5EL2A

Crystal structure of odorant binding protein 1 from anopheles gambiae (agamobp1) with icaridin (butan-2-yl 2-(2-hydroxyethyl)piperidine-1-carboxylate)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
125
structure length
125
Chain Sequence
DTTPRRDAEYPPPELLEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGAP003309-PA
publication title The crystal structure of the AgamOBP1Icaridin complex reveals alternative binding modes and stereo-selective repellent recognition.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 41
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 5el2A01
3CZ0A 2QEOA 3CZ1A 2PQLA 3R72A 4INXA 3VB1A 3N7HA 2QEBA 4INWA 3FE6A 1LS8A 1TWOA 4FQTA 2WC5A 2P71A 4OZDA 3RZSA 3L4AA 3D75A 3NGVA 3K1EA 2QEVA 3CYZA 3S0BA 5EL2A 3B6XA 1QWVA 3QMEA 3S0DA 2FJYA 2P70A 3BFAA 1ORGA 3D74A 2WC6A 3CDNA 3S0EA 2KPHA 3DY9A 3L4LA 3D76A 2WCKA 1OOHA 3S0FA 3R1OA 2ERBA 3DXLA 3CZ2A 3Q8IA 1DQEA 3B7AA 2WCLA 3DZTA 3D77A 3V2LA 2L2CA 3S0AA 1OOFA 3D78A 2QDIA 2QEHA 3OGNA 1OW4A 1TUJA 1XFRA 1OOIX 3FE9A 3NHTA 3B86A 4F7FA 1OOGA 3R1PA 3NHIA 3B88A 3BFBA 3B87A 4JD9A 2WCMA 3BJHA 3FE8A 3BFHA 2GTEA 2WCHA 3L47A 2H8VA 3PJIA 3R1VA 3DYEA 3CABA 1C3ZA 4PT1A 5DICA 1GM0A 3D73A 1T14A 2JPOA 2WCJA 1C3YA 1P28A 3S0GA
chains in the Genus database with same CATH superfamily
1M45A 2LE9B 1LVCD 2KFHA 1QLSA 3R72A 1WLZA 2G9BA 5AFPA 3BQ3A 2A4JA 4INXA 2PALA 3VRNA 1KK8C 3NSLA 2KDHA 3LK0A 3CWGA 1SL7A 1RK9A 2JWWA 3O2PA 1SL8A 3BUMB 2JQ6A 3FE6A 3PALA 4INWA 5I8NA 2WC5A 1XFZO 1KK7Z 1XO5A 2CCMA 2WC8A 3GOFA 2O5GA 5AEQA 5KTYA 2ISDA 3L4AA 3NGVA 2NCPA 3C1VA 5CSIA 1DF0B 1TCOB 3I5IB 3ICBA 1QATA 2AAOA 1XFWO 1CM4A 2BCAA 2JT8A 1LKJA 5EL2A 2LP2A 3RLZA 4XJKB 2KSPA 3EKHA 1MWNA 1A29A 1TNWA 1HQVA 2AMIA 2D8NA 4GGFA 3SG7A 3D74A 1FI6A 4MEWA 3I5FB 3S0EA 1MXEA 3CTNA 3I5IC 1QX2A 2NZ0A 1PALA 1IKUA 3IF7A 3A8RA 2FJUB 2PRUA 1NCXA 2OPOA 1MUXA 2LP3A 2WCKA 3VGOA 3S0FA 4FQOA 3CZ2A 3KPXA 1DQEA 1K96A 1TOPA 5AERA 5HYDA 2HPSA 3SS4A 1J7RA 2M3WA 3DF0A 2JPTA 3B7AA 3DZTA 3I5FC 3V2LA 4P2YB 1B1GA 1KCYA 1NX0A 3S0AA 4ORCB 3FWCA 1BU3A 2F2OA 3D78A 1FPWA 1BR4B 1Y0VH 4IL1A 4QJ4B 1J7OA 2ZN8A 1F70A 1ZOTB 1M46A 3OGNA 1YRTB 1S1EA 1Z2CB 1YX8A 1BR1B 1PULA 2DOQA 3PATA 5HKYA 1K8UA 2I2RE 1L7ZA 1QTXA 2M8UA 3DVEA 4JWQA 1BOCA 2EHBA 1IQ5A 1J1EA 1XFRA 2KYCA 3CR5X 2L4HA 1PSBA 2M0RA 3IVTA 1SL9A 2JOJA 2L4IA 1W7JB 2KBMA 2WCEA 2KLEA 5JJGA 1KQMB 3MSEB 1QXPA 1UHNA 3NHTA 5AXIA 1FI5A 1ALVA 4GAOA 1JUOA 1SMGA 2SASA 4PHNA 4UPGA 4M2OA 1CNPA 3R1PA 4GPLB 1JFKA 3B88A 2KGRA 3PLFB 4A4BA 4M2PA 3BFBA 3EVRA 1WY9A 4IJ7A 4I5LB 2H61A 1KQMC 3IQOA 4XYNA 4ZCUA 5AANA 1BLQA 4PE0A 3F45A 1TCFA 2NXQA 1PVAA 1DEKA 1JFJA 1BJFA 1GQMA 1ZACA 2MA2A 1U5IB 3PSRA 2KAVA 1IRJA 4PCWA 1NPQA 4N1GA 1A75B 4YGDB 1XK4C 3QRXA 2QACA 2JU0A 1J55A 3CLNA 1F8HA 4DUQA 2O60A 2LAPA 1PRWA 1K90D 3ZWHA 1EXRA 3O78A 1GJYA 1T14A 1LXFC 1DJXA 2JPOA 1C3YA 5CSNA 1CDLA 2CT9A 1NIWA 1SNLA 1N2DA 2M1UA 5JOLA 2BBNA 1IIOA 4Q04A 1RROA 1CDPA 1IG5A 2K0JA 5CSJA 1S6CA 1KFXL 1CLLA 4WQ2A 1NX2A 3CZ1A 4PHKA 1RTP1 2PQLA 3BUXB 2K8MB 1IGVA 2K7BA 2Q4UA 1L2OB 3O4YA 3SS3A 4BY4A 2BKHB 1NX1A 1YVHA 3CGAA 1QVIY 2KNEA 4E68A 1BMOA 3AKAA 1YUSA 4GUKA 2QEBA 4L9MA 5I2QA 2CBLA 2EGDA 4FQTA 2P71A 3LL8B 2FCEA 4OZDA 3VROA 1IJ5A 4CIDA 3D75A 1L2OC 2KLDA 2I94A 2HF5A 2JC2A 1S5GZ 2PMYA 1K9UA 1Y1UA 3BYAA 1V1FA 1H8BA 3CYZA 1CFDA 4P5OE 2PSRA 3S0BA 4I5KA 4ETOA 3EK8A 5IBWA 2HQ8A 3CR4X 3GK4X 4MBEA 1C07A 3EG5B 2LHLA 2FJYA 1G8IA 3PN7B 1KWOB 2JULA 2KFFA 4YGEB 2F3YA 1E8AA 2KPHA 1TRFA 1FF1A 1B47A 2Q91A 3D76A 3M0WA 1SYMA 4PDZA 1OOHA 4D1EA 1B8RA 1UP5A 1PSRA 3R1OA 1Y1XA 2G2BA 3BOWB 5TNCA 5F6TA 3SIBA 3PN7C 4C0LA 3D0YB 1KWOC 3E3RA 3CZTX 1SCVA 1XFUO 2WCLA 2YGUA 1OMVA 1VRKA 1IWQA 3EKJA 3OX5A 4MN0A 3WHUB 2MRDA 1M63B 1WRKA 1NP8A 1JC2A 4GFTA 1DMOA 3LCPC 3SIAA 3I5HB 1CLMA 3PM2A 4NDBA 1F55A 3DD4A 1B7TY 1RFJA 1TUJA 1Q80A 4ORAB 3OB1B 3TDUA 1CDMA 1DELA 1AUIB 1W7IB 5K89A 1IJ6A 4I5JA 3ZNIA 2L50A 3CS1A 3WHTB 5KSZA 1Y1AA 5FI2A 3JTDB 4MZLA 3I5HC 4HRHA 2MJWB 1SSEB 2KAYA 3KF9A 4OR9B 4F0ZB 3B86A 4OV2A 3OBVA 4DS7A 1OOGA 2K60A 1KQVA 1NUBA 2LUXA 2WCFA 1XA5A 2QPTA 2Y1MA 3JTDC 1KK7Y 2K7OA 1B8LA 5CPVA 3FE8A 4MZKA 2JTZA 2KI4B 5B8IB 1UHHA 2LM5A 1YTZC 2WCHA 3AAKA 1MXLC 2JTTA 2BAPA 2KBIA 2L51A 3R1VA 2JXLA 4DCKA 2E30A 2Y5IA 2BBMA 2L5XB 3OB2B 1RWYA 1M39A 1RJVA 2KFGA 3CABA 4KYNA 1NX3A 1MR8A 1F4OA 3KHEA 1W9ZA 3NSKA 2KI4C 1NWDA 2ZFDA 2F8PA 2PASA 3A4UB 1B9AA 1SY9A 2HQWA 1AVSA 1KFUS 3DVKA 4JQ0D 1P28A 1OE9B 2BNXA 2LMVA 4I5NB 1K93D 1K94A 1OZSA 1UHJA 1UURA 3NSOA 2WOSA 1A03A 3NXAA 3SS5A 3WNXB 3DVJA 5CSFA 4GGNA 1G33A 2P6BB 2LLSA 1JWDA 2SCPA 3VB1A 1Z4HA 2L5YA 1N65A 1YX7A 2EC6B 5HKZA 4CFQA 4QJ5B 1PK0D 2BECA 2K2AA 2NCOA 1UHKA 4YI9A 2JNFA 2L0PA 4FTGA 2M7LA 1F4QA 4C0JA 2H2KA 1LS8A 2E6WA 1OQPA 4MRYA 4NDDA 3UO9A 3VRRA 1M31A 2VRGA 2AUCA 1SBJA 2PVBA 2JT3A 3DVMA 2Y4QA 5D7FA 3SG6A 1CM1A 2LLUA 2EC6C 3LK1A 1CFPA 2QEVA 1XFYO 3GK1A 3DF0B 1EG3A 4GGFC 3SG5A 1D1OA 1KFXS 5PALA 5KU1A 2WNDA 4CFRA 1YUUA 2ZN9A 2BL0B 2CTNA 1A2XA 3BFAA 1ORGA 1BG1A 3CDNA 2K61A 1F71A 4MSPA 1RECA 1YURA 4HRGA 3TZ1A 2LVJA 2K2FA 2BCBA 1NYAA 1AJ5A 2GGZA 3H4SE 3UNWA 2K7CA 3FIAA 3FWBA 3PM8A 4CLNA 2ERBA 4OVNF 1DJIA 3BUWB 4M2QA 3VRPA 1DF0A 1YR5A 2BL0C 2F2PA 2JNXA 3I5GB 1GGZA 4PE4A 1CLBA 1OMRA 4QJ3B 5FI6A 1SCMB 3FS7A 4XJKA 2PYQA 4PE1A 1SRAA 5DKNA 3TDIA 1OOFA 1KSMA 2KQ6A 4PHMA 1AP4A 3GK2A 4YGAA 1MHOA 4PHJA 4AOMA 1DJWA 3I5GC 2LHIA 1OW4A 2M1KB 4YGCB 1SCMC 1UWOA 1S36A 2KQYA 2M7NA 2OS8B 2BE4A 4YRUA 1OOIX 1UUSA 1TUZA 1J7PA 1XFVO 4WQ3A 2BCXA 1QJTA 1ODBA 4YGBB 1DGVA 1GGWA 3OP0A 1DJZA 1AJ4A 2MLFC 3O6BA 1CTRA 2H61C 4F7FA 2KI6D 2OS8C 1DC1A 1QV0A 1TNXA 2LMUA 2TN4A 1EL4A 2LUCA 3B87A 5DKQA 1YVLA 2NLNA 2WCMA 2ZNDA 3BJHA 5GQQC 2M29A 2L2EA 2IS9A 2I18A 2JT0A 3HX4A 1CKKA 3LLEA 2Y1NA 2MBXA 4JKTA 3SG2A 1B4CA 1MF8B 2H8VA 1S5GY 2M49B 2OTGB 2LCPA 3PJIA 1OMDA 1C7WA 2LC5A 4U8DA 2CNPA 2MAZA 1JF2A 2F3ZA 1S6JA 1TNPA 2R2IA 1C3ZA 4PT1A 1CMFA 1IQ3A 2ZKMX 1BF5A 5DICA 1ZFSA 1GM0A 1DT7B 2GV5A 3D73A 1XYDA 1TIZA 1K9KA 1XK4A 2WCJA 3BUNB 5G08A 1LA0A 2OTGC 2LVKA 3S0GA 3EK4A 3AKBA 5HL1A 3CZ0A 1CMGA 3KEVA 1SKTA 2QEOA 2CXJA 3OHMB 1CFCA 2BE6A 1OSAA 1U5IA 4YI8A 1H4BA 1UHIA 1DJHA 1LINA 2LMTA 3PFVA 2KYFA 1A75A 2RGIA 2LLTA 4ICBA 1DVIA 2KOTA 1F54A 1S6IA 3N7HA 3WXAA 3O4XA 4GNKB 1TWOA 1PVBA 4NDCA 1WLMA 1Y6WA 3RZSA 1OOJA 3CR2A 1QV1A 3D10A 3K1EA 1FBVA 1EH2A 1QX5B 3BUOB 4HSZA 3SG4A 5ER4X 1A4PA 2BKIB 1EG4A 3B6XA 1K9PA 2LNKA 5D3OA 1QWVA 3QMEA 1DTLA 3S0DA 1DGUA 1S26D 2L98A 1JSAA 2P70A 4YBHB 2M9GA 4USLA 4AQJA 2WC6A 4A4CA 1CFFA 1B8CA 3DY9A 3L4LA 1NCZA 3NSIA 1SPYA 1X02A 1OZOA 2LVVA 2F33A 3OX6A 4GBAA 5FYXA 3SJSA 3SG3A 4ZCVA 4C0KA 4N5XA 1CB1A 1YRUB 5D69A 1QLKA 4HREE 3DXLA 1N0YA 3Q8IA 5HLVA 1AHRA 1KSOA 3AAJA 2FCDA 4ORBB 1SK6D 2LANA 3D77A 4TNCA 5HKWA 4AQIA 2L2CA 1QVIZ 3EVUA 1ZUZA 2KHNA 2QDIA 1KFUL 1V1GA 2QEHA 2LV7A 1QIWA 3TUYB 2MLEC 4MLWA 2WORA 3EK7A 4CPVA 1J7QA 1WDCB 2HETA 2KAXA 2ZNEA 1WRZA 1ALWA 1JF0A 1TN4A 1FW4A 1MQ1A 1QASA 3IQQA 1QX7A 3KO0A 2K7DA 1QIVA 5I2LA 3TDZA 1K2HA 4OCIA 3BOWA 1IH0A 4DIRA 5I94A 3D0YA 3JVTB 1DJGA 1NCYA 4DRWA 2LVIA 3TUYC 1TTXA 1WDCC 3FE9A 1EJ3A 4MZJA 1TNQA 1HT9A 1QS7A 3EVVA 3TS5B 5BPJA 5ER5A 1K95A 1DJYA 2I7AA 3NHIA 4WRIA 5DKRA 1JBAA 1R6PA 1J1DA 2M97A 1ZMZA 1SR6B 2GGMA 3JVTC 4JD9A 3HCMA 2WCBA 4NQGA 1LA3A 5J3XA 4N1FA 3BFHA 1WRLA 1BODA 2GTEA 3TS5C 2JRFA 2B1UA 3VRQA 5HLOA 3L47A 3RM1A 3K21A 2MHHA 2FOTA 4BY5A 2KI6C 1XFXO 2JZIA 4MVFA 4JPZB 2COLB 5I2OA 1AK8A 4PALA 1YUTA 1BT6A 1SR6C 4MRXA 4PE7A 4R1EA 3DYEA 1R2UA 1S3PA 1B7TZ 3BXKA 1G4YR 2ZRTA 1KK8B 5FI7A 2V53A 4OKHA 1C7VA 1XVJA 1CDNA 2ZRSA 2KGBC 1NSHA 2JXCA 1SW8A
chains in the Genus database with same CATH topology
3CZ0A 2QEOA 3CZ1A 2PQLA 3R72A 4INXA 3VB1A 3N7HA 2QEBA 4INWA 3FE6A 1LS8A 1TWOA 4FQTA 2WC5A 2P71A 4OZDA 3RZSA 3L4AA 3D75A 3NGVA 3K1EA 2QEVA 3CYZA 3S0BA 5EL2A 3B6XA 1QWVA 3QMEA 3S0DA 2FJYA 2P70A 3BFAA 1ORGA 3D74A 2WC6A 3CDNA 3S0EA 2KPHA 3DY9A 3L4LA 3D76A 2WCKA 1OOHA 3S0FA 3R1OA 2ERBA 3DXLA 3CZ2A 3Q8IA 1DQEA 3B7AA 2WCLA 3DZTA 3D77A 3V2LA 2L2CA 3S0AA 1OOFA 3D78A 2QDIA 2QEHA 3OGNA 1OW4A 1TUJA 1XFRA 1OOIX 3FE9A 3NHTA 3B86A 4F7FA 1OOGA 3R1PA 3NHIA 3B88A 3BFBA 3B87A 4JD9A 2WCMA 3BJHA 3FE8A 3BFHA 2GTEA 2WCHA 3L47A 2H8VA 3PJIA 3R1VA 3DYEA 3CABA 1C3ZA 4PT1A 5DICA 1GM0A 3D73A 1T14A 2JPOA 2WCJA 1C3YA 1P28A 3S0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ0 A;  2QEO A;  3CZ1 A;  2PQL A;  3R72 A;  4INX A;  3VB1 A;  3N7H A;  2QEB A;  4INW A;  3FE6 A;  1LS8 A;  1TWO A;  4FQT A;  2WC5 A;  2P71 A;  4OZD A;  3RZS A;  3L4A A;  3D75 A;  3NGV A;  3K1E A;  2QEV A;  3CYZ A;  3S0B A;  5EL2 A;  3B6X A;  1QWV A;  3QME A;  3S0D A;  2FJY A;  2P70 A;  3BFA A;  1ORG A;  3D74 A;  2WC6 A;  3CDN A;  3S0E A;  2KPH A;  3DY9 A;  3L4L A;  3D76 A;  2WCK A;  1OOH A;  3S0F A;  3R1O A;  2ERB A;  3DXL A;  3CZ2 A;  3Q8I A;  1DQE A;  3B7A A;  2WCL A;  3DZT A;  3D77 A;  3V2L A;  2L2C A;  3S0A A;  1OOF A;  3D78 A;  2QDI A;  2QEH A;  3OGN A;  1OW4 A;  1TUJ A;  1XFR A;  1OOI X;  3FE9 A;  3NHT A;  3B86 A;  4F7F A;  1OOG A;  3R1P A;  3NHI A;  3B88 A;  3BFB A;  3B87 A;  4JD9 A;  2WCM A;  3BJH A;  3FE8 A;  3BFH A;  2GTE A;  2WCH A;  3L47 A;  2H8V A;  3PJI A;  3R1V A;  3DYE A;  3CAB A;  1C3Z A;  4PT1 A;  5DIC A;  1GM0 A;  3D73 A;  1T14 A;  2JPO A;  2WCJ A;  1C3Y A;  1P28 A;  3S0G A; 
#chains in the Genus database with same CATH topology
 1M45 A;  2LE9 B;  1LVC D;  2KFH A;  1QLS A;  3R72 A;  1WLZ A;  2G9B A;  5AFP A;  3BQ3 A;  2A4J A;  4INX A;  2PAL A;  3VRN A;  1KK8 C;  3NSL A;  2KDH A;  3LK0 A;  3CWG A;  1SL7 A;  1RK9 A;  2JWW A;  3O2P A;  1SL8 A;  3BUM B;  2JQ6 A;  3FE6 A;  3PAL A;  4INW A;  5I8N A;  2WC5 A;  1XFZ O;  1KK7 Z;  1XO5 A;  2CCM A;  2WC8 A;  3GOF A;  2O5G A;  5AEQ A;  5KTY A;  2ISD A;  3L4A A;  3NGV A;  2NCP A;  3C1V A;  5CSI A;  1DF0 B;  1TCO B;  3I5I B;  3ICB A;  1QAT A;  2AAO A;  1XFW O;  1CM4 A;  2BCA A;  2JT8 A;  1LKJ A;  5EL2 A;  2LP2 A;  3RLZ A;  4XJK B;  2KSP A;  3EKH A;  1MWN A;  1A29 A;  1TNW A;  1HQV A;  2AMI A;  2D8N A;  4GGF A;  3SG7 A;  3D74 A;  1FI6 A;  4MEW A;  3I5F B;  3S0E A;  1MXE A;  3CTN A;  3I5I C;  1QX2 A;  2NZ0 A;  1PAL A;  1IKU A;  3IF7 A;  3A8R A;  2FJU B;  2PRU A;  1NCX A;  2OPO A;  1MUX A;  2LP3 A;  2WCK A;  3VGO A;  3S0F A;  4FQO A;  3CZ2 A;  3KPX A;  1DQE A;  1K96 A;  1TOP A;  5AER A;  5HYD A;  2HPS A;  3SS4 A;  1J7R A;  2M3W A;  3DF0 A;  2JPT A;  3B7A A;  3DZT A;  3I5F C;  3V2L A;  4P2Y B;  1B1G A;  1KCY A;  1NX0 A;  3S0A A;  4ORC B;  3FWC A;  1BU3 A;  2F2O A;  3D78 A;  1FPW A;  1BR4 B;  1Y0V H;  4IL1 A;  4QJ4 B;  1J7O A;  2ZN8 A;  1F70 A;  1ZOT B;  1M46 A;  3OGN A;  1YRT B;  1S1E A;  1Z2C B;  1YX8 A;  1BR1 B;  1PUL A;  2DOQ A;  3PAT A;  5HKY A;  1K8U A;  2I2R E;  1L7Z A;  1QTX A;  2M8U A;  3DVE A;  4JWQ A;  1BOC A;  2EHB A;  1IQ5 A;  1J1E A;  1XFR A;  2KYC A;  3CR5 X;  2L4H A;  1PSB A;  2M0R A;  3IVT A;  1SL9 A;  2JOJ A;  2L4I A;  1W7J B;  2KBM A;  2WCE A;  2KLE A;  5JJG A;  1KQM B;  3MSE B;  1QXP A;  1UHN A;  3NHT A;  5AXI A;  1FI5 A;  1ALV A;  4GAO A;  1JUO A;  1SMG A;  2SAS A;  4PHN A;  4UPG A;  4M2O A;  1CNP A;  3R1P A;  4GPL B;  1JFK A;  3B88 A;  2KGR A;  3PLF B;  4A4B A;  4M2P A;  3BFB A;  3EVR A;  1WY9 A;  4IJ7 A;  4I5L B;  2H61 A;  1KQM C;  3IQO A;  4XYN A;  4ZCU A;  5AAN A;  1BLQ A;  4PE0 A;  3F45 A;  1TCF A;  2NXQ A;  1PVA A;  1DEK A;  1JFJ A;  1BJF A;  1GQM A;  1ZAC A;  2MA2 A;  1U5I B;  3PSR A;  2KAV A;  1IRJ A;  4PCW A;  1NPQ A;  4N1G A;  1A75 B;  4YGD B;  1XK4 C;  3QRX A;  2QAC A;  2JU0 A;  1J55 A;  3CLN A;  1F8H A;  4DUQ A;  2O60 A;  2LAP A;  1PRW A;  1K90 D;  3ZWH A;  1EXR A;  3O78 A;  1GJY A;  1T14 A;  1LXF C;  1DJX A;  2JPO A;  1C3Y A;  5CSN A;  1CDL A;  2CT9 A;  1NIW A;  1SNL A;  1N2D A;  2M1U A;  5JOL A;  2BBN A;  1IIO A;  4Q04 A;  1RRO A;  1CDP A;  1IG5 A;  2K0J A;  5CSJ A;  1S6C A;  1KFX L;  1CLL A;  4WQ2 A;  1NX2 A;  3CZ1 A;  4PHK A;  1RTP 1;  2PQL A;  3BUX B;  2K8M B;  1IGV A;  2K7B A;  2Q4U A;  1L2O B;  3O4Y A;  3SS3 A;  4BY4 A;  2BKH B;  1NX1 A;  1YVH A;  3CGA A;  1QVI Y;  2KNE A;  4E68 A;  1BMO A;  3AKA A;  1YUS A;  4GUK A;  2QEB A;  4L9M A;  5I2Q A;  2CBL A;  2EGD A;  4FQT A;  2P71 A;  3LL8 B;  2FCE A;  4OZD A;  3VRO A;  1IJ5 A;  4CID A;  3D75 A;  1L2O C;  2KLD A;  2I94 A;  2HF5 A;  2JC2 A;  1S5G Z;  2PMY A;  1K9U A;  1Y1U A;  3BYA A;  1V1F A;  1H8B A;  3CYZ A;  1CFD A;  4P5O E;  2PSR A;  3S0B A;  4I5K A;  4ETO A;  3EK8 A;  5IBW A;  2HQ8 A;  3CR4 X;  3GK4 X;  4MBE A;  1C07 A;  3EG5 B;  2LHL A;  2FJY A;  1G8I A;  3PN7 B;  1KWO B;  2JUL A;  2KFF A;  4YGE B;  2F3Y A;  1E8A A;  2KPH A;  1TRF A;  1FF1 A;  1B47 A;  2Q91 A;  3D76 A;  3M0W A;  1SYM A;  4PDZ A;  1OOH A;  4D1E A;  1B8R A;  1UP5 A;  1PSR A;  3R1O A;  1Y1X A;  2G2B A;  3BOW B;  5TNC A;  5F6T A;  3SIB A;  3PN7 C;  4C0L A;  3D0Y B;  1KWO C;  3E3R A;  3CZT X;  1SCV A;  1XFU O;  2WCL A;  2YGU A;  1OMV A;  1VRK A;  1IWQ A;  3EKJ A;  3OX5 A;  4MN0 A;  3WHU B;  2MRD A;  1M63 B;  1WRK A;  1NP8 A;  1JC2 A;  4GFT A;  1DMO A;  3LCP C;  3SIA A;  3I5H B;  1CLM A;  3PM2 A;  4NDB A;  1F55 A;  3DD4 A;  1B7T Y;  1RFJ A;  1TUJ A;  1Q80 A;  4ORA B;  3OB1 B;  3TDU A;  1CDM A;  1DEL A;  1AUI B;  1W7I B;  5K89 A;  1IJ6 A;  4I5J A;  3ZNI A;  2L50 A;  3CS1 A;  3WHT B;  5KSZ A;  1Y1A A;  5FI2 A;  3JTD B;  4MZL A;  3I5H C;  4HRH A;  2MJW B;  1SSE B;  2KAY A;  3KF9 A;  4OR9 B;  4F0Z B;  3B86 A;  4OV2 A;  3OBV A;  4DS7 A;  1OOG A;  2K60 A;  1KQV A;  1NUB A;  2LUX A;  2WCF A;  1XA5 A;  2QPT A;  2Y1M A;  3JTD C;  1KK7 Y;  2K7O A;  1B8L A;  5CPV A;  3FE8 A;  4MZK A;  2JTZ A;  2KI4 B;  5B8I B;  1UHH A;  2LM5 A;  1YTZ C;  2WCH A;  3AAK A;  1MXL C;  2JTT A;  2BAP A;  2KBI A;  2L51 A;  3R1V A;  2JXL A;  4DCK A;  2E30 A;  2Y5I A;  2BBM A;  2L5X B;  3OB2 B;  1RWY A;  1M39 A;  1RJV A;  2KFG A;  3CAB A;  4KYN A;  1NX3 A;  1MR8 A;  1F4O A;  3KHE A;  1W9Z A;  3NSK A;  2KI4 C;  1NWD A;  2ZFD A;  2F8P A;  2PAS A;  3A4U B;  1B9A A;  1SY9 A;  2HQW A;  1AVS A;  1KFU S;  3DVK A;  4JQ0 D;  1P28 A;  1OE9 B;  2BNX A;  2LMV A;  4I5N B;  1K93 D;  1K94 A;  1OZS A;  1UHJ A;  1UUR A;  3NSO A;  2WOS A;  1A03 A;  3NXA A;  3SS5 A;  3WNX B;  3DVJ A;  5CSF A;  4GGN A;  1G33 A;  2P6B B;  2LLS A;  1JWD A;  2SCP A;  3VB1 A;  1Z4H A;  2L5Y A;  1N65 A;  1YX7 A;  2EC6 B;  5HKZ A;  4CFQ A;  4QJ5 B;  1PK0 D;  2BEC A;  2K2A A;  2NCO A;  1UHK A;  4YI9 A;  2JNF A;  2L0P A;  4FTG A;  2M7L A;  1F4Q A;  4C0J A;  2H2K A;  1LS8 A;  2E6W A;  1OQP A;  4MRY A;  4NDD A;  3UO9 A;  3VRR A;  1M31 A;  2VRG A;  2AUC A;  1SBJ A;  2PVB A;  2JT3 A;  3DVM A;  2Y4Q A;  5D7F A;  3SG6 A;  1CM1 A;  2LLU A;  2EC6 C;  3LK1 A;  1CFP A;  2QEV A;  1XFY O;  3GK1 A;  3DF0 B;  1EG3 A;  4GGF C;  3SG5 A;  1D1O A;  1KFX S;  5PAL A;  5KU1 A;  2WND A;  4CFR A;  1YUU A;  2ZN9 A;  2BL0 B;  2CTN A;  1A2X A;  3BFA A;  1ORG A;  1BG1 A;  3CDN A;  2K61 A;  1F71 A;  4MSP A;  1REC A;  1YUR A;  4HRG A;  3TZ1 A;  2LVJ A;  2K2F A;  2BCB A;  1NYA A;  1AJ5 A;  2GGZ A;  3H4S E;  3UNW A;  2K7C A;  3FIA A;  3FWB A;  3PM8 A;  4CLN A;  2ERB A;  4OVN F;  1DJI A;  3BUW B;  4M2Q A;  3VRP A;  1DF0 A;  1YR5 A;  2BL0 C;  2F2P A;  2JNX A;  3I5G B;  1GGZ A;  4PE4 A;  1CLB A;  1OMR A;  4QJ3 B;  5FI6 A;  1SCM B;  3FS7 A;  4XJK A;  2PYQ A;  4PE1 A;  1SRA A;  5DKN A;  3TDI A;  1OOF A;  1KSM A;  2KQ6 A;  4PHM A;  1AP4 A;  3GK2 A;  4YGA A;  1MHO A;  4PHJ A;  4AOM A;  1DJW A;  3I5G C;  2LHI A;  1OW4 A;  2M1K B;  4YGC B;  1SCM C;  1UWO A;  1S36 A;  2KQY A;  2M7N A;  2OS8 B;  2BE4 A;  4YRU A;  1OOI X;  1UUS A;  1TUZ A;  1J7P A;  1XFV O;  4WQ3 A;  2BCX A;  1QJT A;  1ODB A;  4YGB B;  1DGV A;  1GGW A;  3OP0 A;  1DJZ A;  1AJ4 A;  2MLF C;  3O6B A;  1CTR A;  2H61 C;  4F7F A;  2KI6 D;  2OS8 C;  1DC1 A;  1QV0 A;  1TNX A;  2LMU A;  2TN4 A;  1EL4 A;  2LUC A;  3B87 A;  5DKQ A;  1YVL A;  2NLN A;  2WCM A;  2ZND A;  3BJH A;  5GQQ C;  2M29 A;  2L2E A;  2IS9 A;  2I18 A;  2JT0 A;  3HX4 A;  1CKK A;  3LLE A;  2Y1N A;  2MBX A;  4JKT A;  3SG2 A;  1B4C A;  1MF8 B;  2H8V A;  1S5G Y;  2M49 B;  2OTG B;  2LCP A;  3PJI A;  1OMD A;  1C7W A;  2LC5 A;  4U8D A;  2CNP A;  2MAZ A;  1JF2 A;  2F3Z A;  1S6J A;  1TNP A;  2R2I A;  1C3Z A;  4PT1 A;  1CMF A;  1IQ3 A;  2ZKM X;  1BF5 A;  5DIC A;  1ZFS A;  1GM0 A;  1DT7 B;  2GV5 A;  3D73 A;  1XYD A;  1TIZ A;  1K9K A;  1XK4 A;  2WCJ A;  3BUN B;  5G08 A;  1LA0 A;  2OTG C;  2LVK A;  3S0G A;  3EK4 A;  3AKB A;  5HL1 A;  3CZ0 A;  1CMG A;  3KEV A;  1SKT A;  2QEO A;  2CXJ A;  3OHM B;  1CFC A;  2BE6 A;  1OSA A;  1U5I A;  4YI8 A;  1H4B A;  1UHI A;  1DJH A;  1LIN A;  2LMT A;  3PFV A;  2KYF A;  1A75 A;  2RGI A;  2LLT A;  4ICB A;  1DVI A;  2KOT A;  1F54 A;  1S6I A;  3N7H A;  3WXA A;  3O4X A;  4GNK B;  1TWO A;  1PVB A;  4NDC A;  1WLM A;  1Y6W A;  3RZS A;  1OOJ A;  3CR2 A;  1QV1 A;  3D10 A;  3K1E A;  1FBV A;  1EH2 A;  1QX5 B;  3BUO B;  4HSZ A;  3SG4 A;  5ER4 X;  1A4P A;  2BKI B;  1EG4 A;  3B6X A;  1K9P A;  2LNK A;  5D3O A;  1QWV A;  3QME A;  1DTL A;  3S0D A;  1DGU A;  1S26 D;  2L98 A;  1JSA A;  2P70 A;  4YBH B;  2M9G A;  4USL A;  4AQJ A;  2WC6 A;  4A4C A;  1CFF A;  1B8C A;  3DY9 A;  3L4L A;  1NCZ A;  3NSI A;  1SPY A;  1X02 A;  1OZO A;  2LVV A;  2F33 A;  3OX6 A;  4GBA A;  5FYX A;  3SJS A;  3SG3 A;  4ZCV A;  4C0K A;  4N5X A;  1CB1 A;  1YRU B;  5D69 A;  1QLK A;  4HRE E;  3DXL A;  1N0Y A;  3Q8I A;  5HLV A;  1AHR A;  1KSO A;  3AAJ A;  2FCD A;  4ORB B;  1SK6 D;  2LAN A;  3D77 A;  4TNC A;  5HKW A;  4AQI A;  2L2C A;  1QVI Z;  3EVU A;  1ZUZ A;  2KHN A;  2QDI A;  1KFU L;  1V1G A;  2QEH A;  2LV7 A;  1QIW A;  3TUY B;  2MLE C;  4MLW A;  2WOR A;  3EK7 A;  4CPV A;  1J7Q A;  1WDC B;  2HET A;  2KAX A;  2ZNE A;  1WRZ A;  1ALW A;  1JF0 A;  1TN4 A;  1FW4 A;  1MQ1 A;  1QAS A;  3IQQ A;  1QX7 A;  3KO0 A;  2K7D A;  1QIV A;  5I2L A;  3TDZ A;  1K2H A;  4OCI A;  3BOW A;  1IH0 A;  4DIR A;  5I94 A;  3D0Y A;  3JVT B;  1DJG A;  1NCY A;  4DRW A;  2LVI A;  3TUY C;  1TTX A;  1WDC C;  3FE9 A;  1EJ3 A;  4MZJ A;  1TNQ A;  1HT9 A;  1QS7 A;  3EVV A;  3TS5 B;  5BPJ A;  5ER5 A;  1K95 A;  1DJY A;  2I7A A;  3NHI A;  4WRI A;  5DKR A;  1JBA A;  1R6P A;  1J1D A;  2M97 A;  1ZMZ A;  1SR6 B;  2GGM A;  3JVT C;  4JD9 A;  3HCM A;  2WCB A;  4NQG A;  1LA3 A;  5J3X A;  4N1F A;  3BFH A;  1WRL A;  1BOD A;  2GTE A;  3TS5 C;  2JRF A;  2B1U A;  3VRQ A;  5HLO A;  3L47 A;  3RM1 A;  3K21 A;  2MHH A;  2FOT A;  4BY5 A;  2KI6 C;  1XFX O;  2JZI A;  4MVF A;  4JPZ B;  2COL B;  5I2O A;  1AK8 A;  4PAL A;  1YUT A;  1BT6 A;  1SR6 C;  4MRX A;  4PE7 A;  4R1E A;  3DYE A;  1R2U A;  1S3P A;  1B7T Z;  3BXK A;  1G4Y R;  2ZRT A;  1KK8 B;  5FI7 A;  2V53 A;  4OKH A;  1C7V A;  1XVJ A;  1CDN A;  2ZRS A;  2KGB C;  1NSH A;  2JXC A;  1SW8 A; 
#chains in the Genus database with same CATH homology
 3CZ0 A;  2QEO A;  3CZ1 A;  2PQL A;  3R72 A;  4INX A;  3VB1 A;  3N7H A;  2QEB A;  4INW A;  3FE6 A;  1LS8 A;  1TWO A;  4FQT A;  2WC5 A;  2P71 A;  4OZD A;  3RZS A;  3L4A A;  3D75 A;  3NGV A;  3K1E A;  2QEV A;  3CYZ A;  3S0B A;  5EL2 A;  3B6X A;  1QWV A;  3QME A;  3S0D A;  2FJY A;  2P70 A;  3BFA A;  1ORG A;  3D74 A;  2WC6 A;  3CDN A;  3S0E A;  2KPH A;  3DY9 A;  3L4L A;  3D76 A;  2WCK A;  1OOH A;  3S0F A;  3R1O A;  2ERB A;  3DXL A;  3CZ2 A;  3Q8I A;  1DQE A;  3B7A A;  2WCL A;  3DZT A;  3D77 A;  3V2L A;  2L2C A;  3S0A A;  1OOF A;  3D78 A;  2QDI A;  2QEH A;  3OGN A;  1OW4 A;  1TUJ A;  1XFR A;  1OOI X;  3FE9 A;  3NHT A;  3B86 A;  4F7F A;  1OOG A;  3R1P A;  3NHI A;  3B88 A;  3BFB A;  3B87 A;  4JD9 A;  2WCM A;  3BJH A;  3FE8 A;  3BFH A;  2GTE A;  2WCH A;  3L47 A;  2H8V A;  3PJI A;  3R1V A;  3DYE A;  3CAB A;  1C3Z A;  4PT1 A;  5DIC A;  1GM0 A;  3D73 A;  1T14 A;  2JPO A;  2WCJ A;  1C3Y A;  1P28 A;  3S0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...