA 5ER4X 1SR6C 1J1EA 1QIVA 1WY9A 2E30A 3DVEA 1QLSA 2O60A 3KF9A 5DKRA 1CFFA 2LLTA 2CT9A 1NPQA 2MA2A 1LXFC 1ALWA 2KI6C 1J1DA 2L5XB 5CPVA 2MBXA 5HYDA 2B1UA 2BECA 1DJIA 2OS8C 4L9MA 3EVVA 1XFVO 4YGBB 2JZIA 2FCEA 4GFTA 1QTXA 3TDUA 4ORCB 1CNPA 1B8RA 2LV7A 3F45A 4GPLB 1L2OB 1BMOA 1M46A 2MJWB 2ZFDA 3JTDB 4Q04A 5HKWA 3TDZA 3D0YB 1S6CA 4OR9B 1JFJA 1VRKA 2JWWA 2F8PA 2M7LA 1Q80A 3GK4X 1AUIB 1TTXA 1JSAA 1SL7A 2KFHA 1CM4A 1EG3A 1PRWA 1BR1B 1J7OA 1QS7A 1MF8B 2M1UA 2OPOA 4MSPA 4UPGA 1S6JA 3MSEB 2OTGB 1FW4A 2K8MB 3O78A 3PATA 1DF0B 2WCFA 4OKHA 1YRTB 4A4BA 3FWBA 4GGFA 3DVMA 5D7FA 1CDNA 1NIWA 3FS7A 2GGMA 4OCIA 1EG4A 2PASA 2ZNDA 2LANA 3NSKA 3LLEA 1M39A 3OB2B 1TIZA 1KFXS 2LVIA 4PE4A 2R2IA 2KBIA 3RLZA 4C0JA 3HX4A 5KU1A 4QJ5B 1ZOTB 1CLBA 1H4BA 1ALVA 4XJKB 1XFYO 2M7NA 1GQMA 1KQVA 3WHTB 1WRKA 2KAXA 4I5JA 4PHKA 1EXRA 1YRUB 4ORBB 4MBEA 4F0ZB 2CXJA 1J7RA 3FWCA 1QLKA 2TN4A 4YGCB 1KSMA 2CBLA 3BOWA 1RECA 1Y6WA 1LA0A 2JNFA 4MRYA 4DS7A 1KFXL 2JULA 1CLLA 1WRLA 1J55A 2JT3A 3IF7A 1B9AA 2BKHB 2KHNA 2KYFA 5D69A 2SCPA 3CZTX 1B47A 1BR4B 5GQQC 1A29A 3AKAA 1BODA 3IQOA 2K7BA 2M8UA 1WLZA 1SCVA 2LMUA 4MVFA 2KI6D 5AERA 3BQ3A 1CDLA 1UHNA 1SPYA 2E6WA 3SG4A 1OE9B 2ZN9A 1L2OC 4PE0A 2O5GA 2ZRSA 1SL9A 4YGEB 3JVTB 4PDZA 1M63B 1A75B 1PVBA 4AQIA 2F3ZA 2LMVA 5CSNA 2LVKA 1QX2A 2Q4UA 1AK8A 4OVNF 2L50A 2OTGC 4I5LB 1XK4A 1PULA 1UUSA 1ODBA 1CDPA 4MRXA 1ZFSA 2H2KA 1EH2A 1U5IB 1OQPA 4DRWA 4M2PA 1SNLA 1JWDA 4NDBA 5CSJA 1OOJA 2D8NA 2RGIA 2QACA 1QASA 3OHMB 1RK9A 1EJ3A 1AJ4A 1BU3A 1IQ5A 1TNPA 2BE4A 4XJKA 1SBJA 1XO5A 2JOJA 1R2UA 4PE1A 3O2PA 2HQ8A 2JU0A 2KOTA 3FIAA 1K2HA 5KTYA 2K7CA 2F33A 2LP2A 3EKHA 3GOFA 1IH0A 1SL8A 2LUCA 1HT9A 1UHJA 2A4JA 1FF1A 3DF0B 2G2BA 4M2OA 1ZACA 2HETA 2KFFA 1WDCB 2M9GA 2LHIA 4D1EA 2PSRA 3CTNA 3TDIA 1M31A 2GGZA 4FTGA 1BT6A 1XFWO 5JJGA 2BCXA 2PALA 1AHRA 5BPJA 1JC2A 2KSPA 5F6TA 1NX1A 2JT0A 1OSAA 3JVTC 5DKQA 2MRDA 4WQ2A 2F2OA 2LAPA 1KWOC 1BLQA 2KI4B 4BY4A 4WQ3A 1DJWA 2HF5A 3CR5X 1SRAA 4I5KA 2WORA 2KAYA 1NX0A 1RTP1 3D10A 4MN0A 3NXAA 1QIWA 3I5FC 5G08A 4QJ4B 2MLEC 3PALA 2LE9B 1TN4A 4N1GA 4ORAB 1K90D 3EK7A 2Y1MA 1A03A 1S36A 3EK4A 1N65A 2LUXA 1G8IA 1M45A 4MZJA 4DCKA 2K0JA 2WNDA 1YURA 2JPTA 3OB1B 5IBWA 2ISDA 1IRJA 1B7TZ 1YUSA 3AKBA 4GBAA 4NQGA 2MLFC 3TS5C 1FI6A 1NUBA 2BCAA 4P5OE 1R6PA 1C07A 4N5XA 5ER5A 3WXAA 1B7TY 5I8NA 1S3PA 1TNXA 2JNXA 3CR4X 2SASA 3CR2A 1JUOA 3BUWB 2V53A 1PSRA 2KFGA 1UWOA 5PALA 5K89A 2M49B 4ETOA 3PSRA 2Q91A 1B4CA 1YUUA 3TUYB 1G33A 1RROA 1NCZA 2EGDA 3I5HB 2KNEA 2LM5A 1WDCC 2AMIA 1DJGA 4A4CA 2LC5A 4U8DA 2AAOA 4C0KA 2CTNA 2EHBA 1TCFA 1MQ1A 5HKZA 4C0LA 5DKNA 1NCYA 1K8UA 2WC8A 3NSOA 3AAKA 1JBAA 1KQMB 1CMFA 1K94A 4IL1A 1DGUA 1LINA 1IJ6A 3GK2A 1GJYA 3JTDC 1SR6B 1D1OA 1IWQA 4PCWA 3D0YA 1K9UA 3DVKA 5HLVA 1UHIA 4XYNA 1JF0A 2I94A 1K9KA 1DGVA 1YX7A 2IS9A 4MLWA 2LLUA 4P2YB 1DJZA 3H4SE 1KSOA 1LVCD 3LK0A 2JTZA 2KI4C 1NX2A 4PHMA 3ZNIA 2Y1NA 3SIBA 4WRIA 3O4YA 1XFUO 1AP4A 1J7QA 3VGOA 1DF0A 3K21A 3TZ1A 4USLA 1OMVA 2MAZA 4BY5A 1NWDA 3CLNA 1SW8A 3PM8A 3SG5A 1MUXA 1ZMZA 1IGVA 5I2OA 1WLMA 1YX8A 1BOCA 1YUTA 2K2AA 1CTRA 2LNKA 1TOPA 1TNWA 1MWNA 3ZWHA 3EVRA 2KGBC 5CSIA 3WHUB 4FQOA 1MXLC 1ZUZA 2COLB 3IQQA 1AVSA 4YGDB 1CM1A 1C7VA 2L4IA 2M97A 4DUQA 2BE6A 4ICBA 4GUKA 5AXIA 3PLFB 5AFPA 3SG6A 2FJUB 1Y1UA 4N1FA 3BUNB 4GGNA 4HSZA 4CFRA 2KAVA 1JF2A 2LHLA 4AQJA 1W7JB 2PVBA 3AAJA 3OX5A 1UP5A 2ZN8A 3VRNA 4CFQA 2LVVA 2M0RA 1PK0D 3SG2A 1QV1A 1OMDA 3KHEA 1RWYA 3PFVA 1DT7B 2M3WA 1K93D 2Y4QA 3WNXB 2WOSA 1J7PA 1KCYA 3I5HC 2JXLA 3PN7B 3KPXA 4YI8A 3QRXA 4JWQA 5I2LA 4MEWA 1BF5A 1UURA 2WCBA 1W7IB 1F54A 2NZ0A 4YI9A 3HCMA 1CMGA 2F3YA 1HQVA 2QPTA 1XA5A 1OZOA 1KQMC 4R1EA 1SCMB 3VRQA 2ZKMX 1IG5A 4NDDA 2F2PA 2LCPA 2VRGA 3I5IB 1Y1XA 1Y0VH 3VRPA 5KSZA 3BOWB 3LCPC 2EC6B 2G9BA 4AOMA 1F71A 2K7OA 1BJFA 3M0WA 1A75A 1S5GZ 1KK8B 2HQWA 1OMRA 1MHOA 2BBNA 1BG1A 3SG7A 4M2QA 5AANA 1S5GY 2K2FA 1E8AA 2LLSA 1IJ5A 2BBMA 2JT8A 4DIRA 3SJSA 1U5IA 3E3RA 1TNQA 4GNKB 1K95A 3GK1A 3OP0A 4HREE 3DD4A 1CLMA 3SG3A 2KQ6A 5HLOA 1PSBA 4PHNA 1YVLA 1S6IA 4OV2A 4ZCVA 3EVUA 4E68A 5J3XA 1DJHA 2AUCA 1SK6D 2FOTA 1NCXA 2HPSA 2I7AA 3BXKA 3NSLA 2K7DA 1SY9A 3BUXB 4PALA 1IQ3A 2PRUA 1B1GA 1QX5B 1G4YR 4MZKA 3A8RA 1CFCA 1FI5A 2BCBA 1YR5A 2JQ6A 1LA3A 3I5GB 1TCOB 1PVAA 1QJTA 1F55A 2JTTA 3CS1A 4CPVA 1EL4A 1SYMA 4GGFC 1CDMA 1QXPA 2K61A 2M29A 1F4OA 2ZRTA 3BYAA 1H8BA 1DMOA 2NLNA 3BUMB 1QV0A 3DF0A 4CLNA 1GGWA 2CNPA 3CWGA 3LL8B 1XYDA 2ZNEA 2BL0B 5TNCA 1UHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN7 C;  2L2E A;  1AJ5 A;  1L7Z A;  1DJX A;  1KK7 Z;  1S1E A;  1QAT A;  1SCM C;  2FCD A;  2PMY A;  3KEV A;  1KK7 Y;  5FYX A;  2LMT A;  3I5I C;  2NCO A;  2L51 A;  2I2R E;  3KO0 A;  3A4U B;  2EC6 C;  5CSF A;  4YGA A;  5I2Q A;  2M1K B;  4PHJ A;  1CKK A;  3BUO B;  2L98 A;  1RFJ A;  1UHH A;  1CFP A;  1KK8 C;  1QVI Z;  3LK1 A;  2KQY A;  1CFD A;  2P6B B;  1XVJ A;  1QVI Y;  1N2D A;  1NSH A;  3DVJ A;  2Y5I A;  5HKY A;  2OS8 B;  2WCE A;  2JRF A;  1GGZ A;  2GV5 A;  2BKI B;  1F8H A;  1JFK A;  1F4Q A;  1SMG A;  1DJY A;  1FPW A;  2DOQ A;  1B8C A;  1B8L A;  1MR8 A;  4PE7 A;  1NX3 A;  3OX6 A;  3CGA A;  4HRG A;  3VRR A;  1S26 D;  4NDC A;  4QJ3 B;  3VRO A;  1KWO B;  1A2X A;  4YRU A;  1RJV A;  1QX7 A;  1PAL A;  1SKT A;  1V1G A;  3O6B A;  1K9P A;  2LVJ A;  1XFZ O;  3I5G C;  1C7W A;  1MXE A;  1WRZ A;  1XK4 C;  4YBH B;  4TNC A;  1X02 A;  2LP3 A;  1KFU S;  1IKU A;  2KDH A;  2MHH A;  2NCP A;  1N0Y A;  2JXC A;  1DTL A;  2NXQ A;  3I5F B;  4HRH A;  1K96 A;  4ZCU A;  3RM1 A;  2H61 A;  1F70 A;  4I5N B;  2H61 C;  1NP8 A;  3EKJ A;  4JPZ B;  2KGR A;  3SIA A;  1FBV A;  3EK8 A;  5AEQ A;  5B8I B;  3ICB A;  3TUY C;  2I18 A;  4JQ0 D;  2BL0 C;  1TRF A;  3NSI A;  1OZS A;  4GAO A;  3C1V A;  1CB1 A;  1Y1A A;  1NYA A;  1V1F A;  3TS5 B;  1DVI A;  2CCM A;  1XFX O;  1KFU L;  2JC2 A;  2KYC A;  2L0P A;  1LKJ A;  1YVH A;  1A4P A;  5JOL A;  4MZL A;  4CID A;  1YTZ C;  2KBM A;  2L4H A;  5ER4 X;  1SR6 C;  1J1E A;  1QIV A;  1WY9 A;  2E30 A;  3DVE A;  1QLS A;  2O60 A;  3KF9 A;  5DKR A;  1CFF A;  2LLT A;  2CT9 A;  1NPQ A;  2MA2 A;  1LXF C;  1ALW A;  2KI6 C;  1J1D A;  2L5X B;  5CPV A;  2MBX A;  5HYD A;  2B1U A;  2BEC A;  1DJI A;  2OS8 C;  4L9M A;  3EVV A;  1XFV O;  4YGB B;  2JZI A;  2FCE A;  4GFT A;  1QTX A;  3TDU A;  4ORC B;  1CNP A;  1B8R A;  2LV7 A;  3F45 A;  4GPL B;  1L2O B;  1BMO A;  1M46 A;  2MJW B;  2ZFD A;  3JTD B;  4Q04 A;  5HKW A;  3TDZ A;  3D0Y B;  1S6C A;  4OR9 B;  1JFJ A;  1VRK A;  2JWW A;  2F8P A;  2M7L A;  1Q80 A;  3GK4 X;  1AUI B;  1TTX A;  1JSA A;  1SL7 A;  2KFH A;  1CM4 A;  1EG3 A;  1PRW A;  1BR1 B;  1J7O A;  1QS7 A;  1MF8 B;  2M1U A;  2OPO A;  4MSP A;  4UPG A;  1S6J A;  3MSE B;  2OTG B;  1FW4 A;  2K8M B;  3O78 A;  3PAT A;  1DF0 B;  2WCF A;  4OKH A;  1YRT B;  4A4B A;  3FWB A;  4GGF A;  3DVM A;  5D7F A;  1CDN A;  1NIW A;  3FS7 A;  2GGM A;  4OCI A;  1EG4 A;  2PAS A;  2ZND A;  2LAN A;  3NSK A;  3LLE A;  1M39 A;  3OB2 B;  1TIZ A;  1KFX S;  2LVI A;  4PE4 A;  2R2I A;  2KBI A;  3RLZ A;  4C0J A;  3HX4 A;  5KU1 A;  4QJ5 B;  1ZOT B;  1CLB A;  1H4B A;  1ALV A;  4XJK B;  1XFY O;  2M7N A;  1GQM A;  1KQV A;  3WHT B;  1WRK A;  2KAX A;  4I5J A;  4PHK A;  1EXR A;  1YRU B;  4ORB B;  4MBE A;  4F0Z B;  2CXJ A;  1J7R A;  3FWC A;  1QLK A;  2TN4 A;  4YGC B;  1KSM A;  2CBL A;  3BOW A;  1REC A;  1Y6W A;  1LA0 A;  2JNF A;  4MRY A;  4DS7 A;  1KFX L;  2JUL A;  1CLL A;  1WRL A;  1J55 A;  2JT3 A;  3IF7 A;  1B9A A;  2BKH B;  2KHN A;  2KYF A;  5D69 A;  2SCP A;  3CZT X;  1B47 A;  1BR4 B;  5GQQ C;  1A29 A;  3AKA A;  1BOD A;  3IQO A;  2K7B A;  2M8U A;  1WLZ A;  1SCV A;  2LMU A;  4MVF A;  2KI6 D;  5AER A;  3BQ3 A;  1CDL A;  1UHN A;  1SPY A;  2E6W A;  3SG4 A;  1OE9 B;  2ZN9 A;  1L2O C;  4PE0 A;  2O5G A;  2ZRS A;  1SL9 A;  4YGE B;  3JVT B;  4PDZ A;  1M63 B;  1A75 B;  1PVB A;  4AQI A;  2F3Z A;  2LMV A;  5CSN A;  2LVK A;  1QX2 A;  2Q4U A;  1AK8 A;  4OVN F;  2L50 A;  2OTG C;  4I5L B;  1XK4 A;  1PUL A;  1UUS A;  1ODB A;  1CDP A;  4MRX A;  1ZFS A;  2H2K A;  1EH2 A;  1U5I B;  1OQP A;  4DRW A;  4M2P A;  1SNL A;  1JWD A;  4NDB A;  5CSJ A;  1OOJ A;  2D8N A;  2RGI A;  2QAC A;  1QAS A;  3OHM B;  1RK9 A;  1EJ3 A;  1AJ4 A;  1BU3 A;  1IQ5 A;  1TNP A;  2BE4 A;  4XJK A;  1SBJ A;  1XO5 A;  2JOJ A;  1R2U A;  4PE1 A;  3O2P A;  2HQ8 A;  2JU0 A;  2KOT A;  3FIA A;  1K2H A;  5KTY A;  2K7C A;  2F33 A;  2LP2 A;  3EKH A;  3GOF A;  1IH0 A;  1SL8 A;  2LUC A;  1HT9 A;  1UHJ A;  2A4J A;  1FF1 A;  3DF0 B;  2G2B A;  4M2O A;  1ZAC A;  2HET A;  2KFF A;  1WDC B;  2M9G A;  2LHI A;  4D1E A;  2PSR A;  3CTN A;  3TDI A;  1M31 A;  2GGZ A;  4FTG A;  1BT6 A;  1XFW O;  5JJG A;  2BCX A;  2PAL A;  1AHR A;  5BPJ A;  1JC2 A;  2KSP A;  5F6T A;  1NX1 A;  2JT0 A;  1OSA A;  3JVT C;  5DKQ A;  2MRD A;  4WQ2 A;  2F2O A;  2LAP A;  1KWO C;  1BLQ A;  2KI4 B;  4BY4 A;  4WQ3 A;  1DJW A;  2HF5 A;  3CR5 X;  1SRA A;  4I5K A;  2WOR A;  2KAY A;  1NX0 A;  1RTP 1;  3D10 A;  4MN0 A;  3NXA A;  1QIW A;  3I5F C;  5G08 A;  4QJ4 B;  2MLE C;  3PAL A;  2LE9 B;  1TN4 A;  4N1G A;  4ORA B;  1K90 D;  3EK7 A;  2Y1M A;  1A03 A;  1S36 A;  3EK4 A;  1N65 A;  2LUX A;  1G8I A;  1M45 A;  4MZJ A;  4DCK A;  2K0J A;  2WND A;  1YUR A;  2JPT A;  3OB1 B;  5IBW A;  2ISD A;  1IRJ A;  1B7T Z;  1YUS A;  3AKB A;  4GBA A;  4NQG A;  2MLF C;  3TS5 C;  1FI6 A;  1NUB A;  2BCA A;  4P5O E;  1R6P A;  1C07 A;  4N5X A;  5ER5 A;  3WXA A;  1B7T Y;  5I8N A;  1S3P A;  1TNX A;  2JNX A;  3CR4 X;  2SAS A;  3CR2 A;  1JUO A;  3BUW B;  2V53 A;  1PSR A;  2KFG A;  1UWO A;  5PAL A;  5K89 A;  2M49 B;  4ETO A;  3PSR A;  2Q91 A;  1B4C A;  1YUU A;  3TUY B;  1G33 A;  1RRO A;  1NCZ A;  2EGD A;  3I5H B;  2KNE A;  2LM5 A;  1WDC C;  2AMI A;  1DJG A;  4A4C A;  2LC5 A;  4U8D A;  2AAO A;  4C0K A;  2CTN A;  2EHB A;  1TCF A;  1MQ1 A;  5HKZ A;  4C0L A;  5DKN A;  1NCY A;  1K8U A;  2WC8 A;  3NSO A;  3AAK A;  1JBA A;  1KQM B;  1CMF A;  1K94 A;  4IL1 A;  1DGU A;  1LIN A;  1IJ6 A;  3GK2 A;  1GJY A;  3JTD C;  1SR6 B;  1D1O A;  1IWQ A;  4PCW A;  3D0Y A;  1K9U A;  3DVK A;  5HLV A;  1UHI A;  4XYN A;  1JF0 A;  2I94 A;  1K9K A;  1DGV A;  1YX7 A;  2IS9 A;  4MLW A;  2LLU A;  4P2Y B;  1DJZ A;  3H4S E;  1KSO A;  1LVC D;  3LK0 A;  2JTZ A;  2KI4 C;  1NX2 A;  4PHM A;  3ZNI A;  2Y1N A;  3SIB A;  4WRI A;  3O4Y A;  1XFU O;  1AP4 A;  1J7Q A;  3VGO A;  1DF0 A;  3K21 A;  3TZ1 A;  4USL A;  1OMV A;  2MAZ A;  4BY5 A;  1NWD A;  3CLN A;  1SW8 A;  3PM8 A;  3SG5 A;  1MUX A;  1ZMZ A;  1IGV A;  5I2O A;  1WLM A;  1YX8 A;  1BOC A;  1YUT A;  2K2A A;  1CTR A;  2LNK A;  1TOP A;  1TNW A;  1MWN A;  3ZWH A;  3EVR A;  2KGB C;  5CSI A;  3WHU B;  4FQO A;  1MXL C;  1ZUZ A;  2COL B;  3IQQ A;  1AVS A;  4YGD B;  1CM1 A;  1C7V A;  2L4I A;  2M97 A;  4DUQ A;  2BE6 A;  4ICB A;  4GUK A;  5AXI A;  3PLF B;  5AFP A;  3SG6 A;  2FJU B;  1Y1U A;  4N1F A;  3BUN B;  4GGN A;  4HSZ A;  4CFR A;  2KAV A;  1JF2 A;  2LHL A;  4AQJ A;  1W7J B;  2PVB A;  3AAJ A;  3OX5 A;  1UP5 A;  2ZN8 A;  3VRN A;  4CFQ A;  2LVV A;  2M0R A;  1PK0 D;  3SG2 A;  1QV1 A;  1OMD A;  3KHE A;  1RWY A;  3PFV A;  1DT7 B;  2M3W A;  1K93 D;  2Y4Q A;  3WNX B;  2WOS A;  1J7P A;  1KCY A;  3I5H C;  2JXL A;  3PN7 B;  3KPX A;  4YI8 A;  3QRX A;  4JWQ A;  5I2L A;  4MEW A;  1BF5 A;  1UUR A;  2WCB A;  1W7I B;  1F54 A;  2NZ0 A;  4YI9 A;  3HCM A;  1CMG A;  2F3Y A;  1HQV A;  2QPT A;  1XA5 A;  1OZO A;  1KQM C;  4R1E A;  1SCM B;  3VRQ A;  2ZKM X;  1IG5 A;  4NDD A;  2F2P A;  2LCP A;  2VRG A;  3I5I B;  1Y1X A;  1Y0V H;  3VRP A;  5KSZ A;  3BOW B;  3LCP C;  2EC6 B;  2G9B A;  4AOM A;  1F71 A;  2K7O A;  1BJF A;  3M0W A;  1A75 A;  1S5G Z;  1KK8 B;  2HQW A;  1OMR A;  1MHO A;  2BBN A;  1BG1 A;  3SG7 A;  4M2Q A;  5AAN A;  1S5G Y;  2K2F A;  1E8A A;  2LLS A;  1IJ5 A;  2BBM A;  2JT8 A;  4DIR A;  3SJS A;  1U5I A;  3E3R A;  1TNQ A;  4GNK B;  1K95 A;  3GK1 A;  3OP0 A;  4HRE E;  3DD4 A;  1CLM A;  3SG3 A;  2KQ6 A;  5HLO A;  1PSB A;  4PHN A;  1YVL A;  1S6I A;  4OV2 A;  4ZCV A;  3EVU A;  4E68 A;  5J3X A;  1DJH A;  2AUC A;  1SK6 D;  2FOT A;  1NCX A;  2HPS A;  2I7A A;  3BXK A;  3NSL A;  2K7D A;  1SY9 A;  3BUX B;  4PAL A;  1IQ3 A;  2PRU A;  1B1G A;  1QX5 B;  1G4Y R;  4MZK A;  3A8R A;  1CFC A;  1FI5 A;  2BCB A;  1YR5 A;  2JQ6 A;  1LA3 A;  3I5G B;  1TCO B;  1PVA A;  1QJT A;  1F55 A;  2JTT A;  3CS1 A;  4CPV A;  1EL4 A;  1SYM A;  4GGF C;  1CDM A;  1QXP A;  2K61 A;  2M29 A;  1F4O A;  2ZRT A;  3BYA A;  1H8B A;  1DMO A;  2NLN A;  3BUM B;  1QV0 A;  3DF0 A;  4CLN A;  1GGW A;  2CNP A;  3CWG A;  3LL8 B;  1XYD A;  2ZNE A;  2BL0 B;  5TNC A;  1UHK A; 
#chains in the Genus database with same CATH topology
 3PN7 C;  2L2E A;  1AJ5 A;  1L7Z A;  3B87 A;  5K89 A;  4JKT A;  1DJX A;  1KK7 Z;  1OOH A;  1S1E A;  1QAT A;  1SCM C;  2FCD A;  2PMY A;  3KEV A;  1KK7 Y;  1P28 A;  3S0B A;  5FYX A;  2LMT A;  3I5I C;  2NCO A;  4FQT A;  2L51 A;  2I2R E;  3KO0 A;  3A4U B;  2EC6 C;  5CSF A;  4YGA A;  5I2Q A;  2M1K B;  4PHJ A;  1CKK A;  3BUO B;  2L98 A;  1RFJ A;  1UHH A;  1TWO A;  1Z4H A;  1CFP A;  1KK8 C;  1QVI Z;  3LK1 A;  2KQY A;  3FE6 A;  1CFD A;  2P6B B;  1XVJ A;  1QVI Y;  1N2D A;  1NSH A;  3DVJ A;  2Y5I A;  2FJY A;  5HKY A;  2OS8 B;  2WCE A;  4F7F A;  3UNW A;  2JRF A;  1GGZ A;  1IIO A;  2KPH A;  1DEL A;  2GV5 A;  1W9Z A;  2BKI B;  1F8H A;  1JFK A;  1F4Q A;  1SMG A;  1DJY A;  3S0G A;  1FPW A;  4INX A;  2DOQ A;  1B8C A;  1B8L A;  1MR8 A;  4PE7 A;  1NX3 A;  3B86 A;  2YGU A;  3CGA A;  3OX6 A;  4HRG A;  3VRR A;  1S26 D;  4NDC A;  4QJ3 B;  4INW A;  1KWO B;  3VRO A;  1A2X A;  4YRU A;  1RJV A;  1QX7 A;  1PAL A;  1SKT A;  1V1G A;  3O6B A;  3BFB A;  1K9P A;  2LVJ A;  1XFZ O;  3I5G C;  1C7W A;  1MXE A;  1WRZ A;  1XK4 C;  4YBH B;  4TNC A;  1X02 A;  2LP3 A;  1KFU S;  1IKU A;  5D3O A;  2KDH A;  2MHH A;  2NCP A;  1N0Y A;  2JXC A;  1DTL A;  2NXQ A;  3I5F B;  4HRH A;  1K96 A;  4ZCU A;  3RM1 A;  2H61 A;  1F70 A;  4I5N B;  2H61 C;  3R1P A;  1NP8 A;  3EKJ A;  4JPZ B;  2KGR A;  3SIA A;  1FBV A;  3EK8 A;  3D76 A;  2JPO A;  5AEQ A;  5B8I B;  3ICB A;  3TUY C;  2I18 A;  4JQ0 D;  2BL0 C;  1TRF A;  3NSI A;  1OZS A;  4GAO A;  3C1V A;  2BNX A;  1CB1 A;  1Y1A A;  1NYA A;  1V1F A;  3TS5 B;  1DVI A;  1SSE B;  1XFX O;  2CCM A;  1KFU L;  2JC2 A;  2KYC A;  3PM2 A;  2L0P A;  1LKJ A;  1YVH A;  1A4P A;  5JOL A;  4MZL A;  4CID A;  1YTZ C;  2KBM A;  2L4H A;  3BJH A;  1SR6 C;  5ER4 X;  2QDI A;  3OBV A;  1J1E A;  1QIV A;  1WY9 A;  2E30 A;  3DVE A;  1QLS A;  2O60 A;  3KF9 A;  5DKR A;  1CFF A;  2LLT A;  2CT9 A;  3CYZ A;  3DZT A;  3SS4 A;  3CAB A;  1NPQ A;  2MA2 A;  1LXF C;  1ALW A;  3R1O A;  2KI6 C;  1J1D A;  2L5X B;  5CPV A;  2MBX A;  5HYD A;  3IVT A;  2WCL A;  2B1U A;  2BEC A;  1DJI A;  2OS8 C;  4L9M A;  3EVV A;  1XFV O;  4YGB B;  2JZI A;  1C3Z A;  3S0F A;  2FCE A;  4GFT A;  1QTX A;  3TDU A;  4ORC B;  1CNP A;  1B8R A;  1TUZ A;  2LV7 A;  3F45 A;  4GPL B;  1L2O B;  1BMO A;  1M46 A;  2MJW B;  2ZFD A;  3JTD B;  4Q04 A;  5HKW A;  5EL2 A;  3TDZ A;  3D0Y B;  1S6C A;  4OR9 B;  1JFJ A;  1VRK A;  2JWW A;  2F8P A;  2M7L A;  1Q80 A;  3GK4 X;  1AUI B;  4JD9 A;  1TTX A;  1JSA A;  1SL7 A;  2KFH A;  1CM4 A;  3DXL A;  1EG3 A;  1PRW A;  1BR1 B;  3S0E A;  1J7O A;  1QS7 A;  1MF8 B;  2M1U A;  2OPO A;  4MSP A;  4UPG A;  1S6J A;  3MSE B;  2OTG B;  1FW4 A;  2K8M B;  3FE8 A;  3K1E A;  1DF0 B;  2WCF A;  3O78 A;  3PAT A;  1YRT B;  4A4B A;  3FWB A;  4GGF A;  3FE9 A;  3DVM A;  5D7F A;  1CDN A;  1NIW A;  3FS7 A;  2GGM A;  4OCI A;  1EG4 A;  2PAS A;  2ZND A;  2LAN A;  2QEB A;  3LLE A;  3NSK A;  1M39 A;  3OB2 B;  1TIZ A;  1KFX S;  2LVI A;  4PE4 A;  2R2I A;  2KBI A;  3RLZ A;  4C0J A;  3HX4 A;  5KU1 A;  4QJ5 B;  1ZOT B;  1CLB A;  1H4B A;  1ALV A;  3DY9 A;  4XJK B;  1XFY O;  2M7N A;  1GQM A;  4OKH A;  1KQV A;  3WHT B;  1WRK A;  2KAX A;  4I5J A;  4PHK A;  1EXR A;  1YRU B;  4ORB B;  4MBE A;  4F0Z B;  2CXJ A;  1J7R A;  3FWC A;  1QLK A;  2TN4 A;  4YGC B;  1KSM A;  2CBL A;  3BOW A;  1REC A;  1Y6W A;  1LA0 A;  2JNF A;  2KLD A;  4MRY A;  4DS7 A;  1KFX L;  2JUL A;  2WC6 A;  1CLL A;  1WRL A;  3B7A A;  4PT1 A;  1J55 A;  2JT3 A;  3IF7 A;  1B9A A;  2BKH B;  2KHN A;  2KYF A;  5D69 A;  2SCP A;  5DIC A;  3CZT X;  1B47 A;  1BR4 B;  2PYQ A;  5GQQ C;  3D74 A;  1A29 A;  3AKA A;  1BOD A;  3IQO A;  2K7B A;  2M8U A;  1WLZ A;  1SCV A;  2LMU A;  4MVF A;  2KI6 D;  5AER A;  3BQ3 A;  1UHN A;  1SPY A;  2E6W A;  3SG4 A;  1OE9 B;  2ZN9 A;  1L2O C;  4PE0 A;  2O5G A;  3D77 A;  2ZRS A;  1Z2C B;  3N7H A;  1SL9 A;  4YGE B;  3JVT B;  4PDZ A;  1QWV A;  1GM0 A;  1M63 B;  3UO9 A;  1A75 B;  1PVB A;  2H8V A;  4AQI A;  2F3Z A;  2LMV A;  2QEV A;  5CSN A;  2LVK A;  1QX2 A;  2Q4U A;  1AK8 A;  4OVN F;  2L50 A;  2OTG C;  4I5L B;  1XK4 A;  1PUL A;  1UUS A;  1ODB A;  1CDP A;  4MRX A;  1ZFS A;  2H2K A;  1EH2 A;  1U5I B;  1OQP A;  3OGN A;  4DRW A;  4M2P A;  1SNL A;  1JWD A;  4NDB A;  5CSJ A;  1OOJ A;  3B6X A;  2D8N A;  2RGI A;  3NHT A;  2QAC A;  1QAS A;  3OHM B;  1RK9 A;  1EJ3 A;  1AJ4 A;  3SS5 A;  1BU3 A;  1IQ5 A;  1TNP A;  2BE4 A;  4XJK A;  1SBJ A;  1XO5 A;  2JOJ A;  1R2U A;  3NGV A;  4PE1 A;  3O2P A;  1OOI X;  2HQ8 A;  2JU0 A;  2KOT A;  3FIA A;  1K2H A;  5KTY A;  2K7C A;  2F33 A;  2LP2 A;  3EKH A;  3GOF A;  1IH0 A;  1SL8 A;  3D75 A;  2LUC A;  1HT9 A;  1UHJ A;  2A4J A;  1FF1 A;  2QEO A;  3DF0 B;  2G2B A;  4M2O A;  1ZAC A;  2HET A;  2KFF A;  1WDC B;  2M9G A;  2WCJ A;  2LHI A;  4D1E A;  2PSR A;  3CTN A;  3TDI A;  1M31 A;  1XFR A;  2GGZ A;  4FTG A;  1T14 A;  1BT6 A;  2BL0 B;  1ORG A;  1XFW O;  5JJG A;  2BCX A;  2PAL A;  2PQL A;  1AHR A;  5BPJ A;  1JC2 A;  2KSP A;  5F6T A;  1NX1 A;  2JT0 A;  1OSA A;  3JVT C;  5DKQ A;  2MRD A;  4WQ2 A;  2P71 A;  2F2O A;  2LAP A;  1KWO C;  3O4X A;  1BLQ A;  2KI4 B;  4BY4 A;  4WQ3 A;  1DJW A;  2HF5 A;  3CR5 X;  1SRA A;  4I5K A;  2WOR A;  2KAY A;  1NX0 A;  1RTP 1;  3D10 A;  4MN0 A;  3NXA A;  1QIW A;  3I5F C;  5G08 A;  4QJ4 B;  2MLE C;  3PAL A;  2LE9 B;  3CDN A;  1TN4 A;  4N1G A;  4ORA B;  1K90 D;  3EK7 A;  2Y1M A;  5FI2 A;  1A03 A;  1S36 A;  3L47 A;  3EK4 A;  1N65 A;  2LUX A;  3R72 A;  1G8I A;  1M45 A;  4MZJ A;  4DCK A;  2K0J A;  3BFA A;  2P70 A;  2WND A;  1YUR A;  2JPT A;  3OB1 B;  5IBW A;  2ISD A;  1IRJ A;  1B7T Z;  1YUS A;  3AKB A;  4GBA A;  4NQG A;  2MLF C;  3D78 A;  3TS5 C;  1NUB A;  2BCA A;  4P5O E;  1R6P A;  1C07 A;  1FI6 A;  4N5X A;  1DC1 A;  5ER5 A;  3WXA A;  1B7T Y;  5I8N A;  3S0A A;  1S3P A;  1TNX A;  2JNX A;  3CR4 X;  2SAS A;  3CR2 A;  1JUO A;  3BUW B;  2V53 A;  1PSR A;  2KFG A;  1UWO A;  5PAL A;  3SS3 A;  2M49 B;  1OOF A;  4ETO A;  3PSR A;  2Q91 A;  1B4C A;  2WCK A;  1YUU A;  3TUY B;  1G33 A;  1RRO A;  1NCZ A;  2EGD A;  3VB1 A;  3I5H B;  2KNE A;  2LM5 A;  1DQE A;  1WDC C;  2AMI A;  1DJG A;  3CZ2 A;  4A4C A;  2LC5 A;  4U8D A;  2AAO A;  4C0K A;  2CTN A;  1C3Y A;  2EHB A;  1TCF A;  3B88 A;  1MQ1 A;  3PJI A;  5HKZ A;  3CZ0 A;  4C0L A;  5DKN A;  1LS8 A;  1DEK A;  1K8U A;  1NCY A;  2WC8 A;  3D73 A;  3NSO A;  3AAK A;  5FI7 A;  1KQM B;  1CMF A;  3L4A A;  1JBA A;  1K94 A;  4IL1 A;  1DGU A;  1LIN A;  1IJ6 A;  3RZS A;  5I94 A;  3GK2 A;  1GJY A;  1OOG A;  3JTD C;  1SR6 B;  1D1O A;  1IWQ A;  4PCW A;  3D0Y A;  1K9U A;  3EG5 B;  3DVK A;  5HLV A;  1UHI A;  4XYN A;  1JF0 A;  2I94 A;  1K9K A;  1DGV A;  1YX7 A;  2IS9 A;  4MLW A;  2LLU A;  4P2Y B;  1DJZ A;  3H4S E;  3DYE A;  1KSO A;  1LVC D;  3LK0 A;  2JTZ A;  2KI4 C;  1NX2 A;  4PHM A;  3ZNI A;  2Y1N A;  3SIB A;  4WRI A;  3O4Y A;  1XFU O;  1AP4 A;  1J7Q A;  3VGO A;  1DF0 A;  3K21 A;  3TZ1 A;  4USL A;  1OMV A;  2MAZ A;  4BY5 A;  1NWD A;  3CLN A;  1SW8 A;  3PM8 A;  5FI6 A;  3SG5 A;  1MUX A;  1ZMZ A;  1IGV A;  5I2O A;  2QEH A;  1WLM A;  2KLE A;  1YX8 A;  1OW4 A;  1BOC A;  3QME A;  1YUT A;  2K2A A;  1CTR A;  2LNK A;  1TOP A;  1TNW A;  1MWN A;  3ZWH A;  3EVR A;  2KGB C;  5CSI A;  3WHU B;  4FQO A;  1MXL C;  1ZUZ A;  2COL B;  3IQQ A;  1AVS A;  4YGD B;  1CM1 A;  1C7V A;  2L4I A;  2M97 A;  4DUQ A;  2BE6 A;  4ICB A;  4GUK A;  5AXI A;  3PLF B;  5AFP A;  3SG6 A;  2FJU B;  1Y1U A;  4N1F A;  3BUN B;  4GGN A;  4HSZ A;  4CFR A;  2ERB A;  2KAV A;  1JF2 A;  2LHL A;  4AQJ A;  1W7J B;  2PVB A;  3AAJ A;  3OX5 A;  1UP5 A;  2ZN8 A;  3VRN A;  4CFQ A;  2LVV A;  2M0R A;  1PK0 D;  3V2L A;  3SG2 A;  1QV1 A;  1OMD A;  3KHE A;  1RWY A;  3PFV A;  1DT7 B;  2M3W A;  1K93 D;  2Y4Q A;  3WNX B;  2WOS A;  1J7P A;  1KCY A;  3I5H C;  2JXL A;  3CZ1 A;  3BFH A;  3PN7 B;  3KPX A;  4YI8 A;  3QRX A;  4JWQ A;  5I2L A;  4MEW A;  1BF5 A;  1UUR A;  2WCB A;  1W7I B;  2L5Y A;  1F54 A;  2NZ0 A;  2K60 A;  3HCM A;  3L4L A;  4YI9 A;  1CMG A;  2F3Y A;  1HQV A;  2QPT A;  1XA5 A;  1OZO A;  1KQM C;  5HL1 A;  4R1E A;  2WCM A;  1SCM B;  3VRQ A;  2ZKM X;  1IG5 A;  4NDD A;  2F2P A;  2LCP A;  2VRG A;  3I5I B;  1Y1X A;  1Y0V H;  3VRP A;  5KSZ A;  2L2C A;  3BOW B;  3LCP C;  2EC6 B;  2G9B A;  4AOM A;  3Q8I A;  1F71 A;  2K7O A;  1BJF A;  3M0W A;  1TUJ A;  1A75 A;  1S5G Z;  3NHI A;  1KK8 B;  2HQW A;  1OMR A;  1MHO A;  2BBN A;  1BG1 A;  3SG7 A;  4M2Q A;  3R1V A;  1S5G Y;  2K2F A;  5AAN A;  1E8A A;  2LLS A;  1IJ5 A;  2BBM A;  2JT8 A;  2WC5 A;  4DIR A;  3SJS A;  1U5I A;  3E3R A;  1TNQ A;  4GNK B;  1K95 A;  3GK1 A;  3OP0 A;  2GTE A;  4HRE E;  3DD4 A;  1CLM A;  2BAP A;  3SG3 A;  2KQ6 A;  5HLO A;  1PSB A;  4PHN A;  1YVL A;  1S6I A;  4OV2 A;  4ZCV A;  2WCH A;  3EVU A;  4IJ7 A;  4E68 A;  5J3X A;  1DJH A;  2AUC A;  1SK6 D;  2FOT A;  1NCX A;  2HPS A;  2I7A A;  3BXK A;  3NSL A;  2K7D A;  1SY9 A;  3BUX B;  4PAL A;  1IQ3 A;  2PRU A;  1B1G A;  1QX5 B;  1G4Y R;  4MZK A;  3A8R A;  1CFC A;  1FI5 A;  2BCB A;  1YR5 A;  2JQ6 A;  1LA3 A;  3I5G B;  1TCO B;  1PVA A;  1QJT A;  1F55 A;  4KYN A;  3S0D A;  2JTT A;  3CS1 A;  4CPV A;  1EL4 A;  1SYM A;  4GGF C;  1CDM A;  1QXP A;  2K61 A;  2M29 A;  1F4O A;  2ZRT A;  3BYA A;  4OZD A;  1H8B A;  1DMO A;  2NLN A;  3BUM B;  1QV0 A;  3DF0 A;  4CLN A;  1GGW A;  2CNP A;  3CWG A;  3LL8 B;  1XYD A;  2ZNE A;  1CDL A;  5TNC A;  1UHK A; 
#chains in the Genus database with same CATH homology
 3PN7 C;  2L2E A;  1AJ5 A;  1L7Z A;  1DJX A;  1KK7 Z;  1S1E A;  1QAT A;  1SCM C;  2FCD A;  2PMY A;  3KEV A;  1KK7 Y;  5FYX A;  2LMT A;  3I5I C;  2NCO A;  2L51 A;  2I2R E;  3KO0 A;  3A4U B;  2EC6 C;  5CSF A;  4YGA A;  5I2Q A;  2M1K B;  4PHJ A;  1CKK A;  3BUO B;  2L98 A;  1RFJ A;  1UHH A;  1CFP A;  1KK8 C;  1QVI Z;  3LK1 A;  2KQY A;  1CFD A;  2P6B B;  1XVJ A;  1QVI Y;  1N2D A;  1NSH A;  3DVJ A;  2Y5I A;  5HKY A;  2OS8 B;  2WCE A;  2JRF A;  1GGZ A;  2GV5 A;  2BKI B;  1F8H A;  1JFK A;  1F4Q A;  1SMG A;  1DJY A;  1FPW A;  2DOQ A;  1B8C A;  1B8L A;  1MR8 A;  4PE7 A;  1NX3 A;  3OX6 A;  3CGA A;  4HRG A;  3VRR A;  1S26 D;  4NDC A;  4QJ3 B;  3VRO A;  1KWO B;  1A2X A;  4YRU A;  1RJV A;  1QX7 A;  1PAL A;  1SKT A;  1V1G A;  3O6B A;  1K9P A;  2LVJ A;  1XFZ O;  3I5G C;  1C7W A;  1MXE A;  1WRZ A;  1XK4 C;  4YBH B;  4TNC A;  1X02 A;  2LP3 A;  1KFU S;  1IKU A;  2KDH A;  2MHH A;  2NCP A;  1N0Y A;  2JXC A;  1DTL A;  2NXQ A;  3I5F B;  4HRH A;  1K96 A;  4ZCU A;  3RM1 A;  2H61 A;  1F70 A;  4I5N B;  2H61 C;  1NP8 A;  3EKJ A;  4JPZ B;  2KGR A;  3SIA A;  1FBV A;  3EK8 A;  5AEQ A;  5B8I B;  3ICB A;  3TUY C;  2I18 A;  4JQ0 D;  2BL0 C;  1TRF A;  3NSI A;  1OZS A;  4GAO A;  3C1V A;  1CB1 A;  1Y1A A;  1NYA A;  1V1F A;  3TS5 B;  1DVI A;  2CCM A;  1XFX O;  1KFU L;  2JC2 A;  2KYC A;  2L0P A;  1LKJ A;  1YVH A;  1A4P A;  5JOL A;  4MZL A;  4CID A;  1YTZ C;  2KBM A;  2L4H A;  5ER4 X;  1SR6 C;  1J1E A;  1QIV A;  1WY9 A;  2E30 A;  3DVE A;  1QLS A;  2O60 A;  3KF9 A;  5DKR A;  1CFF A;  2LLT A;  2CT9 A;  1NPQ A;  2MA2 A;  1LXF C;  1ALW A;  2KI6 C;  1J1D A;  2L5X B;  5CPV A;  2MBX A;  5HYD A;  2B1U A;  2BEC A;  1DJI A;  2OS8 C;  4L9M A;  3EVV A;  1XFV O;  4YGB B;  2JZI A;  2FCE A;  4GFT A;  1QTX A;  3TDU A;  4ORC B;  1CNP A;  1B8R A;  2LV7 A;  3F45 A;  4GPL B;  1L2O B;  1BMO A;  1M46 A;  2MJW B;  2ZFD A;  3JTD B;  4Q04 A;  5HKW A;  3TDZ A;  3D0Y B;  1S6C A;  4OR9 B;  1JFJ A;  1VRK A;  2JWW A;  2F8P A;  2M7L A;  1Q80 A;  3GK4 X;  1AUI B;  1TTX A;  1JSA A;  1SL7 A;  2KFH A;  1CM4 A;  1EG3 A;  1PRW A;  1BR1 B;  1J7O A;  1QS7 A;  1MF8 B;  2M1U A;  2OPO A;  4MSP A;  4UPG A;  1S6J A;  3MSE B;  2OTG B;  1FW4 A;  2K8M B;  3O78 A;  3PAT A;  1DF0 B;  2WCF A;  4OKH A;  1YRT B;  4A4B A;  3FWB A;  4GGF A;  3DVM A;  5D7F A;  1CDN A;  1NIW A;  3FS7 A;  2GGM A;  4OCI A;  1EG4 A;  2PAS A;  2ZND A;  2LAN A;  3NSK A;  3LLE A;  1M39 A;  3OB2 B;  1TIZ A;  1KFX S;  2LVI A;  4PE4 A;  2R2I A;  2KBI A;  3RLZ A;  4C0J A;  3HX4 A;  5KU1 A;  4QJ5 B;  1ZOT B;  1CLB A;  1H4B A;  1ALV A;  4XJK B;  1XFY O;  2M7N A;  1GQM A;  1KQV A;  3WHT B;  1WRK A;  2KAX A;  4I5J A;  4PHK A;  1EXR A;  1YRU B;  4ORB B;  4MBE A;  4F0Z B;  2CXJ A;  1J7R A;  3FWC A;  1QLK A;  2TN4 A;  4YGC B;  1KSM A;  2CBL A;  3BOW A;  1REC A;  1Y6W A;  1LA0 A;  2JNF A;  4MRY A;  4DS7 A;  1KFX L;  2JUL A;  1CLL A;  1WRL A;  1J55 A;  2JT3 A;  3IF7 A;  1B9A A;  2BKH B;  2KHN A;  2KYF A;  5D69 A;  2SCP A;  3CZT X;  1B47 A;  1BR4 B;  5GQQ C;  1A29 A;  3AKA A;  1BOD A;  3IQO A;  2K7B A;  2M8U A;  1WLZ A;  1SCV A;  2LMU A;  4MVF A;  2KI6 D;  5AER A;  3BQ3 A;  1CDL A;  1UHN A;  1SPY A;  2E6W A;  3SG4 A;  1OE9 B;  2ZN9 A;  1L2O C;  4PE0 A;  2O5G A;  2ZRS A;  1SL9 A;  4YGE B;  3JVT B;  4PDZ A;  1M63 B;  1A75 B;  1PVB A;  4AQI A;  2F3Z A;  2LMV A;  5CSN A;  2LVK A;  1QX2 A;  2Q4U A;  1AK8 A;  4OVN F;  2L50 A;  2OTG C;  4I5L B;  1XK4 A;  1PUL A;  1UUS A;  1ODB A;  1CDP A;  4MRX A;  1ZFS A;  2H2K A;  1EH2 A;  1U5I B;  1OQP A;  4DRW A;  4M2P A;  1SNL A;  1JWD A;  4NDB A;  5CSJ A;  1OOJ A;  2D8N A;  2RGI A;  2QAC A;  1QAS A;  3OHM B;  1RK9 A;  1EJ3 A;  1AJ4 A;  1BU3 A;  1IQ5 A;  1TNP A;  2BE4 A;  4XJK A;  1SBJ A;  1XO5 A;  2JOJ A;  1R2U A;  4PE1 A;  3O2P A;  2HQ8 A;  2JU0 A;  2KOT A;  3FIA A;  1K2H A;  5KTY A;  2K7C A;  2F33 A;  2LP2 A;  3EKH A;  3GOF A;  1IH0 A;  1SL8 A;  2LUC A;  1HT9 A;  1UHJ A;  2A4J A;  1FF1 A;  3DF0 B;  2G2B A;  4M2O A;  1ZAC A;  2HET A;  2KFF A;  1WDC B;  2M9G A;  2LHI A;  4D1E A;  2PSR A;  3CTN A;  3TDI A;  1M31 A;  2GGZ A;  4FTG A;  1BT6 A;  1XFW O;  5JJG A;  2BCX A;  2PAL A;  1AHR A;  5BPJ A;  1JC2 A;  2KSP A;  5F6T A;  1NX1 A;  2JT0 A;  1OSA A;  3JVT C;  5DKQ A;  2MRD A;  4WQ2 A;  2F2O A;  2LAP A;  1KWO C;  1BLQ A;  2KI4 B;  4BY4 A;  4WQ3 A;  1DJW A;  2HF5 A;  3CR5 X;  1SRA A;  4I5K A;  2WOR A;  2KAY A;  1NX0 A;  1RTP 1;  3D10 A;  4MN0 A;  3NXA A;  1QIW A;  3I5F C;  5G08 A;  4QJ4 B;  2MLE C;  3PAL A;  2LE9 B;  1TN4 A;  4N1G A;  4ORA B;  1K90 D;  3EK7 A;  2Y1M A;  1A03 A;  1S36 A;  3EK4 A;  1N65 A;  2LUX A;  1G8I A;  1M45 A;  4MZJ A;  4DCK A;  2K0J A;  2WND A;  1YUR A;  2JPT A;  3OB1 B;  5IBW A;  2ISD A;  1IRJ A;  1B7T Z;  1YUS A;  3AKB A;  4GBA A;  4NQG A;  2MLF C;  3TS5 C;  1FI6 A;  1NUB A;  2BCA A;  4P5O E;  1R6P A;  1C07 A;  4N5X A;  5ER5 A;  3WXA A;  1B7T Y;  5I8N A;  1S3P A;  1TNX A;  2JNX A;  3CR4 X;  2SAS A;  3CR2 A;  1JUO A;  3BUW B;  2V53 A;  1PSR A;  2KFG A;  1UWO A;  5PAL A;  5K89 A;  2M49 B;  4ETO A;  3PSR A;  2Q91 A;  1B4C A;  1YUU A;  3TUY B;  1G33 A;  1RRO A;  1NCZ A;  2EGD A;  3I5H B;  2KNE A;  2LM5 A;  1WDC C;  2AMI A;  1DJG A;  4A4C A;  2LC5 A;  4U8D A;  2AAO A;  4C0K A;  2CTN A;  2EHB A;  1TCF A;  1MQ1 A;  5HKZ A;  4C0L A;  5DKN A;  1NCY A;  1K8U A;  2WC8 A;  3NSO A;  3AAK A;  1JBA A;  1KQM B;  1CMF A;  1K94 A;  4IL1 A;  1DGU A;  1LIN A;  1IJ6 A;  3GK2 A;  1GJY A;  3JTD C;  1SR6 B;  1D1O A;  1IWQ A;  4PCW A;  3D0Y A;  1K9U A;  3DVK A;  5HLV A;  1UHI A;  4XYN A;  1JF0 A;  2I94 A;  1K9K A;  1DGV A;  1YX7 A;  2IS9 A;  4MLW A;  2LLU A;  4P2Y B;  1DJZ A;  3H4S E;  1KSO A;  1LVC D;  3LK0 A;  2JTZ A;  2KI4 C;  1NX2 A;  4PHM A;  3ZNI A;  2Y1N A;  3SIB A;  4WRI A;  3O4Y A;  1XFU O;  1AP4 A;  1J7Q A;  3VGO A;  1DF0 A;  3K21 A;  3TZ1 A;  4USL A;  1OMV A;  2MAZ A;  4BY5 A;  1NWD A;  3CLN A;  1SW8 A;  3PM8 A;  3SG5 A;  1MUX A;  1ZMZ A;  1IGV A;  5I2O A;  1WLM A;  1YX8 A;  1BOC A;  1YUT A;  2K2A A;  1CTR A;  2LNK A;  1TOP A;  1TNW A;  1MWN A;  3ZWH A;  3EVR A;  2KGB C;  5CSI A;  3WHU B;  4FQO A;  1MXL C;  1ZUZ A;  2COL B;  3IQQ A;  1AVS A;  4YGD B;  1CM1 A;  1C7V A;  2L4I A;  2M97 A;  4DUQ A;  2BE6 A;  4ICB A;  4GUK A;  5AXI A;  3PLF B;  5AFP A;  3SG6 A;  2FJU B;  1Y1U A;  4N1F A;  3BUN B;  4GGN A;  4HSZ A;  4CFR A;  2KAV A;  1JF2 A;  2LHL A;  4AQJ A;  1W7J B;  2PVB A;  3AAJ A;  3OX5 A;  1UP5 A;  2ZN8 A;  3VRN A;  4CFQ A;  2LVV A;  2M0R A;  1PK0 D;  3SG2 A;  1QV1 A;  1OMD A;  3KHE A;  1RWY A;  3PFV A;  1DT7 B;  2M3W A;  1K93 D;  2Y4Q A;  3WNX B;  2WOS A;  1J7P A;  1KCY A;  3I5H C;  2JXL A;  3PN7 B;  3KPX A;  4YI8 A;  3QRX A;  4JWQ A;  5I2L A;  4MEW A;  1BF5 A;  1UUR A;  2WCB A;  1W7I B;  1F54 A;  2NZ0 A;  4YI9 A;  3HCM A;  1CMG A;  2F3Y A;  1HQV A;  2QPT A;  1XA5 A;  1OZO A;  1KQM C;  4R1E A;  1SCM B;  3VRQ A;  2ZKM X;  1IG5 A;  4NDD A;  2F2P A;  2LCP A;  2VRG A;  3I5I B;  1Y1X A;  1Y0V H;  3VRP A;  5KSZ A;  3BOW B;  3LCP C;  2EC6 B;  2G9B A;  4AOM A;  1F71 A;  2K7O A;  1BJF A;  3M0W A;  1A75 A;  1S5G Z;  1KK8 B;  2HQW A;  1OMR A;  1MHO A;  2BBN A;  1BG1 A;  3SG7 A;  4M2Q A;  5AAN A;  1S5G Y;  2K2F A;  1E8A A;  2LLS A;  1IJ5 A;  2BBM A;  2JT8 A;  4DIR A;  3SJS A;  1U5I A;  3E3R A;  1TNQ A;  4GNK B;  1K95 A;  3GK1 A;  3OP0 A;  4HRE E;  3DD4 A;  1CLM A;  3SG3 A;  2KQ6 A;  5HLO A;  1PSB A;  4PHN A;  1YVL A;  1S6I A;  4OV2 A;  4ZCV A;  3EVU A;  4E68 A;  5J3X A;  1DJH A;  2AUC A;  1SK6 D;  2FOT A;  1NCX A;  2HPS A;  2I7A A;  3BXK A;  3NSL A;  2K7D A;  1SY9 A;  3BUX B;  4PAL A;  1IQ3 A;  2PRU A;  1B1G A;  1QX5 B;  1G4Y R;  4MZK A;  3A8R A;  1CFC A;  1FI5 A;  2BCB A;  1YR5 A;  2JQ6 A;  1LA3 A;  3I5G B;  1TCO B;  1PVA A;  1QJT A;  1F55 A;  2JTT A;  3CS1 A;  4CPV A;  1EL4 A;  1SYM A;  4GGF C;  1CDM A;  1QXP A;  2K61 A;  2M29 A;  1F4O A;  2ZRT A;  3BYA A;  1H8B A;  1DMO A;  2NLN A;  3BUM B;  1QV0 A;  3DF0 A;  4CLN A;  1GGW A;  2CNP A;  3CWG A;  3LL8 B;  1XYD A;  2ZNE A;  2BL0 B;  5TNC A;  1UHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...